3RVOA

Structure of chey-mn2+ complex with substitutions at 59 and 89: n59d e89y
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
b'MADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
molecule tags Signaling protein
source organism Escherichia coli
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvoA00
3HCWA 3NNSA 3UKJA 3QEMB 3FDFA 4YP9A 4G0OA 4E7PA 1VKRA 1VRVA 5IC5A 3NNNA 4W5QA 2A9OA 1ZN2A 3S99A 3B2NA 3IDOA 2RJNA 5BRAA 2JRLA 3RVNA 2PL9A 1KMIY 3QLUA 4WUTA 1LK0A 3N0XA 4MS1A 5JNWA 4MS4A 1E6MA 3GV0A 2AYZA 2E4YA 1LJUA 3TX6A 1BA2A 4KK4A 5FWYB 2MSLA 5IEJA 1P6UA 4H60A 3O1IC 3QEMA 1NXOA 3N0WA 1AB6A 1RXIA 4N0QA 1NXSA 1NY5A 4MQFA 2R4QA 1JDPA 2MSKA 3OQNA 3LKBA 2PUGA 4P98A 4MS1B 2OENG 1DZ3A 3Q41A 2PMCA 3H6HA 5TPWA 1FFSA 2E4XA 4Q7EA 3Q7SA 2RGYA 4IMIB 3D8UA 1U04A 3OQOA 3QLVA 3T38A 4EYGA 1MIHA 2PE5A 3LUCA 1VLZA 5KQPA 5EWLA 3LUFA 1RNLA 4LDAA 4L85A 3H1FA 3IP7A 2I6FA 4MQFB 1USIA 4N03A 1QP4A 1URPA 3JVDA 1H9CA 1JWLA 4ETNA 3HUTA 1NXWA 1YS6A 2JVJA 4JB2A 2FN8A 4PYRA 2PUFA 1QP7A 1USKA 3OQMA 5HSGA 1F4VA 2JCGA 2R48A 4WT7A 3SM9A 1W9HA 5TQ2A 3CRNA 1I3CA 3O21A 4QICA 4EVSA 1D1PA 4MRMA 2YHBA 2PUBA 4Z4CA 3H5IA 4EVRA 4NQRA 4EYOA 5TQJA 1BVHA 2CD7A 2FVYA 3A10A 1Z15A 4YO7A 2L19A 1D5WA 4G0YA 1ZDMA 2XDYA 1JHZA 2P9HA 2QZJA 3N8IA 2PAFA 3LFTA 1APBA 4Z4HA 1ISSA 2RJOA 3C97A 1W25A 2E4WA 4RKRA 1RZRD 4LRQA 1SRRA 2FKAA 3F6CA 4EY3A 5TPZA 4KFCA 4MRMB 4MR9B 1JDNA 4F8JA 4YCSA 2WB4A 1YK1A 2A9PA 2DRIA 1JYEA 4XAQA 2CWDA 1D4ZA 2FLKA 2M98A 4YRZA 2QU7A 4WWHA 5JS1A 1QNLA 3RVQA 1NXPA 3OLZA 3F6PA 4MS3B 3CU5A 4H3HB 3H5WA 5KQMA 3CHYA 1GUBA 2IKSA 3DBIA 3MF4A 5B3JC 3HJFA 4MR9A 2HQBA 6CHYA 1M2EA 1JL3A 1YVUA 2RDMA 5KI6A 3H1EA 1K66A 1M2FA 2MYPA 1R8JA 3TD9A 3H75A 4NCBA 5EWJA 2FMIA 3N53A 3O2SB 4WXEA 3UK0A 3QEKA 4N41A 1TMYA 3M9XA 1MAVA 4RY9A 1JLKA 5CNMA 8ABPA 2B1JA 3H5VA 3OO1A 2A9QA 1U2PA 1ZGGA 3LUHA 2FN9A 3H5LA 1DBQA 3Q9SA 5FBKA 4Z9AA 1JFVA 2TMYA 5CHYA 4L4UA 4KPYA 4PICA 4Y9TA 1EFAA 3CNBA 3R0JA 5EWJB 4RXUA 4TLMB 1QPZA 1QQBA 4RV5A 1SXIA 3VNAA 3DZDA 3O2QB 2KYRA 2WY2D 3T6KA 3N0RA 1PEYA 4G86A 1JFSA 5D2CA 4E7OA 3C3WA 2E4UA 3ILHA 3Q15C 3SAJA 4RKQA 5GOTA 3HM9A 1GCAA 1IIBA 1NXXA 3QX8A 1RPJA 3HUUA 3TMYA 2WRZA 3KLNA 4MAAA 3MMNA 1FSPA 4NV3A 4G0MA 4KRFA 2Q5CA 1OXBB 2NT3A 5KWSA 3OLVA 2IPAB 2IPNA 3BREA 3SY8A 3KG2A 2LUOA 1NXVA 4RK0A 3NNDA 3HDVA 3LUDA 1KRWA 4RZSA 2X7XA 3M6MD 3C3KA 3ROFA 3FFTA 3GYBA 3IP9A 4Q6BA 3K4HA 4FE7A 4RK5A 3JY6A 1YS7A 4TN5A 2FSPA 2L18A 1BAPA 4ZPJA 3QELB 4KK3A 4MQEA 4RY8A 4KQCA 4XXHA 1QO0A 5JS2A 4NICA 1CHNA 4D6XA 5KC9A 4G97A 4JASB 4IILA 2CHEA 5CNJA 2N9UA 3EDCA 1GCGA 2ZAYA 4ZJPA 2JB9A 3HS3A 1E2BA 4W5RA 1Z26A 1LBHA 2R25B 2MYNA 3RVMA 5IUKC 2PUEA 2LBPA 4ETIA 4G0ZA 4MGEA 3QELA 4MQEB 3NBMA 3FFWA 3G85A 4RK6A 3CTPA 3RVJA 1D2AA 2FQYA 3O75A 1YMUA 3CLKA 1PNTA 3CG4A 3NHZA 1WETA 1Z17A 2PLNA 4EVQA 3OMXA 1K68A 5B3JA 5CNIA 2FTKE 1CYEA 1DRJA 4ZMSA 4G0QA 3MQ4A 4IGAA 3D02A 2M1ZA 2MYUA 1Y1LA 1A2OA 4MS4B 1ZHHA 1JF8A 3TO5A 1FQWA 1LJLA 2HQOA 2WJWA 3LTEA 1DP4A 4RY0A 1SXGA 3H5TA 3O2JA 1DCFA 3JTEA 2R47A 2GX6A 2GKGA 1P8AA 4YLEA 1DC7A 3GBPA 3HO1A 5BR1A 5GQSA 3O1JC 1E6KA 5JNVA 3KCNA 4N0PA 5HKOA 1EAYA 4CBVA 4Z4IA 2JBAA 3A0RB 3I42A 1QP0A 2E4ZA 3DGEC 4G0PA 1VPWA 1XHEA 1ZITA 3KYJB 4F12A 1JBEA 2H0AA 3CZCA 3OMWA 1KRXA 3GA5A 3KJXA 1DCKA 4EGSA 1NATA 3KLOA 1YMVA 3E3MA 1T34A 2VUIB 2HSGA 3HZHA 3KTOA 4IRXA 5IULC 5C5CA 2VYCA 2HPHA 4RSMA 4UHJA 4HNQA 5TPZD 3EJWA 5PNTA 1YK0A 3O1HB 1TM2A 4OLAA 3IP5A 4YWHA 2JBAB 3C3MA 4Z99A 3H6GA 5E3JA 1U0SY 3F7NA 3K9CA 3T95A 4F11A 4FB4A 3EGCA 3UUGA 2QW1A 4RXMA 3KSMA 4YV7A 2V0NA 5TQ2B 3KS9A 1MB3A 2HQRA 4O1HA 3CKMA 2IPLA 4XARA 4DADA 4F06A 4F3TA 4MYRA 1DBPA 4MLCA 1F51E 4QYWA 1ABFA 3DLHA 5ABPA 1LBIA 5EWMB 3IPAA 4YS6A 3IPCA 1JFTA 4JB0A 2ID9A 9ABPA 3QLUC 2FEPA 5IUJC 1ZAYA 4LE2A 3CFYA 4O5AA 2PUDA 4W5NA 3HK2A 1OXKB 4DN6A 1ZGZA 3JVIA 4XLTA 2FMHA 1KGSA 3GBVA 4B09A 3DGFC 1BDHA 2FMFA 1AB5A 3OO0A 3Q7RA 4KREA 5IX8A 3MYYA 4JA2A 1E6LA 2JVKA 3QK7A 5EWMA 2ZWMA 4KMRA 3VNBA 1Z13A 5DCLA 1QO0D 4G0XA 5TQ0A 1PNRA 5IEBA 4RXTA 2F8SA 1Z2EA 1L5YA 2IOYA 5C5EA 4OATA 5KQLA 3I45A 2LP4Y 4Z9BA 5FWYA 2IYNA 1NTRA 4LE1A 1P6QA 3LMKA 2FMKA 2WWVD 1ABEA 3HV2A 1B00A 1U2QA 2O20A 2MSWA 5TQ0B 2WJAA 4YR7A 1TLFA 4YGXB 4W5TA 5TPWB 4WZZA 5I4CA 3LOPA 3OM0A 1DC8A 1EHCA 4UHKA 5IUNC 3SNKA 3LUKA 4QYMA 3LUJA 3MIZA 5EWLB 3T8YA 3HVRA 2FLWA 1C4WA 3LUAA 4HYEA 1CEYA 2VK2A 3URMA 1ZH2A 5T3YA 4ML3A 3F73A 1ISRA 4HNSA 1MVOA 4GNRA 4M88A 5FWXA 3N75A 4PZ0A 2GI4A 2FW0A 3HDGA 3FGZA 1M5UA 3E61A 3L49A 4JP1A 1FFWA 3FFXA 4D74A 3HXMA 4PE5B 1PEAA 5CNKA 2QVGA 1DG9A 3CG0A 3SG0A 4EUKA 1TJYA 3GT7A 1JYFA 3RVOA 1EWKA 4KZKA 3IP6A 3FMVA 3RVLA 4Z4EA 5KQGA 2GWRA 5T7BA 4Z0NA 2FXIA 2GBPA 3OLYA 1BDJA 1PUXA 3H5OA 2JK1A 2CHFA 5FWXB 4NCAA 1L5ZA 2ID7A 5ED4A 4ZMRA 3QLTA 2B4AA 1U8TA 4QPJC 1Z12A 2L2QA 1C0EA 3JPYA 1DCMA 1QQAA 3TB6A 2OQRA 2QV0A 2QVCA 1A04A 3RQIA 3RVKA 1EWVA 4TMYA 3O74A 1UDRA 4FE4A 2W42A 3JS5A 3MM4A 4O1IA 1M5TA 4RK4A 2E4VA 1SD5A 4RK7A 4Z4GA 3H1GA 3EODA 4OTZA 3ROTA 4MS3A 2L17A 2IPMA 4RS3A 5F64A 4EYKA 4W5OA 3EQ2A 4DQDA 1HEYA 3BRSA 2FEWB 1NXTA 2HJ9A 