2WOJA

Adp-alf4 complex of s. cerevisiae get3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
301
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPASE GET3
publication title The Structural Basis of Tail-Anchored Membrane Protein Recognition by Get3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 104
structure length 301
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wojA00
3QG5A 3CX6A 3P1JA 4V0NA 4HB0A 1EFRD 4Q1FA 1Z06A 4QG7A 3WNDA 4NKRA 3BH0A 3BORA 2FEOA 2ZUDA 3L0SA 4JVMA 3GLIB 2OESA 3RS0A 2YC4C 1E2EA 3R7WA 3V4FA 2XAUA 3GLFB 4BWYA 1OIWA 2WJYA 4RKEA 1G6HA 4OHXA 3SU8A 3VKWA 3TSZA 2A5FA 4ARZA 2PLFA 1CRPA 3WNBA 4JSYA 1OYWA 3O8DA 1FPMA 2A5GA 1HT2E 3IPXA 1G3MA 2ONJA 4CGZA 2GRJA 1W36C 3R9XA 3NBXX 2NTYC 1LY1A 1TNDA 4OHYA 4ABYA 3DM5A 1GG2A 4Q03A 1UEIA 1Q12A 3PCRB 2FGJA 2QM8A 4NCKA 4ZI2A 3PXGA 2ZYWX 1CXZA 4PTLA 1U9IC 1R5BA 1II0A 1ZM7A 5LB4A 3GJ5A 4DVGA 3N5CA 1G3QA 2XXAB 2ERXA 1GNQA 4G1UC 4LDJA 1GRRA 1X1SA 2N46A 1UBEA 1GKIA 4B48A 4V0ME 1X1RA 4R98A 5CYPA 3RS4A 3WRYC 1DAIA 3U44A 2W00A 3I32A 4JT2A 1PJRA 2J0SA 3DZ8A 3I8XA 4BLOA 1Z63A 1E9RA 1HA3A 3IEUA 4JYBA 3K0AB 4KODA 1O87A 3SYLA 1Q3HA 2WIAA 4EFNA 4Q9LA 4I1UA 5FFMA 621PA 4F91B 1DO0A 2ZROA 2W6JD 4CEJA 5J4KA 1AS3A 5E4FA 4HAUA 2ZS7A 2XZOA 4LBVA 1UBGA 2R8RA 5HPYB 5JECA 4IVRA 3B1XA 3FFBA 2BJVA 1KY3A 1U98A 3B60A 2ATXA 3BB3A 5A0FA 4JLOA 1EWRA 3RDPA 4G5RA 3SJBA 1G8YA 2C9CA 1N5LA 2FSIA 5J5CA 2KJQA 3RANA 5FTLA 1Q44A 5HE9A 1P9WA 4GPTA 3O47A 4QBIA 2HEIA 4LC0A 5FPHA 2ZRHA 5JBQA 2YV5A 3KTAA 1BYIA 3K0EA 3TRFA 2FF7A 4A1FA 1S1CA 4A2QA 2ZRJA 4URYR 1E94E 3RRMA 2HT1A 3EZ6A 1DEKA 1MO3A 1KY2A 5CJ2A 2IYUA 1RZ3A 4DLYA 2ZTSA 3U3MA 3H0KA 3PUWA 4BECA 3QF4A 1CIPA 1NMXA 4OHWA 1XX6A 1NLZA 4P4UA 3THXA 4BFYA 2FOLA 3AEZA 2NPIA 1DAEA 2JJ1A 2ZYUX 3QKSB 2QE7A 2Q3MA 3GJ6A 3LXXA 3DOEA 2IYZA 1IAQA 1IY1A 521PA 5K8TA 1JJVA 1OT3A 2QROA 5KNCA 2BBWA 3HU3A 2V6IA 4DCUA 5EJEA 3D8BA 1MABB 2V9PA 3Q72A 4D4KA 3EXAA 1N0UA 1U8YA 1TF2A 2GZDA 5E7MA 2QAGC 1OFIA 5JJLA 3T5DA 4OHVA 4TLDA 2GK7A 3E70C 3WRXC 1SKYE 2J0QA 3BERA 2ZE7A 4Q19A 1SVMA 1ZM2A 4ZCMA 2ZE8A 3IBGA 4BQSA 1KK3A 2IHYA 1SXJD 3L2OB 3AKEA 5EP3A 4Q02A 4B2IA 1OFUX 4A15A 4QGAA 2AD1A 3P4XA 4E22A 2OAQ1 1G21E 4ON9A 3H1TA 4Q4HA 4DWJA 1HQCA 3GFOA 1IHUA 4ESHA 3PITA 1ZCBA 5DHAA 1GWNA 1KDOA 1HY3A 3AF4A 3ZJYA 4KSCA 1XJCA 4EFMA 2PEZA 1TQ4A 2A2ZA 3HPQA 1W7AA 4MKFA 4ZDIA 2BMDA 1NJFA 1YR7A 5JJIA 2GCOB 2OCPA 5EE0A 1NP6A 3VR4A 3PJRA 4X8MA 3RWMB 4EIWA 3C5CA 2IS2A 2VH5R 5EE9A 2BV3A 4TSFD 4AG6A 4EPWA 1TMKA 3NDPA 5C18A 2F43A 3VR6A 1FMJA 1AN0A 2YOFA 5C1BA 5JI2E 1YR6A 2QTVB 4JL8A 4NONA 2WPDA 3AB3A 2GTPA 1XD8A 1G7TA 4HYYA 2IF0A 4PC6A 1Z0JA 4DDVA 3FMOB 1FP7A 4FMBB 4ZV4A 3NC1C 3R8FA 3VR3A 2YJTD 4XSHA 1N6OA 4JLKA 2QP9X 1BIFA 2EW1A 2PEYA 5L8VA 1XJQA 2O8EB 2LKCA 1XB2A 5BN5A 1XEXA 4A8JB 2A9KA 4URXR 4AKIA 5LB2A 3AKDA 4W7SA 2E1RA 1FP6A 2C96A 3J81k 1G5TA 3CWQA 2JLXA 2QP3A 1KJYA 2CBZA 4IDOA 2IC5A 2IYVA 4RD1A 1JQJC 2ANCA 1N6NA 4C4PA 3WP1B 3FTQA 3SYKA 3K0FB 2HJGA 2BBOA 2EYQA 2J46A 4MGYR 2QGNA 1XP8A 1GFIA 3JVVA 2VO1A 3CZQA 2IT1A 3LX8A 3DKVA 3ADBA 1XRJA 2PH1A 3NBFA 2QMUA 1XTJA 4U02A 2IYTA 4LI0A 1DE0A 2WOJA 1W5SA 3A4LA 4TMWA 3QKRB 1BYUA 1MO4A 1WDTA 3AP1A 3EIEA 4PQYA 4DJTA 2JIZA 4RD3A 4Z1MA 2GZHA 5EZ6B 2NO6A 1XBTA 2WWXA 1OSNA 2W2TA 3EPJA 4RCZA 2ZI9A 5FOTA 2CE7A 2YWFA 3LA6A 5B2ZA 1Z6AA 2DFKB 1K5DA 3IQXA 4JLAA 1US8A 1RKBA 1CR2A 1NY6A 2WSMA 1HE1C 3L0OA 1Z6GA 2AX4A 2VP5A 2D2EA 3FE2A 1XD2A 1IJFA 1YZUA 2FEMA 1A7JA 1JR3E 3QSYA 3KJEA 2B7BA 4Q7MB 1KO7A 4DEXA 1T0HB 4CEHA 4G5OA 3WP0A 1P2UA 3CNOA 3WHKA 1NLFA 2OXCA 5JHGB 3EC1A 4S35A 2CHQA 3CO5A 5CB6A 2VP6A 1HH4A 1GZSA 3MSXA 4N3NA 5DHFA 1P5ZB 1E32A 1E0KA 1ZM3A 3S1AB 3AVUA 3CNNA 2ZEJA 2AL7A 5FL3A 2PCJA 3TSOA 3TUJC 3DKPA 2QENA 1DG1G 4MKGA 3HDTA 3AQ4A 3CKLA 1E1RD 4C0QC 2IXEA 1Z0DA 2FE4A 3F0TA 4I1SA 4A0HA 5L3SA 4A36A 4L16A 1TUIA 3E5HA 2FDCA 2REBA 3Q5EA 1G8GA 1RVDA 1TQ6A 3UMFA 4JJZA 1BOFA 3U7FB 4PSAA 4V0LA 2WSSA 5FTJA 1G4AE 4NCIA 4HUQB 1X8JA 3AVQA 2QMOA 3C15C 4AK9A 4II7A 1KZ7B 1E2MA 1H65A 4IEIA 2IS6A 3HP1A 2FPLA 1FTSA 1LFDB 3RHFA 1YE8A 3ICEA 1MRSA 4DDTA 1EFRA 4Q01A 3TE6A 5KO2A 3MWKA 4CEIA 2GWHA 4NH0A 5D3MB 3KKNA 1CJTC 2P5TB 2WJVA 1DELA 3NBYC 1ONBA 2BBSA 4B34A 1GTVA 4FI3C 1E4YA 1QHHA 3TNFA 5BWMA 2IYQA 2F6RA 5FR2A 3SOPA 4QHTA 3ZD7A 3KKPA 1TQ2A 2XZLA 3SJAA 1G5RA 4YMWA 3RS3A 2A30A 3ICQB 4ACAA 2QTHA 4KLNA 3MWJA 3BFVA 2AXNA 1TEVA 5FPSA 3THWB 3PQCA 2OCBA 1T3HA 4AURA 3LRPA 2QPTA 4NP6A 3KJGA 1DAKA 1SVWA 4L9WA 1F2UA 3MFYA 4US0R 4BRWA 4DCTA 1EG7A 2Q9BA 2VBCA 1XCPA 2F1RA 1JECA 2ZJZA 1AZSC 1SGWA 3DOFA 2ORWA 4C30A 1TAGA 4A92A 2AKYA 4TMZA 4CT4B 1ZCAA 3HR7A 3UATA 1CU1A 1D9ZA 3IIKA 4UXIA 1YHNA 1QBKC 3AVWA 2QG6A 3U6KA 3ZGXA 1ZVQA 4DDUA 2RHMA 2OG2A 2QN6A 3GQBA 3EIHA 1PLJA 2WHXA 3BB1A 3TH5A 1DAHA 2QNRA 2X77A 3I92A 3C4JA 2B92A 3CR7A 1KI1A 3G0HA 4RZXA 5GADl 1W4AA 3CUEF 1Q3TA 2W6JA 1G8HA 2UVQA 1FNMA 3I72A 1S1MA 1T91A 4Q4JA 5FBLB 2IUUA 3W5JA 5KPJA 1QG4A 1I2MA 1EXMA 2F1IA 4KFRA 5DYGA 3X1ZA 1GVNB 4D26A 1ESMA 3OEHD 1TADA 4PC7A 3U7GA 1N0VC 3SEAA 4NTZA 1Z0IA 2HUPA 4LYHA 1KSHA 4TMXA 