1KQOA

Crystal structure of nmn/namn adenylyltransferase complexed with deamido-nad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
233
Chain Sequence
EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEAAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
publication title Structure of Hhuman of Nicotinamide/Nicotinic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 233
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1kqoA00
4ZCQA 1GLNA 3IOBA 4XFJA 3KT8A 1WQ3A 1Q11A 1PFUA 1VBMA 3ND7A 4DDMA 3GMIA 2Z3VA 4EG6A 4ZCRA 3HGMA 4FZJA 4NZPA 1Q19A 4JYZA 2O5RA 3RBAA 4I6JA 2WQ6A 2A1UA 3A05A 1MB9A 1N2OA 3N9IA 1NUTA 3COVA 1MC1A 4WNYA 3PNVA 4MW2A 2QTRA 1N75A 3D6UA 3CLSD 3RFFA 4KPUB 1M8JA 5DASA 4EG5A 1DNPA 1EFVA 3G59A 1O94D 1JEEA 4MVYA 5LLTA 4MULA 2JA2A 4MUJA 1M8KA 3DV2A 3FH0A 4R2MA 1N3LA 3CLUC 1HYBA 3NV7A 5KCMA 3ZIUA 3N05A 3CLRD 3KT3A 1M8FA 4YBRA 3SP1A 2PZBA 5AHWA 2HGZA 1V47A 1MB2A 2VTBA 1GTSA 1JIIA 1K92A 5HG0A 3KT0A 3IUEA 1NYLA 5TGTA 4NAUA 3X1MA 2Z08A 3DO8A 2TS1A 3IVCA 4MWCA 1KR2A 3QTBA 4H3SA 2D54A 4X0EA 1TYAE 2QUIA 3FOCA 1KQNA 1NSYA 4WSOA 4UZEA 1JZSA 3HL4A 1D2RA 1N78A 4MUHA 3AG6A 1I6KA 2WSIA 3FG9A 4PBTA 3MLAA 4EG8A 2A1TR 1LI5A 3CVWA 3CVYA 1XNGA 4JXXA 1ZUNA 4EG4A 3AFHA 1G8GA 4MUEA 3UMVA 1WXHA 2QTMA 3LOQA 3RK1A 4ARCA 5DEOA 3SEQA 2CV0A 1F9AA 2RD2A 3ND5A 1R6UA 1LW7A 4MUNA 4Q93A 1N2GA 1T6ZA 1N2JA 4XFDA 1VLHA 1O6BA 1UFVA 4QBTA 2PXHA 5JBNA 1LI7A 1VBKA 1TQ8A 2H2AA 1EFPA 1KH2A 1GTRA 1O97D 1O5TA 3LE8A 4OUDB 1XNJA 3ZXSA 2X1MA 1KORA 1U7DA 5K0SA 1QRTA 3IVXA 2A4MA 3MLBA 1WXFA 2E21A 3CVXA 2V0GA 4MW6A 1IRXA 2CYAA 3IUBA 3K32A 2BYTA 1OWPA 2DUMA 1R6TA 1QNFA 4DNXA 1N2HA 1Q77A 1G59A 1NUQA 1O0CA 4CDNA 2B7LA 4ZCPA 1FFYA 2ZUEA 4EG7A 3FHJA 1N2BA 1I6MA 1IHOA 2J5BA 1IQUA 4OUDA 2AZXA 1EJ2A 2GM3A 1WZ2A 2IELA 3ISJA 2WB2A 3ZJVA 2QJOA 1YIAA 4J76A 4UZFA 1MJHA 3DPIA 3HZRA 1FYDA 3IODA 3MXTA 3IMCA 3GLVA 1WOYA 1N1DA 4EG3A 3IVGA 4JFAA 1ZH6A 2YY5A 1YI8A 4ARIA 2CSXA 1J09A 3UY4A 1PFYA 5F23A 1J21A 4E1AA 5KWVA 1NURA 4MUGA 3RK0A 2VTBB 4GU5A 1G8FA 3NBKA 1JIJA 3VGJA 3UK2A 5DB4A 2JANA 1XNHA 3P0IA 2EJCA 3TNJA 3QE4A 4YP5A 1U0BB 4NX2A 1K4KA 1IQRA 3H99A 1F4LA 3Q12A 2AG6A 2QUKA 4MW9A 3SZGA 4ZCTA 1ILEA 1N2IA 3VU8A 1SURA 3OTWA 2CYCA 1MAWA 4Q16A 3D6VA 2A84A 1I6LA 4NAHA 4S1OA 1TEZA 1CT9A 3P0HA 4KKVA 3TS1A 4CDMA 1H3EA 1T9GR 1QRSA 3A2KA 3TZEA 1WQ4A 4PY2A 1B6TA 1QU3A 2R5WA 2X1LA 1P7PA 2D13A 3VRHA 5EKDA 3H9BA 3MUEA 2GOYA 1GZUA 4ZCSA 3CLTC 1EFPB 3IMGA 2YXNA 1NUSA 3IOEA 5TEWA 1H3FA 3AKZA 1KAMA 1PG2A 2XRYA 1WY5A 2E0IA 4R2LA 3F3MA 3GUZA 4HK4A 2CV1A 2OQ2A 4MWEA 3ND6A 3Q4GA 1GPMA 4DJAA 5HUJA 3RHSA 2CV2A 4K03A 2DEUA 4G6ZA 3SEZA 2A86A 2J4DA 3COYA 2J09A 4MUFA 4MW0A 3HMQA 3ZXIA 2BTEA 1F7UA 4KR6A 2A7XA 2PFSA 3PNYA 3ZUGA 3ZGZA 1U7XA 3K9WA 5H7XA 1X6VA 1WKBA 3Q10A 4AQ7A 5TEVA 1GAXA 2H29A 1T6YA 4MUIA 4K0RA 2CFOA 1N2EA 4ND6A 5J59A 2A88A 2QUJA 4F4HA 2NSYA 1QU2A 4ND7A 2PIDA 2DLCX 2HZ7A 1EXDA 1PG0A 3H05A 1JILA 3ELBA 3IOCA 1O97C 1EE1A 1T9GS 3L92A 4HJRA 3G6KA 2G36A 3G5AA 3NBAA 2Z09A 2QJFA 4MW5A 1KH1A 1IFXA 1IH8A 1MOPA 3AIIA 3HFJA 3PRHA 3QTTA 3N8HA 1YULA 4AS1A 3FDXA 4ZT6A 5J5AA 1O95C 1EUYA 1OBCA 3CA8A 1KAQA 3JXEA 1JEDA 4MVCA 1YUMA 1I2DA 1QJCA 1OWMA 2JAXA 2J08A 1JHDA 1XJQA 1YUNA 1VBNA 4YMIA 4NDAA 1J1UA 1WXIA 4CT0A 4EG1A 4L2IB 1KQOA 3UOWA 3A4IA 4U63A 1K4MA 3P0JA 2E18A 3KFLA 1WXEA 3HV0A 3ZJTA 3IMEA 1PFWA 2DETA 1ZJWA 1NI5A 1N77A 2EL7A 2IP1A 1EUQA 1T6XA 3U1VA 4EF6A 5H16A 3AG5A 3X1JA 4F3RA 4A91A 1TYCA 3TQIA 2NZ2A 4QRDA 5LM3A 3TZLA 2AKEA 1ZH0A 3FNRA 4MLPA 4QREA 4GRIA 3SZ3A 5TS2A 1OBHA 4L2IA 5K0TA 1M83A 1NUPA 1IVSA 3I05A 1OWLA 1O0BA 1J20A 1OWOA 2CYBA 1JGTA 3PXUA 4G5YA 3UC5A 1A8HA 2DXIA 4JZYA 1YIDA 2X0KA 4MW4A 3P52A 1JECA 3CLSC 3FWKA 4XSVA 3INNA 1O96A 2IJGX 4ZT2A 5IJXA 1NUUA 1M8PA 1O94C 4MVWA 3CVUA 3ILVA 1MBZA 4DDHA 1U3DA 1WXGA 3CLUD 1KKUA 4MQ6A 3OP1A 3RJZA 4EFKA 3CLRC 1QTQA 4BWVA 1MAUA 2RE8A 2QUHA 2I1LA 5FNZA 4OJMX 3S3TA 5HUHA 2V0CA 4ZT4A 4MAFA 3CLTD 4NATA 3IDFA 5IHXA 1J70A 4MW7A 3X1KA 1QQTA 1VL2A 3COZA 4CQNA 2O8VA 2QJTA 4R0NA 1TYDE 3A04A 4MW1A 4DE5A 5LFAA 2WQ7A 4I6EA 1KP2A 5FO1A 5BNZA 1TFUA 1QRUA 4P2BA 4JXZA 4HJXA 4MWDA 1MRZA 1V8FA 4KPUA 1J1ZA 1OD6A 3SDBA 4ZT7A 1TYBE 2VXOA 3FETA 1F7VA 3BL5A 2GKSA 2E89A 1U3CA 1GN8A 3H9CA 4DDKA 2C5SA 2HMAA 1OWNA 5DK4A 4I6GA 4MUKA 1M8GA 2DPLA 1IQ0A 1G8HA 1JZQA 1BS2A 1KQPA 2PZ8A 2YWBA 4MWBA 4PBRA 4ZT5A 4J75A 2X3FA 2D5BA 3COWA 1NP7A 2J07A 2XRZA 2CT8A 1H3NA 4ZT3A 2PG3A 4HPWA 4KR9A 2YWCA 1NZJA 1Q15A 3SYTA 1H1TA 3E27A 4YP7A 3N2YA 3CR8A 4U7JA 4RUKA 5J58A 1R6XA 3FY4A 2ZUFA 1O95D 4DLPA 5KHAA 4G5FA 1Y42X 3PNBA 5FO0A 1ULHA 3H97A 1WJGA 1KH3A 4U8HA 1JIKA 1S4MA 4PBSA 2QTNA 3FIUA 3DLAA 3TQOA 2ZP1A 2DR2A 4MVXA 3IH5A 4TS1A 4YP6A 4EGAA 1K97A 2DERA 1O96B 3C8ZA 1X8XA 2A1UB 1COZA 3L93A 1KP3A 2A1TS 3FI0A 1PFVA 1JMVA 3KT6A 2PZAA 3LCJA 1M1ZA 3M5WA 4RPIA 1RQGA 4KR7A 2CUZA 3ZJUA 3CVVA 3AL0C 1EFVB 3MMXA 2OV4A
chains in the Genus database with same CATH superfamily