5KC8A 4LDZA 4P1ZA 4KNYA 1Z16A 1EWTA 4OG2A 3ILYA 4RU1A 2LPMA 2PKXA 3HSYA 3KKEA 5DGCA 2MYTA 1QMPA 1GUDA 1TVMA 1DBWA 4RDCA 4N47A 4JOQA 3GL9A 2PJUA 2A9RA 3L6UA 3A3KA 4WXMA 1RXEA 2NT4A 1RZRA 2H3HA 4OLBA 3GRCA 2AYXA 4ETMA 2VUHB 2WMYA 3RH0A 4KV7A 4XASA 1D1QA 1MB0A 3DLBA 2PL1A 3EULA 1DJMA 1ZY2A 1XHFA 3CS3A 5BQ3A 4H3KB 3NHMA 5JNRA 3MA0A 1Z18A 1P2FA 4Z4FA 4XFKA 1A0OA 3KHTA 5JNSA 4S05A 1BDIA 3QLVC 3GWGA 4RWEA 2JVIA 5BRJA 2QXYA 3BBLA 3A0UA 6ABPA 1Z2DA 1XWWA 2NZVG 1ZH4A 3I5AA 3LUGA 4Q6WA 5HQJA 4MR7A 7ABPA 4MR8A 4HNRA 4GPAA 4S04A 3N6VA 2BGGA 1Z25A 4KQ9A 5JNTA 4ZYLA 4IF4A 3G1WA 5DTEA 4D6YA 3RVSA 3I09A 5HM6A 1GLGA 5FBHA 3W9SA 3CZ5A 2QSJA 3LKVA 3Q7TA 4MLDA 2IDMA 1YIOA 3EQZA 4LX8A 3QX9A 4MR7B 4MR8B 1ZESA 4RK1A 2NUBA 5DLEA 2F8TA 3BILA 1SXHA 1JH9A 3M9WA 3OLXA 1FFGA 3OM1A 4IMJB 1DRKA 4KVFA 5JNUA 4LE0A 1ZVVA 4JAVC 4PEVA 3RVPA 3BRQA 4LZLA 3EAFA 3OLWA 4N76A 4OBBA 2FQWA 3RVRA 1QKKA 2FEKA 5IBQA 3SQNA 2QR3A 1USGA 1S8NA 2P4UA 3KYIB 1JX6A 2J48A 4TLLB 1J56A 5DKFA 2FQXA 3HEBA 3JPWA 2PUAA 1YTUA 1PHRA 4EYQA 2NZUG 3C6QA 5TE9A 4MPTA 2PUCA 2LIVA 2YHAA 3P9YA
chains in the Genus database with same CATH superfamily
4ZU3A 4Q24A 3EIHA 2X14A 1OTXA 2R79A 4HAVA 4PZCA 2GN8A 2KBEA 3W5UA 4CN8A 3GRUA 4YP9A 3BWCA 3D7SA 3PE4A 4QYXA 4G9BA 1FJ2A 4TROA 3PHCA 5F2EA 2HWWA 4I4TF 1ZN2A 1PZHA 2QI9F 1EFLA 3A6LA 1KO1A 4I6GA 3VKHA 3RVNA 1CQJA 1QAMA 1C9MA 4XPZA 4WUTA 4KGVA 2OV8A 3QF4B 4TMZA 1OAOC 5EMLA 4Y2QA 4REQB 1DLJA 2FZWA 2SKEA 3LC7O 1LJUA 1ZBQA 3PCRB 2EZUA 1G2IA 3VYTB 5IEJA 1M72A 3P0HA 2QJTA 2BHSA 2W22A 1NXSA 3NW9A 3LF2A 5DN6A 3LI2A 4EKIA 4Z7JA 2B8NA 5JDCC 2CBGA 2VT3A 2AG5A 3LKBA 1HRDA 4J4TA 3C5WP 5K0TA 3WL5A 1VIMA 1RQ2A 3LHSA 2H8KA 1EZ4A 1OASA 1OMOA 5FQNA 2XSZA 1CZOA 1ZN9A 3PDJA 1MIHA 5NLLA 4PYJA 3EA0A 2OVFA 2Y27A 2FF5A 3UMJA 4R0NA 1W1WA 3CB4A 4TKMA 4LCJA 1GDDA 2VJOA 2IZ6A 4MQFB 4KLCA 2VPZA 1L1QA 1OQAA 1RWBA 2PJDA 2W0MA 1NXWA 3M0EA 4B9EA 4QU5A 5KU1A 3WYCA 2VAMA 3RU3A 3G2HA 1U7HA 1KH3A 3WFJA 6REQB 4HMOA 3GUCA 3LCVB 1OR8A 1SBTA 1OZAA 3BTSA 1WY5A 4ZAWA 1PFWA 2YHBA 2OCGA 5JZSA 3ABOB 4CIXA 1C7EA 3O0TA 2VOJA 4RHUA 5ALIA 4AFNA 3M4JA 1W5TA 4HY3A 4Y1FA 3WVNA 3WQQA 4EW6A 5KX5F 2DPMA 1QVWA 2BZ1A 3A1FA 3I37X 1YRQA 1Y42X 1JHAA 3JVVA 2A7QA 4KL8S 5ALGA 4D9JA 4Z4HA 3NDBB 1RI4A 2QZ9A 4EF4A 5AW1A 1KKLA 2AR7A 3FWPA 4YN3A 5LJLA 3T52A 1SVMA 1UK8A 2QVZX 3PRJA 2FKAA 4EY3A 2YJ5A 1KTVA 5C4MA 4E5VA 3AI2A 4X6LA 2BYTA 2W2VA 1H8HD 2NUAA 3HZZA 3G6WA 1RMQA 4D4HA 2ZIAA 5KYYB 1DXQA 5KQSA 4B76A 4X65B 4JP2A 4NOMA 1ISHA 1WE2A 3F7MA 4U2BA 4QGSA 4RTQA 2BH9A 3B1YA 3NPAA 1DKLA 2AC7A 5IM4A 3HJAA 4JEUA 4UEWA 3EB9A 4EZIA 2NP6A 5CPBA 4WVFA 4Y2SA 3ETJA 4LHXA 3PYLA 3AEKA 3NC0C 3DAOA 2GN1A 2B8WA 4PLPA 4QARA 4ZOLF 4D6PA 5A03A 5KOYA 3U7HB 4CLXA 5ECGC 1G6Q1 3OJWA 1LVUA 1CULC 4LXTA 5LNK6 5FTMA 5KYXA 1T3HA 2FZEA 1IK6A 1I2AA 4LFCB 1MPTA 5B55A 1GLNA 3DC2A 4WXEA 4I55B 2DKOA 1O7JA 5DHAA 2H1OA 4OXIA 3KEGA 1OI3A 5FPPA 1QS0A 2M6LA 3FYCA 5JS6A 5CX4A 3F5DA 5KNBD 1L9XA 1GKIA 1X1AA 2PX6A 1OHHA 2X1LA 3LUHA 4OGLA 3PUHA 3H5LA 1OVGA 1DBQA 1NPYA 3N2EA 2BGKA 2VJYA 3AEQB 4XRRA 3BA1A 3VZBA 4A1FA 1R1DA 1RYNA 2Q2OA 4P2BA 4KO8A 3FWKA 2KM1A 3HDYA 4HX5A 5DTMA 4BXOB 1QGED 5K3AA 4YT4A 1JA0A 4WN9A 4RXUA 3Q8LA 3JQGB 2EKPA 3DNMA 1J20A 2F1RA 4A8JC 5C8YB 2ZJ6A 5AHXA 4D3YA 1ACJA 2DFTA 2AZ4A 2OSVA 3NB0A 3PXBA 3UN1A 1PS0A 3HQ4O 1Y6JA 5GIOE 1U94A 3V8RA 1NKVA 1CV2A 3OPXA 2EBFX 2YYSA 4H31A 1QV9A 2D06A 2ZTLA 4CKCB 1ULTA 1Q20A 1TVEA 4CF3A 1ZH6A 4ITUA 4TTJA 3TKYA 2HY7A 3EZ9A 2BGIA 1JLSA 3FB4A 4QA9A 2JAWA 5JJLA 2VUSA 3ENKA 1HYHA 4Q4AA 3GZNB 2GK7A 3C24A 1N6NA 5K99A 4ZI7F 4Q02A 3F4KA 4KHZA 4CKEA 5IRCD 4NXNB 4F04A 2IEDA 2YY7A 2HJGA 4G4SP 3LXMA 3C7AA 1J2JA 4Z4QA 1W1IA 3ISJA 3R9XA 5FL3A 3AY7A 4HDRB 2ZATA 2I1WA 2I71A 4N6OA 3T9BA 4BNGA 3AR4A 1ZZEA 1DX6A 2BI4A 4TN5A 5HMLA 2A8YA 3TLXA 1ZA2A 3ZIUA 2VLIA 1JAYA 1BS1A 4G0WA 2JKZA 4C30A 2GCGA 2Z1NA 2C7GA 4KUHA 2OCXA 2OZPA 1I5EA 2EW2A 4YAJA 4F4HA 3AW9A 1BHJA 2CHEA 2C4WA 1YZLA 2P9FA 1F38A 3QIAA 4XIFA 3EDCA 4FGLA 3RJ5A 2ZSEA 4O2RA 3EZLA 4C6RA 3ANTA 1LQ2A 4UHFA 5BNWA 3AFHA 4CEHA 2VWHA 2QTMA 2RB4A 3MB5A 4CDNA 1M6YA 4OEHA 3REFA 1K6XA 1T0IA 1IJKA 4NCNA 3NBMA 5KTYA 2JLQA 4ZOAA 2FQYA 1SC4A 3EVBA 3RB8A 1QTRA 4TTVA 2GZ1A 1L4GA 1XCMA 2OXCA 3NHZA 1Z8FA 4JP5A 4KE7A 4U4AA 1QDUA 3PYMA 3UKOA 1X2BA 2P65A 3V2GA 4KOAA 1XZJA 2UVDA 1R66A 3LLVA 3DZIA 4MKGA 4CCSA 5FJIA 3QM1A 1W2WB 3VJMA 1OZGA 1SCDA 4LMPA 2OGZA 1VP3A 2O6LA 3JQBA 5EHGA 4ZVUA 4FFOA 3EDMA 3O4JA 1U5CA 3VDMA 4I1PA 4RSHA 5BY2A 4C21A 1FTSA 5IAJA 2HQOA 1I94B 2DBQA 2KW5A 1Y9EA 2V58A 3TDKA 2J3QA 3WK7A 3QKRB 4PYKA 1D2CA 3JCZA 4RHFA 3U7IA 3UF0A 3O1JC 4QOSA 4D4JA 3EXAA 2CB0A 3KCNA 3P71T 5G0UA 4ANFA 4BZZA 4QBGB 4YXWD 1H3EA 4UE3S 4IXTA 3EDRA 4XIYA 3PT5A 1OLSB 4OA5A 1JDBB 4YX9A 3DHWC 3DW1X 3SICE 1UPUA 1RHQA 4E14A 1T91A 2BBOA 1TA9A 5TJHA 4UUMA 4CKXA 3BXZA 4AS3A 4ENPA 3WQBA 1YVPA 3R3XA 3HZHA 1AQNA 4QUEA 3TTVA 2VYCA 1I3LA 2X6QA 1H1TA 1U9YA 2GA8A 1U0LA 1NQ5A 1CIVA 3BULA 5BP7A 2EZ8A 5LQAA 5T3UA 4UQLA 3ZD7A 1F2DA 2E6KA 2WJ6A 4M89A 3F7NA 1GUFA 3OTHA 3T95A 4EX7A 5A4AA 2ZSDA 5INTA 1LV7A 1ORHA 