4D0GA 8OHMA 5KNDA 2GZAA 1WRBA 3UWKA 1W0JD 4V0KA 3LFUA 4Y0AA 3QG1A 3DZDA 3K9NA 1UJ2A 1Z0AA 1ZBDA 5SZJA 2CCJA 5TY0A 3VR1A 3W34A 5C46F 2QY9A 1KK2A 3QIAA 2XSZD 1IJEA 5AR1A 1AJEA 2JAQA 1KSJA 3JZMA 2RGEA 1NG9A 2PZGA 2D74A 2GXUA 2XB4A 4XVUA 4HZUB 2O8DA 1ZD1A 4DLVA 5JJKA 4O2RA 2LCFA 3O8RA 2EVWX 2CHGA 3H2YA 5FOXA 3PR1A 4JVSB 3BE4A 5KDLA 3ETLA 4DT1A 2OAP1 2PX3A 3KFVA 4I1VA 4Q1EA 3HYRA 1N25A 1UADA 3R20A 4W5JA 3VR5A 3UG7A 2O8FA 1PZNA 4PPGA 1W4CA 1QRAA 4Q4AB 1XWIA 1T5IA 1Y3AA 4IOJA 2ZR7A 3LWNA 4LV6A 4MYTA 4GSYA 4FCWA 1ZU4A 2KE5A 1IN8A 4BGDA 2MSEB 1C1YA 3W8NA 2I4IA 2GEVA 3EW9A 1M1YE 1X3SA 2IXGA 2NZ8A 3ND8A 5FUVA 4NHOA 4YMSA 4FMCF 3NTUA 2PT7A 2RGNA 2QMHA 2CNWD 3HPRA 4KITB 5C2JB 5KNBA 2WMNB 2IUTA 3KJHA 4QRHA 3MWLA 2PJZA 2G1KA 3NHBA 2GAAA 1ZD8A 4WIAA 5UKDA 1SXJA 4PAQA 3PUVA 4HDOB 4C2TA 1GITA 5M04A 4MKIA 4MRVA 2CL6X 2JDID 2VSOA 2CXXA 2CJWA 4GZLA 1NKSA 5JS7A 1AM4D 5DO9A 5IRCD 1W36B 2BM1A 1NBME 4GRAA 3QBTA 2WAXA 3DL0A 3L82B 2QUZA 2XNDD 4OYHA 2UZ3A 1SQ5A 1ZP6A 3L43A 5CDFA 5JSZA 2FSHA 3VNUA 1E0AA 2WKQA 2O8CA 5JZVA 4KVAA 2FFAA 4W9MC 2QGZA 1NSTA 1G7CA 1Q1BA 3IEVA 821PA 3AVOA 2WWIA 3QE0A 3EA5A 4TSFA 4RSGA 4ASUA 3LW7A 4HEJA 2QAJA 4DSUA 1KHTA 4WAUA 5AJYA 2ZRMA 4C7OA 3DEFA 3OESA 2KSQA 3SBEA 1S96A 2ZYTX 2G9NA 4XJXA 4PHGA 4CRWB 3BJIC 5EXTA 3ZZUA 1H8HD 4R9UC 4BZPA 2OM2A 1T6NA 1XTSA 2KI5A 1M7GA 1S9DA 4FMCB 4Q47A 2PX0A 1W44A 2DBYA 1ZMXA 4HSEA 2CLDX 1CEEA 2OUKA 2VYFA 4FXPA 1OIVA 1VKJA 3T1OA 2A5JA 3C8UA 1JPJA 1AGRA 3WMFA 1L4YA 2AR7A 4B6EA 1KGDA 3BRWD 3FDIA 4ITRC 1YR9A 1IN5A 1NI3A 3IIJA 2JLQA 2QMEA 2L0XA 2GESA 4Q1DA 3LDAA 2Z4SA 2D06A 4CVNA 2C04A 1YQTA 1G3IA 1ZINA 4G01B 2Q9AA 4HDCA 3BXZA 1N6PA 3M4YA 3H84A 4LY6A 1EWQA 4PAMA 1E2FA 2I3BA 1F5NA 1QHNA 2AK2A 4QNRA 3QEOA 2H57A 1G8PA 1XU4A 4LK2A 2IYRA 2R6DA 3QPWA 5J40A 2F55A 1ZNYA 4PHTA 5CIQA 1LVGA 2HLDA 2IYYA 4PX9A 1WXQA 4ZDJA 1ZRHA 4Q7KA 4ZIRA 1KI6A 5C4GB 2XTMA 3K09A 3CF6R 1AS0A 4JSTA 3FHTA 1P62B 3RC8A 1FQKA 1ZUIA 2IUSA 3CONA 1NMZA 4IHQA 3R9WA 4ZCIA 2HDNB 4ACBA 2ZR0A 4MYHA 4GFDA 1H8ED 1OB5A 4GOKA 2XGJA 4DKXA 5FI1B 3I73A 2YNMA 4EPYA 1MKYA 1JBKA 1N6IA 2O0KA 2FZ4A 4EUNA 2QAGB 2IW3A 2ZUBA 2ZJYA 2IA5A 2VSXA 2QA5A 1OPXA 4M9XA 1XCGB 4KCGA 5EUQB 2F7SA 2RB4A 1LTQA 4OI2A 4R7ZA 1QHYA 2ANBA 1KAGA 2XX3A 1NIPA 2H18A 2OFOA 4DHEA 1JALA 5K8UA 2PL3A 4O2LA 2F3RA 3GLIA 1DAMA 3I1FA 5LBIA 4D81A 3SJCA 2PLRA 2PZFA 4D80A 4OI0A 1RJ9A 3PEVA 2WJJA 421PA 1XZPA 4OK5A 3PV0A 3KQNA 2R44A 2ZANA 1XTRA 3EZFA 3G82C 2J3EA 5BN3A 3OIWA 4TYNA 5BN4A 4D25A 3RLFA 4EAQA 3V9PA 3EC2A 3N70A 4L8GA 4TMVA 4WOPA 1YKSA 1Z22A 4JL5A 1WBBA 2ECKA 1CR1A 4LCBA 1E98A 3X1YA 4PPFA 4BFTA 4Z51A 3AV0B 2P6RA 5DI3B 1XTQA 1UDWA 5DE3A 5EZ5A 1DBSA 1YJ5A 4TTPA 3SC3A 1VG1A 4QXAA 4QFMA 5HKKD 2OHFA 2J7KA 3NH9A 3CF0A 5DNYB 1P60A 2ZAOA 4MUBA 1P9RA 2C99A 1FX0B 3IHLA 1AS2A 2BMFA 1VDZA 4QM7A 4CYMA 2J0UB 4EQ6B 1P73A 4RD0A 3U6BA 2GXAA 3NBZC 4RD2A 2ZE6A 2CVHA 1UFQA 3AVYA 5GVRA 3K0AA 3A8TA 1XEFA 3CX8A 4B3CA 5GJBA 1FL9A 1E0SA 4DSNA 2F3TA 4ZKDA 1LF0A 4OK6A 2JEOA 4Q66C 4KU4A 4PAOA 4IJMA 1W4RA 3CWZA 3D3QA 3O8BA 1Z08A 1W4BA 1ZC3A 2YC2C 1ZW6A 4WW0A 5DLQC 4EPRA 1HV8A 5ELXA 4KLZA 1FMLA 1E6CA 1G20E 2ATVA 5FUYA 1KOFA 2HYDA 4FWTA 3B5JA 5CLLA 4NYJQ 3IUYA 4A0GA 5JHHB 2WOOA 4C0SA 3TBKA 4URUR 3QPUA 4URVR 1T8UA 3MAAC 4NMMA 3VAAA 3VU9B 2DFTA 4RD6A 4GT1A 1DPFA 4YMTA 4URWR 2P2LA 4JJKA 1KIMA 5JWHA 2RGNC 2ZSBA 1RRCA 4C0JA 1M2OB 4RFSA 3R7WB 1RYHA 2F9LA 4B3XA 1S2MA 3TSWA 4JVNA 2FPKA 3AP3A 5EE3A 1E1QA 2G88A 1E2KA 2CCGA 1SXJC 3SNHA 3EZ9A 1W2GA 4DUGD 3A1WA 4ARZB 3OEHA 4E03A 1D8TA 1EX7A 4JIMA 4EPTA 4K81B 1R2QA 1VYUA 4E09A 1DVRA 3CRMA 2DR3A 4LBYA 4NYJR 3ASYA 3GJ3A 2QM7A 4M22A 4IDQA 4DB2A 1W0JA 2NMVA 4TZ6A 3B8HA 1CJKC 1A2BA 3PIRA 4GL2A 2W58A 1BS1A 3KUCA 1N6KA 2Z4RA 1FUUA 1P6XA 4F4CA 2XSZA 4LHWA 5EXPA 4XOIA 121PA 3K70C 2BWJA 5AJZA 4LYFA 2J7PD 3SI7A 3BB4A 1SVOA 1OJLA 4WXPA 2DWPA 3EWAA 5A5GA 1HTWA 3Q5DA 4XSGA 1KK1A 4AD8A 5BQ5A 1OB2A 4RKFA 1AQUA 1K6MA 4MRSA 1Z83A 1XNJA 4IEEA 4PZYA 3ZVMA 3B1ZA 1GKUB 1R0XA 2FWRA 4LZZA 3RRZA 4EPXA 3GPLA 2OILA 2WM9B 1D2MA 3U61B 4KYUA 4UNRA 2O8BA 4G5GA 1GRQA 4B44A 2C2HA 1E79D 3CR8A 3C7KA 2AFIE 3KXIA 4TLBA 5G3ZA 2G77B 4KFUA 4EFLA 3I3SR 3V00A 2ZRGA 2MSCB 2C98A 5FOSA 4QBHA 5SZIA 1UDXA 3FPAA 5GJVC 3QXHA 1IXZA 3MWYW 4BFUA 1VG8A 3BWDD 2DWQA 4WZBE 4K46A 1UKZA 2QQ0A 4KO8A 4HAZA 3KTAB 1M6NA 1U90A 2B8WA 1IQPA 2JDIA 1W0KD 3QY0A 5TMPA 3TGPA 1XJ0A 2VTKA 5EUMA 1KI2A 1KMHB 1SVSA 5FBQB 2FU5C 2QU8A 4OJQA 4M1MA 2XNDA 1UBFA 2QSZA 1F3OA 3QF4B 4FIDA 4C9BA 2ZSAA 3RAPR 2O8EA 3THXB 3CPEA 2QRZA 4L9SA 1G6OA 2FG5A 2WMOB 3CPJB 3K09C 4GDFA 2GJSA 4YC7A 2ZRIA 3FFAA 1XMVA 1OH6A 3TIFA 1G9XA 1UKVY 3H86A 2VP4A 3EG5A 5FUWA 4LJYA 4LYAA 2ZRBA 4HB3A 4XWKA 3TR0A 4JBYA 1KAOA 1KZGB 3BGWA 4IOKA 3K0FA 5CLQA 1J70A 4FN5A 1H8HA 1KO1A 2WVJA 3A4NA 3GD7A 4I81A 4BFVA 3EWSA 5EP1A 1NVVQ 2VRWA 1L4UA 1P75A 1ZAKA 3R8CA 5G41A 1G19A 3I62A 1NJGA 5AUOB 1W47A 1YZTA 1BKDR 4AKEA 2JLSA 3SFVA 3MRSA 3KQHA 2CVFA 3D7MA 3ND9A 1JXMA 1Q0UA 3GLGA 2BMJA 4PQRA 1OHHD 1KO4A 5KDDA 1SHKA 2O5VA 1G291 4H1UA 2RHDA 3OAAD 2WTUA 2R6GA 4Q4HB 2F1JA 1G16A 1KJWA 4I99A 2ZI5A 