1KQOA

Crystal structure of nmn/namn adenylyltransferase complexed with deamido-nad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
233
Chain Sequence
EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEAAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
publication title Structure of Hhuman of Nicotinamide/Nicotinic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 233
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1kqoA00
2PZAA 4QBTA 1IH8A 2WQ7A 1TYBE 4AQ7A 3COVA 4EG6A 3K32A 3FETA 1O94C 3GLVA 1QU2A 3PRHA 1FYDA 4G5YA 3IMEA 4YMIA 3H97A 1Q19A 2EL7A 4MW9A 3IOCA 2QJOA 4S1OA 3Q10A 3CVVA 4MUGA 5DASA 4ZCQA 3OP1A 2A88A 1O0CA 1WXIA 3ISJA 2DR2A 4F3RA 1M8FA 4EG3A 4KR9A 1OBCA 3HGMA 1M8GA 3SZ3A 1O5TA 3ZXSA 4DDMA 3AFHA 2YWBA 4XFDA 5K0TA 2ZUFA 2ZP1A 4I6EA 5H16A 2WB2A 2DUMA 1EJ2A 1H3NA 4MWBA 2J07A 4J75A 1NUSA 2GM3A 3X1JA 2IELA 1O96B 1J1UA 4ZT4A 3D6VA 1TYCA 5KWVA 4WSOA 1OWLA 3RHSA 1Q77A 2X3FA 2XRYA 1EFVA 3GMIA 1G8GA 1O95D 4R0NA 3IH5A 3H9CA 3G6KA 1XNHA 3RJZA 1N2GA 3UY4A 4A91A 2C5SA 4EG8A 4ZT5A 3DPIA 1CT9A 1YUMA 3FOCA 4UZFA 3FNRA 1EUYA 2YWCA 1JEEA 1JIJA 4KPUB 3CLSD 1JGTA 2DXIA 2E18A 2HMAA 4HJXA 1F7VA 1COZA 2A84A 3Q4GA 1Q11A 1IRXA 1NP7A 2CYCA 4QREA 4EG5A 3OTWA 1Y42X 3PNVA 1MC1A 1O97D 1NUTA 3MMXA 3FH0A 3A2KA 3CLRD 1IFXA 3TS1A 1EE1A 1PFUA 3C8ZA 1NUPA 3L92A 5F23A 1JECA 1WOYA 1U7XA 2AKEA 2OV4A 3UOWA 1XNJA 1O6BA 1EFPB 3AKZA 4MW6A 2QTRA 2X0KA 4JXXA 1J1ZA 5H7XA 4DLPA 1T9GS 3DV2A 1K4MA 4NAUA 1VBNA 3SEZA 1VBMA 1JZQA 1XNGA 3FDXA 4ZT2A 2QUJA 1S4MA 1G8HA 1KAMA 3JXEA 2D54A 1QNFA 2Z09A 3AG5A 3VU8A 2A4MA 5HG0A 3SYTA 2YY5A 1T9GR 4F4HA 1YIDA 3P52A 3RBAA 1N2HA 1JHDA 3LE8A 1PFYA 3ND5A 2QUIA 1MAWA 4MW1A 3A4IA 2GKSA 2VTBB 4JFAA 4YP6A 3IDFA 4MULA 4MUFA 3Q12A 3BL5A 2JAXA 2NSYA 1I6MA 1MBZA 4MUEA 1ZJWA 1LI7A 1D2RA 1O96A 3SEQA 4BWVA 4E1AA 4MQ6A 1DNPA 5TS2A 4U8HA 3IUBA 1G59A 1KH3A 1MB2A 1IHOA 3ZIUA 4YP5A 2DEUA 1F7UA 4YP7A 1ULHA 3H99A 1H1TA 1O95C 2PG3A 3LOQA 2ZUEA 4L2IB 1QU3A 4K03A 1JEDA 1YUNA 2YXNA 4EG7A 1NSYA 2H29A 2IP1A 1OWOA 1QRSA 2CSXA 2D13A 1N3LA 3TQIA 4KPUA 2DETA 3ZUGA 2RD2A 1NUUA 2E0IA 3P0IA 1X6VA 3CLSC 3DLAA 1N2OA 1HYBA 3GUZA 1B6TA 1OWNA 3MXTA 2PFSA 1M8KA 1PG2A 1V47A 3IOBA 4TS1A 3IMCA 4NZPA 3UC5A 3IVXA 1OBHA 1O97C 3VRHA 3H9BA 3FY4A 4Q16A 1KP2A 3CLRC 1U3DA 1N2EA 1JZSA 4MW0A 3RK0A 3CLUD 3N2YA 2EJCA 3KT8A 2QJTA 1EUQA 1IVSA 1BS2A 4OUDB 1ZUNA 1N1DA 4HJRA 5FO1A 4CQNA 2PIDA 1I6KA 2J4DA 2PZ8A 2A1UB 1KP3A 3IVCA 4MWCA 3CVUA 4QRDA 1VBKA 1YULA 3G5AA 4GU5A 2BTEA 3K9WA 3SP1A 1GAXA 1T6XA 2D5BA 1M8PA 1TQ8A 2CT8A 2CYAA 1Q15A 4NDAA 1I6LA 2A7XA 3HMQA 3QE4A 4WNYA 3ILVA 1MAUA 1NYLA 1KKUA 1MB9A 1N2IA 1WZ2A 1ZH6A 4DDKA 1IQRA 1I2DA 2NZ2A 3N9IA 3HZRA 4DDHA 2HZ7A 1M8JA 1OWPA 2VXOA 2J08A 4RUKA 1KQPA 1H3EA 3NBAA 4GRIA 3KT6A 1PG0A 2QJFA 1R6UA 2WQ6A 1TFUA 2QUHA 4MUIA 3N8HA 1NZJA 4JYZA 2Z3VA 2GOYA 5TEWA 4EG4A 1QRUA 3F3MA 1PFVA 1K92A 1U0BB 3ELBA 1ILEA 1WXEA 5FNZA 3X1KA 3HV0A 4EFKA 1GZUA 4MW7A 1N2JA 4MVYA 1G8FA 2IJGX 4H3SA 3HL4A 1K97A 4PBRA 4YBRA 3AL0C 2CFOA 1MOPA 3U1VA 1JILA 3MUEA 3X1MA 2X1MA 1UFVA 1KR2A 3H05A 4CDNA 3G59A 4MVXA 1FFYA 1WKBA 2HGZA 2JA2A 3FI0A 2X1LA 1EFVB 3UK2A 3CA8A 3FWKA 3FHJA 2CV0A 1R6XA 3ZXIA 4R2MA 1H3FA 4EG1A 4MW4A 2J5BA 2XRZA 1N78A 3CLUC 4OUDA 1MRZA 1OD6A 4ARCA 1YI8A 2R5WA 4NX2A 3IVGA 5J59A 4KR6A 3QTBA 1T6ZA 4ZT6A 2PXHA 3PXUA 4AS1A 2JANA 2QUKA 5DK4A 3A04A 4MWEA 2E89A 1PFWA 3VGJA 1T6YA 4ND7A 1QQTA 4P2BA 1YIAA 4CT0A 4ND6A 4PBTA 1JIIA 1MJHA 1JIKA 3PNBA 4XFJA 4FZJA 4MUJA 4ARIA 1WXHA 2A86A 4MWDA 1QJCA 4HK4A 5EKDA 5JBNA 1KH1A 1VLHA 3QTTA 2V0CA 3COWA 3TZLA 3TZEA 2CUZA 2TS1A 2QTNA 1GTSA 1J09A 5KCMA 1QRTA 3KFLA 1KH2A 2I1LA 3P0HA 3N05A 1SURA 4R2LA 3IUEA 4I6JA 2WSIA 4ZCSA 1O0BA 4OJMX 2H2AA 1NI5A 4JZYA 4RPIA 3DO8A 3ZJTA 3TNJA 1KQNA 4MW5A 2RE8A 3FIUA 4MUHA 1EFPA 1N2BA 4NAHA 1WY5A 2CYBA 1OWMA 1KQOA 1X8XA 5LM3A 2AG6A 3SDBA 1F4LA 5BNZA 2QTMA 3HFJA 2CV2A 2A1TS 1V8FA 1A8HA 5TEVA 4MUKA 5LFAA 1QTQA 5DB4A 2AZXA 1GPMA 4HPWA 1EXDA 3AG6A 1XJQA 1KORA 5LLTA 3FG9A 4J76A 3KT0A 4UZEA 4DNXA 3KT3A 3MLAA 2A1TR 2Z08A 3COZA 1GN8A 2O5RA 1RQGA 1NUQA 4DE5A 2VTBA 2CV1A 1ZH0A 2V0GA 1LI5A 1O94D 3AIIA 1R6TA 4ZT7A 1NURA 1K4KA 4EGAA 3LCJA 2G36A 3UMVA 5HUJA 1N75A 3CLTC 4PBSA 2E21A 3P0JA 1N77A 1LW7A 3ND6A 1VL2A 1J20A 2J09A 3IOEA 3NBKA 2PZBA 3SZGA 3A05A 2O8VA 2B7LA 3ZJVA 5J5AA 3CVYA 4ZT3A 3RFFA 4L2IA 1GLNA 1U3CA 3I05A 1WQ3A 4PY2A 1M1ZA 1P7PA 5IJXA 3S3TA 4EF6A 4G6ZA 1WJGA 3NV7A 4ZCTA 3CVXA 4MVCA 3IODA 5KHAA 4I6GA 4MUNA 4G5FA 3TQOA 1WXFA 4MAFA 1F9AA 4XSVA 3E27A 1JMVA 2DLCX 3M5WA 3ZGZA 4MLPA 3ZJUA 1J21A 1KAQA 3COYA 1TYDE 4CDMA 5AHWA 3CR8A 1WQ4A 1IQUA 1U7DA 3IMGA 4U7JA 3CLTD 1GTRA 5HUHA 2BYTA 3PNYA 4U63A 4K0RA 4MW2A 1TYAE 1M83A 4MVWA 4ZCRA 4Q93A 3CVWA 5K0SA 4KKVA 4KR7A 1J70A 2A1UA 3MLBA 3ND7A 3L93A 5DEOA 4DJAA 4JXZA 3D6UA 4X0EA 2OQ2A 4NATA 2DERA 1WXGA 4ZCPA 5TGTA 3INNA 5IHXA 1IQ0A 2DPLA 5FO0A 3RK1A 1TEZA 5J58A
chains in the Genus database with same CATH superfamily
