3RVOA

Structure of chey-mn2+ complex with substitutions at 59 and 89: n59d e89y
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
MADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvoA00
5E3JA 4G0MA 2CWDA 3C6QA 2FLWA 1ZDMA 4F12A 2ID9A 3UKJA 1LK0A 1UDRA 2FQWA 2MYNA 2L2QA 3EAFA 3IPAA 4LE0A 3MQ4A 4YLEA 4RV5A 4NCAA 3HV2A 4MR8B 5TPWB 2CD7A 3CNBA 4JB0A 1MAVA 2WY2D 2DRIA 2HSGA 2RJOA 1EFAA 1SRRA 3MIZA 2B4AA 2FEPA 2MSWA 3M6MD 4E7OA 3A3KA 3ROFA 4EGSA 3C97A 1DZ3A 1NXPA 3JS5A 5BRAA 5JNVA 2A9PA 3H5LA 3O75A 5CNKA 1U8TA 3H1FA 2F8TA 3BRQA 3TD9A 3BRSA 4YS6A 1AB6A 2AYXA 4JASB 1SXHA 4G0OA 4KVFA 1RPJA 1FQWA 1YK1A 3KKEA 3Q41A 1IIBA 4RY9A 2E4ZA 4PE5B 5FWYA 2PL9A 2IOYA 3ILYA 4OBBA 5F64A 3SY8A 1EWTA 1ZH4A 3I5AA 4Y9TA 1QP7A 1Z18A 2FMIA 2N9UA 3OLVA 4H3HB 3CLKA 3T38A 1U0SY 5JS2A 4LDAA 3N8IA 1TM2A 5KQGA 1GUBA 8ABPA 1Z17A 3NBMA 3QLVC 3LKBA 2H0AA 3SNKA 5T3YA 1DRKA 2E4WA 1DC8A 1A04A 1XWWA 1Z15A 2IYNA 4W5QA 5IUNC 3A0RB 5TQJA 3VNAA 1RZRA 1QQBA 2V0NA 5TQ2B 1ZITA 4Q6BA 4N03A 2NT4A 4NICA 3F73A 4Q6WA 1P8AA 3LUAA 3H6GA 2OENG 3BREA 3MA0A 1JYFA 4W5TA 3EULA 4Z99A 1M5TA 5GOTA 1L5ZA 3MYYA 2FN9A 3O1IC 3KYIB 3L49A 1RZRD 3O2SB 1R8JA 3KG2A 5KC8A 4KFCA 1YIOA 1BDHA 5DGCA 4KREA 2QVCA 2X7XA 3HUUA 4JOQA 3GL9A 3KLNA 1BVHA 3O74A 4MYRA 4KQ9A 1EAYA 3CS3A 5EWMA 3EDCA 1USKA 5B3JA 1F4VA 4XFKA 1DBWA 5I4CA 3RVKA 2W42A 1JF8A 1RXEA 3CFYA 4RY0A 2WWVD 3HUTA 4DN6A 3OQNA 2F8SA 4QPJC 3URMA 5EWJA 3UK0A 2CHEA 4P1ZA 1MVOA 4OLBA 1FFSA 1ZGGA 3F7NA 4MAAA 2LUOA 3W9SA 4ML3A 4G0PA 3HJFA 1DJMA 4Z4HA 3R0JA 3EODA 1NXXA 3EQZA 5JS1A 2CHFA 3RVPA 4RU1A 4OATA 5IX8A 4G97A 1DCFA 4CBVA 5TPWA 2R25B 3FFWA 3M9WA 3O2QB 4IILA 4WT7A 3ILHA 4WXMA 3N0WA 1ISRA 5CNMA 3SG0A 1ZVVA 3OMXA 3QEMB 1DBPA 1JL3A 4LDZA 3D8UA 5CHYA 1K68A 4H60A 4RKQA 1VLZA 2GI4A 5EWMB 3FFXA 4RS3A 3C3MA 1LJLA 3Q7RA 2PUFA 1Z12A 4RXTA 1FFWA 1DRJA 3EGCA 2PUEA 5HSGA 3A10A 3HXMA 3G85A 1E6MA 5KQMA 2MYUA 5EWJB 4YR7A 4ZPJA 1Z16A 3O1JC 1F51E 4KNYA 2NZVG 3EQ2A 4LZLA 2HQOA 5IEBA 1BAPA 3LUHA 3OM1A 1MB0A 4FE4A 3T6KA 1CEYA 5IEJA 2RGYA 1M5UA 1QNLA 3E3MA 4MQEA 4XARA 4Z4GA 1YMUA 1VRVA 2HQRA 2PL1A 4Q7EA 3HEBA 4MRMB 3I09A 5DLEA 3KTOA 4RK7A 1JFTA 2IKSA 3N0XA 2PAFA 5T7BA 2MYTA 3LUJA 2AYZA 3GT7A 3NHMA 3FFTA 3HCWA 1EWVA 1QQAA 3FDFA 1JDNA 3N6VA 4ETIA 3HO1A 4GNRA 4XXHA 1ABFA 4RK4A 3HSYA 3OM0A 1KGSA 5TQ0B 1DCKA 1XHEA 2A9OA 4D6YA 5TQ2A 1JYEA 2PUAA 1PNTA 4PZ0A 1Y1LA 3CHYA 1YVUA 2A9QA 2KYRA 3H6HA 3RQIA 3BILA 3QLTA 5JNTA 4JAVC 5TPZA 5JNUA 4KK3A 1QP4A 4MQEB 4EVSA 3DLBA 2QR3A 1URPA 3H5OA 4DADA 4MLDA 2E4UA 4G0ZA 1EWKA 4W5RA 2IPNA 4ZJPA 2QZJA 5BQ3A 2FMHA 1ZN2A 1WETA 1Z26A 3EJWA 1PEAA 2IPLA 2VUIB 2NUBA 3I45A 4IMJB 2R4QA 2HPHA 2WRZA 3HS3A 3GV0A 1PEYA 3QLUC 3OMWA 1E2BA 2JRLA 2JBAA 2O20A 5TPZD 3T8YA 4TLMB 1M2FA 2ID7A 1A2OA 2FMFA 5DTEA 3ROTA 1USGA 2M1ZA 4NQRA 1KMIY 3JY6A 4RK5A 4MR7A 4RXMA 2R47A 3RVQA 1MB3A 3TMYA 1ZESA 1RXIA 3C3KA 2RDMA 3T95A 4D74A 3GWGA 4RZSA 4TN5A 3IP7A 2L19A 4G0XA 3LUDA 5HQJA 2PMCA 2FXIA 4FE7A 4NV3A 4KPYA 2YHBA 3HK2A 3OLWA 4IGAA 4RK6A 5CNIA 3KHTA 1C4WA 2GBPA 3JVDA 2FN8A 4ETMA 1OXKB 2QSJA 2R48A 4YWHA 4B09A 2LIVA 2PUGA 4YRZA 4WZZA 4DQDA 4EVRA 1E6KA 2P4UA 4O1IA 1QPZA 3QEMA 2L17A 2IDMA 4EYKA 5IULC 2JBAB 1B00A 2E4XA 3KYJB 1YTUA 1J56A 4RWEA 3QK7A 5BRJA 3QLVA 1APBA 4MS1B 1Z25A 2IPMA 4MR7B 1NXOA 3RVJA 2VK2A 4Z4FA 4OG2A 2PUCA 3DZDA 7ABPA 4QYMA 2LBPA 3UUGA 4KZKA 2GWRA 1CHNA 1RNLA 4YP9A 4HNRA 2M98A 3LUGA 5EWLA 4YO7A 4N0QA 4KRFA 4EYOA 3HDGA 4RK0A 5ED4A 3CG4A 3NNSA 1Z2EA 1QO0A 3HDVA 1KRXA 1ISSA 3A0UA 3QX8A 1BA2A 3QELA 4QYWA 4HYEA 4NCBA 1ZAYA 1NY5A 4MRMA 3LUFA 1SXIA 4G0QA 4F11A 4PYRA 5KQPA 3O21A 1TMYA 2PE5A 3I42A 2E4VA 1NTRA 1YS7A 1W9HA 4N47A 1D2AA 1P2FA 1QKKA 2PUDA 4Z4IA 3CZ5A 1DG9A 4WXEA 3NHZA 4EY3A 1I3CA 3CTPA 1VPWA 4W5OA 1U04A 5TQ0A 3H5WA 1QO0D 1Z13A 2WB4A 4MR9A 5IBQA 4XASA 1QP0A 3TB6A 2WJWA 1JFVA 3VNBA 3TO5A 4OLAA 5EWLB 3Q9SA 2VYCA 4F06A 1L5YA 4M88A 5DCLA 3SQNA 3G1WA 3RVSA 5KC9A 3H5VA 1PHRA 4TLLB 2HJ9A 2FQXA 3QELB 5FWXA 2VUHB 3RH0A 3LMKA 4O1HA 4EVQA 4F8JA 5KQLA 1ABEA 4UHJA 1JDPA 2QW1A 3B2NA 3JVIA 2MYPA 4KK4A 3HVRA 1GCAA 3JTEA 4IRXA 1JWLA 3S99A 1BDJA 1JBEA 2XDYA 4Z4CA 1FFGA 1QMPA 4JB2A 2Q5CA 1K66A 5JNRA 3Q15C 4RDCA 1NXWA 1ZH2A 4RY8A 1HEYA 4YCSA 2PUBA 2FLKA 4GPAA 4MR9B 3CZCA 4WWHA 4F3TA 4D6XA 4PICA 4S05A 5FBHA 1LBIA 3NNDA 2JVJA 4KMRA 2FMKA 3LTEA 3QEKA 2QU7A 3F6CA 1P6UA 5IUJC 3RVRA 4ZMSA 1JLKA 4EUKA 1FSPA 4XLTA 1VKRA 1A0OA 5HM6A 2ZWMA 3IP9A 6CHYA 1CYEA 3RVMA 2MSKA 1OXBB 3H5TA 3F6PA 5FWXB 2QXYA 3BBLA 5C5CA 4LX8A 4L4UA 4LE2A 2JB9A 4MS4B 6ABPA 4ZYLA 3H1GA 3IP6A 2I6FA 4S04A 3LUKA 3LOPA 5TE9A 2HQBA 1ZGZA 2WJAA 1NXSA 3OLZA 1D4ZA 3FMVA 1KRWA 2LPMA 2P9HA 4Z9AA 4MGEA 1JX6A 4O5AA 1YS6A 1PUXA 2JVKA 2ZAYA 3KSMA 2FQYA 4MS1A 4FB4A 5JNSA 5KWSA 4N41A 1C0EA 1NXTA 3KS9A 4MS3A 4Z4EA 3RVLA 3DBIA 2PKXA 1P6QA 3GBVA 4G0YA 2FVYA 2FSPA 5JNWA 4YV7A 1JH9A 4RSMA 1SD5A 3C3WA 4IF4A 5IUKC 4EYQA 5B3JC 4ZMRA 4RK1A 3H5IA 3HM9A 2FKAA 4G86A 2PJUA 3GA5A 1GCGA 1GLGA 4P98A 1USIA 1BDIA 1ZY2A 5ABPA 5C5EA 4HNQA 4N0PA 2IPAB 1MIHA 4KQCA 3RVNA 3DGEC 1SXGA 4WUTA 4HNSA 1GUDA 4OTZA 