1U8ZA 2H5EA 2NOAA 5FTMA 4IXNA 4C0BA 3TVTA 4RZ2A 2BIFA 1VG9B 3ASZA 4D82A 4CT5A 2ZYVX 2CL7X 1N5IA 5JWRA 4Q4LA 1KO8A 1F48A 3SJZA 1KDRA 1A4RA 1AQYA 5JLJA 1X8LA 2VF7A 2CLSA 2NGRA 5B58C 4LV5B 1NVVR 4PHFA 1NMYA 4D4MA 1G8FA 3WYAA 5JEDA 3GJ8A 4PHHA 5KPDA 2N1BA 5L3VA 1MH1A 5J47A 3A58B 4TT3D 4PSVA 3BOSA 1OKKD 3LO5A 3C16C 3THOA 1II8A 3ZS8A 3KQKA 2O52A 3KQLA 2ZXUA 1V43A 3CZPA 1F60A 2OSBA 1H8EA 2QPAA 3QENA 2CEAA 3PG5A 2QPOA 2RH5A 1L7VC 4W5WA 2YKGA 3NWJA 4BFSA 5IF9A 3E1SA 1S4QA 1OLOA 2CL0X 4YMVA 4DLSA 2BEKA 1CTQA 4IFBA 2IXFA 2V1UA 1Z6TA 3IIMA 3GCGA 3M0EA 3UIEA 4ILEA 2V7QD 2C8VA 2VL7A 3VHLB 2WZQA 4HUQA 5E3HA 2BCJQ 5EXSA 3FGNA 2OBNA 1WA5A 2WJIA 3SYNA 3QBVA 3W9YA 2Q21A 3LV8A 4J0QA 4LC1A 1GL9B 4R71A 2Q0HA 5KU1A 2R6AA 5EXXA 3WY9A 4DIDA 4AY2A 2XOKD 5FBVB 1E2PA 1ZD9A 2ODWA 3K53A 4LHZA 4O25A 1XMIA 5DH9A 3L0PA 4IOMA 3TQCA 5AUQA 4EDHA 4GBMA 1PVOA 2XEXA 1GAJA 3PUXA 1JAIA 1F2TB 3VKGA 1NL3A 3PUZA 1Q1EA 5G40A 1G41A 5BYKA 4BRUA 1DG3A 5B64A 1OFTA 4PXAA 2WWHA 1HT1E 3AKYA 5EQTA 2BMEA 5GJCA 4WA7A 1R5OA 5TDHA 5GVSA 1WB9A 1BMFD 4TZ0A 5HCIA 2ZVPX 2FMXA 2GJAA 3F8TA 2BKEA 2G0NA 1NN1A 3ADDA 4B33A 3KFXA 3M1IA 4QL3A 2GXQA 3RRNA 4L15A 2ZSEA 1T3SA 2ZREA 3AF2A 2I1VB 2JCSA 1JEEA 4F7WA 5HKKA 2WWYA 3NH6A 4FMDF 3FVQA 1IOZA 4NYMR 3L8YA 4CEHB 3ZZTA 3IKJA 3VR2A 1VMAA 3OIUA 4JZKA 3LW8A 2WWGA 4YDSA 1U0LA 2JJ2D 4ZDWA 4JYCA 3EPHA 4P0TA 3K9GA 5L3QA 4TTQA 1U94A 4IFEA 4M1TA 4Q5IA 3AGPA 1VECA 4OQMA 3GLHE 4XWAA 3U2QA 1EK0A 4NDZA 3HU2A 5KUTA 2ORVA 3PUYA 2WIBA 4ZDKA 4LPKA 2D7CA 4CZ2A 1IY2A 4B3DA 1A82A 2UKDA 3SHFA 1J7KA 2BBTA 1RRPA 2YWHA 1KI3A 5F3WB 4LV8B 4D2IA 1ELOA 3LH5A 3RNLA 1NIJA 3HWSA 1D9XA 1E3MA 1DOAA 4DCNA 3UPUA 4ZI3A 4HAXA 1BH2A 5JI3E 3CBQA 3BK7A 1NBMD 2W6ID 4UJ3A 1R4AA 1CF4A 1PUJA 5H1YA 1J8YF 1QHIA 2BOVA 3NEJA 4MYUA 1KO5A 2V55B 3G5UA 3NC0C 4TWZA 5A4JA 1AA9A 2GF0A 3KXKA 1AGPA 5DYIA 3CNLA 3QF7A 4LPSA 2BHRA 1N6RA 1LW7A 2G83A 1QHHB 1EFCA 2A3RA 2WICA 2A78A 2VP2A 4N0EA 5H8WA 1FNNA 2E87A 1UKEA 4ZO4A 1YR8A 4A9AA 1YZKA 2R62A 4FMDB 2ZE5A 4JBXA 2GETA 1R0ZA 2ZETA 3GJXC 4RD4A 4DUGA 1XZQA 3EZ2A 4OQNA 3KL4A 2GK6A 4A0FA 2D62A 3OIYA 2C5LA 2P65A 3QXXA 5D3QA 5DN6D 2IYLD 2ODEA 4LBWA 1RYFA 4DC9A 2EFCB 1F2UB 1GDDA 4GOJA 2DB3A 1TF7A 3ECCA 1U99A 5EE5B 3A6PC 4I1OA 1ODFA 4RY2A 4M1WA 2AWNA 2RAPA 2W2XA 3KXLA 3CX7A 3LQRA 4MRRA 1S3GA 1IONA 2NO7A 5G3YA 3KKQA 3W5IA 3MLEA 3TUIC 1ZUHA 4KJZA 3EA0A 3P20A 1T4GA 4QJ4A 2QL6A 2RGCA 1KNXA 2G6BA 1U0HC 2GJKA 2J7PA 5LPNA 3TUZC 4DLZA 4KBFA 5CIWA 2VHUA 4L5BA 5KSOA 4PFSA 4QGHA 3QXJA 3IDQA 1R0WA 4UJ5A 3BS4A 2ZS8A 4TN1A 3TQFA 5JWOA 3U7HB 1J90A 1WF3A 1I4LD 4RVCA 3WYGA 1Q1QA 3QUSA 3LX5A 4MKHA 4PO1A 2A5YB 1KTVA 2AWOA 4QJ5A 1E69A 1J2JA 1P3JA 4HDQB 3LY5A 1AZTA 2PMDA 3QJYA 1E79A 4GI7A 5KSPA 4D0NA 3O8CA 1GP2A 1OXTA 1M7HA 5F9HA 1LNZA 4FINA 3A1UA 1JXOA 3VFDA 4BEBA 2GNOA 2ZI6A 4AI6A 2CHVA 3CRRA 1LS6A 1G3RA 2GAOA 3PEWA 4TLEA 2QE7D 1DAFA 5CK4A 1XPUA 1ESNA 1KK0A 4LHYA 3B1YA 4RZUA 2D4HA 4HUTA 2ORIA 1HEIA 3AUYA 2AXPA 2JATA 4KVGA 1CS4C 1J99A 5FI0B 3NDBB 4URZR 1KKMA 4NZYA 3CIOA 4IRUB 3I8SA 1W0KA 1XPRA 5SZHB 5TB5A 4YXWD 2JJ8A 2P5SA 4NBSA 4TL8A 1MT0A 2O8DB 4OHZA 2VHCA 3CM0A 4TMTA 2AN9A 1M74A 3C14C 4P4TA 4DT1B 2ZRNA 1T8TA 2JLYA 3DM9B 4IDHA 1G7SA 1S8FA 1ZNWA 3JZAA 2H7VA 2X8AA 2ZRKA 3T1VA 3ZYCA 1E2DA 2PMKA 4OQFA 4B6FA 3AVVA 1M34E 4LSGA 3P26A 4Z8XA 3MG9A 5KHOC 2V8OA 3SBDA 2D7DA 1CBUA 1LB1B 1JR6A 3AVPA 2EFDB 2ODNA 2ZS9A 5P21A 4YLGA 4BUJA 4P4SA 1X6VA 1XCMA 2FGKA 4I4LA 4HB4A 3KZ1E 3U3RA 1E2HA 2REXB 3X1DA 1KNQA 3A1SA 2EFEB 2F1HA 3K0SA 3FKQA 4MH0R 1VYTA 4G5QA 3CW2A 3RWOA 1UM8A 3KB2A 2R6FA 3W6OA 4FD2A 3FMPB 5H70A 2IYWA 1CJMA 2A5DA 2RGBA 5ANRB 1CRQA 4JKYA 1X8KA 3GEEA 2QBYA 1D2EA 1OHHA 2BEJA 3A1VA 4HB2A 5E95A 3OAAA 3ZD6A 4JLVA 2OBMA 4EPVA 4JS0A 1E0JA 1JI0A 1OYYA 1OXVA 5JSZB 2J41A 1XXHA 2C77A 1IN7A 4DCSA 1C9KA 2QEQA 2R6CA 2GXSA 2SHKA 1TU3A 3QXCA 3SDZA 2GEUA 4EJSA 1IXRC 2OCAA 2ZSFA 1Q21A 4FWIB 5FH9A 4B32A 5JFGA 3U4QA 2J87A 4B35A 1NN3A 2CK3D 1SVKA 3K70B 1KKLA 2ZRDA 5L3RA 1UAAA 3QPVA 1OE0A 3BH6A 1R5NA 4PR0A 3TMKA 1VIAA 2ZUCA 2OEPA 4KHZA 5G53C 2E9SA 3B9QA 1D5CA 2YHSA 1OKKA 4FCTA 5FBWB 5IDVA 4AWXA 3B13B 3A36A 3LVQE 4A6PA 3THYA 1Z6YA 2HXYA 2FSGA 3QVVA 1XPOA 4O3MA 1HYQA 3P4YA 3TVDA 4ZPXA 5TXGA 3UG6A 3WBKA 3QOFA 3T12A 3EAQA 2Q3FA 3GFTA 1MOZA 3GLHB 3RRYA 4JLBA 1NVXQ 3TLXA 1NKTA 4TLAA 1EFTA 1G17A 4OJKA 4UXHA 3UWOA 2OT3B 3ZDQA 2EFHB 3W3AA 1XTKA 3RABA 4GMXA 1MR3F 1ETUA 3AF1A 2QT1A 3BIFA 2V7QA 5J4LA 5DIFA 2HXSA 4RCYA 1JAHA 1SULA 3CH5A 4BLSA 1WMSA 1KI4A 4D0LB 4M53A 5CB8A 1OH8A 3N2EA 3TW4A 3QVUA 3N2IA 4KI0A 4RJLA 2QP4A 4MQBA 2NO0A 1CJUC 2VLIA 2GCPA 4BFWA 2Z83A 1EGAA 1LS1A 2ZRCA 4NU0A 2OE2A 2X2EA 4ZCLA 2Z6VA 1YRBA 3AP2A 5KSYA 2XOKA 1YZNA 1E1RA 3MJHA 3W6NA 2CLCX 4U7DA 2QI9C 1MO6A 3QEJA 3RS7A 3GLFA 3KKOA 3RS2A 1FX0A 3GP8A 1W48A 3B78A 1Z8FA 4GP7A 4ZIRB 4MDFA 4IOLA 2P67A 1VCMA 3CPHA 4UNQA 3F3YA 4CDGA 2J1LA 5IK2D 4BPBA 1RIFA 1TUEA 1SKQA 5FTNA 3I5XA 3LNCA 1BMFA 4HAVA 1QVRA 2IEZA 4GNKA 2FFQA 1OIXA 4DRZA 2BVNA 4M21A 2B6HA 2HV8A 2ODBA 1XEWY 2KBEA 4JMPA 5JRJA 2JLWA 3GMTA 2FNAA 4TYYA 2NO9A 1GNRA 3EZ7A 3DO6A 4AKGA 2XXAA 