1KQOA

Crystal structure of nmn/namn adenylyltransferase complexed with deamido-nad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
233
Chain Sequence
b'EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEAAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
publication title Structure of Hhuman of Nicotinamide/Nicotinic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 233
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1kqoA00
2J09A 3UMVA 4RUKA 3KT0A 4EG3A 4ZT2A 3K32A 5TS2A 4EG6A 4ND6A 3N05A 3TZEA 2PG3A 1I6LA 2Z08A 1TYCA 1MOPA 4DNXA 1WXGA 2CUZA 3GMIA 4KKVA 2CSXA 2HGZA 2DEUA 3IVGA 1KR2A 3JXEA 3INNA 4R2LA 2E0IA 1WZ2A 1QTQA 4JYZA 1NZJA 4UZFA 5DEOA 2D54A 1WXHA 2DUMA 2J08A 3CR8A 1GTRA 5KCMA 1GZUA 2YWCA 4FZJA 4EGAA 5TEWA 1N2OA 2Z09A 3COZA 2CYAA 1KORA 3H05A 4MQ6A 3DV2A 2JANA 2YY5A 2QTRA 1A8HA 4J76A 3ZUGA 1ZJWA 4EG7A 1F9AA 1X6VA 2AG6A 4YMIA 1KAQA 4RPIA 1QNFA 3P52A 4MW6A 3FDXA 3IMGA 1M8GA 1JEDA 4HJRA 1MBZA 3FH0A 2CV0A 1PFYA 1O94C 2CFOA 2G36A 3RBAA 4WSOA 4ZCRA 3AKZA 3ZXIA 1IHOA 2RE8A 1I2DA 1JIIA 2AKEA 3LCJA 1T9GR 3FG9A 1EXDA 2PFSA 1IQUA 1NUTA 1J70A 1N75A 3FOCA 3SEZA 3PRHA 1PFVA 1LI5A 3OTWA 2WB2A 3P0JA 1H3NA 1IFXA 4K0RA 4JXXA 1N77A 1LW7A 3FWKA 3A05A 3IOBA 1M1ZA 4MW4A 1JEEA 1GLNA 1NUUA 1OWPA 3IODA 2X0KA 4CDMA 3ZGZA 1I6KA 1JILA 3H99A 1O5TA 3BL5A 1MC1A 3LE8A 1Q11A 2HMAA 4EG4A 1WXEA 4MUHA 1WQ3A 5DASA 2QUKA 3ELBA 2QJOA 3ND6A 1B6TA 4U7JA 3CLRC 4A91A 2CYBA 2O8VA 3H9BA 3ZIUA 4WNYA 3CVYA 4F4HA 2TS1A 3KFLA 2V0GA 1XNGA 3FIUA 1NUQA 1IVSA 4ZT7A 4JZYA 5DB4A 4HK4A 1JHDA 5KHAA 1QJCA 3AIIA 4L2IB 1JMVA 4MWBA 5H16A 4MUKA 1OWOA 4ZCPA 1T9GS 1JECA 3DPIA 4ARIA 1N2HA 4MULA 1HYBA 4MW5A 5F23A 4MUIA 4NX2A 3ZJUA 3E27A 1VBNA 4MWDA 1O97C 3MLBA 1WXFA 2V0CA 1OD6A 3RHSA 1XNJA 4MW9A 1YUNA 4ARCA 1M8JA 2CYCA 4NAUA 5HUJA 4XSVA 5AHWA 2QUJA 4YP7A 4I6EA 2A4MA 3SZGA 3H97A 1VBMA 1O95C 2JAXA 4MW1A 1H3EA 3AG5A 1T6ZA 2ZUEA 4NZPA 4I6JA 4XFDA 1EFPB 1YUMA 1TYBE 1PG0A 2O5RA 2X1MA 3UOWA 1G8FA 1WJGA 3CVUA 1FFYA 4EG1A 1QU3A 3RFFA 3FY4A 4ZT6A 3X1MA 3MXTA 1R6UA 1K4MA 2QUIA 4HPWA 3UC5A 3IUEA 2WQ6A 1U3DA 3N8HA 1IQRA 1MB9A 3H9CA 3ZJTA 3CLTD 3MMXA 2J4DA 5DK4A 4MAFA 1IRXA 3SEQA 4L2IA 3IMEA 2OV4A 1MRZA 5J58A 1JZSA 2NZ2A 2DXIA 4AQ7A 3IOCA 3NV7A 1KH2A 1CT9A 2QJTA 2R5WA 3AG6A 4Q93A 1Q77A 4GRIA 1X8XA 5FO1A 3UY4A 1YULA 1OWNA 4GU5A 5LLTA 1U7DA 4MUGA 3M5WA 1NUSA 1Y42X 1TQ8A 3HFJA 3GUZA 3CVXA 3G5AA 1GN8A 5TEVA 3TQIA 3FETA 2X1LA 2X3FA 1O6BA 4X0EA 1G8GA 4MVYA 4I6GA 4OJMX 4R2MA 1J20A 1F7VA 2J5BA 3S3TA 4U63A 2WSIA 2D13A 4BWVA 4ZT3A 3AFHA 3K9WA 3IUBA 1QRSA 3X1KA 1EUYA 1R6TA 5TGTA 1Q19A 5BNZA 4U8HA 1U7XA 1KQOA 1EFPA 1WKBA 1F7UA 1ZH6A 2HZ7A 4G5FA 1J1UA 4Q16A 3NBKA 3HL4A 2GOYA 4DDMA 2RD2A 3C8ZA 2YXNA 1RQGA 2AZXA 3CLUD 1VLHA 5K0SA 1ZH0A 1O0CA 4DDKA 3RK1A 3I05A 1MJHA 4ZCQA 2C5SA 3ND7A 5FO0A 1QU2A 1M8FA 1TYAE 4CQNA 1NP7A 4DLPA 1G59A 4KR6A 1K97A 1TFUA 3IVXA 2EL7A 2IJGX 1D2RA 1LI7A 1BS2A 3U1VA 5LFAA 2Z3VA 3PXUA 1V47A 2YWBA 3TNJA 4NDAA 3TQOA 3IOEA 2BTEA 5IJXA 4HJXA 3QE4A 1N2IA 3RK0A 2A1TR 1OWLA 1J09A 3COVA 4J75A 1IQ0A 2QUHA 5HG0A 2B7LA 5JBNA 3ND5A 1EE1A 1XJQA 2IELA 3TZLA 2E18A 4MW0A 2E21A 3ISJA 3VRHA 1N1DA 3DO8A 2VTBB 1O94D 4DE5A 4NAHA 1MAWA 4CT0A 4P2BA 1K4KA 3NBAA 2A88A 2A86A 3Q4GA 