4DWJA 3FPEA 1JXQA 3FMPB 2EP5A 5FTLA 3OF2A 4X1OA 2DHQA 3ZOKA 4D5GA 3T3NA 1XC7A 3EX7C 1D1PA 4LHXA 1VSUA 2G0AA 4FKZA 4KI7A 5IW8A 1XMOB 4ZRNA 3MBOA 1FA9A 1YDWA 3BM5A 3GZTB 4RKQA 3C8UA 4ZOAA 2P5UA 2YV5A 2OFFA 4QE3A 2C2HA 221PA 1OVGA 2NX2A 4ZCRA 5CA1A 3RU2A 1AE1A 1KXJA 2TMKA 3EARA 4JUCA 5CW1A 4Z2YA 4LJRA 3C16C 2O59A 4M9CA 3RTEA 4V0KA 1T0UA 2LNDA 3CRRA 1NQVA 3MOIA 3I32A 1KBOA 3GYBA 4WOBA 3DL0A 3JVUA 3ZGLA 1BE1A 3GLQA 4GM1A 5EQFA 1MH1A 2Q4DA 3COVA 3KEQA 4RAQA 4LRTB 4F5DA 2R1UA 2GSWA 4WNYA 4DB2A 1M0TA 1Q0PA 1OYWA 1L4FA 1WZUA 1B16A 3E5RA 4I9UA 4YDRA 3GFSA 3GJ3A 1ZGHA 5IBPA 2GAAA 3RS2A 1XWWA 2PQ2A 4WOPA 3R9WA 4K8OA 3ETGA 4KR2A 1GEGA 4MVYA 1HTWA 1Z4IA 3FGPA 3MHTA 1YRWA 1NN3A 5I9BA 4ATNA 4IF6A 4Y6OA 4KFUA 4PYIA 5M29A 4L6IA 4OLAA 4RJJA 1CQPA 1QGYA 3WGKA 4UE6A 4OB8A 3WA7A 1RXVA 4DNPA 4NTZA 5LXTA 1M34B 1JH9A 4DSNA 2YIJA 3C3DA 4G41A 3G9TA 4I3FA 4AX4A 2FPGA 4KQFA 1ZOLA 3MRSA 5HRAA 4NP6A 1AGNA 3LNTA 2PQ6A 2DFLA 2PV7A 3FOWA 4I3HA 2ACKA 5BN3A 5JRDS 3LRPA 1ZH4A 1Y9JA 3PK0A 3IVCA 2QW1A 4BLUA 1FP4A 2V9ZA 3UT5A 2WD9A 3NORA 1NXSA 4CMAA 1BE0A 4XB2A 1I4TD 2AC2A 3CX4A 4IIDA 5ALIA 4YV7A 4QT0A 4UUBA 2REOA 1WCIA 4UW9A 5F12A 5HMMA 5T4HA 3X2FA 4C03A 4IJUA 4MWTA 3BQNB 1RQ2A 4NZOA 3UPTA 2GZMA 4IMIB 5H3CA 4DSTA 1X1BA 3RKSA 3FOEC 2IS4A 3VU0A 4WK0B 3ZCXA 1S9DA 4G5XA 2P2NA 3O31A 1II8A 3ZQJA 1DTSA 5AVVA 2Z58A 2QP4A 3D4IA 2FPIB 3C5HA 4PLHA 2XTMA 4HB3A 3DOCA 4XFDA 5TIIA 1N2JA 5BNWA 2JJMA 1ZSVA 3GI1A 4RF4A 4CKZA 4YX9A 2WPNA 1T6NA 3ABZA 1O6BA 2IYWA 3SKYA 2HT6A 3G8DA 3OCXA 4UTVA 4O4HA 2DWOA 5C5DA 1M3SA 4JIMA 1E6LA 4WN9A 1ST2A 2H1RA 1P44A 2H7XA 1U0NA 3LDUA 1XNJA 3UM9A 3A4TA 4CQJA 4KGXA 4HFJA 4H1VA 1QRTA 1G9XA 1NQUA 4NL4H 3L3BA 3WB9A 1ZINA 3EDQA 5E7QA 5IT5A 5MHTA 1DKLA 2ZXUA 2BELA 1NI4A 2GFHA 2YASA 4TV9F 4NMWA 4EELA 2DUWA 4FQ5A 2B83A 3AHHA 3CO0S 4DPLA 4V1CB 3EWNA 2OORC 1SEVA 2VHQA 3EFOB 2J9RA 3DAHA 4CTMA 1RJWA 3SXPA 3UGKA 2AL7A 2FUKA 2RH9B 3AFGA 3AJ9A 1LY1A 3TLKA 2SCUB 1PO7A 1RYEA 2PKXA 4IJMA 5TS3A 1QHYA 2JJYA 3P9IA 5EL0A 3UB2A 5C3MA 2ZUEA 3HKCA 4Z7QB 5CA1F 1N2BA 4KR7A 5DYNA 4EWLA 1IHOA 2X3YA 3EXG1 4CQLA 2P1RA 2QDXA 4DA0A 2XA1A 3ROFA 2EZ8A 1UCFA 1LBEA 1O6ZA 2PMWB 2QLBA 4GMKA 4X1KB 4B7UA 4DW8A 5EJ6A 3PCRB 4JLDA 4BLTA 5A9RA 3FTPA 2JDID 3LUHA 5CXSA 1QBGA 1HT3A 2WIKA 1UZNA 2OXFA 3UCEA 1KJYA 2QL6A 4GDMA 4EPRA 3O74A 3LUAA 1A7AA 4KWHA 2D5CA 2HJVA 4DRXA 1JDTA 1AH2A 2OXRA 2XCUA 2ZYUX 1N3IA 3GHHA 2L82A 4ZV4A 2FW8A 3TBKA 3ADOA 1RM4A 1XP5A 4M1TA 3KHKA 3L7CA 1E1YA 4ENTA 4J1TA 2ZRAA 5B1HA 1WLYA 1WDLA 2XVAA 4ZQFA 2YXBA 1P6XA 3N2KB 2JGDA 1DC3A 2BN4A 4ZVSA 4KR0A 4V3BA 5LXTF 1M7GA 1GYRA 1JEQB 3IUSA 3NBKA 5KTRA 4BX9A 2P4UA 3H1TA 1W2GA 1R18A 1PR0A 1T4GA 5AI6A 2ZETA 2QW8A 3R8FA 4E33A 2E49A 4EY7A 4JT8A 5DM0A 3AHJA 4KXQA 4KO4S 1X7ZA 4YI5A 2Y1DA 2N1BA 3OD5A 1XR3A 3U0VA 4KN6A 1M5RA 1JPNA 2DE0X 1T35A 4HUTA 2BP7B 4YP1A 4HSGA 1TX4B 2FPMA 2PTHA 3N8IA 3PQDA 2A84A 3ANSA 2PLFA 3T12A 2D62A 1FL9A 2X8LA 3I01M 4NYMQ 1Z5WA 2IYUA 3EHEA 2HREA 2QRHA 3J81k 3KZNA 4F06A 3A6JA 3K5IA 5FPPA 1P2SA 3KM0A 1A69A 2VYVD 3TSYA 2Q62A 3WJ2A 2ODAA 3CGGA 2O06A 4MP3A 3QTLA 1F48A 4O4HF 5FOUA 1SQ0A 3FZNA 4UUPA 2UU9B 1W0JD 4FXPA 1W0KD 2EKBA 2QD5A 5EMNA 5IVKA 3NTXA 4HEA1 2ZYGA 4MI6A 1DIHA 5DI3B 1RWMA 2WYUA 3A70A 1NMYA 2IHNA 2XT6A 5ITSA 4XX0A 4OP1A 1KI9A 1BEEA 5EP4A 4PIVA 1V16A 1NF9A 2VAWA 2VYNA 1RXCA 5EUMA 3HNRA 2QTFA 3OZAA 2PQ0A 5L7WA 4YJKA 4WDRA 2H16A 1MORA 3E8XA 5U4QA 3TNLA 4GMDA 4BIMA 4YYZA 3OTGA 1GYPA 3ADBA 1I1QB 4MLZA 1ZFNA 3HXOA 5TQ2A 3IC5A 1E0JA 1KZ9A 2G76A 2J48A 2GEFA 2YCLA 2Z5FA 2Q2VA 3KEGA 3COYA 4MQEB 4Q3LA 5ED0A 4YCSA 1QVVA 4KVZA 5FX2A 1XZGA 2VSXA 4YGYA 5EOVA 3ZQKA 4B5LA 2PLNA 1IZYA 2QMYA 2ZSJA 2DUJA 2KB0A 3KYBA 4EY6A 4UPEA 1NN5A 1MO2A 4BUJA 1W94A 4R5HA 4KLCA 2OZPA 4J2HA 4NCBA 2H29A 1P91A 1HE8B 1L5MA 2Y0DA 3ANLA 3O4RA 4OHYA 4AZ0B 1P5ZB 2CDCA 4R8RA 3RHFA 4C07A 1N32B 4EQZA 4QOJA 5A2QA 4KYIB 3RABA 4NBKA 3Q8LA 1QU2A 4D8WA 1P4JA 4Z3KA 3AVYA 5HQJA 2QRNA 3GLUA 4H1TA 4JJZA 1LBQA 2H6EA 2WLSA 2E48A 4ZO9A 5BYBA 1JHUA 1JSZA 2ZAYA 5FKJA 3HH8A 4RJIA 4F4FA 1N4DA 1B2LA 1LV8A 2G36A 1ZZGA 1C4OA 2PRKA 3E7DA 3PIRA 3R6LA 2Q29A 4LTDA 4QU9A 2PM8A 3AIIA 1MOPA 2VT3A 4Z7JA 5EPUA 4Y2HA 3JD4A 2YJNA 1JEJA 1USKA 1YCFA 1DJLA 3FHOA 3RSHA 5C51B 3PUWA 4HB2A 4LOHA 2ZVJA 5DLQC 3ULKA 2ZKLA 3HZHA 4INOA 3L7YA 3P9CA 3GRVA 4Y6PA 2EWWA 4IO0A 2V1UA 1NTRA 1QB7A 5JE8A 4PLPA 1UJNA 1UK6A 3WL7A 3SVLA 3R23A 1D9ZA 1CZUA 4IUDS 1SC9A 3V8MA 4W5JA 3VC7A 4FN4A 1XLUA 1YDFA 4G65A 5FTNA 4UQPA 3EDMA 2CL5A 4GPBA 3S68A 1SU7A 3PFWO 5CX1B 4YMTA 1FDTA 3RJ5A 3O91A 4JD5A 2H11A 3V46A 3GUYA 5ER9A 3RIHA 3U3DA 4CV2A 1RHQA 4EZEA 3FPCA 1C9MA 3N53A 4AMVA 5B53A 3LYLA 10MHA 3V8QA 4NICA 4CQMB 4IM7A 5E7MA 5A4DA 1H2XA 2OP0A 3PE4A 1MRNA 2I4IA 3LT1A 4PYRA 4U63A 3ZGYA 1B3RA 3HGQA 4ECEA 1SPXA 4IJVA 3NW9A 1QRDA 2PZEA 2VTVA 3IAM1 3ANNA 3LVRE 3NM6B 4XIIA 3PGVA 4DABA 1Y63A 2YYZA 2BZGA 1GZ7A 3AFMA 3MT7A 4X66B 3QX3A 2HXGA 1ABFA 4ZHQA 1F4PA 3IKLA 4ZQCB 5L4SA 1NWHA 1RXUA 1Y3HA 1ZCJA 2HDWA 2D2EA 2J33A 3I9KA 2VP2A 2WTEA 3AL3A 3FPGA 2ZTUA 2IXEA 3AG5A 3B70A 2Y2UA 3CRW1 3GT7A 3TX2A 4WD3A 4BIIA 3DFMA 3GLRA 5HQTA 1KJNA 5COBA 4Y1EA 4C5AA 2Q1UA 5EMLA 4Q0MA 1BROA 4X6XA 3SIRA 4CPDA 1A95A 1CR4A 3BTVA 4AJLA 2ZJOA 4WBSA 5JAUA 1BWPA 1GFIA 