1G1MA 2OXRA 4V02A 2GVDC 4LUCA 4JLJA 3LBIA 5DSZA 4TQAA 2JJ2A 1CJVC 4HLUA 4PO8A 4M2LA 4LWZA 2CE2X 5FOWA 2GJ8A 2YZ2A 2VIIA 3JVUA 3VU9A 3QKTA 1NF3A 1OH5A 2IWRA 3OE7D 3AKCA 4Q21A 1R10A 1E9SA 2AFHE 3GLGE 3OFND 1KSFX 1IM2A 4MITA 4JKIA 1D2NA 2B8TA 3K8YA 5AJXA 5LD2C 2IS4A 1RJ9B 4E07A 1NNEA 5BYJA 5BW8A 3EPLA 1Z2AA 4QJ3A 5JCPA 4CF7A 1DARA 4M8NE 3CH4B 3PFIA 4TQUS 4UNNA 4M4SA 5E7JA 2PT5A 4PZLA 5JMTA 4QHYA 4MYCA 5HZHA 1NBMA 4KFTA 2FN4A 2W6IA 2GJ9A 2ZM5A 4IXMA 5KDOA 3L8ZA 5HTKA 2QORA 1VCOA 1HQYE 4BLRA 2VP0A 1OW3B 1K8RA 2ZIAA 1E2NA 2V54A 2YINC 2GKSA 4ERNA 1E4VA 5AWFC 1VPLA 1Z5ZA 4G0NA 2ZJ5A 3SQXA 2Y8EA 1AIPA 3NKVA 2DHRA 3UANA 2XB2A 1FTNA 1U81A 4TL9A 4BASA 1L2TA 4MRPA 1OH7A 2AD5A 4YQFA 4UNSA 5JCZA 2PJRA 2IBMA 1A1VA 2MMCA 2GA8A 3NHAA 1E2JA 1FZQA 4P32A 1JJ7A 4R2HA 5CJPA 3AVXA 1IXSB 5DN6A 2NIPA 1MRNA 1Z47A 3P27A 2JLUA 4QOSA 3D6TB 2HT6A 2N42A 2V1XA 3QKSA 4PPQA 4D4JA 4QGFA 3NIBA 1SZPA 2V3CC 3KJIA 4GZMA 5H68A 5AJWA 2CMKA 4Q9JA 2ZRLA 3T15A 4B3FX 4A0RA 5FTKA 4M1YA 3BAFA 2X2FA 4KV9A 2H17A 4MUAA 2ZPTX 4C0AC 1MABA 2RGDA 2P0EA 1Z07A 1JB1A 2WAYA 4LYJA 4M1KA 4E5UA 3LXRA 4Q9HA 1DO2A 4BE7B 4KBGA 2JGNA 4PPNA 1Y63A 2DFLA 3U44B 1GILA 3ZQJA 1QF9A 3C5HA 1E9DA 1AKEA 5IHPA 2C03A 2VF8A 2J59A 1M8PA 1NG1A 3Q7PA 4Q1BA 3BH7A 3FKSD 1OF1A 4HATA 4JVLA 5HE8A 4CEJB 4RFSB 1DTSA 4Z8YA 3I4LA 3GEIA 1AKYA 4W5HA 4C3ZA 4IVPA 1W36D 1KMHA 2O0HA 2R9VA 4IW3B 1I4TD 5TVKA 3OEED 4H9GA 4MDEA 3Q9LA 2Q6TA 2XJ4A 4Z54A 4C0HA 1U2RA 2RKOA 3CRW1 5FPKA 2RGXA 3OHMA 2G0TA 2GCOA 4JLDA 4LJAA 2CNWA 1O3YA 3VMFA 2DY1A 1CR0A 1EX6A 4TYPA 3U7EB 3LBNA 3EPKA 1TEXA 3WBJA 2OFXA 2DFNA 4Q9KA 3B7GA 2OLKA 3PENA 1IY0A 5J4YA 4NE2A 4RFVA 5AK0A 1CP2A 4EJSC 1E9AA 4DLTA 3FB4A 1JR3D 2IK8A 4U00A 5EE1A 1CLUA 4DSOA 4YXWA 4LJ7A 2ZSDA 4QBFA 1OXXK 3QI2A 5BXQC 5FL7D 5AUNB 3GJ4A 3X1XA 1Z0KA 4LOAA 3CRVA 2EYUA 3OIVA 3Q8XB 2IL1A 3R9IA 1FQJA 2QTFA 1W46A 1GL6A 2VHTA 4FCVA 1TPZA 3RC3A 1COWD 4OQXA 3HU1A 3K0CA 4A8JA 4B74A 1Z0FA 5FPYA 4AYWA 4A82A 4JLNA 1KI8A 4GOXA 1KSGA 4LX0A 2FA9A 4XIGS 2O8BB 4EKDA 1XMJA 2FJUA 4QC2A 2NO1A 2AK3A 1N6HA 2GCNA 2ZITA 4PC1A 1RC8A 3ADCA 2GVZC 3REFA 5EP2A 2WBLC 3B6EA 4GMDA 4B73A 2IF2A 3AUXA 1P61B 4WVFA 4BLTA 3BC1A 3LLMA 3U3JA 1CKEA 2P6NA 1KI9A 4B3BA 4K8OA 1J8MF 4D6PA 1WBDA 4PQFA 4P31A 2EU8A 3K70D 4ASUD 1M7BA 2VP9A 1PUIA 2H16A 3ONWA 221PA 1NRJB 3QKRA 3TW8B 1W49A 4XD7D 4HLQB 2J5XA 1KI7A 4G3XA 2JLZA 1P2TA 3I61A 4LJ6A 1OXSC 2LWIA 1Z3IX 1Q57A 4AYXA 1ZYUA 5E7IA 4KXFB 1JPNA 1B23P 1R7RA 3NXSA 2EQBA 3LVRE 1KDTA 4V03A 4DLUA 1R6BX 5KOYA 1NY5A 3LD9A 1U8AA 5J4HA 1XTIA 3DMNA 4B3GA 2V6JA 3KDSE 2D3WA 2VPPA 4Q00A 4KFSA 2XJ9A 2QT0A 2CK3A 4OBEA 1QHGA 3K1JA 4PC2A 2F43B 4Q18A 4X8OA 1G3UA 4A2PA 2WKPA 2Q9CA 3KKMA 2IEYA 4NPHA 1R8QA 2JASA 2HJVA 2ZQ5A 4F38A 1N5KA 1NSFA 2IYXA 1T0JB 2ZU0C 4TQ9A 2QQEA 3S1AA 4V0MA 2W0SA 3V4RA 1N5JA 4DEYA 3MMPA 4XVQA 1OFHA 1UBCA 1UF9A 4HLUC 2QZ4A 5AUPB 3ZVNA 3VKHA 1XEXB 3M6AA 1E9EA 4MGZR 1RE0A 2XTZA 1JNYA 4S2EA 2HLDD 3PVSA 1E99A 3GLGB 1RW4A 5EP4A 5B30A 1IBRA 1F2TA 1G18A 3OF5A 3WNCA 2FFHA 3GEHA 4JBWA 3QKUA 2KWIA 2WKRA 3FWYA 3K9HA 4MGKR 4BZXA 1WP9A 4NL4H 5GJWC 4ESVA 3Q3JB 1XMSA 1P72A 4DCVA 2GEDA 2BC9A 2GHIA 4XWOA 2ZR9A 4PSKA 2O0JA 1ZNZA 4N1AA 4AYTA 3WXMA 4PANA 1T9HA 4ZKEA 3HJNA 1XFAA 2Z0MA 1SVIA 2I1QA 1SXJE 1GRNA 1XF9A 1RRGA 5D3MA 2B7CA 3EASA 4TYQA 3BBPA 2X19A 4NYMQ 5KSZA 2QSYA 3U3KA 2FH5B 2NQ2C 3ZIAD 2YWGA 4DXAA 2CCKA 4H1VA 4PC3A 5CYOA 3B2EA 1X86B 1G64A 1LV7A 5HZKA 2AHOA 2RMKA 4UQOA 3IQWA 3UMSA 3W3ZB 5CDFE 4F92B 1II8B 2MMGA 5IK2A 2FX3A 2ZRAA 4LBZA 3THWA 1Z29A 4HLCA 5KYKA 1GKYA 1FW6A 4BFXA 5CITA 2BJWA 1QDEA 4XTCS 4A6XA 3FOZA 5K8LA 3DVLA 1I4DD 4M9QA 2YOHA 4TLCA 5FOUA 1US8B 1TTTA 1B0UA 3IO3A 4QGGA 4AKHA 1E9CA 4XVRA 1XD2B 2UZIR 3OZXA 3QNUA 4KSBA 2ZAMA 2GF9A 5TV2A 2GBLA 2OZEA 1A5TA 1II9A 4NCHA 2EWWA 2TMKA 4B2LA 1DS6A 2BM0A 1DAGA 3DMDA 1AK2A 2IWHA 3VNVA 4LHXA 1FFHA 2CDNA 5IT5A 1VHTA 1GNPA 2DWOA 4B2PA 4BEJA 3OE7A 4DB4A 2D2FA 1VHLA 4A2WA 3BFXA 1P7CA 5CM8B 2ZU6A 4DBLC 3T1TA 4Q7LA 1UPTA 2W83A 3OFNA 4TTRA 3SR0A 3KB1A 5L3SB 1N2CE 1Z2CA 3KUDA 4KYIB 4DZZA 4LHVA 2FFBA 1YZQA 4F93B 5JS8A 1G7RA 2FSFA 4LGMA 3WMEA 1OV4A 1GOTA 2NPFA 5SZKB 4PZZA 2P6UA 1XXHE 4LRWA 1P4SA 3WHLA 1TL7C 3IGFA 4AC9A 1QZXA 1R8SA 3MUFA 3QXSA 3CB4A 3ZS9A 4P3YA 2VSFA 2GILA 3T06B 3T61A 2VA8A 1RRFA 4B47A 3RVBA 4IVQA 4POAA 2G1JA 4CEIB 3TR5A 1KYIA 3Q7QA 1Q1ZA 1GUAA 2JLVA 3ZQ6A 4TL7A 3FMFA 4OK3A 4YMUA 1E2GA 3MCAA 4HZIA 1NN0A 2WJGA 4U5XA 4UXJA 1GSIA 4US2R 2IYSA 2C9YA 2J0VA 4GP6A 1IN4A 4LJ8A 1CR4A 2FV8A 3SS8A 2X1VA 3RS5A 4JL6A 5C4MA 1Z6XA 4HZUA 1S3SA 2QRNA 4HI0E 5TARA 5L3QB 4Q1CA 3BFKA 1P2VA 4L4UA 5JEEA 4KAXA 2EWVA 1VTKA 1SKYB 2ZVQX 1XEWX 2ZJ8A 3A4MA 5FR1A 3TK1A 5CM9C 3UK6A 2HYIC 1KDPA 1V5WA 2C78A 5FUXA 4OI1A 2ERYA 4X8HA 2R65A 4F4JA 4Q4AA 1N3BA 1Z28A 2ZRPA 1QVAA 2HCJB 1E1QD 3H4MA 4A8JC 3K0CC 3VX3A 2R2AA 3VQTA 1YZGA 2KB0A 4B76A 5F9FA 3REGA 4AG5A 5J4VA 3LQQA 3LLUA 4JLPA 3SN6A 3B82A 2OO7A 4AIIA 1YZLA 1I2DA 5F98A 4UNPA 2ZI4A 4BFZA 4B71A 2YYZA 3VTKA 3GLIE 4Q1AA 4XTRA 2ZJ2A 2WJHA 2VHQA 4TMKA 3ZLJA 5DGXA 2ZRFA 3GLFE 4NYIQ 3IPYA 2ZJBA 3FKSA 2XZPA 4MA4A 