3JPYA 2OVBA 2B94A 4WKGA 5K3CA 3ZQKA 1IH8A 4RTLA 1U7ZA 3KSMA 1C3EA 4PLVA 1USIA 3BG5A 3NJ8A 1T9HA 3TRIA 5EEGA 1DXHA 1R8SA 3RS2A 4CQMB 3E9QA 4FP9A 1TKCA 5J4HA 4ENWA 5L9AA 3W5BA 4Z4FA 3I62A 1QGUA 2GJ9A 3PF9A 3BMQA 5AKJA 2J85A 4ANFA 4MR9A 1VCNA 3OLXA 4MKZA 2Q6KA 3GXBA 5ECGC 4WV3A 2FEAA 5AHKA 4DKJA 2PCJA 4P98A 3AHJA 2WVGA 4M8IA 4R7TA 4X1YA 1E2QA 5FUMA 4BLOA 3EY9A 1DC7A 4IILA 5IBQA 1H5UA 4WNAB 4CRWB 1DJLA 3LPLA 1P2TA 1TQDA 1VA4A 4RK0A 3KR9A 4ZIRB 1SMKA 4IDAA 5DULA 3QG5A 5G1PA 5AXAA 5C8DA 1EJ2A 1FBNA 5HRAA 2CCKA 3H1PA 3OFNA 5JQWA 1Z2AA 2IHJA 3MUFA 5L3QB 3EAGA 4RTQA 3LOPA 4IH1A 3GT7A 3ZZTA 2W0SA 3M6FA 3NS7A 1B8VA 1OXSC 3V7YA 3E9MA 2Q7OE 3R5JA 3ICQB 3DEKA 3DONA 4FSXA 5AW5A 5M34A 3L0IB 3FKSD 1LTHR 1MC4A 1W88A 2C2XA 1VLVA 2ILTA 4I4IA 4J0GA 4OHVA 1NT4A 2JH3A 2FMUA 3RYFA 3SLKA 2P0YA 4ED9A 3S0JA 1D1QA 1G3MA 4EG8A 2VAXA 2LCIA 1G2OA 2FSSA 4UXIA 2DULA 2OL4A 4MV6A 4V2IA 2Z5LA 2GK3A 4QFDA 5EIHA 2ASEA 2VBGA 4DDVA 3HSSA 1R4NA 2HMAA 4TWRA 2Y1FA 3PF8A 2FJ0A 3A6EA 2WD7B 2C1XA 3G2QA 4CM4B 2JIOA 4BECA 1PG5A 2REBA 4KOEC 3M4NA 3UZUA 1N5IA 1WZEA 5ANRB 1YC5A 3RTAA 3RUPA 4BUCA 1Y42X 3H9QA 3QI2A 5F1KA 4NECA 5K8IA 1UBSB 1YJ5A 3QKWA 4UM5A 4Z0TA 2NO6A 3LQRA 3NRCA 4OI2A 4AJ9A 2XE7A 2CLLB 1PDWA 4H08A 4H18A 1SC1A 1J9ZA 3OOWA 4BJ6A 1BFDA 4Q18A 1JECA 1YS7A 4Q9IA 5I5EA 5CX4A 4RFVA 3LT0A 1CEYA 1E6UA 3BWXA 3CWCA 1MOQA 3CU5A 1C3OA 2HQRA 3Q2OA 4KQMA 1CE8A 2QRUA 2FPKA 3IR7A 1AX9A 2V7BA 1CQJB 1NRIA 2QAGA 3DV2A 3HS3A 1T9KA 1ZUNB 3PJFA 3N8IA 3MFQA 4MQ4A 5B1DA 4IFTA 4DRZA 2HGSA 3TI7A 3D8RA 1GOTA 3L84A 1SM4A 2IGBA 3CSSA 3L7JA 3UMBA 3V8RA 3GRRA 4L15A 2FZ4A 1I4TD 4Y30A 1KYWA 1H42A 1XJCA 1Y1RA 4I8DA 4RMIA 3LNTA 3RS4A 3VU8A 3RVPA 3AZPA 1Z26A 3C3JA 3L6BA 4R71A 1T9GR 2M98A 2NZYA 4QUEA 3GN2A 3CJQA 4R31A 4P7KA 1XTKA 5CDFE 2R6CA 5CVCA 1UBKS 2V6GA 4BMZA 1RPZA 1QQ5A 4YXWD 5CU7A 1HZZA 1IPHA 3GLRA 3BIJA 4INZA 5JG7A 3LHSA 3MTBA 2FZGA 3EOZA 4MUFA 1WX1A 3B7WA 2FZLA 3O8OB 3DUFA 4BWFB 2AOWA 4ZZ1A 1M33A 4DA0A 3TYXA 4A0RA 3GH3A 1JFFB 1YCGA 1A7KA 3UCEA 2JZCA 2QN7A 1NATA 3JRXA 3KM0A 5F33A 5CFMA 1JHQA 2ZWMA 4QWWA 3UB2A 1KWKA 1FX1A 3UUWA 1UT8A 2G5GX 4R1LA 1ZNYA 4BZZA 2D2IA 1XUOA 3FSEA 3OG9A 4TZ6A 3BIXA 3LHDA 2M2IA 5EJFA 3QVGA 4OM7A 5E7QA 5IC6A 1CY7A 4L2IB 2BGNA 1MH1A 2QQ0A 3PDJA 1NYTA 2CF6A 3IPAA 3ZGOA 2UUCB 1PX2A 3KELA 4M1TA 4LKOA 2J3LA 5EQJB 3EQ2A 1WS6A 4HYTA 5E8RA 4QPDA 4ENVA 3BD7A 1H6BA 1GR1A 4IXDA 3PC6A 5HZHA 2YWDA 4UBNA 3K0HA 3RVSA 3PXGA 5B7GA 2QPTA 4ALIA 3OLWA 5EHXA 4IVNA 5DWDA 5BWMA 4ENPA 5I7OA 1XK7A 4X3PA 5TRTA 3GMTA 3OJOA 3OJWA 3IMCA 3AKDA 4F2WA 3LKZA 4MV9A 4EK9A 1P45A 2BAGA 2DKFA 3VC1A 1XDDA 1PT6A 3ZY6A 4D0RA 1IBCA 2NV6A 1PK7A 1JTFA 3CLHA 1GT91 4G26A 5TF4A 1YZTA 1LC3A 2QGFA 3DAFA 3K9LA 4GXNA 4BMDA 2GZHA 4E32A 1OYOA 1RLTA 4KIUA 4PFJA 4DDUA 3BXEA 4WZBB 1E6CA 5L7TA 3PQDA 3AI3A 3FWHA 4P3YA 4B3CA 5BVGA 2V59A 1YBFA 3IDZA 3ESAA 3WGUA 5LQNA 3CNQS 4BPBA 3HFSA 5TF0A 5KDDA 1G6HA 1OAOA 3QKUA 1VQ1A 2KQUA 4O0MA 2JFYA 2WG1A 3ELDA 2KI5A 1J0AA 1KZYC 1VBKA 1VCOA 1ZHFA 2PH7A 4KGVA 4NENB 4ZD6A 4D43A 1QH1B 4YCCA 5C5IA 1FIUA 5IARA 1N7JA 3I37X 4M8SA 5EP3A 4XJXA 5LNK6 3O8LA 1PR6A 4XWKA 1BGXT 3EBPA 4DBZA 2BFOA 4I9HA 3DZGA 3PPWA 3FZGA 3ZPXA 2IVZA 3WC4A 4HLNA 4NHEA 2D5AA 4HB3A 3BS4A 5AW7A 3QF7A 3DYVA 4D9JA 2HT1A 1MZVA 2C61A 1SKQA 1RC1A 2SCUB 1KJ8A 1DBRA 3CRRA 4NDZA 2VLIA 4NZNA 4TL8A 1C50A 2OZPA 4P81A 1JNYA 5A3QA 1YI1A 1ACLA 1FFBA 4RZ2A 5KOHA 1BXKA 3ZIAA 5JNUA 1E3SA 5ARBA 3F90A 4ZDIA 3RO7A 3E3AA 4JWKA 1D4AA 2E4ZA 3AP1A 2OHGA 1WHSA 5H3HA 5CM8B 2J08A 2XCOA 1ZGAA 2JW5A 3KJHA 3GFPA 1H3EA 1Y5LA 1LJUA 5THKA 1XB2A 1A4XA 1U2GC 2DQ4A 2O2JA 5F76A 5AVWA 3D4BA 2QTWB 4JLKA 4RKYA 1LX6A 4RY2A 1GR0A 3DE5X 4J49A 1GVNB 4JAVC 1N9ZA 3MD9A 1Q84A 3GQBA 1N5DA 1ULTA 4MEJA 4X1IB 4B35A 1YU9A 2OYCA 4M0FA 4B81A 2QM3A 2ZEJA 4R9SA 5CJJA 3BE6A 1QRUA 2G88A 2XKBA 2YWXA 4MVJM 5JVDB 4FTWA 4FYIA 3VJKA 2H48A 5HIIA 1XN1A 4N76A 3Q9LA 2YY7A 2PLWA 4GBJA 2F67A 1U1FA 5ALMA 5FNZA 3ZU4A 1YVPA 5BYKA 1G64A 2FTKE 5HCNA 3M2TA 2G0NA 1VDZA 2ZBVA 1FTYA 2XJ4A 5JD6A 4W5QA 3EGXB 1E3TA 1H9AA 4GM1A 4FBLA 2C3UA 1BHJA 4BJ3A 4GPZA 2CFOA 2FNAA 2ATIA 4IHJB 5H0IA 1FLAA 1QF6A 2VPZA 3MUEA 2NPFA 2JGMA 2PMDA 2ADFA 4NYJR 1U5BB 2W0MA 3GG9A 4MWSA 1KR2A 3H05A 4R41A 1TXGA 2WSMA 5KU1A 1O77A 1MAAA 2ERCA 4FVTA 5E8JA 1VPLA 1G63A 1GXSA 3PWZA 1TM2A 3IPCA 3O0DA 1BD3A 3IELA 2F3TA 5IN5A 421PA 1AK1A 4CKCA 4UVHA 4DJFC 3OIUA 4RCVA 1W4LA 4F2GA 2XRZA 2DPHA 3EJWA 4U39A 3KJFA 2OV1A 5CCEA 2R5WA 4NX2A 1MX3A 4L5IA 4C2BA 3RVMA 3BSFA 1F20A 4JNKA 3GLFE 4U0KA 1T5DX 2JARA 5JJIA 1A88A 1VHJA 2VUSA 3WX0A 3G9TA 2R11A 3V00A 2O2CA 1A9SA 2E89A 1XVVA 2PRYA 1E4YA 1H4VB 1ZX1A 1M2EA 2I7CA 3EVEA 4MRNA 4BO9A 4D0NA 1OB5A 3W1WA 3OBIA 4RNDB 2EL9A 4ZOCA 2PZMA 4WZ6A 1WCXA 4E5UA 4CLRB 1G8YA 3A3PA 3KXPA 4MUXA 2K2WA 1C7EA 1PBNA 2WUEA 4M22A 4CEIB 1CW2B 1DAIA 4WK6A 1E3DA 4OU5A 1V7CA 2JEOA 1J8FA 1JDJA 1EFLA 1I0ZA 4BNHA 3D6TB 4DMHA 2ZLBA 1W8DA 2FWPA 3D4PA 1YWGO 1L5SA 1LUAA 2O7SA 3BJZA 2JFUA 2NO0A 4L9SA 5E6RA 1JDSA 1SURA 2BHSA 4IRUB 2WHQA 3WWZA 3HXOA 3EEBA 3F71A 1NQXA 4R2LA 2ZULA 4ER0A 1YRWA 2PKQP 4RXTA 3IKJA 4E5NA 1KKMA 3JVEA 1OLXB 1GU1A 4KO4S 4LZPA 3QBEA 1ZDMA 1ZU4A 2Q1TA 3VI3B 2I67A 2GETA 1HBJA 2NZ8A 3LCCA 2W7TA 3PQ6A 2O6LA 3BH0A 3GOHA 5SY6A 1KHHA 