3AUKA 3PL1A 4JL8A 1GZ3A 3GLTA 1IN6A 2GJAA 3KYCA 3M3DA 1Z63A 1SFRA 4AIIA 3UC5A 1BQ4A 2WHEA 2P9QA 1UKZA 2PLWA 1NW6A 4GYJA 4L5CA 4LTNA 4UJ5A 2QZ9A 4ZQGA 3N5KA 3WC4A 5IVPA 3S2IA 2AEMA 2SBTA 4ZYVA 1H85A 1O96A 2IJGX 2VJDA 1TPZA 1NE2A 1SBTA 3SZRA 4GKKB 1U8YA 1UAYA 4OQPA 5BUCA 1UJBA 2F3SA 3TQQA 3G23A 16PKA 1H8EA 1RM5A 1T9HA 4EFKA 4JB0A 3BREA 5LQDA 3NT4A 4C7OA 3LG2A 4HUQA 4UU8A 2O2DA 4AJIA 1AZTA 2YVLA 3CNNA 3OCCA 1KMQA 3MXOA 5IK2A 4BYGA 5A71A 3PJFA 3O4VA 4W7HA 1WBBA 4FWIB 2YW2A 2QN7A 1OROA 4IH1A 2D3WA 1YR7A 2W2TA 1AKUA 3AOEA 1P0FA 3DJFA 4FLFA 1FFBA 3OEED 3BA1A 4DLRA 5C80A 2HR1A 4LSMA 2PKEA 3L9XA 4TMVA 3FTEA 2VBCA 3WNZA 1CIPA 3CVJA 2SKCA 1OLUA 1J0XO 1E3DA 4DV4B 1QS0A 3W8NA 3LAWA 2A5YB 5AXDA 2NQ2C 3RF7A 1CEYA 3EPLA 3AERA 1NFRA 2ZIZA 3GGPA 1KXZA 4OM8A 1KK3A 4OB6A 1EVKA 4CFSA 4KGZA 4DFDA 4HJXA 4DAEA 4H4EA 4QZVA 1BO6A 4IXDA 1G2OA 1MAVA 2FI1A 3N86A 5FUWA 4EJ6A 1VKHA 1SVLA 3E22A 4FNAA 4IH4A 1MXFA 2OKGA 2MINB 4Q4JA 1YUBA 3UJBA 2JFPA 1U3CA 5DJ5A 3W6PA 3HS3A 1Z29A 2XUFA 2NYRA 3OKAA 3KYDB 4NR0A 1A2KC 4G67A 1FTQA 1P74A 3A31A 1YZVA 5CFRA 3JVEA 1GOTA 1QVAA 3UOAB 3KQOA 2YJ4A 2PKYX 3CYFA 5EFZA 1Q83A 5AFSA 2HEGA 4WFKA 3V4FA 3QW2A 4ITUA 4XAQA 1KQPA 2OHVA 4IVPA 2HBQA 1Q44A 4ZQBA 1LSOA 3H9QA 3Q9SA 4IICA 4LE2A 3C3PA 1QG0A 3DJYA 4G26A 2W2LD 4N5NA 4FOLA 3STHA 5JO9A 3DDNA 5JNWA 3K9GA 3IKTA 4A26A 3BK2A 4YI3A 2ZUSA 2GK7A 3U1BA 4H7JA 5GOZA 5LJLA 4DBZA 2DULA 3EXAA 4DIOA 2NNWB 1PP4A 3IEUA 4B3DA 1N5IA 4CXMA 4LOAA 1V39A 3AKDA 4ZEMA 5L7TA 1L7EA 3RUDA 3RIGA 5H81A 1I51A 1PSWA 1YOVB 3KOZA 3RJ9A 3ZDRA 4QPCA 4RD3A 2Q41A 2OVBA 3C3BA 2WTBA 3PX3A 3VR6A 4YFVA 4QYIB 2Q3MA 1X70A 3HVJA 1KETA 1BD4A 4EKEA 5COAA 5JADA 1DMRA 1XKXA 1S01A 3H97A 5DTEA 1O6FA 4P8RA 1KH3A 2W2QA 3WJAA 4G0OA 1J49A 1PR1A 4RPJA 4DT1B 5BMVA 3O38A 3K0KA 4GOXA 4PBSA 1V8BA 3OMLA 1U6IA 2Q0QA 2QPLA 4G0XA 3OEYA 3MTEA 3EXHC 3HP1A 5A4IS 3QI2A 3DLIA 2H57A 5F5XA 3T4PA 7REQA 2QSJA 4IEFB 1X1CA 2OHGA 1AF7A 4MYSA 1P9LA 1LWNA 4MQMA 1ISHA 3SQWA 1XX6A 1W5FA 3AF3A 4KV7A 2M6LA 1PFVA 4C4SA 4A8HA 3R7AA 3EZXA 3U3MA 2CLLB 4OI4A 1SHKA 3TXXA 4EY8A 1NV9A 4YRAA 3JARA 3CVVA 4OSEA 3BT7A 1FDWA 1FB5A 3P4XA 4J0DA 2O5EA 1NP3A 5LA6B 3DVAB 3OIGA 1PUIA 1CBUA 1DP4A 2I8CA 2ZROA 2VWPA 2YH2A 1ETHA 3B9BA 3W8RA 1LZKA 3U4QA 2GAFA 4BHTA 2WHPA 2UXCB 4C7JA 5BY2A 1T9KA 3FHCB 3HXKA 5D1NA 2EW8A 1EUDA 2W93A 1V5GA 3QW4B 4N6OA 2HN9A 4KFRA 2H1FA 5D5HA 2P67A 1FMCA 3U4CA 4EJ0A 4HDCA 1IOVA 2X1HA 2J4CA 3AVUA 1DC5A 4PS1A 3FMOB 4DR2B 4ABYA 4IV0A 1D9XA 2J5KA 2VP0A 5E4YA 2ZIFA 3Q3JB 3VDMA 3MG9A 1PGJA 1JI0A 2ZWPA 3IIJA 3JASB 2DBQA 4YRKA 4RZ3A 4TLCA 3L05A 4MW2A 4RV4A 1CF4A 2B21A 1N75A 1X7DA 4W5RA 1L5LA 1RQXA 1P0IA 2FGJA 4OXKA 5HDBB 1M8JA 3HEAA 3CUKA 1MH9A 4HXGA 4GLJA 3KQYA 4QICA 1M6VB 2QYTA 4X44A 2ILTA 3FH0A 3KJGA 1OYOA 3CLUC 2A30A 3MWEB 3W90A 1K6JA 1LLCA 5DSTA 5DYGA 1Y3FE 4N65A 4A0QA 3VSBA 1U6JA 4POAA 5AHWA 3JS5A 1HE1C 2GYWA 3DE4X 3K8OE 2VZ9A 4NAUA 1LQUA 3QNMA 1GRRA 4JX8A 3M33A 2C0QA 2Z08A 4C7KA 3QBTA 4ROTA 4LZAA 4QEZA 5F73A 1TJPB 3ET4A 4ZI5A 3DCNA 3SSAA 3SM9A 4PR3A 2WF6A 1TYAE 3O95A 2NPFA 4C2TA 1N7JA 4P82A 3KRTA 4U00A 4YAOA 2P69A 2AB0A 4M9ZA 4Q7MB 5E6UB 2EL9A 1N78A 5HYVA 4A0HA 4O4LA 2QTLA 3KXLA 1FE8A 4QGGA 4KX3A 1PFKA 3TLEA 5JS1A 3CVWA 3UTCA 4BMVA 3E7PA 3UMVA 5TT1A 1D2MA 2QTMA 3TJMA 2X22A 3G68A 3P2YA 3PA6A 3U4MA 3SEQA 1OLSA 1BHQ1 3I2HA 4LIPD 3AQIA 4K9DA 1PJRA 2WICA 1NP6A 3A9RA 3EUAA 4EATA 1T8RA 3BXZA 4QXMA 2FFHA 1VLHA 4H6VA 1T13A 2D5AA 2HCJB 2WP8J 4QBTA 4AL4A 3IAUA 1P3DA 2AJ8A 4HTFB 5KNDH 2H2AA 3FD8A 5CMLA 1EBBA 1NVMB 2YYSA 4FNGA 4KUHA 3NTQA 1RWXA 1Z6PA 5LBTA 3ZWNA 1ORTA 1U7DA 2FRXA 1JDSA 3HVUA 3SC2B 4IHKA 1WW8A 2NU8B 1AQIA 2B35A 4LHEA 2AN5A 3A6KA 1EK5A 1IRXA 2GPTA 4GD3Q 4MW6A 1CRPA 3OQ6A 1CHDA 3M4NA 4G56A 4JOSA 3IKVA 4X3PA 5KVQA 5A9SB 1RFLA 5JFGA 1OBFO 2VYQA 4LNUA 2BYTA 3W9UA 1C0PA 3HKBB 5BWMA 5HTKA 4DC9A 2QMUA 1E5TA 4MCAA 5EQDA 4KQMA 1CFZA 1Q22A 3RSQA 5L3SA 1NNUA 3LLMA 1ZIPA 3MQFA 3QLVA 3OLQA 3PTAA 1T4CB 1A0OA 2UYHA 3H9EO 2QW0X 3ZLVA 3WGYA 1Y81A 2WAAA 3B78A 3TIXB 2P9JA 1H8HD 5FBZA 2D1FA 5ICEA 4FEAA 4RD2A 2EOAA 4XTRA 4ZVUA 1YB7A 5CTJA 2HNBA 2CZGA 4CHTA 2P7HA 4BJHB 4LBZA 1Z8FA 3OUUA 1YHZA 4Y1FA 5HNKA 4E3WA 1EUCA 1TW3A 4YACA 5LPNA 3KJQA 2WSMA 5FADA 3OPYB 4GLBA 4RIEA 5B3KA 1A2OA 1Z0KA 4B3BA 4EEKA 3GLVA 5HSGA 5DNCA 5ESWA 1D04A 1BOOA 3UK6A 5KKAA 1ISIA 1NQOA 3PWSA 4EH1A 2XCQA 2WFLA 1F5NA 3KVNA 1ODKA 4TKZA 1U1DA 3U37A 2EBHX 3EJWA 2WZDA 3TD9A 4ETWA 4KW7A 4U7DA 4OA5A 2EERA 5KNCD 3M1LA 2ZUWA 2VL7A 1A5ZA 1MJFA 4K6KA 4KLRA 4U2FA 4WZBE 4CTNA 4EB3A 2EIHA 3W6ZA 4E1AA 2AFRA 4IQ8A 4KMOA 4UE3S 1KMHB 4FMPA 5ALQA 1DBSA 4RTMA 4RA6A 1QIEA 2X42A 2BCJQ 3H13A 3QFSA 5FTJA 3RUIA 2I4LA 2R68A 3ODGA 1GO2A 2JLAA 3FNHA 1JFFB 4HH4A 4OATA 4QGBA 3RANA 4ESVA 4I9NA 5DB4A 4NVRA 4E5YA 2C2YA 2X6QA 5BW4A 3LM8A 5C0OE 2C8JA 4AF6A 1UBOS 3V80A 4P3NA 4EHHA 1WEKA 3BFVA 4F7WA 5L4NA 3GAAA 3OJ0A 4I4TA 3RW9A 2PKQO 5EPEA 4FZRA 4Q37A 5FOXA 4Y2SA 3U0BA 4U7GA 1EXMA 5KVSA 4R71A 1FVXA 1Q7GA 3IYLW 4PCUA 3FGNA 4Q1EA 4ZCTA 3GLGA 2Z6AA 2F17A 4KXWA 3OC6A 4Q47A 4WK4B 4O4LF 4RK7A 5DCLA 2QX7A 3LRTA 1QH8B 3ZE0B 3D6VA 4JGGA 