2HF8A 3WMGA 1KJZA 1U0JA 3HYTA 5AJVB 5FOVA 2YOGA 4HAWA 3LAWA 4Q4JB 5FBRB 3LBHA 2BKUA 3BD9A 1E9FA 2VEDA 3RSLA 2DCUA 1E96A 2NG1A 4WZAE 2AKAB 3NEYA 4B43A 3IHWA 3FHOA 1GL7A 4MRNA 1TU4A 3VX4A 3OEEA 4A4DA 3DPUA 3T34A 4M9ZA 2FZLA 4LJ5A 4QBGB 3EARA 2A7QA 3T1QA 3TAUA 5HR5A 1RFLA 2JJ1D 4OI4A 1G4UR 1U9IA 3AGQA 4Y0VA 3PEUA 5B57C 4IDNA 3SQWA 1T5LA 2FPMA 4MGIR 3A1TA 2MSDB 5KTYA 3CRQA 1EESA 3TKLA 2WWWA 1ZIPA 4NYIR 1JR3A 3ZZ0A 1OXUA 1ZC4A 3AF3A 4NCJA 1SVLA 2J9RA 1TF5A 4LJ9A 3RYTC 1PLLA 2YVUA 5FPTA 4DSTA 3VHXA 4IDPA 5FL7A 2IX3A 4WZ6A 4C0LA 4M1SA 5LD2B 3ADKA 2ZI7A 1VYVA 3AF0A 2OBLA 1COWA 5JRZA 3U60B 1EFUA 3MD0A 4HLDA 2V4ZA 2O8FB 3KX2A 1T3LA 3MGCA 1D6JA 4OL0A 5DISB 4D4LA 4C0KA 1VCIA 3IILA 3L0IB 3B1WA 2NZJA 1R0YA 2EFGA 1GIAA 3IBYA 4M9SA 4RZ3A 4US1R 1QHXA 3KQUA 4UKDA 2GDJA 2J45A 2W2VA 1S9HA 3GFPA 2H1LA 3MJRA 2BCGY 4IKEA 1NLYA 1CULC 2G3YA 3K9LA 1LF5A 2Z5FA 4Q48A 1SXJB 1L8QA 2ASEA 3UKDA 1VIYA 3TAHA 1UKYA 4CW7A 1MO5A 4XD7A 3HR8A 2WPDD 3U5ZB 3Q85A 1G5PA 2RCNA 2CJWB 4PO9A 1XD9A 4QM6A 3DHWC 2H8KA 3AVTA 4O0MA 1YRAA 2C95A 1WE2A 2YWEA 3NG1A 4V0OA 1EFHA 1N6LA 2IHBA 4DLRA 3T35A 3WYFA 1K5GA 1ZIOA 3E2IA 2O8CB 2OV2A 2PCLA 2JA1A 2B21A 3C41J 5LDDC 1HUQA 3GLHA 1ZNXA 1ZU5A 1E2LA 4CIDA 4LJ4A 2BDTA 2H92A 4DDWA 1HE8B 2OFWA 1QG2A 2HF9A 4YDHB 4TL6A 3ZVRA 4YONB 2QAGA 3F5FA 2VQSA 3UXMA 4XH9B 1W2HA 3ZVLA 1JEDA 1VG0B 4QKQA 1C4OA 4WBSA 4P4SB 4C7OB 1NVUQ 4G5SA 4TT3A 1SHZA 4R2IA 4M0LA 4BLPA 1E9BA 1TX4B 3SFZA 1ZM9A 4N0DA 4OQLA 4TYWA 3A37A 2LKDA 3FMIA 2ZJAA 2DPXA 2RGAA 1BO6A 2GBLC 3P32A 2ONKA 3T5GA 5HCNA 1XDBA 1GM5A 2Z43A 2HCBA 3FYHA 1IN6A 3W90A 2PZEA 3W8RA 1W1WA 3EX7C 1F6BA 1TQDA 1YVDA 1ZUNB 4M1OA 4WXRA 1MV5A 2OCYC 2OLJA 1E2IA 2QBYB 1QHSA 2JIZD 1WCV1 2PBRA 4Z1MD 3D31A 3B85A 2VHJA 6Q21A 1P2SA 1ZM4A 2IS1A 4DLXA 1ANKA 4HAYA 1P9NA 4BLQA 3ZH9B 1RPZA 1NN5A 2RGGA 3SZRA 3TJZA 3B1VA 3GJ0A 4DIEA 5F2EA 1XXHB 2C9OA 4OKSA 3UMRA 3IO5A 1PV4A 3W6PA 1W5TA 4X8LA 3CF2A 3X2SA 1DADA 3AH8A 3GJ7A 4EJSB 5DI3A 4B75A 2REOA 4Q9IA 3U4QB 1FUKA 1N0WA 721PA 1YU9A 3EIQA 3I5YA 3QQ5A 1E2QA 3SHWA 1KMQA 3ZIAA 1VCNA 4JLMA 4F4IA 1FOEB 1A2KC 2DYKA 2WV9A 2XITA 2ZJOA 4C2UA 1ZJ6A 1KI6B 2Q3HA 1Q22A 2J0UA 4DLWA 4EQ6A 2P3SA 4FW9A 3RSOA 3THYB 1NVWQ 2W0MA 3B9PA 1UEJA 4JT4A 4QHSA 1JQLB 4BZQA 2XTNA 3X1WA 2K5UA 1HURA 5K8IA 3AM1A 3NVAA 1S0UA 5DI9A 1WQ1R 3PEYA 4Q7JB 5CK5A 2KBFA 3SE0A 3U3OA 2F9MA 2WWFA 1Q20A 2XNSA 2WSSD 3FHCB 3DDCA 4QNMA 2JLRA 4P33A 2ZI3A 3CLVA 1PLKA 4NCNA
chains in the Genus database with same CATH superfamily
3ZWXA 4V0NA 4WOBA 3DEZA 2VDUE 4HB0A 4OHKA 4Q1FA 4W8GA 1DKLA 2YZMA 1CW2B 1ZMOA 5CUQA 4I5GA 4L8FA 5F4ZA 3I23A 3V1YA 1SCIA 4YH1A 1PDVA 4D8WA 3QX7A 5DYNA 3GJSA 1QDLB 3SZMA 1LK0A 2J4CA 3UGJA 4FFBA 1E2EA 3R7WA 1O6ZA 4FM9A 4YJ3A 1IHOA 3BCRA 4PU0A 4CT0A 4DG5A 1CZLA 3UGTA 1UMCB 3GLFB 4B7UA 1OIWA 4F1WA 3KEQA 1FMTA 2HHAA 1SUFA 1YMQA 4RVNA 2Q5QA 5BN3B 2HL6A 2ZBEA 3I1JA 1G2QA 1CUEA 3O8DA 1UBLS 4L9AA 1BHSA 3IPXA 1A0OA 1DKOA 1XE3A 3KPVA 3ODGA 4DDHA 1W36C 2HWKA 1XZCA 4X1IB 2FQWA 3EXIA 3I8OA 3NBXX 5TF0A 3F46A 5EPEA 3SM3A 4WERA 1TNDA 4H2DA 4JQOA 2QD4A 4J0KA 4JJ6A 2AC2A 4FBGA 1FW8A 3DM5A 5JSHA 2UUCB 1RM4A 4O6VA 4BEVA 4PRLA 2XPCA 4NCKA 3CNEA 4ZI2A 4K26A 5CG2A 2I2AA 4Y2UA 1J00A 3GJ5A 3WYDA 4CL0A 1S2LA 1DV1A 4R9SA 4ZI5A 5EHNA 2Y3IA 5KCZA 4EY5A 3WYCA 1X1SA 2IDMA 1QYDA 1CZNA 1VJRA 3DZIA 1GKIA 4B48A 4G97A 1XCJA 2IP1A 3WRYC 3E0QA 4R83A 3TR6A 5CVVA 2KW5A 3CR3C 3IPAA 1X7GA 5ICCA 4J0CA 2J0SA 3DZ8A 3I8XA 1TC1A 2Y6VA 3IEUA 4FJ1A 3K0AB 1J2EA 5B4TA 1J2YA 1DRKA 2WWTA 4DG9A 4EFNA 1UMKA 4RMNA 4I1UA 4L0QA 1NBOA 4UUAA 1Z8NA 13PKA 2RK3A 5HIJA 5BO5A 4DV2B 2H4WA 1E6MA 1SC1A 2HBRA 4HAUA 4Z53A 1KAQA 1H2ZA 1IE3A 4JI5B 2DR0A 5JSFA 3FFBA 1KY3A 2QRUA 1EUDB 1C7FA 2B1QA 2FKAA 3BB3A 3CZAA 4G84A 2A4KA 1AK9A 4LWPA 4G5RA 1OZFA 4MR9A 1C30B 3DSRA 1GU0A 1PN3A 1G8YA 4S24A 2C9CA 2QJOA 3ELBA 3NHFA 3FJYA 5J5CA 1IHYA 4CODB 5IJ9B 3TD6A 1PG2A 4U4AA 4N0MA 3DYIA 1ZKMA 1SHTX 1NI4B 2HEIA 4JLSA 3MTGA 3UT5A 1P1RA 5FPHA 1O5OA 4KKVA 3PNBA 1J9EA 1BYIA 1PZFA 4KX5A 3O2NA 4A2QA 4GOOD 2AYXA 3AY0A 1HLDA 4HNTA 4TWAA 5IKPA 5PGMA 2HT1A 1GV0A 3JWGA 4INAA 4IHJB 1KY2A 1JA1A 3HGMA 3ZLVA 2B6NA 1YCHA 2VC2B 2CT8A 3L06A 1NJ2A 1VE7A 1XUOA 1NMXA 2HK9A 1XX6A 1OPRA 2B30A 2PRJA 2PZLA 1O08A 3IMFA 1VE1A 5D8DA 5E9JA 3R0VA 2NPIA 1DAEA 2JJ1A 2X5XA 3OUZA 3Q41A 2PBFA 5DOZA 2CD7A 1SU8A 3AILA 3AUJB 4DHWA 2FZVA 2QE7A 3KWFA 1FLAA 4GPIB 4HFNA 2Q3MA 3GJ6A 4PLZA 3LXXA 1VHWA 4BN5A 2PGXA 1WZCA 1IY1A 2W90A 2WTBA 3GY0A 4DA7A 5BRJA 4KMRA 4UVDA 1JJVA 1NBAA 2QROA 2ZBVA 2V6IA 1NT2A 3VPGA 1VM6A 3H99A 3Q2OA 1FUEA 5FD8A 4EJ6A 2B69A 2I65A 3IMEA 1SHUX 2IXDA 2PFSA 4AMUA 1U8YA 1I0ZA 1FP4B 2H0QA 1OFIA 2Q5JA 3ABRB 4FFDA 3T5DA 1JLSA 2ST1A 3DZKA 4FT2A 3RVNA 4XQCA 3GD5A 3FTPA 3SC2B 1KBOA 4ZCMA 2ZE8A 3IBGA 3OUUA 3QJ5A 1XVLA 4G1FA 4MI1A 3HK2A 4RJIA 4AQYB 3AMVA 4FX2A 2AOUA 2TMDA 4B2IA 3SZGA 4QGAA 3AM3A 3ZE9A 1E8DA 1JFLA 1HT3A 3EFOA 1PBTA 1EIWA 3RYIB 2X6RA 3G6KA 1G21E 4ON9A 3H1TA 4MWBA 3PQ5A 4Q4HA 3V4OA 3GFOA 4B40A 1MVLA 1RMTA 4O4IA 2OV1A 1LPOA 1TOAA 3AC0A 2GBGA 3VYRB 1HY3A 3AF4A 1GEEA 2Q3CA 2P1ZA 4KSCA 1TQ4A 3IPLA 3K2EA 