1VSBA 1WP9A 3OTWA 5JTUA 1KEZA 4TKVA 4W9RA 5THQA 4L0CA 5IT4A 3QWIA 1FX0A 1PGPA 3GCWA 4UZFA 5C8DA 3L0IB 3U6KA 3BL5A 1J8VA 1U8ZA 1Z6YA 3WO0A 2ZKLA 4UPDA 4BC1A 3MSXA 4JJ7A 1D4OA 2XYHA 1CUYA 4ZT5A 3T35A 4I3HA 1Q0ZA 5BWOA 4C7OB 5ERXA 3X0DA 8OHMA 2Q9AA 4BO6A 1A2QA 5TMDA 4EDHA 4IDBA 3LPCA 3DAFA 4GG1A 4IQ8A 3CFYA 5EIBD 5TY0A 3H11A 3I05A 3T5GA 1FS5A 4OCZA 1TFUA 4ZRMA 4QJBA 1GITA 5JXWA 1W48A 1E66A 1GNQA 1V35A 4G5OA 4DR1B 2R7AA 2P62A 2PSEA 4J1TA 1N57A 2ZWMA 5TRTA 3O73A 3ZX5A 4DA0A 1R15A 3HKEB 4YJ3B 4E6PA 2JLYA 2CDNA 3NUZA 5KKCA 1DTSA 4X8HA 3SSAA 1QIKA 4CQMB 4OGWA 3VR4H 4FR5A 3MWLA 1B0AA 4U6QA 1EFDN 3PPIA 4KLNA 1LDMA 2Y1DA 5DWQA 5JAOA 5DXAA 5ICEA 4TTAA 3A05A 2AEEA 2CGEA 3SDBA 3G0OA 2G28A 2OFWA 3OH8A 5EPOA 4ZKDA 3G82C 1O6BA 1SEPA 2O20A 3TLGB 4KSCA 2J3DA 1O0CA 4EYEA 2OHVA 5K8TA 4JQYA 2BGNA 1AQUA 3O0DA 4B7UA 3MLEA 4E31A 5IFKA 4V3CA 3KKPA 1AK9A 3KPWA 3OM0A 3U3KA 4IDHA 4MMYB 1I2DA 4PNHA 1H05A 1UMCB 4Z53A 4KLAA 1XZDA 4XGQA 3ENVA 2B8TA 5LYYA 4OB7A 1XZNA 2FLWA 2O2JA 4KR3A 1U9JA 2CVPA 3I30X 3B78A 3IR6A 3RRYA 5EP3A 4JITA 5C8XA 2R6FA 1Y5NA 1G19A 3KWMA 3TR0A 4XWOA 2ZZMA 1TA4A 1BCSA 1MVOA 2BBTA 4HDQB 5F7JA 1IHUA 4YROA 2O07A 3TSAA 4DNFA 5J2UB 4MGIR 2GUGA 5DX0A 2KB0A 4D74A 2BCJQ 5DHSA 4K9DA 3JQ6A 1QBKC 2P6NA 1K6JA 2J5XA 2E4AA 1OT3A 1YACA 4HZIA 2PIAA 3NGLA 3QVSA 1AV7A 2CLLB 5ICCA 3NIGB 4LRYA 4MA5A 4R68A 4FMBB 4MICA 1XE3A 1BMQA 3H5OA 3HCBA 1C0PA 5KWEA 1I4EB 1TYCA 1L5ZA 2ID7A 3O92A 4P5EA 4PLTA 2A57A 3M83A 4Q82A 3ND8A 3SXUB 2PMKA 3HGTA 1XZPA 2L2QA 2DH5A 3G2OA 3HA3A 3OT5A 4WA8A 2HYIC 1BKDR 2AFHA 1CS0A 3K0KA 3VOAA 3OU2A 2OO3A 3GT0A 3HP7A 3NP7A 2CLFB 3V4LA 2QT0A 2PZLA 4WADA 3CF4G 3VR5A 2GWHA 1ONNA 1ABBA 4MUYA 1X8JA 2JAHA 1X80A 1VI5A 1XEWX 3FVVA 5A0FA 2QTFA 3ADDA 1QK5A 1Y6QA 4MS3A 4ZDKA 4C78A 1FNMA 1HDOA 1HFEL 3R1IA 1EGAA 2R8RA 5LKAA 4JXJA 5L4LA 3JRNA 4OQLA 2N1BA 4M76B 2JFFA 1D4FA 1G4UR 4U2DA 4LDZA 4DMHA 5CBPB 2FFJA 1FXWF 3INYA 4UXJA 3VU9B 2QAGC 4CQLB 2QSZA 1U1CA 1QMPA 1K8RA 1TIKA 4BO1A 4DLBA 1TVMA 1F7UA 4YRGA 4CLHA 1LLFA 4LC0A 1WNTA 3QKSA 2CKMA 1ECLA 3WZMA 5A06A 3QX3A 2A9RA 4WESA 3IAS6 3BWEA 2ISQA 5BURA 4GL2A 1YBFA 2GNOA 2AB0A 2YOFA 1QYRA 1K92A 4CM3A 4XASA 4WLFA 1JYSA 3I52A 4RJ2A 2VWGA 2W6NA 1E4EA 4XQ9A 4KNVA 1WKVA 4AB1A 4OUDA 4X8OA 1Y1RA 4PC3A 2WKRA 1J22A 3D0RA 1HV8A 4LNAA 4MYTA 3FOZA 1D04A 1M1NA 2MCFA 4C4ZA 4IHJB 2JGJA 1DKRA 5BR7A 3B1VA 2UVPA 4EW2A 1EX9A 1U4NA 3AGPA 2C99A 2O3JA 4WOJA 3W8RA 1EEHA 5B6JA 1NKTA 2IP1A 5E1OA 4G36A 4NBWA 4J0HA 4I0WB 3K0BA 3ZBQA 1Q3KA 3AT1A 3DMYA 4NMXB 5EXPA 4CMEA 5B4TA 5FOXA 4LDRA 2C0PA 1PR1A 2BY4A 5L3RA 1T8WA 2AFIE 2JJ8A 3G1WA 4NYIQ 5HRUA 3X1MA 4MIOA 4GM1A 1EB9A 2F2TA 3WOHA 1VLLA 4ETWA 5A1JA 2H9YA 1FFAA 2WD7B 1R6AA 3CY6A 3PXGA 3PB3A 1NMZA 1XJ5A 3UANA 3EOBI 4OA8A 1XU7A 2WU0A 3QX9A 3WB1A 4HPXB 2L42A 5LWQA 5LLSA 2RK4A 1NR5A 1Z37A 2NUBA 4PAGA 3QZUA 1NF2A 1ID1A 4M86A 1M0SA 3QMVA 2VK4A 3MTIA 3OLXA 5E2IA 3FPJA 4HGPA 4KQJA 1EJ6A 2JCBA 1RYHA 3I39X 4EG4A 3WV5A 5CXXA 4E5PA 4C05A 1R0XA 4JAVC 4RACA 1TC2A 4COKA 1A71A 4AMZA 1C8LA 1JXAA 1YU6A 3HYSA 4NULA 4N5HX 4EA7A 3EGXB 1WDMA 4YP6A 2EIHA 3I5YA 2FPIA 4BIMA 2O8EA 1O0SA 1MBZA 2NXNA 1G55A 1MP0A 1TK2A 1WUIS 3HWSA 1JHQA 3SM3A 2LCIA 3T3MB 4FFNA 5TS3A 3K0FB 5HOQA 3TM5A 2IOFA 5CFQA 1U3FA 1XZGA 4IQ0A 3BGDA 2QUIA 1TZMA 2Q21A 5I8PA 4BO5A 1F5NA 3BN3A 5L7WA 2GAFA 1N7JA 3QVGA 4P3XA 2VR1A 1RPNA 4M99A 1HZJA 2XMRA 4QJ5A 2DX7A 5TE9A 1KI8A 4X97A 4LYAA 2AG6A 4PR3A 3R7WB 5K45A 2A6PA 4L3WA 3OZXA 1VG8A 2VG8A 3OZAA 1VMAA 3B85A 4RVCA 4X8MA 4HH4A 1ES9A 3NNNA 1YFZA 1WOYA 3IOCA 4RLSA 1YRHA 4UARA 1PYDA 4ZVLA 4F1WA 3TZQA 5I7EA 2WIKA 3T9EA 2B78A 1OUMA 1CS4C 2EATA 2XT6A 2GAOA 3QUCA 2X0IA 3AUAA 1A8IA 5AP9A 2KBFA 3GV0A 1XX6A 4U9IS 4WNAA 1QLJA 3TX6A 1BA2A 5KOHA 5H82A 4RAQA 3TAXA 3BS4A 1WA5A 3BRWA 4R3UC 2B5VA 5LSAA 2IQIA 1QE3A 4Z1MA 1KK0A 1TXGA 1E3IA 2N1MA 3ISVA 3OD1A 4N0QA 4DIBA 2DBRA 4CG0A 2VP4A 2VTDA 2OXIA 2IYPA 4HZUB 5JZ9A 1TM4E 4CUZA 5HM8A 2YJZA 2VDRB 4WSOA 4KITB 2JGDB 2QRZA 2RGYA 3EOAI 3NV7A 5DHRA 3X1JA 2IJGX 3DQQA 4AZ0B 4ZI2A 2D2VA 1NNUA 1UFRA 4OF4A 1SBCA 2GOYA 3L7JA 3LDAA 4X00A 5LDGA 2A5YB 1FYDA 1X70A 3ABZA 5EWLA 5ULLA 4D96A 4OO3A 4E2ZA 5I7OA 1RVV1 3AP1A 4GBGA 4DMMA 1JJBA 2HADA 2ZKIA 5ILGA 3TDMA 1K2VN 2J3EA 3JVDA 4XWAA 5FTWA 1H9CA 5TMBA 4CEJB 16PKA 2AC4A 5AUQA 4Q9DA 1ZSYA 4FB5A 2GCPA 4DCOA 1M8FA 2J3HA 4DT1A 5FBLB 3AEUA 4PLWA 1PL8A 3S7TA 4WT7A 3C3EA 4U7JA 2I6TA 1VKZA 1P45A 2A84A 3SFTA 3LQYA 5DM60 1C3LA 4LJ6A 1ST2A 4HH1A 2P9TA 2YXPX 4QULA 4YO8A 3V8EA 2FFRA 4E46A 4JBXA 4DW8A 2HUNA 3GOQA 2I2WA 3PFIA 1PSWA 4HLDA 4DZZA 4ZTUB 3KXLA 4YRLA 2E21A 3GP5A 4FUQA 2BN4A 5CDSA 4Q7QA 1OX6A 2MOKA 1VMIA 4L9SA 1QG6A 3DHNA 4YCSA 1CS0B 1CZLA 1UBMS 1VTKA 1R4MB 4GD3Q 1R27A 2JJ1D 2DTEA 5IDXA 1V41E 4HNVA 1KC3A 2CWDA 3H99A 5DTQA 5LZ2A 5LBIA 3DCYA 3LV8A 1ZD3A 3NWBA 4AW9A 4YV2A 1C41A 3Q9LA 1YFKA 1PJSA 5FTJA 2FPUA 3NIBA 3E1GA 4HTFB 4MS3B 1A9XB 3FMOB 4OMDA 3U7JA 4RA9B 1RE0A 2YZ7A 4CGZA 1GGKA 1Y8RB 2Z5GA 4N8SA 3W79A 2J9XB 3OU6A 2ODBA 1EDBA 5I4IA 2HQBA 2WNHA 1X2EA 4IJVA 3LPAA 1EPUA 3BMNA 1EXMA 3H7AA 4Y6PA 2QMOA 4E94A 4NCBA 3ZS9A 3UA4A 