3N53A 4MPTA 1T34A 1TVMA 5FWYB 5KI6A 2WMYA 4MQFA 1PNRA 3K9CA 3IPCA 3OO0A 3SAJA 4EYGA 3N0RA 3K4HA 2LP4Y 4RXUA 5BR1A 3OLXA 3IP5A 2A9RA 4MS3B 3QLUA 2MSLA 3SM9A 2YHAA 1D5WA 3GRCA 4N76A 4IMIB 3LUCA 1TJYA 4Z0NA 4LE1A 1NATA 5D2CA 3FGZA 1H9CA 1NXVA 2E4YA 3Q7TA 4UHKA 1AB5A 3O1HB 2BGGA 1YK0A 4RKRA 4YGXB 3OQMA 9ABPA 3JPYA 3DLHA 4Z9BA 1DCMA 3L6UA 1XHFA 1M2EA 3H1EA 3KCNA 2TMYA 4E7PA 3D02A 3M9XA 4JA2A 1LJUA 3CKMA 3P9YA 1JHZA 1DBQA 2QVGA 4MLCA 3LKVA 5DKFA 1TLFA 4MQFB 4PEVA 3KJXA 5IC5A 2FW0A 3LFTA 4LRQA 2FTKE 2GX6A 1D1PA 2JK1A 3MF4A 1JFSA 5PNTA 3OO1A 3QX9A 1U2PA 1W25A 3CG0A 1S8NA 3DGFC 3NNNA 3O2JA 3IDOA 2L18A 4MR8A 1DP4A 1YMVA 2JCGA 4KV7A 2JVIA 3N75A 4H3KB 2NZUG 2H3HA 3GYBA 1DC7A 3HZHA 3JPWA 4ETNA 2OQRA 4XAQA 1Z2DA 3CU5A 1U2QA 2RJNA 2FEKA 2FEWB 2GKGA 2J48A 3GBPA 1D1QA 3TX6A 2QV0A 1ZHHA 3CRNA 1LBHA 4MS4A 2PLNA 5HKOA 5CNJA 3MM4A 3E61A 3MMNA 3Q7SA 3OLYA 4JP1A 3RVOA 1E6LA 3OQOA 1EHCA 4QICA 2B1JA 2NT3A 4L85A 5FBKA 4TMYA 5GQSA 3KLOA 3H75A 4W5NA
chains in the Genus database with same CATH superfamily
5A1JA 2Q3FA 1Q16A 2PDAA 4ZIRA 1Q7BA 1RQGA 5JANA 2WAYA 2XAAA 3LWBA 2FR1A 2ZDHA 1K7FB 2HMUA 3C7KA 1E3MA 1YXMA 4OLFA 1OH8A 1X1AA 2G25A 1RHJA 4DRZA 2O8CA 3BEOA 4NCIA 3TLBA 5JC8A 1YR3A 3BFVA 3KKPA 4G81A 2WZDA 5FI0B 5LXTF 3D4LA 3FX2A 1WBDA 2O57A 2IS4A 3K0CA 4KKVA 1A96A 2Z57A 1P0MA 2GF9A 3JAKB 1IIRA 1GTMA 1W581 3GZTB 2IF0A 2IY8A 5GONB 1JAXA 2HIAA 4V38A 5LLTA 4ISBA 4MUMA 1HM5A 4WMLA 3CLSC 2W4IA 3JQFC 1DZIA 1NMEA 2PX4A 3QUCA 5ILQA 3UMBA 4ZOLA 3ZOZA 3PE3A 4JU9A 4X1YB 3LRXA 3VR6D 1HE1C 4ZRMA 1OU4A 4YJFB 2ZUBA 1K7SN 4BO9A 4D41A 3LRPA 3PQ4A 4C0XA 1O9BA 3BM5A 3KTAA 3EIUA 3QVXA 1AZSC 2DC1A 1X7YA 1FTNA 2X22A 3OF3A 3WZLA 1XCJA 3OIDA 2DQYA 3ZVNA 3DO6A 1R9MA 3T4XA 3VR3D 1LRJA 2GHQA 3P45A 2FMIA 3PA6A 1E2GA 2FN7A 3KQYA 4H3HB 4TS1A 4DJFC 4OH7A 1MJFA 2A3NA 1JAHA 4C29A 3ELBA 1AMOA 1H23A 1OCEA 3UKDA 1H5NA 2V8BA 4AY6A 1PR9A 4E2XA 3G1TA 2WJYA 1R8QA 1IJFA 2HLDA 4MRNA 5KREA 2D1FA 3E2PA 4X97A 1NRJB 3COZA 3LKBA 2HXGA 2BEJA 3PHJA 4LF5B 3IO3A 3O8LA 1YL6A 3FCUB 3NGLA 4JEIA 1XWWA 1N36B 2QLBA 1RWNA 3HP7A 3U4DA 4L9RA 1T26A 3CH5A 2RGRA 3A0RB 4RC9A 3RE1A 1XELA 2F7SA 4OGWA 5LD2B 5A7FA 4QL3A 2FF5A 5B7GA 1NAIA 1R4NA 4D56A 5FB3A 3F49S 4R3NA 5BN1A 4Q6WA 5JYDA 2G0AA 4X85A 4FVTA 1GYQA 3KVOA 5P8WA 1JT9A 3CGWA 4B43A 3BREA 3A1TA 4AURA 2ERYA 2H1CA 3ABSB 4WOKA 4LYGA 4JC8A 2GD0A 1YZQA 3M34A 3OQ6A 4V0QA 2C5GA 5D00A 5ED0A 2B8JA 2XA1A 1GG8A 4WAUA 4BLTA 2IBTA 2RHJA 1D6MA 2COKA 4DILA 1E5TA 1QB7A 4Q3LA 1SEPA 2ZSJA 1IMOA 2H9YA 4BVLA 4AW9A 1K08A 3F71A 4FFLA 3DP9A 2QTTA 3KG2A 3O4FA 3Q0EA 2AF4C 1S6YA 1QGYA 4FX5A 3VAZA 2BE9A 4DE5A 1OUMA 5JCOC 2LGJA 3I0ZA 3L8DA 4XUGB 4KREA 3IJRA 3BOSA 3A6HA 3OF2A 3HLYA 1BQEA 3H3JA 1PJZA 4GMHA 1AHNA 1YRHA 4Q9KA 3ZEAA 4EMTA 3C24A 4MSUA 5AESA 5CFRA 1MR3F 1TQ2A 3JTMA 1NLUA 1EFLA 4TTAA 4CUJA 4QTTB 4BZZA 3OQNA 1QFMA 5BN3B 1I3NA 4X7BA 1JSLA 3OCWA 1XHLA 3PNQA 4E12A 2CV2A 1RC8A 2QZ9A 1E7YA 2WZCA 3WDMA 1DARA 2ON6A 2VAXA 3L41A 4XUEA 3UYLA 4EFMA 2ECPA 3MMPA 4R84A 4CUZA 2QYHA 3ACBA 1M33A 2EKBA 1DCFA 3LPCA 3OHPA 1GZ4A 1X87A 2AX4A 2CFIA 4MI3A 4TTTS 5LQMA 3LQ2A 5LBUA 3L4EA 4URUR 3NR2A 5EIBD 2OCIA 1YRBA 2FJPA 1L3IA 1XDGA 2X15A 5LQSA 1PD1A 4BMZA 4K40A 3DDWA 1MH1A 1NIPA 4K8RB 1VLZA 1X80B 3HMKA 1UEJA 5EVCA 3UTDA 3C3MA 2E6UX 4LNUB 1LJLA 1UBFA 1Z12A 1XJ0A 2R1UA 3R3WA 1CK4A 1E3EA 1PGPA 3FCXA 1U4SA 2OOSA 1OTHA 1W4RA 3EZYA 1TCAA 2EW8A 2R9VA 1WNTA 1X15A 4XUCA 3TEMA 1ADBA 4XX1A 2DPMA 4A0RA 4NJMA 3I0MA 1BSVA 3TOVA 3NS7A 2RIPA 3OU2A 1M74A 4RCVA 3UG7A 5JEEA 5DE3A 1ZJWA 5LMUB 1B1CA 1A8QA 4MQEA 1IVNA 4F4UA 3M70A 1WZCA 2WI8A 3FHCB 1N8SA 4A27A 2HQRA 2PL1A 3I4LA 2QRKA 2XXJA 1NSTA 1J07A 5K8CA 2DR2A 2X4GA 2PR2A 3WLLA 4R2XA 1LDGA 5L40A 2XGOA 2O3QA 2ZYRA 4ZMBA 1E3WB 4WKCA 4M1OA 3FUTA 2HTEA 2Q1UA 4QC2A 1Y34E 3MMSA 4H4EA 5E6SB 5SZKB 4JYBA 3TW8B 3EFBA 1H2AS 4GKAA 3RVBA 4L4XA 2YW2A 4NJEB 1BG6A 1Y9JA 1DCKA 1XHEA 4TS9A 2X4DA 4RL4A 3ZIAA 4PONA 1DMSA 2GKSA 2QTRA 4NV1A 5HCNA 2HHAA 4U5QA 1M1YE 3WMWA 3ZBUA 1D2GA 3IVAA 2BBSA 2CUKA 5ALSA 1E1NA 1Y8CA 1ZI8A 4JJ4A 1G21A 3EGDA 4DCNA 4QTYA 3AW9A 4I50F 5HRCA 3LFHA 3LO5A 2DUUA 3UWOA 1Z88A 5C3MA 5K7SA 1Q22A 1SPBS 4IDCA 4TVKA 1KS9A 1YRLA 4H4DA 4IIYA 5EE5B 3LXXA 4AJ2A 4QUKA 1XTUA 5HXAA 3EJWA 1F6DA 3ESBA 5DTQA 4IKPA 2OAQ1 4PCVA 4RUKA 5DHSA 4DIMA 5DTMA 3A4IA 1PFQA 1FFYA 2HK6A 3AR7A 1XRPA 1HSZA 1N2CE 3QLUC 2ECFA 4ZAGA 2W2XA 1DV2A 1XMPA 1YR2A 2PY6A 3II6X 4P5PA 1G8GA 1N5LA 1TQDA 3H2BA 2FPSA 4LMAA 3JW8A 2EKZA 3C74A 4JOBA 5BW6B 3UAVA 3JY6A 3M8KA 3WLRA 1FDWA 3WKBA 2YWJA 2VPYA 4GMXA 3TZKA 4B4OA 2CVHA 2K7ZA 4QWMA 2ACVA 3JQFA 3EBPA 2CSXA 3AY3A 2GFIA 3GNLA 3D8TA 1Q0LA 1Q83A 1XPRA 1ZIYA 3AYZB 1YZ3A 3KAPA 3LXUX 4EVIA 2HBZA 1LPSA 2DPGA 3C3EA 4IPTA 1OXXK 4B83A 1THZA 4RTSA 5EGSA 4CQMA 2Q1TA 3R5KA 4H31A 3V2IA 4ATNA 4JLPA 4IGAA 4I1PA 4RV4A 5BSVA 1E2IA 2GBPA 1KA9H 3K4PA 3K32A 2IDJA 4RIEA 1OXKB 4A82A 2A4MA 2BCEA 4B09A 3L01A 4Q7QA 1U0GA 2O05A 2EV9A 1F8YA 2X5NA 1DUIA 4FBLA 2H63A 3JAMA 3H3XA 3L6BA 1Z4MA 3QEMA 2CLIB 4QQNA 5HJ5A 4AS2A 2E2WA 5DIZA 3ZJUA 2FE4A 2AOTA 3KYJB 1GDTA 2R8OA 