2A2ZA 5EVJA 3VSDA 4MKFA 4OHPA 1QB8A 5JJIA 1GV1A 4LXIA 4AF8A 3JALA 4MYSA 1N7HA 4YEDA 5EE0A 5FP0A 2EX0A 1PQ4A 3D81A 5AW2A 1Y37A 3C5CA 5CAEA 2VH5R 2NZYA 4EPWA 5C18A 1M9NA 1RHJA 1H0KA 2F43A 2JGIA 3OP4A 3VR6A 5DSTA 1AN0A 2V98A 5JI2E 4JL8A 1SN7A 3STXA 4UASA 3CLRC 3DZGA 4F2WA 4NONA 1E1YA 2WPDA 3AB3A 3FNHA 5ALDA 2QX7A 2GTPA 2NZUG 3MCZA 1U7ZA 1E8MA 3LC1O 4HYYA 1SUBA 4E5YA 2PN1A 3FMOB 4P4NA 1KIAA 1Z36A 5F1KA 2YQZA 2HA2A 5D2CA 4XSHA 5KNDH 1N6OA 2L19A 4JLKA 2QP9X 1BIFA 1QH1B 2PEYA 3JQFC 2RFLA 3LQ1A 3JQDA 4MLCA 2FAXA 1YMUA 1YBMA 5AQ1A 5JANA 2LKCA 4Z9AA 2JAUA 3AHIA 4G0XA 3AFOA 3AHEA 1DBRA 5H82A 2JHFA 2VHEA 5DLYA 4URXR 2J48A 4FOSA 4KOAA 2E1RA 1SB9A 2C96A 4MVJE 3J81k 5EKTA 3HA7A 4WBNA 2EP7A 1O94D 3AIOA 3VISA 1XVTA 4IDOA 4RD1A 4M0PA 4YRJA 1T25A 2QXUA 1KFCB 3OWOA 3PDWA 4HFRA 1C5KA 1Q7EA 3HWX1 1AF4A 1WCWA 4BKMA 4D0RA 2Q07A 5FDFA 4EVRA 2DG2A 4KPGA 1HEUA 3PFHA 1PNTA 1OAAA 3GGCA 4WJKB 3WA6A 3UEOA 1NOKA 4ZOBA 1QIEA 4S3MA 1SO8A 2J3DA 1Q83A 1E3TA 4BIIA 3ROTA 1E64A 3I2JA 4X85A 5FV7A 5H16A 1NW9B 3NT4A 4DR4B 3HXKA 1KHHA 3G3EA 1WCXA 2EKBA 1XTJA 3NBFA 4R8MA 1ECGA 3T7SA 2WQ6A 2GSWA 2W2KB 1JYFA 5KQLA 1OXBB 5KX5A 4TMWA 1JKMA 3OCYA 4YXWD 1BYUA 4YX9A 1S8OA 2JHGA 2ZK7A 3ZHUA 4BTVA 3HEMA 5KYYA 1Z75A 1Z68A 2XKAA 4KI7A 3GZNA 3A25A 2B9EA 3NM5A 3OJFA 4D96A 4BP9A 4N8EA 1FSSA 2A9PA 2NO6A 1XLVA 3EF3A 4D43A 3M9WA 1PWHA 1J97A 2W2TA 4MV5A 3EPJA 1T5BA 2XKKA 4AY5A 1P5HA 1DO8A 1UBTS 3ND5A 4LOHA 4PZUA 2CE7A 3LA6A 5B2ZA 3FSGA 3MRVA 4BRSA 5K7SA 4F5EA 4WK0B 4WACA 2DFKB 5TLSA 2D1FA 4FVTA 1CR2A 1JEJA 1NY6A 1HE1C 2VP5A 3BMNB 3E9MA 1XD2A 1IJFA 1PV2A 2FEMA 3I53A 4TKLA 3TVYA 3KJEA 2B7BA 4Q7MB 3RVDA 1WNTA 4G5XA 2WJPA 3CNOA 3PQ8A 1NLFA 1NR7A 3PFWO 2H00A 3OECA 3D8UA 4WXYB 3WHKA 3HCNA 4MEJA 1W0CA 1X1EA 1N0IA 4ZOLF 4D8YA 5CB6A 3OPYI 2XCTB 1J07A 1ZSYA 4Y2HA 1WXWA 5E0OA 1TM4E 3D3NA 3ETGA 5DHFA 4EW1A 4AZ3A 1K7EB 1J0DA 2VAMA 2C4WA 4N76A 2QRPA 5EPUA 5HFAA 2GHQA 2XCRB 2AL7A 4M0KA 4JH0A 5FL3A 1A9XB 3TSOA 3KLBA 3DKPA 1GPJA 1DG1G 4KQJA 1Q11A 4S12A 1ZIDA 4B9AA 3CKLA 2NO5A 5EINA 3F0TA 4I1SA 5L3SA 4A0HA 1YAHA 3V6MA 3VC7A 5BXQC 4DADA 3QEAZ 5DM70 2P8SA 1GQSA 2FDCA 1G8GA 4CLXA 3GQVA 1N5RA 4RZHA 1TQ6A 5EA2A 5LYJF 3LHSA 2OXIA 1ADBA 4UW9A 4H15A 3VZQA 1MX1A 4ZAZA 4V0LA 3DTVA 4B6RA 2WSSA 1IVNA 2GMWA 3BJEA 3MN1A 3P96A 5BV1A 4FFRA 5AOAA 3AVQA 3C15C 1NNUA 3A9WA 1E2MA 4IDFA 5GONA 5BSHA 2FPLA 2YVLA 3BILA 3UPDA 3ICEA 3I5MA 1I7PA 4NFHA 4Q01A 3TE6A 5KO2A 4FHEA 1QF6A 3EOBI 4NH0A 2D1RA 2BFPA 1Q2XA 2XIQA 3R3UA 3TZHA 2XUOA 4B34A 3BGVA 3RTEA 4B2YA 2R751 5AXDA 4H7EA 3TNFA 4NZ9A 1L7XA 1M2NA 4ZT4A 1ENZA 5CFRA 4JBIA 2DSNA 3EGIA 3H6HA 4HYTA 4LYGA 5FR2A 1PZXA 3GZJA 3SOPA 3D7RA 2OHXA 4QYMA 3ML1A 3KKPA 1E61A 4I46A 3R3SA 3SJAA 1NLUA 4CMIA 3RS3A 4DIKA 1YONA 5I9TA 2A30A 2V6GA 2I8AA 3IR5A 4RPKA 5A2GA 3CXUA 5EWMA 1PL7A 5DDIP 3BFVA 2UDPA 5FPSA 5A5EA 3D3WB 5DKFA 2P78A 1T3HA 5AKKA 1A4UA 3KKZA 2M6RA 3CJQA 4PICA 4UPVA 2WNIA 3KJGA 1Z4QA 2V7VA 4L9WA 5BQ3A 2YJNA 2N0SA 1YRLA 1F2UA 3M81A 2I6UA 3DBRB 4US0R 1ZITA 4BRWA 3EVEA 1XCPA 4H31A 2F1RA 1JECA 1I36A 4XPZA 2ZJZA 4BNVA 1RQGA 1VRWA 1OXKB 2DHCA 3DOFA 4YUXA 4C30A 4C6TA 4XYEA 4JZYA 4LTDA 1ZCAA 3HR7A 5IAOA 2NZ2A 2V7UA 3KOXA 1AHHA 5IN5A 3ZGXA 4BO3A 4EG5A 3EWNA 4DDUA 5BV7A 5EFZA 3GQBA 4UBKA 4JOBA 1VE3A 2NWQA 3EIHA 4GP9A 4O08A 1B0AA 5DGCA 4DMUB 1OJ7A 1PLJA 2QKYA 3REQA 4ENQA 5LWHA 3HJRA 1C80A 4PEVA 1UUFA 1L5YA 3EDRA 3I2GA 4PPYA 4JQZA 1K92A 3JRNA 3O31A 5GADl 2JH3A 1SUEA 3ESBA 3JTEA 3LL7A 4QLBA 4ZN6A 3L46A 3R7NA 1TVKB 1T1SA 5I7EA 4WJLA 1FNMA 1A5AB 1K6XA 2V0CA 1ZOLA 1GT91 2IUUA 1WB4A 3FCEA 3RADC 3LZDA 2D0IA 5G4KB 5DCUA 1GZHB 1EXMA 4GU5A 5LQMA 3FNFA 1A76A 5AI0A 1L5GB 4Q3OA 1ESMA 1G21B 2ORED 2LV8A 3K8OE 5GWXA 1XV5A 2X40A 3TL3A 2XVXA 3TAXA 1RXCA 4ER7A 2OQIA 4L28A 3F4BA 4JC5A 1RMQA 2HUPA 1AE1A 3UKOA 4D0GA 1I3OA 1E5XA 3LUGA 1HLGA 4DPLA 1W0JD 3OM9A 3BICA 3DZDA 5FI5A 5BQFA 1Z0AA 2B5OA 5TY0A 3HRIA 2CB0A 4S1TA 3H11A 3GL9A 2VFAA 4OLHA 3P4UA 3WO1A 5BWCA 2GAIA 1L5MA 1NX6A 3L1JA 1IJEA 4UBLA 4ITVA 3HKDB 2ZUEA 2JAQA 5DLPA 2XB4A 1MPXA 2PTGA 5JJKA 1ONOA 3FFXA 2IKSA 4KIUA 2HREA 3GOQA 4WCVA 1VMDA 3H2YA 2DT8A 3G23A 2YMQA 3CG0A 5K9ZA 2LP4Y 4JVSB 5KDLA 5ALKA 3R75A 1QIGA 2FCRA 4I1VA 3C8DA 4Q1EA 3HYRA 1JTFA 4V39A 4NE9A 5KYTA 1YD7A 3CZ9A 2G5TA 1ENOA 2W5UA 1W9HA 3G8BA 3R20A 4W5JA 4MVJH 5AT1A 4DYHA 2O8FA 1YASA 4KQWA 3OBIA 3CUYA 2H2HA 1W4CA 5JVDB 4Q4AB 4DCMA 1XWIA 4DWOA 4XPIA 1UK7A 1W76A 1T6XA 4GSYA 4MKRA 3FXAA 1E4EA 1R0LA 5DGDA 3ZDCA 1ULHA 1IN8A 3IAM1 2MSEB 3RV4A 3DCJA 2IU3A 5FQNA 1L1RA 5ED0A 2B4QA 2JRLA 1M1YE 1WS6A 1X3SA 2R7NA 1MA3A 3BHIA 4EUFA 1XF1A 4YMSA 4NF2A 4FMCF 2PT7A 4GEGA 2CNWD 4KITB 5LQKA 3R0QA 3EQ9A 3C0KA 4YRBA 1RYBA 4TKUA 4EO9A 5LP6A 2W4QA 3V80A 3A9SA 3ZCVA 4GMKA 4IICA 4REOA 2HD4A 3NHBA 3LSYA 1RAGA 3O6VA 4GGPA 1ZD8A 5GZ6A 4WIAA 4KUEA 3OQ6A 5KTKA 1S6YA 3KVOA 3BXHA 2C1ZA 3KXDA 4MRVA 3LOUA 1VJGA 4ZEVA 3WWDA 2JDID 2FK7A 4ZCPA 1B00A 1GZ6A 1FFBA 3D6MA 4J43A 2VHVA 3PICA 1AM4D 5C7YA 5IRCD 3ROMA 2RE8A 2XUFA 3JQ8A 4JJ7A 4MUGA 3KL2A 1QIMA 1P7VA 2EZ9A 1I4WA 1SAYA 3Q9SA 3ORYA 1HYHA 3TECE 5F52A 2ZWOA 1GAXA 2PSFA 