3RVLA 4DCMA 3BGWA 2EFCB 3F3YA 4EZIA 3F6RA 2UUAB 1DPGA 3FDJA 3IQXA 3ZTTA 1CSEE 1OTXA 4DREA 1OF1A 5BRNA 3JQ8A 2A1IA 3NTQA 4MRMB 1KQOA 2ZBPA 3M34A 1Y9AA 4BX8A 1RWNA 5CB0A 5LM3A 3UMMA 4ZVNA 4AG5A 4PX2A 3D8BA 4HDSA 1CY2A 2ZIWB 3A4MA 4BFVA 1WIWA 1M2OA 3MK31 4UBJA 5FOVA 5BYAA 2IU4A 2A9PA 5LFAA 2QG4A 1EXVA 4K0KB 1BYUA 4N9WA 4U6NA 1HSZA 1NN3A 1KDZA 1S2NA 4GZLA 1XJQA 1RFGE 1G3IA 5KHOC 2VWQA 1X3SA 1WUYA 2NUPA 4PINA 5KYYA 3OQBA 3KCQA 5FOXA 2CXHA 2ZS9A 3KBOA 4BLQA 1BWRA 4LI0A 1EDOA 3OESA 5DXJA 3T7AA 4P4UA 4X20B 3DOEA 1O9GA 2ZKLA 4JT2A 2QTZA 5ALSA 4LRSB 1D2CA 1NDHA 2V0GA 2M1XA 1J07A 3QPBA 3UAOA 5I3ZA 4YP9A 3WGNA 2G36A 4CUKA 1F5SA 1UANA 3CNHA 2Q3LA 4L6CA 3UATA 1RLOA 1GDDA 2UDPA 3PHIA 1ZI6A 4I4TB 4O2AB 4QM7A 2E21A 1I4DD 3VZBA 3AU9A 2NIPA 2YJTD 4PCAA 4DVJA 1UBEA 3N07A 2H1FA 1AUQA 4QDKA 4G36A 1EJBA 4LXXA 3ICWA 5FPTA 2B4KA 4CIDA 2AFVA 4ESOA 5JH7B 2Q7XA 2V5AA 1TEVA 3GJ5A 4ZT3A 3EPLA 2HK9A 3G17A 1NYRA 2ZVJA 3EVZA 1OV6A 1G4UR 1Q1BA 4Y2PA 4PTLA 3L0CA 4G4JA 4JASB 3I2YX 4M89A 4FN4A 4EB6A 3C1UA 1CZNA 1GL6A 2OV6A 3TQTA 5FBRB 4HWSA 3P2JA 3OKCA 1V35A 5A7HA 3PNLA 2FUG1 5LPNA 6PFKA 3DVSX 4KXXA 4JJ8A 4MVCA 5CYPA 2W6IA 6LDHA 2WU0A 4BZQA 1E58A 1GZ6A 4LV5B 1D5WA 1YVEI 1ZMBA 3A4LA 4MAFA 5EE3A 4TT8A 4BKMA 1E9CA 2C83A 2J32A 4GMKA 2HRZA 1UKCA 5BYJA 3T5MA 3T9FA 3W2EA 2QM0A 1ZG3A 3RIEA 2B61A 2C2OA 1FP6A 4MJ3A 2VUUA 3R0JA 1NX9A 5TPZD 2A14A 3K73O 2AJBA 1RZRA 1P7WA 2CFCA 1GQQA 1QGAA 2ZTUA 4REOA 2R4TA 4JZKA 2ESRA 3P9ZA 2F64A 3MTEA 4I0WB 4JL8A 4CM7A 3RKUA 4EY8A 4HX5A 4LTDA 2WLSA 1JAHA 1N1GA 1H8HD 2W43A 3I6BA 5CJPA 1DAHA 2PUGA 1FDTA 1EP3B 1GPLA 4CMEA 3BQNB 4BRSA 2QW0X 5JASA 1VP3A 2GWRA 3TQSA 4CM8A 4BNVA 3EDCA 5CYFA 4DW8A 4Z1OA 2X2EA 5C1PA 3THWB 1JJVA 4FMBB 2NUAB 2XITA 3NO4A 2G1AA 4PHHA 3F9RA 4RSRA 4X0EA 3TNFA 2CKMA 2GM9A 1JHMA 4UDOA 1QHSA 4NATA 2PXXA 2WWYA 2A4KA 1X1AA 4PGAA 4RAOA 4HDAA 4CJXA 3UPUA 3FTEA 4L22A 3LZDA 5IK2D 1J39A 3FMPB 3MWDA 2CWWA 5IHXA 4B3GA 4JMLA 4PLHA 1NBOA 4U2GA 4FW8A 3N0VA 4WRRA 4B2YA 4QU0A 5H9WA 4F4DA 4IDQA 3QW4B 3D2BA 3K6RA 4GH5A 4C1NA 3JYLA 3MJFA 4DQLA 4GVXA 4QJ5A 5DGXA 1TKRA 3E3NA 3LDGA 4G5SA 4RDHA 3N6VA 3RE1A 3ULKA 3THXB 1GUBA 3DE1X 4FDLA 2W00A 4HVTA 2HDNB 4GLLA 3R4VA 4ZQCB 3WWYA 5LMUB 1Z56C 2G7ZA 1WBDA 1JPNA 3E4CA 2VZ8A 1XPRA 3GBSA 1S01A 3VR6A 4TM7A 5C1BA 4LYGA 3OH8A 1Z5GA 2EL7A 2V03A 3BL6A 3H2GA 4P4SA 4BMVA 3OI7A 4JLUA 4W8OA 1XVAA 4PCLA 1QZXA 4MQUA 3RHFA 4ZCQA 1H2EA 3JATB 3ZHZA 5LOVB 4Z2YA 1RAHA 2M32A 3EHDA 4ZQGA 4BWGA 3AOGA 1AKTA 1J2EA 1XEWX 3ECAA 2MSCB 1J56A 3NBZC 4AX8A 5ICSA 3PVZA 1Y6FA 2A9RA 2JI8A 3AY0A 4OL0A 4Y2VA 1PEDA 3Q1LA 1S6YA 2YIJA 1GUAA 2XSZA 4F91B 2P9ZA 2NXEA 1UC9A 3K9CA 3WKDA 2G1JA 3HGMA 3QVSA 3WLFA 3F8WA 1I8TA 2GCEA 2EXXA 2OHFA 2WWTA 3OPMA 4HSGA 1JHOA 1GT6A 1MPTA 4WXHA 3YASA 1HDXA 2CE2X 1DKNA 3TLXA 2W5UA 3ZHCA 1HYQA 3AJDA 2ISSD 1RYMA 5PGMA 1RXIA 3QBDA 1XMXA 4TSFA 4DT1A 1C8KA 2FPMA 3HI6A 4RF4A 1AS2A 3HRIA 1C9NA 2I1WA 3QLVA 5KWVA 2VRCD 1RP1A 3EXHC 4L50A 1C4OA 4TMXA 4D4MA 4AY2A 4PRYA 4P4NA 1SXJC 4MX8A 4WN3A 1BSVA 1RJGA 4RD0A 3GFTA 5I3CA 1M5RA 1P6XA 3REGA 4RE6A 1CS0B 2NSDA 2VF7A 5LB2A 1MO3A 4G0XA 4QVKA 1OA1A 4L3VA 1JTVA 1QFMA 2REQB 3EIEA 3U2QA 2BJHA 3R3UA 4QPPA 4EPWA 5BV0A 3NTVA 1TRKA 4M60A 1ZBQA 1JW9B 2NPIA 2AFRA 3FBTA 3KJQA 4BGIA 2AHOA 4D4KA 1ECBA 2Y6VA 1R8QA 3PLNA 3V97A 3AV3A 3CZ9A 4A7PA 2VSNA 4BX3A 4Y6RA 3A6PC 1L1QA 2YC4C 4G01B 4M0EA 2C54A 1IHYA 2BEWA 4A8PA 4AWXA 3HR4A 3OQMA 3AQIA 1ZCBA 4DN6A 4PC2A 4CL8A 3FTQA 4I5EA 2FV8A 1A9PA 1NQUA 1ZD9A 2BEVB 1NJSA 3OZXA 3CY6A 3OVMA 4FEYA 3L7NA 5KSYA 3HU3A 3FH0A 4PYNA 3FOBA 5U4QA 3U5TA 5K4HA 5JJBA 1VJGA 4Q4CA 4MCAA 1J8MF 4PN3A 5LJLA 2BC9A 4FGUA 4S2UA 2CB9A 3LUDA 3OJ0A 1C29B 4QUJA 2A3NA 4RA6B 2WWVD 1UQRA 2EQ5A 4PAOA 4GMXA 1KNQA 3HSYA 3O82A 5ECYA 4F4JA 4K6GA 4BO8A 1C0EA 3TNLA 2BFDB 4ZGWA 4YO8A 2GZDA 4JXXA 4H4EA 4TL7A 4MR7A 1PLLA 1VLZA 1T9GS 1T36A 5DCUA 2DH6A 1DUSA 3FKSA 3QU4A 5AOAA 5HNKA 2DTEA 3I28A 4XGKA 3I9NA 1XTTA 2I2CA 4LMAA 4UMFA 4F3TA 4GXQA 4NOJA 1IDOA 1YE3A 4FFSA 4PSKA 3LDAA 3LDFA 2DBRA 3OQPA 4HQKA 5JNTA 3NYRA 2Z09A 1CD5A 2EKBA 1T5LA 3UB4A 4BVJA 3SZMA 1QKIA 3PC3A 3G1WA 3HN2A 1M76A 3E81A 1YIDA 1RRKA 1W34A 4MEBA 5AW9A 2V9CA 1PNQA 1QBGA 3NHJA 2YXPX 4GPTA 5IABA 1IDN1 1MDFA 2PLAA 4KUEA 3SPXA 2R2AA 1JFRA 3K30A 3LA8A 3S70A 2GKSA 4AKEA 4EW3A 2ICAA 1NP3A 4N01A 1Q1GA 4UMDA 1UKZA 2AJCA 3LHFA 2A67A 3H1BA 4UKDA 3JSXA 3G49A 2X8LA 1LFDB 1FL9A 1QUFA 2IXFA 4XFKA 2C95A 3R0VA 1SB8A 1I5RA 4YECA 3RT9A 3BWVA 4FDTA 5PNTA 2XGJA 4HC4A 1RKUA 4DXAA 5JVDF 1T9AA 4LFBB 4AURA 1DC3A 2AOTB 3L46A 3I5AA 3ESZA 1Z82A 4NPAA 4B79A 1DRKA 3EXIA 4L28A 1T2NA 2VS1A 3ZIUA 2FWNA 2XIJA 5MGBA 1Z5VA 1RHMA 4FMCB 4YTEA 2RKWA 4QJ3A 3TIIA 4AMUA 3P4UA 1GHTA 2RARA 3DE3X 3FZNA 5T57A 3HUEA 4FNAA 4DLUA 1QP7A 2XCTB 3P96A 4D41A 3AOEA 3OEWA 3DFIA 3PGMA 5CXUA 1PJRA 1OWOA 2WFAA 2P9FA 3E2PA 3EA0A 2GCPA 3C5HA 4YP1A 3ZDEA 5I45A 3CZQA 2CSXA 4BZWA 2LD4A 2J41A 4J1TC 1CYDA 4DA7A 2DETA 2YY6A 3OEHD 4FYHA 2E0IA 3BTSA 3R3ZA 2EC5A 1S3FA 2DTDA 2ID9A 1UK6A 1V7QA 1Z37A 2O20A 3EG5A 1E9FA 3A70A 4MGHA 2H1HA 5AVYA 4UUPA 5CLGA 3L2OB 4NL4H 5CH3A 1F4VA 4RH0A 1Z0JA 