3BA1A 4OUKX 4RWEA 1UPXA 1UFVA 2I9PA 2H2DA 3ZHZA 4CW7A 5BRJA 4GSLA 1T1IA 3BK7A 2P11A 1C1DB 2Z6UA 3EDRA 1QSGA 1QH0A 1VTKA 4HWSA 3LAWA 2O6HA 1KPIA 1HYHA 4YJGA 1ECCA 1SK8A 3AWDA 5FLXA 5ALPA 2PUCA 4H4CA 5I8WA 3MJTA 3AF2A 1N4DA 1LGYA 1U8FO 4QNMA 3WRXC 1G2OA 2BGRA 2JAOA 2J0UA 4LRXA 5IT4A 1UDBA 1R12A 2R7MA 1U0FA 3EWSA 5TEVA 1N25A 4R0VA 4FDUA 4K86A 3DOUA 5HE9A 2J6BA 1FQKA 2XRMA 5B3KA 3BGWA 2PUTA 2Z08A 2ZVJA 3QELA 1G8KA 5LLSA 2G9NA 4NCJA 2GVDC 4IOLA 2PR7A 4PQFA 2QIPA 2Y1EA 1ZSVA 2X2OA 1FP4B 1VDZA 2LZ0A 4RM3A 1ZD9A 3EOAI 4YRCA 3TJMA 2RH5A 4RF4A 1FRZA 3IDSA 1KZGB 4UXJA 1GT6A 4BO8A 2DHDA 2UYGA 4EHBA 2PUDA 1QK4A 1DV1A 4O2BF 4QOFA 5JAZA 5ITZB 3HFRA 1H0RA 2QTLA 3TLCA 2W2QA 4MV8A 4QXMA 5EE0A 5J2UA 2HRQA 1GZDA 1MAWA 2R68A 3P9ZA 5BYKA 5JCOA 1L5SA 4Q9IA 3C8DA 1EUCA 1P33A 1ONNA 5J9FA 5FTKA 4ZZ2A 1AGRA 5LNK1 1WPXA 5K09A 1TTQB 5BUZA 4YR9A 2UVDA 4F1WA 1HUQA 4CMJA 2E1PA 3WQSB 1L5YA 1H6BA 4F06A 4F2GA 1PV4A 1A2BA 3PQ7A 1W4BA 1Q3TA 3ZWVA 5KC9A 2W2PA 3QJGA 1XA0A 4ZI5A 3L43A 1L6RA 3INGA 3ESRA 3KKMA 2VPPA 3CW9A 4KFUA 3OTIA 3RH0A 3HC7A 1GZVA 4INJA 3GLGB 4EVQA 1S96A 4I3HA 4CV2A 4TWIA 1ZNQO 2EBHX 3ZHBA 4BHTA 3HVRA 4IRXA 1E9DA 3HXKA 1FYFA 2ETXA 3ICEA 1J5PA 1FB5A 1K4MA 2P1DA 2OLEA 4ISCA 3WSTA 5HOEA 2O8FA 1JN0A 5E2IA 1IM8A 4JB2A 4ZV9A 3PFIA 2CF6A 5C8YA 3WLFA 1WY7A 3H6KA 3PWSA 2E87A 4GWKA 3DDCA 2IEIA 4RDCA 3UWMA 1GEGA 3NIDB 1HTTA 4OXYA 5CYOA 3G5AA 4G4JA 3D8RA 3DMGA 4PICA 2Q4TA 3RFUA 1VMKA 1TAUA 5A0TA 3HY3A 2ZYUX 4QNNA 3BXZA 3NIBA 4U7TB 3SYLA 1HOTA 4CEIB 4OMDA 4OM8A 3ZLVA 2QYOA 1SG0A 2QRVA 2PH5A 3KUKA 3QTLA 3T3IA 1EZ1A 4UBLA 3OPXA 3PT5A 2YV3A 4G5YA 4TV8F 3BD7A 2PLWA 4YAOA 3ANMA 5BVGB 2WLTA 1LX6A 4WW0A 2QAGC 3KVNA 2JHAA 3HDYA 1RC0A 4P83A 5EMHA 5CG1A 2DF8A 1H42A 3S2FA 5C5CA 2JLVA 3EDQA 1Q74A 1EWQA 3OKPA 1I32A 2PM8A 3IIIA 3H1GA 3ZWWA 2IYWA 1E2MA 1E1QD 1FW8A 3LYHA 1JEJA 4RTKA 2XXAA 5E9AA 5ALGA 1UWCA 3WL8A 1FMCA 3DHWC 4LWOA 2ETVA 3CYFA 3RUEA 1JHUA 1WG8A 3H65A 3JASB 3WJ1A 5BW8A 3GRAA 4L51A 2VJNA 3I83A 3H2HA 4O5AA 4XWYA 3QRWA 4Z1MD 3AUTA 4YB8A 1U4NA 1VL0A 2JVKA 2QL7A 1SOVA 2WWRA 4DG9A 3ZJVA 3IVRA 4BNJA 2X13A 1P7YA 3NTOA 3LWZA 4QXAA 2HY7A 3DBIA 3T5BA 5K0TA 4EBFA 3KO8A 2O8CB 3M6UA 3OMLA 1AA9A 1T5DX 1F8FA 4FNGA 4N0DA 1KETA 2FK8A 5BW5A 5BXQC 1JQEA 2F3TA 4D96A 2VJCA 3C3WA 1T10A 3FE2A 1ORTA 4O25A 4ZMRA 2O5CA 2I2WA 1VJTA 4GM1A 4DS3A 1OI3A 1MV8A 2CFOA 1ULZA 1XZIA 3ZPXA 1H2HA 4IZHA 1U8CB 3IQHX 1USIA 2ES4A 2Z58A 2NVOA 3PQCA 2VSQA 5K0GA 1BCRA 1PNQA 3LC7O 1NVFA 1UMDB 4J0EA 4X5OA 3WL4A 4AKTA 4IX9A 4BX3A 3VPSA 1RP7A 1CD5A 3IBSA 4XWKA 3K5PA 3V42A 4C4XA 1GZHB 3L0PA 2OG2A 5BNZA 1PNRA 4XH9B 4PZDA 1EU1A 3LHKA 4JC5A 4Q9NA 4I9UA 4CKEB 2QMHA 3FLMA 1QYDA 1Z74A 4XDZA 2HWXA 1QV7A 5AW5A 1F60A 2ZR7A 1XD2A 3QLUA 2G5GX 4ZICA 2BRUC 1D6SA 2OYSA 2NTJA 2RI6A 1R18A 2V59A 2VTEA 2ZWPA 4BZXA 2G70A 2PBLA 4FMDF 4B3DA 3KUUA 4DLPA 1X14A 4TTQA 1T36A 4YLYA 2F8LA 3FB4A 5AHRA 4OGKA 1U0RA 2G40A 4KAJA 4L9AA 4LYJA 4MW2A 4ZU3A 1E4EA 1KYXA 1V3VA 3MTIA 3AHFA 2QD1A 1PKXA 1YK0A 1ZMTA 3CZRA 3PUHA 2AH5A 3QVOA 3QVVA 5H5JA 3NHUA 5I8ZA 4ZCMA 1MZVA 1DO8A 2PCJA 3PD7A 5IJAA 4OYRA 5J4KA 3VKGA 2JI8A 3DYIA 2VJLA 1T3SA 1ZH6A 4TMWA 3P9YA 3OCVA 3VYRB 4EG4A 5K6RA 1U5BA 1XZQA 4Q3KA 4B3SB 1KJJA 3QF7A 1NQOA 2C92A 3PBKA 3PWTA 4EW3A 3AFGA 2EJBA 2WFAA 2XTJA 3KJXA 4L8WB 3AEUA 4OQEA 4TROA 3RJ5A 2WWFA 2Z4TA 3ZWMA 5KKNB 2OV4A 4N5MA 4PLZA 3SF8A 3WMFA 1GJRA 3EQ6A 2CBZA 5KNBA 2YWDA 3WTCA 2BFPA 4DKJA 13PKA 1U2PA 1C8LA 1K9SA 3AF0A 3LWNA 1ZIXA 4K9SA 4DMFA 1OX5A 4C0LA 3IS3A 1YKGA 2G17A 4WN9A 1KH2A 4B4WA 4YAJA 4KDEA 4XAQA 4XLZA 3VR4D 2YJ3A 4U2DA 3HBNA 2QNRA 2GMWA 2XWJI 3V1UA 4C0KA 3WRXA 4Z8XA 4R9RA 1J2UA 1ZHHA 2XYGA 5ENDA 1RWOA 3OQVA 3JQ9C 2O2ZA 4FC6A 2B9VA 5SZJA 1YDEA 3TR5A 1Y42X 3H75A 1TJPB 3W5SA 2OK8A 5BV1A 1NQ5A 1EHCA 3K5IA 1J1ZA 3GUYA 5AJUA 1KSJA 4IGIA 3I62A 1JKXA 4ZQBA 3B2QA 3DOFA 3N2YA 4W1SA 3IAS6 3LBHA 1S8FA 1C5KA 2FLWA 3OJEA 4BO5A 2OAGA 1ESEA 1UDRA 4DR2B 4LE0A 4D97A 1YR1A 1CNMA 1E1CA 1IG0A 2FCRA 3MFQA 4P31A 3ND6A 1E2DA 5F1KA 1C9JA 1N3IA 2XMGA 1D4AA 4B73A 4GQBA 4OP1A 1CUEA 3FPSA 4EI7A 1OHHD 5DTJA 1XYYA 4GLBA 4WQMA 1Q7RA 1UPBA 2FEPA 2NIPA 3M6MD 3N2NA 2PMEA 3T15A 1H8HD 2BJHA 1SC6A 3I39X 4P2GA 2R11A 1D3AA 2UUPA 5BRAA 2JFOA 3JQ6A 3U31A 1DB3A 4IAOA 3FMIA 2DPXA 5AVYA 1QC5A 2EDAA 3BGDA 2WFZA 3BRSA 2VWPA 3O73A 1I10A 3DR5A 2AYXA 2W5UA 3NHJA 3AVUA 2B2NA 3OESA 4IHJB 3KSDO 4JP5A 4LN1A 5CH8A 4FDAA 2VOJA 2ZB2A 3P2JA 4H7JA 4MRRA 1Z39A 5I7SA 5DV9A 4I9NA 2XUIA 5KYXA 2D2EA 1KMQA 4Z2YA 1UC4B 2VPZA 2WTBA 4H7KA 3GUUA 1PHPA 4GM0A 4IKOA 4W7SA 2PLRA 2JW5A 3Q4GA 5L7YA 4NMHA 4DGQA 2EJWA 3T7KA 1DAGA 3JYLA 5AXBA 1J8DA 2HBQA 3JRXA 2GLUA 2GZ2A 2OCAA 2RGEA 1P9WA 2N9UA 2WHQA 1XRMA 3L0YA 5DI3A 4O08A 3CLKA 4MWGA 4BC1A 1WL8A 2FFAA 3PR1A 2A57A 3GHHA 2VSXA 4EARA 5I4BA 2P2LA 2UZIR 5K0BA 3QY0A 4FSHA 5IANA 5JYCA 2GF2A 1LSUA 4FMCF 4WL0A 3BQ9A 1GNTA 1DRKA 1K97A 2HCTA 3PXGA 1U9IC 3VV2A 4EUFA 1PQUA 2BHLA 2CVPA 4U2GA 3ND7A 3VSCA 1GA6A 1QJ4A 1PQPA 2NQ8A 4A6DA 1NNUA 1U7XA 3LUPA 3VNAA 2YFQA 4D8XA 2VDQB 1T9GS 3NJRA 4DDMA 1NGSA 4RTOA 1AZTA 2QAGA 5G0VA 3ZTYA 