4YBRA 4MUNA 3D6UA 4OUDB 1U0BB 3HGMA 2JA2A 1KP2A 1KQPA 3QTTA 1YIDA 3MUEA 4QBTA 3SDBA 3X1JA 4MW2A 4YP6A 2DR2A 1I6MA 4DJAA 4MUJA 4G6ZA 1NUPA 4MUEA 2DLCX 3TS1A 1KP3A 3P0IA 4MW7A 3SYTA 3COWA 1NI5A 2DERA 3L93A 4UZEA 2A1TS 2BYTA 3AL0C 3G59A 3CLSD 2A84A 2PXHA 4MUFA 3CLRD 4AS1A 2CT8A 1KKUA 1EUQA 3PNYA 2J07A 5J5AA 3A4IA 4EFKA 1ULHA 1H1TA 4R0NA 1MAUA 3LOQA 1QRTA 3CVVA 3VGJA 4JFAA 1TEZA 1NYLA 3IH5A 2DPLA 2CV1A 2GKSA 1N3LA 5LM3A 4E1AA 2GM3A 3D6VA 4CDNA 2VTBA 1M8KA 1DNPA 1WOYA 2PZBA 1H3FA 1M83A 1EFVB 1O97D 1T6XA 4ND7A 2DETA 2QTNA 2ZP1A 4OUDA 4KR9A 4ZT4A 1G8HA 1VL2A 4ZCTA 1GAXA 2QJFA 4KPUB 3HZRA 4KR7A 3KT3A 1JZQA 3ZXSA 1IH8A 4QREA 3A2KA 1OBHA 1JIJA 5K0TA 2PZ8A 5J59A 3ILVA 1T6YA 3QTBA 1YIAA 1GTSA 2QTMA 2PZAA 1O95D 4MVCA 5FNZA 1M8PA 3KT8A 1J1ZA 1XNHA 1F4LA 3PNVA 1K92A 1COZA 1O96B 2PIDA 2ZUFA 1MB2A 3ZJVA 4JXZA 3HMQA 4NATA 4PBTA 4EF6A 2H2AA 2VXOA 3OP1A 2H29A 3L92A 3N9IA 2A1UB 5IHXA 4MWEA 1O0BA 3CVWA 2OQ2A 1WXIA 3GLVA 3FNRA 1P7PA 3CA8A 3UK2A 4DDHA 4G5YA 3CLTC 1NURA 1ZUNA 3A04A 1N2JA 4PBRA 4K03A 2I1LA 1KAMA 3IDFA 3CLSC 4H3SA 4ZT5A 3N2YA 4YP5A 4EG8A 1GPMA 4MLPA 1FYDA 1QQTA 4QRDA 5H7XA 3PNBA 5HUHA 1EJ2A 1N78A 3P0HA 1YI8A 2D5BA 1OWMA 2A7XA 3COYA 3IMCA 1S4MA 1QRUA 1Q15A 1V8FA 1WY5A 1EFVA 4S1OA 3F3MA 1ILEA 2E89A 2EJCA 1R6XA 4KPUA 4PBSA 3HV0A 3RJZA 3KT6A 2IP1A 5KWVA 3Q10A 1VBKA 4MVWA 1KQNA 4F3RA 1U3CA 2NSYA 1TYDE 3FI0A 3DLAA 3Q12A 1N2EA 4PY2A 1SURA 2XRYA 1OBCA 3G6KA 3FHJA 1KH1A 3VU8A 1O96A 3IVCA 3SP1A 2CV2A 1PG2A 3MLAA 1JIKA 1N2GA 1WQ4A 4TS1A 1N2BA 1KH3A 2A1UA 3CLUC 4ZCSA 5EKDA 3SZ3A 4MWCA 1NSYA 1PFWA 2XRZA 1PFUA 1UFVA 4XFJA 4MVXA 1J21A 1JGTA 2WQ7A 4EG5A
chains in the Genus database with same CATH superfamily
2VRCD 4TV9B 1HZZA 3U80A 1OAOC 3F3SA 4MGIR 1JA1A 1U0HC 1ESNA 4N40A 4DGQA 1LB1B 1XLVA 3DTTA 1SG9A 4HPJB 3PQ2A 3DC7A 1DDOA 3G02A 1EDEA 3ANNA 1JU4A 2WG1A 5LD2C 5B64A 3V6LA 3QLVC 4AJPA 1ORHA 5LB2A 5JD4A 1IVNA 2ODAA 4M9UA 2AFHE 1WBBA 3R09A 4GKAA 3VFDA 4E6EA 2Z0MA 3DPSA 5AK6A 1NVUQ 4QO7A 1H6DA 1VI6A 5DDIP 2DBZA 3ZXUB 3S2UA 1TECE 1HE8B 2DUWA 3V1KA 4OF4A 1ZK0A 3A6LA 3GH1A 5EESA 4J3FA 1P2VA 3RKUA 3P9QA 4AP5A 3CBQA 5K99A 2AJBA 1ETHA 2JGDA 5AP9A 4JS0A 1W5BA 3N7AA 5I7AA 1C7JA 3HB4X 4PM4A 5CCDA 3ZTTA 2X7JA 4DMKA 1J33A 5LC1A 3TNDA 5L45A 2CV2A 1RQNA 3FSRA 2XB9A 4GM4A 4AQDA 1Q57A 2XXBA 4EZIA 2FMTA 1Q1GA 4F5YA 3KUUA 4MR8A 1MV5A 1P1IA 1H2WA 1V71A 2ZT7A 4MVJD 3J7AC 4LJ9A 5HR5A 4E70A 4TXHA 3RVSA 4MVJM 3K9FC 4C6SA 4YR9A 1KZ9A 1H1LA 2H2DA 2V9PA 3KQLA 4B3MB 4YJHA 2EYQA 2FMXA 2XIJA 1E69A 1P72A 3RNOA 2YFQA 2EERA 1OLUA 2NM0A 3NASA 5DTRA 2PRIA 3SZLA 4BVJA 1NNEA 2OLJA 3OCWA 1IQUA 3ZTYA 1OSNA 1CUGA 1F6BA 2ACVA 2Z9DA 2P6OA 3OE7A 2MR6A 3QY9A 4O4JB 4AVYA 3G5MA 5KNDH 3URKA 1XK7A 1GTMA 1VHTA 4CIXA 2GCEA 3PHJA 1H3NA 2OBYA 1C1DA 1FFBA 2C9DA 3FWKA 5L51A 1JEEA 1DEXA 3N8IA 4LCEA 4NP6A 4XB1A 3MWKA 4P8RA 3DHNA 2C92A 4KQKA 2XECA 4DY6A 1WZUA 2C95A 4UCQA 2ZATA 3EFEA 3DE4X 5DHSA 3UENA 4NCAA 5FQOA 2DTEA 4MLCA 1PSWA 3TDKA 4DWWA 2OZKA 4H0CA 2RHOA 1YB1A 2FPPA 2PL1A 3LIPA 3EPRA 4IDFA 2JI7A 3MJTA 2X41A 1Q83A 5DE3A 4EG4A 3BYZA 1UM8A 3EZ6A 1WXEA 3QXCA 4M8SA 1M1NA 2QJWA 5A3SA 1L5QA 3ND6A 3NG1A 2IYEA 2AW3A 2C7RA 2FOLA 2WUGA 3OUUA 4NCHA 5HKKD 1GTG1 2QI9C 3MCTA 4RZXA 3ZIUA 3H2IA 1A5ZA 3DQPA 