3M6AA 1A97A 1OYVA 4C7XA 4GEKA 2R00C 4YMLA 3U4QA 4DV4B 3SS8A 4MUAA 3UK0A 3ZWWA 3L6DA 1B73A 3CLRC 1HEYA 2IL1A 2QRZA 3V3TA 4CN8A 2ZYDA 3NHKA 4WNCA 3R8XA 4G8CA 4A1OA 3VYRB 1U81A 5B3JA 4RHEA 2R0QC 1T24A 1UH5A 1I3LA 3PFWO 5TDHA 1C3VA 3S6JA 3VU1A 1NVFA 4PZ9A 3HJCA 5DHTA 1L5LA 3RUIA 4AF8A 4ZYYA 1GAQA 1RBMA 4UAGA 1VHTA 3CW8X 3MSCA 4TWZA 2BFBB 2WZDA 2ZR9A 5FO1A 3VNQA 3EHEA 4L4XA 5J2UF 5B30A 4G4SP 3FCSB 1EFTA 3VPXA 3W8RA 5B6IA 1N5MA 2OBBA 3NKLA 2IOHA 4G5XA 4H1WA 2V65A 2XBUA 3O3MB 4X84A 2FOIA 3CINA 3TXXA 3VVMA 1OXXK 1WR8A 1XROA 3L8CA 3LWBA 2I2DA 4Q4HB 3OCJA 5BN4B 3AR7A 3KSRA 1ISFA 5IHPA 1CUGA 1M9NA 2X8AA 2HA6A 2O2EA 2B98A 4RIFA 5BSEA 3RBZA 2WT4A 3LKDA 4DBLC 5BURA 5CM2Z 4XKJA 3V8VA 3GIDA 2O8FB 3S7ZA 2ZATA 2WHXA 2HMYB 1L4GA 3S4YA 3G5TA 5HGXA 4J0KA 1OMOA 1SVUA 2ZAOA 3D3WA 3BJEA 2PJDA 4G97A 2FN4A 1BDHA 3WKCA 1MB3A 1IQRA 2V55B 2F43A 4XX0A 4H15A 1G5FA 3W8FA 5LNK1 3AW8A 1GNSA 1QIKA 2Y1CA 1X7YA 3RFTA 1SKMA 4IGKA 5LDDC 5JSZB 1E2BA 3BXFA 3ZQUA 1BN6A 2C7QA 5HTKA 1T91A 2YJ4A 2WKRA 4KDEA 4PRKA 5JO9A 4C0JA 1GIAA 4CU2A 4WKBA 4I99A 5DLYA 1JG6A 2VF4X 5U9CA 1LK7A 2JFHA 1QBKC 2VNAA 3PNSA 1VHLA 1W5BA 3W06A 4F5YA 1IPEA 3WNQA 1FXWF 4IOLA 5JCPA 2VAMA 2WYVA 3QX9A 5LDGA 5A9TA 3QMVA 2Z3VA 2GOYA 4YMHA 3RYIA 1AA6A 1W94A 2W2KB 1FUIA 3G13A 3HXLA 5BY2A 4FFDA 5AI8A 3F6CA 4QQKA 5AMXA 3UJ7A 3VHXB 3K92A 3SHTA 3ED5A 5JHHB 3DH0A 2D7DA 2OPBA 1FFDA 1GZUA 3D4IA 1L5OA 1NNUA 3IO5A 4UU0A 5CAEB 4B6PA 2IJGX 1C8VB 2PV0A 4H3SA 4HEA6 1CG6A 4I4TF 3U7GA 3FOAA 3LUPA 4H27A 1JE1A 3DT9A 4CHGA 3IEPA 4PLTA 3GA0A 2BMJA 5FXMA 3W9BA 5JLAA 1GCUA 2Z3ZA 3G59A 3C8HA 3H2YA 3JWIA 4GL4A 4ETNA 5IKPA 3D1VA 2I2BA 1QCCA 5D3MA 3DMFA 3NC4A 2CHGA 5AOVA 4B3FX 2DFLA 3EF0A 3DV0A 3EXFA 2BFEA 1WW2A 1G4HA 1JYEA 5AUPB 3EMVA 4X6LA 5IVHA 1DFIA 3IVRA 1M6YA 4LHEA 4PFSA 3PFIA 4NG4A 4FGSA 1JKMA 1SOMA 1KERA 3DDCA 3PZRA 4EHFA 4PWZA 2Z1DA 3NH6A 1KRWA 1UWCA 2J3DA 2PXHA 4N40A 4Q4JB 3ZQ6A 1E3WB 3ENNA 3QHQA 3CXUA 3ZEIA 2FQQA 4BX9A 4EI2A 1VL1A 1JLLB 1ZK4A 4PGGA 1JDTA 1J33A 3MYRA 2CL0X 3P9IA 1JIIA 2GTHA 2IY7A 2XCQA 4D9CA 1HTWA 1AHNA 2FPGA 3CPEA 2WAMA 4WT7A 5C4IA 4R6WA 2JLXA 1K5PA 4QXOA 3TX6A 4TZTA 3WG9A 2WB4A 3VJMA 1PZGA 3H3XA 1G17A 2QTNA 3RVDA 3F67A 1MEJA 1I2BA 2X1HA 3W05A 1VIMA 1ZMTA 4MAAA 3GGGA 3T41A 4KEAA 4JVLA 5FNVB 4J90A 1QPGA 2XTZA 1EWKA 4YWJA 4CKBB 1TEXA 1OBOA 1XI2A 2D4HA 3A3OA 4BGEA 2PSFA 1QH8B 3PUWA 4FT2A 3FFXA 3TLJA 2X41A 4XCQA 3ZX4A 3WNVA 4ERNA 4M9XA 4HGRA 5FHQA 1KXJA 1WLYA 1MC5A 2G70A 4IBOA 5E3HA 3LIPA 1GLGA 2BE7A 1NJGA 1SUFA 2RGCA 3D3QA 4ML3A 2I34A 4OCZA 4TXLA 4D3DA 5AQEA 1UMKA 3MAGA 4NQZA 1VSUA 4OQ4A 3N28A 1KJWA 3AIOA 4KXLA 1IEVA 3SDBA 1F4LA 1SVSA 1IOLA 2CXQA 4QRIA 3SC2B 5TMPA 2KWIA 3HFJA 4Z4HA 2CV2A 1Q2XA 3STHA 5AI4A 1DV1A 1V8FA 1YE5A 4B3SB 1D6JA 1Z6XA 1CQPA 3JD3A 1VTKA 5B4TA 4TZKA 1QMGA 3ELYA 3OICA 1X1DA 2G5PA 5LR6A 4JI3B 5A04A 3JQGA 4KFUA 4DDTA 2QMYA 2QRLA 3LHIA 4F21A 2QRVB 2NOAA 1RAAA 1W4RA 2VYCA 3KT0A 2P9CA 4LVCA 4RQAA 5CVVA 3S2GA 4A2QA 1TLLA 5IZCA 5K0EA 3ISTA 2VPQA 3T5PA 2JBWA 5MFPA 4YROA 2D1QA 1NUQA 4YY3B 3VR3D 1WQ1R 3DQZA 4IZHA 3UN1A 5CH5A 2VIIA 3EG9A 1V7PC 3E1GA 3HE3A 4FHZA 1SKUA 3ZKWB 3JYNA 2QV7A 3CRZA 3KUDA 1A4RA 3EZNA 1H1DA 4QPCA 1KMHB 1K4KA 1NZDA 2Q3DA 4O33A 4PQEA 4KGXA 1K5GA 1GCOA 1YZNA 4C1BA 1QYDA 1D0SA 3CLTC 4YRLA 1ZR2A 1ZONA 2Q5EA 5ALEA 3WRXC 1S8OA 4E13A 2QX8A 1N77A 1IHXA 3STUA 1S8FA 1J20A 3L8ZA 1PYOA 1I13A 2QP4A 1P1BA 1OT5A 3C5WP 2XUDA 4D9EA 1H2HA 4B0PA 4DSZA 3RRZA 5IP5A 4JEIA 4F4FA 2ZDQA 5LQDA 4PS0A 1R6VA 1X3LA 5HDQA 2HHHB 1WQ3A 4I3HA 3LRTA 1VSBA 4B6EA 2FZWA 2H5JA 5BMVB 4G6ZA 2ZT5A 3E58A 1LV8A 2MU1A 3MIIA 4O3FA 4QVGA 1XU4A 4TTTS 4QVIA 1BEEA 4NJMB 5G53C 3HH8A 3BB1A 3CIOA 3DVRX 3FYSA 1Z0IA 3HDVA 5DRTA 1X92A 3MINA 4GWLA 3CISA 4N0EA 4TQUS 2ORVA 2XQVA 2HF9A 1SUCA 2H92A 1X0VA 4OMUA 2XUJA 2IYUA 3OZFA 3EZLA 1QHNA 1ZIPA 2FEKA 4HB2A 4OB8A 4OQPA 1MXFA 2PN1A 3PYMA 3L7CA 5JO0A 1K9VF 3RC8A 3PR1A 3E7XA 4AZWA 4A36A 2WIDA 3DCJA 1NPDA 1ZESA 1ESZA 3KQTA 4G5RA 1GFZA 2IXEA 3G02A 3BFXA 3KUXA 4DIMA 2J6IA 1SG9A 3N2KA 2RGAA 3SIXA 2X9NA 4BRWA 2B35A 5BQOA 3JZAA 4I3GA 2LUOA 4QOHA 1PJ4A 1A1SA 2BMWA 2WR8A 3T34A 4YDRA 4TPKA 2ZYHA 3HCAA 2GBCA 3C3WA 4DRXB 1UP4A 2I7TA 1G5HA 4YUXA 4C4OA 4M0MA 5D00A 1ULZA 4ZTUB 1AUXA 1TKBA 1F8UA 2YS6A 5DEOA 4OBBA 1A2BA 1X7WB 4JGIA 1V7ZA 2D2VA 2JFWA 3A1UA 2RGUA 1KYXA 2SECE 5FA5A 1ID8A 5LZ2A 1M34A 1QO9A 3V46A 1Y4UA 1RKXA 2R8PA 3V1LA 3WFIA 1QIFA 2FPIB 2JGNA 2FPLA 5FA6A 3UH0A 1Q5PA 2HV8A 4I1OA 2M1ZA 3RS3A 1W46A 2DPLA 2PGLA 4LRYA 3MCAA 1A04A 2PBLA 5EIOA 4F0JA 5D2CA 2QP3A 1FK8A 1WDLA 3GNQA 2QVZX 3GVPA 3KPUA 3PXCX 4K9PA 3RR2A 2ORYA 2QD3A 3W2HA 3WAKA 4QRHA 5E6UA 1VMEA 1U2ZA 4YRRA 3K32A 1NQ5A 2C97A 1QG2A 5AM3A 1XPUA 1F5NA 1M0WA 2JPDA 3FTNA 2IZZA 4ZDKA 1ZIOA 2IF0A 3ESYA 3L0YA 1NL3A 1SVWA 1VKHA 4JDPA 4ZEMA 1P81A 1AOXA 1EESA 1ZQ9A 3NANA 1TUIA 2P3OA 1DI0A 1KJIA 4C4YA 1KZ4A 1Z28A 2QIPA 3HA7A 4PX3A 5DHSA 4CG0A 4DCNA 1R5NA 3UHFA 4TUYA 4EW2A 1YSCA 1ULUA 4TVKA 4YRFA 2ZBQA 2Q5CA 3K6SA 2CHVA 2F00A 3QLJA 1LBSA 2FXVA 1JU4A 2I6QA 2H7VA 3HDQA 5BORA 3UWSA 1T4MA 4B4OA 3AYXB 1SBZA 1M2GA 4JCOA 4R0MA 1RRCA 4KV9A 