3RODA 1T2EA 3FAZA 1AD2A 5DE3A 2PUJA 2WJWA 3WOVA 2WTXA 4KMSA 1TM7E 4BZXA 3CISA 2ORWA 2WWFA 3IAS1 2R85A 3LK7A 5EZQA 4FDVA 3DBHA 2BUBA 2ZIGA 3UZUA 5EJIA 5EYPA 5JLJA 5ADUS 1OX5A 3DVLA 3KSUA 1I3OA 4P35A 3I01A 1N9KA 1UAGA 3PPXA 2D4HA 4REQB 3RG2A 4IHQA 4J91A 4J6FA 2Y0CA 3FCOA 2OY0A 2XR1A 4R2XA 1DIOB 3IMFA 3WWEA 3IEKA 3BCHA 2NYUA 3IX7A 1I36A 1QH0A 4G8BA 5ALNA 1GKKA 1SC1A 1XNQB 2PMDA 1P1FA 4GPTA 4S35A 3LL4A 4IVQA 4BTVA 2XQVA 1GG8A 3HBLA 3AKZA 2NUPB 1TCUA 3V4OA 3N1UA 3ZHUA 3DCIA 5CH5A 2A0XA 1ZU4A 3D7RA 1Q74A 1RCFA 1TU3A 3LD9A 4TTAA 2K87A 2PL3A 3VR4A 4ACBA 1R0RE 3T3MB 3ZEIA 4DBLC 1SVKA 4ZMSA 1NAIA 1MENA 4LYFA 3RYIA 5GV8A 1XAIA 3OZIA 5CDFA 1DAKA 2QORA 1G20A 2R7LA 1P9NA 3ZLTA 3ZJ5A 4CUZA 5AVKA 5FR1A 1L1FA 1W2HA 1R1DA 3TQCA 1Y6RA 2C4KA 4U7WA 5GWXA 3V55A 4BNKA 4C4YA 2NZXA 2QGZA 4M1KA 5DEIA 2NV2B 4TZKA 2TMYA 4AY4A 3HBFA 2C7GA 4DIUA 2X2EA 5LB4A 4X91A 3RRMA 1GEEA 1DJNA 1M6WA 2DWCA 5REQB 1ZVVA 4XRGA 2ZK7A 2BR3A 3K1ZA 5CIQA 1GAJA 5AVSA 5FBQB 4RDHA 4Y30A 4XYGA 1E1NA 1GLVA 1VJCA 2MSWA 4FFOA 4X1IA 2NSYA 4XVCA 4MHTA 3MJCA 3PKIA 3ASYA 4PF1A 5I9TA 3DEHA 4D79A 2O7SA 1OXSC 2QI9F 1V0JA 3VPHA 3JYLA 1LBHA 3KHUA 1TEHA 3I52A 2IHUA 2VIIA 4BNHA 2R47A 1N7IA 1OFGA 1TM3E 3BZUA 3FZYA 4RM2A 4BMXA 5KWJA 3VNRA 1ULBA 2FDCA 2ZT6A 2C04A 4DLNA 2V7EA 2GD2A 1SVNA 4GEKA 3O5AA 4CKWA 1GTJ1 3NBAA 2B9EA 1EBFA 2GVNA 2HKIA 1ESMA 1SH7A 2OV2A 2ZJBA 1C7QA 3LA6A 3PR3A 1F51E 2A58A 4P22A 5T41A 2ZJ3A 4EX7A 1ZN2A 2JGKA 1DRJA 3WHIA 5EZYB 3QE0A 2WT4A 7ABPA 4IMPA 1NL3A 5BNTA 3CA8A 5JISA 4O1IA 4RKFA 2Z56A 3RVJA 2ZSIA 1KAQA 1O1YA 2QAIA 1APBA 3D02A 4YMSA 1OXKB 3DKRA 4PPGA 2RKBA 1JEDA 2PUHA 3DZCA 4L95C 4UNNA 4DR7B 2DX7A 1ZDMA 2GBGA 1X1RA 4IV5A 5EIWA 3FUUA 3DNFA 2XDAA 4JJ7A 1HOTA 2ZAIA 4I4TF 2YHAA 4D74A 3P8ZA 4HAVA 3TK1A 4BEWA 3FIJA 5HOQA 3WBJA 3VTZA 2BV3A 2RKOA 2VT7A 3BMCB 2F4VB 1TZ2A 1JRLA 1BMFA 2YKGA 2VAMA 5B58C 2CJYA 3T8YA 3TG2A 2H9IA 4UOQA 3CKKA 2XLBA 3ROQA 1C8LA 3H75A 4Q4AB 5AJZA 4URZR 5NLLA 4Q1BA 5DT9A 1SB9A 1ZXXA 4IX1A 3WSVA 3BCRA 3QEMA 3QOWA 3WLMA 3GLFA 1UFOA 5CA0A 4DEXA 1UBEA 4O3MA 4L57A 1ZJWA 3P5BA 4FS3A 1VJGA 4L0QA 1T6XA 1QV6A 2IEAA 5C35A 2VDQB 3C3JA 1L7DA 5B64A 5BSFA 1WUKS 4PZZA 4QA9A 1N6RA 2AR7A 5LLDA 1T9DA 5DM60 1E1KA 4JLPA 4L8GA 4L2IA 1VB3A 3S7TA 5C9ZA 2JFVA 5BURA 3SR3A 1UPAA 1NLYA 3DS8A 2FTKE 3KEMA 4BO0A 3WYFA 1SBQA 2FJUA 1KF0A 1G63A 3NBXX 2QS9A 4WRRA 4O2BA 1E2BA 4YJGA 5IVIA 3H2KA 4B3XA 4BATA 4IGAA 4OM7A 3S6JA 1XI2A 4CNQA 1GUBA 1CS0B 1H0SA 3P9QA 2XNSA 3C6MA 3FWKA 4G89A 1LDBA 4L4XA 4N12A 2AMYA 3V2GA 5IJXA 3RYFA 4DMGA 5EE1A 3ZDYB 2P2ZA 3C41J 3PP8A 1P5RA 1SUWA 1WV1A 3S1LA 1VGRA 5ARDA 2GM4A 1A27A 4KQJA 3GP8A 3H9GA 2V5VA 5K0JA 5GMOA 1JXMA 3ZTTA 1DBQA 1E1MA 4DEYA 3D4NA 1WP9A 5JIBA 2OBMA 3LYHA 2I1LA 2FHSA 3AXTA 5HUHA 1ES9A 1IBSA 3ZBTA 2FXIA 4YRSA 3KR0A 3U6KA 4DDTA 1GKLA 1QHGA 4KWTA 3VDQA 5K3BA 3R8XA 4X64B 4LGCA 3PU6A 4FJ0A 4M9SA 4LRWA 4DLKA 5ESDA 4BQRA 3WLTA 4NPCA 2IIBA 2Z2IA 4HAOA 3HHEA 4MW7A 5T8KA 3P2IA 3Q0IA 3UJHA 5TE9A 5FBWB 4F72A 1JQAA 2P5YA 2HF7A 5CFQA 1M6YA 1Q3HA 1H2EA 1U3TA 2C9YA 2HAEA 1ZSYA 2WQ7A 1IM8A 2Q3JA 5FO1A 1GTVA 1JL3A 5FOQA 4P0PB 4EJFA 4ZPJA 2CMDA 3GMTA 3N0VA 5A4AA 5LQSA 5LL6P 3WO0A 1WWKA 1DBIA 1V8FA 4BC0A 2PR7A 4KXYA 1E94E 1Y6GA 4FYWA 1KVUA 1SUIA 2GXUA 1TYBE 1VOTA 1H1LA 1N0IA 2IF0A 1JYEA 2VYND 4G5HA 1KU0A 3WLPA 1Z68A 4AQYB 3U3XA 2XMZA 3ZZ0A 4H7KA 4HVCA 4C22A 5CB6A 1IK6A 3ONEA 3PFBA 3GUVA 2FV8A 2Z5LA 5J4KA 2XB6A 4M87A 5MGBA 4C4ZA 1TUIA 1M34A 1N1MA 2JHAA 2C98A 1UXKA 4I6GA 2OXTA 1GA1A 2ATEA 2XMCA 3N8DA 1RVDA 1WZNA 3WYGA 2MYTA 5GIOE 1ZIYA 2XKKA 4OMCA 2D00A 4N54A 3RC9A 3SDSA 1EQAA 4LRSB 3QG5A 4OB7A 3UUGA 2RARA 3S1AB 1ZJYA 3JRWA 3QV1A 4LXHA 4Q05A 1PR3A 1N5LA 1GVNB 1R50A 1QM5A 3MJSA 2JJQA 1D7AA 1JBEA 3D6MA 3H18A 4PCVA 5CU7A 4KR9A 5KOYA 3EXIA 1VRCA 2HT1A 1MQAA 3WAKA 4XQGA 5D00A 5ALTA 1RKVA 3T7DA 3FJOA 4L5BA 3PCTA 1L4HA 4YTEA 4YP7A 1GZ5A 5AQ1A 2V7XA 3RFTA 4BPRA 1RNLA 3J81A 1NPTO 2HRDA 1UK8A 2CVFA 2AIRA 3GH1A 3NONA 3VR5D 2QM8A 3PXDA 3RYCB 1NXPA 4QO7A 5IKOA 2AOXA 1REQB 3BA6A 4FNOA 4BRSA 3FRJA 2B1JA 1WNFA 5AVWA 1E59A 2Q50A 2HEIA 4RK0A 1JLHA 4BO5A 4JQZA 1NVKA 1ECBA 1YRAA 3ES9A 1GNVA 3LZCA 2NVUB 5KZMB 3K70C 1SKMA 1XDWA 1RRVA 3BWXA 2ATCA 3GY0A 1F6BA 1HH4A 2O20A 2XD4A 3NANA 4O2BF 1YL6A 2I2AA 4W1RA 2OHOA 3ZZMA 4BVGA 1LPMA 2VDVE 1J07A 2J3KA 3I9V1 4EA6A 4FBGA 4CG3A 2VHYA 4L8FA 2AV6A 4RKYA 5ALOA 1NMXA 3UXYA 2DERA 5F51A 1RAFA 3C8ZA 1M2EA 4YIHA 4LN1A 3WLAA 1ZP6A 2IVZA 1KFKB 1D2NA 5CHEA 3V9PA 4IJ6A 3OQBA 1S3FA 4V1CA 4QDOA 2NN3C 2OG1A 3AFOA 3QOFA 3EFOA 4OMUA 5HBGA 2B5OA 1QYWA 1IULA 4II2A 1YB2A 3L84A 4HOYA 3TEJA 4KPYA 3QOXA 5DN6A 3B20A 4ZV9A 1VL0A 4FKMA 1L4BA 5AW4A 4A8TA 1TA0A 4BAUA 1TK2A 1TEVA 4F6LA 1MVLA 2SCUA 1Q11A 1GCGA 2NSJA 2HLNA 3I8SA 1JG3A 2BLNA 1E3QA 3I5UA 1H2YA 1HMPA 3E7FA 4JOQA 1TQ2A 2FK8A 4RZ2A 3DW1X 1F5SA 4X60A 4BBPA 4P5EA 3OSZA 1GIAA 1SEPA 3C14C 4X85A 4PVDA 3RBVA 1XMIA 5DNVA 5KYVA 2FPKA 2DECA 4I9GA 4NZPA 1XQYA 4XGKA 1LEHA 3GJ0A 4FE7A 1NNSA 3VNUA 2NTYC 4NV0A 3WNQA 3T9BA 4OYRA 5E9WA 1NXWA 5ECDA 1OGYA 2PR2A 4DM4A 4PGFA 4RHUA 2QLLA 4D9BA 4OXYA 3CMCO 1B42A 3WQRA 2JLZA 