3EDCA 4GLBA 2MYUA 3WBJA 1FFEA 2J3JA 4N1AA 1FPMA 5DHQA 3EZ9A 4ND8B 4ZXPA 4IQFA 1KEUA 3E7PA 3JATB 4H7HA 5G0WA 1KIAA 2ATIA 3IUJA 3OF3A 3WWZA 2QD5A 5HQTA 2CD7A 4XWWA 3TBHA 3AVOA 2Y1EA 5FB3A 3WWEA 2AG0A 1E6UA 3ZHYA 1HTWA 3BIXA 1G21B 2FOXA 3OX2A 4IEFB 1GPUA 1Q0RA 2F1IA 2GXQA 1T0PA 4NCNA 1FJ2A 1TT5B 2G9ZA 1AK2A 3NOQA 3IXLA 4PLWA 1CBUA 4RKEA 3UNXA 4I5EA 3AVWA 5TPWB 1V16A 1KYVA 4HHEA 3UK7A 1M2OB 1RIFA 4O25A 4ZMSA 3FCAA 2H08A 3T7DA 3UM9A 1ZVKA 5K8CA 2NXJA 5KYYB 2VCEA 1ESEA 3OOEA 4L4XA 4WECA 4EEZA 1WW2A 2AUTA 2BJWA 3MWYW 4BNKA 4EOGA 4ZYTA 1FLAA 3TEMA 4A03A 4A6PA 3DBHA 3OU7A 3PD0A 3SIXA 4INPA 4PAMA 3WLPA 2FFHA 2P0YA 4U3JA 4WLVA 3VV3A 5C52B 2V7GA 2V7WA 3WC4A 3R7WB 4OP2A 4QU8A 4RQUA 1RYEA 4DVGA 1SVUA 3X43A 4DCJA 3JWJA 4DNPA 4P4SB 3L0OA 1QFSA 2W70A 3PKIA 4J3NA 3R3JA 2QRJA 1JU9A 1GNVA 1DHTA 1S02A 1ZOIA 2ECKA 3GNTA 2BY4A 4M0PA 3W8DA 3ZNNA 1JTEA 1Z7GA 2BCGY 2HIHA 1WUJS 4M86A 3WLOA 2XPCA 4NHOA 3W5DA 2FWPA 3VZRA 1Y3FE 3L4SO 2GPYA 2NO9A 1RQ7A 3DNFA 2QAGC 1NWHA 4ILKA 1KTVA 5BSKA 2QMUA 3CVUA 2VQSA 2R47A 3WGZA 4CMKA 1VL0A 4P7BA 1O4VA 4ZQBA 5H83A 4E5KA 1WCXA 3LDGA 3MM4A 4LV6A 4ZYYA 1MXFA 1RJGA 2ZBDA 4F11A 1UC5B 2H3HA 3UT5B 4MDHA 3G68A 3UC5A 2YHIA 2IHYA 1EK5A 2FXIA 2ODBA 2WJAA 4UM7A 1A1SA 4TZKA 2WQ6A 3T3EA 4K2AA 1R4AA 1JEQB 1XD2B 5TC4A 2WWHA 3QY0A 3CRQA 4TTPA 1I3MA 2RGNC 3PK0A 3S5UA 4M1OA 1UINA 5D7NA 4OX9Y 1SXJC 2R6GA 4J0JA 1XKTA 5DN6A 3V8RA 4LBYA 3OQMA 3AUXA 1PX2A 2JLSA 1AQ6A 2JARA 3RIXA 4D9NA 5B37A 1DRVA 2BEWA 1TTHA 4BZWA 4ZC1A 4WUVA 3E70C 1M1YB 3ZGVA 1YZUA 3EBPA 4QU9A 4MLZA 2GXSA 2H2GA 4BFCA 3TX6A 3OE7D 3FWYA 2BMVA 2J0UB 3GFFA 1ACJA 2ECOA 1SOMA 3I0NA 3ZBUA 4COOA 5LLTA 2R1VA 3TSZA 5TNXA 1TQ8A 4YDHB 5DSZA 3KYCB 1RLTA 2PQ2A 3L0CA 4Z1OA 2C0QA 2I2DA 4GLOA 2AN3A 1VJRA 3R3HA 1BGVA 2B2XA 5DNWA 4HYYA 4YV0A 3LQKA 4JNKA 4IJQA 1R0XA 4GECA 5EYPB 4C3UA 5B2ZA 5DYTA 5EP1A 4RZ3A 1TF5A 2IX9A 2NZWA 4MGHA 1P6XA 5SY9A 1EBFA 4GOLD 1WO8A 4D9KA 1TTTA 3MOGA 2CVHA 2FUG1 2YWJA 3IVRA 1UMDB 4R8VA 3TK1A 3K0EA 1EUYA 3A2MA 4FDVA 4L5IA 2XKJE 3DEFA 3S44A 4KUEA 2E4WA 1V3QE 4ZKDA 3G2QA 3GCXA 4II7A 5P21A 3W8FA 5ILOA 4EL0A 3SHWA 5JWOA 3ENQA 5GIOE 2QM7A 2B99A 1Q2UA 2HQOA 3STVA 4MQMA 1PT9A 3O8LA 2H1HA 1RHJA 2H2IA 1IDOA 1VC2A 2AMYA 1G8JA 2A2ZA 3FNIA 4GQBA 1XQWA 4RK6A 5DX1A 3TEJA 4KSBA 2WHPA 4C6HA 5IZCC 2AG8A 2VHUA 3JAKB 4PO1A 3K1AB 4EPRA 1QH8A 2BD0A 4RSRA 5CB8A 1Z29A 1PL0A 3OSUA 1MJHA 3HYCA 1FUYB 2QR5A 1PP4A 2BFAA 3CZPA 3ASUA 2Q1WA 3R0IA 4M60A 5E1DA 3HUDA 5JMPA 3B6JA 3ZOZA 4TM7A 2WT8A 4AKSA 1G2QA 2XE4A 5KOYA 2CLOB 1QWOA 3U4CA 3ZHZA 3AVTA 1DVRA 1G5TA 1P1KA 2IBMA 4NBVA 1NX9A 3R6TA 1ZN7A 3D7LA 3IIEA 1T0IA 2MOKA 3I9OA 1T35A 1G8KA 2QV0A 3IP6A 4JMLA 4BNUA 4TRNA 1PDWA 4HDNB 4U7WA 3K35A 2CB9A 1CCWA 4TLBA 3PDIA 3OE1A 1KRWA 4QLBA 1W1UA 2CHGA 5IYZF 1EZZA 3C6QA 1KSFX 3GEEA 5CNJA 3HCDA 2MT9A 1OPXA 1WD5A 1OAOA 3ADKA 3FYUC 1X14A 3ILHA 5F1KA 3SOZA 2AEEA 1TIKA 3K0HA 1GGMA 4EHFA 4BLPA 4MA0A 4EK9A 3BVPA 5D8DA 1P9LA 4TMFA 3WAKA 2HWKA 3ND5A 1Y7PA 4W4TA 1JPNA 3B60A 2BSXA 3HVKA 5BV7A 1X7DA 1TTQB 2XMBA 1V6SA 3QLVA 4F06A 5A3JA 1SC1A 2PUAA 4WBNF 4I55F 3KOMA 4GYJA 1DAFA 1UXJA 2Z6VA 1C9YA 3VR5H 3VJLA 1G55A 5KKNB 2R66A 4DDVA 1I6WA 3KZMA 1MGPA 1R8SA 4MTCA 2X42A 2MSWA 2P4HX 3OZTA 5HKLA 5CW2A 4LJ5A 4W99A 