1Y1QA 4ACAA 2ZJFA 4URYR 2BCGY 2ODAA 4DLAA 1IUOA 5DXFA 4YRPA 1O7JA 2YXDA 2ZRAA 4Z86A 2OFFA 5BMVA 2ZP1A 1VGQA 2P1DA 2Z30A 4XR9A 1M6NA 2XE4A 1JFVA 3B5JA 2G17A 4OJTA 5I7EA 2DJIA 4K46A 5DM1A 1NUSA 2ISCA 3PNQA 3X1JA 1DEXA 3SBXA 3ZW8A 4ES6A 2WJJA 3HRKA 2FEWB 2VXCA 4WESA 4HTFB 2E6KA 2D62A 1GM5A 4ZEVA 4M54A 3TRFA 5HCUA 3DDWA 1YKGA 2B8WA 4QXRA 2WPNA 3TW4A 4KN6A 4CWAA 2HY7A 4P3PA 4WMLA 2I7XA 4F1JA 2NZWA 1VLLA 1EFVA 2GK6A 4QU5A 5FWYB 2P0EA 3ETLA 3W79A 1NG9A 5LBTA 1Y8QA 2VF2A 3RDPA 5CIQA 1YZVA 2MCFA 5TMEA 4RVSA 1C2TA 3OEEA 4L5JA 2RGYA 3R0QA 4Z5XA 1Z6AA 1XKTA 1A8IA 5E4FA 2OCGA 1N2GA 3SEFA 1T4BA 2C03A 1T1SA 3PDIA 5CCBA 2BSAA 5AI6A 3DAGA 3CVOA 4BKUA 4ARZA 3TKLA 1V9SA 3SXJA 1HEIA 3L7KA 4JWTA 1WKVA 3PXEA 2PANA 5DBFA 3I0NA 4D9IA 4D6YA 1ORTA 3ZDYB 1Z4JA 2WUWE 5BW4A 2X42A 3GJSA 4P84A 3SVZA 4DUZB 1MUUA 1W49A 2WJYA 2FZEA 1C41A 4GXTA 4WBNA 1L8OA 3H0EA 4IJQA 2VJCA 1ZMOA 2B25A 1KDTA 4J03A 1R64A 3PNVA 1EX1A 4Y6LA 4GC9A 1VJDA 3GBPA 5EEHA 4B7AA 5JALA 1UAYA 3KQYA 3NHLA 3AJRA 4DJEC 4N54A 4UM8B 1KEVA 3T5AA 2AQHA 5FTLA 1D2HA 1U7XA 3DO6A 2VRCA 4NFYA 5T64A 5AM1A 3F4LA 4CEJB 1P2FA 3DL4A 4N5NA 1XNJA 3BFVA 5I47A 4Z99A 3C4QA 4IINA 1P1FA 2WTMA 4BMCA 4ZFNA 2X0KA 4FLEA 4JXJA 4FNOA 1A76A 2XT6A 2JA1A 4MQEA 4MS4A 4YJGA 1S2OA 4NAUA 4F1KA 1ZWLA 4JMPA 4HH1A 5K0NA 4IJVA 1UPFA 1N92A 3HKBA 3OCXA 3DCIA 4OBXA 4EF4A 2HADA 2HA4A 4TS3A 1E5DA 3C6MA 4TXNA 2F8SA 2PUAA 1F8GA 4E5PA 1DVRA 4FUQA 3ZGXA 1JEQA 1B15A 2FSVA 9ABPA 3O1IC 3EGOA 4QQNA 5AXCA 1P5HA 4Z9AA 2P35A 3SYTA 1J22A 3OE5A 5H02A 1PUXA 1KR5A 2YINC 4EYEA 2MYPA 4F4HA 5B12A 3A4NA 4QO7A 4I4CA 2CLCX 1EFRD 3PJDA 3MMPA 4UCFA 2HIGA 3WWPA 4BJ5A 3T3HA 2XOXA 2EG9A 4AG3A 4MULA 1IJBA 3CRQA 4FFLA 4BQIA 5IAAA 1JA1A 4FONA 3RJ5A 2ZSKA 3E9YA 4ZZ3A 1LWNA 2RBGA 3USZA 3H19A 1OAAA 5IJ0A 1O96A 2YIMA 1MTZA 2RGRA 3BRWD 2PLFA 3FF1A 1L9XA 3K2EA 4MP6A 3GARA 1G7TA 2C8JA 5C5EA 1C2YA 1GYQA 2Q6LA 2YJZA 1SZPA 2PUJA 3L7BA 1NI3A 3C7AA 4MYTA 2IZ1A 3PFNA 3N5KA 3GGCA 4O1IA 4DAEA 4NOMA 3DV9A 1J0CA 2YZKA 4C4PA 5AVRA 1UOQA 4ZOEA 1BXZA 3IL2A 2VN8A 1NMYA 1SKYE 1U3WA 2XUHA 2YV3A 1LDMA 4LGMA 2X4IA 2DBZA 2DPGA 3NHWA 2G9ZA 1ULHA 1T0PA 3ABRB 2H7CA 3O83A 3DTNA 4Q66C 4M7PA 4FX2A 3RS8A 4EKYA 1FMLA 2YBEA 4MV4A 1BXGA 1T1IA 1Y5RA 2R4QA 3LVFO 2K87A 1CY0A 2QUBA 3AHDA 4NS4A 2F1RA 1PX0A 3FUCA 4TRRA 1GTL1 1J97A 1N6HA 3LLUA 1ZGBA 3ZY2A 4OIMA 5G1OA 3G5LA 3ZZ0A 4C4AA 5EMJA 1KAOA 1ATIA 2B34A 2RGNC 3PTLA 4LZOA 1CERA 2PVSA 4KPUA 2G4CA 2MSWA 3IILA 3QITA 4AVYA 4EO7A 5IFKA 3OX1A 2WY2D 3NAGA 4DPKA 2HA7A 1VYTA 4LRTB 1H6CA 3U44B 3KHUA 2YHIB 1HYBA 1ZXBA 1KK1A 2KB0A 1E2GA 1W5FA 2XYPA 3TOZA 2VUHB 1O97C 4BMXA 3GL9A 4KAAA 4F86A 2ZR7A 3UA3A 1G5IA 2FG7C 1QHIA 2X13A 2AXPA 1F3OA 1QIJA 4M1ZA 3W1VA 2YOGA 1LU9A 1KDOA 3CCBA 1EZZA 1KMCA 1N2EA 2UVPA 2JI4A 1TW2A 2GCIA 2V6IA 4L08A 4UCQA 5D3QA 3GJRA 2C7GA 5CG2A 2OXCA 1V1RB 3E3OA 4XYMA 2VG8A 3ZV3A 4A16A 1P5ZB 4F71A 3BDVA 3E2IA 5ALNA 1N7GA 3EDQA 1QS0A 4AFNA 4BNIA 1X39A 5JCXA 4B45A 1LDGA 1ZM3A 2HU7A 3IP6A 1IK6A 1M1NB 1N0WA 2VTEA 4HCJA 4QRDA 5B1EA 1T3ZA 1QIEA 1YULA 3AXSA 4EO4A 2VDWB 1LH0A 4RSGA 2PMFA 3MGAA 1QGOA 4QGAA 5A4AA 4OAPA 4YRQA 2JFPA 1NUHA 1U8EA 4HATA 3ZE8A 1MIOA 5AJHA 5FI0B 2JB9A 2JK1A 5KYUB 3AESA 1W4CA 5BYBA 4C5CA 2CHUA 1CY4A 1DSSG 1JIVA 2AOVA 3K35A 1CDDA 3A11A 1V5WA 4E4RA 4IIHA 2RGWA 2J0UB 3K0SA 2XQJA 5JBIA 3AFIA 3V32A 3UFXB 4FPXA 4M83A 4PIVA 4YJDA 3UXYA 2XLCA 4DA8A 3VTKA 5CDGA 5DSZA 4X1OA 4BFWA 2MINB 5B6JA 3O4JA 1LK5A 1Q6ZA 2C59A 2EGGA 3KC2A 4E15A 1ZJZA 3EVCA 3EZ9A 3O91A 2AYYA 2X9QA 4UUMA 1Z5PA 3AMVA 2HZ7A 4AZ3A 2GD6A 3H2HA 3LY9A 3P45A 2EFEB 4R05A 2P30A 1P0IA 4RUKA 4QA9A 5EWMB 3PQFA 4DM7A 4X7PA 1IRIA 2PWAA 2FPPA 2OO5C 2Q28A 1GZ4A 4LPKA 1NW9B 4MVJH 3KBBA 3TRKA 5HKKA 4Q7QA 3M1AA 2VDRB 2AI2A 4TN5A 3W5VA 2J5RA 5BQ5A 1HOXA 3IQIX 1J2RA 4D45A 1R74A 3IE0A 4NCIA 4TV8F 3DZCA 1DL5A 4XPIA 4CLOA 4YRNA 2JHCA 2ON6A 4F46A 5JSFA 5T4FA 1BGVA 3TM4A 2EQBA 1EFHA 2IDJA 1H2YA 2LRHA 2WUFA 4PHGA 5DBIA 1AV6A 1M34E 4TLDA 2WAYA 3LQ2A 3NOOA 4Q47A 4TLCA 3WMRA 5DBHX 621PA 3TVTA 2VNJA 4OYHA 1AHPA 4FHDA 2I6TA 4AKIA 3PDCA 4AO6A 2AG1A 3PIRA 4BB5A 2IYOA 2VTKA 2A0KA 3ZDAA 2HPZA 4MPPA 4WTOA 1C1DA 5I7AA 1EQUA 1T5OA 2PUBA 2D2FA 1XQWA 3H87A 1Z6QA 1G8JA 2IEAA 3I0ZA 1IN4A 5FADA 4EHHA 4DV0B 3Q0EA 4GOMD 4TYPA 4DC1A 4Y0VA 1UFVA 4HZGA 3UMCA 1E60A 5EKTA 1AB6A 1E0KA 3NALA 2BZ1A 3P4YA 4YLYA 3N75A 1ZXXA 2QLNA 1U9CA 4OQDA 3ZTWA 2IX3A 2SHKA 3ABSB 3VU0A 1R6XA 3GDWA 4D82A 1U2PA 4L5YA 4AYWA 4HEA1 4F85A 1TVMA 2GA8A 3DVAB 3WGTA 5CDUA 2R6ZA 1V2HE 2O23A 3ETCA 1E2IA 4RNCA 3R7DA 1E7RA 4TKVA 1YKSA 3IVGA 3H7AA 4JBLA 2Q0SA 2YMQA 3B9QA 4JFRA 5FDFA 2XNKA 4B3IA 1BCRB 3QF4B 4OB7A 2JHGA 1OFTA 2H3EA 3A1VA 3EVGA 1E9BA 2C5HA 1FXSA 2MSKA 1P31A 2RJOA 3D59A 3LBAA 4JKIA 3T15A 1N6OA 1T6YA 3K8YA 3BXZA 2Y0PA 1YIAA 2PJZA 4CT0A 5BN3A 2CXOA 1PSWA 3DDZX 4COKA 4PQYA 4RLFA 4KRFA 1FFSA 4BO2A 3TTVA 4KK3A 1NU6A 2BIFA 2GZ2A 4CIVA 3HYLA 5THQA 3RC2A 4LZAA 4EA8A 5COQA 1LNQA 1XO1A 2OB1A 3AEUB 4V0OA 4US2R 1J8YF 3ENZA 5I7UA 3QE9Y 2UXBB 1VG8A 3AWIA 3QVKA 3TZ6A 5CA1B 1L4HA 2W8BA 4DZRA 4MUYA 3KPYA 2XT9A 4GDFA 3M89A 4AS2A 1K8RA 5IC4A 1UJ4A 3ODPA 