4HLUA 3FFWA 1U8CB 2HHCA 3LX8A 4F9EA 1X1EA 5KINB 3D6UA 1J2UA 1YMVA 1A04A 2IW1A 2IRWA 4X24A 1DNPA 3AUUA 3EIQA 1CVIA 1FTYA 3ZKWB 4BQOA 5B2EA 4JJ6A 5DHUA 2Q27A 3DMHA 4ALNA 5FV4A 4URHA 1ZUNB 1RZUA 2QTVA 2R6CA 1A50B 2ZW9A 3DV2A 3F6RA 2B25A 3NV7A 3QITA 4QASA 1BS1A 1QGZA 2OZKA 3DP7A 3EWAA 3IQEA 3VC3A 3NIFB 4RVOA 2CNKA 4W7IA 2OKCA 3ACCA 4GPD1 2PX5A 1ULTA 1JEQA 2QMHA 1P19A 3AZPA 1H6CA 1OAOA 4LJ4A 3SI7A 3FB4A 1PJTA 1NMQA 2JFNA 4YQYA 3F5QA 3PIIA 5DGHA 3ZHTA 3ZXYA 4EPTA 1DUSA 1GPH1 1H8ED 1KSJA 3PUIA 2VKQA 2VHEA 4KIFA 1D09A 1PTKA 1M2NA 1OQAA 3T5MA 3UJAA 3SK0A 5HK8A 5C5CA 2RHLA 4Q1AA 2EKQA 2BP7A 2W7TA 5IK2D 2IH5A 4L9SA 3HY3A 4A92A 2WIFA 4IG4A 3AG6A 1TMKA 1UZUA 1U5AA 1VLMA 1BG6A 1XAJA 1DRUA 4G84A 4R8VA 1PWZA 3KL2A 1N7HA 1XDDA 5SY6A 2VEDA 3CVYA 4QPPA 5CBPB 4S3MA 1OXXK 4FUTA 2JVIA 3UTDA 1N0WA 1VI5A 1D5WA 5BYJA 2HO5A 4R1QA 1OT3A 3I58A 1SBNE 2NGRA 5FLYA 1H4VB 4ZALA 1MAHA 1I7LA 1UC8A 1GNTA 1PQUA 2JAWA 1U1CA 4ZV7A 3I5XA 3C97A 4BKQA 1F2UA 2Q6LA 1U04A 2WMYA 1NR7A 2GBLA 4TL9A 5A3VA 1QPGA 2J3IA 3C2QA 4KV9A 5AUOB 1CFJA 3R0ZA 2C5BA 3UOGA 1Z6XA 2Z43A 4NBRA 4JC5A 4PPNA 4C4OA 3VYWA 1UC9A 4TYNA 1C3LA 2XTJA 2C2GA 3CIOA 1K7SN 3V8PA 4NPAA 1XYGA 3VO1A 4E2FA 4BNVA 2CYAA 2QJWA 1QCCA 1HT2E 2FSGA 1Z35A 2R1TB 1K5DA 3HLTA 3UAYA 5A02A 1XK7A 1YJ8A 2IA5A 1E7QA 1V7CA 5IM4A 3HLYA 3U40A 3TZKA 3NGMA 5CB4A 2HGSA 3QVGB 4MQEA 5AM1A 4N47A 4JI1B 2GN9A 3AI1A 3RSSA 2QF7A 1GKIA 2ZRJA 3GFOA 2X5XA 3H84A 3O73A 1KZ6A 2I6UA 3GCZA 4DLUA 2A5LA 3WLRA 2XLCA 4KDRA 1SZDA 4ZCPA 1WUYA 4CM3A 1P73A 1CR1A 1OU4A 2XVXA 2D1YA 4ZFNA 1EESA 3FHJA 5IABA 2R6AA 3K20A 2C58A 4JLWA 1SCJA 1KOLA 1MB0A 3PGMA 1Y7IA 5E95A 2QTWB 2AFHE 5JSKA 1XLVA 1QF6A 3JCZA 2HQOA 3HRHA 1T0PA 2R2GA 4XRRA 1OIVA 1T8PA 3ZHRA 2PRYA 2G6BA 2XGMA 3BFKA 5DNAA 2ZJ8A 4MGZR 3C4QA 1YWGO 4YJHB 3WAJA 2XTNA 1BGXT 3TB4A 3BGWA 3VR6D 2JH9A 2ZZKA 3LTNC 4TTQA 5LZ8A 4AKHA 1ZHOA 1ZUD1 1U0OC 3EVEA 4N5IX 4MHOA 1A1VA 1XTBA 4NRDA 5CDHA 4LPSA 4PYNA 3BIOA 4MVJG 4QUDA 1J24A 4RYLA 3MYYA 5B36A 4DZRA 3KVRA 1WULS 2IP2A 1MJ5A 4V1CI 4UE2A 5F4ZA 3WL4A 3ZV7A 4GSYA 2DR0A 1M1YB 1QRRA 4IOKA 4L4ZA 3RK0A 3L41A 3GFTA 3B82A 3FLAA 2WZBA 3AXSA 4LWQA 4R31A 4CYMA 3F97A 5FPHA 1OXVA 3T5TA 3RD5A 1K0FA 1FLDA 3C3XA 1LUAA 4MKHA 1A8UA 4Z86A 5JD6A 3QE4A 4YRPA 3HVHA 3MPUA 3MM4A 1HFJA 1PKXA 4NX2A 3DVQX 3SOZA 3NIWA 5ISMA 3TEFA 1F4LA 4JVLA 4PONA 2QUKA 4R0VA 3UA4A 4S04A 2N3ZA 5B1YA 3KSMA 4FCVA 5GZ6A 3BJIC 4TN5A 1JKJA 4B3IA 4FGJA 2XGSA 4FYXA 3VBEA 3KB8A 9GPBA 1WL8A 3DEIA 1W85B 4FT4A 1RW4A 4GE0A 3IDSA 1RM0A 5KU1A 2VWQA 3IESA 3B8EA 3NEPX 3ODPA 4HAUA 4NYJR 5FJJA 4ALLA 1E63A 3EA0A 4K9NA 4C6HA 3E82A 3GHYA 4NC9A 1GQ2A 2DF8A 1TMYA 2WAXA 2EP8A 2XNJA 2Z83A 4HXFB 2Y1OA 4WLFA 2IU3A 3R7FA 2O1EA 1JWBB 5JYCA 3GJZA 4N3AA 3I1IA 4QVKA 4BVJA 1YMQA 4X8OA 2A0UA 4E5PA 2VUTA 1WXDA 5KREA 1CCWA 1R9NA 4ALJA 3I6ZA 3IDOA 4PIPA 3CRQA 4MKGA 3DVRX 4ZTZB 2J6HA 2QIOA 4NCJA 4X8HA 4R8SA 2K7ZA 5LYYA 3GPCA 1JKFA 5E2IA 3H5LA 2LZ0A 1T34A 2CCGA 3SHFA 2WWRA 2FMTA 2W6QA 1F8YA 3LX6A 4KQKA 2RH4A 1E8NA 4IQ4A 2QSZA 3FVQA 3RB8A 4UATA 2YZ7A 4DCOA 4BMZA 4AY5A 2J5QA 2PJZA 4NJEA 2Z8ZA 2IC5A 2EFEB 3KXDA 4HADA 4AD8A 4JA0A 3RHSA 4HX9A 4MWGA 1EG2A 5IM4F 3V7YA 2Z95A 5CB4F 4J7AA 1YB6A 3VO2A 4F8JA 5AKHA 1KOGA 3TDKA 2P6RA 4KR6A 3E4CA 3LBAA 3Q9UA 3WDSA 3N2GA 5JC8A 1U81A 5CXXA 5TLSA 1ZR4A 1IN1A 2FK7A 5ENZA 4OQLA 5I3ZA 5H8WA 1QO7A 1R9GA 3HXLA 2V8BA 4D99A 3USCS 4JHLA 4JYCA 4L02A 4RORA 3A1DA 5KQSA 3R3YA 4JI0B 2F7SA 2IDZA 3FR7A 2ZBDA 5KAMA 4WN3A 1SIUA 3ZHXA 1B6SA 1WW3A 2H7VA 3BOSA 4HLQB 4PW0A 2O19A 2AEJA 2NW6A 3FLEA 4PSVA 4F9TA 5BRAA 4G9EA 4N3BA 1LCIA 1XROA 2BD0A 3QX7A 3FCUB 3OBIA 1Q1BA 2Q9UA 4NE9A 5DXJA 4ER7A 2WM3A 1GGVA 4XFKA 1R5JA 3G85A 3BJMA 1DBVO 1ODCA 3H3JA 4P1ZA 3OKFA 2LCQA 4F12A 2GERA 3PC8C 2GPYA 4GXTA 5J2TB 4LYHA 4JL5A 2CDAA 4UM5A 1Z28A 4K88A 3IT3A 4KL8S 4F5YA 1P1BA 1EFTA 1JKMA 2B92A 1R8YA 4TT3D 4OGGA 3KWMA 4CHGA 1BMDA 2JIQA 3IKMB 3VX3A 2G09A 3U44B 4JV5B 3ROTA 2P8SA 1D03A 3LJKA 1FZTA 2EWMA 2FUG1 3GELA 3W7AA 3WIBA 4C4PA 2WWTA 4GKAA 4FDMA 1VMAA 1AQ6A 1E77A 1G18A 3AK4A 3LQKA 4EBFA 2RHJA 3LC0A 2MINA 3EA4A 3FRHA 3P9XA 4C0BA 1NY5A 3IO3A 3LPNA 2CLIB 3DULA 4B6RA 3F8SA 3ISVA 4FLMA 4PQGA 2GPWA 4QHTA 3H5IA 3KYDA 4MIEA 2C61A 4KXMA 1ZO8A 3D43A 4A82A 5K6AA 1JZTA 2HRZA 3QKRB 4G0ZA 4PFKA 4QDXA 5TPZA 3T1OA 2X6TA 1S1CA 1CUVA 1WHTB 3B6ZA 1NW7A 1GAWA 3IXMA 4GPAA 3LO8A 1C0IA 3Q3GE 2CJWB 4QJ5A 4QOFA 4Z4EA 1CUEA 3KZXA 2CMGA 3A32A 2Y8EA 2UXBB 3SPXA 4MMZB 1J99A 4BO2A 1AOXA 2QLMA 3KJZA 3PKJA 4GR9A 3JYHA 4W9NC 1OH5A 1M0WA 4YJFB 2Z5VA 4DM3A 1TO1E 3G02A 3VJRA 1CEEA 2ADOA 3BGDA 4KQGA 4EKDA 4B3FX 3UWSA 1DARA 1NI5A 1PWYE 3FBGA 5HRUA 4J7UA 2OO3A 4U1RA 3TM4A 4MB0A 5D8DA 3T3GA 1E6WA 3QBJA 1GFSA 4KI0A 3KTAB 3N2NA 1T8WA 4MV9A 2NZ2A 4L3WA 5LM3A 3AY7A 2VUHB 4NH4A 4Y0VA 3R7DA 3DHYA 2FLVA 1HF3A 1HORA 2QU8A 4ZAXA 5CYGA 4ZVQA 2WOJA 2GBCA 1PUXA 1YDHA 2Y05A 3GJTA 4MV7A 3ST7A 5EMKA 1W581 3SR0A 2D1TA 4DT1A 4N8SA 3DEZA 1O0BA 4WWHA 3KPUA 2PKCA 3NHFA 4U6QA 1N8NA 1MD9A 1RD4A 1O6GA 1L4LA 2I76A 1U28A 1X19A 1SCDA 4WESA 1P5JA 1GSOA 1B76A 3QRWA 5CNMA 1L5OA 5LZ7A 1E2JA 4DV0B 2JHGA 8MHTA 2R79A 