3FZEA 3ON5A 5EKXA 1I5EA 1YHNA 2GJKA 1DBWA 3LPNA 2AS0A 3A6FA 1PWZA 5T8KC 1F20A 4YLEA 3RPEA 2JLZA 1QYXA 4EUHA 3Q3HA 4DCSA 5DN6D 4B80A 4X7RA 2BHLA 4BYGA 2BFDB 5DGCA 4IZOA 2AC2A 3A9WA 5C8DA 4NKRA 2FLKA 5JCZA 3DVRX 3PDHA 1FNNA 4MW2A 2X22A 2XHEA 4LHZA 3OY2A 3U81A 3MG9A 1U8EA 1CP3A 2EBFX 4JP3A 3ZHTA 1EFUA 4GX1A 4L72A 3I73A 1I0LA 3OLVA 3EOBI 2FTKE 2WAMA 2WYIA 4G6ZA 4KMRA 4PC6A 1GLGA 1XRNA 4ESVA 3K7EA 4AUMA 4B79A 1X7XA 5LL6P 3IAHA 3D02A 4ENVA 1KPGA 1QAQA 3OQBA 5JPIA 3OMXA 2VHWA 5JAUA 1XWFA 3BSFA 1QX4A 2CSUA 4KQXA 5A0FA 2NPFA 1ABEA 2PVPA 3PGXA 4CI9A 4YUXA 1WBDA 2BBWA 4OHXA 1T1IA 4O2BA 2DF8A 3CEJA 2PLRA 4DBVO 2ZQ5A 1VKZA 2RHHA 2YJ3A 2UZ4A 4A1FA 4HI0E 2ZJ0A 2VF5X 3DDUA 3OKPA 4HH4A 1DIAA 1PR1A 2NPIA 2QVYX 1PNQA 3OFJA 5KOIA 3TVDA 2D5IA 3A4IA 1ZIPA 3JWIA 4YGXB 5HFJA 1NHGA 2HCFA 1QHYA 1VE6A 4FBLA 4JDPA 4L8LA 1UC4B 1IYZA 1QK3A 2I6SA 3ADOA 3DBOB 3LHIA 1UDBA 1FX0A 5DTQA 4D5EA 1E59A 5I9IA 4WCFB 1RMTA 5B53A 1WRBA 1H4QA 4X6XA 3VAZA 4RHFA 3CJQA 1LBSA 3KSAC 3VPBA 3FTNA 4RJ2A 4TWRA 1QQBA 4H9GA 5EXDA 3VVLA 2PU5A 1P81A 2G9NA 2VPXA 5BQ3A 1TJ4A 4B3GA 2VH2A 1J0EA 4KYTA 2JCBA 1O58A 3T1TA 2VTBA 1FYWA 4MMYB 2PH7A 1JQLB 2ATEA 4JSYA 3TL2A 2X2OA 3FZQA 1WOYA 4EI9A 4ZI7A 1FZQA 3LYUA 4EY8A 3ELUA 2J3HA 2F6RA 1ACMA 3OZIA 2O2SA 4P3OA 2M6LA 4S1TA 3VR5A 4BB6A 2IHUA 2XR1A 2FN3A 4OH7A 2DFVA 3H2SA 2PLWA 1QV7A 3QU4A 4HFJA 2OPBA 4KYUA 1FDUA 5LDDC 3BD9A 4JVLA 1VLMA 1MVOA 2Z57A 3QELB 5SYMA 2PRZA 4LISA 4J94A 1NVEA 2OGSA 2F1RA 2PUJA 2R97A 3PQ8A 4K87A 2DTDA 4PFJA 5DI3A 2IUFA 4F5ZA 3HA7A 3K0BA 3GJSA 1GG8A 1I24A 3EXIB 4BOYA 3C4VA 3L41A 2NLOA 4JZKA 3WK6A 1FJXA 2V1UA 3LCMA 3KT8A 3UN1A 1OVGA 1IBCA 2RJ3A 1YKFA 2FETA 2HXSA 3OJWA 1ETUA 2FDXA 2Y1KA 1K63A 1CPYA 4RZSA 4CG0A 2XITA 1RP7A 3SSNA 1F6WA 1G0NA 4MWEA 4F8EA 3AYZB 4XE5A 2AOUB 3Q87B 5BUCA 4N6NA 1KQGA 1OFVA 3VKWA 2ZIVB 2I2FA 3OOWA 2NNWB 1NMYA 4PZPA 4V0ME 3CA8A 4DV3B 1IXSB 1E2IA 3A0UA 2GN0A 4FONA 3WZLA 5HIIA 5IABA 1RMQA 1EUCA 3IR5A 1P73A 5F35A 1XMQB 1JG4A 3RABA 1ATIA 1J42A 4X92A 4FGZA 3E23A 2QW0X 4INOA 1A2QA 4IVRA 4OHMA 3VTZA 3NKLA 3K71B 4PRYA 1ZK4A 1LUAA 3T3IA 1QKKA 5JXJA 1IJBA 2H1SA 4JI7B 2ZJBA 2JKYA 3KQWA 3NBUA 1Z4JA 3UJ7A 2H2FA 3ZZMA 1FMCA 2I6XA 1OWMA 5JO9A 5L3RA 1LLCA 2VL7A 5IBRA 4BNVA 4ENPA 1XYVA 1FFXA 4CL8A 1YBHA 2RGNA 4XGRA 2EWMA 2XCOA 3L7IA 4A1OA 3KEGA 1RM3A 3HZOA 3LVRE 4YMVA 1U5AA 1WMEA 2F9MA 4G1MB 4OHFA 3UG6A 3AINA 4ZDKA 1YS2X 4RD2A 4BASA 2BFNA 2H17A 3RJZA 1BU5A 1U5BA 5L7WA 2E6UX 1T2VA 1HOXA 2A5FA 4TTRA 1JSRA 2I8LA 4CYMA 1YDFA 3R9XA 4EUFA 4EPXA 1TDJA 3G82C 3BD8A 1NONA 2JHPA 4KRYA 4X00A 1QDEA 3GJTA 1HM5A 3GRUA 2VNHA 1V3UA 4IIXA 4LE0A 2B1GA 4YUYA 5C53B 3L46A 3KZKA 4JKYA 1VCNA 2AWNA 2IY8A 5CK5A 2IT1A 4Z4EA 1SVLA 4XM1A 2FHPA 1UM9B 3VU3A 4BMYA 1Z74A 4IRMA 1GRQA 4UULA 3RS2A 4YV1A 3SZ3A 1XZJA 1PR4A 2HV8A 3H5OA 5JPDA 1UMKA 2O1XA 2DQKA 3IHKA 2YC2C 3CW8X 4FR0A 4XFJA 4YMWA 3RTDA 3OQIB 1ECGA 1PQYA 3SQNA 3LLCA 3NATA 4M8NE 4F4DA 1H2ZA 1NQXA 2QL7A 3D6HA 3IPLA 3KT0A 1KF0A 4A8PA 4B4KA 3R6WA 3JRWA 2QR3A 4OI1A 4ND6A 5DK6A 1WA5A 3MJ4A 2DHDA 4MR9A 1W19A 4FBGA 4KVZA 3BKXA 3Q98A 4LNUA 4E5UA 4OU5A 4ILEA 2QQEA 5JZ9A 4BJ3A 3PI7A 4ND2A 3HTXA 4A0QA 1AE1A 2DQZA 5DH9A 5IARA 4B1FA 5A3RA 1KR2A 4B71A 1X74A 2DR0A 2BGUA 3VR5D 2E0IA 4R0MA 4CM5A 