2V1XA 1LTKA 2WHQA 4R01A 4WZBE 1V9LA 2C54A 2DH6A 5I9TA 4O4HA 1B6GA 1E99A 3L7OA 4OAOA 1SOAA 3P0JA 1PFUA 2Y0CA 4P5DA 3D31A 1X77A 3FSRA 2AIRA 5BV1A 1NC1A 2BDTA 4L5AA 2BFWA 4PWYA 1MC5A 2I1LA 2H2IA 4HNTA 2I87A 5CHYA 1KO8A 3QPUA 3G88A 8ADHA 4TT3D 4Q9AA 3CISA 1K7YA 1OY1A 4FMDB 2BFEA 1IBCA 1SXIA 4UATA 1RPZA 4FQ7A 1RIIA 4J0JA 2NU6A 3PG5A 4G5XA 5CFOA 1P4JA 3IAUA 3M2PA 1O5TA 2F55A 4RHYA 5D2CA 3D6UA 1DNPA 2OAGA 4E7OA 2XYRA 1XMSA 3O8OA 5TEVA 2E4UA 4X64B 3Q15C 4C14A 5IF9A 3UW1A 3HM9A 2R85A 3GDWA 4N18A 1X1RA 1THZA 1SCBA 4S1PA 3MBOA 4FS8A 3I58A 1EUCA 3PNBA 1QORA 3IQHX 2GPAA 3GCXA 4LV5B 4UUAA 5BUQA 2NXEA 5IK2A 1K06A 1IPFA 2IPNA 5ALXA 3R5JA 1UJ2A 1J07A 1FDSA 1DWOA 3DC7A 4M60A 3CUWA 3D6TB 5JH7B 1E0DA 1VI2A 2D62A 2X58A 3A2KA 2ODPA 2ZPAA 5JXGA 3GZJA 3NWPA 5JO0A 4LZJA 1VXRA 2H29A 4OVKA 3D6NB 3VH1A 4RULA 3R74A 3REQA 2VN8A 3VR3D 2XA1A 5KS2A 1BO6A 1KYQA 2L18A 2H5JA 2OHXA 2VSQA 3UENA 2Q2NA 1PVVA 1CHNA 2EZTA 1UBUS 2C03A 2Y1FA 5DO9A 5P21A 3C41J 1KFEB 3OPYA 1IQPA 1T2CA 5C7OO 2ZAYA 2XRYA 3D1LA 2YFHA 3ZNOA 5TF4A 2PFSA 3P96A 3RRMA 5G53C 3S3TA 3A1VA 3TE6A 5GZ1A 3QPAA 4JNKA 1LEHA 4NEHB 2Q0XA 3GLGA 2I22A 2QAGB 3RLIA 4DLWA 4A8PA 2C2GA 4NG4A 4MDHA 4QDJA 5D3KA 2CYCA 4L22A 3NI2A 1R5NA 1V8ZA 4PX5A 5TGDA 1W36C 4CCWA 4G5SA 1Y5LA 2IUEA 3NCHA 4ENTA 2AX4A 3WYFA 1IDOA 1Q7CA 2PHZA 2JFVA 2QDXA 3G2JA 4B6PA 2YDYA 4A6XA 3THWB 5LR6A 1QYIA 1L7NA 5BT9A 3ICWA 5D01A 5K0SA 5EMMA 3ICOA 5JAHA 2LCFA 3RRJA 4DS3A 3GJQA 1N5KA 4IHJF 2WQZA 3NC1C 2YFQA 4UD6A 3BWXA 5K5EA 1QGOA 2GXAA 1A2OA 2XNCA 3DO5A 2JHCA 1WULS 5IPFA 2WJWA 3U5TA 3OEHA 4MB0A 1DP4A 2VPPA 1M34E 1Y1PA 4KRGA 4LWZA 3PFWO 3SIWA 2FZGA 3R77A 3GAAA 1N8KA 3GHYA 4NU0A 3VTFA 3F7OA 4DLXA 3SD7A 4CKWB 2XRFA 5EJ5A 1CUFA 1ZW6A 1ZHOA 4QDOA 4WK2B 1Y3IA 3IJ5A 1PL7A 4G5GA 3RBVA 1PJ8A 4ZDWA 3VDRA 3TZKA 4BKUA 4CBVA 4EECA 1QB7A 4LF4B 3I42A 5AICA 4HRXA 2ZUWA 1XK7A 4YR9A 2YICA 3H7IA 2CNBA 4K46A 3DKIA 3GJ0A 5P8WA 4AG3A 4JBNA 2BWJA 5TDHA 5DSZA 1M2VA 4K1XA 4E11A 1KYWA 1NQUA 2BRUA 3DM5A 4EPVA 1OU0A 1QVVA 3BORA 3EFOB 4OU4A 5AVOA 2PNJA 4YMVA 1HORA 1JUDA 1FQKA 3D4PA 1JSXA 1DG3A 4NEQA 1CVLA 4LBVA 4BV2A 3ZZ0A 1P5RA 3STYA 4H4EA 1UC5B 2JIZA 4LSWA 4MI1A 5IBRA 2JI7A 1TO6A 3IT1A 3UC5A 4AJPA 4NENB 2F8MA 2CL0X 3AOGA 2P79A 5EXXA 3TLJA 3VR0A 4YV7A 2WJVA 3UMMA 2OV2A 1YB5A 4UVIA 4ZI7A 4KX5A 2HA2A 4GX0A 3VKGA 2LCQA 3A06A 4QYWA 5LYJF 1FJXA 2JBWA 3MINA 3NGXA 1OAAA 5GZ3A 4FTWA 4LBZA 4TZKA 2G25A 1YHNA 2VWPA 1KY4A 1W34A 1JSLA 4GYYA 3ZE6A 2X2FA 4QT4A 4K87A 3ZLUA 3LRTA 3O31A 4NU6A 2FY8A 4QGHA 5IJ0A 1GQOA 1LF5A 2O7NA 3AG5A 3HJTA 3CLUD 4RVOA 4E5UA 3G8CA 1XMJA 1P5HA 3S40A 1SG9A 1A1SA 3O6VA 3GD7A 1DX4A 2YV3A 3DR5A 5DWDA 3AL3A 1R4MA 5IX8A 3BD7A 1I1HA 4LDJA 1YQQA 4KYIB 4YPFA 2WJ4A 2B1GA 3DKKA 1P29A 5EWMA 3SK0A 2I9PA 2WSMA 4QHTA 1BW9A 4EG3A 1Z13A 1T4CA 4MTCA 4RYLA 2BKAA 5JD5A 2IHJA 2Y1LA 5LZ5A 2R1UA 3SC2A 4DRXB 1FMFA 2D0OB 1TM5E 3SEAA 1IQUA 2QYOA 1GRRA 2CK3A 1OWLA 3KJGA 5FOWA 3ZZNA 4F3YA 4XE5A 1M6EX 3ZI7A 3R5SA 4KJXA 2BP7A 1JR3D 1O57A 3LE8A 4MV0A 4E2FA 3R0VA 2XBUA 5CX1B 5DRYA 3T3IA 1WZIA 2ZJFA 4ZOBA 4AUKA 4IDGA 1G9SA 5EPEA 1P9RA 5TQ0B 2OZEA 1OXMA 5FUQA 4X92A 1SQ0A 4ZOEA 3MHTA 4PYMA 1W4BA 4C3VA 3WADA 1C1XA 4UAVA 1XN1A 1AX9A 1I4OA 2HCTA 1F8GA 3AP2A 3LUKA 4IR7A 1WMBA 2Q3FA 3IPYA 4E4YA 3JD1A 1SIUA 5JSYA 1C3VA 4WFIA 4Y2HA 3HVRA 2QA5A 4WOPA 4QU9A 4DTIA 2CNWA 5HYVA 1RFLA 4GRAA 3EVFA 3T06B 4MZXA 3N2LA 2AMFA 3DP9A 3UHOA 1DKOA 1N5LA 3U1TA 3GUUA 1KMNA 1AKTA 4KXNA 4BKMA 5DN6D 5KPDA 2VYQA 4UU7A 3NR2A 4R2IA 2G1UA 2WD8A 4WRRA 3MMPA 4JUAA 3HJNA 4UUOA 2P0YA 1WOMA 4E07A 4K9SA 4DBZA 3TI7A 3NTQA 1NHWA 2PBZA 1RP1A 4URFA 2W6OA 4XH9B 4IIBA 1XAHA 2YJGA 5K20A 1H9BA 3MCZA 4DARA 1GUZA 1EINA 4LVNA 1B4DA 1PYOA 2IY9A 3ORHA 4DV4B 3AB3A 3TW0A 3SIXA 3GUYA 1Y82A 1A8QA 2NO6A 1SK8A 3C0KA 5HW0A 5MFZA 3FH0A 3OZGA 4C6TA 2C3MA 3C16C 1OFUA 1A5TA 1OHHD 4LKRA 1IN1A 3CGWA 2XY4A 5KEIA 1R0KA 3ZGXA 3GAMA 3GNSA 5EUMA 4IIVA 5ALFA 1GAXA 2A3NA 2CFRA 3LOUA 5DIFA 4CIDA 3L4SO 3ZXUB 1OFUX 1QKIA 2R7MA 2ZRIA 3PDIB 4I9NA 5EE0A 3AUUA 4CEIB 3GMIA 3BC1A 2W2NA 4RTLA 4ZK2A 2L17A 1KI7A 3LPDA 3CB2A 3V80A 3AEKB 1DI0A 3LAWA 3G5LA 5FUYA 2FX2A 4OG2A 2ACEA 5DHFA 4DR5B 1N2HA 1S2GA 4LYYA 4RZ3A 1KZHA 3PRHA 4RL4A 2ODEA 3RK0A 2PNFA 1GUDA 1Y4UA 3HBLA 3U44A 5IYZF 1PQUA 4M3NA 5CLFA 1J8YF 1QGAA 4G2TA 4KVAA 3INRA 2X8JB 1QS0B 2NT4A 4HNAA 5E3IA 1PIWA 2W6JD 4G37A 1T2FA 1YRLA 2OT3B 3SMQA 1E5DA 4GP7A 2GAIA 4MV7A 4C7JA 4DCVA 4DR2B 1WUKS 1D8AA 2WMDA 1KOFA 2ZTSA 3KZMA 4J1QA 5CA0F 1DJMA 2Z09A 2VYVD 1QDLB 2O3SA 3AGQA 3VDXA 1QH8A 4M0DA 3TXXA 1XQ9A 3V9PA 1X3SA 3WYNA 4CETA 4XR9A 4EL0A 4LZPA 2WWHA 2PWPA 2Y3IA 3O5AA 3T7RA 3NALA 1ISGA 2RHDA 3OJXA 2JFOA 3IRVA 4JEIA 2F9MA 5ALLA 3D64A 2E5FA 2QD5A 2V8BA 3CLUC 2HRBA 2PH7A 3W5CA 2Q6KA 3AY0A 4KWTA 4XDGA 3B1KA 3SQMA 3PQ7A 3DUFB 3ERCA 4DWJA 4CKCA 3D6JA 1TI7A 1L7QA 3ZWWA 1SURA 5T8KC 1X42A 1D1SA 2Q4TA 3JYLA 4WCFB 3PEWA 2FZCA 1NQVA 1YR8A 3SP1A 3KE9A 4ZYLA 4DR6B 4L1KA 1ND5A 3W9BA 3A3OA 3B9RA 1ILEA 3OIVA 5TC4A 1G3QA 1RJGA 3AFIA 3U4DA 3A70A 2ZP1A 3U56A 2VTBA 3R3VA 2Y0PA 3ZLTA 3ZLBA 3OX1A 3T7AA 3DYIA 3VZPA 3PJDA 2XE4A 