1OZGA 3NIDB 4P34A 1YQDA 3EVDA 3IFSA 4LXIA 3G7NA 4WQMA 4X71A 1BKYA 1ZGGA 2Q1XA 3OM0A 3NVKI 1N6PA 2R8OA 2YWJA 2VT3A 3OUZA 4JX9A 1RQRA 4CLHA 3LCVB 2J0EA 4TTAA 4MW5A 1KEWA 4QUAA 3FD8A 2EWWA 1B41A 1N2BA 1O6ZA 2ZTMA 3ZU3A 4XVUA 1RHRA 3B2NA 2GXUA 3LL4A 3S5JA 1WMBA 4CZ2A 1QK3A 1P7VA 4QBFA 4UNIA 5A71A 1LSOA 4YHBA 4AN1A 1HMYA 5FI3A 3LRPA 3EVNA 4MARA 5AK3A 1U1CA 3GK3A 1IN7A 4ZU3A 4MWZA 3RV4A 3UF0A 1GZHB 1DTSA 3NDJA 3I30X 3MHPA 3KCNA 1MZPA 3AETB 1UMCA 2H1WA 5BMOA 3PNKA 3G5MA 3GT0A 2P3QA 1TM4E 5J1SB 3GC6A 3VO1A 5DB4A 1GRCA 4RMGA 1BRTA 1POXA 1RPTA 2J6HA 2R6R1 1NE7A 2GM4A 2PHZA 1KORA 1FPQA 4B87A 3UVEA 2H2IA 2QRGA 3FM9A 3NIBA 5FL7A 1EX6A 4OM8A 4EMSA 1Y3CE 4GKVA 2XUKA 3NNDA 2CXXA 4H2DA 3KSBC 5JYEA 1YFJA 2GZMA 4YPOA 1CBUA 1ZKDA 3N8NA 4ZXFA 4C6TA 2JGDB 4CHTA 1R0CA 3ZE1B 5ENVA 2I9PA 3L6RA 4OHRA 4EY6A 1IIBA 1NURA 3VDQA 3W6PA 2Q5HA 5B1SA 3N74A 3JWHA 1Y6ZA 3PS9A 5F1PA 5EJ7A 4UUAA 1ORHA 3IIJA 2RCNA 2KX7A 3P0JA 5JR3A 4O4LB 1ULAA 2I76A 2P2GA 3B6ZA 1P9NA 4Q05A 3JAKA 4MOWA 3NAQA 3RWOA 4A5OA 1E2EA 1DE0A 5IVPA 1GILA 2OFWA 1V1JA 1XVTA 4QGGA 1AGRA 1E1NA 2DSTA 3UMGA 3NBYC 3DCNA 2ONZA 1V1MA 5ESXA 3G2PA 1E4EB 5DH9A 4R68A 4BP1A 3IJRA 3NBXX 3S3TA 5HZKA 2IYFA 3C3YA 1DCFA 3WWOA 3F98A 3GLIA 4RKWA 3KQQA 3JS5A 3BKWA 2OUIA 4CIXA 3ZV4A 1FOEB 1YR8A 1VKNA 1V9LA 2GMWA 3CLKA 3K8OE 2FPUA 2JFOA 3KEGA 3RG8A 1GSIA 5JCOC 1LRKA 2GVZC 3VR3A 2JRLA 4DJTA 2O9JA 4TTPA 1M2NA 1HL7A 1VG1A 2ODNA 2V6FA 1UXHA 2X77A 1SPXA 4MLPA 4N8EA 4CEHA 1O0SA 2NXWA 4BLWA 1KZ9A 4LYDA 4S1NA 1OY1A 1KP9A 1KF0A 1JLMA 1O95A 2LKCA 3N87A 5EXXA 3KKOA 3TGLA 3C16C 5ELXA 3ZD8A 3EXG2 1EM8B 2NU9B 4IRMA 3GFVA 1OIWA 5DU2A 1EGVB 1YA6A 2VPIA 4XOIA 1HDGO 5KJFA 3QWFA 1UPCA 4ZP1A 1TK2A 1J0BA 2OCPA 3ONDA 4UVDA 2C5EA 4WZAA 2R5NA 2WM2A 3O4FA 3QE3A 4NDNE 4RGYA 3GP8A 3BRSA 4R9VA 3U4CA 4RV5A 4DCVA 4ZRNA 5A02A 3DM9B 4Q93A 3SE7A 1VJCA 3FCXA 5K0SA 4E2ZA 2PZEA 1Z12A 2A1UA 1NVKA 5DKFA 3EPKA 1AUPA 1E7SA 3ZJ4A 3KOZA 3VZSA 4HWTA 5DTQA 4DJAA 5ALHA 1RSZA 5AXDA 2WWWA 1GLVA 2RH4A 4PEVA 1PSZA 4ZTBA 4Z9BA 2YXEA 3TE6A 3HQ4O 4HRXA 3FRIA 2DERA 3TXAA 5KC8A 1DGQA 2L18A 3TTTA 5IH7A 2NV2B 2WKPA 3N6XA 3MWGA 1H85A 2X19A 3ZH2A 3SWWA 3O3CA 1I7DA 4H4DA 1TGYA 1ECFA 2A9FA 3N2ZB 4XI9A 1EIZA 3JX9A 4Y0NA 1EE9A 2BV3A 1CDEA 1EK6A 4HDMB 4RA9B 3RD5A 3RTGA 3BRQA 2IYAA 4UEQA 4US0R 1VZ2A 2B7CA 3RQSA 3B12A 3BF8A 4OGLA 4YAJA 1W36D 3HEBA 4OUKX 1VSVA 4J16C 3HJHA 4MB6A 1THGA 1MOSA 3UB3A 4D99A 2D6FA 2ODQA 2OHJA 1F2UB 2QL7A 4MW9A 2C9DA 3A31A 2I6XA 1S8AA 3UWOA 4TZ0A 3RSFA 1OYYA 3DT6A 3QRWA 4X24A 1U2RA 4QGHA 1WHTA 4Q34A 4H3VA 4LXUA 3GWGA 1IC6A 4BTVA 2CXRA 2DX7A 1JKFA 2YQZA 4A0HA 1XF9A 5LD2B 3WLKX 4TXMA 4Q1EA 1AXEA 3KU1A 4P4GA 4ZV7A 1BVYF 3WHLA 1YJCA 1XD2A 5BSKA 2DFTA 3HKEB 7REQA 3AF3A 4EMTA 1N2CA 2FSUA 3RSZA 3UO8B 4XFDA 3U17A 2O7NA 4M1KA 4Y2JA 2QMHA 4MSUA 4X90A 2JLUA 2O06A 4HUQA 2F3QA 3W9SA 3LPNA 3FB1A 2FW7A 4P3NA 1E2NA 1S02A 3C5VA 1CIJA 3D3EA 3OOYA 5JXJA 1RZVA 1H1LA 3QLUA 4PXSA 2QXTA 2BH2A 3RHSA 3VNUA 3F5SA 3RUAA 4FYPA 3WO1A 4LVUA 5E7MA 4KLRA 4EJ0A 1T9ZA 2ZUWA 1P19A 3FPLA 3U6BA 4KVZA 4D74A 4MI9A 3ZU5A 1HFEL 1Y3IA 5I7HA 4XIGS 1SCAA 4AJNA 3SJBA 2P11A 2Q4RA 1GG5A 2QXYA 3KJNA 3R5FA 4INPA 1CJTC 3AUAA 3GJ4A 5A5FA 3C45A 1UPUA 3HU5A 5HBRA 2BFFB 1IZ0A 3OZIA 3RJZA 4GBED 3GLGB 1B23P 1HETA 3DVQX 3JASA 5D3ZA 5CA0B 5K6RA 4NBVA 4B3XA 2OV8A 2XTMA 3K5HA 4ZVOA 4L8GA 2FP4B 3AONB 2YW2A 1GZ5A 2I4IA 1W581 1Z3CA 3I8XA 5CLHA 1K1EA 2YWCA 3JRNA 4H16A 2GNAA 1E7MA 2E18A 4LXQA 4BIMA 5HQTA 1C7IA 3BULA 4OMCA 1E0SA 3ROTA 2A84A 1X1TA 1H69A 5EZQA 3NGMA 3TE7A 4DWJA 1NP7A 2NACA 3B5IA 2PKRA 2VJYA 3HZHA 1EUDA 1NF8A 4YJKA 4A82A 3GJYA 2OCDA 2WJAA 1SIWA 4Z3DA 4QHSA 2FWRA 2W6PA 3HYTA 1ZPDA 1RU3A 5JNVA 4IFIA 1H66A 2AJDA 2C29D 3WGYA 5J23A 1H0HA 3GZNB 4TV9F 4FSDA 1ZVKA 2WWIA 3N70A 4GKBA 1TC2A 3SY8A 1YDMA 1WOYA 4RXMA 4BGUA 4E4TA 5MN6A 4MYSA 4O2LA 5CTJA 1D0VA 1G9SA 1XRQA 2B92A 2EKDA 4V3BA 4YYEA 3U13A 1WMAA 4F4CA 4GOLD 1F6WA 5LDHA 4S2EA 2HI0A 4FILA 3E8SA 4Y2XA 3PKJA 4CQMA 3G85A 2LPMA 4EJMA 4AZSA 1AIPA 2OBFA 1TZCA 1K4MA 4RY8A 2KPOA 2WMNB 5E2AA 1XNGA 3EIHA 3H5WA 1PCXA 4OYRA 2C4NA 2EZ4A 2OXEA 4NCHA 5JRDS 1CLUA 1RW4A 1Y0BA 1Z68A 2H1RA 4LG1A 3RRBA 5JD3A 1Y6RA 2C78A 3FHLA 4ZA2A 5GGYA 3EWNA 4MHOA 1O54A 3OOSA 4E12A 3TD6A 3RUCA 1C0IA 3GWZA 5DMXA 4Z7NB 3R5KA 4FWIB 5FOSA 4EENA 1EEHA 3JQCA 4Y6GB 1NPTO 2NVBA 3ZXXA 2IBTA 1E1QD 2OK8A 2WAOA 4J3JA 4TWIA 3WK4A 4ZHSA 4D26A 3GA5A 4ZIRA 5FYDA 4HH0A 4DGSA 1AQNA 5ICMA 4JJIA 1TAQA 4I55F 2JFZA 2VSYA 1VPVA 2YJ5A 2JGEA 1U90A 1DPFA 1W0KA 4DR7B 3FDZA 4XXHA 4F5EA 1HO3A 1LI7A 1QF7A 3NIWA 4TL9A 1L5YA 2SBTA 5GVSA 5L3QA 1L5MA 4BNMA 3JR7A 3IX7A 4U8HA 5A5DA 4P82A 3TAUA 4FS8A 4CE6A 16PKA 4TKUB 3KZMA 3KKEA 3HR8A 2CUTA 1QO0A 4KQEA 4WFKA 2OENG 3AF2A 1OX4B 3L9WA 3ZNNA 1U8ZA 4A0GA 4ZOLF 1EJ0A 2FMIA 4GOJA 4NYJQ 4W5OA 2GK7A 3H65A 4J4BA 4LF4B 1EM6A 3FFAA 4XEUA 2PL5A 1JQ5A 3KKQA 3K05A 1DWOA 2X9GA 4C3UA 2DHDA 3M3PA 4N5IX 4BL5A 2LIVA 1HTBA 1PK9A 1W96A 5G0TA 1S4QA 1TO1E 3NM4A 4KJZA 3P97A 1WV1A 1SKBA 2D0DA 3IV6A 3QJ5A 1N3LA 1J1IA 1F48A 1UR5A 1YS2X 3T9AA 4OGFA 2PX3A 1RI3A 2BHNA 1GO2A 1ZM9A 2VRNA 3A7EA 2WD7A 1EFRA 