2WOJA

Adp-alf4 complex of s. cerevisiae get3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
301
Chain Sequence
b'VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPASE GET3
publication title The Structural Basis of Tail-Anchored Membrane Protein Recognition by Get3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 104
structure length 301
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wojA00
1MABB 1E69A 4WAUA 1UKVY 2AXNA 5JCZA 2G0NA 2JLSA 1LB1B 1TEVA 3AVWA 1S0UA 3T12A 5KTYA 3C7KA 4HLQB 1SXJA 1KGDA 4S2EA 2PJRA 4P4SB 2HXSA 2WKRA 4KFUA 5FPSA 3KTAB 2H92A 4P3YA 2FEMA 2RMKA 1W0JD 4U7DA 3TUJC 4FI3C 3E5HA 2ZI7A 1P2TA 2DY1A 1FP6A 3MWLA 1GNQA 1XCGB 4TMXA 1N25A 3HR8A 3I72A 3WYAA 1EFHA 1G3RA 3MUFA 1BIFA 3QBTA 4A8JA 1GFIA 3EASA 4C0LA 2F43A 3GLGE 1DAHA 1KSFX 3V9PA 2BCJQ 3WHLA 4IOMA 3K70B 4QJ5A 1GRRA 3WP1B 5J47A 2FGKA 3NBFA 4H1VA 1J90A 1QHGA 1VHTA 4LPKA 4DBLC 2OCBA 1E2LA 4HDCA 3A4LA 5EE0A 1W7AA 1W4CA 2ZAOA 2AKYA 4WZAE 1FTNA 4B75A 3L8YA 4NCIA 2IBMA 4NCNA 4KSCA 4XJXA 5C1BA 2YZ2A 4B34A 1WCV1 1XXHA 1E9AA 2BIFA 2HV8A 2HCBA 4E07A 4JVNA 2DFKB 2FPKA 4I1VA 4LYHA 1OKKA 3BAFA 1COWA 3PR1A 5KDLA 1D2MA 4KAXA 1XPRA 3EZ7A 4D82A 3PUVA 3GJ0A 721PA 4Q1BA 1JR3E 1OV4A 4RD3A 3KUDA 4DB2A 3MWJA 1N0WA 5AWFC 3B1YA 1KI1A 2JA1A 3TW4A 1G8FA 2YHSA 3HP1A 2ERYA 1XCPA 2OBNA 5EE9A 1MO6A 4KLZA 4PSAA 2J7PD 4M9QA 3RANA 4C7OA 1MH1A 3PFIA 1XMVA 1GSIA 2DWOA 2HDNB 1D2EA 4HI0E 4BZXA 1DG1G 2ZE7A 4PC2A 4XD7D 3WBJA 1TQ2A 1VG8A 2IYLD 2FFHA 4KJZA 2IYSA 1TL7C 1GRNA 4Q1AA 3ZZTA 2ATVA 1JAHA 3MWKA 3PEWA 2ZU0C 3ZQ6A 2QA5A 4DLTA 1RZ3A 3RLFA 2X1VA 1R8SA 5TV2A 3WRXC 3SFZA 4LYFA 3B13B 2CMKA 2CLCX 2WKPA 1ZM2A 2QMUA 4Q47A 3NVAA 2O0KA 1E2KA 3L82B 2QM8A 4URZR 5CIQA 3WMGA 3P27A 2AK2A 4H1UA 4AC9A 4QGGA 1RW4A 2PLRA 3TSZA 1R0WA 2XNDD 4B3GA 4IW3B 3GJ3A 2JLQA 1P2UA 1S4QA 5ANRB 3GLFB 1R5NA 2NIPA 4US2R 1KKMA 2G1KA 1OHHD 2BJVA 1TPZA 4F93B 5JZVA 4JSTA 1JR6A 1HURA 1NN5A 1NY5A 1YR9A 4R9UC 5H1YA 1VCIA 4BLSA 2F1JA 3OZXA 3G82C 4P33A 3ZZ0A 1W46A 2XB2A 4GOXA 3KTAA 2XTMA 1TQ4A 2GAAA 3SHFA 4D80A 4TT3A 3FMFA 5JSZB 2VYFA 2W6IA 3NEJA 1RE0A 4NKRA 3B1VA 3I32A 4B35A 3AP3A 4DLRA 2J3EA 4DDUA 5JI2E 2QP3A 1XEXB 4CW7A 3QKRB 2GJ8A 3D6TB 2AWNA 4DC9A 4GMDA 4F7WA 3HU2A 2G3YA 1KAOA 1EWRA 1UF9A 1CR1A 3FB4A 1CEEA 4RY2A 1JPNA 4LJ8A 4XWAA 2ZJAA 5M04A 2QRNA 4P0TA 4YMUA 4JVMA 1H65A 2VA8A 3NTUA 3T06B 3CR7A 3WYGA 3AF4A 4BGDA 1OH7A 2BV3A 3OAAA 3T34A 3K0SA 4B48A 2Q9AA 3R8FA 4D4MA 1A5TA 1Q1ZA 1AM4D 1VDZA 4KV9A 3AGQA 1IQPA 1WP9A 1G7CA 2R6GA 1OFUX 4A0RA 3H1TA 5F98A 5JJKA 1W48A 3BB3A 3B9PA 1XTSA 3OF5A 4WXRA 4D25A 2IUUA 4Q4JB 2DFNA 4LPSA 2YWGA 2W00A 3C5HA 4ESHA 1NJFA 1E2DA 1IM2A 2H1LA 1EG7A 3OFND 4DHEA 2ZSFA 1NG9A 3I73A 4Q7LA 2PT5A 4CEIA 1AIPA 3AGPA 3BB1A 2WIBA 3BD9A 2R6AA 1ZAKA 1D6JA 2ZRHA 4Y0AA 5AJVB 3HDTA 1NSFA 4C4PA 4EFNA 1WMSA 4LZZA 3T15A 1W49A 3VR2A 1R10A 4ZI2A 2ZSEA 5G3ZA 4ZDIA 3QIAA 4JKYA 3GLGA 5B2ZA 4BE7B 3IGFA 1R0ZA 1YRAA 2VP0A 3CRQA 4ZCIA 1G8GA 2W0MA 1HE8B 4AK9A 221PA 3THWB 3BH0A 2PEZA 1E4YA 2BBWA 5TY0A 1JXMA 4LHZA 1D9ZA 4UNPA 3H4MA 1OH8A 2DCUA 1QHYA 3VU9A 2ZYVX 2VHQA 4CEHA 3Q5DA 2OZEA 3EZ6A 4ITRC 3VHLB 4V0ME 3CW2A 4OHZA 2CL0X 3NH6A 5DHAA 2Z6VA 3GD7A 3GJ7A 4DVGA 3MLEA 4UNNA 2ORVA 1CJKC 1S3GA 2IYXA 2PEYA 3RS5A 3A1UA 4GBMA 3U6KA 2CE2X 4KI0A 3NBXX 4MUAA 3U3MA 1G1MA 3FOZA 1KMHB 5C4MA 4W5HA 2IYVA 4M1KA 2WWIA 2ZPTX 4MH0R 4LGMA 1XFAA 4HZIA 1JR3A 3TJZA 2J0SA 4FXPA 5H70A 2WPDA 1ZNWA 1KO8A 1WRBA 3RC3A 1GKYA 4PHFA 1ODFA 2H16A 2AX4A 2CL6X 5A0FA 3GPLA 2CNWA 1VMAA 2KJQA 3KQUA 4JL6A 2RGEA 4PQYA 4YDSA 5K8TA 3QKUA 4OYHA 4KFRA 4CRWB 2H18A 2X8AA 1NY6A 2ZUBA 1Z06A 4JLJA 1XJ0A 5FUWA 3RS0A 3OIYA 5JSZA 2WSSA 4WZ6A 3ZDQA 3RWOA 4RD4A 4OHVA 2Q9BA 3IIMA 1NLFA 1UKZA 1YU9A 2UKDA 4HAXA 4M0LA 1K8RA 3JZAA 1XF9A 2J1LA 3B5JA 1KJZA 4BRWA 5CIWA 4G5QA 4TZ0A 2GVZC 1EFUA 2WMNB 3PCRB 1RRCA 2QNRA 2GXQA 4QHYA 2O8DA 3OEHA 2YWFA 1XD8A 1SVWA 5EUQB 1Z07A 2V8OA 3OHMA 2C96A 1NMXA 3L0IB 2AD5A 1RJ9B 2V7QA 4KBFA 5E95A 2R8RA 3QENA 2QAGB 1UEJA 1L7VC 2UVQA 1IOZA 4BEBA 3A4MA 5FL7D 1ZIPA 1SULA 3KX2A 5D3MB 1UDWA 4MGIR 4Q4JA 1XTJA 4A4DA 1N6KA 1RRGA 4LBZA 4ACBA 4KO8A 3TVDA 3IEVA 4CT5A 4O3MA 1FQKA 1OXSC 1ZIOA 1G6OA 4MYUA 5DI3B 2YVUA 1PLKA 2JLXA 1XCMA 3H2YA 1II8A 1OXTA 1OT3A 2A5YB 2FV8A 1US8A 3W6OA 4PAQA 2QAGC 4GP6A 1KKLA 3L0SA 2REOA 1GKIA 1T0JB 4HEJA 2QSYA 2ORWA 4NP6A 1ZMXA 3REFA 3ADKA 4NMMA 1V43A 4B33A 4QM7A 3FGNA 4QGAA 2BMFA 1IAQA 3K9HA 4M1WA 1KHTA 4A82A 3I62A 4D26A 1KO7A 3ZD6A 3FMIA 4K46A 1PUIA 3EW9A 4ZV4A 1SGWA 2IYRA 2QY9A 5H8WA 2VHCA 1OH6A 2OCYC 5GVRA 2J7KA 1XMSA 3IILA 2Z5FA 1E1QD 5BWMA 2RB4A 1WA5A 2FZ4A 1G8YA 2VP2A 3B85A 3HPRA 2FWRA 3K0AB 4RVCA 3UKDA 2PX0A 4RCYA 2VL7A 2E1RA 1U8YA 3MJRA 2DFLA 1X8KA 3UMSA 1KMHA 5JRZA 3IO5A 1FTSA 4US0R 2CJWA 5GADl 2P0EA 3L0PA 2ZREA 3NKVA 3MD0A 1U9IC 4DUGA 4K8OA 1PV4A 2QMOA 4B76A 2D4HA 5BYKA 5FUVA 1HTWA 3DKVA 3IBYA 3KKOA 4M9XA 1SVIA 1P5ZB 2HCJB 4CT4B 4HUQB 3KQHA 1G8HA 4P32A 1DAMA 2WWYA 3U4QB 4JT4A 5LD2B 4FWIB 1WB9A 5K8IA 1G17A 2R2AA 4PPFA 4JLPA 2N42A 3BJIC 4JBWA 1GKUB 1G64A 2VP5A 1YR7A 4BFUA 4Q21A 2FZLA 1X3SA 4G3XA 1YZUA 2IK8A 