1XLVA 3I6IA 4Q1DA 1HDCA 1E79A 4RIHA 5C8ZA 1TVKA 5BQPA 1KWGA 4DV4B 4ARUA 4U7DA 2GARA 4E5DA 3V4SA 2HLDD 1FZQA 1G21B 5HMMA 1GITA 3EGDB 1NLMA 2HQ1A 2PK3A 3DBRA 4I55B 4P33A 3VTFA 4PG8A 5K03A 2V4MA 1JYFA 4GZ6A 3DMTC 2A1UB 3MS4A 3IKVA 3PHHA 3GFQA 1NMYA 4GOJA 1H4VB 1XZBA 2FPPA 4S1TA 1XNJA 4MYCA 4P7FA 1RI1A 5CW1A 3ZWDA 1K5GA 1NE7A 2WT4A 3HSKA 1HYEA 3KEQA 4GBJA 4LF9B 2BMFA 2L0XA 5IYZB 3MJHA 4YUVA 1JEOA 1P72A 2EGGA 1R64A 4NU6A 2GRAA 4X45A 4XWGA 4ANFA 5KNLA 4DT1A 4P86A 3CIFA 1ZR2A 1CFJA 1JSXA 2AWNA 4G1MB 4OX9B 4TTPA 1G20A 1ACLA 1P5JA 1M1NA 4I4TF 4K1XA 5D5QA 3N8HA 3SQOA 1EI9A 1N6RA 1VJRA 2ZI5A 3NPMA 4LJ8A 3WL5A 4DLKA 2AFRA 1P5HA 5I4CA 1WSWA 3VR1A 2W42A 4C5CA 4FMBB 4IXNA 3ROEA 3OKFA 3PF9A 3KDAA 3L8ZA 1TYZA 4R40A 4EUNA 3E9QA 1UEXC 2R6HA 1CR0A 2IOQA 3ENQA 5FUVA 2C4HA 4KYVA 4LISA 3A27A 2A67A 2FZKA 5LDGA 4QJIA 4P35A 3AEQA 4Z4HA 3UXHA 3X1DA 3RJMA 1BWSA 3SLRA 5EMMA 1D8AA 3FLBA 2JZCA 3L4BC 2ECKA 4RU1A 3RANA 1IM2A 5BWBA 2XQKA 4BO0A 1FLAA 1YQXA 2IEZA 1Q2UA 1ZHOA 3L0ZA 2MCFA 1U6JA 1RCUA 1W48A 2XUZA 4UEQA 4UBNA 3WLMA 3MJVA 4LWQA 2BRUA 4IZ6A 1GR1A 3QEMB 4LDZA 1DBPA 2ANBA 4BIMA 5BR4A 5J47A 3B3AA 4IDQA 4HRYA 1GGEA 2Q50A 1QS0B 1IBLB 1LY1A 1Y8QA 4YLGA 4EGQA 4EW1A 2VDRB 2I8AA 4Y6LA 1COZA 5CLGA 4LQ4A 2FFHA 5CB4A 2PSJA 3OFJA 3SD7A 1GOTA 2QRGA 3BUSA 3EG5A 1ISMA 3CSUA 4OD0A 2YW9A 5FPTA 1E3DA 1KNQA 4ODIA 3EDMA 1QRUA 3HO8A 1G6OA 3KTDA 4AJIA 4DNQA 4FJ0A 4CIDA 4GDFA 2OESA 3FZNA 3VH4A 5KSOA 2B61A 3MWJA 3EGEA 4X1KA 2FHSA 3WL7A 3IPXA 1TYAE 3AQ4A 5JYBA 1VRVA 3QP9A 3UXEA 4URXR 2V74B 2WYVA 2XUAA 4RK7A 2XOXA 2DWUA 2VBFA 1P0CA 2YMMA 2OFWA 4OI0A 4AL4A 3HMQA 2WOOA 1G1MA 3FDZB 1QWOA 3PUKA 4LRSB 3BGSA 3RS9A 1VMAA 3BT7A 4KPUA 1PL8A 4RK4A 4P4SB 3IIJA 4KE6A 1F8UA 2H3EA 5JXHA 4L8VA 2Q2WA 1J70A 1TYEB 2AQHA 2NU7A 3GF4A 4YIKA 3RAGA 3CNQS 4NG4A 2F1KA 3VI4B 2QK4A 1NW7A 1RAAA 2BEUB 2LKDA 4JJ8A 3JQ9A 3JQ7A 4D0LB 3SIPA 2JRCA 1AKUA 5HDQA 3BKWA 2BEKA 5TPZA 3MMZA 4G9EA 2AHOA 4WXYB 3ZGNA 4W5RA 3NC1C 3TL6A 4ITUA 4J3FA 1K3FA 2ZB3A 2FMHA 4R5HA 5E9JA 5EZQA 5CDYA 1Q44A 3EC2A 2C5HA 5JSHA 4BPBA 2BSXA 721PA 3MQ2A 2XCQA 1P3Y1 1XZAA 3UJ7A 3ZIAD 2NUBA 4MKFA 4R2WA 4KO8A 4AFNA 3K15A 4N7JA 4M53A 4L3VA 4BE7B 2ABWA 3AP3A 3KQKA 1EE9A 5AUOB 1U81A 1Q0HA 2CSUA 4KLRA 5C8YB 4H16A 3T9EA 3I61A 4WKPA 2WKWA 3RHSA 2D6FA 1M2FA 5CUQA 2I3AA 5A5EA 4PX9A 3H4IA 1IL0A 3N58A 1VG9B 2M1ZA 4J0CA 3C85A 3DXFA 3DPUA 4IV0A 5AKZA 2E21A 3N8DA 3ZKWA 5IHPA 2CNNA 2HUNA 2HU8A 2RDMA 4ZRNA 2NXCA 3H2GA 1PK8A 1P73A 1GSAA 1S2DA 2C83A 1IVYA 2II6A 3RK4A 3SHFA 3DZGA 4AUMA 2GJ9A 5KNDH 5GAJA 3MGGA 3RYCA 3BMCA 2RIRA 3ZDFA 3D6AA 4BVFA 3WK5A 4DMRA 1L8OA 1OC4A 3AI7A 5ADWA 4ALLA 1LU9A 4N6GA 1EX1A 5ARBA 4I14A 4Q4AA 3RAFC 1CB7A 5F4ZA 3U3MA 4CIBA 2XXAB 4L1KA 3MD0A 1PL7A 1P2BA 1LB1B 1QK3A 2O8VA 3CLSD 3L06A 3W4JA 3ZCSA 5BN5A 1ZXXA 2WFLB 1E2NA 1VCIA 2Q1WA 1N77A 3AR8A 1L5QA 5EA2A 1RHRA 4MGKR 3DHYA 1QO7A 2I3GA 4CQMD 1MG0A 3L7OA 3NWEA 4HX9A 1LDBA 4CCAA 1A98A 1H1TA 1KORA 2C99A 2CXNA 4UVGA 1U9IA 5FOVA 5FWNA 3ORSA 1U0BB 4QOJA 3G5LA 3MJRA 3UT6A 4RDXA 5G0UA 3AUJB 2NV2B 3TNFA 1VYHA 5F1YA 3K72B 1EFPB 1CNEA 3LUGA 4BVKA 4WBNA 2YQZA 2C4VA 3EMDA 4EYOA 5C8DA 4XVUA 5IKXA 2GJSA 1DTWA 1WUJS 1LPBB 3NO4A 1FDIA 1PS8A 3EMBA 1VE1A 4A26A 2Q3EA 2C8LA 2B0JA 3DZJA 1YR9A 4AUNA 1BA2A 5LJIA 4HYEA 3TAHA 1EXWA 2WNIA 1BCRB 4CU5A 5G1PA 2ZSDA 1WUKS 1EXNA 1D7AA 1XZLA 3A58B 2QVBA 3DMTA 3RLFA 1IEXA 5AIBA 5BQOA 4FGWA 3PQ3A 3I42A 4ZCLA 5ENZA 1NZDA 3VV3A 2RHBA 2F3QA 2DBVO 1O3YA 4N65A 1H0SA 3IMGA 3USZA 4PTZA 1TGYA 4LFAB 4ARZA 1PGQA 1XU7A 1J0CA 4CF7A 4JYAB 4INZA 4XM0A 4NOJA 5AI4A 4CLEA 1XD2B 1KEWA 3R09A 5T64A 4HDOB 5TQ0A 3RDPA 5LU9A 1OGIA 1B4DA 4MICA 1Q2XA 3KOUA 1RADA 2HO4A 3EG9B 5FCDA 3TX2A 4AD8A 3FROA 1IY9A 3VNBA 3ZLTA 4KWHA 4R0MA 1E1RA 3N2KA 1JEAA 4TKVA 2KLHA 3RBVA 3OLCX 4KTTE 4HATA 4JNKA 3PPYA 4U6NA 1WW3A 3TE6A 1IZ7A 3TW0A 5CM8B 2XEDA 3DFMA 3W2EA 5H8WA 3NRCA 3ZY6A 1YE8A 2FFQA 2J5QA 2O2EA 2A3RA 2H4YA 5AIAA 2PT7A 3PL1A 4Z9FA 1VKZA 4Z51A 3UGKA 3ZS8A 5DHFA 3JVIA 4X8OA 5JAPA 1A8PA 1G38A 1U5BB 3JTEA 3A1NA 3L4BA 2AG6A 1JWLA 1MJGA 4LXUA 3TDMA 3IOBA 1BDBA 4IFBA 5JU6A 1D4FA 1FU4A 4KGDA 3F6YA 3OICA 3ABIA 2YHSA 1GRCA 1QHGA 1CVLA 1E20A 2ZB8A 5AKIA 3SF8B 3VDQA 2Y27A 1HNXB 3NZEA 4EY5A 2OUIA 1BN7A 2VKQA 1LBIA 2PJDA 1HT3A 3HFJA 4HB4A 3ZBQA 4BV3A 1KK3A 4FZRA 1PLKA 1X19A 1DKRA 3NRJA 1CUCA 3IP8A 2ODBA 1KDZA 1CQXA 2AMLA 4GC9A 1LNZA 4XLTA 1G5IA 4ARBA 1Z47A 4K7JA 5T8KC 1GCUA 3WAKA 5BXYA 4KQWA 3KLMX 2GFHA 4J0HA 2YINC 1PUJA 3UV6A 1NF2A 5FWXB 3PITA 2XA9A 1JEQB 2AC7A 5A0FA 1LLDA 1W34A 3G0DA 3PX3A 3G8YA 3C3BA 4KQMA 4XM1A 4HNTA 2IJGX 3DT9A 1NVMB 4R3UC 2YMLA 3PTAA 2ZYTX 4WY8A 5ALZA 4QKQA 5ALEA 1YHNA 2DM6A 16PKA 3E82A 3O4IA 3RPEA 5BV8A 1TA9A 2GETA 3KOYA 1LDMA 2JLBA 1J9EA 3DF7A 2YXNA 1R4ZA 3GMDA 5L4SA 2NYVA 1QH8B 1RI5A 3O8QB 2GLXA 3PS9A 1IONA 1R4AA 4HWGA 4IWNA 4YECA 3JQRA 3PKZA 3QW4B 4YRFA 1R0RE 5DK6A 2VXOA 4EPRA 1Q7GA 2VHTA 2ZJOA 3A37A 3E58A 3O4HA 4G0YA 1SZCA 2D59A 5CTAA 3ZG6A 4Y2SA 1WW2A 3THYB 2D4HA 3Q3EA 3WK9A 3O82A 1T1SA 4EIWA 2CMHA 2PQ2A 3BRCA 4K5QA 2H7YA 2E48A 5DBEX 5K01A 1YFJA 3BB1A 