2AQKA 2H8KA 2JFVA 2YTZA 1PUXA 1WCWA 1O4WA 1USVA 2W4IA 3QXSA 5KNCA 4R1NA 2DUMA 1U8FO 1T0UA 5KCMA 2OB2A 3MJRA 1K6IA 3COZA 4H27A 1LU9A 4FHDA 5JCJA 3NT4A 1OXVA 4Y6PA 4WK0B 3RVRA 4AXBA 1KR5A 1YL7A 5FBWB 4BFTA 1GO2A 1XFDA 3JPWA 2GAOA 1J0XO 1DTEA 2FEPA 2YY5A 3IQGX 1NAHA 4E5DA 2FB9A 1BDBA 1M2GA 2C00A 2ZM6B 1H5NA 2IXFA 3HWRA 3IMGA 4LC1A 1V3VA 4EJ0A 4HB2A 1BAPA 3OQOA 2WYUA 3FH0A 4FS8A 4MZXA 4NV0A 2RGRA 2IUTA 5AHKA 1IONA 1QYWA 3D7NA 3EW9A 2ZDGA 3NX4A 4Q37A 5FTNA 3SX2A 1EHCA 2YMMA 5I01A 3SR4A 3GJRA 1M73E 4II2A 4OK3A 3WIEA 3ZE0B 4POOA 2RE8A 4ZOLA 1SCJA 2ZW9A 3NORA 2PMBA 3LDUA 4WX2B 5DMHA 1XROA 2INGX 2BZ0A 2FMKA 3CR3C 4FE4A 1J24A 4J7XA 1NXSA 2TECE 1JH8A 4PANA 1V6CA 1ZM9A 3DF9A 4YQZA 1IFXA 4D5GA 1N77A 2WTXA 1RQLA 5EJ2A 2XYRA 1Y4AE 3AUUA 3C6KA 4KUHA 5HKAA 1G8AA 3DZKA 2DECA 3VJKA 4E2XA 3FYCA 3QE9Y 2HRRA 2DJ5A 3LBFA 3KAQA 5IXYA 2XA9A 3LA8A 2XB6A 5TVGA 1I7SB 4UNNA 2GNOA 3VSDA 4OQFA 5F3RA 4EQZA 1R0LA 1M5TA 2CJWB 5IG2A 2EG5A 3DF7A 3GX1A 4WLOA 2CB0A 5DXJA 4NCBA 3LE8A 4RHTA 4DXHA 3PEWA 5E6UB 1SEPA 2XMGA 4DIUA 1J2JA 1YMQA 3EZXA 1RADA 4RO0A 1Q74A 5JJCA 3D5EA 1KS2A 1UBHS 1EEHA 4DCNA 4G67A 1BN7A 2JEYA 4J1NA 1EDBA 1KPHA 3RM3A 4YY3B 3A9VA 2Q5FA 4TMXA 5JBQA 4OHOA 5FRDA 1EX6A 3YASA 3WJ7A 1SVMA 7YASA 2BONA 1UXIA 3AFMA 5DYIA 2QIPA 1KQFA 5KPDA 1CE8B 1JL3A 4HK4A 5FV7A 2XMPA 1KYYA 2EBWA 3PGA1 4YI3A 4AYTA 5K8JB 2FFAA 1OI3A 2ZLBA 4MDYA 4R54A 1JSZA 2GYUA 1G18A 2IYOA 4Z0PA 1QBKC 5BY2A 5JXIA 3GNQA 4HH3C 1V1JA 5THQA 2WNIA 3FWNA 4TX1A 4PLYA 4YAWA 2L18A 5JARA 4HLUC 1WXQA 4L16A 3BRQA 4TTJA 3B89A 1IZ7A 4XIFA 5ALJA 4NR0A 2Q21A 4LFBB 4DADA 3P2EA 4NOKA 3PQ7A 5AJHA 2FZ5A 3GDOA 1FSGA 1GCIA 3FVRA 4RPJA 5CDYA 1FFCA 1WXFA 2YRFA 3DL4A 4H7KA 3B6EA 3QTLA 4N65A 1OD6A 4N12A 2PKCA 2IDKA 2C20A 2JFWA 4MW9A 3IDAA 4ARCA 3LPCA 1RM5A 2X5XA 5KX5B 3C16C 5JFTA 4GXTA 1OCEA 3F6RA 5WRFA 5B7PA 4RK1A 5IAOA 1E1CA 1ONPA 4HAIA 4M0EA 1E9BA 4DLZA 2VP5A 3VNSA 1A9ZA 2GN6A 3DHWC 3GEDA 1HE2A 2ZE7A 5CDFE 1A8SA 2JAXA 2ZJ1A 3AERB 4F04A 1NYTA 4BUZA 1RXSA 4XUDA 5JZSA 3ZVMA 3L01A 1KYIA 4OOEA 3PNPA 3WFZA 5KNCD 1M67A 4DWOA 4P5DA 4FQ8A 3WYGA 3K8ZA 3RFFA 4HWPA 2EFYA 5JCJD 4CFZA 1CC1S 2AZMA 2OFWA 3AUFA 3JALB 5BWLA 1JJBA 1R0ZA 4YRPA 4HPWA 4TXJA 2QQGA 3OUTA 4AZ0A 3G9UA 1FP2A 5HE8A 1C7ZA 4DRXA 2ZUCA 2QVCA 1N2SA 5G4KA 4DUZB 4NONA 1V5IA 1FTSA 1KZYC 8LDHA 3OZSA 1E98A 4ZCIA 1YA8A 4ZVPA 1RRKA 3KUKA 4ZVTA 3AR5A 3RS7A 1QR2A 2X9VA 3KKKA 4K2HA 4NAVA 2IUEA 3B52X 1SOAA 4QOIA 1Y6FA 4LJ6A 5J58A 5LP6B 1U0OC 3CNQS 1G4AE 3PFIA 1LSJA 5GZ3A 4LZPA 4P0QB 3ZC3A 4N9QA 1X9HA 2UZ1B 4QJIA 5HFNA 1CUXA 2G67A 1Y1QA 2ZRCA 2JIMA 1HLFA 4CNBA 3THWB 1A9OA 2IXGA 4J0EA 3IA2A 5I9MA 2J0SA 3TPZA 2OUKA 1J9ZA 3UOAB 3R5HA 3BM5A 1GPH1 3GRPA 3IRUA 1XZBA 1V7ZA 3SEFA 3PVSA 3TVYA 3VNUA 4PZDA 2EQBA 4UPEA 5LZ4A 1KDPA 4DKXA 1E89A 1TK3A 2X3FA 3CGWA 1UL1X 2C97A 3IUQA 4OI4A 3OCVA 1QG6A 1B3RA 1CUIA 1R6VA 4WTOA 4PG7A 3TE7A 1E0DA 5EUMA 3SZOA 4BU0A 4F6RA 3S3TA 4BNYA 3ENKA 2C2YA 1E1LA 2PKQO 5J5VA 1YRWA 4LKRA 5TQ2B 3UPUA 4EPWA 1BS9A 3HN2A 4X1KB 2G6BA 2J45A 3OIYA 4NMXB 3K9WA 4RNCA 5HM6A 3BRWA 2YXBA 4OQPA 1WL8A 1P4HA 2E9SA 5IBCA 1G9XA 5J23A 1BEUB 3KQPA 1EFPA 1P7WA 3WNVA 2COEA 5IVPA 5CFNA 3KALA 3KO8A 1UMBB 4KFUA 3NR2A 1VPLA 4BBZA 1YBAA 1GN9A 4B3TB 3L4BC 13PKA 4UTVA 2FMIA 