4TLBA 3AEZA 1ESMA 4DCUA 3QPWA 5C18A 1FP7A 3IBGA 4BLOA 3DMDA 4ZPXA 4JLVA 4NTZA 1VG0B 4M53A 3A58B 4URWR 4TMZA 1TNDA 1RRPA 2XZLA 4IDPA 2VSOA 4POAA 2V6JA 1N6OA 3EC1A 1BYIA 1F2TA 5LD2C 3LX5A 3TKLA 2FOLA 1ZC4A 2H17A 3BK7A 3Q7QA 3A1SA 1Z6TA 2Q3MA 3J81k 1Z2AA 2IS2A 1M74A 1ZU4A 1X6VA 2R9VA 2FFAA 2OCPA 1T91A 1AN0A 4LJ5A 2WTUA 3QQ5A 4LJ9A 3A1VA 4ZDJA 3AVOA 3Q8XB 2ZRBA 4QGFA 4UNRA 1IJFA 1IN7A 2KE5A 1WBDA 2JDIA 2NG1A 3LY5A 2DYKA 3CX7A 4TQ9A 5JFGA 1MO5A 2QAGA 5EJEA 2XOKD 3FVQA 1MO4A 3DMNA 4L16A 4B73A 1KI8A 4JT2A 1DAEA 1KO5A 3THYA 5L3SB 4TYWA 2IUTA 2VLIA 1S96A 3TAHA 1NNEA 1G6HA 2GHIA 5CLQA 4TZ6A 1P3JA 2NMVA 4B47A 2GJKA 1NBMD 4IXNA 3NHAA 5K8UA 3OESA 2C9OA 2QPAA 1UKEA 1AS2A 3QPVA 1XX6A 3JZMA 3QVUA 4KYIB 1O3YA 3KXIA 2GA8A 5J5CA 2C04A 3CRRA 1ONBA 4Q18A 3CPHA 3AKYA 2ODNA 1H8HD 3RDPA 1TADA 1E2HA 2IEYA 4PAOA 2DWPA 4AIIA 4RKEA 5DYIA 4DLXA 2B8WA 3AP1A 3ADDA 2IYYA 1P9NA 4IVRA 2WJVA 4OK6A 2J41A 3MMPA 1E2MA 1OW3B 2EFGA 1Q22A 1GRQA 3CH4B 3BFVA 3RRNA 3V00A 3W5JA 3NWJA 4B6EA 2XSZA 3M1IA 2BEJA 3SN6A 4R2HA 2I1QA 4EQ6B 1GL7A 2ZRGA 4D0NA 1LV7A 4LY6A 5EE5B 2HXYA 3N2IA 2O8CA 1CR4A 2IHYA 4IEIA 4DRZA 2BKUA 3CNOA 4OL0A 3TLXA 2MSDB 5KSOA 2QPOA 1XWIA 4NZYA 1VHLA 3KQKA 1KDTA 1CS4C 2WAYA 4V03A 4QJ3A 3I8SA 1E1RA 4YDHB 5FBRB 1VCNA 2MMGA 4DJTA 1ZUNB 1E9RA 1VTKA 3QJYA 2DBYA 4HB4A 1XTRA 2GZDA 4NYJQ 4D0GA 1SXJD 1AJEA 4QBHA 1GDDA 3AKCA 4MRSA 1E94E 4HUQA 1FNNA 2QTVB 2LCFA 4R7ZA 1CR0A 5FPKA 4DLYA 5EP1A 2F7SA 2J0QA 4BEJA 1NN1A 4GOJA 2QQEA 3HYTA 4RFSB 3SYNA 2V54A 3MGCA 3EAQA 3ZZUA 3Q3JB 2KWIA 4HZUB 4Q00A 1NKTA 3U7EB 4DIEA 2JJ8A 2CCGA 2RHDA 4Q1CA 4XVQA 3AVXA 2IHBA 5DN6A 1CBUA 4PZYA 2GEDA 1XP8A 4LJ6A 1IJEA 5EUMA 5BXQC 2WJJA 4HUTA 2GRJA 3TUIC 3F8TA 2E87A 1AQYA 4V02A 3U5ZB 1MR3F 1Q3TA 1DTSA 5F3WB 5B58C 4DSTA 1M34E 1GAJA 2QTHA 3VX3A 3LV8A 1KI3A 4E03A 1KO4A 2FSHA 3IQXA 4W5WA 3U44A 2CLDX 2B92A 4TTRA 2ZRKA 1J70A 3DKPA 3OIVA 4JYCA 4M1TA 4PC6A 1SVSA 5TARA 2D7DA 2F3RA 1A2KC 1GOTA 2ZROA 4A9AA 3IIJA 4P4TA 4EKDA 1JBKA 2IXFA 3QEOA 3HWSA 4NE2A 4Q9HA 3DOFA 1OKKD 1P75A 1JPJA 2IYZA 1T3LA 3B8HA 4Q4HB 4LYJA 5CDFA 4AYTA 1Z47A 4C0KA 2LWIA 2QMHA 4XSGA 4D4LA 3U7GA 4N1AA 4KVGA 4Q48A 5L3SA 1ZUIA 2BKEA 2ZANA 2C2HA 1HH4A 1HT1E 1W2GA 3SNHA 1GTVA 2OCAA 3ONWA 4EDHA 2KBFA 4LYAA 2EFCB 1ZNXA 2XITA 1L4UA 1KI2A 3LA6A 4PZZA 3SZRA 4XVRA 1N0VC 4TMTA 4QOSA 3AP2A 4UNSA 2BDTA 2RAPA 2IYUA 2YC2C 4JZKA 2NPFA 4WOPA 4YMSA 5GJWC 4IRUB 1HA3A 2CEAA 4GPTA 2H8KA 1MT0A 1NVXQ 4C0BA 4EFLA 4IFBA 3TSWA 4XWOA 1W5SA 3AVTA 4EPRA 2ZI3A 3GFOA 2JIZA 4LUCA 3RABA 3HPQA 3P4YA 2DFTA 4Q4AA 4PR0A 4BRUA 1E3MA 4OBEA 1TUEA 1CXZA 4LHYA 5DSZA 2MSCB 2ZRAA 2ZXUA 1XU4A 3AF3A 3U7HB 1G3QA 4F4CA 2FA9A 2OAP1 1CTQA 2V9PA 4IEEA 1DPFA 2IF2A 3MWYW 3Q5EA 4GRAA 2BCGY 2NO0A 2IWHA 1XD2A 3SQWA 1OH5A 5TMPA 2EFEB 3WNCA 4JS0A 4LJAA 3BB4A 4D2IA 3BH6A 1WF3A 2NPIA 5HE8A 4ARZB 4DLVA 4TQUS 2ZRPA 1XRJA 5FPHA 3FFAA 4BFXA 1W36C 1ETUA 1II0A 3K0FB 1NVUQ 4R71A 1QF9A 1TEXA 4C0JA 1EESA 5HR5A 4TT3D 1FUKA 5JS7A 1DOAA 2W58A 1BMFD 4FMCB 1QHIA 1R4AA 2W6ID 5DIFA 1PJRA 2BMDA 3HJNA 2RH5A 4LV8B 1XTKA 4Z54A 2VO1A 3K8YA 1P7CA 2FMXA 4MYTA 3W6NA 3EZ9A 1IONA 3K9GA 4X8OA 2ZI5A 5G53C 2JJ2D 4PQRA 1J8YF 4I1OA 3SHWA 4KODA 4AG5A 3ZVNA 3CNNA 1PVOA 1KK1A 3EPJA 4ACAA 3ECCA 3THXB 1KJWA 1G21E 3VHXA 1N6RA 3BGWA 4DSNA 1F3OA 2ODWA 3OAAD 1Q44A 3L2OB 1GP2A 2XX3A 3VR1A 2DWQA 4IDOA 1KI9A 2JLUA 1O87A 3CWQA 1IN6A 4JIMA 2HYDA 4H9GA 4PAMA 5CB6A 1E9DA 5P21A 1FQJA 4IOKA 4NYMR 4Q4HA 5JBQA 1XDBA 4C2UA 4B43A 3K70C 1KZ7B 3WY9A 4JLDA 1A7JA 2ZJ5A 4LRWA 4Y0VA 2A2ZA 5ELXA 3DM9B 5HZKA 2FF7A 2AFIE 2WWGA 3GLFE 2W2TA 5FFMA 4Z1MD 4MGZR 2GTPA 1CRQA 2ORIA 1NLZA 2WWWA 3EARA 3UIEA 1T6NA 3BC1A 3LBHA 3P32A 1G291 3DZ8A 4DLZA 2AK3A 1W0KA 4G5GA 2ZJZA 3JVUA 2AR7A 2IYTA 3ZQJA 1NRJB 2UZIR 4M2LA 1XMJA 4BFSA 4NCKA 3W3AA 2ZRFA 5CB8A 1E9SA 2IW3A 2ZJBA 4Q03A 4D6PA 3TMKA 2FSIA 1II9A 1OB2A 3K53A 3HU1A 1J2JA 1TF2A 4A15A 1Z63A 1MO3A 4L4UA 1KI7A 4AKEA 4LJ7A 1E0AA 4Q9KA 3CRW1 1OPXA 4BFTA 1E2IA 2A5JA 2VQSA 5D3QA 1EXMA 3E1SA 1QRAA 3NG1A 5DLQC 2PCLA 5L3QB 4MRVA 2GEUA 3EIEA 2A9KA 2WV9A 2GXUA 4ESVA 4UXIA 1IHUA 5AK0A 4L5BA 4BFWA 1OF1A 2RKOA 1UBFA 1GNPA 2K5UA 2ZTSA 3LO5A 3QKSA 4FMDB 5CITA 1SHKA 2ZYTX 1P61B 2H5EA 1W4BA 3AKEA 5EP3A 5B57C 4MYHA 2J0UB 2JJ1A 4AYXA 3X1XA 5TB5A 4JJZA 1UKYA 1JR3D 3LWNA 2G9NA 3R9IA 3H84A 1VYVA 4U02A 2VHUA 4ARZA 2O8EA 1MABA 3PUWA 4TMKA 4DIDA 5KPDA 2CNWD 5F2EA 4OQFA 3IEUA 1E9CA 3JVVA 1E99A 2CK3D 1X8LA 3TR5A 4PC3A 1D5CA 4P4SA 4UNQA 4PPNA 4Q9LA 3I5YA 3LLMA 2BBOA 4UXHA 4OHYA 1ZW6A 4C0HA 1KAGA 2ZRLA 2WSSD 1UBGA 1PUJA 4AI6A 1AGPA 2GCNA 4QNRA 3NDPA 2FNAA 2OT3B 2YWHA 2DHRA 2OBLA 3K1JA 3ND8A 4YMTA 4JMPA 2OM2A 1P60A 2WKQA 2ZEJA 4FWTA 1KY3A 5K8LA 1IN5A 2QU8A 2AFHE 1YZKA 2X19A 1C4OA 5BQ5A 4PO1A 3OEHD 2C9CA 1ZP6A 3C8UA 1G4UR 3CM0A 5E3HA 1J7KA 4GMXA 4XVUA 2V7QD 3CUEF 3EZ2A 4QRHA 2F1HA 4JBYA 1Q1BA 2YOFA 3SBEA 4DXAA 4ZDKA 1QZXA 4Z51A 1CF4A 1UJ2A 2OESA 4QJ4A 2C99A 5SZHB 2PBRA 3IDQA 4N0DA 1Q20A 5J4LA 3SYLA 1N2CE 3SI7A 2ZVQX 3C4JA 2ZSAA 3FFBA 3CPJB 4JLNA 1DO0A 5EP4A 2HLDD 1YVDA 4C2TA 5FR2A 1KJYA 1ESNA 1AKEA 4C9BA 1KDOA 1XEFA 2A3RA 4M8NE 1XD9A 