3LDHA 1P1KA 3NGMA 1LVHA 1YOBA 2OQIA 2VXBA 4LZPA 4NFSA 3ZWBA 4WESA 5C5EA 4TLBA 1W1UA 3AJEA 3OOWA 5K3OA 1F4PA 1SXGA 1WPQA 4GF5A 4HWPA 2OHVA 5DVZA 2ONZA 2OAEA 3Q2OA 2Q7DA 1ISFA 3C5EA 1UP7A 2BI8A 3KJZA 2YIMA 1KDTA 3IBTA 2ZI4A 2ZZNA 4MMZB 2QTMA 4U3JB 1JSCA 1W8DA 2QHXA 2UV8A 3RFFA 5B5SA 5LBIA 3ITNA 2F9LA 2CXUA 4PGGA 2QN3A 4KQXA 2BI7A 3Q5GA 1YKSA 4PRZA 4QU5A 5DI3B 3LBFA 2YHAA 3FYTA 4N3GA 5DT2A 5AI0A 2C5LA 1INLA 1QVAA 4YJ2A 1KKLA 3IE2A 1BX3A 5EERA 3TBFA 2BH2A 2G72A 2BGNA 3UAWA 2HOQA 2YASA 2EZ4A 4KKXB 4EQ6A 4JODA 3UK6A 3FVWA 3R7NA 2E0IA 1RPZA 2W71A 4GX5A 4OM7A 2HPZA 3GJ3A 1JU3A 2IZ0A 4L7QA 1J8MF 1VKNA 3OQ1A 1E8NA 3DWEX 3ZWYA 1QFZA 3VVLA 3LK6A 4MQ6A 5KBYA 9ABPA 5TIIA 4HB3A 3EXIA 3A2NA 3T1NA 1FDVA 3D02A 3CN7A 4N82A 4BLOA 4OGGA 5KTKA 3HKDA 4GKJB 1TVKB 1NW5A 1DINA 5K0SA 3WYCA 1T2VA 3LFUA 2X42A 3O93A 3VR4H 3AB7A 1S3FA 3SDBA 5KX5A 4JGBA 4KXNA 1X9IA 3VTAA 5BMVB 5L7TA 3FOBA 3P52A 4BNHA 5H3LA 2REQA 3SSAA 3GRUA 3A9SA 4DYHA 2JS7A 3WMGA 3S29A 5LKAA 1XO1A 2HEIA 5KTMA 5LQUA 3JATA 4B6RA 1YJ5A 1P4JA 2V7EA 2JVIA 4YRLA 3GEPA 3R75A 4DT1B 1IK6A 1SZJG 1SHLA 1Z2DA 3DE1X 3KEMA 4YFVA 1A4RA 2FMXA 2GN9A 1QOPB 4BQNA 4DBZA 3I5YA 1KJYA 1MX1A 1J22A 1JI3A 3GBPA 2COEA 4EO9A 1UBOS 1KR2A 1F9AA 2PUJA 3KOMA 3QTTA 5KNBD 5EQTA 5C35A 1DHTA 1QAQA 1SWWA 2R6JA 2ZRBA 3OURA 5JVDF 1V1JA 3L02A 1W5SA 3VKUA 1ZR4A 1QKJA 2IEAA 3Q1LA 3FSJX 4QICA 2B1JA 1YUBA 1RAFA 4PXSA 2VSOA 1ZIOA 3N5CA 4RAQA 5IAGA 2DZDA 4UUMA 2FPWA 3KSUA 3NP7A 2CWDA 3OZTA 3FJYA 4HLCA 1USUA 1JR6A 3KFXA 2ZGVA 3PGJA 2W22A 3D7SA 2A1TS 4CN9A 3NVDA 3EVEA 3FVRA 1ZOPA 1XJ5A 3F9RA 4JR2A 1XLTC 2N1MA 1P9RA 1MAVA 3GCXA 4J1SA 1RAGA 4MV6A 4EHDA 5C46F 1TO2E 5ADVA 5CB6A 2IL1A 1J2EA 3AJDA 1Z38A 5AUNB 4LF4B 4DXDA 2PFSA 4UM8B 3VH1A 5JQGF 3H1FA 2F8TA 1Y3FE 2NSLA 1WXXA 2WJ6A 5AHXA 9LDBA 5K4AA 4ZXPA 1R6UA 1NUUA 4XOUA 4O5OA 5C3UA 3ENNA 3QVMA 3B1ZA 1KSHA 2WIAA 3B2EA 3SBEA 1P9OA 3TB4A 5CXSA 3DCJA 1M34A 4HPXB 2IU4A 3V8EA 5IWAB 2AC2A 3TE7A 5LQCA 1D8TA 3Q6MA 1UBCA 2HV9A 4N48A 2AN9A 1FLNA 2ONYA 4QYSA 1X2EA 4X1KB 1A9YA 3H8JA 1X7WA 3KJGA 3U3RA 1KDOA 2X7JA 2MR6A 3PKIA 2PHZA 3VJKA 5BR8B 4LDAA 1OYVA 1E1DA 1KSFX 2JLZA 2VEOA 4HTAA 3TSOA 1N4AA 1UPFA 4E5UA 4JCOA 8ABPA 2J3MA 2Z0MA 4QQFA 5L3QB 1TC1A 3T3NA 2PNJA 4Y0NA 2ZDQA 3F4KA 1VGVA 3G5UA 3ORYA 2EP7A 4G5FA 5ARCA 4YRPA 1GTRA 1O8CA 5G02A 4JI1B 4PC1A 3IE1A 3FTQA 2HRZA 3DDHA 4OXNA 4Y2GA 1CIPA 1X1DA 1JA1A 5T8KA 5BQ5A 3DPSA 3EC1A 2NSHA 2NU7B 1X7ZA 4FZ3A 4I8IA 3VPCA 3ZZNA 4UMDA 3I92A 4AG5A 4G1FA 2PX6A 2JLXA 1ND6A 1D2CA 4KO2S 4F2HA 1PJTA 3JQ7B 2P9GA 4YMTA 3CNNA 5H70A 4LYFA 3U26A 4BAUA 3FTCA 3B48A 5HQ3B 2Q5JA 3EIOA 4QJ5A 4UD6A 1GQQA 4YHBA 5EAIA 5KAPA 3TQOA 1J0AA 5GOTA 4C06A 2JJYA 4M89A 4JJFA 3V46A 3HJAA 1I2CA 4QEKA 3LBYA 2SNIE 5A9TA 3VNRA 3W3AA 4XGRA 3ZQJA 2XPCA 3C14C 1K0FA 2OB1A 2CMKA 4D4JA 1CY6A 4UBJA 3I01M 2NO1A 2RMKA 3FHTA 2R97A 1WMDA 1SCKA 2OLJA 3IYLW 1E79D 2IF2A 3GCZA 5E4FA 1U98A 5C1PA 2CVFA 5G40A 5KDOA 4JLOA 4KWIA 3CM0A 4C0HA 3UBMA 2H4FA 1Q21A 4ZI7B 4Q0MA 3T0GA 4LC1A 1VLJA 2NO6A 5CA0B 2YIDA 4RF3A 3THWA 3LXRA 4G65A 4KUGA 1EX9A 1ADJA 1ODIA 1FNSA 2CJWA 3V8QA 3ZKWB 4Y7CA 1H0KA 3A32A 4A8JC 3N3AC 3OM9A 1ZONA 4M0LA 1GG2A 1MVOA 1OZ0A 4FI3C 4L16A 4QDTA 4F9EA 2ZJYA 4JB8A 4A2CA 4BTLA 1TRHA 3AXSA 4Q7JB 4EHLA 4G0PA 2FUG6 3RAEC 5JJLA 3BD8A 3LM8A 3LQQA 5CVVA 2OZKA 4MB6A 4PLHA 3X1WA 2VTBA 1OA1A 1N57A 1P77A 4Q3EA 2CV1A 3SHTA 3QPVA 3AHCA 1KYTA 2JGEA 5CLHA 3K2EA 4PHCA 3GJQA 3W5DA 2YVLA 3O2QB 1PEKE 4CDMA 1GL7A 1PJ2A 1VJDA 3EXFA 3MWDA 3BWDD 4GOOD 4Y2XA 3TUJC 3OMXA 3CNHA 1IQ0A 3SQLA 1L7MA 3U17A 4ZYZA 1BEZA 3R7WA 1FF9A 2RD2A 3LDFA 1I6WA 1ZD5A 5LP6C 3SDSA 3FF4A 3GUCA 3AR6A 1UK9A 5DXJA 4D9EA 1II0A 2PUFA 2BAGA 4D79A 4CU2A 1DRJA 1G1AA 4PO1A 5D3MB 3R1IA 3VSEA 2PUEA 5LSAA 5FV4A 2QZZA 5IW8A 2Q5EA 2MYUA 2W6ZA 2XMPA 5EWJB 3UN1A 5AOVA 5FPSA 4BE9A 4WBNB 3SC6A 4R2LA 2FJ0A 1T8UA 4F93B 3ONWA 3CR8A 4YI3A 1GVHA 1ZOLA 1DTWB 3QVSA 2MDTA 4YNBA 2EQBA 4OOFA 1Q5PA 4ZCTA 4KHZA 2EVWX 4CL2A 2JI4A 4JYPA 5TS2A 3ZU3A 5MFPA 4Q7EA 3ZUGA 3ZWNA 4DPKA 3VJRA 2BTOA 4XB1A 2QTZA 1VHJA 2PAFA 1EX6A 2TRSB 4DRXA 1F5NA 1KYYA 1SZDA 2Y4NA 2QQ5A 3OX1A 1ULBA 4J90A 3LY8A 3D1JA 3GEGA 4R1QA 2VA9A 4ARZB 4URZR 1E3JA 2YWRA 3HSYA 2UZ0A 3ICVA 4O8ZA 2X9VA 2Q0QA 4AS3A 5TQ0B 4CM4A 2B3TA 1CP3A 2OWEA 3BF7A 1CHDA 4QVGA 3I2IA 5DM60 4RTQA 4HDMB 5BYAA 1IRXA 3PC6A 2ZQ5A 1NQWA 3E3OA 4WKBA 4AN0A 1V47A 1PDVA 4U0KA 4F60A 4W6QA 4TKVB 3LE8A 2XE4A 2KYRA 1Z0KA 2YJ6A 1U90A 3HDQA 3LCRA 5EKXA 2MIIA 4ZA2A 4JAVC 3TLMA 5BO5A 4IHJF 3U7JA 2XA2A 3TTTA 5JNUA 5CGZA 1T2EA 4MLDA 3S2UA 4CT4B 2E4UA 2VQEB 4FBMA 3TVTA 1WR8A 4REMA 5GOZA 3GR6A 1FYDA 4QGHA 1C9EA 2AI3A 4E6PA 4GYYA 3G9QA 4PPFA 2P69A 4ARVA 5JR3A 1AKQA 1RZVA 3IUYA 5DN9A 2R4QA 4RTMA 1E2HA 2OM2A 3DBHB 3NIWA 4O33A 1G3RA 5FRDA 4NKRA 5DHTA 3WKEA 4A6EA 1XLTA 1HLPA 2LTAA 2JRLA 4W9RA 5TPZD 1CJKC 1R6XA 4Z7NB 2P35A 3B1KA 2FPMA 3NTQA 3PFCA 1KZ6A 4MZXA 5L3RA 1J99A 1XZKA 1USGA 2RGUA 3D5QA 1QYRA 4NQRA 3CB4A 3RVQA 1FDTA 1MB3A 1VPDA 1I7SB 1T8SA 3EUAA 4B84A 2R6AA 1BXKA 4BO3A 2WKQA 4TN5A 2PRZA 4DSAA 4Q66C 3S6JA 4BKRA 3LLSA 1NASA 4OMFG 