1VHTA 4LX8A 4PM4A 1ZK2A 4CL0A 5E6SA 1LY1A 4RK1A 2IUTA 3IH5A 2IXBA 2WUGA 3IJPA 5DRTA 1FUYB 1R10A 3IL2A 3L4EA 3JAWB 3EPLA 3O83A 2KE5A 3ORFA 3FPBA 2HIMA 4F4DA 1XPUA 5FF9A 4DA9A 3ZU3A 1N6PA 1EHYA 9ATCA 1ZVVA 4FYPA 5EKDA 1UP6A 5LIRA 4A5SA 4LTDA 5FEMA 3PD0A 2JCVA 3EAFA 4O6VA 4K9MA 5ALUA 5CDTA 1T5TA 3AVYA 1JIJA 4LVUA 4PHCA 5I9MA 2W4QA 1QCYA 4KQGA 4LF5B 3VNUA 4IDPA 3RVRA 3U3RA 3IELA 2JLVA 3U80A 4PPNA 3P9CA 3VHXB 4BQEA 3JVUA 1ZD4A 3KQVA 2WKSA 2XCRB 4WHMA 3GELA 1OIVA 3GHHA 2ENWA 1R0YA 3IO5A 1RCUA 4Y6OA 1E5QA 2NOAA 1TF2A 2IYUA 4E4RA 4RAOA 3IFSA 3D8RA 3LXRA 4X41A 1JNYA 2DFVA 2NZUG 2QLFA 2VPQA 2YVKA 3PR1A 4NK4A 5E4TA 4LOKA 3W8FA 1ZJWA 5AH0A 2G0AA 3IAS1 1INLA 2IXFA 1PJBA 2P2DA 4R3NA 3AONB 1LBSA 1V37A 2ZYWX 4P36A 4YRDA 5TVKA 1N1MA 1Z75A 2ZDQA 3HUDA 2FZVA 3KE8A 3VNVA 1O8CA 1ZCZA 4GQIA 4TYPA 3EA5A 3EMKA 5HQ3B 4YHBA 4JYMA 3HB1A 2I4RA 1FXWA 1UKZA 2PT6A 1A5BB 1V3TA 3FYSA 1OWOA 2VBFA 4FGZA 4RHCA 2H1WA 2R7LA 5L3ZA 5F1PA 1RABA 3HWWA 5FNVA 5K8LA 1BWQA 2YWEA 1WDLA 2CB9A 4ZEMA 1JHVA 1Y3AA 1P6UA 3OFNA 3UXYA 1FBNA 3GFSA 1T2EA 3KV3O 5AO9A 5CCXA 7MDHA 1AV6A 4O2AF 2AOXA 3ZC3A 2VXBA 2CDCA 5CX1A 1KK2A 2VCYA 5FL7A 5KSPA 3SHWA 3QJGA 5K0ZA 1YQEA 1GZSA 4KGDA 3D2CA 3QENA 5H59A 4EG5A 1CJCA 3O90A 1WEKA 5TPWA 3OJLA 1FFSA 3VDQA 4YB8A 4BVLA 2XGOA 4D3FA 1EGMB 1B0UA 3HA2A 3GVHA 2PGJA 3MJ4A 3QLVA 4IMIB 2GN0A 3OU7A 4IVRA 2Q3MA 2ZBPA 3AX6A 4FMDF 1NT4A 2VK8A 3DVSX 4L75A 4RCZA 3VKFA 3KJQA 4QBTA 5DHTA 1LSOA 1JTVA 3OVMA 5JXHA 2QDKA 5KNLA 1V39A 3Q85A 4XYGA 5AJTA 3ZU4A 4GR5A 1RM5A 4IKOA 4JLMA 4LK3A 4LGCA 4D8WA 5HVNA 2RGDA 2C59A 2ZR0A 3D6VA 1FDIA 4YECA 1VJGA 1F4VA 4R98A 1E2KA 3KKLA 4MV5A 4C4PA 3T1QA 1U0NA 3ZZ1A 3X1WA 5A6VA 3AH8A 3X1XA 2IBTA 5TR9A 1VP9A 3V2HA 2C4MA 3HFSA 3VU3A 3WO1A 1XNQB 4K3UA 2H1FA 1VG0B 1P0FA 2FSFA 2BR5A 3H5IA 4EVRA 4ZI5A 3HH8A 1E7QA 4PFSA 1MX1A 4QNRA 2VWQA 5FQOA 3VPSA 1NMXA 1SCKA 4DRYA 3HNPA 4E33A 2P77A 1L7OA 2B92A 2HK9A 2W6ZA 3ICCA 3I9NA 4YDRA 1TPYA 3OQ6A 3COZA 2JZNA 2QD4A 2UZ3A 4OJMX 4PU0A 5EVCA 4ZXPA 4QOIA 1V9SA 4LRQA 3RHTA 4Z54A 1YZQA 1NUSA 5TPZA 4RVFA 3C3BA 3O93A 1S2OA 4KFCA 1QZUA 3MD0A 4EP1A 1NSFA 3D5TA 5CYOA 1PR5A 4P4UA 2WZBA 4GKBA 4XAQA 3OSUA 5F35A 2FLKA 3FOAA 4DPKA 1F6WA 3CKYA 4KR9A 4F21A 2QQGA 4H6WA 1GNVA 1NXPA 1UC4B 5AIAA 3F6PA 4ENWA 4IEIA 2B8JA 2BMVA 3EFEA 4L6AA 1CJMA 3F2IA 1E3LA 3BD9A 4EUFA 1XRSB 3DDSA 4RIEA 1M2EA 2NW6A 4POOA 1LBTA 4QTUB 2QP4A 3H1EA 4LWPA 3WLEA 5C1IA 5KYYA 2MYPA 1QHFA 1S3SA 3H75A 1DUVG 1O6FA 1BHSA 2UYQA 5A2QA 3M9XA 2O7SA 4AWAA 1UXGA 2A92A 2O3QA 3I28A 4N5MA 2M6RA 2XA9A 4BVAA 3IAXA 2B1JA 5LXTB 3H5VA 3R0IA 5EFOA 3VSAA 3ZVNA 3ITDA 1ZGGA 3BPSA 1ZHFA 4GGPA 3EC1A 3PLNA 3SR4A 4BE9A 4BEJA 2FWAA 1A97A 3BWVA 5A5EA 2NZXA 3DOOA 1BJRE 2CJWB 1P60A 1TKRA 3B8HA 2IXGA 1D5CA 1QQBA 4H6VA 1QKJA 5FI5A 1Q1EA 2NYRA 4MVJH 4RDIA 1RQRA 3HPRA 4F4FA 5IVKA 1PR4A 1YZNA 1A27A 4L4ZA 3AJEA 3UTCA 3TG2A 4JU9A 1PEYA 4CR7A 2WIJA 3M6AA 2G07A 1JSZA 4D45A 3L4KA 4LSZA 3WB2A 4C2AA 2CXNA 2XB9A 1Q0QA 2D13A 2D5CA 4IGKA 1GRNA 5LZ7A 2JFYA 2V59A 1IBSA 2VNHA 3NONA 2PS0A 3QLJA 2WRZA 4OMUA 1O94C 3PIIA 3KYBA 4CI9A 1TD9A 4OQ4A 2FZKA 2KMLA 2ZBDA 3LO8A 1HNNA 2CF5A 1FSSA 1E77A 3PZRA 4K6CA 4NOJA 5GGYA 3DCNA 5BXYA 1V8BA 3SZLA 4B0PA 4N3BA 5CU7A 2WSSD 4P4GA 3NNDA 1KRWA 3GLVA 3E5NA 3FSJX 5D1HA 1I6MA 1IE3A 3RSFA 3ZCTA 1V3QE 4UUPA 5C1DA 1JXOA 3KQYA 2J0QA 4DNXA 1V4NA 2YJTD 4RK5A 1MJFA 1H65A 1RLTA 2B20A 3NT5A 3ZK9A 2VC2B 3DCJA 3F6YA 4M38A 4OKNA 2FWBA 2Z5FA 4KQCA 1N5OX 1X92A 1G1MA 1NUTA 1YJBA 2D2IA 2IEZA 4ZV9A 3ZXXA 2V1UA 3UYLA 4G97A 3IE1A 3QE3A 1W46A 5LA6F 3EWNA 1UUFA 2DJ5A 2RD2A 3WHKA 4Q1BA 1VDMA 5DGTA 2DLNA 4CHTA 1YE3A 1DO0A 2WAYA 2EW1A 3BQMB 3QW4B 5I7VA 4HEHA 1TO2E 2FPSA 3BE6A 4S0ZA 1VBMA 4TV9F 1OV6A 3DAYA 3E7DA 2FPWA 1J70A 2BFFA 2I4NA 3HKBB 3RVMA 4XW2A 2BFCB 4MGEA 3TE7A 3QELA 1H0SA 3VZSA 1PKEA 1PD1A 1TZCA 2XTNA 2HMYB 3EBPA 4GOJA 4K2HA 4J1NA 3ZHRA 4U2GA 3JALA 4FDAA 1P7CA 3FFAA 4J29A 1XQVA 3C48A 1CUZA 1MX5A 3BFVA 1EDOA 2VSFA 2ZI9A 4BHTA 2W43A 3BGOS 1Z4OA 1ZC4A 3BIXA 2FXVA 4G8JA 4WGFA 3STTA 3ZEIA 2FTKE 1NP7A 1VJRA 3L77A 1CYEA 2H4WA 1DRJA 1EIZA 2YN2A 2NN3C 3IV6A 3VNSA 3ER9A 2D5LA 1MAHA 4B6FA 4YV1A 1H6CA 4TVOA 1A4XA 4Q1VA 3GFOA 1VJTA 1V16B 4WXPA 4P3KA 2XJ4A 3ER8A 1AS3A 2WM2A 5EZSA 1NBHA 3TIIA 3JSXA 2EJVA 5JEEA 4QX6A 1X7DA 3ZYZA 4FYWA 4PSCA 1SHTX 4R9VA 4PZAA 3CNLA 4UVDA 4IGIA 4PRLA 3NEPX 1LK5A 1J23A 1F3LA 1QB8A 2WF5A 2WTNA 2OV4A 3FETA 3FUCA 3R7SA 4B6EA 2VSYA 4FZ3A 2QYHA 2OD2A 4RUKA 3L9XA 4PLCA 1ZRMA 2Q6OA 4ZYVA 2PKQO 3PUKA 2BJVA 2J3LA 3K6SB 3GY0A 3WLRA 2E82A 1X1SA 1T8PA 4QQFA 1L4EA 2PA3A 4G0PA 4IF6A 5ALEA 4FEYA 5EMKA 3ON5A 1NDUA 3W9YA 4LYDA 4UTNA 3KELA 1U7PA 3LDHA 4B6OA 4H7KA 4GP9A 4GPBA 4DMGA 4H7IA 2CXXA 3VR5D 1ZZGA 4Q4DA 1CQXA 3K8QA 1T34A 4FJ1A 3KTOA 4AJOA 4EI8A 1RXWA 3GRVA 3OTQA 2CE7A 3U7QA 1L3CA 4LC9A 4P3NA 1M5RA 3N0TA 5U1PA 2FFQA 3PX7A 1O54A 2GRUA 2FV8A 2O2YA 2HLHA 2PD3A 3OEHD 4G4JA 4R1LA 1FUEA 2P2LA 4B32A 2IUYA 2CXHA 1WUTA 3L18A 1JHDA 4L4RA 5CJJA 2RKWA 2FW7A 4QUDA 4NMMA 1JVSA 1Z0JA 1LPAB 1GILA 4RTJA 3KRTA 3LLMA 5BQPA 4EZEA 1Y7HA 1I7QB 1XCGB 1HQKA 1FUKA 2VYFA 4IXWA 4CT0A 