2WOJA

Adp-alf4 complex of s. cerevisiae get3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
301
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATPASE GET3
publication title The Structural Basis of Tail-Anchored Membrane Protein Recognition by Get3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 104
structure length 301
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wojA00
1G4UR 3MWJA 1XU4A 3GLGE 2WTUA 2H57A 2QM8A 4IFBA 4TQUS 1NN3A 2IYSA 1PV4A 4ZCLA 2VEDA 4ZPXA 3GQBA 1OIXA 2ANCA 2GCNA 3GLHA 2OESA 2BMDA 1ZD9A 3DZ8A 4V03A 4G01B 3OEHD 2GWHA 1GRQA 1DELA 2FMXA 2IT1A 1FP7A 5AUPB 4WXPA 1ZINA 5DN6D 1TQ6A 4JJKA 4LUCA 3EC2A 2G9NA 1DAFA 2B7BA 4AK9A 3SI7A 1CS4C 4Q48A 3LW8A 4QOSA 4JKIA 4EPRA 1HURA 1HA3A 3CRW1 3KB2A 2FJUA 4MKGA 3SBDA 5JI3E 1UKYA 5KSPA 1M7BA 2IBMA 1QG2A 1E0AA 1VCIA 1KDTA 2C9YA 2OEPA 4EKDA 4KV9A 3HU1A 2BMEA 4KCGA 2P65A 1NKTA 5JS8A 1WMSA 4JVMA 5FTKA 2NQ2C 3K1JA 3WXMA 1UEIA 3GLGA 5UKDA 5ANRB 1XJCA 4TTPA 3H84A 4RD6A 1GNRA 4Q1CA 4WIAA 2BJVA 2ZSDA 3I32A 5KDLA 1UFQA 4HZIA 5B64A 4XWKA 3OIYA 2AFIE 1JECA 1YKSA 3L0SA 5JHGB 2R6GA 3LX8A 2Q0HA 3QQ5A 1JJ7A 3QVVA 3CRRA 4Q21A 4TL7A 2GJKA 4CDGA 2IK8A 1S3SA 1P2UA 2P5SA 2AN9A 2J1LA 4NTZA 1HT1E 1FUKA 3T5DA 2QE7D 1ZNYA 5G41A 4M9XA 1W48A 3B9PA 1NF3A 4DXAA 3LXRA 4EJSC 2BHRA 4S35A 4OI1A 3LV8A 5EP4A 3KFVA 1G5TA 1KSFX 1T5LA 4TYQA 4JL8A 4RZ2A 4PO1A 3PFIA 1FPMA 3B2EA 3U5ZB 3MMPA 4JSYA 4LK2A 4X8MA 1E3MA 5FUVA 1S8FA 4IXMA 4EIWA 2HYDA 1DAHA 2JJ1D 2OLKA 1FL9A 3ZZ0A 4M1MA 4QJ3A 2BCGY 1G9XA 2QQEA 3GJXC 4PQFA 3AGQA 2VP9A 4TLAA 4AURA 2QAJA 1J70A 2XNDD 4TYNA 3RWMB 3BH6A 4G3XA 4DWJA 3MRSA 3GJ7A 1G8FA 1C4OA 2ORVA 4W5WA 1P3JA 2DR3A 1NJGA 2IEZA 2RGDA 4IDPA 4Z54A 4FIDA 1QZXA 5B2ZA 3CRVA 3I8SA 4JLAA 3B1VA 4YMVA 4JIMA 2CVFA 2WJGA 3N5CA 1G5RA 3OHMA 2ZROA 2W6JD 3AVPA 4ERNA 3DL0A 3TBKA 1GSIA 1JR3E 3RS5A 3KQLA 2Q3HA 2GEUA 2E1RA 2RGCA 4HLCA 4C3ZA 3PJRA 2YINC 1L7VC 1BS1A 1SZPA 3PCRB 1W2HA 2R44A 4YQFA 3P32A 4A2WA 4A15A 2PT5A 5KSOA 4M4SA 1I4DD 2HYIC 1KK2A 3SFVA 4Q1EA 5GVRA 4C30A 2J7KA 2ZSEA 4OK3A 2CEAA 5FOWA 1ESMA 1OXTA 2W83A 3HP1A 4UJ3A 3PR1A 1EFRD 4DLXA 3DKPA 1QVRA 4B2LA 3QKTA 1LFDB 4WZBE 4P33A 2GVDC 4HYYA 4UQOA 3ZJYA 3K53A 4TMXA 4NCJA 1UKZA 4CIDA 2P2LA 4KJZA 4OQLA 2FEOA 3K8YA 2G0NA 4Q1BA 3B60A 2WOJA 2ECKA 4JYBA 3KUDA 4M2LA 4YLGA 4V0LA 2EW1A 2IYLD 3OFND 2JIZD 2ZRDA 2DY1A 2FZLA 4JLDA 3AVQA 2CVHA 1WDTA 3TR0A 4DCTA 1A5TA 2VHCA 3CX6A 3NBYC 5E95A 3Q85A 5FPKA 1MRNA 2V6JA 1JR3A 3WRYC 1UDWA 4OBEA 3BFVA 3K70B 2HF8A 1XTKA 4RKEA 2IL1A 2BEJA 3PUZA 1T91A 1Y3AA 1KY3A 2C9OA 4NYJQ 4RD4A 3TNFA 2GJ8A 2X8AA 3P27A 4FI3C 4B47A 3U6BA 1QRAA 3LFUA 3K9HA 4OYHA 4XVQA 5SZHB 5JWOA 4K81B 1L4UA 1D5CA 5SZJA 1IXRC 1GITA 3PEWA 4TSFA 4TMWA 4L4UA 3UK6A 4FMBB 4IJMA 4LPKA 1E1RA 4US1R 4B2IA 2O8DB 3E2IA 1XJ0A 1ZMXA 3DVLA 1HE1C 5AJWA 2MSEB 4P0TA 3U44A 1SHKA 3KKPA 4EPVA 5CYOA 4WBSA 3BAFA 1IN7A 1XDBA 2J45A 4QHYA 2A3RA 4XIGS 1TAGA 1GKYA 5EZ6B 3UKDA 3PIRA 3IUYA 2GETA 2ZVPX 2OAP1 3RYTC 2QAGB 3QPWA 4M9QA 5DE3A 2JASA 2FGKA 5DI3B 3W8NA 4B74A 5GVSA 3H1TA 3DO6A 5IHPA 4IXNA 1CJKC 2GHIA 5LB4A 4CEJB 1CKEA 1R5NA 3B13B 2ATVA 2ZAMA 5HTKA 4LBZA 3VX4A 4AWXA 1VPLA 1Z6TA 2G77B 2W2VA 2WMOB 4DSOA 3CIOA 2RMKA 1ANKA 4IKEA 5C2JB 1TF2A 821PA 3ADDA 2JLSA 3HWSA 1KDOA 3C8UA 4I4LA 4B35A 4LRWA 4EDHA 4B44A 3ZVNA 1J8YF 1Z3IX 4HI0E 4UXJA 1I4LD 1Z2AA 1Z29A 4YXWA 1E2EA 5C46F 5AJVB 1VECA 3QKUA 4MYCA 2IX3A 2ZI4A 3A1UA 3VU9B 5CDFE 1R6BX 3QKRB 2RB4A 1E9FA 5JI2E 2WSSA 2NO1A 2QI9C 1SXJD 1TU4A 3CNNA 3TUJC 2QAGA 3GEHA 2OXCA 1G3IA 1TEXA 5DI3A 2EWWA 1N5LA 5FOVA 3RSLA 2ZUDA 2OCYC 1OT3A 1P62B 1XEFA 2QMEA 421PA 4RZXA 4DLWA 4IEEA 1VMAA 3T1QA 4CEJA 4IRUB 1E2JA 1E4VA 2IS6A 1R0WA 2OFWA 3ZQJA 2J0SA 3TVDA 2Z5FA 4P3YA 4KFRA 3FB4A 3TH5A 2X2FA 3D31A 4J0QA 3ZS9A 1GILA 3DEFA 5SZIA 4IVPA 3OE7D 1PUIA 3EWAA 5DIFA 3SU8A 2QEQA 4F92B 4ITRC 4HUQB 2SHKA 1W36D 3QVUA 4I1UA 2FH5B 5DO9A 3Q72A 2D4HA 3CX8A 3IILA 3ND8A 4OHZA 5C18A 3ICQB 5DSZA 1B23P 2OXRA 1OFTA 1YU9A 3VU9A 3VKWA 1YZUA 1GNQA 3B9QA 3QKRA 3A1VA 4Q4AB 2R6FA 3BIFA 1IQPA 1YR6A 3FMIA 4Y0VA 2JGNA 2C9CA 4MRNA 1MOZA 4FWTA 4OHXA 4M1WA 1TUIA 5GJCA 3PEVA 1G64A 2PBRA 3WP1B 2AWNA 2VBCA 3U2QA 5D3MB 3FYHA 1XD9A 4LZZA 4GPTA 4U5XA 4PO8A 2W6IA 5DNYB 4N0EA 1GTVA 3A4NA 2KWIA 3QG5A 4JLPA 3RS2A 1E2GA 3EG5A 5LBIA 3JVVA 2WWXA 2WKRA 4NYIQ 4HUQA 5FH9A 4GBMA 2XSZD 3SR0A 4GL2A 5EUMA 3TK1A 3X1XA 1Z2CA 2QMUA 1XWIA 4EFLA 1IN4A 1FUUA 1RIFA 1PUJA 1IXSB 4QBHA 4Q4AA 3EZ7A 4CYMA 2YOFA 1DADA 3R7WB 3BERA 2WSMA 3ZS8A 4Q4JB 1OB2A 1F60A 2AR7A 2GXSA 3SJCA 1PZNA 4KODA 2MSDB 2QP9X 3IEUA 1CIPA 5H70A 3K70C 2ZQ5A 4HDQB 3TAHA 2ERYA 3PENA 4A4DA 3SJBA 4BFUA 1X86B 2BVNA 4PXAA 1NRJB 1VTKA 4D0LB 5D3MA 4EPWA 4EAQA 2FGJA 1G3UA 3DHWC 1ZIPA 3EZ6A 3LY5A 5FBWB 1GRRA 1IM2A 1Z6XA 621PA 1VKJA 2HCJB 2IS4A 2GJSA 1RYHA 2FN4A 1MO3A 1KAGA 3ICEA 3B1WA 2JDIA 4NCKA 1SVIA 4PHHA 3RSOA 3PEYA 4B34A 3FHCB 2NGRA 3K9LA 5JJLA 5AUNB 2H7VA 1W49A 4FN5A 3DPUA 2BM1A 2R6DA 3K0AB 4TL9A 4G1UC 4MGKR 3R7WA 2ZYTX 2WIBA 4PSKA 2GAAA 4Q4JA 2LKDA 5L3QB 2ANBA 2Q9AA 4IVRA 2QAGC 1KO7A 2Q9CA 5CIWA 3X1YA 4CT5A 2QP3A 3NHAA 2WMNB 