3QXCA 3W3ZB 1Z6AA 2PMKA 2C77A 2YOHA 1KNQA 1YJ5A 1ZUHA 2ZUDA 4TSFA 1HV8A 2XTNA 2BVNA 3QXSA 1SVOA 1JEDA 2J9RA 4HAVA 3ZYCA 4R2IA 3WBKA 1JALA 3ADBA 2ZVPX 1UADA 3I5XA 3KQNA 1WE2A 4YLGA 1OXVA 3UPUA 5J40A 5JECA 2NTYC 2HF9A 2OBMA 3RWMB 2GF9A 4O25A 1N6HA 4OI0A 3OEEA 2AWOA 4TTQA 1N3BA 1G5PA 1YZTA 2V4ZA 3U2QA 1GWNA 1DVRA 1T9HA 2ZETA 1JNYA 3P1JA 3LFUA 1E32A 2G0TA 4TMWA 3SYKA 2HF8A 5IF9A 2C78A 4B3DA 1NJGA 2OEPA 1U0HC 2XTZA 1XEWX 1OXUA 2VF7A 4DKXA 4DWJA 2ZSBA 4XD7A 2ZE8A 4L15A 2QPTA 4LCBA 3T1QA 2KB0A 3WNBA 3ZS8A 2PL3A 2CL7X 3D8BA 3GLFA 2ASEA 5L3RA 4DCTA 4G01B 2ZYUX 5FTMA 2GDJA 5TVKA 2A5FA 2HYIC 4PPGA 2GETA 1U2RA 1FFHA 1S3SA 4LHXA 1TMKA 1Z0AA 3CRVA 4IOJA 4RSGA 1OIXA 4WW0A 2Q21A 4Q7KA 3LVRE 4QHSA 4QM6A 4B2IA 4YONB 1HQCA 2BOVA 1JECA 1KYIA 1KY2A 4IDQA 2FPLA 1M2OB 1XEXA 4TLCA 2OG2A 4M9ZA 4PHHA 2XNDA 3WMFA 3QKRA 4EIWA 3WHKA 1R8QA 3RS4A 1BO6A 2GXSA 3UG7A 1Z83A 2ZE6A 5AUPB 1D9XA 2RCNA 3FKQA 2WWHA 4EJSB 4M1MA 3A37A 1DEKA 2QP9X 2ZS8A 3KFXA 5EP2A 4B2PA 4EAQA 1GITA 3MRSA 4ZCLA 1X86B 3QG1A 3VKWA 2GZAA 2KSQA 4QHTA 1NMZA 4KBGA 5DISB 1GG2A 2P5SA 4G5SA 4US1R 2ZRIA 2W0SA 1CJMA 1LFDB 2QL6A 5KHOC 1M6NA 4QG7A 1E0KA 2JASA 2VP9A 3A8TA 1T3HA 2JLRA 3C15C 3KKPA 3I92A 2J87A 2HEIA 4TLEA 5KSYA 2EYQA 3UWKA 2F6RA 3W9YA 2OAQ1 1E2JA 1QG2A 5JLJA 5JRJA 2QENA 4LSGA 5IK2A 5KDDA 1DO2A 1UM8A 2CHQA 2X2FA 3X1YA 2CDNA 1JEEA 2WICA 1H8EA 3SBDA 1KI6B 1NVVQ 4YXWA 1WBBA 1NP6A 4FD2A 3LXXA 4HAZA 4Z8YA 4YMVA 2ZQ5A 3QXJA 4CF7A 2JLYA 4BPBA 1PLJA 4RD0A 3SJCA 1EGAA 5KDOA 4BECA 4HLCA 1KO1A 3THWA 2NO6A 5TXGA 1ZRHA 3KKMA 1TAGA 2W6JD 4EPVA 1GM5A 4NYJR 1U98A 1HEIA 2XSZD 2ZE5A 3BS4A 1SHZA 3OFNA 4DDTA 4CEJB 1CU1A 5EZ5A 5FBWB 3KQLA 3EZFA 1W44A 1X8JA 1U99A 2OUKA 2WJIA 3DM5A 5LB4A 1SVLA 2VEDA 5DO9A 3SR0A 3REGA 2HUPA 1J8MF 1TU3A 4YMWA 4ZCMA 4LDJA 3O47A 3IUYA 2IS6A 3RRYA 1R2QA 4V0OA 4JLBA 1RC8A 1G4AE 1M1YE 2CVHA 3FHCB 2NZ8A 3R8CA 3TRFA 4B74A 3ZIAD 2FSFA 3K9LA 4IVPA 1GNRA 3AB3A 5DE3A 4TTPA 3TNFA 5JI3E 5LDDC 1CULC 5BYJA 1EK0A 4E09A 5FOSA 3KB1A 1NN0A 1Z22A 1FX0B 2IS4A 1L2TA 5IRCD 3GQBA 4OQXA 2ZRCA 2C98A 1OFHA 1W5TA 2AXPA 3TR0A 5J4KA 3P20A 1U81A 1XMIA 2QM7A 2XB4A 2QTFA 3DZDA 4DSOA 1A4RA 1KIMA 1RIFA 5DN6D 4C0QC 3MSXA 4DLUA 3GFPA 4KHZA 2VRWA 1N5IA 4TLAA 3RS2A 5BN5A 3KFVA 3A4NA 3R20A 1IY0A 4NYIQ 2OHFA 3GLHE 3G0HA 1YZQA 5FI1B 4OI1A 3B78A 4MUBA 1AZSC 1N0UA 2EFDB 3UK6A 4RZ3A 2VTKA 2HT1A 2IA5A 1M8PA 3T35A 4KFTA 1G8PA 1JXOA 1Q1EA 4ZIRB 5BN4A 4RJLA 1NBME 4GP7A 3IO3A 1XZQA 2PT7A 3WRYC 2WWFA 4V0MA 2EYUA 4XSHA 3RVBA 1E9EA 3CX8A 2GNOA 1RJ9A 4R98A 3TQCA 1N6NA 1R6BX 3EIQA 3SJAA 2P65A 2W2VA 4Q7MB 2PJZA 3LD9A 5A5GA 1I4LD 4DB4A 1IY2A 3I4LA 3KDSE 4MYCA 3GJ6A 3QI2A 4TYNA 5D3MA 1E2FA 2PCJA 1ZBDA 5KYKA 1XPOA 1AQUA 1CJUC 1S2MA 1AK2A 4YQFA 5LPNA 3BWDD 5EE1A 1G41A 1N6LA 1OYWA 3CPEA 5DI3A 2D74A 1ZVQA 2QUZA 3C5CA 4XIGS 4KVAA 4A6PA 1MKYA 3I3SR 3WP0A 1HUQA 4QXAA 3ZH9B 2I3BA 2ZR7A 4EPXA 3ZJYA 4LBVA 4Q02A 3X1ZA 4M1OA 1J99A 3SC3A 3BXZA 3F5FA 4RD6A 4EPWA 1R0YA 2WJHA 2JLZA 2ZAMA 1BS1A 3CR8A 3B60A 3GLHB 2W2XA 3CLVA 4G5OA 4OK3A 5HKKA 1OFIA 2ANCA 4MQBA 2LKDA 4TL6A 1FPMA 5KNBA 1G7TA 3GLIE 5GVSA 3LBIA 2JIZD 2HT6A 4D0LB 2OFXA 1IBRA 1P4SA 4F4JA 1KK0A 1SXJE 4MKHA 4CEJA 1FW6A 2ANBA 4IJMA 1EFTA 4PXAA 4XWKA 4HAYA 1U9IA 3KJIA 5FR1A 1Z0KA 1XJCA 3KKNA 3FMOB 4F38A 4TYYA 3GFTA 2Q9CA 2YV5A 4I81A 4FCWA 3CH5A 1YR6A 3K0AA 4Q5IA 4DDWA 1F48A 2ODEA 1U0LA 3UATA 1YKSA 1K5GA 4L9SA 5KOYA 4ZDWA 4JL5A 3M0EA 4J0QA 4PANA 3BBPA 2ZSDA 2X77A 3THOA 3GLIA 3B1WA 3LVQE 4HB2A 1KSGA 1FX0A 3VMFA 2G1JA 1JQLB 1E9FA 5EXTA 3U4QA 2O0HA 4AYWA 5JWHA 1E1QA 2EFHB 3K09C 3EWSA 4LV5B 3U3JA 3L43A 2BWJA 3KB2A 4HYYA 4KLNA 4LBYA 1P9WA 3R7WB 4G1UC 2GK6A 1U8ZA 1XXHE 1C9KA 4URYR 5SZJA 5B30A 4ZKEA 3QBVA 1OB5A 4L9WA 2O0JA 1XZPA 3B1XA 4CGZA 3GLIB 1TX4B 1OFTA 5DHFA 2ZITA 3M6AA 4HB3A 1E2QA 5KU1A 1ZJ6A 4C0AC 1SXJB 1OLOA 1ZNYA 2QQ0A 2G88A 1MV5A 5HCIA 1T8TA 3AM1A 3H0KA 4WVFA 1BH2A 2FE4A 1ZINA 1IXZA 3KXKA 3PIRA 1KK2A 2ZJYA 1OIWA 5JWRA 1KSHA 4A8JB 5J4HA 2FU5C 5FI0B 1DBSA 1CP2A 4EPTA 2F43B 2D7CA 1E98A 1NG1A 5C2JB 1COWD 4LOAA 4BFVA 1RYHA 3NEYA 4C0SA 121PA 4PQFA 2Q3HA 2H57A 1FMJA 1VIYA 3EPLA 1KI4A 3MCAA 1YQTA 3NXSA 4KXFB 3TK1A 1JJ7A 3SEAA 4C3ZA 4I1SA 4DCVA 1LNZA 2XZPA 3RSLA 1B23P 3OIWA 4XH9B 4ABYA 4FINA 2MSEB 4M1SA 1KZGB 3LW8A 4GI7A 1W0KD 4BLRA 1E0JA 2O8FB 2RGCA 3VKHA 5AJXA 4URXR 1XXHB 5LBIA 1HE1C 5GJCA 1YRBA 4WA7A 1DARA 1Q57A 4UXJA 3EA0A 4HDQB 2XOKA 3MFYA 5JMTA 1T0HB 2Q3FA 1VCOA 3GLHA 3PEUA 1P2SA 5CK5A 1ZM7A 2ODBA 1LF5A 4RZXA 2XNSA 4RD2A 5KSZA 5F9FA 4A92A 4XTCS 1Z29A 1Z5ZA 4PPQA 3RC8A 1GIAA 2CXXA 2FN4A 1OYYA 2P3SA 3LQQA 4O0MA 2QMEA 4EQ6A 2A78A 1W36D 4C7OB 3L0OA 4JKIA 3BRWD 4FN5A 4BFYA 3LXRA 5BW8A 2UZ3A 4AKGA 2D62A 2GKSA 2FFBA 1H8HA 3DEFA 3K09A 3PUYA 4ZKDA 3AVQA 3O8BA 2JJ1D 1YZNA 2VP6A 1E6CA 2PLFA 2Z0MA 1QBKC 2FX3A 1G18A 3W8RA 3KJHA 1UAAA 1E4VA 1Z3IX 2ZS7A 1OJLA 4WZBE 1ELOA 4M22A 3O8RA 4NPHA 4K81B 2QT1A 1AA9A 2Q6TA 3AVPA 2R6FA 3CO5A 3EC2A 1N5LA 4A36A 2ZI9A 2P67A 4DCSA 1DS6A 4KU4A 4N0EA 3ICEA 4RFSA 3SJBA 4GFDA 4II7A 4Q7JB 4O2RA 4BFZA 3D7MA 3KJGA 4M21A 3LW7A 3RS7A 1OSNA 2N46A 3DDCA 4HZUA 3UMFA 8OHMA 