1RLJA 1PJ4A 1U4OA 1UH5A 4B3JA 1WBDA 1LVGA 3QYFA 3SQLA 1KHTA 5AFSA 1CUCA 4OMFG 5EJ9A 4FLEA 2QAJA 2NSLA 1VBNA 3GIWA 3H8SA 4HB0A 4LPKA 2P78A 3GBVA 1ZUD1 3IDAA 4R41A 2CUKA 3ICPA 4WA7A 4XWWA 5JHGB 1P74A 1E6LA 1QHHB 4HRYA 4AZVA 4CLRB 4YMHA 1M3SA 2XF2A 3ZW7A 2O0JA 3X2FA 3K7EA 3E9MA 2A9VA 4MROA 1TECE 3RS7A 2C2KA 3DE2X 2LNDA 1FBTA 3UKDA 5DLYA 5KSOA 4DY4A 4HLCA 4X7RA 1N1EA 4PX2A 3S2SA 1GFZA 2EFCB 4Q18A 1AUVA 3WDSA 1PNOA 1YS2X 2HRZA 2QTTA 5K8IA 1RE1A 2VJCA 3PQFA 3B51X 2C4KA 2AOVA 5GV8A 4M49A 1I6LA 3TRJA 1M6WA 1E1QD 3IE0A 4OHBA 2P1DA 4BAZA 4MJ3A 3RADC 1GIAA 2I54A 3AUSA 5CM2Z 4BKRA 2G04A 4MUKA 3WAGA 3LL7A 3ORQA 4O29A 1S8AA 4RQTA 2PZBA 4NAHA 1BN7A 1Z2AA 4QXMA 2BH2A 3E3NA 4PLYA 1Y3DE 4DSOA 2GH1A 3WK9A 3L0SA 3CF6R 3PFGA 1NVXQ 1DC8A 1ZIXA 2ILTA 3KC2A 3NX4A 4UUQA 5H5JA 1G3UA 5FTKA 4I50A 1Q3HA 1G8AA 2GCOA 3GQVA 4H6XA 4Q3AA 3QFCA 3QU2A 5EWLB 2E5WA 3L05A 5TGTA 5FH9A 4JI8B 1E2LA 1KJQA 4HYEA 1COWA 5IC4A 5CJPA 2O8BB 3V2IA 2ZRGA 1DKMA 4XLLA 1TKCA 4NBRA 3BDVA 4OQPA 4MRPA 3QIVA 3AEUB 5G41A 3WJAA 5HCUA 1UEJA 2OXEA 4MGYR 4ZI3A 5FRDA 2IDZA 2OFFA 1I0LA 4I7EA 4QNNA 4S24A 3HXMA 1GEEA 3I92A 3JW8A 3M8KA 5U9CA 1T35A 2FPPB 2QVGA 2QPLA 3EQ8A 3ZG6A 3OIDA 5KDDA 3F5MA 4ZHQA 5A3RA 2ZEJA 3IUPA 4QLOA 3GJ6A 3DFZA 2R62A 3UJ9A 2BEUA 4DCNA 4F84A 5JJ5A 3BFPA 1IVYA 3SEQA 1XOIA 3QG1A 4BNZA 1NN3A 1GPNA 3STWA 1F2TB 3CX3A 2VP0A 2P8SA 2G77B 3ICEA 2P2SA 3DT6A 5GADl 1XXHB 3WJ2A 2WOOA 1IY0A 3TUIC 1Z0FA 4O63O 3NORA 4YCNA 2Y1CA 2WNSA 4QSMA 4TZ0A 4IL5A 2AD5A 2ANBA 5H0IA 1Q1BA 2GKSA 5DXJA 3O7WA 3C43A 1UJNA 4O1IA 2P9CA 1M5TA 1GNPA 1SU8A 1X7YA 2CCKA 2XCUA 3FIJA 4IDOA 4RK4A 1NPTO 4RESA 4XI9A 4FFRA 5HIJA 3IVAA 1U5BA 5H3HA 1P33A 3PDCA 5EJ7A 3TECE 2J09A 1MOZA 2I4LA 4IV5A 4LZZA 4YUZA 1T1IA 3PPWA 4JNCA 4WKNA 3ZNPA 3OKFA 4GMFA 4ZQIA 1RRFA 3O4GA 1EWTA 4YPVA 3T5AA 1GU1A 4V0MA 3HSYA 4IOLA 4EI7A 1WP4A 2DJIA 3VYSB 2RK3A 4DVGA 4F93B 3P4YA 2ZT7A 4RHXA 1G59A 1E8MA 4N0MA 4BO9A 4OX9B 1Q84A 4XVUA 3SR0A 1RXEA 4AXXA 1RQLA 3FCAA 1I2BA 4MULA 4WL0A 4CLEA 2IUFA 4MI6A 1W29A 2QTLA 5F1KA 3X1ZA 1EAMA 2FDRA 3V33A 1PL6A 1I4DD 2Q3JA 5EI5A 1I0IA 2QRHA 2DFKB 3GG2A 4KPUB 1ZQ9A 2YCBA 3O9MA 4FCCA 2WHEA 1T13A 2BT4A 1ZM4A 3QX7A 3NM6B 5GV7A 1I9GA 1U7ZA 1Z18A 5DHUA 1J9GA 4DDVA 1R4ZA 1QQ6A 3KAKA 1U8EA 3SSOA 1MDFA 2C1XA 5JNSA 2GK6A 5LM3A 3VOTA 3JQFC 3KQHA 4RF3A 1KEWA 3VBEA 5CP8A 2CVOA 1TJ4A 3A0UA 4CVNA 2O2IA 3VPHA 4PTYA 1V9CA 1EJ0A 3CZMA 1U9IA 3I34X 5CB6A 4EELA 1T2VA 1TUBA 1IOLA 5CIYA 4NCIA 4URYR 3V34A 1Q6ZA 4LF6B 2VZ0A 2H16A 3N9IA 2GZRA 4MYCA 1ADYA 4IF4A 5EUQB 5B2FA 5EHZA 2DETA 1JQDA 2EEPA 1E1RD 4WKOA 5F21A 5C4GB 4DSNA 2UVPB 2GZDA 1DB3A 2WKQA 3W9SA 3SS9X 1OWPA 1BWPA 4V24A 4ACAA 5ALZA 3AO0B 4HGZA 3DWEX 1X1TA 3H4TA 1WHSA 3NPMA 4WASA 3T1TA 4B3DA 4M8NE 5EYPB 4EM6A 3ZLVA 2CDBA 2O5RA 4RM2A 4CMIA 2ZIEA 3GXOA 3K16A 4CNBA 1QU2A 4A91A 1DRKA 3ZKAA 5EJ8A 3KSRA 4KVFA 4OH7A 4LE0A 4UBKA 5JNUA 1SA0A 1WIWA 2IL1A 3F1KA 3WTBA 1KQFA 1ZD5A 3PICA 1UP7A 3PDUA 1U3VA 3RCBA 3THXB 5K3FB 2WAAA 3FMIA 2G0TA 5EQDA 3RVBA 2HA5A 3NYRA 5ALRA 1PRYA 3FJYA 3KX2A 4IIJA 3IJRA 3V1KA 3MUOA 2EJBA 2FHSA 2RIPA 4AWXA 1S8NA 5AXDA 5BN4A 4OBWA 1JGTA 2C84A 1Q3TA 1LV8A 1N3BA 4GMGA 4KWEA 1WRBA 3V1TC 4KVZA 4CM6A 3I04A 3NHBA 2QSYA 1KMHA 2NPFA 3AESB 4OIFA 5AI8A 2I34A 4LHZA 5B4VA 1H5UA 5FNVB 4NY1A 3WWYA 1UJ5A 4GXRA 3ZDDA 1Z34A 1QLWA 2XNKA 4G0NA 1B43A 4KUGA 1RXCA 2Q62A 3FR7A 1DQNA 3P9YA 4D4KA 4IKPA 5DISB 2I66A 4QHYA 3QEMB 1AQ6A 4KJZA 4N0EA 2EQ5A 1TQ4A 2VNJA 3TW4A 5B64A 2JDID 3MWEA 5BSEA 2FSIA 3MWGA 1OPRA 2BEWA 4MTLA 1WXQA 2BJWA 3AHJA 1LSSA 1E18A 3OHMA 4MS1A 1P7WA 4TQ9A 5KTTA 2ZVDA 3HY6A 1QO7A 5F33A 3VU8A 2AYZA 2WP0A 4X90A 2G88A 1DAGA 5I9BA 4B0OA 4X44A 4D97A 4UMDA 2X1VA 1B8NA 2HQSA 2PX2A 1C0IA 1GQRA 2IP2A 4DLUA 3NP9A 1RXIA 3HP4A 3RC8A 1PT6A 1FFHA 1YQ9A 2JDIA 1SZDA 2PRYA 2ZRMA 3WIEA 3OX4A 4NJEA 2MU1A 4MI3A 1DO2A 1TCVA 2JK0A 3CLTD 2JEOA 2EX0A 3AILA 4BEBA 4DGQA 3H6HA 3ZWPA 2WF6A 2WM3A 5K6AC 2ERCA 3OKPA 4FIZA 4WNAB 4UZSA 3UV7A 4JC8A 2O3UA 2QMZA 4BV3A 4RGBA 1JS1X 4Y1EA 3O8DA 3R5KA 1BDBA 2XYVA 3DEAA 1IWBB 4FSHA 3W5HA 2D0PB 4A8JA 5DW3A 5JCOC 4EB6A 1QP4A 1J24A 1IB6A 1LD3A 5ALJA 1CP2A 1P73A 3Q4GA 3JQQA 1GGJA 1UBKS 2C83A 2JGNA 3A3NA 3DOEA 3L8FA 3O8BA 4MWBA 4ETNA 1N3LA 2DHEA 3AXTA 4NMWA 1VPDA 2FZ4A 5DM0A 4HATA 3ME5A 3ESYA 4HN9A 4AD8A 2FWPA 4ER6A 2JCGA 2R48A 2YXBA 4IVPA 2HBQA 4US2R 5IHXA 3QEOA 2ISCA 1RI3A 1WMDA 2EG9A 4E5SA 3OF3A 4RKYA 2QSUA 3SX0A 1D1PA 4EVSA 2V9CA 1GA6A 3B3QA 2VJLA 4ZHQB 4FR2A 3LH5A 3Q1LA 3PQ4A 4CEJA 5D6NA 2RGNA 2R6GA 1DWUA 1YZUA 1WCXA 1JHZA 1Q7RA 1D2HA 2VJNA 1M6VB 2ZLBA 4JCCA 3EG9A 2Q2WA 4OHKA 1Z06A 4FFBB 4Q39A 2M1XA 1K7SN 3QU4A 4IIUA 5JDIA 1APBA 1IBMB 1HXHA 1PV1A 5FI0B 2E4WA 4QAJA 5EFZA 3RT9A 3TQOA 1Q0HA 3C1AA 3K9FC 4CF4A 1X74A 2ONJA 1J49A 1WKCA 1XZKA 2NZWA 1ZVQA 4JYAB 1E79A 4HVLA 2BD0A 3TBHA 3NOXA 3ZWOA 3PR2B 1BFKA 2XMZA 4OQYA 3W8NA 4O2BF 3NH6A 3ELUA 2AEFA 4BFTA 1T0JB 4ZCTA 2I8LA 1HDGO 3BMOA 2VDJA 1U5BB 2X41A 4PO8A 3NVKI 3H5WA 1S3IA 3PC8C 2D4AA 1S02A 1C81A 3DB1A 3GCGA 3P9PA 4R05A 1EGVB 5IKPA 5DYYA 1VE6A 3P94A 5ER9A 3PBKA 5F76A 4WDQA 3HZOA 1YVUA 3RIXA 3HKCA 