1DCFA 2X0RA 3EPLA 3K6RA 4AN1A 1KDRA 1UFOA 3C4QA 4RPHA 4BCDA 3Q3EA 4UVDA 3OFVA 3SDSA 3ADBA 5DJ5A 2BP7A 3MCVA 4PTLA 3X2EA 3PJDA 4KN9S 3I3OA 1J07A 2HCRA 4B83A 2QM0A 3F3KA 3HBMA 4KLZA 5TS3A 3N2GA 4HZUA 3RTAA 1P1HA 3F5QA 3WGHA 4DV7B 1Y82A 2GESA 3TGLA 3ITEA 1MIOA 2QL9A 1IJFA 4X95A 3GZJA 5IWCA 2CLLB 4JI8B 1XZFA 1AMUA 1CDEA 3G9QA 4DA9A 3K94A 1G59A 2ID4A 4JBYA 2OGTA 3KLPX 3F7NA 2C4TA 3DLTA 1P1BA 1JA9A 3NJRA 1EEXB 2VHCA 5KTRA 2JKVA 1BS2A 2GJ8A 4L3OA 2VHVA 1LF5A 4Q3DA 2OCDA 1VQ1A 4A8TA 2FW9A 1OI2A 4TLEA 4ESHA 4ACAA 3ZE2B 3M4JA 2BM8A 4IZHA 2O2YA 1UAAA 3P9RA 3O4HA 4M1WA 5KDOA 4LUCA 5EVCA 2JEZA 3DO5A 3QVOA 3VUEA 1K8XB 1K68A 2WU8A 2IY9A 1OWLA 2GYVA 1VPVA 5JNVA 3TQCA 1G21E 3FFXA 3H0CA 1NNLA 5A7FA 3I83A 2Q5IA 1G291 1PR3A 2IZ1A 3TLGA 3EXHA 4YCSA 3A3PA 1A2OA 5HUJA 4HT3B 3ILXA 4R71A 1KJWA 2IELA 3LIIA 3VNAA 4FXOA 5CFOA 5JADA 3N5CA 4K3UA 2WU4A 4F7DA 3L07A 3P2MA 2E18A 1OAAA 2I4NA 2VCHA 4L07A 4OQ4A 3AVQA 5AVWA 1PVDA 2HCJB 3H5WA 3ISJA 3RDPA 2C5EA 1QYCA 1JF8A 4M49A 1SHZA 2ID7A 1QONA 5FPYA 2BMFA 3OX1A 4L7QA 1IIRA 1X7ZA 3EDQA 3JTEA 3RSCA 2WWIA 2V3VA 3K05A 5BSVA 4WEQA 1NRXA 5K3CA 4WAUA 1M72A 3CEPB 3HR7A 2IDZA 4U7FA 5K3FB 4ATNA 2DWPA 4AI6A 3EAGA 3CH4B 4HFRA 3TPFA 3MPOA 1E60A 4NOLA 3GQBA 4ARZB 1RVDA 4PPGA 1V26A 4IOLA 3LZDA 1KI8A 1YQGA 4IIBA 4P58A 4CKCB 4UVIA 4WY8A 4TV8A 2HIMA 4Y2GA 3GC6A 4GGPA 2HBQA 4HAXA 2QTBA 4KOAA 1J8QA 3GLUA 2OXTA 3N8GA 3KV1A 2R4UA 1OLXB 4IDGA 3TD6A 2EKZA 4LMAA 5FKJA 4MS1B 2AFIB 3GP3A 3VR1A 3LKBA 3ZQKA 4DR6B 4PZAA 4HB3A 5JATA 1GTZA 1UADA 2EDAA 3AL0C 2WJZB 2WKRA 3HACA 2WMYA 2Q2VA 4V0KA 3PQ3A 5BV0A 2H5EA 4BFWA 3OMWA 4MUFA 3HVIA 4RS3A 1R4NB 3TSYA 4WKBA 1TQ4A 2J5RA 2MHCA 2FPGA 3H42B 3LQ1A 4J0IA 4NCJA 4P81A 3WKCA 1OLSB 1AOXA 1T2CA 2F59A 1BFKA 3VTKA 4RH0A 4BB0A 4LSZA 5KYXA 5JYDA 3TNLA 1P39A 1H1TA 3MTEA 1QBGA 2XDWA 4J43A 5BNFA 4WJLA 3N0TA 1IWPB 4I1IA 2H63A 1PR0A 3V1LA 1M1YE 4MUAA 3CZ5A 4LAFA 2RGEA 5DGTA 2IV2X 3ADPA 2C5GA 2E5LB 5GQSA 3AVUA 3MTGA 3UB2A 1VPEA 4X6LA 3IP5A 4QXQA 1GXSB 2C57A 1Q3TA 3W5IA 4E2ZA 4BIIA 4EA7A 4B4OA 1X80A 4P31A 5ADVA 4CLRA 4FE3A 3ONWA 4JJ7A 1VCIA 3EVFA 1YQDA 2VDWB 4ND7A 2F64A 4EB3A 2BDTA 1BEZA 3NT5A 4KR9A 3SQOA 4Q5IA 2OZLB 3HWWA 4UQPA 2NT4A 3KCQA 3O74A 4KPUB 1H2AS 3KHKA 1RC0A 2VFAA 5HBGA 3ELWA 3L8FA 3HY6A 2IGBA 1PT8A 4OU4A 3JZAA 2O14A 5DCUA 2I6TA 4HLUA 2ZRBA 3FNFA 1U2DA 3C98A 4R83A 5ER9A 2CJPA 1I2CA 3M9LA 4RHEA 1N6IA 1B0AA 1J0AA 3GFTA 3AR2A 4D9HA 3L5KA 2R85A 2WIDA 1RCUA 2NTNA 1WE2A 2RMKA 3OZWA 1COZA 4MP8A 5DYWA 2ONKA 1O6CA 1UZUA 1XTBA 5IJWA 2ZJ2A 4AWAA 1E0AA 1XB2A 1D09A 4BYMA 2OWEA 1DQSA 1I4LD 1PQ4A 2FF7A 2Q3EA 1L8OA 2VSFA 3AJDA 3OZRA 3QFSA 1V8BA 3QVSA 4UBJA 4BO8A 3FSGA 3GIDA 1DOAA 5CFRA 2LRHA 3PPYA 2FQQA 2PUCA 3USES 3VX3A 4R41A 4WV3A 4I5FA 5CB4A 5IDQA 3G89A 1JHPA 3ICEA 1GDHA 3TZBA 1KRXA 1KAMA 1MF7A 3G8YA 4R98A 4X61A 3U3RA 1R66A 4J90A 3EARA 1RWMA 2ZIWB 3NPAA 1YTUA 5B30A 4AM8A 5BURA 5K0NA 4NS1A 1FTGA 4QD3A 1B6RA 1YASA 3TX2A 2QEQA 4ZALA 4TSRA 4AMVA 3ETLA 1V1MA 1CRWG 1T2NA 4C08A 1QOZA 3RBXA 3GCGA 1QYDA 4YYZA 5HUHA 3FPHA 5HHTA 3P97A 5ECYA 1MQSA 1TMYA 4LWQA 4LY0A 5CGQB 1ISGA 1Q7CA 2GZDA 2RK6A 1AUXA 2RGXA 2JBAB 2X4IA 4J0QA 4RY9A 5ARDA 1BDIA 4EB0A 5ALRA 2JGDB 5FI0B 2J1LA 4C01A 5J40A 4LYFA 4QQFA 3KT6A 3MS7A 4HDRA 