1ZISA 4YAOA 3ZJ5A 4HVLA 1FZTA 2JGFA 2Z5FA 3Q7TA 1XG5A 2B21A 4HS9A 3U19A 4MPDA 4FC6A 2PRSA 3AY3A 5JSKA 1E6LA 1NW5A 2FW1A 3H9BA 5WRFA 1NI4B 2P75A 3BRWA 3NC1C 3GLSA 4PLPA 2H0QA 3E23A 3EA5A 3EZFA 1I4WA 1VLQA 4Y1EA 1KK3A 1PBTA 4QXQA 1Z73A 4YQEA 3V33A 4BNNA 5JI3E 1I2AA 2XUZA 2WHYA 3FR8A 1WDMA 3MFYA 3PFFA 4KYTA 1CZRA 4HAZA 6Q21A 5AWFC 3D54D 3PFGA 5HM6A 5KC9A 4N0PA 4GP6A 4K3VA 3U16A 3T0IA 4PSVA 1ZUNA 3GOQA 4EEKA 1UEJA 2OFOA 3P0RA 1LZLA 3ZTYA 1K6IA 3K70C 3LC7O 1B8UA 2P0AA 1SHZA 1ST3A 1OA0A 4F04A 1CJKC 2C4UA 4JNCA 4V3CA 3BAZA 4NABA 4F5ZA 3GLIE 4O5AA 4BLVA 3E8XA 3IJ5A 4IJ6A 3GO4A 4PYLA 4UFOA 3RJTA 4AX4A 3NI2A 3TNDA 3CRNA 5DHRA 1YZGA 5J63A 2J3QA 2WW8A 1GCGA 2D5BA 2H2WA 2J7PD 4PC6A 4URZR 3S1LA 2ZJ3A 4DEXA 2A5DA 4JGGA 4YQFA 3T9EA 3TTWA 5FJIA 1DKPA 4GMDA 4N3CA 1KVQA 3VC7A 2IX9A 4H7KA 3WRVA 5K09A 2VYVD 2H11A 2HNBA 1K6EA 3W2IA 2A9OA 5JYBA 2X5KO 2I80A 3EQ7A 3BWCA 1MAUA 2YIVX 4NBLA 4BO6A 4Y1RA 1SHKA 5F2KA 3D31A 3HB1A 1T4GA 1ZH6A 1E66A 2Q29A 3JAMA 1SVLA 4YJFA 5JQGF 1AK2A 1UBTS 1ZGHA 2AEFA 3HZRA 4MRVA 4OBEA 3SS9X 2C96A 1OWPA 4UHEA 1Z0KA 3C1TA 4E5VA 3M6VA 1NKVA 3VAAA 1QGUB 3M5DA 5B58C 3JWGA 1TZKA 2ZUDA 4C6RA 2B6HA 3BMQB 4OQXA 4Q9KA 3SQLA 2GHQA 4MR9B 4KU4A 4Q37A 4RQUA 3I2HA 4XWYA 4C2UA 3TCKA 3F2IA 5AK5A 2RHRA 3IIKA 3R6DA 1W4ZA 1L3BA 1NUAA 3L3BA 5KJ6A 1EEXB 3D4LA 3CBQA 5LKAA 3GLFB 3NOVA 1BROA 3PUKA 1KMQA 3M7IA 4N03A 5JOQA 4G2NA 2AR9A 2MOKA 4IH4A 1PWYE 4KK4A 1JHXA 4CIBA 4XLZA 4EFKA 3K3PA 1GQOA 5KZMB 2DH5A 2RGGA 1VHQA 2PA3A 4L4UA 3AWDA 4K6MA 3KLOA 2FW0A 3IEUA 1D03A 4IFBA 1FMJA 3B6JA 3DBOB 3KOWA 1I1NA 3FHTA 5THXA 1E4VA 1JILA 2HM7A 1MX5A 3QYAA 2G82A 2N42A 3FMVA 4H0CA 1ZCJA 1BMFD 4CDRA 3PJRA 4UMVA 3ANSA 4X41A 2AZ4A 1IM8A 3DKVA 2PA0A 4Z9XA 1W0JA 3C6KA 2VBFA 5AHXA 5EJIA 3B1VA 3PYLA 2ZTSA 4P8RA 4PLWA 3ZYZA 4DHWA 4LYHA 2DFPA 3CA8A 2XF2A 3CEHA 3NIFB 4YAGA 2XH8A 3HG7A 4UNRA 1L0BA 1U5AA 1NJ6A 1JHYA 2OC9A 1FP4A 3CRW1 5ALTA 3RYFB 3W9YA 4QNNA 5A06A 1O5OA 4ARCA 3COPA 4MV5A 4E7PA 2WSSA 4HHEA 4HLUC 3C15C 5AVSA 1KY5A 1VGRA 3DOHA 5BW5A 2WMYA 1RAEA 2NVUA 2UXDB 5I51A 3R6LA 4XR4A 1N2CE 4NENA 1R4NB 1H0KA 2J3MA 1NR1A 1QH1A 4MP8A 4ND7A 4ZCLA 2X40A 4ND6A 2C88A 2D74A 2JFGA 5C46F 2Z9DA 1ZK1A 3WIBA 1J0DA 3GFQA 4MPRA 4XYBA 1SBNE 3V5NA 3ZDFA 4N6GA 2PZLA 3GCWA 2VZLA 4QYIB 2DYKA 3COWA 3W5AA 1E3JA 1WXQA 1JA0A 1NSTA 1I36A 1X7DA 4ASUA 3O84A 3A1FA 3SFZA 4OLBA 3IT0A 2I0FA 5HF8A 1KGSA 2ZW9A 1C3OB 2W2XA 1DDGA 2HDOA 1NSFA 4U9HS 2ZR8A 1CE8B 1ORDA 4W5HA 5GM1A 3T5CA 5C2JB 4CKWA 5K0JA 2P8SA 2Y76A 1S2IA 4OJMX 2AMLA 2CVOA 2QAGB 2V7WA 4NQRA 5DI9A 3DO8A 4K88A 3ZJTA 3FIJA 2HMTA 1KI6A 4FB5A 1J9EA 1TTHA 1WRBA 3FYUC 5CLQA 1T1EA 2QT9A 1SUDA 2ZJ7A 4TYMA 4M53A 2IXBA 1K08A 2FMXA 3PQ4A 4ER3A 1DLIA 4LGCA 4X1IA 3U37A 4C20A 1ZH8A 2CMFA 2Q21A 4EGCB 2NW6A 1IM5A 1N6IA 5JVDA 1DCTA 4KFRA 4MP3A 4AUKA 2YNMA 4BY9E 1PGOA 4FFOA 3HM2A 3PHGA 4G63A 3RGGA 2NAFA 4KLCA 3N3BC 2GCNA 1MORA 4RIHA 5FUXA 5B1YA 5C80A 4A92A 2PX0A 1ODIA 2OCXA 3UMFA 2R44A 1EDEA 3PDHA 3T8YA 3Q2IA 1H2ZA 3CJRA 3TUIC 1M6WA 4CMJA 1TYZA 1O89A 4Q7EA 2BMAA 4B85A 3D7NA 4J76A 1Z0SA 5DT9A 4TQAA 4EAAA 5B36A 2EFGA 4Q00A 3KXDA 4N9QA 4DNXA 4IYRA 5I7WA 4URXR 2DRIA 1YBMA 3GH1A 3SG0A 2HU2A 4MPTA 4DE5A 3CNEA 3BTOA 1LBIA 3K9QO 3KWLA 1QFJA 4C4SA 4URFA 1BE6A 5FEMA 1O87A 1RWXA 1R6TA 1ZRSA 2ZIXA 4KQHA 5IAKA 2QL9A 4G2TA 1C7FA 2YWEA 1D5CA 4HGYA 1OXTA 3GUCA 1TVCA 1DAGA 3ASZA 1QIIA 3QVGB 2PZFA 4V39A 5EIBD 1KQ3A 1NNI1 2Q4EA 2XMSA 2DQKA 4XTCS 1L4YA 2WYIA 1IE3A 2RAPA 2DBQA 3AHEA 1U98A 3A05A 4CFZA 2ORED 5GV8A 3PGKA 1DJNA 2MTBA 3L0ZA 3Q3JB 4GECA 3JD0A 5A6SB 1JWLA 1GQSA 5EJ6A 1NV9A 5G4LA 5A4KA 5I8WA 4XAQA 1SIBE 2JVKA 4HLDA 4W9NC 4D98A 2RHWA 1OAOC 1FDVA 5AKYA 4LRQA 1GSOA 1N2ZA 2D2XA 3R8CA 3ILYA 4KOAA 4BMNA 2HXGA 2EF0A 2OHHA 2D4AA 1QGYA 3UBMA 4RVUA 3AQ4A 3ENQA 2XBLA 3UENA 5J2UA 4F9EA 5K0BA 4DPLA 1SXHA 2WJZB 3EEYA 1Z8HA 3R6WA 1NVVR 2OAEA 3E5HA 4KP7A 4MTCA 4UJ5A 2CFSA 3L40A 3B5EA 3AUFA 5JIBA 1Y7LA 4ZREA 3UMJA 1I51A 3PWKA 3ER9A 2QPLA 1I80A 3OLVA 3DDOA 4GSYA 3QIAA 3ZCSA 1Z5NA 4CIWA 2E55A 1FEZA 4ROTA 1P4SA 4CBVA 5BVGB 4R54A 4H7EA 4D6XA 2QBYA 1QH0A 2O50A 1K86A 3MRTA 4L8VA 4QECA 1V5FA 4L5BA 3WYNA 4RU1A 4ENSA 1ZHOA 4ZCMA 2Y93A 1Q12A 5HS4A 1ZXLA 5BO5A 1ODFA 3K2QA 4NMWA 4XUDA 2XOEA 2G7MC 4BJHB 3C41J 1ZOLA 4JCCA 4JUIA 3WSTA 1X1EA 4AC9A 1T13A 4EP1A 1KFEB 3JVDA 3TUZC 2QYHA 3LUAA 3E70C 2C20A 4MA4A 4U9UA 3BREA 4PZPA 2EIHA 4DIDA 1M10A 4XVCA 3IEMA 2HSGA 1NOKA 4HYEA 4A10A 5JY1A 3VH4A 3ND7A 1TAUA 2BHRA 4GSLA 1OKKA 3KQSA 2NO5A 4I7EA 4NYMQ 5E6SB 3BHMA 4EHKA 2AEMA 3N0RA 3DDNA 1CCWA 4D44A 1K8XB 1USKA 3BRCA 3UW3A 3N59A 1ENOA 1GYRA 3B7GA 5KOHB 2ET6A 3L4KA 4YMWA 4EDFA 1AXRA 5C5CA 1FXWA 3HA3A 1MO2A 4OK6A 5IZ4A 4LFCB 1G55A 3IBGA 1LWOA 1DHRA 2I4NA 2XVYA 1BYIA 3WGKA 1Y7PA 2Q27A 2RB4A 3TGWA 1MGOA 3KPJA 1IY1A 1Z62A 4LDAA 1GPAA 4E3WA 2V8OA 2CXNA 4G9EA 1NVDA 5FF9A 4E21A 4G5YA 4I4TA 5JPIA 4B84A 4DC9A 1APBA 3GQBB 3OFVA 4G1UC 4AKHA 3H97A 1S7GA 3AERA 5CGZA 5FI5A 4YAIA 4AWBA 1N0UA 2XGSA 4H9GA 4OU4A 3IMFA 1AVTA 4LHSA 1YS9A 4E08A 4UHFA 4CMIB 1XZFA 3U0VA 3OPQA 2QS9A 2O0KA 3I9FA 4ZO9A 5C18A 2GCOB 3BSWA 4HQ6A 3KHKA 