2DFLA 4IW3B 2IS1A 2YYZA 3U60B 3GJ4A 1DBSA 1NIJA 2WBLC 1SHZA 1DVRA 4OI0A 3AQ4A 4QHSA 3QBTA 1XPOA 1W4BA 3OAAA 1UEJA 4NCIA 4WVFA 3J81k 1IAQA 1VG8A 1N5JA 1U8ZA 2GESA 6Q21A 1I2MA 4RD3A 2ZIAA 5KPDA 4LJ4A 1TUEA 1JXOA 1IY1A 3U3JA 1NSFA 4V0OA 2WWFA 1QVAA 1Z0KA 3K0AA 4JLKA 1U81A 2GRJA 1OH7A 3CB4A 2NO0A 5BWMA 1HT2E 1D2EA 4NBSA 5E7IA 1A2KC 1RKBA 4U02A 1T6NA 4MKIA 4RJLA 2YHSA 4HB4A 1J99A 4YMUA 2EWVA 4Q47A 4JBWA 3REFA 4E03A 5FI1B 1XMIA 3OEED 2AD5A 2R65A 2XTNA 3RC3A 8OHMA 2ZRCA 4QRHA 2QMOA 3W5JA 4BFSA 1G5PA 1XFAA 2JLRA 2ZAOA 3IIKA 4CF7A 2WOOA 3MWLA 1S2MA 2DFNA 4DHEA 2J5XA 4M22A 4L15A 4DUGD 4JKYA 5FOTA 1AGRA 1HV8A 2CLSA 4IHQA 1B0UA 2YOGA 4LWZA 1RRFA 3SJAA 4ZCIA 1ZBDA 1KSHA 4MUAA 1NBMA 4TYWA 1JPJA 4AYWA 4PAMA 2Z43A 4ZDIA 3ADKA 1P72A 1Z0DA 1Z0FA 3RVBA 3W3ZB 3KKNA 1CRQA 1E9AA 2HEIA 5JEDA 4TWZA 3BC1A 4BRWA 1U0LA 3TSOA 2ZREA 2OBMA 1OIVA 1XTRA 1N6KA 3NEYA 3W8RA 1DE0A 2OZEA 5DLQC 4CVNA 4KI0A 1KSJA 2JCSA 4WAUA 1Z0JA 2C2HA 3I73A 1G1MA 1T0JB 2A30A 3S1AB 1H8HA 1KKMA 1P5ZB 3AP2A 1XEWY 2VYFA 4AKEA 3W5IA 2EVWX 2R6AA 3I61A 3U3KA 4GP7A 1KZGB 1KAOA 5EE5B 3KQHA 1OH8A 3MWYW 1HY3A 4BZPA 2JAQA 2VLIA 1A2BA 3C16C 4FD2A 4HLUA 3U7GA 4DLTA 2G83A 1AGPA 4II7A 1HE8B 1Q3HA 1Z22A 4LY6A 1IN5A 1N6HA 1Z0IA 4ACAA 4B75A 3BXZA 4E5UA 3A4LA 4RVCA 2CK3A 1XD8A 4ARZA 5KUTA 3IBYA 2GEDA 2GF0A 2OV2A 4B32A 3RRYA 5D3QA 2CMKA 2REOA 4MKFA 1LY1A 2N42A 4FXPA 4DDVA 4X8LA 4MRSA 3RAPR 2P3SA 3S1AA 1S0UA 2BC9A 1E98A 2DFTA 3L82B 3QF4B 2YC4C 2IYTA 2AK2A 2H92A 1E2IA 5JFGA 3L2OB 1ZUNB 3UXMA 1NVXQ 2QNRA 2ZSFA 3M1IA 5TY0A 2BKUA 3LRPA 1OXSC 1ETUA 4D81A 4K8OA 3AVYA 4P31A 3LLUA 4XSGA 3CF6R 4TYYA 1AZSC 1WXQA 4GSYA 5M04A 2Z83A 2JATA 3LBNA 1SVSA 3AVUA 4R2HA 3EARA 1MKYA 3RS4A 2HXSA 1XD2B 2AKYA 3KZ1E 5TDHA 3GLIE 2QSZA 2ONJA 2ZANA 3MD0A 3OIUA 4AD8A 1ZVQA 2UKDA 1YZQA 2O5VA 4CRWB 1U8YA 3C15C 3DM9B 4OI2A 2GZHA 5H8WA 1BYIA 4RKFA 5EP2A 2WAXA 1YRBA 3EA5A 3QF4A 4Q00A 1TADA 3THYB 1IJEA 2PJZA 3P26A 2CLDX 4YMSA 3ZVLA 2B8WA 2OAQ1 3B8HA 3L8YA 3BJIC 3TKLA 2F9MA 4Z1MA 2GCPA 1ELOA 1EWRA 2NG1A 1CLUA 1LTQA 3RWOA 2QORA 2QRNA 3CZQA 3TE6A 1CRPA 3KDSE 3GLHE 1LB1B 5AJXA 2N46A 4E07A 3TUIC 1HH4A 2IYZA 1ZNWA 3IBGA 1W2GA 4A36A 1KI1A 2OLJA 1DAKA 4Q5IA 3O47A 2J9RA 4W5JA 3JZMA 5KU1A 4BFXA 3GJ8A 4IFEA 4LHXA 4ASUA 1OFIA 4C2UA 4DVGA 1AIPA 3IQXA 1ZM3A 3B1ZA 1QHGA 3BGWA 4Q4LA 5P21A 3HYRA 1F2TB 2I4IA 5HKKA 3AP1A 4JLJA 3UPUA 4DZZA 1CXZA 3AKDA 2HJVA 4C0QC 3KKQA 1R7RA 2CDNA 3MUFA 1CR0A 1NG1A 2I1VB 4PHFA 1MH1A 3Q8XB 5FOSA 2KE5A 2PMKA 2GEVA 1KKLA 1N5KA 4C0KA 2VP5A 3ZD7A 1YR7A 5J4KA 1M34E 1M74A 2YWGA 4QFMA 4TMKA 3TUZC 3AH8A 1E2PA 4ON9A 4HLUC 1XCGB 4KU4A 2AWOA 4IOMA 3CRQA 4MA4A 3CF0A 4OHYA 4V0MA 1KGDA 1GM5A 3H0KA 3EIEA 4DLVA 3B5JA 1QF9A 2FPMA 1UADA 4IOJA 1KI6B 5A0FA 2XJ9A 4LI0A 2PX0A 2C95A 2ZJZA 3BFXA 3RHFA 5JECA 4LJAA 4U00A 221PA 4LV6A 1NJFA 2GCOB 3NC1C 1A82A 1F2TA 1Q1BA 4FINA 4B48A 2EQBA 2OFOA 3KTAB 1OV4A 2QBYB 5FBLB 5J4VA 3NBFA 3QXXA 3V00A 5K8UA 3R8CA 5JBQA 3LX5A 3EZFA 4D80A 4TLDA 3SEAA 1U90A 4MITA 4M1OA 3MJHA 3UATA 5TV2A 2J7PA 2OBNA 1IY0A 4TMTA 1EG7A 4A6XA 3SYNA 4NHOA 4JSTA 3PV0A 3SOPA 5L3SB 5BYJA 3SHWA 5LB2A 3CWZA 1KIMA 1MO6A 3GJ6A 3ADBA 2OFXA 2PZEA 3VNVA 1KI6A 5LD2B 4W9MC 5F2EA 1G7SA 3KXLA 1MRSA 1RYFA 1ZM7A 3TQCA 5JMTA 2DCUA 2G1JA 4A82A 4YDHB 2Q3MA 3ADCA 1ZYUA 4K46A 4UNPA 3KTAA 4BLSA 4ZDKA 1BKDR 1T0HB 2QBYA 4MKHA 4JLOA 1NLYA 3QY0A 1F5NA 2EFCB 2QL6A 5G53C 2GZAA 1G41A 1JR3D 1LF0A 1T3HA 2ATXA 4RD0A 1NVUQ 3BFKA 3LA6A 3IQWA 2GXQA 1NN1A 2C5LA 2WZQA 2A5YB 3K0EA 3VR1A 1OH6A 2VL7A 2HT1A 1TU3A 5FBRB 2OUKA 4PAQA 5JLJA 2ZSBA 3LO5A 4Z51A 4C7OB 4F4CA 4HAWA 5L3SA 3F3YA 1Q57A 3NG1A 3BE4A 2IA5A 3BORA 4B3CA 4C9BA 1HEIA 4H9GA 2O0KA 2IYYA 3CH5A 3E70C 4G5OA 2C99A 4GZLA 3W34A 1LVGA 3D8BA 4U7DA 5E7MA 2D3WA 1GL6A 3GEIA 3LBHA 3MCAA 3C41J 3LAWA 2VP2A 4TSFD 1OF1A 4OQXA 4PHGA 1NY5A 4GI7A 1E1RD 2JLWA 1ZU5A 3VR6A 1G19A 2ZETA 4PPQA 5F3WB 1AN0A 1D8TA 3F0TA 1Z08A 5FTMA 2D2EA 3MLEA 3VR4A 2AHOA 1GZSA 1RJ9B 1VYVA 2BKEA 3MFYA 3WP0A 4TQAA 4WZ6A 1G6OA 1GKIA 3VR5A 4IEIA 4RFVA 1VYUA 1IXZA 5FTNA 3I8XA 1Q44A 4MRPA 4A0FA 3K70D 1ZCAA 2FX3A 4RZUA 1XCMA 1XTQA 2QGNA 3SS8A 3TSZA 2FDCA 2FU5C 2YWHA 1E2LA 3Q7QA 1R5OA 1PJRA 1W46A 721PA 3NBZC 4F4IA 2ONKA 1K6MA 1P75A 3VR2A 4IDQA 2WPDA 2HCBA 4NDZA 4BLQA 4ACBA 4HAUA 2F1RA 4AG5A 4TZ6A 4W7SA 2VHJA 2PCLA 3A36A 3IDQA 2A5FA 2BM0A 2RGXA 2P6NA 1G3QA 1YZLA 3T35A 1UBGA 3AVTA 1P6XA 1QHHB 2FOLA 2NPIA 2OBLA 3AP3A 4ILEA 1QHIA 3F8TA 3THXB 4PAOA 5EP1A 3PXGA 1JPNA 4YXWD 1E6CA 3PITA 5EP3A 1RJ9A 3TR5A 4URZR 1ZJ6A 2GK7A 3U7FB 1E0JA 2ZE6A 1ESNA 1AQYA 4E22A 2BV3A 2G1KA 4HB2A 4DJTA 3THOA 4KBFA 3SJZA 4D4KA 1SVOA 4Q03A 1MT0A 4DKXA 1E99A 1NP6A 3LH5A 4I1OA 1EK0A 1N6PA 2O52A 3I4LA 4TMZA 2FSFA 2PMDA 2QTVB 4QKQA 1OHHA 1UJ2A 3MGCA 1W5SA 2O8FB 3GD7A 3WHLA 1KNQA 2G6BA 3U3RA 1TX4B 2BBWA 1JXMA 5KYKA 2ZVQX 2QPTA 2W0MA 1OYYA 1N0VC 1NI3A 4PR0A 1QHHA 1W5TA 3B7GA 2Q3FA 3THXA 4MH0R 2GZDA 3TRFA 3B78A 4LDJA 1QHXA 3GPLA 2E87A 4Z8YA 4A2QA 2WJYA 2YJTD 1ZNZA 4B3XA 5DYIA 4L8GA 5DI9A 3OIWA 4L9WA 3LQQA 4URVR 3FMFA 2GKSA 3AVXA 4NZYA 4QM7A 1XCPA 3RRNA 1W4AA 5H1YA 2IWHA 4I1SA 1JAIA 4OK6A 