3ZWMA 3CX6A 1SUPA 4QARA 4BBAA 3PWTA 3VU9A 4BTEA 3A3NA 4N54A 3WL5A 4EI7A 1R4ZA 1RYDA 4P53A 2QLBA 4B81A 2QQFA 1XZHA 1KK1A 4MR8B 1YAJA 4BMOB 3CUYA 3VNVA 4KOEC 3KYBA 2ZOSA 4RPLA 2HKIA 3NALA 3X1WA 4EUSA 2HH9A 1I3OA 4JBHA 3VBCA 1H1LB 1DC8A 4DPKA 5D7BA 3B1YA 4OX9B 4YJHB 4AJ2A 1YACA 2RI0A 1TMOA 4LDJA 1ZJZA 1JDPA 3SQDA 1OLUB 3PKZA 5K8TA 1NVXQ 3M5PA 3PXAA 3PHHA 2B1RA 3L7YA 2YOGA 3AMVA 4KXFB 1DXHA 2YVKA 3ECCA 1IVSA 2ZGVA 2ZB7A 4R31A 2QGNA 2LXNA 4ZCSA 3TUIC 5BQXA 4TM8A 1JQBA 2MJLA 4URUR 4IFEA 1J0CA 1DINA 2JCGA 3IQXA 1C1DB 3MD0A 1CUJA 1J21A 1M6NA 1PW5A 4B7XA 5EIEA 4GVXA 3B3FA 5L7TA 2C2KA 2JI4A 4P82A 4ZPXA 1J90A 2F3QA 4AJOA 2P6MA 1HL3A 2KM1A 4ME6A 2ORWA 3RT7A 3CNLA 4EFLA 3HJGA 4G0NA 3OPYI 2GARA 2XQVA 5TY0A 4I50F 1T36A 2FPPB 3L4BA 3DYIA 4UEJA 4OM7A 3EFOA 3O83A 3V7WA 1U02A 1M1NB 2XLCA 2CXHA 3BWDD 1E2HA 3KFXA 4QTZA 3L1HA 5E4TA 3TTSA 2F4VB 1CFZA 3GPBA 4KLNA 3KCNA 4C76A 2B8EA 4RMIA 1ZJYA 1PSDA 1TVCA 1LBHA 3WB1A 2O7RA 2X8AA 3EZ2A 2NYAA 3SJ7A 2GVZC 3NXKA 2C5LA 1SHJA 1E7QA 4KJXA 4WINA 4X6UA 2FSUA 2XUOA 4OI0A 5H5JA 2ZTMA 1TMGE 1J2RA 1HE4A 1L1EA 2SECE 1ECFA 4MGYR 4NYIR 5KJEA 3USZA 4CTMA 3TGPA 4ID3A 5IF9A 3MIZA 4ZRNA 2ZCUA 5HVNA 1U7PA 3F73A 1VJCA 2OG2A 4HNAA 1XA0A 3ABZA 5GONA 1AD2A 2K6GA 2Q99A 4EY7A 3OG9A 1JQEA 3ZHOA 3BRSA 4JJGA 3ZW9A 3O3CA 1B7GO 2G36A 4ZCRA 4C2BA 2Z6QA 2Z2JA 4KXVA 3ITNA 5K7SA 1ZD9A 1JIIA 1QGOA 3I92A 4G1UC 2VC2B 3T3DA 1ONSA 1U2ZA 3OC0A 3UK6A 2PFSA 3KOXA 1J23A 2DKNA 4RK5A 4RDHA 3V8EA 2GBGA 1QLWA 2ZE6A 1XR3A 4U3JB 4XSGA 4ZO4A 3EGEA 1DAIA 4RQAA 2Z04A 1SD1A 4DLRA 3GUYA 1V43A 2CJYA 4OJTA 1ESMA 3K2QA 3R7LA 3W06A 4B32A 3HYNA 1K8RA 1US8B 4TXMA 2YW2A 1ULTA 2NVUA 3AM5A 3BXPA 2JI9A 4OKSA 1B14A 4BRWA 4G5GA 4EHAA 4FHFA 1D4FA 1PK8A 3OM0A 3PX2A 3PNSA 3QNMA 4NDNE 4PG6A 3D54D 1NUUA 5CD9A 4QGFA 5B2EA 4ZJUA 2IE8A 2JCYA 3RBVA 1SUEA 1P1JA 3FYTA 3KQSA 3ZWWA 4LFAB 2B0JA 3A9CA 1JXAA 2ZSIA 1ORTA 4D6XA 1QRRA 1S3GA 3R8CA 1XZGA 2FFQA 1HDZA 2J85A 2X8BA 4I5GA 4L0MA 5LIRA 2DCMA 2GM9A 1M9NA 3R4VA 3GZTB 4U7JA 5JY6A 2AQIA 3C3BA 1NBHA 3OCYA 2Z56A 1DBPA 3UA3A 2YHIB 4RELA 3ZHCA 2TS1A 1SVWA 1QXSA 2P9FA 3C3WA 1EKXA 2GERA 3T9FA 5BW8A 1KNXA 3K70D 4KE7A 2PGAA 4DYDA 3ZE1B 5EJAA 2VQ6A 3D7KA 3K6JA 1UPCA 3L7LA 4FYJA 3VJRA 4LTMA 1SOUA 1E18A 3EGOA 4K05A 3WY9A 3GT0A 1D1PA 3SVTA 3T5CA 1T3TA 1ZU5A 4V2UA 3ADCA 2GH1A 2NXWA 3F1LA 4BXOA 1SCQA 1XJWA 2BEWB 2Q7XA 3M1YA 4TUYF 3ZD9A 1LGYA 1FFHA 3EGIA 5BQ5A 3O82A 3ZWAA 1XTJA 1Z56C 3IAS1 3KVNA 2JLUA 2EBHX 3F8WA 2QTHA 4Z9BA 1OXSC 4MCHA 2FUG6 4TTAA 1D2AA 2P9YA 3Q8KA 1Z25A 3PLNA 3E8XA 4JI1B 3KXPA 1VBNA 2NSDA 4I1OA 4BNXA 2R1VB 2B1QA 4YH1A 1W7AA 1UODA 3FZGA 2HTEA 3HCPA 4D81A 2J67A 3D0KA 1VKHA 3BXZA 1TZKA 2XSZA 4IMIB 3RHSA 1W5FA 5I8ZA 2CNLA 4LYHA 3X1XA 3DEZA 3BIWA 4RLFA 2PX2A 4IHKA 5IBQA 4PC2A 1URPA 2VPZA 5HF9A 4RD3A 2DH5A 3K9NA 3MCWA 4QQKA 4MHOA 2IF0A 1KMHA 3GYGA 4I6EA 3AF3A 5C8ZA 4XUCA 1NJ5A 4JLSA 1RRPA 1H6BA 1S5PA 3KOOA 1F2TA 3AI7A 4AJEA 5LYJA 1ODKA 2CXUA 1F2UA 4NZPA 3TRKA 1G9TA 2JZNA 2IVFA 3IUMA 4B9EA 1PWHA 2G1AA 4YFVA 3DDWA 3HO8A 3V4RA 4OFWA 1UOQA 5SY4A 2ZITA 4O1HA 1EUZA 3JQAA 4TWAA 5G0SA 4B44A 4M38A 4MA5A 3KPYA 2L69A 2QG4A 2D62A 3M83A 4DR7B 3R24A 4N5LA 1SQGA 1G66A 1RJWA 3C5WP 2WHPB 4N7JA 5DTMA 3N8HA 3R8FA 4PFKA 3MUOA 5DHTA 4DJFC 