3G9XA 5H9WA 4FE7A 1NVEA 5LU8A 3VFDA 2J33A 4ICIA 4MW7A 5CNIA 2PXHA 3HDHA 4QDKA 3R0VA 5CLIA 1P9NA 5K3CA 5KDLA 3V4OA 2X0NA 4ZRDA 4I55F 4U0JA 5J2TA 1W88A 1WCXA 4UE3S 3AG6A 4F3NA 1ULTA 2O1EA 2QT9A 3HB5X 1TMOA 3OEYA 5FTWA 4HR7A 3UMGA 4MI1A 2UXDB 1FDRA 2NUPA 2PL3A 2I55A 4GI1A 1DXQA 5AVZA 5FJIA 4RBNA 2BP7A 5IYZF 1JE0A 1IN6A 4HVTA 3TM5A 2H2GA 1LNQA 2Z43A 2V5UA 2JFUA 3LCVB 4LNHA 4LVNA 1QGOA 4GG1A 2G1KA 2HREA 2R3SA 2DBRA 3FCOA 2GWRA 1CZUA 1ZN8A 3DDOA 3KKZA 4H15A 4HNRA 4LBWA 1L7RA 3RI3A 1CEXA 1V5WA 1Z2PX 3GARA 1EBUA 1O9HA 5LOVA 4YCNA 5CIQA 1HE8B 1JMVA 1NPYA 1OZAA 3PGKA 4WRRA 3W8FA 4NABA 3E6AA 4ZFNA 1EFRA 2WD7A 4LI3X 4UHFA 4KE8A 4FSXA 1R5BA 1JG2A 4FHDA 3CWQA 4EKIA 1PBTA 2ZSUA 4WESB 4C7MA 4QUDA 4WK0B 5BWNA 2RAUA 4FR5A 2GEJA 4CL3A 4MTCA 3R7FA 4E5VA 4X41A 2OVFA 1I1NA 4LOJA 3N59A 2IU3A 2I1LA 3QXJA 4UCQA 521PA 4MWZA 1H1DA 4KIGA 2FYTA 2I7VA 1IK4A 3F74A 1NE2A 4ARCA 1FA9A 4LA4A 3UO8B 1DUSA 1C0KA 3OETA 3P9SA 4NBVA 2C2XA 1C9MA 3CTPA 5GM1A 4U7HA 5A4MS 2YNMC 2C5SA 4MR9A 5JO9A 4YJ2B 1LD3A 1ZNWA 2D00A 1QYWA 2P5TB 3PFHA 4Q4JA 1SZPA 4OEHA 4ARSA 2AVNA 3VPDA 3WLTA 4EQ6B 4EJMA 4F86A 1NUTA 4MV0A 5T4HA 2R1TA 3ANXA 3W6OA 1CRQA 2AL7A 2O3RA 1THMA 4G41A 4A8JA 1N5JA 1N9GA 1Z6ZA 3E4CA 3PJDA 2GPWA 4EA7A 1NMSA 4M7OA 3HV0A 2ONJA 2JLQA 3VVMA 4FSDA 4EJ0A 4UJ5A 1PGJA 1HDRA 1N0WA 1JDPA 3HDJA 4C2AA 3OP4A 3WTBA 1R2QA 3VJLA 4BBZA 3R3ZA 5C80A 1BE6A 3CN9A 3GVXA 3MMXA 1ZIPA 3H1TA 4M2LA 3RSCA 2R7LA 3VGPA 2XDYA 4AZ0B 1MHPA 1QMPA 1N2SA 2QY9A 421PA 1K66A 1SXJC 4KGZA 5KX5B 1IWBB 4EI9A 1S4MA 4IFEA 1P0PA 2Y67A 1VPTA 3T3PB 3OUUA 1RJ9A 2A33A 2GOYA 2ZRPA 4S2UA 2REQB 4IIJA 4BRWA 4TV9A 1PFGA 5AW4A 1VP9A 2PKQP 2W8BA 1E18A 3GLGE 4WD3A 5FT9A 5LP6A 1RQNA 4KFSA 1XZHA 1TQ8A 2AHRA 2P75A 2B1RA 1AK2A 3EVCA 3EWNA 3H1PA 3NNDA 4QXRA 4DRYA 4A2PA 3R5HA 3VAYA 1V7QA 5THXA 4EUKA 5ALYA 1ECGA 2M6SA 2ONKA 2XQVA 4J43A 3TPCA 3U81A 3EFEA 3GCGA 3H4MA 3L7JA 3N1UA 5J43A 4BRUA 1M2VB 2HK8A 2VCHA 3CIOA 1OXBB 1A9ZA 2JIPA 4PYMA 2A0UA 2QXYA 4HD8A 3JWEA 2A7XA 3C16C 3BULA 3K8ZA 4L4UA 3MINB 1CF4A 3CXUA 5E7MA 3IP6A 2D0DA 3P5BA 4XWTA 2P3SA 4J1QA 3LSTA 4H3SA 2I2BA 1JTFA 2GT1A 1PZEA 4HS9A 2VDUE 4EABA 3H9UA 4YP7A 1WDMA 4UDXX 1PW5A 4WNCA 2ZUCA 3V4VB 3WZ2A 1BOFA 1Y5LA 1WXIA 4HEJA 4Z9AA 3TKAA 4MGEA 4DIDA 3RC7A 1RT9A 5COAA 1CRPA 3I6QA 3SEQA 1ZXBA 3CPJB 3FOAA 5E9WA 5LA6B 1W73A 1PZGA 4TUYA 3TRIA 4J9UE 4BXOB 3FUCA 4Z4EA 3O9VA 3GAMA 3HYLA 5L3SB 1E8DA 1ULAA 2FR8C 4OHZA 4YRGA 3IEIA 1GO2A 1X7XA 3TOXA 2G76A 4PYNA 3RAPR 1AGXA 4HGYA 5KVSA 5A4KA 4HTFA 3IVCA 2IY9A 2C4TA 3MOGA 4X90A 4EYQA 1XF1A 5B3JC 1G4UR 4FINA 5DP2A 2PJUA 2EAUA 5F78A 1TE2A 2FG5A 2GRUA 3C3AA 3I0NA 2DECA 3OCZA 5FYQA 3W77A 4JKOA 4URWR 3P0JA 2K4MA 3ZVRA 4N0PA 2ZJ4A 3H16A 1YZGA 3L7CA 3CA8A 1W52X 2OZEA 3KR1A 1KEUA 4N7BA 4C0WA 1ZK3A 3L7NA 4EY6A 3DP7A 3RTAA 3I1JA 3REQB 3IT1A 2HYDA 1QTQA 3H19A 4MPTA 5FYDA 3UJ8A 1T34A 1ZRNA 3AUFA 4XPIB 5KI6A 1NJGA 3U7GA 3KQOA 5DSXA 2FX2A 2WF7A 3ADKA 3CH7A 3IPCA 4RLSA 3SAJA 4DFDA 2Q0XA 3IPYA 4E33A 3MPUA 4UHCA 2BLNA 2JJMA 1X7WB 4A16A 3CLTC 3HWX1 3Q11A 3AL3A 4MROA 1QIKA 4PRYA 1QIGA 1NW4A 4LE1A 2BPOA 5AKLA 1CEEA 2H57A 2G36A 4G8CA 4NLLA 1E5DA 3W8RA 4H18A 3NV9A 4ZI7F 1SHJA 5ADHA 1D9XA 1F2TA 1LLUA 2OPHA 5D1NA 5H82A 2J85A 1MX5A 3OG9A 4MYTA 3S27A 5K4GA 3BZWA 3DLTA 4OLHA 3K20A 2V0CA 3AVPA 4YGXB 1TCBA 7REQA 1DCMA 5JRDS 1GRNA 2ZIEA 1CQIA 4Y0VA 5DWDA 4E7PA 1NWCA 5LZ5A 2QRLA 2PYZA 2WFMA 1VE9A 1C2YA 2R00C 1KJQA 3CLVA 1YCGA 2R8BA 2ZAOA 5DKFA 5DDIP 5AWFC 3WGKA 2VLBA 1QLWA 3RUFA 2BKAA 3VR0A 4JUIA 2C57A 1AKNA 5M2QA 1H5UA 1BXGB 2ZTVA 3NHLA 3MERA 4PC2A 4R7TA 1EP9A 5BSGA 1FSSA 1MN6A 2G0TA 3P94A 1KHHA 2A5LA 3C7TA 3PFKA 1L7BA 3FOCA 4DY4A 4K9OA 3NNNA 3K6KA 4RVFA 1N0IA 2JAHA 4TWRA 1V25A 2BFFA 4F1KA 2Z1MA 3I04A 4N9QA 3MT0A 1DC7A 3JD0A 5TGTA 2OQRA 3W9BA 3PTZA 1WBJB 2O4CA 4FKBA 4PX3A 5ALVA 1H2YA 2Y1GA 3SC2A 3TTVA 2F1RA 3O90A 1PJ8A 2V5AA 5ALDA 3TX6A 1QTRA 4G23A 4B45A 1LI5A 6ADHA 2UAGA 1O97C 3THWB 5FPQA 4LV5B 4RTRA 1CUJA 4I6GA 2QX6A 3CV3A 1XAIA 3IHTA 4ZKDA 5K3DA 3LRTA 4Q7LA 4ZDJA 2AOUA 2IEYA 3DE4X 1V2GA 2OBYA 2LVBA 3ONEA 1GQFA 1OA0A 1C9YA 2J59A 1ST2A 1P1CA 3H1BA 3ZY5A 1XTQA 4C04A 5TJHA 4L2IB 3I9V1 4B3TB 1E2LA 2OCDA 4ZAXA 5JSYA 5LYJA 1C1YA 1NRXA 4AY3A 2CD7A 1J1UA 2PO5A 2X8BA 4L9WA 1FMFA 1QVRA 2YNMA 1YQTA 3N2IA 1RACA 2H5EA 2PMKA 5AVQA 3C97A 4HX5A 4EB0A 3R7WB 5HUHA 4EKGA 4EGCB 3H2JA 2W0SA 1EBBA 3QOYA 4RA9B 1RPNA 3T1QA 3GGOA 3UQZA 5H4GA 2P5YA 3QFFA 1UDCA 2WHPA 4FD3A 3K1AA 4I8DA 5MN5A 3ESYA 1NC3A 2H65A 4Z9YA 3ZQ4A 4OPMA 1DFHA 2WF8A 4UJ3A 1YZVA 2G09A 2IZ1A 3TXXA 4PE5B 3BXHA 2YS6A 5FOSA 3T61A 4NG5A 4GPD1 4V1CI 2DQKA 4JLJA 1E96A 5I7OA 2NZ2A 5F9MA 1JHVA 1TKAA 3K0SA 4MVJH 1C8BA 1RRVA 1SQ0A 3FA2A 1X1RA 3L0CA 1SXJA 1EQAA 2I6TA 3VM6A 4QT4A 1QQTA 4F3CA 2ZUFA 1VMIA 4Y6SA 4DRXB 4EB6A 3AUYA 5BT9A 3TDKA 1T0JB 1XEWY 1B0PA 4HXEB 3UKOA 3WWOA 3U39A 4B3CA 4C5AA 4GOXA 3V4RA 1DAOA 2AYYA 1ENOA 3GMIA 4AMYA 3OBIA 3HJRA 1EINA 1LDEA 1PZMA 3EUFA 3OD1A 2WG2A 5JFTA 1EXMA 3OX2A 4H17A 1B26A 1SQSA 2IYXA 3AOGA 3G89A 3HJGA 5IUNC 5T57A 5TQJA 4CM4B 4CNBA 4YQYA 5EIOA 2NVBA 4ZODA 4CFYA 4DSOA 