3BG5A 1H4TA 2PPVA 4IWNA 5DE3A 2WJJA 1ADCA 4BNMA 4FC7A 5DZSA 2QJRA 2A78A 1T4BA 1U0HC 2P91A 3EEYA 3UK0A 3W2FA 1JIQA 4BNWA 1FA9A 4GYWA 1X8XA 5H4GA 1SBNE 1TA0A 1TQ6A 3QSYA 2C8VA 1VYTA 3GN1A 3OFND 3B6EA 1FL9A 2YOHA 5DOVA 3P9IA 1AM4D 3Q3EA 3GBSA 3ABIA 1H2YA 4GZ3A 3DEFA 1N5MA 4GZ5A 4KAJA 4M7RA 1ZQ1A 4Z3DA 1GSOA 2ZE8A 4HVTA 4LXXA 1V4BA 5A9RA 5K0CA 2AQHA 2YZGA 3DZDA 3U0BA 1PI3A 2ID8A 3QOWA 1M2HA 2ZW9A 1N2GA 5D1NA 1U1FA 4PG6A 1E61A 4PYQA 4WERA 3NVMB 1Y4AE 1GV0A 4JB3A 4OB6A 1XVTA 3WGOA 1B14A 5IASA 5AW7A 1TUBB 4EHLA 3P2KA 4WLUA 3RGGA 3ZTTA 3HVUA 4NU5A 3AF6A 1R8YA 3BXXA 2AJCA 2ZSJA 5GJWC 5K8JB 3CGGA 4QREA 2VDVE 4LQ4A 2UDPA 4GVXA 1KQ3A 2EHJA 3A1CA 4NFLA 5SV2A 3ZNNA 4AZ3B 1MW8X 2O54A 1VA4A 4MW4A 1U0EA 3PHJA 2WWIA 2CSUA 4HPJB 4DLAA 3SJ7A 1HQCA 5CB4B 1MQSA 1KO7A 1ECCA 4U6NA 3ROFA 3IP9A 3RS5A 2AR0A 4Q5IA 1Z7BA 2C7VA 1UBJS 1NLMA 3NT2A 3WRXA 1T36B 5A3JA 5K09A 1KQPA 1AGXA 2FSPA 3CW9A 3Q1KA 4XVQA 5DI3B 3A9TA 3W6UA 2XE6A 4CMGA 2HJHA 5I7AA 2ORVA 1XFAA 3RQSA 3IHWA 1TLLA 1HYBA 5CNJA 5KJEA 2GZ2A 4DYHA 5CYPA 4AC9A 1KEVA 2JB9A 2AK2A 3QVMA 1Z26A 1E2DA 1JPUA 2NO5A 3M34A 4AS2A 2IVZA 3H2YA 4NAVA 5BSMA 5BN5A 3C6KA 4OP1A 3PT9A 4EUNA 3GN2A 1A4UA 4B47A 2BZ0A 5HF6A 2FMUA 1JKJB 4D9HA 4EGJA 3K2BA 1Z4IA 2Z9CA 3LPMA 5B3AA 2IZ5A 3S8EA 2BHLA 4P86A 5SZIA 4AY2A 4KEAA 3UATA 3RIMA 3ZHUA 5CNIA 1C2TA 3JYOA 2R6JA 4IINA 2QMEA 4DIOA 4JLKA 1I4TD 3QJYA 4BWYA 5DNUA 3OMLA 4C0SA 3DBVO 3B1FA 1UBCA 3RHZA 4IDDA 3GLGB 4R9NA 1YRAA 5HJ5A 5LKRA 1E7MA 1Y1LA 1PX0A 2QV7A 1B0ZA 4H77A 4HG2A 3HNOA 1KARA 3VC7A 4EVIA 3ZUGA 2DWOA 4RTOA 2PR2A 2W2LD 3LTEA 1YQWA 3UK7A 3NAMA 2C1EA 3JQAB 4LEIA 3ZJTA 3TSZA 1QC5B 2MINA 2X22A 4IYJA 4R1OA 3HO1A 1QGUB 3EDOA 2VZ9A 1QONA 1VCMA 4UEQA 3SIRA 5BR1A 4BFZA 5DBGA 3LT5A 4FD2A 5A0VA 1FRFS 5AKLA 1RADA 4PAQA 1XZEA 1QOQB 1GOTA 1NN0A 4Z4IA 4NYJR 3EZXA 1E9BA 5EIAA 2Z9DA 1EK5A 2HA3A 3GLRA 3U4HA 2B36A 1IN8A 3K8OE 1ZITA 3UGKA 1HMPA 3QXHA 4YCBA 4BFWA 1XZBA 3OMWA 3NV9A 1IUPA 4BQQA 3VO8A 1AKUA 2B6HA 1KAGA 2VUIB 4FGUA 1L4NA 1FZTA 3I9V1 3ZBUA 1JALA 2QN2A 1T4GA 3IC5A 4B79A 1PVOA 2QIOA 3IV9A 3TBKA 2GPYA 1H23A 1UDAA 2JLCA 3H6GA 4GO1A 2BMDA 4B1FA 2FPKA 1Y1TA 3FTCA 3OX3A 3WJ1A 4BP8A 4GWLA 4LJLA 2ACKA 4RQAA 1Z7GA 4C7KA 3KDPA 2UZ1A 4BLPA 1L7MA 2NO1A 3R6LA 2C82A 3T5BA 4O4LF 3UEOA 3NOVA 1JIXA 4I14A 1T29A 5F77A 2BW0A 1B0PA 3KPJA 1P2GA 2NSHA 4MI9A 4PS1A 2IE8A 1RTTA 4KMSA 4B4OA 1YI0A 2VRBA 4JT2A 3V42A 4XPIB 3O4RA 4GDFA 4E21A 4PXSA 4FOLA 1WTCA 3DPSA 4OOFA 2VAWA 1K7FB 1EFCA 4Q3DA 3H2SA 5HJEA 4AMBA 1K98A 1I3MA 2XR1A 1IY9A 3A36A 3EVCA 1DBVO 1Z07A 4JDPA 1XRRA 2XZLA 2Q4RA 1COWD 2QUZA 5DP2A 3SHOA 4JA2A 2ZRPA 2ZRAA 3D54D 4KFTA 1A9RA 4F3CA 3Q8XB 4L8WB 1NLYA 1XT6A 1I2MA 4P84A 3VPDA 1CU1A 4L74A 1GKLA 1P1JA 5T6BA 1XNRB 2FMTA 3HN7A 3O47A 1U8CB 1E0KA 2H1CA 3Q2KA 3KQSA 3OX2A 2GFHA 4RA6A 1TJPB 3EAQA 1QGDA 5F2OA 5GJVC 4HAXA 1VJ1A 3WP1B 2XUQA 3JZIA 2XLBA 4KQ6A 4CIAA 1U2DA 3KQUA 2LP4Y 3VXKA 1I30A 1E63A 1U1GA 2VHYA 3ILVA 3QNWA 3AHIA 3RFVA 3K09A 3PNOA 3WK5A 2XUIA 2Y1XA 2B4RO 2D1SA 1T4CB 2WIBA 5G0TA 3SWWA 2WZCA 5A6SB 3ACCA 2I2XB 1ISMA 2VT7A 4JQSA 1KJNA 3A7EA 2X1HA 2YWBA 3JTMA 1V8PA 1TK9A 1VSUA 4KI7A 2R6ZA 5FB3A 3ZV4A 3BA6A 2H85A 3HXLA 3AU9A 4WOBA 3RUAA 1N5IA 4X24A 5REQA 1KI2A 2RH5A 1CEYA 1U80A 1E2EA 2Z8ZA 3BCSA 1UXHA 1RYFA 4TLDA 4TWBA 4GGOA 1WQ3A 1XU4A 1BVYF 3O8LA 3P1JA 3U9SA 4IH9A 4EARA 4ZO4A 5EE5B 2D2FA 3RTEA 4DQUA 3PU6A 4ZYZA 1YJXA 4GU5A 4ZVQA 2HBRA 1GQYA 3UJ7A 1TU4A 4ARUA 5LQMA 2AV6A 1BRTA 1K8YB 1Z9BA 4HD8A 4HBGA 5HFAA 5BNIA 5I7WA 5JW6A 2ZM5A 4PG7A 5HUJA 2A4MA 1E9DA 4GX5A 1V6SA 5L3SB 1O6CA 3UCXA 1M74A 1B2LA 3E3AA 2O50A 4H1WA 4PV7A 1GZVA 5F1YA 1KKUA 4W1RA 1EU1A 2Q4OA 3JZDA 4LV6A 4M9SA 4KXFB 4FFPA 1U8UA 1UDCA 3TQQA 3M70A 4FJ2A 4JP3A 1IIRA 3VUFA 2JATA 3GJ3A 3GQBA 4UTOA 5CB4A 3AF1A 2J6BA 3I6ZA 4OHOA 1HE5A 2AC2A 4IX1A 1PL0A 3VHRA 1AT1A 3CUTA 4GYKA 4UW9A 4W5JA 3MM4A 1M0WA 4M8LA 4Q03A 3PP8A 1U6IA 1M67A 1UPBA 3S7ZA 5ALPA 4A0QA 4HDAA 1QWOA 1WBJB 5AI5A 5F64A 2PKWA 2B1IA 3H05A 4WXYB 2WDZA 3ZHBA 1HM5A 3IRUA 3QQ5A 4RDXA 2WKWA 2R65A 1NRJB 1J06A 4M0PA 2BFAA 5IXJA 3HB7A 2GQ0A 3QTBA 4M1SA 1T25A 3WL3A 4ATNA 1UBHS 1CTQA 2OPBA 2P75A 4ITRC 2DQKA 3ZPXA 4LF8B 1K9VF 3MRTA 5AKZA 5HE8A 3VPCA 4E13A 1ORIA 2V3VA 5E1DA 4CV2A 5CDFE 1W2GA 2Q6TA 4CCAA 1JJ7A 1XPJA 3ZU2A 1E7WA 3FVWA 3MJCA 3GRCA 2ZYUX 1XZHA 1SKYE 1SZPA 1OROA 3IP8A 4L6IA 1U11A 1WKBA 5HILA 2FPOA 4DAOA 1PW7A 1RKBA 1ZWLA 1WABA 1D1QA 5HIMA 5KAPA 5BN3B 5KYGA 1KJJA 3QHAA 3ZCPA 1L7DA 2J5BA 1ADFA 3S2YA 3ASYA 4L76A 3LD9A 3RV3A 4D0RA 3MA0A 1WXDA 3M6VA 3GLIB 1AXRA 5LOVB 4FYKA 1G21A 1U1IA 5MF6A 2PXHA 4J4BA 3QLVC 1NJFA 3P9SA 3D8NA 4PQRA 5AJZA 5K2OA 3QU7A 4QPNA 4YUVA 4Z86A 1CKEA 3TLBA 5A4FS 2QRVB 3D4LA 3ZWQA 5EJGA 3VKWA 3PTAA 3H1TA 3IBSA 5U4QA 3OWHA 3TD2A 2VCHA 2ZWPA 3QXJA 1NUQA 3T1NA 2MHCA 5DT2A 4C4SA 3MJEA 4LOHA 1MTOA 2PZJA 1PF7E 3K1AA 3PPYA 5DTEA 3ZIDA 1J0CA 5HTKA 3U3ZA 2QX8A 4YRSA 4Z51A 1X38A 3NGMA 3IOBA 2I67A 1V7CA 3K1YA 3ZHZA 5LLTA 3SF8B 1F5SA 1JDUA 1MQAA 5C9ZA 5JAZA 2PZFA 3B89A 4C01A 2IDMA 4JOCA 2VHJA 3I1YA 4AJEA 4TRMA 1NE7A 1XLTC 1MLDA 1XFDA 1ZD1A 1OIWA 2IYRA 