2OM2A 4JL6A 5EQTA 1KDPA 1OSNA 3MG9A 2ZI5A 1G8GA 5EXPA 4D25A 3WNDA 2O8FA 4C0SA 2X2EA 4JJZA 1EX6A 1JAHA 4B73A 2W6ID 2XNSA 4PANA 4Q9LA 4Y0AA 3UWKA 3V9PA 3ZD6A 4OK5A 1AJEA 2B21A 4TN1A 2JJ2A 3ZZUA 2V9PA 1Z6GA 1DAEA 1A4RA 2CL0X 3EIQA 4R71A 2XB2A 2W0SA 5JWHA 5KTYA 1VG1A 4HDOB 2O8DA 4PC1A 2O0JA 3RANA 1NL3A 4LJ9A 1J2JA 3P4XA 1W47A 2BIFA 3KL4A 4KSCA 2AK3A 2RGNA 5HZHA 2OHFA 3M6AA 2CL6X 2IHBA 1GL7A 2EYQA 1HYQA 4KLNA 1XPRA 3CR7A 1QDEA 1DAIA 1MV5A 2XZOA 1G18A 2PH1A 1PVOA 2NZ8A 3H2YA 4US0R 3VAAA 3T1TA 2QENA 4POAA 5G40A 4BZQA 2O8EB 3R9IA 4GZMA 3EW9A 3L8ZA 1OYWA 1OXVA 1KMQA 4GNKA 2YWFA 3NC0C 1NSTA 4NE2A 4Q9HA 1CU1A 2NTYC 2QN6A 5J5CA 2WM9B 4CEIB 4PC6A 2VF8A 2RHMA 2RGBA 3FVQA 3NXSA 5DHFA 2HV8A 2ZJYA 2JDID 4PC2A 5EE1A 4YC7A 4ZDJA 1OPXA 1GFIA 4M1YA 4OHWA 3JZAA 4HSEA 1ZNXA 2RHDA 1LS6A 2CJWB 3SC3A 1G8PA 4BZXA 2DB3A 5BN3A 2VIIA 3TSWA 2IEYA 2IHYA 4TZ0A 1OKKA 4RCYA 4UNRA 4C0BA 1JQLB 4ZKEA 3FFAA 5KDOA 3MSXA 3VKGA 3CM0A 3ZYCA 2XB4A 5KSZA 2O8BB 1G3RA 3EPJA 5J40A 3BH0A 4GMDA 2QT0A 5FTLA 1KO8A 3QXCA 4NMMA 2A7QA 4R7ZA 1NLZA 1AZTA 3B82A 4QGHA 2C03A 2P5TB 2N1BA 5E3HA 1NN5A 3QBVA 3A1WA 3ZVRA 4CEIA 4CEHB 1SULA 1SVLA 1UF9A 1XTIA 3OAAD 5CLQA 5AJZA 5CYPA 1EFTA 3TMKA 5JJIA 5JZVA 1TF5A 3T5GA 1SXJB 3D7MA 3ZLJA 4AYXA 1Q1EA 4MDEA 3VR3A 4DLYA 4RD1A 2CJWA 4B2PA 2F55A 4BEBA 3GP8A 2JLUA 3EZ2A 1BO6A 2H18A 1UBCA 1FFHA 3UG6A 1CJTC 2FFBA 5KPJA 4HLDA 3GJ5A 5F9HA 2O8BA 3LNCA 5JSZB 1D9XA 1GNPA 5GJVC 3OF5A 1E9BA 3W6PA 2UZIR 2IXEA 3U61B 5F98A 1CEEA 4M53A 2X77A 5FPYA 4NU0A 5TMPA 4XTRA 1QBKC 4AKIA 2X19A 3QUSA 5AUQA 3W6NA 3LW7A 1CJVC 1AKEA 3KKMA 3WNBA 4EPXA 1YQTA 1P7CA 4D0NA 5FR2A 1AK2A 3CKLA 1ZC3A 4TT3A 1HQYE 1XRJA 3WYFA 2E9SA 1MABB 4TMVA 3EX7C 3I92A 2B6HA 1GKUB 4GFDA 4GDFA 1ZM4A 1DAMA 3P1JA 3NH6A 4KYUA 1FW6A 5EE9A 2EFGA 3EXAA 3K0CA 1W44A 2WICA 4PFSA 5JSZA 1OB5A 2ZUCA 1NNEA 2IXFA 2ZU0C 2RGNC 1XZQA 2G0TA 2JLZA 3WMEA 2K5UA 4ZV4A 1Q12A 4MQBA 2YV5A 1PLLA 1L4YA 5FL7A 5LDDC 4M9SA 3U7HB 4DSUA 2W00A 1OXUA 2R8RA 3CW2A 4MGZR 1U0HC 3IIJA 2J59A 3DKVA 4MYHA 1EGAA 1ZP6A 4BFWA 1WQ1R 1F6BA 1IN6A 1E0SA 2UVQA 4NONA 3WY9A 2ZJBA 1H8HD 1W4CA 1XB2A 4M0LA 5IT5A 2JLYA 4KHZA 3O8BA 1MABA 2W2XA 5FUYA 2VP6A 4HAZA 5L3RA 1R2QA 2P6UA 3W9YA 2KBEA 3SYKA 3TGPA 1NBME 1E2NA 3JVUA 1FX0B 1VIAA 5AUOB 4OJKA 2QP4A 3ZQ6A 1JALA 2JJ8A 2W2TA 2L0XA 5CK5A 4PC3A 2CCGA 5L3QA 4EQ6B 3CPJB 2R9VA 2GJ9A 2CK3D 3EC1A 3G0HA 2C04A 4EUNA 2J0QA 1JI0A 2XEXA 3D6TB 2GAOA 1II0A 4PSAA 1BIFA 3NKVA 2H17A 1R0YA 3AUYA 2XTZA 3GJ0A 4OL0A 5BW8A 4TLBA 3PUXA 1COWA 3MJRA 4CW7A 2QM7A 1IHUA 2X1VA 1IBRA 3P20A 4HB3A 4DLRA 1Z07A 5H68A 3F5FA 5TVKA 2YKGA 2CHGA 2V1XA 2CXXA 2OCPA 3SN6A 4DT1B 2IYWA 3M4YA 1DPFA 2JA1A 4OKSA 4P4SB 2MMCA 2FSHA 3RABA 3U7EB 3WMFA 2ZI3A 2BCJQ 2DWPA 3SQWA 5CK4A 2ERXA 3CRMA 1CR1A 1KHTA 3QXSA 2F1HA 3SE0A 5FBVB 1NMZA 3BBPA 3W3AA 1L8QA 2WKPA 3DOFA 1EWQA 1A7JA 1M2OB 3LD9A 5EJEA 4KXFB 4DB2A 3EASA 1DTSA 4L5BA 3T06B 1Z0AA 3DZDA 3TVTA 1VIYA 4DDTA 4F93B 1FQKA 3REGA 2CNWA 4P4UA 4B76A 4LYFA 2DPXA 3SZRA 3QPUA 2BWJA 4DDWA 4KSBA 1KO5A 1YZGA 1ZC4A 1T8UA 2Q6TA 3K0FB 1YJ5A 3FKQA 1G6HA 1CR4A 5K8IA 4FMCB 4QNMA 3ZIAA 4DEXA 2IWRA 2ZR9A 4PC7A 1T4GA 2YWEA 1CJMA 4Z1MD 1KDRA 3T1VA 3QI2A 4ESVA 3TIFA 5JS7A 1XXHB 1M7GA 4BASA 4RY2A 4F7WA 1DO2A 3VFDA 4ZO4A 3PG5A 3THWB 4A0RA 2WIAA 1N6LA 1G4AE 2FE4A 2MSCB 3VKHA 4RZ3A 1F3OA 3K0CC 4ZCMA 1Z47A 2ZR0A 2RKOA 1FZQA 2J41A 4EFNA 2GBLA 1XP8A 4BFTA 5J4LA 3WBKA 5KNBA 3PEUA 3FTQA 1JBKA 5G3ZA 4B71A 4ASUD 3A1TA 2RCNA 4US2R 1ZUIA 1KJYA 4TTQA 2ZE7A 3GJ3A 4JBYA 5HCIA 2ZI9A 3T12A 4R98A 1T5IA 4HATA 1W4RA 5HKKD 2QA5A 1P9RA 1TMKA 4Q7KA 3N2EA 2VHUA 4FWIB 1ZRHA 4LHZA 3H4MA 1UBFA 2F1JA 3AVOA 1E9EA 1E2DA 1EFUA 1VCNA 3IKJA 2D7CA 4L16A 4OI4A 1IONA 1D6JA 4KFSA 2C78A 1XXHA 1DAGA 3ND9A 4KAXA 4C4PA 3Q9LA 3KX2A 4EJSB 4EPYA 1KI7A 4RSGA 3THWA 1Z8FA 1KI9A 3NIBA 2KBFA 1TF7A 1U0JA 1YE8A 1XEXB 2QPAA 1NVWQ 2ZE8A 4RFSB 5FOUA 1N3BA 1H65A 1W0JA 4OHVA 5CITA 3TQFA 2RGEA 5EXSA 5FUXA 2ASEA 3EWSA 3SFZA 3DMDA 3IGFA 3EZ9A 4D4LA 5KSYA 3GFTA 3EPHA 1E4YA 2C96A 4MRRA 4JLBA 4LX0A 5EE3A 4DCVA 2LCFA 2B92A 1R0ZA 2FPLA 2YOHA 4YMWA 5C1BA 4LBVA 1ZAKA 3E1SA 1WB9A 2ZR7A 2OE2A 2A9KA 3LXXA 3IPXA 1N0WA 1KY2A 1U94A 4LC0A 2QROA 2H1LA 5DISB 2GF9A 5A4JA 4O25A 2CE2X 4TL8A 2XTMA 5HZKA 4GRAA 5HE9A 2FPKA 4B43A 2J7PD 1I4TD 1GOTA 2PZFA 1N6RA 2F6RA 4PX9A 2JEOA 3P4YA 1C9KA 1XEXA 1D2NA 4RFSA 2WJJA 4NCNA 4V0ME 4HEJA 2J46A 4Q7MB 4G5QA 4B6EA 1XD2A 1F2UB 4GP6A 4B3FX 4BQSA 1YRAA 3UMSA 4XJXA 3GMTA 4ESHA 1C1YA 2XOKA 2PT7A 5CM8B 5DHAA 4QJ4A 1E1QA 2VH5R 4KO8A 4NCHA 1ZU4A 1Z5ZA 3LLMA 4Q19A 5KHOC 1KI2A 1G7CA 1YHNA 3I62A 1JQJC 5JCZA 2D62A 4GOKA 3THYA 2ZJ2A 2A5JA 2NO7A 4KFUA 2FF7A 3HR7A 3G82C 2Q21A 1OIWA 4XD7A 4MGIR 4UNSA 1S4QA 3BK7A 2ZRPA 3CH4B 3FMOB 4JVNA 4Q7LA 4Q9IA 1WRBA 2ZI7A 4TTRA 2TMKA 2WV9A 1VG0B 1WBDA 1BMFA 2ZJAA 5TXGA 3A4MA 3QNUA 4LYHA 5FL3A 2AFHE 2QMHA 1NY6A 2FNAA 2PLFA 3EIHA 1FTSA 2CHQA 1F2UA 4LJ8A 1RRCA 4DSTA 1P9WA 1U98A 4BFVA 2ZITA 3FKSA 2R6CA 2NO9A 1K8RA 1ZD1A 2GBLC 1ZD8A 2C8VA 2ZRGA 4IVQA 2HLDA 5J47A 4B6FA 1G291 1JEDA 1NKSA 1FOEB 3EPKA 2XGJA 3FMPB 4M8NE 5CB6A 2DBYA 1II8B 4H1VA 1N25A 