2PD3A 2LDXA 1J0BA 2PH3A 5ALRA 2WQ6A 3A1WA 3GLFB 5EUQB 3NCTA 4UULA 2E5LB 4U2CA 4CQLB 4TTSA 1UZMA 1II8A 3K2QA 1T24A 1A7AA 1M5TA 2UYOA 1JLHA 5FPPA 5HKLA 1L5ZA 3BCHA 1X1BA 4Q9JA 2P1RA 3MCUA 4M55A 2B4KA 4TMFA 4OHRA 4RD2A 5BW4A 2ZIUB 1HY3A 2OAP1 3F6RA 4CT5A 2XH8A 3KYIB 5AHOA 3HXOA 5IBRA 2C9OA 1S7GA 1XRQA 3LVBA 5EZSA 2IOHA 2QMZA 4DUPA 4NZPA 2Y0DA 1G21E 2BM1A 3ETJA 3FB1A 5B30A 5IJ0B 2FR8A 1XK6A 3ZGVA 4HN9A 1L7AA 2QORA 1V7ZA 2V98A 4DSNA 3D4NA 2B82A 2OSVA 3NT4A 4W8GA 2IXEA 4B5LA 2JARA 1CQJB 1NT4A 3GG9A 3BJMA 5B3JA 3ZK8A 1AQUA 3FNGA 2D8MA 3VDXA 1FNDA 3EBOA 1Y9EA 5IT9A 4FUQA 3W3AD 4B17A 2B78A 3G6KA 3N2GB 2BKXA 2QROA 2PS9A 1DAFA 4R1SA 5JXIA 1EDOA 1MD9A 1Y3DE 2VNHA 3SJZA 4BJHB 2HJGA 3AI1A 4E11A 6PFKA 4N5DA 4CRWB 2V5VA 5J5CA 3CX7A 3W9YA 1NN1A 1T2DA 2B8EA 1XJCA 1EG7A 2X8AA 4TQ9A 3TTWA 3EODA 1NXXA 4H35A 5GJCA 4B3XA 2HGSA 1UXGA 3EEYA 1XROA 3I2HA 3UMJA 2J32A 3QNMA 4QG7A 2WU3A 3O4VA 4UDNA 4QG3A 2HJHA 2C9CA 5BMVF 2M6KA 5SY4A 4CZ2A 3ESZA 1AHIA 4WLFA 3SXUA 2QTGA 1OF1A 1JL3A 2GAJA 2DLDA 1BYIA 1NPTO 3A6EA 3NTRA 2V4ZA 5LNK6 4H60A 4N0MA 5ESXA 2WEKA 3S3TA 2EEZA 4RS3A 1XKXA 4ZVRA 1IXRC 5KWVA 3BE8A 4HDRA 2CV0A 3NFRA 1FFWA 4IXDA 4DL9A 4RL6A 4OFBA 1N2ZA 4J2HA 1E6MA 3ZLBA 1AC5A 3QXCA 2X6QA 1GKKA 3MWGA 4WGGA 5EE9A 3HYCA 5A9SA 1YQDA 3ZXYA 1TD9A 3EQ2A 4LZLA 2AN5A 2HQOA 4Q3BA 4BMVA 4ESHA 2WINI 1FJXA 1CEYA 4V0RA 4I19A 1CE8A 2JFHA 1XEXA 2R00A 3UW3A 4XARA 4UQPA 5IWCA 4AM8A 2WBLC 2UZ1A 3MFYA 4L6CA 1YB5A 4D3XA 4KRXA 3SS9X 1KEEA 1ULHA 3F5SA 2BMJA 2BL4A 2IKSA 3QYAA 3L1HA 4J7AA 1RWKA 3BFKA 2IHYA 4MV4A 5EP2A 5HIIA 5K8UA 1G7CA 1C3XA 2SKCA 3FFTA 3HCWA 1QHSA 1XZFA 2MT9A 4KLZA 4K9NA 1BX1A 3RSOA 4R83A 1K8RA 4XZ3A 4ETIA 1E6EA 4B3MB 3HO1A 3VC2A 4QUAA 1Q1QA 4DXHA 2P91A 3I32A 3PEFA 2QLTA 2XKJE 3MJFA 1TEHA 5I7UA 2NSYA 4EMBA 3TVYA 4L6AA 5DEOA 4PVDA 1RD4A 3ZE0B 4RJ2A 7YASA 1PNTA 3WA7A 3M89A 2NM0A 3CY6A 1QH1A 3ZWXA 3KZNA 3WYNA 4UBKA 1RAHA 2RGDA 2ODEA 3NHRA 1E0AA 3B12A 3PPWA 2R1TB 4ILEA 3IEVA 4LHZA 4A8JB 3ZW9A 3N05A 4PZCA 1U2SA 1OWOA 4HPJB 5C5DA 2ZBVA 2GPYA 1Y7PA 2H1WA 4NPCA 5LC1A 3ECSA 4BLRA 2HCRA 3HDTA 3I45A 4KJZA 1QE3A 2WAAA 3IR5A 1Y7TA 1KVQA 3PGMA 5H16A 1N2HA 3QXSA 1XNRB 4L7VA 1A3CA 2JGDB 1ZICA 3NG1A 3U1TA 1E2BA 4OMUA 5BPFA 4MWOA 1E99A 4RZXA 3O26A 2F1OA 1RJ9B 1M72A 2ID7A 3PXDA 2ZTUA 1H93A 1KEKA 2EHDA 3T7AA 3NWPA 2WU1A 3PDUA 4C4YA 2YOHA 4K3UA 4B85A 5LP6B 1LQ2A 3D43A 1ARZA 2Q6VA 3OZSA 4MRVA 2H52A 5KSPA 5K1ZA 3RS7A 5BOSB 4X44A 2DHCA 3GWGA 1NW3A 3WGNA 2WIJA 3Q2IA 3MYRA 4Q1FA 1UXKA 5DNEA 2AW5A 1ZCAA 2YJZA 1NW6A 1XR3A 5B55A 4IDPA 4OHPA 1GPAA 2YHBA 1TQ4A 3JQGA 1YJQA 3KSBC 1TKBA 4RK6A 4KPYA 3HK2A 5DN6A 3TTSA 3SICE 4YAUA 2BM0A 3NAQA 1LH0A 2D5BA 1B42A 2WV9A 4PRLA 4LSMA 4AX4A 2IP1A 4KWEA 5B4UA 3DFUA 2RKWA 2CLFB 3GRRA 2BFOA 5IAAA 3LDGA 4EZIA 3PA8A 4E30A 3OSUA 1HFEL 1M5RA 3PNBA 4EYKA 5AJYA 1P2UA 4FONA 3PE6A 3V5NA 2PLFA 1E8MA 1MX3A 2JJ1A 1V5GA 1JNXX 3FDJA 4JSTA 3ROXA 2ZCVA 5E95A 4BWYA 2OMKA 3LQ1A 4IDGA 3BTOA 3RG8A 4JUDX 1I9CA 4GP9A 1VL8A 1ZNYA 3L8GA 5LFAA 4DQUA 1TF2A 3D6MA 2LBPA 5CVUA 4C1BA 3SX0A 4DTCA 2BYTA 1O95C 1R4MB 5CA0F 4ZZ3A 1X86B 4N0QA 5BYBA 1RJWA 1UJNA 4D46A 1AGNA 2XF8A 4PSDA 2Z8XA 4HTFB 5DM1A 3WGVA 1D6JA 1XPOA 2J5RA 3VNSA 1YVEI 2RK6A 4LMBA 1Z2EA 5CJPA 1MZPA 1KRXA 5I01A 3M6VA 3NIFB 1OASA 2HA5A 3LCCA 1ZMOA 2FDXA 3ED1A 1ZLYA 4C0BA 3NJ4A 5DHQA 1XMSA 1GTVA 1V8FA 3CTMA 2I6QA 2AT1A 3KOOA 3DWFA 1P2FA 4WFQA 1SD1A 3KCQA 4OQYA 3IQDB 1J6UA 4HDNB 3ZCPA 2WZQA 3DQZA 5EUMA 2VJOA 3W5BA 3B38A 1CNFA 1V16A 2YH2A 1CJCA 1TVCA 2QJOA 1SBYA 4P4GA 4XGNA 1FDUA 3IE0A 3QXXA 4F9FA 4P0QB 1U04A 1EFRD 3QLJA 4H1TA 4D2IA 5JCJA 5EJAA 1NPDA 1VP3A 2QXUA 3HU1A 3K0FA 2OYCA 3IURA 5KVCA 1QP0A 2X1VA 2X6TA 4FW9A 3TB6A 3JD2A 4MVCA 3ZIDA 2DFTA 4LS3A 5KS2A 5AM2A 3O1LA 2OD9A 4YP5A 2BEVA 4EJ6A 4KITB 5E2BA 1MB2A 1L4KA 1GFZA 3DKKA 4E5YA 2QRNA 1BTOA 2W6JA 4BUZA 1GFWA 4P93A 1PO7A 5CJJA 1KFKB 2ZJ0A 4DQVA 4WBNF 7REQB 4XR9A 4R7GA 5JSKA 3HZRA 3UWSA 1G5QA 2VZEA 3MNFA 4BGDA 1H2EA 1AK1A 3LQYA 2HHLA 4ND6A 5B1YA 2OKGA 1C7FA 1W2HA 3B6IA 3REFA 3O03A 3S8YA 2PGAA 2VSNA 4WZ6A 5DX1A 4J94A 1SBNE 1J06A 3HPQA 4M76B 3TD2A 2OZVA 2X0RA 2V55B 3D81A 1PT9A 1VL1A 4L5JA 3JAWA 4RPJA 3U9LA 1WQ4A 1DKPA 3WYFA 3M2TA 1ILWA 4RHCA 4KYUA 4OHCA 3LTEA 1J4AA 1FTGA 5D3ZA 5JW6A 4G25A 4BECA 2IH5A 4IP0A 3HH8A 4ZMSA 2W8ZA 2NSDA 3K96A 3IHLA 4LRUA 1CYEA 1Y5MA 1FXUA 3UEOA 2V7UA 1EGAA 2QM0A 2B3DA 4A1FA 3FSGA 2VH2A 4NY1A 1UQTA 1L1FA 4AKEA 5KO2A 1UC5B 4JR1A 2QBYB 3OA2A 2I6FA 2Z6AA 3ANTA 4OJNA 2ZS8A 1P1JA 3UATA 4IZIA 1UIMA 2EGHA 4N49A 1JLLA 1HYGA 2BW0A 2ICAA 3M1IA 4RNDB 3V7YA 2ZE6A 1DIBA 1A9XA 3BWCA 4DMHA 1P29A 4LZWA 2DE0X 2J4FA 2O0LA 3TMAA 1XXHA 1L7EA 4LZOA 4ZDWA 3SJUA 1NMXA 1PUXA 4AC9A 1Q7CA 1OPRA 5EHZA 1G3MA 5DHAA 2VF5X 2X9GA 4W63A 5LYJB 5MDHA 1RFGE 2E5FA 4GVLA 4NBLA 4XX0A 3RSLA 2HAEA 4I5FA 2E6KA 2A0WA 4GE3A 1XMIA 4NJOA 3WLOA 4BFSA 4ZANA 2EF1A 1SC1A 2QE7A 3LIPA 4MB0A 1DXHA 2X77A 1MORA 4QOGA 4Q4CA 2PJZA 1JH9A 1G41A 4KMOA 1UK6A 1XZNA 4GGMX 2O7QA 4HNHA 4RE5A 2B6NA 3TPZA 3WIDA 2WHPB 2VHCA 5ABPA 1T9BA 4M38A 4BLQA 1F2DA 5LN1A 1W30A 3STVA 3RVNA 3DGEC 