1QFXA 3ESBA 3GNQA 5BSHA 2QBYB 2B82A 1XRJA 1UKYA 2RGWA 3UK1A 2P5TB 1Q1ZA 3EIFA 5JSHA 3BIWA 1QDEA 2OGTA 4G9GA 1DSSG 1A2QA 5LA6A 1V6AA 1P2DA 1W34A 1XZAA 2I1VB 5KUTA 2OCBA 1DV2A 2IPOA 5INTA 5AICA 1A97A 1FY2A 3NATA 4IHAA 5FUYA 2PE5A 1Z17A 1BOFA 1GUFA 1XXHE 1OCEA 3OTIA 2PJDA 4PICA 3CIFA 3A6ZA 4ZRMA 4G1FA 2J59A 2OSBA 3CEJA 3F6PA 1DZIA 4KYTA 1OLOA 1VL1A 1QC5A 3MTBA 1J70A 1UP4A 5FL3A 4QUAA 1FYEA 4P81A 4HBGA 3KUUA 2PXXA 3K3PA 1J9EA 2O8VA 2QJTA 3C1AA 3GJ6A 2F48A 4MUBA 1PR9A 4R0NA 3SKVA 1NJ2A 3G8AA 2C9CA 3AOEC 2XKAA 4Q6BA 1QF9A 3MTQA 4XGIA 5E2BA 3REOA 4E6PA 3SICE 4B9AA 3I23A 1PAUA 2FRDA 1ZCBA 1ZWLA 2AYYA 2W22A 5DHRA 2Y1GA 4GW3A 4QXQA 4NV3A 3LP5A 1MQSA 2OLEA 5DHPA 3NV9A 2QAGC 1K2WA 3S1SA 3RSLA 4BV2A 2Z2KA 3NOXA 1EVIA 1QYCA 4BX2A 1M6VA 2OQIA 3ZUPA 2PO5A 3GJSA 3COPA 4Y9RA 2WU3A 1TJ3A 3H9CA 3K6RA 5TPWB 3U31A 4BO6A 2ZQ5A 3E9EA 4F8YA 3MWEA 4R98A 4B6SA 3P97A 4JU9A 5JSFA 3AM5A 1TKBA 3HC7A 4Q9HA 2QRGA 1QANA 4RM3A 1C9EA 3B12A 3LLCA 5HM8A 2QU7A 1WVMA 1E58A 1X1DA 3AM3A 4C6RA 1LPBB 3GZ4A 1XQWA 1NVVQ 1ISGA 2BL4A 4J75A 2NSLA 4Z51A 3DF7A 3HDGA 2I3AA 2XCOA 3DHVA 3GXBA 1JQJC 2VO1A 2CLFB 2X9QA 3N87A 3T7CA 2VYFA 3WXBA 1UBKS 4RE5A 1XQVA 5BSKA 4HH3C 4P5PA 5C32A 1FYXA 2Z1DA 3K15A 1NASA 1PX0A 3LDAA 3Q6IA 3WZLA 1HMYA 5I4BA 2YFQA 4YC7A 5KWEA 4D3YA 5E6UA 4DADA 1DUVG 4Y2PA 1Y8QA 3C7AA 1CB7A 1HWYA 2Z2ZA 3PRJA 4L75A 4KXVA 2C2BA 1C9JA 4U7JA 3SFTA 4P4NA 1KEWA 1XL1A 2P40A 1AUXA 2PX2A 1R6XA 4MVJH 3WJ1A 4QKQA 3ORFA 5EHXA 5I6DA 5JMOA 5CIYA 1BX0A 3HU2A 3Q2KA 1WD7A 4D0RA 2O7RA 3PGA1 1KFJB 4INPA 4HWPA 4OBXA 4P4UA 2YN4A 5E6SB 3U4AA 4DREA 4D9KA 5CXQA 3M6VA 5FO0A 3VOBA 4B3GA 1VXOA 3RTAA 2IXDA 2JAOA 2QRKA 2XWJI 3I4CA 3LKDA 1JJIA 1X9GA 1XSEA 3BKXA 3EEYA 3LXMA 4HF7A 3FA2A 1NKVA 3IEIA 4ZQEA 4KSCA 3X3HA 3K5HA 4AJ1A 3I42A 4QEKA 1XLTA 3CEHA 1B6RA 1DKOA 4KBGA 3VZBA 1VIVA 3IERA 5LC1A 4A0FA 2I55A 3IH5A 2E1PA 4TS1A 2O54A 1E3TA 1DC8A 3WLFA 3L0SA 4U2GA 1RMTA 4PGMA 4BLVA 2RHRA 3NQ41 3Q3HA 4I7EA 3SC2A 5H5JA 4KMRA 3EQ9A 3C0KA 1KY3A 3O1JC 3K0CA 3OU2A 4EHDA 1JHRA 3C3MA 5F7ZA 5FI0B 1YTLA 3W6OA 2ZYWX 3DT9A 4CT5A 3IBGA 3PG5A 1KVSA 4RPIA 3FKJA 3M83A 2CUZA 2C4WA 4UDNA 3HKBA 4HDKB 4GYYA 5FD8A 4BRUA 3M6XA 2Q1XA 5LA6F 1L7VC 1Q0ZA 2HSZA 4LCEA 3KE9A 4LYAA 4F45A 2BAGA 2OAGA 2G71A 3MWKA 1T4CA 1RRFA 2W2VA 2G1UA 2JLBA 3FW1A 4B2LA 4D6XA 5FIUA 1WQ3A 2KX7A 2O0KA 4ASUA 1UMCB 5ECGC 4I1UA 2WWGA 3BE8A 2AG8A 1UKAA 1NXVA 3IP3A 4WL0A 2XI4A 4DAOA 4IDEA 4UHEA 2E4UA 3D6FA 4DSZA 1AGRA 1ODLA 1UK7A 3IBFA 1DRWA 1UMKA 2JGNA 3AKCA 4RVUA 4Y2TA 2JRCA 5AK5A 2G3YA 4N18A 1GZDA 3OPNA 5D85A 3RRBA 2PUBA 3EYWA 5ESRA 3OPYA 3FVVA 2HRCA 1N2OA 3AJAA 3G9XA 3PTZA 4TKVA 4RTOA 2FWAA 4UTXA 1C1XA 4L5JA 2ID7A 3VYVA 3B38A 4UOEA 5FTMA 1XRQA 1UBLS 3PNVA 4II3A 4EO7A 1HC7A 2IFTA 1YE3A 4RIGA 5J5CA 2ZBRA 4IIYA 4JVNA 2AFVA 4JP8A 5KJ1A 2FPRA 2ZBEA 1JEEA 2W2XA 3CX3A 5AVQA 3MWGA 4LFBB 3T35A 4MDFA 3JD2A 4J16A 3CPJB 3HBNA 3OOSA 4L07A 3FYCA 4R2HA 3ZW7A 5C4MA 2PSFA 1KMHA 1Y1RA 4EB0A 1Y1SA 1SAYA 1JR3E 3G9QA 3ABOB 3QJ5A 1RLTA 4QGFA 3ZDXB 1JFFA 3ZS9A 3IR6A 4EMUA 4XKJA 4HDOB 3OM0A 5EMHA 1QQBA 1GT6A 1J7KA 2XMPA 2PAFA 3TQHA 1QMPA 4AZ3B 1K7FB 2R4QA 3HUEA 3MNFA 4C3VA 2I91A 2OBXA 4K9MA 2P78A 1KR2A 1HKUA 5FWYB 1W1UA 3IS3A 2YOGA 1SCIA 4G2TA 3G2HA 1CUDA 3UWKA 1M74A 4MO9A 3FOCA 1KQNA 3TFQA 1E6UA 4MGEA 1QMGA 3CUEF 5GJCA 2H18A 1D2RA 4I8IA 2EBUA 2BHNA 1Y7TA 3DQPA 2Z2YA 2FDRA 4YRMA 4TWZA 2QQ0A 2XTAA 3MLAA 1HL7A 2L0XA 2EQBA 5FQOA 4L74A 2QRJA 1K3FA 2EGHA 1WY7A 4UDOA 4V24A 2ZANA 3FROA 1C41A 1J5XA 2CV0A 1GAQA 1QVWA 2AZDA 4L9WA 5AW8A 4KIGA 4GOLD 3WGNA 2BMFA 4L85A 5TQJA 4REQA 3DLBA 4D3DA 4HATA 3CR3C 1C4XA 1DDOA 2XNCA 4PZDA 5AQEA 1GZ4A 1YR3A 3IKJA 1RHKA 1O87A 4IJQA 1W36B 3EXG2 4MPDA 3WGLA 4QQ8A 3HYSA 3ZWQA 4OUDB 4RQUA 3WFJA 3IMKA 3ZHBA 2DY1A 1Z34A 1KYVA 4AU1A 1OASA 2X19A 2NUPA 4LXUA 4ROSA 3U3JA 1XZQA 2XMDA 3Q6NA 2XRFA 2WJ3A 5JU6A 1NJFA 4JBGA 4MGYR 3V4PB 3O8CA 1J9GA 2UAGA 1Y4ZA 2B7BA 3JRNA 3DDHA 1W9MA 2VJMA 3UMSA 5FPTA 2JBWA 4BVLA 4AYTA 2FEPA 2IYSA 3VJLA 3GEPA 4MARA 2WT9A 2RAVA 3NM5A 3QVLA 3QF4B 4WZBA 1UOEA 2AUMA 3R76A 4ZGBA 1BXKA 4WNAB 5DCWA 4HZGA 5ILQA 1ENPA 2NUBA 1JTFA 1UPFA 5KTMA 4YXWA 4QYSA 5JSZA 3HUTA 3Q98A 2WM9B 3EGVA 5REQA 4DYHA 1C0KA 2I71A 1DRKA 2ZTHA 3Q15C 5FUMA 4I1PA 2QG4A 4RPKA 5CIWA 3W3ZB 3V34A 1FQOA 4DJDC 2GLTA 1PU2A 1PNOA 1XZCA 5AVYA 4UFNA 5H3LA 1WB4A 1YIAA 1B14A 1S3GA 2XWBF 3TTUA 3IAAA 3HP7A 2JKVA 1M2VB 2J0SA 3L6DA 1HYQA 3ZWPA 1UH5A 2VNSA 2EP7A 3CNHA 3ROZA 2DCMA 4U7PB 3CHYA 4K6GA 1EM8B 3SHOA 3UENA 1PYOA 4OU5A 1ZH6A 3HZOA 4A6XA 1IPHA 4NIMA 3EA5A 2X0EA 5JALA 1JS1X 2PY6A 4INJA 4K26A 2QI9C 3H4IA 1GITA 1NUAA 1U02A 1WMBA 5F3RA 4U9HS 5EZYA 1VYTA 1PS8A 4ZOQI 5IAAA 1C9KA 1E66A 2YZMA 4PSDA 4ZOLB 2O23A 1ATZA 3LW8A 4ZOBA 4OV6B 3C5EA 4WX2B 3U09A 1E61A 2HY7A 3QP9A 2I87A 3O83A 3S28A 3Q8MA 5K03A 3TSCA 2D06A 3Q3EA 1QPBA 3JQCA 2RBEA 3BEOA 2GAOA 3BIFA 3CR7A 3A9SA 1OKKD 3F3KA 2R6ZA 5E0KB 5HR5A 1P4AA 2ZM6B 5LKRA 1Z4PX 1ZNYA 3A6EA 3RPEA 3WL6A 4TWBA 3BMCA 4S1TA 2CD7A 1C4WA 5D6OA 1UL1X 1IE3A 4FW9A 4MW9A 1CZNA 5DN6D 2XDWA 3L7BA 4CKXA 2RGNC 2A59A 3KJHA 3M49A 5JOQA 1T2CA 2CXSA 3OT1B 4E5SA 