2H8KA 4HB0A 5JCPA 3GLGB 4DRZA 1QHNA 3KJGA 1ZCBA 1MR3F 2ZJ5A 4ZI3A 4ZKDA 1K5GA 1W0KA 2EU8A 2NOAA 4TL6A 4YONB 2UZ3A 3ZDQA 1E9CA 3NH9A 1KK3A 2BMFA 2FWRA 2BJWA 1X1RA 4D6PA 3DMNA 4Z8XA 4A2PA 1N2CE 4QBFA 3IEVA 3K09A 1OE0A 3AF2A 5FPSA 4PPGA 3E5HA 3GFPA 3QF7A 2WKQA 3I5XA 1XJQA 3QE0A 3PQCA 1S9DA 4A6PA 1S1CA 4L9SA 3WYAA 2H5EA 1H8EA 3LVRE 2C77A 2FFAA 2ZSAA 4EFMA 3RRMA 2WPDD 5C4MA 1WCV1 1AS0A 1E79A 3BWDD 4FW9A 3OIVA 3RS7A 4BFZA 1JNYA 4M21A 2BMJA 5IK2A 1E9RA 2A78A 2P67A 3ONWA 5E4FA 3I5YA 1A1VA 3HR8A 1O3YA 2QTFA 2ODEA 1II8A 2GCOA 1XZPA 1G17A 2ZYUX 1SVWA 1DARA 4JBXA 3CBQA 3SYLA 1DG1G 3VHXA 4IDNA 3B85A 4Q18A 3UANA 4C0AC 1OLOA 2I3BA 2R2AA 2Z4RA 3GCGA 2FEMA 4C0HA 4QC2A 1AQUA 2J0VA 1KI3A 4HAYA 1RZ3A 1S96A 2IXGA 1NN0A 1WF3A 5CB8A 3W90A 3TLXA 1R8QA 2IC5A 2ZYVX 2IF2A 3C5CA 3QOFA 5FPTA 1XMVA 2D74A 5IF9A 1OHHD 2ZRAA 1JJVA 1FMLA 2ZRNA 4JL5A 1XMJA 2PLRA 4BGDA 3O8RA 2FFHA 1RFLA 3SNHA 2J3EA 4DLZA 1NIPA 2FG5A 1NLFA 2V7QA 4RCZA 4UXHA 1U8AA 3Q3JB 3CUEF 3Q7PA 1N5IA 3LBIA 4XSHA 2Z4SA 2HDNB 1FMJA 2QU8A 3IHLA 3GFOA 4C2TA 1OJLA 1SKYE 2VQSA 4V0KA 3RRZA 1SKYB 2ZRIA 4JS0A 2GJAA 4FMCF 2B8TA 1NVVR 2GILA 3GLFE 2PEZA 3TW4A 4AKGA 1BYUA 3QEJA 3GLFB 1FTNA 1G7TA 4A9AA 4X8HA 3OEHA 1FP6A 3BH7A 3EA0A 4DIEA 3ZVMA 1ZUHA 5DN6A 1SKQA 2HJGA 1XF9A 2BEKA 4EPTA 2XJ4A 2OG2A 4I81A 2Z0MA 4PZZA 4C7OA 5AK0A 2A5DA 2XX3A 3PUYA 1WP9A 2QT1A 1UKVY 3DOEA 4NYMQ 4DDUA 1E2MA 2CBZA 1KK1A 1O87A 2DWQA 1VHLA 4QJ5A 5JEEA 1FNNA 3CNOA 4BUJA 4UJ5A 3KXKA 2BBOA 2JJ2D 5SZKB 4HDCA 1IY2A 4WW0A 3KB1A 1Q1ZA 1YR8A 1DOAA 4XWAA 2G3YA 2AXPA 3AV0B 1G8HA 4XOIA 5IDVA 2NPFA 3RLFA 2WWHA 4MUBA 3GLFA 2WSSD 5EZ5A 1K5DA 1Z28A 1Q20A 1UDXA 1NMYA 1TTTA 2AD1A 1X3SA 3K09C 4HZUB 3R8FA 1TPZA 3FDIA 2QE7A 4F38A 1RRGA 3X1ZA 4DEYA 3AF1A 2CHVA 2V3CC 4URWR 4H1UA 3U44B 3NDBB 4AYTA 5HCNA 4QGAA 1LNZA 1ZM2A 1Q3TA 4BLOA 4D26A 3RS0A 4HUTA 1Z6AA 4M9ZA 3L0PA 3U3MA 2D7DA 2GVZC 2QTHA 3AF3A 3OZXA 4CT4B 3CPHA 1GVNB 1Y63A 1G20E 5GJWC 3M0EA 1P2VA 4RD2A 5CJ2A 3QIAA 3QJYA 4LSGA 2JJ1A 2V54A 5DGXA 5IRCD 4AY2A 1V5WA 1W1WA 2KB0A 1P73A 2ZU6A 1DG3A 4N3NA 4XWOA 5KNCA 4OJQA 3PUVA 1OXXK 3NHBA 1OKKD 2B7CA 3KQUA 3VQTA 2VHTA 2ZJOA 3WMGA 2XNDA 1GAJA 5J4HA 4W5HA 4LC1A 3HU2A 3KQNA 4D4JA 3CPEA 4HZUA 2ZEJA 2QQ0A 5TB5A 4B3BA 1E0KA 3N70A 1Z6YA 2OCAA 5AWFC 2OO7A 3DDCA 3HYTA 1D9ZA 1M8PA 1RW4A 4M1TA 2A5GA 4PSVA 2FZ4A 2J87A 1RVDA 4BLPA 2QG6A 3QG1A 2W6JA 1Q21A 5FPHA 5LD2C 4AIIA 1CULC 4QG7A 3LQRA 5L3VA 2PX3A 4LYJA 4QBGB 4S2EA 4TQ9A 4NPHA 4B33A 4B3GA 4QGFA 2RAPA 1G7RA 2OSBA 3FHOA 1V43A 5EXXA 2EFDB 3N2IA 4XH9B 4BLRA 1EFRA 5A5GA 1OFHA 1S1MA 4UNNA 3AEZA 3LWNA 2ZRLA 1BH2A 3I72A 4N1AA 3QXJA 1E2KA 4G0NA 1M7HA 1SVMA 3AF4A 1G21E 3QENA 2V1UA 2ORIA 3OFNA 2ZE5A 4KVAA 1XTSA 2JIZA 2ZRMA 4BFYA 3A6PC 2O8CB 1VCMA 4IDOA 1RC8A 5DYGA 4PTLA 5KDDA 1X6VA 5KOYA 1EFHA 2QZ4A 3O8DA 1N6OA 1WE2A 2AKAB 2J0UB 3FGNA 4TT3D 5CM9C 1GWNA 4BPBA 1TL7C 1TQ4A 1UBEA 1KOFA 4UKDA 4URUR 4Q4HB 1XBTA 4D4MA 2ZRBA 4QGGA 5EXTA 1LS1A 4PHTA 4YMTA 2AXNA 3UMFA 3HPRA 1P9NA 3WHKA 5HR5A 2VA8A 1GIAA 2CL7X 2YC2C 5FL7D 2NMVA 2ZXUA 1AKYA 3G5UA 3Q5EA 4YDSA 2R62A 2O8EA 2IUTA 4FMDB 3R20A 2ZPTX 2O8CA 2OT3B 1G8YA 3VHLB 3V4FA 1KI4A 1X1SA 4DLUA 2HT6A 4LJ7A 4X8OA 2ZS7A 5CIQA 5TARA 3T15A 5CDFA 1SXJE 2J0UA 5FBQB 2KSQA 1Z63A 1TQ2A 3BRWD 3KJEA 2WHXA 3WRXC 1KI8A 1NG9A 3BB4A 2FSIA 3PUWA 1G16A 2KJQA 3SDZA 3ASZA 3SHFA 1XPUA 3U6KA 3ASYA 1S9HA 2AL7A 4HAXA 1AA9A 4NH0A 4QBIA 2FV8A 4B3DA 1XX6A 5K8TA 1OH5A 4BE7B 3BB3A 2Q9BA 4Q4HA 1MO5A 1OW3B 2WAYA 3T34A 4DSNA 2WVJA 3AKEA 3IO3A 1LF5A 4KBGA 4AG6A 1AS2A 1T3SA 2IYQA 2GNOA 4NYMR 5BXQC 1HUQA 1YZTA 1ZW6A 4DC9A 1W36B 1F48A 3CR8A 1KJWA 5KO2A 5JJKA 3EPLA 2FA9A 3FE2A 1ZM9A 1GRNA 2WWYA 2GK6A 4Q9KA 1COWD 4CEHA 4R9UC 4O2LA 4NP6A 4Q9JA 4D82A 2ZRJA 1T8TA 1I2DA 3R9WA 3A37A 1TEVA 1IJFA 1SGWA 3QEOA 1SXJA 2WWIA 1DS6A 2MMGA 4QHTA 1Z83A 1HTWA 4DB4A 2EYUA 1E96A 1ONBA 3LDAA 4FCTA 3QXHA 3RS3A 2EFHB 2QUZA 1N0UA 1P2TA 1XMSA 3BOSA 2JLXA 4OQFA 3K9NA 2F7SA 4PQYA 1X8LA 2PZGA 3BS4A 1YVDA 1NBMD 4KFTA 4MRVA 5C4GB 4JT2A 1X8JA 2OCBA 5J4YA 2V55B 3QPVA 1KZ7B 2PEYA 1UKEA 1YZNA 4LV5B 2IYVA 4OQMA 3FOZA 1R8SA 2C98A 1J90A 2WWWA 3T61A 4BWYA 5ELXA 3NEJA 2GTPA 3RC8A 2LWIA 3OE7A 2QGZA 3MAAC 3C4JA 4G5RA 2IYRA 4GT1A 2IUSA 2ZS8A 3X1DA 1E9DA 1AM4D 2CNWD 3KUCA 3CWQA 2PCJA 4BRUA 4O2RA 5L8VA 1E94E 1D2MA 3FPAA 4ABYA 4DCUA 4LYAA 1R4AA 1VHTA 4LJYA 4TLEA 1CR2A 3VNUA 2DYKA 4IOLA 4WXRA 1CBUA 4NYJR 2DHRA 2ZYWX 1E2HA 2F1IA 2ODNA 2NZJA 1P60A 3ZIAD 4OQNA 2VF7A 4AC9A 3R9XA 3TAUA 1KNXA 4G5GA 4DCSA 3I3SR 4FCWA 3NWJA 3ECCA 2VSFA 1EX7A 2BBTA 1QHYA 4HAVA 4KVGA 4LHYA 4TLCA 5FR1A 1KO4A 4JLMA 5LPNA 2NIPA 2ZRKA 1LW7A 3L43A 3V4RA 2VTKA 2HF9A 4FCVA 1KO1A 1XTJA 3U4QB 3NVAA 5BN5A 3CO5A 3WBJA 1YR9A 2G88A 4WA7A 2WJIA 2XSZA 1R5BA 1U99A 2A2ZA 3VX3A 4A8JB 3W6OA 4KITB 4I1VA 4P4TA 3AGPA 1OFUX 3O8CA 2VHQA 4IDHA 3BB1A 4UNQA 5G3YA 3X2SA 3ZH9B 1Q22A 4URXR 4KLZA 1EXMA 1BOFA 2I1QA 4O3MA 3X1WA 3KFXA 3CNLA 1KMHB 4E09A 2H16A 4KYIB 3KKOA 1UPTA 4JMPA 1KJZA 3IHWA 1U9IA 1RE0A 1WBBA 4A92A 3SQXA 4C0LA 4PPNA 2PL3A 2LKCA 3KXIA 1JEEA 1JR6A 5AR1A 1FX0A 1E9SA 2XITA 1UAAA 3CX7A 2GA8A 2JLVA 