1XMJA 3DFUA 4J0FA 3L6OO 4GMHA 1M8FA 2GZRA 1O3YA 3WMGA 1X7ZA 3E9RA 1LDYA 2GPTA 2N47A 2BI7A 3HU1A 3P9NA 1O5TA 1YS4A 4S1TA 3KXIA 2P4QA 2IZ7A 5JC8A 1URPA 5AW4A 4UBKA 1RRMA 4YV1A 4W6QA 4V0LA 1JALA 2BKXA 1XPJA 2LCFA 1T29A 3FFBA 4O08A 1Z35A 4QIHA 3WP1B 2W90A 3I73A 2ZZNA 2PE5A 4RHFA 1H0SA 3B70A 1LQTA 1W4BA 3KEFA 5A0FA 1OWLA 4FFRA 5HIAA 4NYIR 5AR1A 5D5PA 2VLBA 4HXFB 4KQWA 1DWQA 3C6ZA 3QOXA 1EXNA 2HQOA 4UC0A 4I50F 3JSAA 2HUNA 4RVHA 5IRCD 1QB7A 5TPWB 2VEOA 3V1NA 1WDKA 2ZRFA 1JG2A 3RS5A 1NBMA 1ZP6A 2Z0MA 5C32A 3ADKA 3T7JA 3OAAD 1CETA 4EJ2A 1CUEA 3RSOA 3I5YA 5ALDA 3JZMA 4LWPA 4NCKA 3AB7A 4FOSA 2XCRB 1QFZA 2MR6A 2WICA 1LTKA 3N86A 4UZFA 4X6UA 1R9MA 3VR5D 2NUAA 2WTBA 3UKJA 4II3A 2PGNA 3SBDA 5K8TA 1JDBC 3W8DA 3HBNA 3QWAA 1N32B 2WJ3A 1AF7A 3HK2A 3DXXA 2HQ1A 1LVHA 3GJ7A 4KNWA 3KEQA 4RIEA 3ZGLA 4UEOA 1JMYA 4UTVA 5JEDA 1IFXA 2XB4A 4HR7A 4WJKB 1JPJA 5B53A 3QA3E 3BHIA 3O2JA 5SZIA 3PC4A 1XVUA 1OCEA 4AU1A 1R12A 2QLTA 4RDIA 3LA6A 1W75A 2YWFA 3THXA 4C6SA 4DG8A 4DSOA 4QJIA 1WLSA 3ADDA 5I9TA 3UOWA 2C8LA 1F6DA 2ZAYA 2H54A 2QTFA 2C2HA 3Q9UA 4YXFA 1YBAA 1UM9A 5CEFA 1PSDA 5GVRA 3I42A 2WVJA 4LA4A 1P0CA 3BGSA 3NKVA 4EFNA 4Z3OA 3I32A 4FQ7A 4WK2B 2V58A 5JC1A 4TMTA 4E7OA 5EL0A 3G2KA 4CIAA 1XEXA 4OYYA 3CPJB 1K9SA 3TOCA 4DLKA 1BO6A 1M2OB 1PVVA 2QV0A 5DFAA 4FGKA 3CURA 1KJZA 1YRQA 3H5LA 4IGFA 1NNSA 3WHIA 1TA9A 4Z4GA 1ESCA 4DTIA 1CR4A 2A4MA 1Q1AA 2RBEA 3IURA 1P74A 1JHAA 3QQ5A 4UNQA 2I33A 2BZSA 2QRPA 1N6LA 2YWHA 2HSZA 2XNSA 4WZZA 1U9JA 2R1VB 3WNCA 4ZZIA 4C07A 5KYYB 4E03A 1UJ2A 4Y9RA 1L7MA 3G5UA 3MRXA 1DKRA 1OYWA 4JD5A 1M7HA 1X42A 3EISA 1KWGA 2PFKA 1Z0AA 2XWJI 1I30A 1JQLB 2H4YA 1WMSA 1JVNA 2ZYUX 3A8TA 3FF4A 4HQ0A 3IBCA 4MIEA 4BVLA 1JHVA 5GWXA 2J9FA 4MQ6A 2GHRA 4IVQA 1G3UA 3D43A 3G0GA 4IX9A 1W73A 1N25A 2NU8A 4P0PB 5CDTA 4WGGA 1U0NA 3DZHA 3LPCA 2NX2A 3FXAA 4RH1A 5EHIA 4MK4A 4Q0MA 3SQWA 3WRXA 1XYYA 4HNGA 2DEUA 1T8UA 1RQPA 2J4FA 3CH5A 2C9YA 2I4MA 3IP9A 1DB3A 2GARA 3QM1A 1I32A 1V0JA 1Z88A 4LMBA 2Y6UA 5D6OA 3THSA 1Z8FA 2VDNB 1QGZA 2RBKA 1AQ6A 1NOIA 1TL7C 4WIAA 1XRRA 2X0JA 2ZFUA 5DNAA 5HDBB 1EBBA 4YV0A 5IX8A 4R98A 3WGGA 1WUKS 6CHYA 1OXUA 3LZ6A 4W99A 4NONA 2GPWA 4IWYA 4CMGA 3SZUA 3ETGA 5L4SA 4AW9A 1R4AA 1OPRA 2HX1A 1KZHA 4MKFA 1ZNZA 1QIMA 221PA 2P62A 3ETDA 1IY2A 1E1QA 1JKIA 4GR9A 1GGMA 4HI0E 2Z6VA 2BEVA 1N2OA 3F1KA 4ZZ2A 3VI4B 4I8XA 2GFQA 2I22A 4MGKR 3C6YA 5GM2A 5JW6A 5CBPA 3R8FA 1M8KA 1JWAB 4OGKA 4TS1A 1CY8A 2ZKIA 4FSHA 5EI5A 4J1SA 1OAKA 4FZRA 1DC6A 3NHBA 5A1TA 4UOEA 3C3XA 4FS3A 5KYWA 3LC0A 3DWGA 2C4HA 3WIVA 2H51A 1N0HA 1JS1X 4Q3AA 3UGJA 2VF8A 1L6RA 2X8BA 3BF7A 2BFDA 3JQFA 2VDOB 1Z17A 3GV0A 3PSAA 4MRSA 3VNAA 1SOVA 8OHMA 5L8VA 3PXBA 2X2OA 3GRVA 3CUKA 5JDIA 1IVSA 4OUDB 4WW0A 1EXWA 3QUSA 3MWKA 3II6X 1H4QA 4V1CI 5I4BA 4HO1X 1FMTA 3WICA 3WLLA 4CQNA 1U94A 3CV3A 4BO4A 4CM8B 4ZMSA 5I7RA 4R84A 2FOXA 5CNJA 1H2XA 4F3CA 1N5OX 5LZ5A 1XC7A 1YS1X 1U4NA 3BBLA 4MRAA 2IYQA 5BSMA 1T6XA 2AN3A 3BXXA 4YAEA 1PL6A 1V3UA 2QT1A 3ETNA 5TR9A 4U3JA 2PMEA 4Y8VA 1WD7A 2DJ5A 2I62A 5AUQA 1J49A 1DAMA 3MWDB 2B20A 2RHOA 2ZETA 4KMOA 4O4JF 4M9UA 4EHDA 1UCFA 5JROA 3M82A 1K5HA 4BFTA 4DTCA 1BWQA 1E9VA 3SYMA 2R1TA 2QD4A 3DKIA 2V1UA 5A2QA 5A2GA 5CFLA 5DYIA 1R0KA 4P1ZA 5FTKA 3VFDA 1PNOA 2WI8A 3E7DA 3H18A 4G8BA 4PPQA 2NZ2A 4E2XA 4EUEA 4BV8A 1ZSVA 13PKA 1H2WA 1QWOA 3FNEA 1ZO8A 2GNOA 1RXVA 3F49S 3T3IA 3H3FA 3UAZA 4UDXX 4F11A 3DXYA 4UBMA 1AM4D 2DY0A 3KKPA 4LTMA 4P4SB 2RDMA 5DISB 4D3ZA 1Z15A 3ACDA 5CB6A 1Q7GA 4P6VF 3NBAA 4Q1AA 1A9OA 1L8XA 1U04A 3GB9A 3IVAA 1H05A 4GRIA 3RI3A 1FSZA 2BF4A 3CEJA 1TADA 3DB2A 4R2JA 3L07A 3OJLA 3IUYA 3TFWA 2PSHA 4FFWA 2FUKA 2QZ9A 2AWNA 4UXJA 4C30A 4OV6B 4GI5A 1CIVA 2RI0A 3WLEA 3E7FA 4CPDA 4IDOA 4QDOA 1TUBB 4RKQA 5E7JA 4EG4A 4M99A 2XVAA 3AI7A 4PSAA 3ZDRA 3L79A 5FBHA 1WCYA 4OXQA 2QRQA 3IAAA 2O19A 1Y8AA 2J7PA 4TYNA 4JBGA 2X15A 5TGDA 4AJ4A 4RJLA 4HQLA 1G9TA 1CUCA 2V7PA 3VJLA 4E14A 4BMOB 3REQB 4DT1B 1F0NA 1FPMA 4K7JA 4MHSA 2BKUA 4P2GA 2VQ3A 2JBAA 2Q3HA 2VT2A 5FHRA 5TNXA 5HW0A 2IPXA 1HDOA 2FXIA 3OOEA 3QYJA 3DW1X 2V7TA 4QG7A 4M0DA 1K7YA 3PIIA 3RSQA 3HJNA 4PVDA 4R4JA 3QU2A 2X1LA 4W7HA 2V3CC 3OZDA 5EUMA 2B5WA 4ITVA 2C2WA 2OV3A 3KTOA 3PC8A 1TCUA 2LTAA 4UE6A 3WQQA 4P7JA 1JJFA 1SUAA 4XZ3A 3I01M 4IS3A 4MW4A 3ZU6A 1J7KA 1XFAA 2EW8A 3EUAA 3TLMA 3RF7A 3FZYA 2GZ3A 4PSDA 5J59A 3H84A 2BY4A 2F8TA 2O3UA 3JQAD 4B6FA 4IUCS 1CUVA 1RHJA 3QJYA 3VSAA 1Z83A 4BNJA 1U7TA 4X8OA 1QDUA 1HL3A 3WBJA 4QSHA 3OM9A 1NHGA 1X1SA 2DSNA 5AJZA 3TG8A 4MWEA 2BEWB 2EZ9A 5G0WA 3MHTA 5SYMA 5BN4A 1F0KA 3PEFA 1VFNA 2FQXA 2ZB2A 5DRYA 1XAJA 1MV5A 4TRMA 2BMFA 5FUBA 3T95A 5DW3A 1V16A 3IS3A 3KDSE 2QZPA 3K94A 1PW5A 4R2IA 1CYEA 4RW0A 1P91A 3ZLVA 3L8MA 1S7CA 2NWQA 2PUCA 3WLQA 1RACA 3X2SA 4LY0A 1CQXA 4F60A 2BT4A 4WKNA 4DQUA 2C31A 4IV8A 2ZJAA 3O8CA 5L6LB 3RAEC 1KVUA 2K7ZA 1PVOA 2NUTA 3EC2A 3FPJA 2JHPA 4BGDA 3G2NA 4LY3A 4QBKA 3ZHBA 1IUNA 1AQUA 1NBME 1RWBA 3D6MA 1T36B 1ZINA 2VK4A 1YV9A 4MR7B 3FLBA 4R1PA 4TXHA 4A03A 5KNDD 1GQ2A 3MTAA 5HRCA 1C7ZA 4LCEA 4E1BA 5ES3A 4JDUA 1P1CA 4PC1A 4C4XA 4ZEOA 4YJHB 3IBSA 1XDWA 5AJYA 1T35A 3RF6A 3O8RA 2FDRA 2GDJA 1AHIA