5ADVA 4UHCA 5C5EA 3DT8A 2NU6B 3KALA 3OPYI 4Q4AA 4S1OA 3HDVA 1CT9A 2BM8A 3JQEA 3P0FA 4JYBA 1DOZA 1HFEL 1XHEA 4HHEA 3K96A 4YVFA 5JS7A 4UD2A 2Y66A 4D4HA 1WSWA 1PTJC 4W1SA 1JQKA 3WKDA 3QV2A 1EXNA 1Z38A 2GCEA 2FJ0A 4OHZA 5IJAA 5U9CA 3WWCA 1BH6A 1LX7A 4AO6A 1WBJB 3GGGA 3L4EA 4CETA 1TMOA 3EFEA 3G8YA 3RVSA 2AMFA 3VRHA 4JJFA 1RJEA 2HLDD 3QHQA 1V25A 1E0SA 4MEBA 1Z88A 5H9WA 3JD3A 3EXFB 1R0CA 1R27A 5B3AA 3R6DA 1E3LA 3IMGA 3H7IA 5KKCA 4EIWA 4UVHA 3H65A 3S2UA 3UW1A 5G1NA 4O4IB 4MH0R 4R1MA 2VA8A 1CUJA 5ADWA 1CB0A 3P2MA 4LYJA 2Q3FA 4RIFA 1RACA 3PR2B 4CG2A 4UBMA 2VS1A 2P4HX 4CIVA 3I61A 2SHKA 3KYJB 2I66A 5KQPA 1GPKA 2H1CA 3A1EA 3MHPA 4UM7A 5E8JA 5JRJA 5BSRA 3GNTA 4JUIA 4OGLA 4G6ZA 3LBFA 4NULA 5TVGA 1RI3A 1QIDA 1XK6A 3BG5A 4TUYA 4OQYA 2BWJA 3D2AA 3I28A 2PFSA 3SHTA 4F60A 3OU6A 3WGJA 5FWNA 4RS4A 3B6EA 3EE6A 3GLIE 1PR2A 1VL8A 4DMFA 5G2OA 3PX7A 2WWYA 4EPXA 1VYVA 2A0FA 3MTJA 3OOYA 4XXHA 4EGFA 1V8DA 2YVUA 4N5DA 5HF9A 4C30A 3T38A 1V9LA 3MEQA 5BQXA 3B3GA 4IZIA 3KAQA 3QSGA 1MO4A 3I0NA 1FFEA 1OREA 3BD8A 1JDBC 5K8VA 4HGYA 1OFVA 1JILA 3D2LA 1H6AA 1Y8RB 5HZMA 1XEXB 3I73A 4ETMA 5KYTA 4GL4A 4OLHA 4BNYA 3NDBB 1DIAA 1JU3A 3F7TA 3EZ9A 3GRKA 4N39A 3FYHA 1BVHA 1MU0A 1R4NB 3L5OA 4HX2A 4LGVA 4EDFA 5JUWA 2VSNA 1RHRA 1LRLA 5JLAA 2JFFA 4EB6B 1KH1A 2ZEJA 1IH8A 1WETA 1J1IA 3WTCA 1U7OA 4O8ZA 1U9IC 4IDQA 4M98A 3L79A 3CEAA 4HNHA 2AQIA 5C4IA 3Q7SA 5EZYF 4AS1A 1LFDB 1P1IA 4PGAA 2ERXA 1YFLA 4OJKA 4WXYB 1CY4A 1K9VF 1EUYA 2P11A 1FFCA 3RASA 2FPSA 2H0AA 3IB3A 3QELA 2H4HA 1CUBA 1PBNA 1LPOA 2A5GA 4CEJA 4KXXA 3JXEA 4WKCA 4YIKA 5LZ4A 1T4MA 1PS9A 4LF7B 2X0NA 3R7NA 3V42A 3BCSA 2YINC 3VUEA 4NJMB 1UWCA 4OVKA 2FWPA 3OHPA 3LYUA 3IULA 5E1MA 4WCFB 5BVGB 2RG7A 4EG1A 2RGBA 4OSPA 3ZCPA 3JQAB 1MQ8B 5HXAA 5LQRA 1VSVA 4P92A 5BWLA 4Q9AA 1Y3CE 3C7TA 4MIYA 3LRXA 4KNYA 2REBA 3A4IA 1ZA2A 5ER6A 5EJAA 2IWHA 1TTTA 3NP7A 4P08A 4IS3A 3S1AA 2EQAA 3DTYA 3RM3A 5SZKB 2WUVA 3H2SA 2BFAA 2F1OA 4IUYA 4J94A 5F35A 2PBRA 2FE4A 1SIWA 5AK0A 4EL0A 5LUAA 3BSSA 1OXUA 1PVDA 1Y4AE 1XL0A 1ENYA 2IP4A 1O6CA 1VL5A 3GLIB 1GUDA 2JGEA 1CJMA 2P3SA 2YL2A 2XT0A 4F3RA 4ZMBA 4XQEA 4P7BA 4A91A 1QK5A 2XXBA 3CY6A 3JZDA 4WEOA 3P9KA 3A7EA 4FFBA 1QOZA 2DHCA 4MKRA 1B8UA 2WKSA 3CUSA 3FVRA 5BV0A 2BCEA 1CZLA 1ZH0A 3WP1B 5JMTA 4X62B 2P9ZA 1Y48E 4MLPA 3AIOA 4EHBA 3SZ3A 3TLZA 3AINA 3LWZA 5F77A 1DAPA 2NVUA 1JDNA 5KHOC 1AQYA 1IY2A 1Z22A 5JI3E 5DSZA 4TX1A 4RMIA 3U3KA 1B23P 4H60A 2O2JA 4A0RA 2R8YA 1NYRA 4HMOA 5DV9A 1TIPA 3MA0A 3R0IA 2H1OA 3SEAA 1GR1A 1YIDA 4PLWA 4NLLA 4L5IA 1JECA 3NC1C 1ZEJA 3INNA 4QLOA 4TUYF 4F93B 4RMJA 1ISFA 1V1MA 4F91B 2ZJ0A 1R64A 3T4UA 3TOVA 3AB7A 2Q07A 4O29A 3SF0A 4RYDA 3ICPA 3PEFA 5JH7B 2H1IA 2HBRA 2V5UA 3ILSA 2NUTA 4WXPA 3R3JA 1U3UA 4PC7A 4Q9LA 1NG1A 2CN1A 2VKTA 2F8SA 4B85A 1FSSA 1UXOA 4NNJA 4GPIB 4CQMD 2D0PB 3G0BA 2Q8NA 1QIMA 3AZQA 3DC7A 3UB4A 2JJ2D 2XW6A 4N0QA 1MJGM 1IAQA 5JZMA 1BFDA 4G5OA 1MT3A 4AWAA 1MC8A 3IQFA 1GQFA 4MKFA 3QUBA 4EFLA 2VNHA 4ARZB 1LDEA 5DULA 1PZEA 1WSAA 4YDHB 4ESOA 2X15A 1K88A 3VNAA 3HN2A 4C7XA 1V5IA 5HZHA 3QWHA 4J7CA 3T52A 5IDQA 2O50A 4J6EA 3MJHA 4QUKA 4XUGB 2CL0X 4LRQA 3X1KA 4EARA 3GBPA 3ZPXA 2QUAA 4TS4A 1DKUA 2GH1A 3E8SA 5KSZA 1UFQA 4R6WA 1A71A 5IKPA 1THGA 4CNBA 2C57A 4Q4LA 4RD1A 1RT9A 3W5CA 4GX2A 1ZG3A 1P4RA 1TUGA 1VXRA 4LECA 4NG4A 4PPQA 3T7SA 5G3ZA 3ZKWA 3QYAA 2DLNA 3M0EA 1LFAA 4QLBA 3H1AA 5LP6B 2NV0A 2QN1A 4HAWA 3V1KA 3YASA 1CJTC 2BFOA 3ERCA 1FRZA 3L1HA 1XZIA 4ECAA 4M89A 4EPWA 1WPRA 1T8TA 3I8OA 1KFBB 3CJRA 5EMMA 5K1ZA 3CJQA 3TKAA 3ZHVA 3BS4A 4C6TB 1KERA 2Q2NA 4Q34A 3O8NA 3PJDA 3ESCA 4OFWA 1JVNA 1GUZA 1BS2A 4DLTA 1W5EA 3P19A 2X3FA 4K28A 2AXPA 4XW2A 1NYTA 3KEFA 3ROMA 1P31A 5H02A 3HCCA 4LHVA 5FUBA 3U2QA 1XIVA 3SZOA 4NXMB 1MX5A 1CK4A 1EMDA 3ZTWA 2Q4OA 3Q5EA 1FUKA 2AJBA 3HUFA 4HO1X 1L5SA 1NZJA 4EK9A 1F17A 4PRLA 1XB2A 3AJEA 4ED9A 1KMNA 1VGVA 5AM5A 1XRLA 1RABA 2G1PA 4QJ4A 3MYRA 4F5ZA 3PC2A 4FTWA 3KKLA 4GOOD 5CBPA 1N2SA 1PSDA 4CT4B 5IJZA 4CCYB 3DL7A 1IWPB 4W9RA 4P98A 2NMVA 5ERGB 3L8MA 4PANA 4CGYA 4XD2A 1RYBA 5G1OA 1ANKA 4ETIA 2WNHA 4CF3A 4MO2A 2XA2A 2HMUA 2Z4RA 3A1FA 3D8UA 1EE9A 4GX0A 4IVNA 1Q0SA 4GKVA 4U8HA 3VKGA 4UARA 2OD2A 1LQ2A 1WZEA 4LMBA 3HM2A 3OQ1A 3RHTA 3ZIAA 5FA5A 3QPAA 4ZRDA 3W2EA 3FYUB 3X1DA 2EU8A 4RH1A 3FNBA 3OZVA 2IYAA 3ZQ4A 1KO7A 4K9SA 3E5HA 4B4VA 1EXWA 2Q3DA 4WXMA 1MVOA 2OCLA 2O57A 1FYFA 2H9YA 1C7FA 3NTOA 2R1TA 3DCYA 3D6TB 3FPLA 4JP2A 4LDZA 1Z2AA 4WUTA 4YV0A 3NPAA 5TPZD 4UKDA 5CBKA 5J4YA 4BCCA 1K7CA 4FCWA 4L1KA 2C1ZA 4DR6B 4RL6A 4DRYA 3I6IA 3AL0C 4JLAA 1GWNA 3II6X 4ZCQA 4B84A 2AZTA 2ZR0A 3RRNA 4S05A 2ROQA 4JKIA 5B58T 1MZPA 1BN6A 1SVSA 3KPVA 1PGOA 4AWBA 1PF7E 2YQZA 2PNJA 4BB9A 1TCVA 3E9NA 1XCJA 5C5IA 1ZKDA 3RV3A 5JFTA 4HUJA 1AQJA 1K86A 4OIMA 3RRXA 3FTQA 2KPOA 2PAAA 1IDOA 3S7ZA 4CMIA 4LJ8A 2X1VA 5JCOA 1L7MA 2FA9A 4MJLA 2J6IA 4AY2A 1TGVA 3GA7A 2FZ5A 5ELXA 4D25A 2W9XA 4D41A 1PR4A 1H0KA 1Z06A 2L42A 4QDJA 3VHXB 3T1TA 5IRCD 4YJHA 1NUTA 1V48A 4HVLA 2QG9A 1TUBB 4UD6A 4QD3A 4YLGA 3FYSA 4MWSA 2BMJA 1Z6QA 1GG2A 3DYBA 3LPLA 3ZWWA 1OXTA 4AJHA 2G7ZA 3UJDA 1F9EA 4EHFA 1EFVA 4EG5A 4XWKA 1PHRA 2G06A 