2UZ3A 3TZBA 2JI8A 3DLAA 3L43A 5CDFA 4E88A 1E0AA 1JXAA 5IAGA 2O8CA 1YJAA 3ROXA 3NI2A 4XFKA 1RNLA 2QGZA 1VHJA 1XQYA 1GPUA 3OA0A 4BZZA 1G7CA 1Q1BA 1VPDA 3FUTA 4KO3S 4JP3A 4AU1A 5HOEA 4U2KA 3MWEA 4ENUA 3IEVA 2WWIA 3MJDA 1FRFS 2BGJA 3G0DA 4YLYA 5C8DA 3LW7A 3WMRA 1KERA 2ZDHA 4HVLA 3H83A 4DSUA 4L02A 1R0KA 4Z4GA 1T5HX 1A7AA 3I9NA 1PR5A 4WAUA 4B79A 1CETA 4DLPA 5K0ZA 5KOHB 1AO3A 3SBEA 1S96A 3E6AA 3TG8A 2G9NA 4XJXA 4IV8A 1JIQA 5DF1A 5EXTA 4G56A 3N8HA 1H8HD 4QU8A 3TINA 5C35A 2C7OA 3DR3A 3VHXB 2OM2A 2AF4C 2X5OA 4DEVA 1T6NA 1XTSA 1V5FA 1M7GA 2VJOA 1N1DA 1VXOA 3VPSA 1B93A 3ZBUA 4TXJA 4EKNB 2DBYA 1H3EA 3AWIA 4AAYA 1Z4PX 1CD5A 4EUKA 3T1OA 3VGPA 2ZYGA 1AGXA 1ARZA 1EEHA 2A5JA 3C3DA 3NBUA 1AGRA 1HE3A 1KAEA 4WH0A 3WS7A 1KGDA 3RIEA 3FDIA 1JH9A 2OXFA 4D7AA 2HBQA 1QHEA 1O94A 2FPWA 2Y9MB 1BE1A 2LDXA 2BGUA 1DAPA 3AETB 2Q8PA 1OWOA 1P4GA 2GESA 4IAOA 3LDAA 2PXCA 3CZ5A 5EC8A 2ODAA 1UMDB 1NPTO 3I6BA 1PFGA 2CNNA 5BVGB 3UJAA 5HUJA 4G01B 1AMUA 3DXFA 3NKFA 4JY7A 4KNVA 3V1KA 3A4YA 2FYTA 3BXZA 3CH7A 5IDYA 4I5DA 3UO8B 2GEFA 1EWQA 5CEEA 1PL8A 4PAMA 4LTMA 1QHNA 1U5CA 4OOFA 4UBJA 5A3VA 5I7UA 3WOHA 4JV5B 1RABA 2B1JA 2IYRA 3EPPA 5B55A 1UJ4A 4ZZ0A 1AMOA 4OL9A 1A7KA 1ZNYA 1QP8A 1I2BA 4PX9A 4ANFA 5JNTA 4L76A 2OYCA 1QHFA 1KYWA 4KO1S 2CL5A 2J9XB 4ZIRA 1KI6A 5ECWA 1MGPA 3W2TA 1NMQA 5FV4A 1W8IA 2R6R1 3FOAA 4JSTA 1ND6A 4P7BA 3FHTA 4WEOA 4K87A 4A8HA 1WDWB 4IHQA 2PBLA 3SAJA 4ACBA 1RMYA 1SK8A 4MYHA 4B85A 2FSPA 1OB5A 4DKXA 4NULA 5FI1B 2Q28A 2DY0A 3WGQA 1ZLXA 4EPYA 1Q14A 1JSLA 3IC5A 1QZ3A 1XG5A 1RACA 3K2IA 1MKYA 1SZDA 3KYDA 3DL7A 4BQOA 2QAGB 4QICA 3IEMA 4OIFA 2PR7A 1X80A 1RQNA 2HBZA 2IA5A 4KR3A 5E4JA 1IOLA 2QA5A 3ANXA 1OPXA 2J8ZA 4M9XA 1MIOA 1XCGB 3ZHVA 1DFHA 2NSHA 5EY5B 4P3OA 5EUQB 5JQGB 4I9NA 2RB4A 3WLFA 4R31A 3WO0A 3ZTTA 3KLNA 1UH5A 2DH5A 1ZBQA 1KAGA 2YJ5A 4MVJM 1NIPA 2IYAA 5CVEA 3UT0A 1GGMA 4AP5A 2HCTA 4JYAB 3P9SA 4HZGA 3RJTA 4JKOA 2PL3A 2F3RA 3X43A 2Q8QA 4D81A 4YDQA 1XVVA 2OV4A 1IZ0A 2PKEA 2GPJA 1BD4A 2A0KA 5DM4A 2AOVA 3B3GA 4OI0A 3LPLA 3PEVA 1UMCA 1IK4A 4O29A 1XZPA 2G28A 3PV0A 4G23A 3BIJA 3DUFB 5DBEX 3RUEA 1W73A 1LSSA 1T8WA 2ECFA 4CCSA 2J3EA 2X7HA 5A4DA 2P75A 5BN3A 3G2OA 3QY9A 4TYNA 1CCWA 1EJ0A 3RLFA 1M1NB 5B5SA 4HAIA 1U4NA 3N70A 5TPWB 5T64A 2AZ4A 2OYRA 2VJDA 3ZG6A 2IV7A 1YKSA 3QU4A 4IMIB 2PUAA 4YCDA 5IBQA 3R7AA 3E7PA 5BPFA 4LCBA 3FDZB 3KAKA 1M2KA 4W5OA 1UWVA 4NFSA 4PYOA 3PQ3A 1YULA 1QOPB 3ZGLA 5DI3B 5FWYB 4ZJZA 2J6BA 1MB0A 3UT6A 2MT9A 1XZHA 1IG3A 3SC3A 1MVNA 2P2CA 4CMJA 1PNRA 1OT5A 2HGZA 3FHJA 3LKVA 4K6HA 3M82A 1WHSA 3JQRA 5DNYB 4MUBA 1P9RA 4FE3A 4TQGA 1AS2A 4H16A 3F73A 5IU6A 4KPFC 5EOVA 2Q2VA 4WLNA 5ARBA 4OXNA 4IDEA 1P73A 3IHTA 1T2UA 3H2KA 3UJBA 4HQ6A 3U6BA 2GXAA 3H5LA 2FPUA 3LDHA 3LHKA 3NBZC 4RIEA 4RQTA 2HA6A 3OKAA 2YICA 3ZHZA 5I7OA 3JD3A 1X7WB 3DEJA 1UWKA 3K0AA 1XEFA 4L6IA 2ODQA 1FL9A 1LDYA 1VJTA 3HDYA 3HM9A 5EERA 4DGQA 1LF0A 1M5UA 3GFFA 1FPQA 4JB3A 4IQGA 4RA9A 4E2XA 2GARA 2BONA 4FOTA 3PFBA 1I5OA 2PGIA 4M99A 4Y6SA 4B1FA 4BNZA 1ZC3A 1Z16A 4D44A 1ZW6A 3U17A 2HHHB 1HV8A 1IY8A 1V47A 4JP5A 5ELXA 2Q27A 5ITZB 1M34A 5MFPA 4OP3A 1TB4A 1F4LA 1E6CA 1G20E 1EUDA 4ISBA 4Y2TA 2IOYA 1HK7A 3H2BA 5FUYA 2HYDA 5EIEA 4ZQGA 4FWTA 1JLLB 3IUYA 3WGJA 1QRDA 3PU6A 3SQDA 1BE0A 2Q6IA 1JLRA 5ALTA 3QPUA 3P2MA 1V45E 1M1YB 1T8UA 3MAAC 4NMMA 3VU9B 1K7YA 3I9V1 1ITZA 1Y8CA 3GA7A 4IIYA 4YMTA 1MJGM 1O8CA 4BIMA 2NYRA 4DAEA 4LYEA 2ET6A 1GZDA 1C3VA 3AJ8A 1VP9A 3HA5A 4LGYA 3ILYA 5EJMA 5LP6C 1RYHA 3HBNA 2ON6A 3TSWA 4FNGA 2FPKA 1E1QA 4C05A 2G88A 2AE2A 1GZ3A 1E2KA 1X3LA 2HGSA 1CWUA 3I76A 3SNHA 5KQPA 3NP7A 1JJAA 1PX0A 2O6LA 4D0SA 4ARZB 4CKCB 3K6SB 3MLBA 1CP3A 1UP6A 5DEIA 1QGYA 2OK8A 2WHEA 5JROA 5L6MB 1FYFA 1NM5A 1R2QA 4DXDA 3PUHA 3CRMA 2ECOA 4G63A 4NYJR 1FX1A 5I9LA 1TMYA 1QLWA 1U80A 3TX6A 1IBSA 3C3EA 3GJ3A 3H1BA 4IDQA 1W0JA 2ZIFA 1N32B 2NMVA 4TZ6A 3WGIA 1A69A 5B3AA 2O2YA 3ENQA 3PIRA 1Z74A 2X0RA 4GL2A 1D1PA 2ZSHA 5ALYA 4HXFB 4RABA 1BS1A 3GDHA 5FPPA 3UQYS 3O91A 4RUKA 1AC5A 2VCHA 3FOWA 4MVJD 4X6YA 4EA6A 1M2WA 3AL3A 3ZXUB 5KNLA 3CZRA 3FZEA 1RYEA 3F8WA 3ET5A 1B41A 3KOZA 3O2QB 121PA 1FP4A 3BWBA 3A1EA 2QZZA 3RTBA 2BWJA 2Z8ZA 3LPCA 1PWYE 3URKA 2PRSA 1F20A 3T9EA 2DHEA 2HK8A 5A5GA 3Q5DA 1XA3A 4AD8A 1X9HA 1GYRA 2INGX 3SC2A 5BQ5A 5DSXA 1OB2A 4DV4B 2FPRA 5IN4A 4GVLA 2I6SA 4DSZA 3W4KA 1XNJA 4IEEA 2XUQA 4MMXB 3OOSA 3B1ZA 1KQNA 1V4NA 1VCHA 1R0XA 4LZZA 1NQUA 3LA8A 4UMDA 3U1TA 4D5EA 4MW1A 4ZK2A 3GPLA 2OILA 2WM9B 3T38A 3CKYA 3U61B 4L27A 3VNBA 4P5PA 1RPNA 1SUPA 4FSDA 4ZTUB 2O8BA 3WGLA 1N9ZA 4GSLA 4R0MA 1IUKA 3AKZA 3PGVA 4B44A 4L08A 1E79D 2OMKA 3CR8A 5CDHA 3IPRA 1Y7TA 3KXIA 2G9VA 3WGNA 4Z2AA 4EFLA 2YBEA 3OC0A 5HS6A 3WSTA 1O94C 2Q4TA 4J9UE 1L7OA 2JAOA 2C98A 3DO8A 4KVFA 3H7IA 4M76B 4DMLA 4JOQA 2BFBB 5CJJA 5SZIA 3SDSA 6GPBA 5MFZA 2Q46A 3LWBA 3MT0A 5H9VA 5FBHA 1AY0A 1WQ3A 3QXHA 4G8JA 1H22A 4UVIA 1GTRA 3T9AA 3INGA 1Q0PA 1VG8A 4RGQA 2G4VA 3DDHA 4L5CA 1JU9A 4HLNA 1ZQ1A 4EX7A 5EJ4A 1UKZA 1P5RA 3TOVA 4HAZA 2Z30A 5JQWA 2HW8A 1N36B 3KTAB 2VJKA 3KD2A 1WSWA 1U90A 3JAMA 2JDIA 4HH1A 1W0KD 1QNLA 1IY9A 2E4VA 1PNQA 1XJ0A 1Y1RA 2XB8A 3PPWA 