3UIEA 5B30A 2XXAB 4QM6A 1KK0A 3HDTA 4EQ6A 1R0XA 4QL3A 3AVVA 1G3MA 3U4QA 1W0JD 4TYPA 4LBYA 4LHWA 1PLJA 4LOAA 3RNLA 3QKSB 2GXUA 2YVUA 4A8JA 1N6NA 3ZGXA 2P6RA 3LVQE 2V6IA 4PPFA 1WA5A 4LBWA 1GL9B 5B57C 4GOXA 1JB1A 2CLCX 3B1YA 4M1KA 3DM5A 3PVSA 4PQRA 3IO5A 1KMHA 2ZS9A 4LPSA 4DIDA 4WOPA 1IOZA 1M1YE 4LHVA 4DT1A 4A0HA 4JYCA 5HE8A 4P4SA 1QG4A 1SXJC 3QSYA 4DBLC 2RH5A 4ARZB 3OESA 5HPYB 1RRPA 3BD9A 1XXHE 2BDTA 4JZKA 5EE0A 3K9GA 1P4SA 3VTKA 2Y8EA 1YZKA 3C7KA 2ZRHA 3AUXA 3NDPA 1Q1QA 2ZM5A 5GJBA 2XXAA 1XNJA 5E7JA 3Q5DA 5FI0B 2F9LA 3IPYA 1UM8A 3NBXX 3ZZTA 1XEWX 5CJPA 1SVKA 3I1FA 3QKSA 4G5SA 4GMXA 3AKYA 2XZLA 2XAUA 5K8LA 2XOKD 2ZTSA 2ZUBA 2ORWA 2D2FA 1W36C 3CONA 1E1QD 3A1SA 1J8MF 3MWKA 1P2SA 5BYKA 5DH9A 2HXYA 1L2TA 1KSGA 5BN4A 1NMXA 1E2FA 3HJNA 1W7AA 3K0FA 4QNRA 2IYXA 4Q1FA 3T1OA 4UXIA 5CLLA 1KTVA 4F4JA 4XD7D 3WYGA 4HLQB 3SBEA 1DEKA 1GP2A 3L0OA 2YNMA 4JLVA 1U2RA 1Z06A 3VMFA 4BLTA 2JLQA 3AVWA 4LJ6A 1NVVQ 2V8OA 1BMFD 1M6NA 3OEEA 1QHSA 1X8KA 2IUUA 4CZ2A 5JRZA 3TW8B 1E2QA 4LCBA 2IS2A 4M1SA 4NYIR 2VP4A 1E32A 3UG7A 4ZIRB 2F43B 1J7KA 2IYUA 1US8B 2Z6VA 5FFMA 3TJZA 3FHTA 4P32A 2IW3A 2PJRA 4DUGA 4MDFA 4FMDF 1CP2A 1GUAA 1VYTA 4QXAA 4JVLA 4WZAE 4XVRA 3FKSD 4Q1AA 4R2IA 2YZ2A 4BEJA 1R10A 3C14C 1GDDA 1T3LA 5FUWA 1CF4A 3KQKA 2HLDD 3UMRA 2V4ZA 121PA 2NO6A 4MYUA 2P0EA 2ZRFA 4F91B 1IN8A 5AJYA 2GDJA 2AX4A 2RGGA 2VP0A 4Q66C 3KJHA 1PLKA 2QSYA 1KYIA 2WJHA 3WNCA 3H86A 5BQ5A 1FNMA 1W0KD 4NKRA 4AKHA 1CTQA 4URYR 4LV8B 3L0IB 4PZLA 4ZDWA 1CJUC 3ETLA 1VDZA 2CCJA 2ZI6A 2QY9A 3IIMA 4Q01A 4BECA 5FOXA 1FQJA 5FTJA 3RDPA 1U9IC 1ZIOA 3CLVA 1AS3A 3KJIA 1SQ5A 1N6IA 4A1FA 3GLIB 2QRZA 3GEEA 2REBA 4EJSA 4Q02A 3AM1A 2REXB 521PA 4ZIRA 2F43A 3B6EA 1US8A 3EAQA 2BBSA 4PZYA 1H8ED 2VSOA 2OILA 2WWGA 2ZJ8A 4MGYR 4D2IA 4JLNA 2DFKB 1E79D 4V02A 2BOVA 5B58C 3A8TA 5JRJA 2HUPA 1MO4A 5IK2D 2RGAA 1Q0UA 2VSXA 3HU3A 2QPOA 2ODBA 4A8JC 5GADl 4LGMA 1T9HA 2KI5A 1S3GA 3AF0A 4C0JA 1P61B 1TNDA 1VCOA 3B1XA 3U3OA 2W58A 3K0SA 4ZI2A 4JT4A 2GXAA 4DCNA 4AI6A 4JVSB 4D0GA 3GLHB 3NTUA 1DO0A 2D06A 3A58B 4N0DA 1EESA 1II9A 4IOKA 4I99A 3C5HA 4NL4H 2XZPA 4MYTA 1HQCA 1ODFA 1TQDA 1LV7A 2F3RA 4XTCS 2VPPA 2ODWA 4V0NA 1E69A 2EFEB 3GLIA 3CZPA 4XVUA 5EUQB 2CCKA 3AB3A 5JHHB 5F9FA 1GG2A 4CGZA 2FFQA 2FSGA 3FFBA 3FWYA 2VRWA 5JWRA 1VG9B 2CE7A 4Q1DA 3HPQA 3AKCA 3CF2A 2O0HA 2F3TA 2IF0A 2VO1A 4PO9A 3D3QA 4O0MA 4LJ5A 2V7QD 2DWOA 1EFCA 2WJVA 3UWOA 1RPZA 4GOJA 5KNDA 4A0GA 4Q7JB 4DLSA
chains in the Genus database with same CATH superfamily
4TYMA 2JBAA 4Z7JA 2H57A 2QM8A 3C8ZA 1V47A 4LZAA 4MJ3A 1PV4A 1GUYA 2B5OA 3I76A 4E5KA 4PLZA 3FWKA 4MB6A 2GCNA 1K0FA 5DBGA 4F5WA 3FNGA 2IOYA 5K0FA 4V03A 2WUVA 1HFWA 2GWHA 4BC1A 2ZFUA 3EDQA 2FMHA 3OCUA 2HSZA 5AUPB 4WXPA 1G8KA 3HXPA 2ODAA 5TPWA 3FTDA 1DAFA 1O4WA 1YA4A 3WWOA 4MDHA 2QZJA 4DY6A 5IJXA 3UZUA 4AK9A 4KIJA 3SI7A 1EFKA 2PBLA 3UBMA 3LW8A 4OOFA 1BCRA 5TMDA 2HQOA 3OIDA 5LUAA 2FJUA 2AV6A 3ETCA 1WUHS 2XE7A 3KS9A 3OBBA 3PPYA 5I7HA 1XELA 1M7BA 1OVMA 4L8WB 4OMCA 3VSBA 5BVHA 1E0AA 1DKUA 1KIAA 2OORC 5ARDA 2BMEA 2XGSA 3KEQA 3T7DA 5H3LA 3N8NA 1CUXA 4IHKA 3WXMA 2I6GA 3AF5A 1UEIA 1CZOA 3IIIA 3RIXA 4DW8A 2W8BA 5ICCA 4TRRA 1E7RA 1M0WA 1TZMA 1D1QA 3BD7A 4RD6A 4TTPA 1GNRA 4XEUA 1P5RA 4U7PB 2R751 4LF9B 5B64A 4XWKA 2YFQA 3OIYA 1VRWA 2AFIE 3L0SA 4KQEA 1CJSA 3QQ5A 3M6XA 2VPIA 4QUHA 3FOWA 1U2TA 5LQKA 2R79A 3CEHA 1E7WA 1Q77A 2ACWA 3ET4A 3NAZA 1HT1E 1FUKA 2CDRA 2FW0A 3SXPA 4DG8A 4KYTA 1CB7A 2VQFB 4DXAA 4F06A 3AONB 1U6IA 2BHRA 3L8GA 4D42A 3LV8A 2AC7A 4ZYUA 2P68A 1W4LA 1SH7A 3BTSA 3WS7A 4AKTA 1G5TA 1D1PA 1CY6A 4CTKA 2XRFA 3D4NA 3MNFA 4D1YA 1VL6A 5LNK6 1ST3A 2P2SA 4PLPA 4MKRA 5JUWA 3A9SA 1Z16A 3FMVA 4ZAYA 2PQ2A 3H3XA 5K0NA 3OZUA 4G9BA 5FUVA 4KDFA 8ADHA 6LDHA 5LP1A 3U1VA 1DAHA 5CP8A 4YX9A 3ZE6A 3SBXA 1CEXA 3Q3GE 3EXIA 3QMPA 2X23A 5AI9A 3ROXA 3ZCPA 5CVEA 4Z4EA 4QJ3A 2BCGY 3BGIA 1K63A 3ZWCA 5C80A 3GJXC 1MP0A 3B3QA 3N2ZB 2VP9A 2VAWA 2AFIA 3NRCA 3DFMA 5DM2A 3W9UA 3RWMB 1PS0A 3NBMA 3ICVA 3UAGA 3O91A 4F84A 1RTTA 2ORVA 3OZ7A 2Y77A 3PDHA 5CJJA 2DR3A 2A57A 2IEZA 4IDPA 2Y76A 4Z54A 2Z5GA 5B2ZA 4OX9Y 1QZTA 4BNNA 1N9GA 2HIAA 4R2WA 3SEQA 1NXQA 4N82A 1MFPA 4R68A 4YFYA 2H2DA 3OPVA 1QGZA 3VU0A 5JS1A 4DABA 3PNBA 4DTCA 4MV5A 4ERNA 4CMHA 2BONA 1NZFA 1GSIA 2QQ5A 3RS5A 3CVVA 5JAPA 2B4RO 5I8WA 1JLMA 3BJMA 4OY3A 1GQRA 2GEUA 4HLCA 4C3ZA 2A5LA 4WN9B 2EJWA 1BS1A 5CB4F 3UB2A 3PCRB 1W2HA 2R44A 3FCCA 2JAPA 3KQTA 1IVYA 2XE8A 4BQPA 1ZJ4A 1Y5NA 1XK7A 2JA2A 2HYIC 1P0MA 4XWTA 1LQUA 1C14A 2VXCA 4FDUA 4UBKA 5JFTA 5CVCA 5KTMA 4FONA 1ESMA 1QU2A 3HP1A 4UJ3A 4RKRA 2AI2A 1EFRD 3KVYA 3P52A 3DKPA 1SC1A 4QU8A 5FTWA 1QVRA 2K7ZA 2QD3A 3OFVA 4QIHA 2DZDA 2X0JA 5JY1A 2IZ7A 3R5JA 2UVPA 3HCCA 3QOWA 4P33A 3K9WA 4RQTA 2VHYA 3E3OA 4RK4A 1H1LB 3OPYA 1UKZA 4CIDA 2P2LA 1FNBA 3ZBPA 2X41A 2FEOA 5KHOC 4R0NA 1JW9B 1UJBA 4M2LA 5GP1A 4EARA 1CSEE 2CXPA 2FOIA 1HX7A 1RIIA 2ATCA 3F1LA 5JALA 3NPAA 1ENOA 4ZANA 4EHLA 3WK8A 3V4ZA 4X6UA 2FR8A 3EIWA 1DAPA 1ISIA 1GG9A 3MUEA 3I6YA 4YRBA 4PN7A 1XZLA 1VKHA 1YCHA 1I4WA 2HCFA 2IYPA 1OZAA 1YQEA 4MJXA 2PSSA 1PDOA 4OBEA 5IANA 1FS6A 1H4VB 5ITWA 3RS8A 