2ZM5A 1EWQA 4ERNA 2F55A 5HPYB 2B21A 3PEYA 3BE4A 3T5DA 1UDXA 3OE7A 3CZPA 3EX7C 3K70D 4PHTA 4JLOA 2CHVA 3A1WA 3U6BA 1LTQA 3EWAA 4DCNA 4ASUA 1AZTA 2E9SA 3CB4A 3QXXA 2GJSA 4E22A 3RS3A 2GJ9A 2XEXA 5AUNB 5G3YA 5AJZA 1DAGA 1CKEA 3O8DA 5G40A 5JHGB 2NO9A 4DLSA 3QNUA 1AGRA 2EVWX 3ZS9A 1EFRA 3PUZA 1MRSA 421PA 1I4TD 4PSKA 1ZNZA 2L0XA 3QG5A 4AURA 4MGYR 4TL7A 1I2MA 1RRFA 2ZI4A 4B2LA 2BJWA 5AUOB 4HLUC 4FW9A 3VQTA 3AVVA 4U00A 3ND9A 1KDPA 4MITA 4A0FA 1E79A 3KXLA 1K6MA 2IXEA 2O52A 2PZFA 2QROA 4LWZA 4UQOA 3AF1A 1Z28A 3TAUA 4B32A 4TSFD 1X1RA 5FUYA 3I61A 1HYQA 4ILEA 4S35A 4V0KA 2O8FA 3EXAA 4LJYA 5FBLB 1ZYUA 2EW1A 3GJXC 2EQBA 4PC7A 5CYOA 2YOGA 4IOLA 5KNDA 2WJYA 4QL3A 3QKTA 3U3KA 4AG6A 3O8CA 2OFOA 3B9QA 2F1IA 5B64A 2QZ4A 5CJ2A 2ZR0A 2C9YA 1S1MA 2B8TA 2EWWA 3T1VA 4A2PA 4OQMA 1WDTA 4A2QA 1ZCBA 1UEIA 1ZC3A 4A2WA 2TMKA 3NIBA 1OIVA 1XBTA 4TQAA 621PA 1QVRA 4MRRA 3A36A 3OEED 3N2EA 2NGRA 4CEIB 2J59A 3GEHA 1AS3A 4CYMA 3RAPR 3WMEA 2A30A 2QAJA 4Q01A 2VHJA 3PITA 4W7SA 4URVR 1SQ5A 5KNCA 2IYWA 2KBEA 3E70C 3GLGB 2HJGA 3U3RA 3DVLA 1M7GA 4JVLA 1NI3A 1S8FA 3RHFA 3SOPA 4B3FX 4CDGA 1R5BA 5FPTA 1UBCA 2NQ2C 4G0NA 5IDVA 3K9NA 1TF7A 4FIDA 5C4GB 3VU9B 4B6FA 2WPDD 1DAFA 5DNYB 1BYUA 1QHNA 1TU4A 2IF0A 2OE2A 3Q85A 4CEHB 1P73A 2JCSA 2ZUCA 1DE0A 3FE2A 3F0TA 4UJ3A 2P6NA 1GILA 3K0FA 5IT5A 5FTLA 1IN4A 3HYRA 2R62A 1G7SA 4BASA 2J0VA 1VYUA 2GZHA 5FBQB 4I4LA 2NO1A 3QF7A 2A7QA 4JJKA 4X8LA 5FTJA 1JB1A 1DAIA 1FOEB 2FH5B 4HATA 1VECA 3NHBA 3FKSA 4D81A 3PVSA 3K0CC 2CCJA 1Z0DA 4Q66C 2PH1A 5FL3A 5E7IA 2XXAB 2QE7A 2VH5R 3VX4A 3HU3A 3PG5A 2F9MA 3FWYA 3D31A 2EU8A 1P6XA 821PA 3BFKA 4LC1A 3K0EA 3TQFA 3X1DA 4KITB 2W83A 4U5XA 1U94A 1F2UB 2XZOA 4M9SA 3R9XA 2ZJOA 3Q72A 2XGJA 3GP8A 4DT1B 4M4SA 3THXA 1DG3A 1E2NA 4Q4LA 3T5GA 1PZNA 2QRZA 2WM9B 1U0JA 2F1RA 3QUSA 1DAKA 2ZRNA 2BBSA 4GT1A 4HLUA 4TL8A 5UKDA 3SFVA 1NVVR 1BMFA 1YZLA 4B3CA 3X2SA 5F9HA 1W0JA 3S1AB 1LS6A 4QBIA 4JL8A 4PO8A 5GJVC 3GEEA 3CF6R 2F3TA 4IDNA 3QPUA 4JLKA 3CF2A 1NVWQ 2JJ2A 2OLJA 3ZVLA 2GCPA 4NCJA 3CNLA 2CCKA 1K5DA 2Z43A 3GMTA 5EXXA 4OHWA 1IN8A 2FG5A 3VR6A 4FCVA 2QEQA 5IK2D 4IVQA 2JATA 3ZVMA 2JLVA 3PQCA 2ONJA 4EFMA 3UXMA 2ZS9A 4IXMA 5JHHB 1XB2A 2O8DB 1IY1A 1D8TA 4Q9IA 1ZD8A 2QGZA 4HSEA 2C5LA 3IKJA 1BKDR 1H8ED 1HY3A 4TYPA 3EPHA 4MA4A 4HDOB 2AKAB 4QC2A 4GZLA 1UBEA 5DGXA 2WIAA 4YXWD 1G3MA 3EG5A 2IEZA 4UKDA 5JJIA 1I2DA 3RRMA 3U7FB 2HJVA 1NF3A 3CX6A 4NL4H 2R6CA 2YINC 1Z8FA 4OI2A 3UANA 2FEOA 1GZSA 2GK7A 3DO6A 5FOXA 1SVMA 2WJGA 3RRZA 1KTVA 1DADA 2FFQA 2CBZA 4LV6A 5KUTA 4TN1A 4L8GA 1G16A 5JEEA 2VHTA 2BM0A 4PZLA 2Z4RA 1GUAA 2REBA 4KCGA 4PX9A 4Z1MA 2R65A 1II8B 3I8XA 3QEJA 2C8VA 3AUYA 3TBKA 2WAXA 1US8B 4YC7A 3VTKA 1RVDA 2X2EA 4FCTA 5KPJA 4D4KA 4XOIA 1XNJA 3AVYA 5E4FA 5L3QA 2VF8A 2J7PA 2GCOB 1ZU5A 3G5UA 5HE9A 4NYMQ 1TQDA 1QHHB 4V0LA 2B7BA 1QVAA 3RYTC 4WIAA 2VSXA 5EZ6B 3ICQB 4NYIR 5JS8A 4N3NA 5HCNA 5FTKA 3K0CA 2J0UA 2G83A 3AF0A 2FJUA 1BOFA 4DUGD 2AD1A 3NBZC 2GBLC 4DEYA 1JJVA 5SZKB 3FDIA 2V3CC 4V0NA 2BM1A 3MJHA 4LHVA 4PTLA 3L8ZA 3TE6A 2PZEA 2REXB 2Q0HA 2RGNC 2VPPA 4GSYA 4GOKA 3LNCA 2DPXA 1L8QA 3WNDA 2B6HA 5CM9C 2IYQA 4OKSA 1ZM3A 2J5XA 1P9RA 4HAWA 4RKFA 3TVTA 6Q21A 1TF5A 4KYUA 1N5JA 1D2NA 2ZI6A 2FSGA 4HAUA 1LS1A 2XXAA 2BEKA 2CJWB 4OI4A 3VNVA 4TMVA 3TGPA 2WOJA 1NIJA 3CBQA 5L8VA 3LBNA 2GVDC 2YWEA 4PO9A 5FOWA 4B3XA 1CIPA 1FMLA 5HZHA 2P6UA 1F2UA 1KNXA 4NDZA 3IIKA 1OHHA 2AN9A 3H86A 3QE0A 2WHXA 2OV2A 3CRMA 1F6BA 4DT1A 2CK3A 3IPYA 1RPZA 1XJQA 3CONA 3ZGXA 1NN3A 4MDEA 4MDFA 2AL7A 4RFVA 1E2PA 1UFQA 1E2EA 2IUSA 2MMCA 4I99A 3S1AA 2JDID 2QG6A 1E2GA 2IX3A 2Z4SA 4KSBA 4A6XA 1ZM9A 2ZYWX 3IHLA 2CE7A 1Q3HA 3CWZA 1T5IA 4BZQA 1F2TB 2DR3A 2ZJ8A 2GXAA 4LK2A 1N5KA 1Z2CA 2O8BB 4EJSC 4IKEA 4UJ5A 3W8NA 4DZZA 2BMJA 3C14C 4IDHA 1VG9B 2XJ4A 3SS8A 3NC0C 3B2EA 3LRPA 3V4RA 3SJZA 4DEXA 3PJRA 2ATXA 2IC5A 2FGJA 4GDFA 1PLLA 1SKYE 1RKBA 4TYQA 1P62B 1ZM4A 1CLUA 3SE0A 1LF0A 5H68A 3KZ1E 2C03A 1W4RA 2FDCA 1CR2A 3FMPB 5BN3A 2Y8EA 1F5NA 3AV0B 1JAIA 3GJ5A 5HKKD 1UPTA 2EWVA 3THYB 2QI9C 4RD1A 2WVJA 3SU8A 3ASZA 1L4YA 1G9XA 3QF4B 1T5LA 4BLPA 2HLDA 1EX7A 2JLWA 1W2HA 2LKCA 4WXPA 4Z8XA 3RSOA 4QKQA 2VBCA 5C46F 5E7MA 2D3WA 2I1VB 3CZQA 5FTNA 3RNLA 3GCGA 2GBLA 5EQTA 1Y63A 4NHOA 1G5RA 3BERA 2P5TB 1NMYA 1XEWY 3DOEA 1IXSB 3LAWA 2QP4A 4HB0A 3KUCA 1EX6A 2ECKA 3CKLA 4FMCF 1Z0FA 2GCOA 2RGNA 3AH8A 2V6IA 4QNMA 4GNKA 3EA5A 1Q1QA 1QHHA 1YE8A 4IHQA 3ZD7A 5DH9A 3A1TA 1G7RA 1E1RD 1HQYE 2JEOA 3VKGA 3C41J 4TWZA 1A1VA 1M7BA 1KDRA 4CZ2A 3LQRA 1SVKA 3NC1C 4DSUA 2QN6A 4RZ2A 4JSYA 3TUZC 3VR4A 2VP4A 3VAAA 5CLLA 4FMBB 4QGHA 4JLMA 2O8CB 2KI5A 2D06A 1SKYB 3X1WA 1S1CA 1ZCAA 1S9DA 4Q9JA 3CIOA 3IPXA 4G5RA 1QHSA 2SHKA 1N6PA 1OXXK 1HT2E 1Z0IA 4NBSA 3AVUA 4GL2A 4MGKR 4KFSA 5CDFE 5AJWA 2IT1A 4BWYA 4P31A 3I1FA 3TIFA 3W90A 4JBXA 4PSVA 5CYPA 2CHGA 3W34A 3ZLJA 1FNMA 2QORA 1MRNA 2G77B 1F60A 2QSZA 2YKGA 1R5OA 4EJSA 3DHWC 4ON9A 2V1UA 5FPYA 3ADCA 2PMDA 3SDZA 4Q1FA 1VIAA 1TQ6A 5KSPA 4MKIA 4B71A 5AR1A 2QBYB 2GF0A 3UG6A 3U61B 4NCHA 1KOFA 3P4XA 4NONA 4BZPA 2OXRA 2PZGA 2V1XA 4EUNA 3MG9A 5CJPA 4A1FA 4X8MA 4URUR 4MKFA 1G3IA 1GVNB 1VPLA 2FPMA 