4FFDA 2O2SA 1UPXA 3ZE6A 5KSWB 1SD2A 3RNOA 4M21A 5F2NA 2ZRFA 3BERA 2XIQA 3GROA 2NZVG 4RVNA 3OKPA 2Y2VA 3I9JA 1VG9B 1ZVMA 3PPWA 4G1VA 4JQCA 4XE5A 3RSGA 3EBLA 2UVDA 4WK2B 4XWGA 3VV2A 1M1YA 3AR9A 3K4HA 4URUR 2HWXA 3G5UA 3WWPA 3H6KA 5FPKA 1L4KA 5ALWA 3QYFA 3VC2A 4BN4A 5KNDD 5EPOA 2D1RA 1R0BA 1TW2A 2WE8A 4RV5A 3DO8A 5HCNA 1O4WA 1XT6A 2BFWA 1CY8A 1P1JA 3PS9A 3QTBA 4KQEA 3QWAA 3VJMA 4B8ZA 4BQPA 3K0FA 5I9LA 4CTOA 5JZ9A 5BW5A 3INGA 1FTNA 1X2BA 3WA6A 3EGXA 1PEAA 2D2XA 2GK6A 4DLVA 2WFMA 1DG3A 3AV0B 5EKXA 1OAOC 3M82A 2G4CA 5E8RA 2JK1A 2VI5A 1ZEMA 2IEIA 1ISMA 2PGNA 3UWOA 1W85A 4TL8A 3JWEA 3U62A 2XBMA 2D0DA 2ZXFA 5F1KA 1OGIA 3S44A 2R9VA 2KLBA 1YKSA 2CXPA 1JJ7A 4PAMA 4WHMA 4XQCA 1IG3A 4XEHA 5AI4A 2J7PD 3RK1A 1RRPA 1YB4A 4Y6SA 4F2PA 2DTDA 1K7YA 4YR7A 5T7BA 2ZWOA 4ZVVA 3KQMA 3V2IA 4YRQA 4AYXA 3EPHA 1CJBA 1FNCA 2OUIA 3HXPA 2ZKIA 3D2CA 3GJ7A 1UDBA 4PPFA 3AEYA 3HUUA 3TFWA 1S3IA 3NVAA 5T5QA 1LQTA 3VI3B 2ATIA 4OI2A 1P0PA 3U7EB 1BS9A 5A4KA 3PFCA 1G8AA 4NZMA 4O1HA 2IV2X 1LJ8A 1MB4A 2IVFA 3L0CA 1O8CA 1ZI6A 2O0LA 4GC5A 1VFNA 2CLMB 2PPLA 5EXPA 5G0VA 4I4LA 3HJFA 1WXFA 4QARA 1DADA 1FXWF 1QDLB 3LLVA 2OLKA 4ZJUA 5HJ7A 2IYTA 3KB2A 5D3MB 3K1AB 3E1GA 1XZJA 1N36B 2YQ5A 4W5HA 3QLUA 2P4QA 1NVEA 2Z6QA 2VJCA 5JY6A 4E11A 4UAJA 2R8BA 4L0DA 1I7SB 1IBMB 3G1WA 1CG6A 4NI5A 4ABTA 3AU9A 2HSJA 3HXQA 1NUQA 2GGSA 3JQFA 1FXUA 1DB3A 3ZLJA 3LUFA 4MQ5A 2YV1A 2OHFA 3HEMA 4LF5B 4R41A 3JSXA 3QPVA 2YHUA 2R6R1 5B55A 2B7LA 1YS9A 1AN0A 2NV6A 2VDRB 3HU1A 7AT1A 1Q17A 5BQPA 5IASA 1FFYA 4A7PA 4ZI2A 1FMJA 4Z8XA 5KYUB 3MAGA 1UANA 5ETJA 4MRSA 5C8VA 3ZGNA 4EW3A 2J3QA 1SCUB 1R5OA 4R4JA 5DVZA 3U7GA 3LYAA 2A35A 1I5RA 3V7FA 3THWB 1UODA 2BH2A 1PS0A 1YGPA 4KG7A 4ZARA 2F64A 1FLVA 2QJOA 3TNFA 4DV1B 1DG1G 5JBIA 1VZ2A 4KAAA 2PPVA 4A16A 7MHTA 4PYLA 3IODA 5KI6A 2WUGA 1QHEA 5HTOA 2XPCA 2XUDA 1KBZA 5J2TA 1G66A 3EQ8A 3H8WA 4H7DA 4PV7A 2QM3A 4DKJA 1NW4A 3LT5A 5T4FA 721PA 2IYLD 1LS1A 4Y9SA 4M0FA 5C2JB 1A9YA 4C21A 4ZMRA 3U44A 2ETXA 1VTKA 3BGSA 3H19A 4F5EA 1NURA 3GFBA 1UXHA 3PKZA 1VLLA 4QO8A 4XIJA 5HEKA 4DUZB 1SUAA 1J4AA 1O08A 3F1KA 5E3JA 2XH8A 1HR0B 2V7WA 4Q15A 2QVCA 3HJNA 4QTXA 2OPHA 3O8OB 4CIDA 4IUBS 3RVKA 4MRPA 1X3LA 3OESA 4ID9A 5CX4A 3D31A 2J67A 2H2GA 1W87A 1K3TA 1U1GA 2DT8A 3QKRA 3QUAA 4ZZ0A 1QR2A 2AK2A 2EARA 2B4QA 4GT1A 1L4UA 3H1FA 1PGNA 1SB8A 4OQMA 4UEOA 1PVOA 4ENSA 1NTOA 1JU9A 1IAVA 1L7OA 3JAWA 1DEHA 1SUBA 3PUKA 3ZBPA 1YZNA 2HK8A 3BXHA 1L8XA 4PX5A 3HUDA 2C4MA 4Z9AA 4J9UE 1JMYA 1CZRA 4WVLA 1PL8A 3PFIA 5CYFA 4AG5A 2FWJA 4DQXA 3QU2A 3PXXA 3PQ2A 5L51A 1ARZA 4YJFA 3UCXA 4Q3AA 1Z5NA 5EHNA 3HZZA 1R2QA 2X7XA 1EQUA 1KMCA 1RJGA 4LXIA 1RPZA 1XU9A 3D1JA 4JKOA 4C0AC 2BI7A 4G24A 2FG7C 3MT8A 2Q9BA 3VX4A 2AF4C 2VQSA 5DOZA 3L06A 2V4ZA 2R5WA 3X43A 4KXNA 3GJYA 1HO3A 4M54A 2YHBA 3IEXA 2YOFA 3KTAA 4BV9A 2ISCA 3BAZA 4FZVA 4A6EA 2CB0A 2IXGA 4B0OA 1HLFA 1EFPB 3B1FA 1LTHR 3VKFA 3V1LA 2EBFX 2HA5A 3D3WB 3FJYA 2C3MA 4ZYYA 4A4DA 2X0FA 3UAGA 3DW3X 2W70A 3VR1A 3ITDA 2DY0A 4LRXA 3L1UA 1FPMA 2XRYA 2ZJAA 2VUIB 4OBBA 5EZSA 3VKUA 4C78A 3BXPA 1I32A 5FTKA 2E0IA 5FEMA 3B1VA 5J47A 2CV1A 1GD1O 3AHFA 3M6IA 1Y5MA 2AT1A 3ID6C 3C6YA 3DZGA 3X1XA 2DEUA 1VCOA 4GSKA 4AZVA 2OCGA 3HSYA 1X74A 1UBFA 1NOKA 3DBLB 3RAPR 3A25A 4LCJA 3WGVA 1IUPA 4GPZA 1U6KA 4WLEA 5AI5A 2YJGA 1X7XA 3PNYA 1N0UA 3I2JA 1NU6A 1BYIA 2AOWA 4B3CA 1J0AA 1FU7A 3LVQE 1WLSA 4DN6A 3FVWA 1Z7YA 2DQYA 4YDSA 1J0BA 1FSFA 2VZEA 3RI3A 4DLZA 5LBIA 4GMFA 2Q7DA 1SMKA 3QXXA 1RU3A 4LMPA 4ND7A 2X5JO 4U6SA 3ROPA 4V0ME 1EFCA 1JDZA 1N6HA 3T0FA 4EHNA 4F3YA 1J8VA 4H0FA 3T7TA 2JBHA 1JBKA 1P60A 2AVNA 2RHCA 3ELBA 3IOCA 1WDWB 2B4AA 5EZ5A 4C7MA 1EE1A 1FDOA 1K8QA 1ZUWA 5IBCA 1GVHA 5J2TF 2WYVA 2H4JA 3VYSB 2CB9A 2ONCA 2Q21A 2HZBA 2PLAA 3D7LA 3F90A 3IT2A 5CEFA 2Z09A 2VT6A 3L8CA 1F2TA 3C1UA 5AKZA 1P4HA 4OFXA 3PRHA 2GCOB 4JLMA 4DJJA 3CB2A 5LQUA 1GTG1 2HHJA 4WADA 4QU0A 4YAEA 3UA3A 4E7PA 1JLLB 4DNFA 5K3AA 4HN4B 3HU3A 1PV2A 4WFJA 1QFZA 2OO5A 3ZWXA 2CWWA 2PBZA 2V5AA 1AUPA 1Y9ZA 2ZYAA 4ITVA 4JKYA 5DI9A 2IZ0A 3PGJA 5CVTA 1J25A 3N0RA 4I1VA 4RTJA 4NARA 1YXMA 5JNVA 5JPIA 3TIVA 2OD9A 3FGOA 3C3EA 3ZK8A 3U7QB 1HDIA 2RHWA 4ZDKA 4RHXA 2VSQA 3LW7A 2B34A 4UPVA 1BHJA 3KOMA 2JGJA 5IDYA 3D1LA 3WNVA 3WQBA 2A9OA 2PX6A 2AD5A 3DLPX 3FM9A 4KQHA 4L15A 5JS8A 4YUWA 1H9CA 2PMBA 2LR0A 5TJHA 3T3HA 1T1EA 4YXWD 3A0RB 2VTKA 3SXJA 1J0CA 5K6AC 2E18A 1NLFA 2D1QA 2ZPTX 2GDZA 3NHZA 2ZIVB 3IMEA 2V9PA 3EPKA 1XRPA 1KHTA 1GRVA 3OQNA 4AMYA 2AI1A 1KRXA 1HDOA 1OI2A 4XSHA 3RUPA 2GAIA 3GVIA 1EUQA 1ECCA 1T29A 3N0XA 1H93A 4R9UC 3SNKA 2R7AA 4GH5A 2VNKA 1W76A 3OF5A 3QFTA 3RT1A 3U1VA 4IVRA 1QQ6A 1YJQA 4ZDJA 2PWAA 4OX9Y 3MK31 3V1UA 4Z4HA 4ZC8A 1Q84A 3VNSA 2PH3A 2DSTA 4MS1B 4X92A 2Y6UA 4K6FA 4CFYA 2NG1A 2I54A 5E6SA 5EFOA 1LGYA 3V6MA 1XXHA 3VYTB 4ANFA 1FFSA 5K0TA 4M1ZA 5DKFA 4RKWA 1U8FO 3U17A 4EECA 1E6MA 1H9BA 2G1AA 3I05A 3KDAA 3Q3CA 2BSXA 3QIAA 4LYEA 4RHCA 3ANXA 2XZDA 1KWGA 5A3QA 1S2LA 3ZDEA 3VH1A 5THKA 3L0DA 5AH0A 1IXZA 2JS7A 1KEEB 3MGCA 2VUSA 4G0PA 1VMDA 1HOXA 2Y1FA 5LQAA 1CUWA 4MQFB 1UADA 3ONFA 2FZGA 3G89A 1EEXB 2UXDB 2RBKA 3ICCA 4RY9A 3DTVA 4M55A 5DLPA 3V1NA