3G9UA 2INGX 4HFMA 3JQ9A 1E3JA 3MBOA 3QX9A 4EQZA 4ZOEA 3OY7A 1LRKA 1ECPA 1N92A 3C70A 3TZEA 1KY3A 2C84A 3PIIA 1VIDA 4B47A 2HGZA 4FI3C 1K66A 2C3OA 4Z9FA 5D86A 2AMJA 4JJAA 4XVQA 5EPEA 2ZIXA 1MLDA 2DHQA 5A9RA 1MVNA 4KLAA 1FRVA 4YP0A 4GGOA 5JWOA 3Q2OA 1XZCA 2X4DA 2Q2QA 1VFNA 2J6CA 3OZWA 1QC5A 1E20A 5SZJA 3F78A 3Q10A 1IXRC 4R5HA 1TAQA 1MGPA 1C7QA 2FJPA 4MO2A 5AHXA 5KQSA 2CXSA 2EDAA 3DHEA 3GMSA 2M6LA 4IJMA 2JI4A 3IQFA 3QVOA 1Z12A 1E1RA 4UDOA 3E2IA 4MGEA 1CG6A 5MHTA 4GX0A 3U44A 2ZTLA 1P7WA 3H0CA 5CYOA 4WBSA 3QEMB 3ZHRA 1JJIA 2YJNA 2XYGA 3MJ4A 1IPEA 4QTTB 3VTAA 1R6DA 1T36A 4HHEA 4XIGS 4D98A 3EEFA 2ES4A 5T8KC 3UKDA 3PHBE 4R1QA 5GV8A 3RYTC 1C2TA 4NJEA 1RXWA 4F97A 5LZ9A 3DTVD 4M9QA 2X9NA 4MVJH 5A4IS 2QTLA 3JQQA 1AURA 4KMMA 2D7JA 4OIMA 5DI3B 1JKFA 5IYZF 2ISCA 1M67A 2VKTA 3JQEA 4GR4A 1SBQA 3LHDA 3GRPA 2P9HA 5J2TF 1YI0A 1N9ZA 2ATVA 5HTKA 3ROFA 4LBZA 4XIIA 1VPLA 2FW6A 3F9CA 1FNDA 1Z6TA 1UDCA 3DMPA 4DM4A 5KU7A 2W2VA 2WMOB 3TM4A 2ZQYA 4N9QA 3SDSA 3LX6A 1EWVA 4G9EA 2ISSD 3EODA 3IT1A 4D9CA 2I78A 3DD1A 2AJTA 2CNNA 3AO0B 1H2RS 4I4LA 2D2XA 4Z0TA 2EF0A 4B44A 1J8YF 2XCIA 4K8RB 1W35A 2FW9A 1P7ZA 3RREA 1ZMOA 2G82A 4UXJA 2Q46A 5H3CA 1XA0A 5H4GA 2WVAA 2OCDA 2X1HA 4DARA 1U1CA 3A1UA 1ZCZA 3H5IA 3JVDA 3VU9B 5BN3B 2O6HA 1R6BX 3JQ6A 3QKRB 4CNBA 2NO1A 4WI1A 1RCFA 1EK6A 1CERA 3M5PA 1LFAA 3KJNA 3G8DA 1AGNA 1L7QA 4FI3F 3SOZA 1WPXA 4MP6A 5FOVA 4Y2VA 1FIUA 2RC5A 2QMEA 3IS3A 4NCXA 4RZXA 3STXA 1VMAA 2ZT5A 2MINB 4L0QA 4CEJA 2JI6A 1N2JA 3V3KA 1FTWA 2RGWA 2JFQA 1PU2A 2IS6A 3IP6A 4P3YA 3R3UA 3ZE0B 4YRJA 4YP1A 4EG8A 4I19A 2J67A 3FB4A 1GY8A 2X2FA 3ZS9A 1WMFA 2QDKA 1J1ZA 2XTAA 2P2ZA 3U7QA 3ZNPA 1OLUA 4IVPA 5CD1A 5DIFA 2EJBA 4IMPA 4EG4A 3CVYA 2QEQA 2ZQZA 3HNRA 4F92B 2H7YA 4ITRC 4HUQB 5HKBA 3QVUA 4L73A 4EGAA 3KELA 1FFDA 1Z6PA 4R16A 2FH5B 5DO9A 3ZYZA 2D4HA 3DE5X 3IILA 3S2ZA 3ICQB 4RLQA 3CEAA 5DSZA 5JD6A 3VH3A 2OMKA 1YU9A 2AN1A 2IOHA 4YRIA 1C7JA 3B9QA 3CG0A 1P3DA 4NBUA 4PIMA 4JJ7A 4JX8A 5A9TA 4MRNA 2C2KA 4N6GA 1YHZA 4KDEA 1JG7A 3NYWA 1QJ4A 3PC2A 4N7MA 5DCLA 4FWTA 5GJCA 1PJLA 1TUIA 2JGFA 3ZC3A 3FTFA 2JB9A 2O6LA 2AWNA 2H8GA 1EX1A 3KUKA 5KNLA 4CMGA 1IUPA 1RM4A 1VKOA 1AUQA 4OGLA 5GMOA 1TB4A 5G0TA 4MQ4A 5B1HA 3ANTA 3RQIA 3GLTA 3KSDO 4E0BA 1BN7A 5D3MB 5L4SA 2QLNA 3FYHA 1XD9A 1ZOLA 4MQEA 2DKOA 4DDKA 4R1SA 1C3OB 2P7HA 4B6QA 4U5XA 4G2TA 2H1WA 2G9QA 3OLWA 4LNAA 3HVJA 3QG5A 4JLPA 2BEWB 2HA6A 2R4TA 4LZJA 2NU8B 3RS2A 1DC4A 1GA6A 2RH9B 1KDZA 3EG5A 5LBIA 3VXKA 1KAHA 1Q7GA 2WWXA 5CLIA 4CMCA 1Y1SA 4FW8A 4NYIQ 1NATA 4GBMA 4QDJA 3D6JA 3SR0A 1QAMA 3TK1A 3HCBA 3WLFA 4EFLA 1FUUA 2HY7A 4F2HA 7REQA 1RIFA 1Z7WA 2B6NA 4QDOA 3TNDA 2IP4A 4ZODA 2WHYA 3FYUA 1IXSB 1ZG3A 3EZ7A 3RNOA 1KDVA 5HX7A 2YOFA 1DADA 4YHBA 2Q7OE 4FGUA 1DQSA 1V9SA 2X3FA 4CTMA 1SXHA 3ZS8A 1S8NA 2HBQA 4WD3A 1F60A 2AR7A 3HZOA 5EPOA 3R7DA 1WULS 4KODA 4KQWA 3FPFA 4U6NA 5DM70 3K70C 4HDQB 5AKGA 3RJMA 4A4DA 4QARA 3SJBA 1KYWA 4BFUA 5EYPA 1JTFA 1X80B 4D0LB 1T13A 1DCFA 4W63A 4RTMA 5FJJA 1XQ9A 2OZKA 5L6MB 5FBWB 1RQGA 3EQ6A 1Z6XA 1VGVA 1Z33A 2PQMA 2O0MA 2HCJB 621PA 2IS4A 5KQRA 1RYHA 3WIVA 4FEYA 4O1MA 3FDZA 5CW1A 5BOSB 4DSZA 3ICEA 3B1WA 4S1PA 1J97A 1K2WA 1WX1A 2HF2A 2CYAA 3A70A 3QRWA 4PSUA 2CVPA 5BO5A 3M7IA 4HDNA 4L75A 3PEYA 2NGRA 2EKPA 4KH1A 2IY7A 3DL7A 2Y67A 3AM5A 2JJMA 2OGSA 3L0DA 1DT3A 1GTSA 3UMGA 3DPUA 4HD8A 2I22A 4HXGA 2PWZA 3AJRA 4G1UC 4TRNA 1STOA 2NTEA 1U2EA 2WIBA 3DEAA 3LPNA 3EG9B 2HREA 3DA8A 4K2AA 1IEXA 3ZIUA 5L3QB 1G63A 1A69A 3PK0A 2Q9AA 3NALA 2QAGC 1PFVA 4E2ZA 2Q9CA 4KYVA 2Q2NA 1KMIY 3GGOA 2QP3A 2JFUA 2VJDA 1I6MA 2Q0XA 2WMNB 3NHAA 3QV1A 3I4CA 1G66A 2DFLA 3I2KA 4IW3B 2P35A 3GJ4A 1DBSA 1MCZA 1NDHA 1EVKA 1NIJA 2WSIA 3LUHA 3TCNA 3D6AA 5HXAA 3HKBB 3UGTA 2VYNA 3KAKA 5K20A 1W4BA 4NCIA 2UAGA 1JFSA 2WTMA 1GT91 1RABA 3J81k 4AN0A 3FOEC 5I51A 3C6YA 3R4CA 4RH3A 1JJFA 2GESA 2FW8A 2DT5A 5BNWA 3VA7A 3ETEA 3L7DA 3ELWA 4LJ4A 3RJ5A 1JXOA 1NSFA 3HN2A 2BFFB 3KPVA 1WHSA 3N2GB 3CJQA 5JNLA 2WWFA 1QVAA 1SUIA 1U81A 3NTQA 1QRRA 2GARA 1XVAA 4Y9SA 4TV8A 2O05A 5E7IA 4HDRA 3RRJA 3UW1A 4CDMA 1A2KC 1Z35A 4FQ8A 4P7BA 3PDIB 2CZCA 1T6NA 3HDJA 1KAQA 2R8ZA 3ZBTA 2YHSA 4YMLA 3ABSB 1J99A 3DC7A 1R6AA 3FUTA 1P7YA 1XI2A 3REFA 4E03A 3F6SA 4P1ZA 1W6RA 3OEED 2AD5A 2K4MA 4BFCA 8OHMA 4QRHA 2TMYA 2XCQA 1XFAA 4CF7A 4LYDA 3T1HB 1CZHA 1C9DB 2I0FA 1MV8A 1GGFA 4BXOA 3KT3A 3I37X 4CM5A 2O4UX 4JKYA 3UKJA 4ZAFA 5FOTA 1AGRA 2GN0A 2B5VA 3EGXB 1EDBA 1HV8A 4TWJA 1NWHA 1TYDE 4LWZA 13PKA 1T1EA 3LXMA 2IEAA 3HL4A 3GNSA 4PS1A 4S1OA 1EAYA 1UKCA 3EF0A 2R8XA 1H2XA 5GGYA 4HNUA 4QASA 4RSHA 3CUTA 2Z43A 4ZDIA 3U4MA 4FYXA 1YQXA 4G9GA 3DAOA 3FRHA 3PFWO 4OV6B 4REOA 4R8RA 5IN4A 1C8VB 4K88A 2Q1TA 4HNRA 4PBRA 3BC1A 3TSOA 4BKQA 3CZ4A 3GAZA 3DPSA 3C6XA 4ZOAA 2ZJ3A 2VJCA 3EVEA 3K8OE 3N5KA 2NZUG 2VDOB 3TRKA 1PT6A 1LTKA 5JLAA 1DE0A 2OZEA 4ZN6A 1Q15A 1XROA 1QH1B 2YXNA 1PJSA 2FPPB 4TGLA 2JCSA 4WAUA 1Z0JA 1H0HA 2C2HA 4J1SA 4PIPA 4QPZA 3EXFB 2A30A 3FPCA 3LECA 4C88A 3S1AB 1P5ZB 5CEEA 2EVWX 1XZMA 2QVXX 1E1KA 3AHCA 2CLEB 2KPOA 4GKJB 3BQMB 2JD0A 2Z57A 4YJFB 3VDMA 1OH8A 1AQLA 3WE7A 4BZPA 1A2BA 4B83A 3IDSA 3F8WA 