1X1SA 3HR7A 4DLWA 4OHXA 2O8BA 2YJTD 1ZD9A 5AUQA 4B44A 3QVVA 1JI0A 3U44B 1VYTA 1W47A 2N1BA 5DI9A 1QHXA 2ZIAA 2ZRDA 3U3OA 3MAAC 1KMQA 4HLDA 4NU0A 5LB2A 3D3QA 2YNMA 1KI6A 4AKIA 4RZUA 4F92B 4W9MC 3N70A 2G6BA 3KJEA 1VG1A 5EE3A 1Q12A 1M7HA 1S9HA 4FMDF 4Q1DA 1NLYA 3NDBB 3PUXA 5FL7A 4IFEA 2J45A 4TLDA 2WBLC 5HTKA 3DL0A 3IQWA 3BH7A 2A5DA 1ZD1A 1QG4A 3PENA 3QF4A 5TDHA 2RGXA 3PXGA 2YYZA 3EIHA 1JQJC 2Z83A 5SZIA 2H7VA 1T4GA 3VR3A 3FPAA 4OQLA 1CJTC 2ZRJA 3TW8B 1OE0A 3N5CA 4OJQA 3B82A 4E5UA 1Z6YA 2P6RA 2ZU6A 5FOVA 3AUXA 1W4AA 3TH5A 1YR8A 4MRNA 2OO7A 1Z6GA 3AQ4A 3WXMA 2OILA 1G20E 2WOOA 1W1WA 5A4JA 3CF0A 2D2EA 1U90A 2O5VA 1RYFA 3KL4A 1T8UA 1V5WA 4TL9A 3KKQA 1FUUA 2PX3A 2XJ9A 3AF2A 2JAQA 4C30A 2W6JA 3OIUA 2ONKA 3B6EA 1QDEA 4QBFA 2ZJ2A 5J4YA 3BFXA 2R6DA 5IHPA 4Q4AB 2C95A 1A2BA 1E9BA 1I4DD 3ASYA 4F4IA 2YC4C 4JVSB 5JCPA 5FUXA 3QSYA 3FYHA 3P26A 3GJ8A 3T1OA 1U8AA 3T1TA 2RGBA 2GJAA 2RHMA 4LJ4A 4CVNA 3W5IA 1TTTA 1XD2B 4P4UA 1G19A 1CRPA 1IXRC 3ZIAA 1C1YA 2GEVA 1FZQA 2IXGA 3GJ4A 3OE7D 5JJLA 1Q0UA 3FTQA 3T61A 1AKYA 4ASUD 4Q1EA 1R7RA 2F9LA 1YHNA 4XTRA 1E0SA 4BQSA 4O2LA 4MKGA 2RGGA 1B0UA 5CM8B 3EPKA 4ZIRA 1A82A 2OSBA 2OFWA 4A0GA 5GJBA 1KSJA 2BHRA 2I4IA 2QBYA 3BOSA 1LVGA 2A5GA 1EFRD 2CVFA 2GILA 521PA 2WSMA 1Y3AA 4NH0A 4RCZA 1CJVC 4W5JA 2GESA 3PEVA 3A6PC 4JYBA 1SXJC 3Q9LA 1Z08A 2ZR9A 4AWXA 4I1UA 4F91B 4B3BA 4AD8A 2QGNA 4BLQA 5J4VA 5FOUA 1KK3A 3QY0A 5DYGA 1E79D 4BUJA 1NIPA 4A0HA 2BBTA 3E2IA 2GWHA 2RGAA 3UWOA 2XAUA 3NH9A 1NSTA 3NBYC 3BIFA 4D4JA 4A8JC 4WBSA 5L3VA 2NOAA 1G5TA 2ERXA 1R0XA 3F3YA 2WMOB 1FL9A 5EXPA 1MOZA 3WYFA 4MRPA 4LC0A 2RGDA 3VNUA 4ZI3A 4PFSA 2VIIA 3C16C 5G41A 3QXHA 3ZVRA 1LY1A 2DB3A 2OLKA 2B7CA 3FHOA 4M1YA 1EFCA 2OXCA 2IL1A 5FOTA 4OQNA 4LBWA 4CIDA 4OJKA 5KO2A 2WWXA 1XPUA 3LDAA 2JGNA 1NBMA 2D2FA 3PV0A 4PHGA 1Q21A 4AKHA 1YZGA 1NL3A 1P72A 5JEDA 2CLSA 2ZRMA 3LX8A 2NZJA 3ETLA 1SZPA 2IS1A 4LX0A 3DPUA 1E96A 2P2LA 3GEIA 3V4FA 3W6PA 4X8HA 2BMEA 2WZQA 1GL9B 2V55B 3AKDA 3M4YA 3U60B 5FH9A 2VSFA 1AS0A 1GL6A 4QBGB 4EPYA 1VCMA 5AJYA 5CK4A 3VR5A 4DDVA 4LHWA 1N6IA 4PC1A 2AHOA 2BC9A 4JLAA 1P2VA 4Q19A 1LW7A 4GZMA 4ZO4A 1ANKA 5JWOA 3IHWA 4BLTA 5E7JA 1W36B 1VKJA 2J46A 1TUIA 5EXSA 3UMRA 3BORA 1WXQA 1XTQA 3SQXA 1WQ1R 3VFDA 1RFLA 4QFMA 2QT0A 3FKSD 3QKSB 3B7GA 4OK5A 1Z0JA 3R7WA 3R9WA 2R44A 2NO7A 3Q7PA 3TSOA 3FHTA 2QE7D 1Z6XA 1DELA 2GAOA 3B1ZA 1T3SA 2IWRA 3LH5A 1G3UA 1SKQA 1XTIA 4LI0A 4AY2A 3LLUA 1NKSA 3QOFA 2O8EB 5FBVB
chains in the Genus database with same CATH superfamily
1MABB 5HJ2A 4BWGA 4WAUA 3PUKA 1O8BA 3A70A 4HCJA 2G0NA 1KH1A 2LD4A 3B6JA 5KTYA 4MQLA 2G7MC 1MDFA 5CH8A 3O3NB 3C7KA 3STXA 2QLNA 3BHNA 1KGDA 4KVFA 4S2EA 3VV2A 2HXSA 4WXEA 3A3NA 3LCRA 4KFUA 4EW6A 3UJ3X 4KKXB 4QJBA 3EIUA 4LMAA 1T4DA 3JYLA 2CHUA 1NF8A 2HDWA 2KM1A 2RMKA 2D0DA 1EBFA 4FI3C 3E5HA 2ZI7A 2VOJA 1HG1A 2DKNA 4WOCA 1RAFA 2WHPA 4UCFA 3HR8A 1QFZA 1CYDA 4CIAA 2PPLA 1H3EA 1UDBA 4KO3S 5ILGA 1GFIA 3AIIA 1EDBA 3DONA 3HEBA 3GYGA 1KSFX 4LK3A 1I51A 5H82A 4AG3A 4D1YA 1TZMA 5AKJA 1H22A 3G8YA 1GRRA 5J47A 1SUEA 3QEMB 3O1HB 3T3NA 2FJ0A 2P8SA 2XA9A 3GNLA 4OHOA 4C7BA 2VA9A 5KTNA 1QHGA 1K7CA 5A5EA 5DGDA 1KETA 4DBLC 1XRPA 2EBHX 1NVBA 4WK6A 3IV6A 1JAXA 5C8YA 5C7OO 1W7AA 2DM6A 2AKYA 1WMFA 4XR9A 1XELA 4NCIA 2XPCA 3Q3CA 4XJXA 1UAGA 2X9QA 4EAAA 4L3VA 2PH3A 4OMUA 4B34A 1XXHA 2RG7A 3IAUA 4XW2A 2BIFA 4EABA 1KXJA 2H2WA 3MJVA 2HCBA 1RRKA 4G5YA 3RS8A 2FPKA 3RTEA 2AUNA 5G2OA 4MINA 4YJ3F 4HJXA 1COWA 3PR1A 1D2MA 1AQNA 1CHDA 1LPMA 4M76B 5TGDA 5MHTA 1CUAA 1W1UA 1M2GA 5IW8A 4DB2A 1Z8HA 1IQUA 4GYYA 1LD3A 1X38A 3QZUA 1JW9B 1PJ3A 2A0XA 1KYZA 2Q29A 3CN7A 1CT9A 3SDSA 3WAJA 2Z3VA 1F8YA 4GI2A 1O08A 3TW4A 2NVWA 3BZBA 2HWYA 2XRFA 2ERYA 3GMDA 3HP1A 3JW8A 4WACA 4FGUA 4UCXA 5EE9A 5H9VA 1MO6A 4CE6A 4PSAA 5K7SA 4AP6A 3V6MA 2VYND 3H05A 5GZ6A 1OZ0A 3HYLA 3M2PA 4J0IA 1MH1A 1SCAA 2Y4OA 2IXAA 5LQUA 4YJ2A 5ALNA 2XDYA 2Z30A 4J7CA 2FP3A 3DFMA 3IP3A 3ASVA 1W4ZA 3QFHA 2ZE7A 4UHEA 5CLHA 6REQB 2B35A 2PS3A 4P4GA 3OU2A 1TQ2A 1P0CA 3QTTA 2Y1OA 5LOVF 2JI4A 3W5BA 1RC1A 2IYSA 1DL5A 2EZUA 2JVJA 1TL7C 3BSFA 1SKMA 4G1BA 4JJ4A 4YJFA 4CL3A 1JAHA 4MV1A 5CEEA 2ZU0C 1OYVA 3G2MA 1G42A 4XIJA 3ZQ6A 4F06A 4KPUB 4BC1A 4H35A 2NUTB 1BE0A 3ZV5A 5TV2A 5MDHA 3WRXC 5F33A 4JB8A 5CA1B 5J2TA 4XB1A 2PLWA 4Z4EA 1A4IA 1KP3A 1MJFA 1ZM2A 1A04A 2I55A 5CVCA 5A3QA 2K87A 2QMUA 1E3DA 1WSWA 3G7SA 4Q47A 3QVKA 4ND7A 1YS1X 3RYIA 2W22A 2E4UA 1F0YA 3WDSA 1BN6A 3T9DA 3WS7A 4AC9A 1I80A 2PUEA 3USCS 3ORRA 2Q1UA 3BTOA 4ROSA 4KPYA 2XNDD 4GLLA 4IW3B 3V55A 4DJAA 1Y3IA 1EUCB 2OVBA 1P2UA 2XRMA 3HVIA 2AFIB 1S4QA 3GLFB 4PBRA 2RE8A 2BTEA 3H6HA 1JIQA 3JWIA 5JZVA 1TPZA 1LLDA 4IIYA 1JEYB 1M6VB 1JR6A 3KJQA 1HURA 4BJ3A 4E5VA 2G70A 2N47A 1YR9A 5H1YA 3DS8A 1DUVG 2JGJA 3OU7A 2WKSA 5JVDB 3MTJA 3H2HA 3TWOA 3L1KA 2DLNA 3F7MA 3ZZ0A 4DRXA 2XTMA 4W1RA 2J0EA 1X7HA 3HJUA 4D80A 3PNSA 1DWPA 1PNVA 5ALEA 2ZCJA 3PFNA 1GFSA 2R25B 4IJ5A 1J23A 2JGIA 4NKRA 3I32A 4OXXA 1KYQA 3AP3A 2X1HA 3WKDA 4DDUA 4EGFA 5JI2E 1WMDA 1XEXB 4CW7A 3IMCA 2Z58A 3QKRB 2AWNA 2EFYA 4GMDA 4ZU6X 4A5OA 1ISHA 1SHJA 1UF9A 1CR1A 3G9XA 4NXMB 1JPNA 2B34A 3NC4A 