3UICA 2FQQA 1R5JA 1QDLB 3FJOA 2G28A 3PQ2A 4ZVMA 4MVWA 3V1NA 3ZVLA 4EHKA 2HC9A 1NI4A 1OXSC 2ZYSA 4QO7A 2XGJA 4NIMA 2UXCB 2JFQA 3FTPA 3EW9A 3TF5A 1QUEA 4J2OA 3BMOA 1GGVA 2BFDA 4US1R 1JDZA 5ECDA 2IRWA 2ZOSA 1A9QA 3JQ8A 4TGLA 3BF8A 1MC4A 3CF2A 1MA3A 3QU4A 2PV7A 3FH0A 4MS3B 5JV5A 1C14A 4P7BA 1O7JA 5CYPA 1NN5A 4EB6B 6LDHA 2H18A 3AY0A 1KO8A 3ZU4A 2H4HA 3W05A 2OCBA 1AQNA 3HCAA 1FMJA 1SKQA 2WE7A 5FP0A 2NTYC 5DYTA 5DNUA 1WABA 4IEEA 4KOAA 5EFZA 2IDZA 1I0IA 2CNBA 2I2DA 1D1TA 1YD7A 1AOXA 1TFUA 3CQ9A 4I6JA 3OT5A 4RQAA 3IUPA 3MK31 1W5EA 4M8LA 4JOCA 5BSTA 3UT0A 4D02A 4UVDA 2RBKA 3WGZA 1X38A 2QUJA 1I5OA 1E2KA 1PX0A 1AURA 2PZ8A 5BSUA 1GG9A 3AR5A 4PAWA 3FWZA 4I4CA 1L4BA 2AN4A 4PFKA 3LQ4A 1RCFA 1O54A 1II8B 2GZ3A 2ZJZA 3DC7A 1Z2OX 4X95A 4GBGA 4XYMA 3DFKA 4C5BA 4PS0A 3JWPA 2XCLA 3IQZA 4LSWA 4GO1A 3OIFA 5E0KB 2CGEA 1WP4A 3A1FA 5DTRA 4D81A 3QX9A 1TI7A 1NSFA 2BSAA 3LL7A 5KSWB 4N3NA 1T15A 3VKHA 3K0AB 4ZAVA 1Y37A 4Y1EA 4MR8A 5LIRA 3RRFA 1V37A 2D3TA 2IHTA 3RC2A 2B1QA 4GRDA 4F46A 3JPWA 3IAAA 5H3HA 4YJ2F 3GB9A 3ASZA 1O95A 2OHHA 3ESXA 1RJGA 2FEWB 4PGMA 5AOAA 1W4CA 4KTVE 5GPBA 5CLFA 3KJHA 3NC0C 3DCNA 4MS4A 1Z5PA 3F46A 2Q41A 1PJQA 3GEMA 3MM4A 4QDUA 3VC1A 1OWPA 1QFXA 4M1SA 1LTQA 3ADPA 2W6IA 4DLUA 2P67A 3PKJA 3AL0C 2RHCA 3SIWA 1Z2NX 2W43A 5SYAA 4MCJA 4PSVA 3OEHA 4ZGGA 4BBAA 1BE0A 1BWPA 1CUGA 1CY7A 1DAPA 1LCIA 1HE4A 1Z4QA 3DBLA 3QVUA 3ENWA 2VXYA 5AM4A 5JZOA 4F12A 3GLKA 5AVXA 3K8YA 4WPGA 3PDIB 4IGKA 3P4XA 2QNIA 3RIGA 3MQ4A 4JVLA 4RV5A 1OLUA 1H1LA 2J4CA 4P4LA 5A4DA 4GOMD 4GRIA 3O3CA 2ATIA 5K8JB 3BJZA 1PQ4A 1Y5RA 4Y1GA 3D1LA 1X8XA 2VAPA 1VBMA 3O8RA 2ZB4A 3UAGA 3ROFA 2FSFA 1YBHA 1RQRA 5HFNA 2QMUA 5DNYB 1HG0A 4CMAA 3ZE2B 2TMKA 3HWWA 2X3FA 4S1OA 4R1LA 1F1BA 3TD9A 1H2XA 4QECA 3W6PA 2CLKB 4DJDC 4HI0E 1SXHA 3E9YA 2H9AA 4RKFA 4S24A 1IHDA 1GNLA 3HHPA 3HCFA 3KKNA 5JI2E 3E3AA 1SD2A 1OX6A 1Q20A 3GWZA 3QPCA 3GP5A 4CKWA 4ZOCA 5H83A 2YNMD 3ILYA 3F6SA 3R41A 5HZGA 5KOJA 4JI5B 1KOGA 1IZ9A 4XGQA 1YU6A 2J9FA 3PQ5A 1JW9B 4URHA 4D0NA 1CS0A 3P9CA 4EO4A 4X8LA 4BGUA 4G0NA 3IDZA 3DW3X 1RE0A 1M6WA 3PXXA 4ZT7A 2FMTA 4AXBA 1LPPA 1M6YA 1G98A 2H29A 3WZMA 4KXYA 5TLSA 2WJ3A 3DONA 3EFOA 2CNDA 3KE8A 3CEPB 5JH7F 5LA6F 5F2NA 1HFWA 1AM4D 2ZS9A 4FFOA 3NUZA 3OD5A 1GGJA 2BEWB 4Q9DA 3BH6A 3P97A 1A04A 5E4TA 3FOWA 4DUZB 3KDPA 3Q0IA 3BKXA 2C7PA 1T8RA 2IYNA 2RONA 3OIWA 3RTBA 3R77A 1R5OA 2YRWA 1C4OA 4KQ6A 4I66A 1MJ5A 4NULA 3H4TA 4F4JA 1P1FA 2P6UA 3CRMA 3GK3A 4Z5XA 1A4IA 1SXJD 3LYLA 3HVJA 4UMVA 1QH1B 1FMLA 3NDJA 1I7LA 2PWYA 4JEUA 5DGHA 3ZJTA 4RA6B 4C3UA 3BPSA 2Z3WA 1Y8ZA 3LUAA 4MTLA 1YC2A 1UMCB 3G13A 1ND5A 2PTHA 1UMBB 1TW2A 4JT8A 1Q95A 2IV2X 3N2ZB 3OZCA 4YV0A 3DUFB 3MYYA 1VDMA 2FN9A 1QTNA 3WK6A 2A6PA 2PGXA 3AL2A 1ISJA 1K8ZB 2AK2A 4KBGA 4X7RA 4D7AA 5TQVA 2GPJA 2WV7A 1XT6A 4HNAB 4U9HS 5KQRA 2J9RA 1J00A 3NAGA 3W3AH 2FWBA 1BMDA 2R2AA 5JISA 4N4AA 2DBQA 1KBZA 3HKBA 4KI0A 3LBNA 2GCOA 5FUBA 3GP3A 1GDHA 2IEGA 3AFOA 3ANSA 4HPWA 4PLYA 1TZKA 4D9KA 3GDHA 1CS4C 2GTPA 3PFGA 4JBLA 4IWXA 1Q1NA 1BXRA 1SOMA 2PMFA 3O74A 1Z9BA 1WLSA 3QI7A 3E3NA 4IW3B 4QREA 5B1IA 4E22A 3ICQB 5SYNA 1K88A 3KU4A 2FPIA 1Z45A 1U28C 2YWBA 5L3ZA 2D2XA 2OVBA 3HA2A 3JYNA 2O4UX 2IP2A 2CLDX 2IU0A 3F1LA 3PR3A 4D42A 1SR8A 2BFBA 4UKDA 4MGYR 3RBZA 4CM9A 5A5DA 4N3BA 1H94A 1XOIA 2ATCA 5TMEA 5JSFA 1I2BA 2PX2A 2PZLA 3MGBA 1V8BA 3G02A 2RG7A 4ND2A 5KVVA 4X91A 4RJIA 3MT8A 5FD8A 3GGSA 1JIVA 4LVOA 5L3VA 3ZUPA 3OJ0A 4DNXA 4INOA 4F5EA 3THXA 1TC2A 3K2IA 2XODA 1EE1A 1DELA 3ZX4A 4MHOA 2GK3A 4ZJYA 2G5CA 1M1YA 1ZGBA 2HRCA 4FFMA 1UF9A 2OBMA 3KVVA 1R0YA 3D8UA 4QWWA 4AF7A 1K68A 3D6TB 3QH4A 4IY1A 4HQFA 1QHHA 4L6IA 3SZLA 4C4ZA 4F38A 1QGZA 2WA1A 3QKUA 5HTKA 1Z29A 4RGYA 4RXTA 4XA8A 3E48A 1H3NA 2G9UA 1EB9A 1V43A 3H9JA 2QMEA 5TV2A 1Y81A 3K1YA 5ITVA 2OP1A 2AD1A 3EGXA 1QLJA 1AS0A 5AM0A 3ZV5A 3PEWA 1AQJA 5LQAA 1JHQA 2CFCA 3CLTD 1FXWA 2C42A 2ZYDA 3KKOA 5TC4A 2GPTA 1N92A 1SRQA 3L7BA 3D9QX 2X0IA 4EEKA 3GDGA 1HTBA 2M1XA 4URVR 1XRRA 2G5PA 5DLEA 3L0SA 4OHWA 3PJRA 1Q0UA 1LWNA 5I9IA 4KU4A 5SYMA 2VHWA 2XLCA 3D2LA 1VSVA 2QX8A 3FVTA 3IOMA 5H59A 2PSSA 2Q3HA 4HMOA 5CCXA 4BQSA 1DOAA 2W48A 3MAAC 1AF4A 1VKHA 3OQPA 4AWBA 3W8NA 5AMXA 1LV8A 1T13A 1BW9A 4FX2A 1ADCA 2WHYA 3A6LA 3QJYA 1Y9ZA 3DJYA 4NAVA 5I9NA 5LUAA 3S81A 2FEOA 1NX9A 1MDFA 1IPFA 2HLHA 3AB3A 1Z56C 1M7GA 5AM3A 1WXHA 2MHCA 1DJLA 4YP1A 1IUOA 1DBIA 1J49A 1E9AA 1RRGA 2ZRLA 1W85B 4KMSA 3RARA 4BKPA 3CHYA 4BOYA 1T6XA 1D2NA 2JCYA 1HFJA 3H6HA 2BEVB 3L6EA 3NATA 5ERXA 1ZI6A 3C1OA 3IAUA 3TIGA 4BVJA 4AQDA 3LQRA 4Q15A 1J2YA 1JQAA 4K6MA 2B8NA 4RHUA 1CVRA 3UNXA 2JCSA 2ZT7A 1XBTA 2QZJA 4G07A 3THOA 2EJCA 2R1VA 4X9XA 2HR1A 1FW6A 2GXAA 4GH5A 1FOEB 1Z26A 3CH6A 4D6PA 3HB7A 4RW0A 1YB4A 2PKQO 1SELA 3HTXA 3QBTA 3SBDA 5CA1A 1QVVA 1KXJA 1TM3E 1VIVA 1VHDA 4UHBA 4C4TA 1NZJA 3IAM1 1RI4A 4UBMA 5FH9A 3BWBA 1O97D 2I4NA 4I5IA 2O8DB 1G6HA 3ULKA 3I34X 1EXVA 2DGDA 3DBOB 1VA5A 4AJOA 5E1OA 3WQQA 4OHOA 1TTPB 1A2OA 1BWQA 1NJ8A 4D44A 4ZTZB 1T3GA 4Y18A 3ROTA 2XD9A 3MXTA 4MEJA 2DBZA 1OAOC 1FP6A 1P4RA 2A78A 4QXPA 5FR1A 4EAQA 1I80A 2INGX 4HJRA 1UOOA 1NBHA