1VLHA 3FLMA 4JSRA 4P7FA 4XB2A 3UPDA 2PDAA 4DLTA 1LX6A 1GA4A 1R15A 2JIPA 4Q7MB 1U65A 1PKEA 2JZCA 1G42A 1WUIS 4M98A 3HNPA 4LY6A 1QX3A 3SC6A 2J08A 1IN5A 4AJJA 1ZPDA 4RCVA 4YIHA 1RQ2A 1DUVG 2FW1A 3F7NA 2JD2A 4E5UA 4RVCA 4IL5A 4KNWA 1GHTA 3FNEA 2QR5A 3WQRA 1BHJA 5I9NA 1EJ6A 4A5SA 4F4UA 1HLGA 2OV1A 1QH8A 3H5VA 3JWGA 5D3QA 1H2WA 2REOA 1O5TA 1DC7A 2Z3VA 3DXYA 4KI7A 3DEJA 1XMPA 4TWAA 3TTTA 3C2QA 4OXNA 3WGNA 3Q7TA 2CXUA 1RRVA 3CNQS 3S8YA 3TTWA 1TZJA 3RAPR 2EIXA 5AVWA 2FPIA 4UVHA 2H1VA 4G0VA 1S0UA 2DFTA 4NBRA 5KS2A 3ABQB 5ILQA 3HJFA 4L9RA 2PQ6A 3T6KA 1FXUA 3OD1A 2AK2A 3C39A 3Q3HA 1E2IA 5FFFA 3IQDB 3L2OB 4H18A 5D6NA 5E2AA 2BTEA 1NVXQ 1MA3A 4O63O 2QNRA 2ZSFA 4X24A 4AB1A 3L0YA 2GBFA 5KNDD 1XN1A 3AEYA 2BKUA 4V38A 2P41A 4L8YA 4S1NA 1XWFA 1F6DA 2XV1A 1K68A 1M33A 3I45A 5AMXA 2F8MA 3VYUB 4P31A 4XSGA 3CF6R 4P53A 1YS2X 1L1QA 1WXQA 4MEBA 4O4JB 2BFOA 3BGSA 2JBHA 3F3SA 1DOZA 2V6BA 4MLCA 3EARA 2PJDA 1MKYA 4PZ9A 3DZCA 4R7TA 4OBBA 5HCUA 2YYSA 1T1SA 2QM3A 3VNAA 1M8JA 3T5BA 4EZEA 1Y4UA 1YOVB 4UPEA 2JFFA 2QSZA 2YVQA 2ZANA 3MD0A 5CNIA 2ONJA 4AD8A 5KNBD 1ZVQA 3WX0A 1QMPA 3KT6A 1GXSA 1TM1E 3N59A 2QVCA 1YFZA 4KE8A 1PZGA 2A1TR 3JQAD 1H3EA 4HNSA 5H8WA 1U6JA 4RKFA 4Y2PA 5AKXA 5EP2A 2O7SA 2VA9A 1CT9A 3ONNA 4Y7DA 3T7AA 1QPBA 1EB9A 4OP1A 4QUDA 4TV9F 1LBIA 4MS1A 3P9KA 1Z5UA 4X1OA 4ZEXA 2WFLA 2CLDX 4RPLA 4YMSA 1W5FA 3TW6A 1EFVA 2F4VB 5HF5A 2ADMA 2PWYA 2R8YA 2H1FA 1IOLA 3B8HA 4OYLA 3L8YA 4YAEA 1F2DA 2F9MA 5DOVA 2UVDA 3OA0A 1ELOA 3OOSA 1ZIYA 1RRMA 1JKMA 2VUTA 5NULA 2HO5A 1M0EA 3BRSA 1LTQA 3JTMA 3ZHZA 1VLMA 3VHQA 2AG5A 3KDSE 3GLHE 5AJXA 3TNYA 1XMQB 2GZSA 3PUIA 4GDMA 4IZOA 2N46A 4LMAA 4ZT7A 5YASA 2JL1A 3NV7A 4KACA 3RFUA 3WQBA 2IYZA 2IZ6A 3FA2A 4OLHA 3IBGA 1W2GA 4LZPA 1KZHA 5LJIA 5LQNA 5ALSA 2M6KA 2WM8A 1DU4A 4LHSA 3B7WA 2J9RA 3ISTA 3ZGOA 1ATZA 1YS1X 2V5VA 5KU1A 1YB5A 3PICA 3TZHA 4P6VF 3DH0A 3GJ8A 4LHXA 4I9FA 3Q5GA 4E30A 3D2BA 3TBFA 5TIIA 3CJTA 3K16A 3SCZA 2OGWA 1QHGA 4Q4LA 1HNWB 5IFLA 1HDXA 1F2TB 2B34A 2NO5A 4BNTA 1UFKA 3JQGB 3LCMA 3BK2A 2DWCA 4TVKA 1R7RA 3E5MA 3CGGA 1IUOA 1CLEA 3BXOA 1WJGA 4TRMA 4PHFA 2P2GA 3PFCA 4M6WA 3Q8XB 1MN6A 2PMKA 2A8YA 1KKLA 1S7CA 2ONYA 5ALPA 3GH3A 3L1IA 5J4KA 2ILTA 1M34E 1NUUA 2YWGA 2IY8A 5C5EA 1BQEA 5AI4A 3G5LA 4Y1RB 1XCGB 2WIFA 5EZSA 1P4RA 1NTOA 1ONOA 1NNI1 4Q9AA 3H1EA 4UOQA 4GX5A 3M1YA 1PWYE 4J3FA 4W1QA 3UFBA 3VPBA 5KNDA 1O96A 4IOJA 5AKKA 3AINA 1JUDA 2XJ9A 4BN5A 1H2AS 2X8BA 1TM3E 4K1XA 5IVPA 3G9XA 2E6KA 3JWIA 5JECA 4Y8VA 2ODTX 1KJ9A 4KPUA 4LJAA 4ZYLA 3NC1C 3SS9X 4MRMB 3ISJA 3OZFA 1R74A 3ORFA 1KAEA 1NDUA 2EQBA 2QX4A 1Y8RB 3K73O 3KTAB 2PZJA 5A7GA 2QBYB 3THYA 2OYRA 3F4KA 4X7BA 1V45E 3QXXA 3HR4A 3R8CA 5JBQA 3WJ7A 5KWEA 4D80A 3RK1A 1A71A 2OWDA 4QOIA 1VFPA 3FWHA 1KGSA 4M1OA 1IDN1 1ZGCA 4MITA 1GNVA 5D5QA 3UATA 2P0AA 3OJWA 5EG5A 1NW5A 1YRWA 3FD8A 1JDBC 1XRRA 4C89A 1M34A 1KHHA 2WD7B 1Q5PA 4QXOA 1HZZA 3LUGA 4NHOA 5EWLA 1Z4MA 1O54A 4BE4A 1I7PA 4TZKA 3M33A 2FSUA 5LB2A 1U7HA 3CWZA 4EY7A 3NEPX 1BS9A 4O29A 1T4BA 4JUDX 2FPGA 3ADBA 2OFXA 1P17A 3GCWA 1MZPA 2VUUA 1YJAA 3LXUX 4NU8X 5F2EA 3L7YA 3UXEA 4TOIA 4F4FA 1SKUA 3JY6A 5I6DA 3WNVA 4DR6B 1AH2A 3RVDA 1MRSA 2O7RA 1QOPB 5LQDA 1MPTA 1ZM7A 3PPIA 3UMJA 3EW7A 4FEAA 1R0RE 3PQ3A 5FWYA 1CNFA 3ADCA 1KU6A 3L1VA 1URPA 4ZDKA 1BKDR 1D0VA 4UQLA 4MKHA 4UTNA 3HXOA 2AN5A 1NLYA 2VSNA 4X71A 5G53C 2PY6A 1AU9A 1OYOA 4V2IA 4AQYB 1LF0A 3P7MA 2OXIA 2ATXA 4RD0A 3P9CA 1DRUA 1TCBA 1Y3HA 2C5LA 3K0EA 4OHMA 5FX2A 3BSWA 3H6GA 2VL7A 3H5WA 1HFEL 1T4MA 1MO2A 2DECA 3NR2A 1TU3A 5REQB 4F7DA 1XQVA 2OUKA 2QLJA 1SC3A 2YWXA 2AG8A 2IQIA 4F4CA 2PS9A 5KNCD 4C7OB 4UBLA 2PL5A 1Q57A 3NG1A 1O94D 4Y3UA 3WLLA 3F2IA 3HO1A 2WKWA 3BE4A 4QYTA 4PN3A 2XMZA 4I55F 1ITZA 2V96A 3E70C 1EXWA 4D44A 5IZ4A 3K2IA 5JANA 1ZSYA 4OXKA 5K3AA 4ZZIA 5BUSA 4WPGA 3LBHA 3OIGA 3RVBA 4P54A 1M66A 3C41J 1H66A 1FSFA 3TN7A 1L7PA 4BB6A 1ECGA 3PGKA 3P9IA 1ZU5A 2BJHA 3IFSA 3VR6A 4IQ8A 3CWCA 2D2EA 4AF6A 4UU7A 2AHOA 4K3UA 2JIOA 2FZCA 5DGCA 3O8OB 1U8TA 2QTCA 2P9GA 4U2EA 3KZCA 3TFWA 4ZQCB 5FTNA 4NENA 3R5FA 4ZI7F 2TYSB 4A0FA 1PQ4A 2EBFX 1SHLA 4OFXA 2QGNA 1NXPA 1E3WA 1XTQA 2V5AA 3TSZA 2Y71A 2FU5C 5JFOA 1SRQA 4LN1A 5AKIA 2XUOA 1IATA 3G0DA 1DG9A 4ZREA 1GL3A 4Q9DA 5IAKA 3NBZC 2PX6A 4F4IA 1HI9A 1JGTA 2H51A 3FOBA 4HDKA 4UATA 4IDQA 1DJOA 2PMCA 4BVBA 2O06A 2BSXA 4BLQA 3IRVA 1IBKB 1JE0A 2FSVA 3ZCTA 1XVVA 3AX6A 1VL0A 3AW9A 3IDQA 3V7WA 3ZK8A 4HNAA 1G3QA 2OHIA 2R7KA 2PUHA 1UOOA 2H07A 3CRNA 4TWRA 4YCDA 5AM4A 1QS0B 1D2RA 3T35A 3AVTA 5JD4A 4NC9A 4ILEA 4PAOA 1THZA 4RGQA 4YV2A 1PNRA 2JHGA 5CTJA 5EP1A 3EHEA 5LP6B 1E6CA 1U31A 4BJ6A 5EP3A 2H6EA 4NCAA 4IQFA 2YHAA 1ZJ6A 3UAWA 3U7FB 3UUWA 1JIKA 1E0JA 1ESNA 3GMDA 3VI4B 2DG2A 4HWTA 2YUIA 3O6VA 4DJTA 3W06A 4Q03A 2VF2A 3H2SA 1MT0A 4R41A 3LUCA 1U0GA 2VYQA 4RL6A 4HH1A 5TPZD 1AQNA 4TMZA 2PMDA 1BHQ1 2QTVB 5A5EA 2ESRA 2H29A 1Z4IA 3AXTA 3I0MA 4DRXB 3DTYA 3M3PA 5JXHA 4N40A 1SG9A 2QXTA 3LVFO 5KQLA 3GGPA 1ICEA 3AUTA 5U9CA 3D8SA 3DWEX 3CT6A 2ZVQX 3C7DB 4EO7A 1OT5A 2PVCA 3L4SO 1OYYA 4MW5A 3EXG1 5KZMB 1NI3A 4BGUA 1QHHA 3D1LA 3B7GA 2H5JA 3THXA 3C1UA 2VTBA 4QBTA 3TLJA 1XNQB 