4IUBS 2OG1A 3KTDA 3PDWA 5CDSA 3KLNA 2P2SA 2IYAA 3IP7A 2P90A 1E20A 1F5SA 1PUXA 3BXFA 2XAAA 3PDJA 3QYFA 4IV5A 4P0TA 1C7IA 4PLFA 3ZCPA 3NTUA 3FMVA 4GBED 3DH0A 1LQ2A 3WYGA 4UUMA 4U2EA 2HWKA 4FVTA 2VDMB 4LF6B 3GT0A 1P1JA 3T34A 4G0WA 1POXA 2Q9AA 1V3VA 3I3OA 1Q1ZA 1AM4D 5E3JA 3FOWA 1IQPA 1NUTA 1G7CA 4MLZA 4G4SO 4V2IA 2X86A 3NHKA 2ZYSA 3K31A 3HJCA 5CDGA 1ADJA 2XMRA 3F5SA 3OM9A 1KEVA 1GXSA 4D25A 4KOEC 4ZYZA 2AOUB 3D8NA 4Q4JB 2DFNA 5JCJA 3GP3A 3M6XA 3B3QA 2NZXA 1EG7A 1HBJA 3H17A 3OFND 4DHEA 2ICAA 2WINI 1NG9A 2E4AA 4L2IB 1PEDA 1MAAA 3UOAB 5JY6A 1TQHA 3W7AA 4EEZA 3KL2A 3IUPA 2WIBA 1T4CA 5A62A 2DTEA 1OLSB 2R6AA 4ZMSA 1DWUA 5DV9A 2ZRHA 5AJVB 4EFNA 1NSFA 2RHCA 3ZNOA 4LZZA 4ZZ2A 3RVDA 4JD5A 1W49A 2AEJA 3VR2A 1HDOA 1BE1A 1R10A 2CXPA 3LPMA 4BVKA 1ZK3A 5AJHA 4KIUA 5G3ZA 4Q24A 3FFWA 5B2ZA 1I10A 1T1IA 1EI9A 4BE7B 4QIHA 5CVEA 1RAAA 1G8GA 2GA9A 1SEPA 1N2EA 3MELA 3THWB 2FR8A 2GVNA 3ESRA 4L7QA 5D7BA 5GONF 1RBMA 5TY0A 4LHZA 3PDHA 1TFRA 3H4MA 3JQ6A 4R9RA 3RSQA 4C78A 3DW1X 4G8BA 4QWWA 4YYEA 1QYWA 5K8VA 1PK7A 3Q5DA 2PSEA 3QLVC 3WBFA 4BE4A 2HQBA 4ITRC 5C8XA 2AEEA 1JHPA 3LTNC 4V0ME 3MVEA 3BDAA 2PBFA 1QYVA 3AR7A 4WFIA 3ZV6A 1GZUA 1MN6A 3PRHA 1O58A 5DJ5A 5DTQA 2G4LA 2VK1A 4CKCA 4B3SB 3A1UA 1KL7A 2WUDA 4GBMA 4OGGA 3W9BA 3U6KA 3EXHA 1CUIA 4KI0A 3NBXX 3OWOA 4M99A 4MR8A 4O4LA 1KMHB 4FUTA 4Q12A 5E3IA 5F5XA 5IXSA 1AUXA 2WWIA 1ORVA 1JU9A 4O2BB 3HH8A 4TX1A 1DPGA 1AQJA 2I4LA 1BQ3A 3FUWA 2VZ8A 3UV6A 4J3NA 3RC3A 1WRBA 4HXEB 1CY6A 2X3FA 3GQBB 1J2YA 2JKVA 2AX4A 2NSHA 2CL6X 4YEDA 5TT0A 4DBVO 2ZZMA 4G6ZA 5I4IA 5ICMA 4L75A 1NJSA 2IV7A 5K8TA 1GTZA 1YR2A 3F6EX 4IDCA 5DGIA 1XRMA 1Y1PA 3EUEA 1U0GA 2XT6A 3H4TA 2PMBA 2C7QA 1JHUA 1NVAA 1A3CA 1QKKA 1Z06A 2EEZA 1XJ0A 2JGDB 2X8AA 3OIYA 4D9GA 4WZ6A 1YQEA 4HWGA 1G1AA 2J9FA 5IG2A 2P9BA 3I2KA 5FJIA 1B2LA 1Q1NA 1UKZA 3B6MA 4HAXA 1M33A 2J1LA 4HC4A 2V7TA 2OCDA 2QUBA 4NBLA 1KJZA 1QQ5A 4LECA 3U17A 3NMUF 3VPHA 4W7IA 3MWGA 5CIWA 3VUFA 1G9SA 3F6PA 4G5QA 4DWVA 4D4HA 1EFUA 2ZSUA 2VTDA 5IDYA 2QNRA 2GXQA 4QHYA 3OKPA 3JQEA 4EW1A 3OEHA 4OQYA 2YWFA 1M0SA 4UCWA 5EUQB 3UKJA 3I05A 2F3SA 3I6MA 3OHMA 3L0IB 3IEIA 5ENDA 3F1KA 1HFKA 1A5ZA 3UMVA 4KQ2A 2UVQA 3SIPA 1L7VC 2YASA 5AH0A 4FOTA 5EIAA 4BEBA 3A4MA 1KZYC 2YUIA 1OZAA 5TQVA 1CY7A 2ACEA 4NVRA 3U3XA 3K30A 2MTBA 1UDWA 2P1DA 2R8OA 1XTJA 4A4DA 1RRGA 4LBZA 3OIGA 4ACBA 3LWBA 4UPDA 2EG5A 3EXEA 4AUMA 3VR3D 5K99A 5F77A 3UO8B 3TIIA 5BSHA 2JLXA 1XCMA 3H2YA 1DKUA 1K7YA 1RWQA 1OT3A 2EP5A 5IKMA 2XCTB 3W6OA 4KQCA 3G68A 3CLTC 3L0SA 3UUWA 3WYEA 3PNBA 5KJ1A 4HEJA 2ORWA 1N1MA 1BFUA 2WYUA 3REFA 2TMDA 4CKBA 1V43A 4RV5A 3J80A 7AT1A 4YAJA 3INGA 3FGNA 4HVCA 4FI3F 2DR2A 1RWOA 4NK5A 3NAQA 1QE3A 3GEPA 5HX7A 3UWDA 1VI5A 3WB1A 5IDWA 3TDMA 4B40A 3FMIA 4N5LA 5G4LA 1QQ7A 4K46A 2PK3A 1WHTB 2O2IA 1L8XA 4KKVA 3WK9A 4ZYLA 1SGWA 4M8LA 5HFNA 1HYHA 1NW7A 2VHCA 4KXLA 1T8WA 1JQAA 1BOOA 2R60A 3I6QA 3R5FA 1HWYA 1FRFS 3KEOA 5GVRA 1VRWA 1TKBA 3T4PA 2WIKA 5K0CA 2CXNA 2RB4A 3FRHA 1EWTA 2XD9A 2FXIA 1PJCA 2FWRA 3UKDA 2GN8A 2PFKA 1OTYA 1XVVA 4MV0A 3WLLA 3BA6A 4FLEA 1RMQA 4X24A 3PPVA 4M6WB 3MJRA 1CUEA 2ZJ3A 3MJEA 2YHIA 4JJ6A 1F8GA 4UTXA 5LA6B 1QYCA 5I7UA 3OMLA 3L5OA 3D1LA 2ZREA 1PF7E 5AESA 2H1HA 4OLAA 3EAFA 3MUNA 1U9IC 4J90A 1J49A 2QMOA 4AY5A 4FE4A 3DHNA 3H2JA 2D4HA 4IL5A 2YYSA 4KO4S 3IBYA 4OPMA 2LP4Y 2QYSA 2FMKA 3MTDA 4P32A 2TYSB 3U4QB 1IM8A 4Y1EA 5LD2B 1N9GA 1C7QA 5K8IA 1G17A 4PVDA 5PGMA 5DBIA 3S2YA 2N42A 4JBWA 1FC0A 1GKUB 2EAUA 1G64A 3OOEA 2DPYA 4M55A 4YMIA 1XA3A 4GX2A 4HWKA 1BGXT 3F90A 4BFUA 4D3FA 3SVTA 2CZQA 1FJHA 2FEWB 2FZLA 2I2FA 3BWCA 2IK8A 4GGOA 4K9OA 4KQ9A 3SYMA 4PLCA 1TKRA 3HM9A 1ESMA 4DCUA 5C18A 4KQGA 2VDQB 3EQ2A 3GLKA 4WLOA 3UM9A 3TE7A 3DMDA 3W2HA 4BLOA 2HXGA 4M37A 4M53A 1RM5A 4URWR 3STYA 1PZXA 1TNDA 3T7EA 3WZMA 4I1IA 2VSOA 4JDUA 3ZUGA 2V6JA 4YRKA 5DCYA 3EC1A 1BYIA 1ND6A 3ZQUA 2Z1DA 1LBQA 4UEJA 1ZSVA 1DEHA 2FOLA 1YSCA 3BK7A 3PPXA 3A1SA 1Z6TA 4CN8A 4D57A 2DHQA 2HU7A 2JGMA 3T5MA 3BRCA 4UZFA 2IKQA 5F3DA 3OPVA 3PDCA 2XMGA 5FWAA 2WJ6A 1APBA 1T91A 4H7DA 4RV9A 1PZHA 2HJRA 3L6BA 4Y7DA 2WTUA 1V7QA 3AVOA 3Q8XB 3DP9A 4RO0A 1PU2A 4QGFA 4WWHA 4IUYA 5FADA 3UCXA 4AI6A 3KCNA 2NG1A 2DYKA 2JANA 1K08A 2P78A 3CX7A 1QSGA 4F2DA 2AHRA 1MO5A 2QAGA 1Q2XA 4P3OA 4TROA 3WX0A 1ZEMA 1MO4A 4OA5A 5AOCA 2W2KA 1SK8A 1O96A 2ETVA 1KI8A 1DAEA 1ZD4A 3THYA 4ZQGA 1KDYA 4TYWA 2IUTA 3WLMA 1PSZA 5AKYA 1S96A 3AEQA 4JQOA 4BNZA 1G6HA 1R64A 1Y9DA 2GHIA 5CLQA 3UJCA 2ZRQA 4HD8A 1WZ2A 4AECA 4B47A 1K66A 3HCWA 5TLSA 1O94A 4AKTA 1QOZA 1V41E 4IXNA 1VBKA 3EOZA 1MAUA 1WDMA 3HACA 2C9OA 2FLVA 1UKEA 4IO1A 3I37X 4XYLA 1XX6A 1RQ2A 1Y48E 1E1DA 1PR9A 7MDHA 4WEOA 4K3UA 5B7QA 1SUWA 2GA8A 3FCAA 3C3CA 5J5CA 3WRWA 2Z2JA 1IN1A 3CPHA 2VC2B 3RDPA 2EEPA 4P7KA 1C7RA 2PL5A 4PAOA 2H1CA 4GXRA 3HLYA 4AIIA 4HNGA 2C20A 2DU8A 3CUSA 1SUBA 1S7GA 1I3MA 1ZIDA 3D4IA 4ES6A 4HPXB 1UFKA 4MCJA 2IQIA 4OK6A 4IYRA 1Z4NA 2EARA 3KSMA 3MMPA 1O6BA 4FP9A 4Q9NA 3LP5A 3X1KA 1OW3B 1VC2A 2QG4A 2AV6A 1VMDA 2W93A 1Q22A 2A9VA 1DBIA 3CU5A 3D7KA 3G0IA 3S2IA 4BE9A 1YBVA 4RZIA 2B36A 1WSDA 5TE9A 3SN6A 1NRXA 2JI6A 4R2HA 1Y6JA 4J9UE 3KZMA 