1NRWA 1NVUQ 2LVBA 4P8RA 4OP3A 2C95A 3LX5A 5G0VA 2AI1A 1HDRA 3CH4B 4Q4JA 4UMEA 3UV6A 1PQ4A 4X60A 3VR4A 4F5ZA 4CDGA 3A14A 1DTWA 1N1DA 5DASA 4XQGA 5AJWA 3PXUA 1SKQA 4EO9A 2VP2A 1FFXA 1V3UA 3E15A 3M6UA 5FA8A 3TR6A 5J59A 5CT8A 5IF3A 1IOZA 2N3ZA 2VDPB 3I6YA 4M1TA 4XOUA 3W06A 3W6PA 1CY2A 1N6LA 5DYWA 1WQ4A 4M7OA 5KAMA 4MKRA 1XZIA 2P69A 3TMAA 5GINE 2DERA 1B6TA 3FNBA 2BFFB 3HKBA 4TTSA 1UANA 1QRAA 1WNFA 5K05A 1XTPA 2J48A 2QUBA 5HIAA 1E3JA 3JPWA 4DF3A 4MWTA 4DILA 2YC2C 5LIPA 1YTUA 3K0SA 1UM9A 4R8MA 4EYQA 4YCCA 2PXAA 4ZCMA 2EGUA 1RJ9A 2X7HA 3CZPA 4QXRA 5EESA 1UKCA 5C1PA 2V7BA 3DXYA 4E1BA 2GN2A 1JAIA 3CUYA 3S70A 4JLAA 4MVJE 4IUDS 1SXPA 3V48A 5I6DA 5DM4A 4ABTA 5IC5A 3UCEA 3C4QA 3ZHSA 1UFKA 5BWLA 2DCUA 5JQWA 1JPVA 1KR5A 2O4UX 3LQKA 3O03A 5AJVB 1T2UA 2PL9A 3P27A 1MEOA 1NUPA 3USZA 1WXHA 3G5MA 4H0CA 2NG1A 4LPSA 4RZUA 2J9YB 5AHRA 4RFSB 2XTJA 4EJ6A 4E2WA 5F4ZA 1U99A 5CFNA 3O1IC 3TW8B 3IEUA 2UYYA 5EUBA 1ZR2A 2GJSA 3NFRA 3TVDA 3ZK7A 3UB2A 4MQFA 2JGAA 2QRQA 3S1LA 4B5LA 1JA1A 4M0CA 2ZYRA 3W7BA 3B53X 4HUJA 2D2XA 2YKGA 1BQ3A 5JMOA 1GG2A 2L69A 4OOEA 2QL6A 2Z2XA 3CWZA 3FMGA 3K31A 4YPOA 2PTGA 1EWYA 4C2BA 4R3WA 3ODPA 5KQPA 3EF1A 1BROA 1QDEA 2A0UA 3DV0A 3HXKA 3LUFA 2Q0HA 1MABB 4KTVE 3QA3E 4M7PA 3RW9A 2XI4A 1KI1A 1O96B 1UAGA 4KV9A 4LYHA 4ERXA 2IHNA 3N28A 3D59A 1IXZA 1LS1A 1SQ6A 5KYKA 5DTJA 4B73A 5AHKA 5E6UA 4XCQA 5IBCA 4HMPA 3KFLA 3OJEA 3Q10A 5AKXA 3T9CA 4BNJA 1SU7A 4BO2A 4ZICA 4FW8A 1DFIA 3IJEB 5J43A 1NVAA 3BMQB 3OQMA 4BU1A 2NSJA 2INGX 3IVCA 2WYVA 2PZAA 3FZYA 1WHTA 4FHZA 2B99A 3E1SA 2RH9B 5SZKB 1L3BA 2GLTA 3RABA 4MVJF 1YO6A 1XK6A 1TUEA 2O7VA 4G5YA 3S2GA 5A5GA 5LQDA 10MHA 4HUQB 5KINB 4LJSA 4CTKA 1J25A 2JJYA 2L19A 3LM8A 4FGWA 4HO1X 2QZJA 3PJGA 1ZOSA 4MQ6A 5A5VA 2GA9A 1VHJA 2JASA 3BHMA 5JWRA 1I7SB 4L9AA 4NZNA 5JXJA 3C97A 4G09A 3GT4A 3IS3A 1JIKA 1ETHA 3SJUA 2IFTA 2WJGA 2EQBA 2J07A 3I9FA 1NX6A 2XQIA 3SR3A 3OEEA 1SXJA 4MUJA 1CLUA 2Q0SA 1D4ZA 2TMGA 2GEDA 4HFRA 1BD3A 4WWHA 2XOEA 1TM3E 1UPAA 1QNLA 4JBGA 3HVIA 2DOKA 2PQ0A 3RROA 5G0SA 1WLYA 2QMYA 2VS1A 1Z4NA 3E2MA 1MG0A 5IAOA 4CL2A 1SUEA 1AA6A 1QSGA 5KYNA 1U2EA 3L93A 1U0RA 3DBIA 2BISA 3ONFA 4G5QA 1KBZA 3ZXIA 4AY5A 1P77A 1YJQA 4DSTA 1Q50A 1GYQA 1Z38A 2XV1A 1W9MA 1SCQA 1WVIA 3IXLA 3E9CA 3MTQA 3R3JA 4IZHA 3K0HA 1X1DA 2X3UA 1FSFA 3GR6A 3KL2A 4KGZA 1Z83A 4N54A 4UAJA 1ZM3A 4JUBA 3CVUA 1BMFA 4Z8XA 3RJ9A 2FMIA 3ZVKA 4A4DA 2C4TA 3JQGA 3Q3HA 4I66A 2QLBA 3AM5A 1AK1A 4BVGA 3JWJA 2JI4A 4ESOA 4KODA 3V6LA 2E18A 1FUIA 3D0KA 3T61A 4AROA 1WDKA 2JGMA 2FUEA 4YAFA 5B2EA 1YUBA 3TBFA 3F5FA 3HNRA 1YDMA 4ZAVA 4QQRA 3NRCA 4Z9AA 4AMYA 3MPUA 1X8KA 3R6DA 4L4UA 5FWAA 4CCYB 1IB0A 2BELA 1XDDA 1WCYA 3L7YA 4IXNA 2JCXA 1PZXA 2OZKA 3R5FA 1YH3A 4I55A 4U7GA 5COQA 1ORVA 4L0QA 7ADHA 1KS9A 1NBIA 3R7LA 3W5JA 3L1VA 2BM9A 4L15A 3S1AA 1V5WA 2V03A 3CX7A 1P8JA 1SY7A 4UCFA 4JGBA 4V1CB 2I7XA 1XLVA 2YJ6A 1VCIA 4IAOA 3T7IA 1P5JA 3MB8A 1GZ5A 1YI1A 3DVRX 1UEXC 5I9LA 4EPXA 5FCDA 1QMGA 1U0GA 1XZQA 1E1MA 1XL1A 2FPPA 3IGFA 5DNDA 4ZRNA 3EGDB 3TMYA 1R00A 2R86A 1HG1A 3KYDA 1JQEA 2ZB3A 2KX7A 3I01A 4QQNA 4YUYA 5FWYA 1LB1B 2OGUA 3HG7A 2VQEB 3WGKA 5SY4A 3UH1A 2P4QA 4DUPA 1MRNA 2R6HA 5BW8A 4JVMA 4DR3B 3E82A 4IDEA 1NVWQ 2DR0A 3RYCB 1OOEA 3UMYA 4OI0A 1JLLB 1N4DA 1QPGA 4Z9FA 4RZSA 3KOWA 4WXHA 3EIQA 2WM9B 3I2HA 4YRTA 3GYBA 4BBJA 3IB3A 4WKBA 2GB4A 4FE7A 2EP5A 1T9KA 4CR6A 3CEHA 1YS7A 1T0HB 2FQ1A 1G16A 3HFRA 4RPKA 1M34A 4ZWNA 3H4MA 2VQDA 4ZYYA 3KALA 1H8ED 5C3UA 1QU3A 1EFVA 2HLDD 3OBIA 4HJRA 1GHTA 4BS9A 2GZSA 4R81A 2NUPA 4CT5A 1UQUA 3SI7A 1HI9A 2ZG6A 5LU9A 2ECQA 3NWOA 4KUEA 3RFTA 1NQAO 4U0KA 1KBQA 4ME6A 4A0GA 3PUYA 3VSBA 4BNFA 3ESXA 1UK6A 4W9NA 5CVCA 3IVRA 5KVAA 2YVAA 4G0ZA 3IX7A 3GJ8A 2A88A 3RVJA 3CTPA 4HEQA 2E49A 1YXMA 3PDHA 3L0OA 4KXMA 5J23A 4TS4A 1XTZA 2JW5A 5HDBB 3IR5A 4KPFC 1X1CA 3HJRA 2HBYA 4L28A 2VF2A 2REQA 2CBZA 1JMVA 4JT8A 5TT0A 3EXFB 1KJZA 4RPJA 5B3JA 3K8YA 2C7OA 1HY3A 2HV8A 2ZXFA 3U3MA 3FPFA 3ONVA 4FGJA 4YRJA 1KFKB 1PT9A 4TLAA 1MHTA 4II2A 5DBIA 5FFMA 3QSGA 2PKRA 2OHJA 2M1ZA 2PBRA 1R6BX 2V7GA 1JKMA 3JXEA 4NAUA 4LK2A 2AFRA 5AWFC 1C0KA 1I33A 4KO2S 4L57A 3UB4A 4AYXA 4ZGBA 1ZHHA 2P1RA 1JAZA 1ZXLA 3ADKA 4RY0A 3IBYA 4Q7LA 3O2JA 1A9YA 1IM8A 3PHBE 4P22A 4C0BA 3B6MA 1UKEA 1KIFA 2NXWA 5ISMA 1BE6A 4FINA 3O82A 4HDMB 3CPJB 2WHYA 4H7FA 4LISA 3QWHA 1CJUC 1KE2A 1AGRA 3BTUA 3LBNA 1ODJA 1HWYA 2PVPA 5IFLA 1PEDA 3ZDYB 4BLRA 3JD3A 2FG7C 1M1YE 1YBMA 2CNOA 4RIGA 3VTZA 4EW1A 1ZD9A 5EEGA 1WUYA 4HRVA 1TTPB 4LSMA 4MH0R 1QJCA 2HMWA 1N2SA 2FU5C 3H9GA 3L07A 1GEGA 3KR2A 3OQHA 4I8IA 4RVHA 4DUGD 4E88A 1LPBB 4HSEA 4A73A 1ZG3A 3QPWA 1F14A 3VZRA 2TMDA 1NVEA 4DXHA 2WBLC 2ZJ0A 3DFUA 4WZAB 3UOGA 1FJHA 1I8TA 1T1RA 1A96A 3QXSA 4YMWA 4HYTA 3WGMA 1WV0A 2PX4A 4NWIA 4P35A 2ZTMA 1W5EA 4MB2A 4JR2A 5KHAA 3TZ6A 3ZS8A 2DR3A 4MVJD 3WGNA 4URZR 1P2VA 4LI0A 3ZV7A 4M0MA 2JGIA 1L7RA 221PA 4FFDA 3CQ9A 3M6IA 3OCCA 1PG2A 2CXQA 5H83A 4PRKA 1E2PA 2X5JO 4CUJA 5IDQA 1OT5A 5CYGA 2F59A 4B2IA 5MN6A 1YONA 1OLUA 5FUWA 5IJ9B 3N0VA 4UHBA 1XU9A 3UT6A 5IKXA 3RIGA 4MDEA 2ZT6A 1YD7A 4PS0A 4EOGA 2FEPA 1IZ0A 2C9OA 2ZUEA 1KMHB 4LE2A