1QHXA 2C7GA 3WGGA 4M9UA 4WKOA 2E87A 3MINB 2YJTD 4TUYA 1RBMA 4IF6A 3A06A 4JHXA 4L9WA 1NBAA 3X0DA 4IKPA 1RPAA 1NW4A 1K9VF 3FMFA 1NVMB 1NBHA 1OBFO 4HQRA 4NZYA 5BWCA 3ODGA 4RTKA 1JJAA 3CH6A 3FRJA 3RRNA 1W4AA 2YS7A 4UHFA 5LN1A 1JAIA 2OM2A 3GN1A 4DADA 1VE3A 2YV3A 5EQTA 1NF2A 4EL0A 1FDOA 2E4YA 1OSNA 2GI4A 3TCXB 4F9FA 4RHTA 5E6UB 1NVFA 1G8GA 1X0XA 4D25A 3TF5A 3DOIA 1UBOS 3AKZA 2ZCUA 2C8KA 1BRMA 3JARA 4G84A 4C0SA 1KY4A 4FJ0A 4B73A 1HYBA 1T0BA 3BGDA 3ELYA 3DQPA 5LQAA 2W6ID 4CKWA 1DIBA 3HUEA 3MF4A 4CI0B 4DGSA 4XYLA 1YK0A 1RR6A 1JTEA 4TN1A 4C78A 2JJ2A 2V9PA 1G55A 3WSWA 2Q4EA 2V8BA 1DAEA 1E3DA 1WXWA 4FFLA 3H7AA 3ROZA 4R71A 1VLZA 1PQPA 2XB2A 2ZSUA 4ZK6A 1FLDA 3C7TA 3HBNA 4LNUA 3GCDA 3CN9A 1NL3A 1Z15A 4PNEA 3U48A 5B4TA 3RTCA 5KTPA 4EGFA 3P4XA 4BKMA 1U0OC 2MOKA 2PL9A 3C8DA 5GWXA 1BWQA 1K92A 2AMFA 3HBJA 5HZHA 1P1HA 3LT1A 3M6AA 4OCZA 4WLNA 1GL7A 4NFHA 3ESXA 4G26A 5SV2A 2F1OA 1I7NA 2XCOA 4CKEA 3CR7A 4J6EA 1QTQA 1QDEA 3V4VB 1DAIA 5LOVB 2YWJA 1C9JA 4LECA 1G18A 2XZOA 1XZBA 1RMTA 4DG9A 3EBPA 3H2YA 3PXEA 4RXUA 1DWQA 3FPLA 3AIKA 4WMLA 4BZQA 3R9IA 3TG8A 3EW9A 3QW4B 1ZKDA 2IU4A 4MP8A 1OYWA 4MWGA 1KMQA 4YCBA 3VNSA 2YWFA 4NE2A 1NSTA 5ALKA 3BX1A 1CU1A 1HKUA 2NTYC 1J56A 1MTOA 3NT2A 1GFZA 1PIWA 2H5IA 4QO8A 5BRJA 2RGBA 1Y6ZA 2HV8A 1ZVJA 5ULLA 1GYRA 5CXXA 4PC2A 5EE1A 2IV3A 2WTEA 4G4GA 3VV3A 4MNTA 1OPXA 1HE5A 5HVNA 3PVZA 4XA8A 3CE9A 3JZAA 1LQ2A 1UDAA 1ZNXA 2Q3LA 5LUBA 3DNPA 4TS3A 2CJWB 2P3QA 5C1PA 1X9IA 4BZXA 3IUBA 4CFZA 4RQBA 3DBVO 2IHYA 3TSWA 1ID8A 1E8MA 3H3JA 5E6RB 1JQLB 5KDOA 3MSXA 4ZVTA 3CC8A 2RGYA 1M54A 5KSZA 2Y05A 3EQ2A 2VRCD 3PJDA 3ZX5A 3UT5A 4MW4A 4EFDA 2IYAA 5FTLA 5IT0A 1PD1A 2GLTA 3TPCA 3IBTA 3QEBZ 2ZULA 1EFDN 3MPOA 3QXCA 4R7ZA 4UUAA 5JH7A 1A04A 1NLZA 4H7DA 1G6Q1 1T9GS 1I6WA 2UZ1B 4Q4AB 3RBVA 1TUBB 1W9HA 2C03A 3F6EX 2P5TB 2N1BA 1NN5A 3QBVA 3NHZA 3A1WA 2FRXA 4I4IA 3ZZ1A 1GZUA 4G5HA 4RPHA 1W30A 3TZQA 2NYVA 2BH9A 4PQEA 1EFTA 2A0XA 4TTJA 3OHPA 5JZVA 1TF5A 3E8XA 3WRVA 4W9NC 2JH9A 3IAS1 1SXJB 3P19A 4IRMA 1IHXA 2PV7A 3S4YA 5AM5A 3L3BA 3IQZA 2F55A 3GP8A 4BKOA 1OQAA 3EZ2A 3PS9A 1FFHA 4J2OA 1ZD3A 3ZWYA 1UAGA 5KPJA 2IOFA 2O2CA 1PJZA 3P2MA 2W2MA 3O2SB 5IFKA 3GZTB 3BCHA 2OCGA 3H1GA 2UXDB 4GICA 3K9BA 3NDRA 3OZTA 1QFYA 4EKGA 4BNHA 2VJMB 4RK6A 3LPMA 1AHPA 1X1DA 2H3HA 3OF5A 1E9BA 3TL3A 1N5DA 2IXEA 3BL5A 4FILA 4C2BA 1CEEA 1LDGA 5LMNB 4XVCA 3N58A 4K5QA 1TKRA 3OM0A 3MK31 1SOUA 3CLTD 4NNPA 3FZYA 2X19A 4UMVA 4AKIA 3JAKA 2Y4OA 3M6LA 6REQB 2R5WA 2AOUB 3PWTA 4FZVA 4HFJA 3W6NA 1QQBA 3L0ZA 4Q7EA 3PC6A 5FR2A 1AK2A 3BF7A 3CO0S 2E9SA 2AEFA 2YWCA 2HIHA 4X6YA 1J00A 3D54D 3I92A 4BVKA 3GPDG 3ACBA 1GZ7A 4N5IX 3AEKA 5EZQA 3UOWA 3ZJTA 1GKUB 1CP3A 2I99A 1ONNA 5C5CA 1EX9A 5ES3A 3O4VA 3NH6A 4KYUA 1U5CA 1KQ3A 5EE9A 1IZYA 1OD6A 3K0CA 4PFSA 2V7BA 1E6KA 4YB8A 5JSZA 3EIFA 2ROQA 2B8JA 4NI5A 3N9IA 3SQOA 2JLZA 2AYXA 1HYGA 2G09A 1LPMA 2JGJA 3NLLA 1CUZA 4MWBA 3WMEA 2HHHB 1Q12A 1UC4B 5FL7A 3UICA 1MJHA 2CD9A 3OQIB 4B4VA 3U7HB 1H4QA 4DRYA 4DSUA 2R8RA 3CW2A 4N03A 3DO8A 4QSHA 4MUKA 1O8BA 2D5AA 2J59A 3UQZA 3TTUA 1JFTA 3B1FA 3N7AA 2WSBA 3WFZA 2VDQB 2P79A 1CUUA 3D5QA 4ENTA 4KWCA 3KLNA 3SJ7A 1NXOA 1ZGHA 5K3OA 5GM2A 3PXBA 2HA4A 4BX9A 4RYDA 1DGQA 4O33A 1EE9A 4H7FA 4I6JA 3BSYA 3BRWA 1X7YA 3O8BA 3TOVA 3S8EA 2AR0A 2XKKA 5LYYA 2LIVA 2XRZA 2W2XA 5DM1A 4HAZA 2J3IA 1R2QA 4UOEA 2QL5A 2BTQA 2P6UA 1XTZA 3LCCA 3P9ZA 2KBEA 1QGDA 5HTOA 1M8FA 4ENRA 3TGPA 3I6ZA 1E2NA 1YA8A 2ACVA 3JVUA 1VIAA 4B4UA 4YT2A 1EDEA 4HRVA 5LLDA 3A11A 8AT1A 1AUOA 1Z0SA 2AE1A 2GTHA 3AETB 1BDBA 1KVUA 2JJ8A 4PVDA 5LDGA 1PTKA 4D9MA 5DYWA 1WHTA 2CCGA 3N2LA 4IDCA 4MARA 4EQ6B 1DWPA 1DEXA 3CPJB 4FVTA 3C7AA 3QJ5A 4ZVKA 4CKYA 4CKCB 3J81A 1SUEA 3DAGA 2CK3D 2J6HA 3OF2A 1EU1A 4GMFA 4OO3A 1QYXA 5KYXA 4K0KB 5BSHA 2CFOA 2I4MA 2AJBA 3TD2A 4K9KA 2Z2YA 4BB0A 2J0QA 1JI0A 1ISPA 1AMUA 1ZJ5A 2XRYA 1II0A 4PSAA 3P9RA 3NKVA 4RIEA 4BO3A 1D0IA 2H17A 3N6VA 3OJFA 1TFUA 3AUYA 4XM2A 1XLTC 5JJ5A 5ECDA 1AO0A 1J5XA 2Q6LA 1FP4A 1U3WA 4ZAZA 4ZVQA 4BTEA 4MVXA 3D64A 5H68A 1H42A 2BP7A 2CN1A 1C7EA 3D2AA 2CHGA 2V1XA 1ORWA 4DXDA 4YUXA 3E6AA 1Z6QA 2MWMA 1DPFA 1YACA 2FSHA 4YQYA 4HGNA 3NATA 2VCYA 4BZWA 2B99A 3RC9A 2MYUA 1JEQA 2KHZA 1PFGA 4I4TF 1VPDA 5T4BA 4C6HA 1ZITA 3JATB 1C8BA 4AX8A 3BJRA 2VRBA 3QFCA 1UBJS 2F1HA 3GFRA 1AK9A 4LXTA 3W3AA 3BBPA 1ZHHA 3QVWA 1L8QA 2R60A 1PGPA 1EVJA 1SA0A 2WKPA 3DOFA 1O0SA 1A7JA 4M0EA 1F17A 3H2JA 2LUOA 1X74A 3TQOA 1U11A 4KXFB 1E7MA 3EASA 1MEJA 2LW7A 5C8YA 4FSDA 4L5BA 1H93A 2IU6A 1CF2O 4RIHA 3R6TA 1YNSA 2W9XA 3D5TA 5A2QA 3HVKA 4XASA 1G4HA 3CIFA 4LY0A 1SFRA 3ZWQA 4KR7A 3T7JA 4HR7A 2DPXA 4MWZA 1A98A 3JYHA 1A76A 5JBIA 4I6EA 5A62A 5FUMA 2D6FA 1YZGA 2RIRA 4OATA 3OMXA 4W8OA 2FJ0A 1T8UA 1GLVA 3QEKA 3T5CA 3I1JA 1YJ5A 3FKQA 2XCRB 2M6RA 1TQ8A 2P8SA 4FQ5A 2IWRA 1YFKA 4YUZA 4L4YA 3TR6A 4C0WA 1EP9A 3F6BX 3QI2A 3VUFA 5K0CA 4ESVA 4H3HB 1PEYA 4DCCA 4IX1A 2QN9A 3JASB 4X00A 4BASA 4RY2A 4ZXPA 4F7WA 1D09A 1DO2A 3GFQA 4ZI5A 3RTDA 2IZOA 3IPCA 1QGED 1G4AE 4UDNA 1J49A 2A1UB 3GXOA 5J2UB 3VKHA 1PSWA 1Z47A 2ZR0A 1CB0A 4EFNA 3HJRA 5K03A 2GBLA 3I23A 3KSAC 4RK5A 2CMFA 2D1FA 5J4L