3E22B 1HFEL 1ZD5A 2H4XA 1ARZA 2PUJA 3HV2A 4J2HA 4U39A 5L4SA 4KH1A 3D6UA 4LY6A 2J5RA 3DLBA 4KB5A 3HXOA 4AY3A 1ISSA 4RTPA 1C41A 2ZDQA 1P8AA 1OWLA 1TZ2A 2XBLA 2QLLA 4XM0A 4DRZA 2A9QA 4CG3A 1N78A 3CNOA 4AMUA 1T8PA 1UOOA 4KN6A 4M1EA 5KSOA 2HQRA 5ADVA 3KQKA 1RJGA 1LLCA 4Q3EA 4CM1A 2XQKA 1WHSB 1M83A 2CB0A 2ZFUA 1E1RA 1ZRSA 4QAQA 4QJ3A 4YDHB 5JCXA 2H3EA 3LDFA 5K45A 3TXYA 3Q40A 4FR0A 3L0ZA 2YS6A 1ZUNB 2EKDA 4RMHA 3C3AA 1IHPA 3IVCA 5FHRA 4COKA 3LU1A 3QJYA 4EY6A 1FSPA 1XTRA 1DBQA 5FORA 3NX4A 1CR6A 1TKAA 1MV8A 1QKIA 4HUQA 5DYWA 1ZI9A 3TLMA 3HE3A 5ALPA 3W5UA 2LCFA 1VLHA 3HN6A 1CR0A 3H04A 4QJIA 4DLYA 4RU1A 5BQFA 2OTCA 2J0QA 3D5EA 4WADA 2VWGA 2QQEA 2ZPAA 4IDBA 4FS3A 4WK0B 2IJGX 3BMQA 4OVKA 3MWDA 2FUKA 2DFPA 4R8MA 1QP7A 2C5FA 4Q00A 3U7EB 2WTAA 4DIEA 1PL0A 2JJ8A 2CCGA 4XVQA 4DIBA 3EF3A 4X66B 4C76A 2QR5A 5CXXA 1FU7A 2B4YA 4YT5A 4PZYA 3VKUA 3JYQA 4KQWA 1IJEA 5LQCA 5EUMA 1PQWA 1HEYA 2J07A 1FTWA 2GRJA 1L7QA 3TUIC 3NHRA 2E87A 2MSNA 1AQYA 3MLAA 4H7JA 4Q3NA 4RACA 3AM5A 5C53B 1NFFA 1Q17A 2GRUA 4DFDA 3U5ZB 1MR3F 3SEFA 4H16A 5HXAA 5B58C 4IWYA 3CX3A 3RC1A 4DSTA 4AKSA 1KI3A 4E03A 1OQAA 3EEYA 4F4FA 3LQKA 5HJ5A 3ILSA 2IXBA 3F78A 4CLEA 2JKYA 5JC8A 1J70A 1UK7A 1Q1AA 2AXEA 2G82A 4I7EA 1SVSA 3ZHRA 4O63O 4PYJA 1LXCA 1DAPA 5IAOA 1N92A 4K9NA 2AJLI 3ZU2A 3FPHA 1JHRA 1Z4OA 2B4TO 1MQ8B 4P4TA 2CL5A 3K9QO 4NECA 1OI7A 2QYOA 3DE2X 2IYZA 1EJ0A 1T3LA 3B7PA 3B8HA 4EG3A 2C4NA 1KVRA 3B5IA 2VJNA 3NWEA 3ZCSA 4C0KA 2GT1A 4MW7A 4S1OA 1J39A 4D4LA 4ETNA 4N1AA 4Q48A 5JCOA 4EG5A 5U4XA 5L3SA 1U6IA 1KY5A 2XHEA 1ZUIA 2BKEA 2MT9A 4ZI7B 3QJGA 3ZWBA 3PNYA 1HT1E 1JQKA 3KQYA 4NH4A 4YP7A 3ONWA 1ZICA 2Q2QA 2KBFA 2C9DA 1K2WA 3SNHA 1QLJA 3WIEA 2C4MA 4V1CA 4YYZA 3AJAA 4EFDA 2XITA 2C5AA 1L4UA 3CX4A 4ZVUA 4AN0A 4EHFA 1POWA 4C5CA 4D99A 2RBGA 3K2IA 2PGJA 5NULA 2IVZA 5HBRA 1LKZA 3AESB 2HK8A 3BA1A 2Z5GA 2WWRA 4JZKA 4YAWA 2IPNA 4G41A 2NPFA 3GRFA 4YMGA 2VTBB 3GN2A 4UBIA 1DC8A 3OJEA 4RA6A 3VU3A 5GJWC 5BUSA 1I33A 4NZMA 2I1LA 2CEAA 3BL5A 3G8CA 4J0EA 2FQYA 1Y6QA 3A4IA 4OXKA 1NYQA 3H8JA 4XWOA 2WD9A 3G7UA 4QXMA 4KIGA 1TAUA 3LUCA 1MF7A 2ZI3A 3GEDA 3HKDB 4NCBA 1PJZA 1C29B 5IFLA 3P4YA 3P2JA 1NUUA 3EWNA 2DFTA 3SZGA 4O5AA 2G40A 3EGDA 2Y1EA 4P92A 4UD6A 4BRUA 3CTPA 4HBZA 3ZWVA 5DSZA 5KJFA 4LHYA 2O1SA 2ZRAA 5IMBA 3P52A 3STVA 3UJNA 3T5AA 1G3QA 4Y9UA 2VT6A 4DLLA 4D0SA 4BMVA 2OAP1 4C4RA 4PN3A 3GPIA 1XR3A 3I34X 3EZXA 5IM4A 3E2MA 5IF3A 2OZVA 1ZH6A 3UICA 4BOYA 2G6TA 2PZKA 3P5SA 5DWDA 3VUEA 1QCDA 4F3CA 3TCNA 2EFEB 5B1YA 2HBZA 4LDAA 5TX7A 1BXGA 2Q5CA 2OWEA 2JFVA 3KOWA 1NLUA 3F49S 5HE8A 4ARZB 2YRWA 3FLAA 2D7JA 3INTA 1A98A 4YQZA 1JZSA 2ZRPA 4FGWA 3QVMA 4IY1A 1L7RA 4LKRA 4Z9BA 3FFAA 4RF4A 3VDQA 1XJWA 3OTWA 4YRLA 1W36C 3B6IA 3OBIA 3TOSA 1MW8X 3NFRA 3RE1A 4G0XA 1IHDA 5KVSA 1BDJA 3SLKA 2EGUA 1QO7A 3JD0A 4R2WA 3ZUPA 4L8FA 2PWBA 3WL6A 1EK5A 1KVTA 2PWAA 4QVKA 1DRKA 2BTOA 2BMDA 3GWZA 3L6UA 4LV8B 2NU9B 4LZLA 5BMVB 4JU9A 2O54A 3FNIA 3ICPA 3IQDB 3K8YA 3NJRA 3WSWA 3W6NA 5IANA 1KFKB 5JUWA 2I3AA 4X8OA 2C5EA 2ZI5A 2IBTA 2VKTA 3R6GA 3U1TA 3WLFA 1J8YF 1LI5A 2WT8A 4I1OA 2I2CA 3SHWA 5SICE 1XHFA 3D4OA 3N2KB 3BTUA 1KK1A 4L50A 3VR6H 3W4JA 3U19A 3ECCA 4BMDA 1J2RA 2VJPA 2AMJA 2RK3A 3THXB 1EPUA 1T3TA 3SQNA 3QVTA 2EWMA 3EVFA 4N03A 3ZWCA 1Y5MA 3OD1A 2JH3A 4EVRA 1UBJS 1LNSA 5DFAA 5G02A 3VR1A 1NXVA 1KI9A 3PP8A 2CGEA 4JIMA 3ASUA 3O84A 3ANNA 1E9DA 2XCIA 1FQJA 1I7LA 1OFVA 5P21A 5BMOA 3EAGA 4PG7A 4CETA 4Q4HA 4J43A 1MPTA 1XDBA 4E13A 4B43A 3K70C 4NBRA 4C2UA 4ZEOA 2EHJA 5JMOA 3DT9A 1A7JA 2ZJ5A 5JCJD 1T5SA 2P2NA 4OLBA 4W5HA 1S2NA 3DTVB 2OHVA 1UFRA 3T38A 1U80A 3WDMA 1M2VA 4EB6A 3W5DA 4BJHB 4NS1A 4P7JA 1I7NA 5FFMA 3RBVA 2FLKA 3HABA 3W9UA 1TA9A 3WQSB 2ORIA 2WWWA 3TTYA 2XD4A 3UIEA 4KFCA 1WXIA 1UWCA 3LBHA 1OT5A 2V5AA 1SOAA 3ROKA 5LU9A 1YKFA 2VDWA 4GRDA 3VR2D 2ZJZA 1QB7A 5HVNA 2IYTA 1I0LA 2XUGA 3RVNA 1USVA 4HRAA 1U3UA 3IMKA 4BRZA 3AC0A 3DVQX 3R0ZA 3PHCA 3STHA 3OECA 3QMVA 3GBPA 4XX1A 2IE0A 3DOCA 4B5LA 1F1JA 3MTAA 1SUAA 4EF5A 1V39A 4Q03A 3ZWKA 3I8OA 3H5RA 4AYTA 2COUA 4GWGA 4H7IA 3HU1A 2AR0A 1MO3A 4PTZA 3TGLA 4WQMA 3EMVA 3G5TA 3M6FA 3C7TA 1MX5A 4AKEA 3KSAC 5EMMA 2WVHA 4M38A 5DLEA 3ZIUA 4IMRA 2FKNA 3ZDBA 4UUAA 3OETA 4NV0A 2OV4A 1OPXA 2OV6A 3IXLA 3O8OB 5I9MA 1E2IA 5JSHA 2A5JA 1RM3A 4FDTA 5B1DA 1EXMA 2W2QA 3M2TA 4MPRA 1I7DA 1V9CA 1HX7A 2YV3A 3LG2A 4HF7A 4EUHA 2AN1A 3AHJA 3BRWA 5K20A 3I4CA 2C59A 3OOYA 4UXIA 5AK0A 2BFCA 4HWOA 2DEUA 2DQSA 3I9V1 4GKVA 1Z15A 2H9AA 3LO5A 2R6HA 3EHDA 3KXPA 2BKVA 2XYRA 3R0XA 4LTNA 4EO4A 1P61B 4KQHA 3AKEA 4WD3A 5EERA 4MYHA 2J0UB 1R00A 3SF8B 4AYXA 1EUDB 5KREA 4ZEXA 1NC1A 3R9IA 3I9OA 1L6RA 1UPXA 3P0RA 5DDIP 2PUVA 4FBMA 2PJUA 4OM8A 3W6ZA 4EM6A 4W1SA 1MABA 4DIDA 2QVGA 4HLNA 1ZPDA 4KQ1A 3IEUA 3SSMA 3GG9A 1E9CA 1Z6PA 2CXSA 3JVVA 1IZ9A 4RXUA 4PC3A 3OZAA 2A1TR 1NE2A 2P9QA 3H2KA 4PPNA 3I5YA 1H2EA 4BTEA 1GLVA 3FH0A 1N5DA 2YBDA 4EG0A 1MC5A 3PCTA 4Z3OA 4TS9A 4HMPA 3I23A 3RF6A 4DS3A 3K0BA 3OOSA 4EL5A 2FW7A 3L1UA 1V5IA 4D74A 3HR4A 1J20A 3JD3A 3II6X 1CDDA 3VXKA 4QNRA 3B20A 2W2LA 5KYUB 3I2YX 2OT3B 2IU6A 3R3JA 3IDAA 1FVXA 3K1JA 4XFKA 4LHSA 5KWSA 4JMPA 