1TA9A 4GDMA 1JKJB 1KI2A 1UDRA 1KMHB 1SQSA 4NZNA 1SVSA 4OFZA 4R8RA 4TTSA 2H0RA 4WV3A 5FBQB 2HNKA 4NNPA 3IP6A 1F3OA 1Y9AA 2PFGA 3LF1A 4KGVA 1C0LA 5I8ZA 4XB2A 4XRRA 1G6OA 3CPJB 1RAFA 3QLTA 3QVGB 5C81A 1K8ZB 2ZRIA 3TLKA 4GGMX 4BKOA 3UGQA 5E38A 3DBOB 3ND6A 1G9XA 2UYHA 3GRAA 1OH6A 5DTRA 3RGWS 1PJTA 3WAGA 4LJYA 5E1OA 1WUHS 4LYAA 3HYSA 3PYXA 1JQ3A 2IZ1A 1R4ZA 4P58A 3TR0A 5LOVF 4HXYA 1EB9A 5I47A 1VRCA 2GOYA 3IQIX 1UBMS 3N8KA 5AO9A 4DQ0A 3FROA 1JIXA 5JBNA 1Z45A 4C43A 1SC6A 2K6GA 3O5AA 2WFLB 4YP6A 2FEPA 1H8HA 3L4KA 2CKDA 5EP1A 1NNI1 2JCYA 1YZVA 3E9NA 3DE0X 3FYTA 4HRYA 4EYEA 4EHKA 2A94A 2I3AA 3D59A 1P75A 5EHQA 3R8CA 2VJCA 1RXUA 5G41A 1Q7CA 4M0DA 4MX8A 1NJGA 3WV4A 1W47A 3BJMA 2WE7A 3D3KA 2XQJA 5AUOB 4GVPA 2WJAA 3INRA 2W11A 1Y5IA 2V97A 3IBCA 2NN3C 3ND9A 3Q11A 4MW6A 3WIDA 2VH2A 5LDHA 2BMJA 3FYCA 5KDDA 1AQLA 3G13A 2RHDA 2WTUA 4FDVA 1JW9B 1USGA 2WJZB 1UIMA 2H7XA 4I99A 1ZX1A 2WA1A 1U8ZA 2H5EA 3GVCA 3PC8A 2FSVA 4H6WA 2AYYA 3OUTA 2HRCA 3ABSB 2H2DA 4IXNA 2EW8A 4C0BA 3TVTA 4CQMB 1TGVA 1VG9B 3ASZA 4IO0A 4D82A 5EJ5A 1C1XB 3TQIA 1LPAB 4B7XA 2CL7X 2GYWA 3A2MA 3R7DA 3DKKA 4BVJA 1HQKA 1R16A 3LDGA 4BO7A 4CU5A 2PT9A 3EXEA 3ETDA 2BLNA 1LDMA 2NGRA 3M3HA 4U0KA 3NUQA 1GCOA 1RKXA 4XLTA 3EXFA 3BMNA 4WWHA 4LV5B 1NVVR 3ZJUA 3EUEA 2OG1A 2O14A 5EMLA 3FOFC 1G8FA 4FMPA 3FWNA 3IJPA 5DK6A 2GD6A 1MH1A 1XRSB 3TFWA 2DTXA 3A58B 5H5JA 4PSVA 2EERA 4IYJA 4BQNA 2AJDA 2GBPA 3BOSA 1C7IA 3LO5A 4ER0A 4D9IA 1TAHA 3JR7A 5IBRA 4F2DA 1H85A 1II8A 1SUIA 1C7QA 5BV8A 2ZXUA 2GJ4A 1I51A 2Q0XA 3HB9A 1S2NA 3VU1A 2QPAA 3QENA 5BN5B 4ZRDA 1OTYA 5FFNA 2CEAA 2CW5A 4XM0A 1SMKA 2QPOA 3BXFA 3TDKA 1N78A 3W2IA 4FUQA 2F00A 4FYKA 2RGYA 1Y8ZA 3NWJA 3GEBA 5DRYA 3E1SA 2PDAA 1YVEI 3JAWA 5IF9A 5CCEA 1GCIA 2ZXFA 1NURA 4ARVA 2VVTA 1SCNE 2BEKA 1FDTA 1IM5A 2IXFA 3A70A 3GLTA 4IFBA 2V1UA 2VP3A 3I5AA 3IIMA 4YBZA 3H5RA 1AUOA 3VHLB 5E3HA 2X14A 4IDDA 1ZN2A 3FGNA 2AOTB 1LK7A 1WA5A 2WJIA 3SYNA 1SUSA 3W9YA 3M70A 1CT9A 1L5VA 1GL9B 2GPSA 1JHVA 3AJDA 3G0IA 4YRRA 1TQ8A 3DAGA 3GNSA 3ZLTA 1ADFA 1VP3A 2R6AA 5SICE 2EFYA 5HYVA 1FJGB 3TTUA 4G81A 1TAQA 4H7KA 2P3LA 5HUHA 1ZD9A 3T3EA 3W5SA 1GDTA 1GR1A 4OH1A 3I6IA 5DH9A 4Q0MA 2YN4A 4EDHA 5AUQA 1GL3A 1K6EA 4MYRA 2IKQA 4MQ5A 4QUAA 4AS2A 3VKGA 5G40A 1X7ZB 5BYKA 3VNRA 1DG3A 5EEHA 4KXUA 4H18A 1TYBE 1CZKA 4OQZA 1PW5A 1TA4A 1A27A 4CF5A 2Q49A 1EM6A 5EQTA 1NMEA 2GN1A 1R5OA 1VKZA 1WB9A 4TZ0A 3BT7A 3A1DA 2FMXA 3F8TA 4K9LA 2BKEA 3UMCA 3VDXA 3ADDA 2I9KA 3KFXA 5IAJA 3M1IA 3PVZA 2ZAYA 4K6GA 1CG6A 3RRNA 5H0IA 2E6UX 1NM5C 2ZSEA 5JAIA 1H23A 3LRXA 2JEZA 2PKXA 3AF2A 2I1VB 1OLXB 1JEEA 1MXHA 4WDQA 5DHPA 1UOOA 4FMDF 3S4YA 4CEHB 1U63A 3L8YA 3ZZTA 1MF7A 1V95A 3QVWA 3MQFA 4R1UA 1VJCA 3GC6A 3LW8A 2OOSA 4JZKA 4LQLA 4RKQA 2IODA 1TJNA 4ZDWA 4DA8A 4P0TA 1Z17A 4EVSA 4ER5A 1K08A 3K9GA 4K03A 1WAMA 5HA5A 4TTQA 1U94A 4IFEA 4M1TA 4EA9A 4CKZA 4QUGA 3F7MA 1GPNA 3GLHE 1ZGZA 4OHBA 3G17A 3IMKA 3NAZA 4UDYX 4ZDKA 1O9HA 2OVFA 1MNAA 3V3KA 2D7CA 1UKCA 2VCYA 1RWKA 3GVXA 4IR7A 1E5TA 3LKZA 1D2RA 1KFEB 2B83A 4CLDA 2F62A 4FFLA 3OE4A 4B87A 4PTZA 1HNXB 1FTWA 1JTVA 2X6QA 4C22A 2YWHA 3HBJA 2M1XA 1NXWA 1ZUD1 3F96A 1QV6A 2EZUA 1RQ2A 3MPUA 4GI1A 3E1KA 4J8PA 1E3MA 1DOAA 2YJ3A 3UPUA 1G21A 3C5EA 2WJ6A 1RPAA 1NW3A 4YRDA 1FLVA 1CF4A 5D87A 6LDHA 1PUJA 5H1YA 1I3LA 4BCDA 2PX5A 3I4FA 1U3WA 4O5AA 1V41E 2VNSA 2BAGA 2OR3A 3E05A 3FNRA 1AGPA 2X4LA 2QQFA 5DYIA 4LPSA 2HK6A 3GUCA 2QVYX 1GJRA 1D8AA 4N0EA 1YHYA 1DBIA 4G26A 4A1OA 3NTOA 3ETEA 3ZWPA 4RTJA 5H8WA 2Z6QA 2G70A 3KYBA 1FNNA 3ECAA 3OQPA 1V16B 1YR8A 5EKDA 1Z5NA 1KJJA 3E22B 1U8CB 1R0ZA 4Q1VA 5ULLA 4AMZA 3NFYA 4RD4A 1CSEE 1XZQA 4OQNA 4X71A 1VLQA 4O4LB 4K9SA 4EM6A 5L4LA 2HTEA 5BV2P 4RH3A 2C5LA 5GP1A 1YQUA 3CEPB 2H9IA 5DN6D 4LBWA 5LZ9A 5FYQA 4IIHA 3ZE2B 1EE1A 2EFCB 3PTAA 2Y1GA 1LRLA 1GDDA 2HC9A 3PIIA 4ARIA 1Z2EA 2PXXA 4BV9A 3A6PC 1R6DA 4RHXA 4M1WA 2AWNA 3T4EA 4RLHA 4MB0A 1U5BB 2PVSA 3GLKA 3WGGA 3HKEA 1IONA 1IMOA 3ONDA 1TJ4A 4MVJA 3CX3A 4BV8A 1PJ2A 3HUTA 4QJ4A 5ALXA 2GZ3A 2RGCA 4PYNA 2QQGA 5ALRA 4IJQA 1BE8A 1C4XA 1RI1A 3QWHA 4KBFA 4FZRA 4MPDA 4O2BB 1T26A 4N03A 3C1TA 4PFSA 4QGHA 1DKQA 1BVUA 3QXJA 4C2BA 1UMBA 2AR0A 2GLUA 2ZS8A 2XT6A 3CLUD 4UJ5A 1EFAA 1T9ZA 1HDEA 4L2IB 4UTZA 5JSYA 2W2LD 3MWDB 2CXHA 3THXA 4RVCA 1PJCA 1LVHA 2Z1MA 4Z0NA 4D3XA 4ZYLA 4PLCA 4QJ5A 4W99A 3Q3IA 4HDQB 6REQB 4KWCA 3KTDA 3P9RA 4NPAA 3ZWAA 1P33A 3HNOA 1AZTA 4O2BF 5JNRA 3M6LA 1WF6A 4A2CA 1E79A 2QVLA 4GI7A 5KVQA 3GH1A 2V7PA 3EGEA 5AVUA 5J5AA 1GP2A 5KMGB 5KINB 5F9HA 5DFAA 3L41A 3A1UA 2P9JA 1ID8A 1EKXA 3F5DA 1VKNA 3I6QA 3S1LA 2ESRA 1LS6A 2G7MC 5EIAA 4MAFA 3QTBA 3T5PA 4RTRA 1G3RA 3PC8C 4GF5A 5ETJA 2FSVC 2W9XA 4TLEA 1JEYB 4DMGA 1KK0A 4AECA 4LHYA 1JVNA 3LUFA 1OD6A 3LQ4A 2D4HA 5CURA 3HXPA 3O93A 4B6SA 1T10A 3PF9A 1QFZA 1LLCA 1VQ1A 2JATA 4KVGA 3EOZA 4JBLA 1JJIA 4F5ZA 3NDBB 1KKMA 1GPLA 3IUQA 3I8SA 4Q39A 1W0KA 1XPRA 5A9SA 2BTOA 2H59A 1LZKA 3NANA 2P5SA 5AIAA 3DV2A 1EXWA 2NYVA 1BCRB 3N59A 4FHFA 4ZI7F 1SB8A 1NFQA 1UP4A 2GKGA 2VHCA 3CM0A 2C2BA 2AN9A 3C14C 4LF8B 2PXAA 2BSAA 3DV0A 4TTTS 5HIIA 4J75A 1K4KA 2BJHA 1G7SA 3E53A 3T9FA 1KH1A 1RI2A 1S8FA