1EWYA 4RELA 1FB5A 1P19A 2WKQA 3WGKA 3RS9A 3Q6MA 3FOCA 1KY3A 2OAGA 3OCZA 1CVIA 3R3SA 1TCCA 3AUKA 2YHAA 2J8ZA 1FP4B 2C1XA 4KVZA 4W99A 5D6OA 1NR1A 1PSWA 5F35A 1K98A 3ET5A 1C4OA 1QC5B 1XZEA 3OEHD 3T5CA 1ZP6A 3VAYA 4BBZA 1YVUA 4FE3A 1J7KA 3N5KA 4XVUA 3F73A 1YZHA 3SBEA 5CB4F 2YOFA 2Q2VA 2ZTMA 5TQJA 4XA8A 1U0NA 3BE5A 4Z51A 1P2FA 4U7TB 3GVIA 3MS2A 4RL6A 1CUJA 1H4TA 4QJ4A 3JVDA 5F51A 3UW1A 1KHHA 1R8XA 3QLEA 5BSWA 1JFVA 1CCWA 3ELUA 3ZE8A 3SI7A 2ZVQX 3CPJB 3N6VA 5CPBA 4P3XA 4TV8B 3JD2A 1UL1X 5FR2A 1YDMA 1ESNA 1AKEA 2JFOA 4J29A 5T5QA 3URKA 2Z2XA 2E0IA 3BJRA 1KDOA 4H18A 1X7XB 4BHTA 4MQEB 3TMYA 2GZRA 2R7MA 3QXCA 3W3ZB 2IP1A 2C77A 3FJOA 1YJ5A 3K4QA 5ILOA 1P1RA 3KBBA 4C4XA 4E88A 1HV8A 3LECA 1DV1A 4AU1A 3U4MA 1K7EB 4R84A 2GOYA 1F20A 2R68A 3H5WA 2J9RA 5BN3B 2A92A 1EVQA 3D7RA 3ADBA 3WGJA 4XDGA 3D2BA 1MTOA 1YO6A 2GASA 2IW1A 2HRBA 5L7WA 2FUEA 6REQA 1XG5A 3IKVA 3FYUA 3LGAA 1F17A 2VPQA 4ETMA 1BXZA 1TDJA 3K5WA 2JIQA 3OLQA 1X9IA 2PS9A 4JI4B 3VZDA 2NTYC 2HF9A 3G8BA 2XF2A 5DB4A 3IEMA 2MWMA 1EFLA 3A2NA 3KM0A 4JA2A 1N6HA 1PR5A 3OG9A 5DBOA 5EPOA 1MA3A 4Q1VA 1RRMA 1X1CA 3RJ5A 3U2QA 4KPUA 4XKJA 3ZK7A 2X0NA 2NUTA 1OFUA 1V6SA 2RBEA 4D4IA 3IE2A 4RL4A 4TXLA 1H5UA 3I0MA 3HCBA 2A9FA 3I2FA 5TQ0B 5CA1A 2HF8A 3AOEA 3OZTA 4WKCA 4CKZA 5BRNA 1EHYA 2OEPA 1ZY2A 4GVLA 4BQNA 3AUSA 1AMNA 3K32A 1I14A 1NPYA 4BO5A 4DKXA 3S1SA 1F6WA 4LCBA 2I4MA 3T1QA 4MVJE 4OB6A 2KB0A 4BO7A 6GPBA 2AZ4A 1JDNA 2CXUA 2X5XA 2CL7X 1EUCA 3H5VA 3LL4A 3HMKA 2OV8A 3S4YA 1A5SB 1WCYA 2AFIA 2MDTA 3FVTA 3GOQA 5LQRA 3GLFA 2PS0A 4DCTA 5ITSA 1Y4DE 1M6VA 1K6IA 1O9HA 5AOBA 4NR0A 2DE0X 5BSUA 5LKAA 2A5FA 2GZ3A 3GCDA 4L78A 3D0RA 2PKEA 1NP7A 2RDMA 1DCKA 3IQFA 4FR2A 3LUPA 1FFHA 3RKRA 2CHFA 4DQVA 5JVDA 2Q3CA 5JPDA 2WG2A 2Q21A 3GBSA 4H6PA 3DLHA 1V16B 4QDXA 4XJSA 3RSFA 1B8OA 3I5AA 3W78A 1E3WB 4FC6A 5ALYA 5CDYA 4IJ6A 4QARA 4UBMA 2O5EA 1KYIA 3FTCA 3WXBA 5BN5B 1XEXA 2OG2A 3QKRA 4EIWA 3FPKA 5K4HA 1NOKA 2XUIA 1YRLA 1T9CA 1BO6A 3RS4A 3UG7A 5EXDA 3I09A 3S8MA 3N8NA 1XZIA 1X1AA 1BAPA 2ZE6A 5GAJA 3L84A 2FW1A 3ZR4B 2C92A 1L5SA 1H1DA 3A37A 5EMLA 2Q7DA 5ALXA 4WJKB 3OQOA 1QTRA 4ZVVA 3AEKB 3PEFA 4B2PA 3HUDA 1GRCA 3SWWA 3MRSA 4ZCLA 5ETJA 4KO1S 1X86B 4JUAA 5JADA 1Z73A 4TM8A 4ZZ1A 3RT1A 2R1VB 4X60A 1PQPA 4KBYA 1SRRA 1TM7E 4QQ8A 4TRRA 4MW9A 5KTKA 4G9GA 2QRGA 1GG2A 1L5RA 4WKBA 1WLYA 4Z9FA 5CFMA 4C7XA 1LFDB 3F9IA 2H65A 2JASA 3A8TA 3Q2KA 1I3OA 1RBZA 1RCUA 1A2OA 3QU5A 4MYSA 4DM3A 2CSXA 1TPYA 3KKPA 5TMDA 3I92A 1GDTA 1H85A 1SU4A 3PQ2A 2AOUA 1OTXA 4J3JA 2JGLA 4B80A 1JU3A 1ZD2P 5CFZA 2HEIA 1CUSA 1K8YB 2A1TS 5KSYA 3D6FA 3STUA 2F6RA 5B1HA 1E2JA 3W9YA 1O94D 4X6UA 5JRJA 4MUHA 4LSGA 2CDAA 3OT5A 5IK2A 4UTPA 5HJ7A 1B6RA 2AOXA 4JDPA 1I7PA 4Q37A 1NF9A 1UM8A 1YVEI 2NO4A 4K6CA 4K26A 4QYTA 3MZ0A 3VO8A 4AQDA 3HNOA 1IB0A 2KPOA 1OLSA 2WICA 5ALDA 1TD9A 1CRLA 1NVVQ 1N8TA 4YXWA 1NP6A 5EJ6A 2OOSA 1LWOA 1XL0A 4GOOD 4CF7A 2WLSA 4BPBA 2QY6A 1KBOA 4RD0A 1XTVA 5KINB 4OP1A 3V32A 2P9CA 1U7WA 1ISGA 1QGUB 1RCTE 2H1FA 2L17A 3DLCA 3K4HA 4W9RA 4C43A 2FPRA 3PYMA 2AUMA 3HUFA 5T57A 1BE6A 3H3XA 1T15A 3MPUA 5ICGA 3THWA 2W6JD 2VXBA 1YA4A 1U98A 1TEHA 1SHZA 4EJ6A 1DTEA 1OWOA 1JILA 3AX6A 1KYYA 3MMNA 4REOA 3EZFA 1W44A 3VO1A 1X8JA 3KT0A 1QK3A 1CFZA 1DQYA 1NUSA 1U99A 2H6EA 3HC7A 5AKEA 4R3WA 3UUFA 3WNZA 3WK8A 4LRXA 1QMGA 4K6FA 5DO9A 3A0RB 4K2AA 1MAVA 4HQKA 1FS5A 3IVAA 3KVRA 2H48A 4KN5A 2JFUA 4ZCMA 1HTBA 2LPMA 2W2NA 1CQIB 1XTTA 3FROA 1R2QA 4KC0A 3VSAA 3MB8A 3MUOA 4BNTA 2IS6A 4QLBA 2H5JA 1RC8A 2GK4A 2ZUSA 3LVFO 4YJ3B 5K0BA 1Q1GA 4P0QB 4CM4B 1RMYA 2FSFA 1ZHHA 1GNRA 4YALA 5JI3E 1CUUA 5IKOA 4O2BA 2F59A 2RHWA 4M8KA 1TA4A 2Q99A 1JHAA 3JQRA 3QE2A 4ZRNA 2AN5A 2ZJFA 4MUEA 1EK0A 1L5VA 2PZMA 4C3VA 1NN0A 3MT9A 1L6IA 1M2WA 1FX0B 1XT6A 2F17A 1EXWA 2GUGA 5IRCD 3GQBA 5AW4A 4RVGA 3PXEA 4Y98A 3KC2A 2WAAA 3RG8A 1BWPA 3P20A 2VRBA 2Y05A 1VCHA 4ED9A 2XXJA 5CT8A 3VAZA 1KIMA 2JGDA 4JP2A 2IOFA 1X1TA 4BNVA 1NQVA 1YQWA 4JYMA 3V7WA 5LOVB 3RS2A 2FRDC 2XQGA 4NMWA 1CJSA 3A4NA 3R20A 4TKZA 5M29A 1PJTA 3G0HA 1YZQA 2UUAB 3UK6A 4MUBA 1AZSC 1N0UA 2ID8A 3L4SO 4JCCA 4RZ3A 1JNXX 2VTKA 2HT1A 1UIRA 3G49A 1M8PA 3T35A 3EFOB 5F7OA 2I2XB 1JXOA 4ZIRB 1DRJA 4DR3B 1I9CA 5LP6C 5CP8A 1NBME 3WRYC 1XVTA 2PPVA 4FZVA 2FZ5A 1FDTA 2YV1A 4V0MA 4XSHA 4LHEA 1L5KA 1FFCA 5G0WA 3ZZMA 4YMUA 1PFKA 4MWDA 3DBHB 1G0OA 1TUBB 2X5JO 2XCUA 2WUWE 4FFBB 1DC3A 4WEQA 5DMXA 3N3BC 1R6BX 5SYAA 3R5TA 2PT6A 4K1XA 3RKUA 3VZRA 4Z9XA 1JBQA 2P65A 2W2VA 1GZDA 3HZHA 4G23A 4MQ6A 1D8AA 3FI0A 4Y18A 5ENZA 1DWOA 3B1JA 5A5GA 5BXYA 4BO9A 4FQ7A 4MYCA 1QLWA 3E82A 4QQNA 3B51X 3GJRA 1GLNA 4UOEA 2HNKA 5D5QA 5J63A 4J1QA 4N65A 4D4GA 1Z25A 3HKCB 5KYKA 5F9MA 1XPOA 1CJUC 4K3VA 1OI4A 1NR5A 3PQDA 5JZBA 1YL7A 2XKKA 3BWDD 5K0ZA 1C7JA 3O94A 2WU0A 2O2SA 4ER6A 3TBFA 2EC5A 2QUZA 1CRWG 4OQQA 3CWCA 2FQQA 2GHTA 2YICA 4KVAA 4TMYA 4XIGS 1HUQA 2VHWA 4RVSA 2M6KA 2NU8B 2RI0A 4CKYA 2WF7A 3WIVA 2PIAA 3X1ZA 2DOKA 3NATA 3GPDG 5LQKA 2ASVA 4RTLA 4GS5A 2UUCB 2LTAA 5IBQA 3CLVA 3EYWA 3N6RA 4MICA 2Q3LA 4G8DA 5KNBA 1FPMA 1G7TA 3DBOB 2RC5A 2D1FA 3VR5H 3IAXA 3U7QB 5MGBA 3G6WA 5AQ1A 3RSCA 1SK9A 1IBRA 3A1DA</