5K6TA 1XCMA 5DOZA 1ZSVA 3WLHA 2ATVA 4B43A 4LZWA 2E4UA 4OA5A 2BGLA 3LLSA 4IYRA 4UUMA 4EBBA 3SYRA 1SO8A 4HX9A 2HA5A 5HZHA 4S1VA 2JBHA 2WE7A 4FSXA 4G8CA 4YMLA 5LB4A 3ESQA 3N75A 4KWEA 3KXLA 1KFEB 4Q93A 4WI1A 4JB2A 1OGYA 2PRJA 2ZVPX 4GP9A 4KFRA 4MGEA 1OH7A 1V2HE 2ON6A 2QIOA 3LM8A 4TTTS 5EMKA 3RLFA 4BVEA 3D6NB 4E1VA 4ZAXA 3LQFA 3D1LA 4MJ3A 4M1ZA 4BNLA 5DSTA 5JTTA 4XYGA 1P4AA 1Q5PA 2NW6A 2HSGA 4L6IA 4A5SA 4CKEA 1AQLA 1LNZA 1NE2A 5B1YA 4FOSA 1NY5A 5KTSA 1JKJA 2L42A 2X1LA 3DMTC 4D74A 5A4DA 4P4GA 4OK6A 3D3KA 1D6JA 1EFKA 3CQ9A 4KQCA 2R1TB 4WDQA 2CJXA 4Y1RA 3SC4A 1NT4A 1VIVA 5H3LA 5JE8A 1ISRA 1UBJS 4DDUA 5DT2A 2BTQA 5LD2B 3AUKA 5CNMA 1SUDA 3ZGYA 3NOVA 2HI0A 1LK5A 2XDQA 3QQ5A 4M0DA 5DO9A 1OBFO 1GYPA 3PUWA 4FS3A 3LUBA 4UCWA 3T7CA 1FDVA 4FR2A 3VOSA 4DZZA 4GICA 2ZCJA 5BQFA 2D1TA 3LY7A 5G1PA 5BNZA 2FRVA 1W87A 2JH9A 1I7NA 1TVKA 1ZH6A 3GBVA 1ZUIA 4ITRC 3HB7A 2PA3A 2JLYA 3LYLA 1IEXA 3ONEA 1QCZA 3R0VA 2IWHA 1N5RA 1QTRA 3LUAA 5JVDF 4QFMA 3G0CA 2HQBA 4RZ2A 4ZREA 5B3AA 1L8LA 3FM9A 2AZXA 3QLUC 3T4PA 2XVMA 4OJKA 5EZYF 1NN3A 4JEUA 3GRZA 3ZD6A 2QQ5A 2H85A 3LGSA 3LTEA 4F7WA 3D6MA 2J4CA 2JK0A 3OX3A 2RHGB 1TK2A 3GLHA 4X94A 3RHZA 1Z9BA 2NZXA 3II6X 3NW9A 3H0EA 4YIKA 4PG8A 1G4HA 1IXZA 1TU4A 2FSVA 4W6QA 2OORC 2QTZA 3LY5A 1U28C 4RVFA 4EJMA 2A59A 4UDOA 4JVMA 4KQ9A 5FI5A 2Z43A 4AX4A 4AKTA 1X7XB 1O9HA 2AN5A 2E1RA 2ZSDA 1HL7A 3RT1A 4ZZIA 3A2NA 1SULA 4MP6A 4EMSA 1Q2XA 4JBXA 2NAPA 1N9KA 4PRKA 1FUUA 1USGA 5E0OA 1IAQA 3H6GA 1TO2E 4Y2VA 2QYHA 2XSZD 3PEYA 1ISPA 1I3LA 2WB4A 3TKLA 5K6RA 1YXMA 4O2BB 4Z2AA 5LLDA 1CJCA 3JD1A 4QPZA 3VDMA 5JANA 4LK3A 3P71T 2YMLA 3ACCA 1IY8A 2FR8C 3W8RA 3N3BC 4N8EA 3Q7PA 3CE6A 1E9AA 1ID1A 3AEZA 4LXUA 2JW5A 1NI4A 1RYMA 3I8XA 4KIUA 1W36D 4WERA 2LWIA 4WLFA 4BMXA 1P7ZA 1B1CA 4HX2A 5FWXA 1MR3F 3IALA 5B7QA 1NBWB 3C8UA 4AP9A 3WE7A 2Z4RA 3KOYA 4QTYA 3HE3A 3TM5A 4JJKA 1N4AA 3UCXA 3JQAD 1BWPA 3IAXA 1L7XA 3ONNA 4WZ6A 5HOQA 5JISA 1GQFA 4OTZA 3B8HA 4S1NA 2CW5A 5JS2A 4BX2A 2VTBB 1TM2A 1U9JA 3IDQA 4JIGA 4ZHQA 4Q4CA 1OZAA 4NYIQ 2BI7A 3FF4A 4JUFA 2KWIA 4ZI7B 1T2UA 3KQYA 2UYOA 2A88A 1ZYUA 2K7FA 1ZUHA 4BJ6A 4X60A 1GG5A 3BFJA 4CR8A 3W2EA 2OPHA 4LSWA 1AV6A 4GYYA 3HWSA 3EWNA 2EZ8A 2HL6A 4HXFB 5JWHA 4CCSA 4F97A 1HT3A 1PO7A 3WIOA 3F0TA 2O4CA 1TIBA 1OROA 2OSBA 2O2HA 3N39C 2EHDA 5H02A 4ECEA 1H8EA 1NY6A 2BKXA 5K3AA 2F3PA 3TW8A 4DY4A 1PNRA 2REQA 5DI3B 1KKMA 3LCVB 2DR2A 3BTOA 2VJQA 1T4BA 2ZUVA 1JBKA 4R3WA 1UOOA 2OENG 1QGUA 1PDVA 3GJ5A 1N5JA 1CSEE 1EVQA 1HNNA 2QPOA 4M8LA 1EWTA 1E3JA 1NI5A 5BSGA 5ENVA 2ZR9A 2PJUA 2VDJA 5BXYA 5TIIA 4TYMA 5DBFA 1I01A 1XI2A 3WKDA 2QN1A 4XD2A 3TAHA 3DE2X 3CVJA 1JN0A 1LDNA 1U0TA 5COAA 2JAQA 5ALLA 5JNRA 1UWKA 4XARA 2P2LA 3QA3E 3ZDYB 1BS1A 2ANBA 5HDQA 4PN7A 5JRDS 1P0QA 2G08A 3NTQA 1YNSA 4PLGA 4GI1A 4OHPA 1EESA 2PQMA 3T52A 4NXNB 1QKIA 1EUCB 3KPVA 1Y6JA 2PS1A 4MEBA 821PA 3WYCA 1IG3A 1CXZA 2JLCA 3I2FA 2C9CA 2ZSHA 1CEEA 2I4OA 1Q21A 2O06A 3P9KA 3VHXA 3BE6A 2VRBA 3E9MA 4S05A 1DFHA 4JA2A 1IHXA 4WOCA 4EHIA 3H17A 5IT9A 3C5EA 4O0MA 4JLWA 4RFLA 3E81A 5DRTA 2IS4A 1L5GB 2CXOA 4AO8A 1XRMA 3IB6A 4RTKA 1EP1B 2Y77A 3HZHA 4J1TA 3FCUB 2XA2A 1DMSA 1M8KA 3C14C 5K05A 1Z06A 4M36A 1FFXB 1QANA 4FFPA 1ZD4A 1GTL1 3WI7A 2BBSA 3AH8A 1RLOA 3AUYA 1B0PA 3G8CA 2P2SA 3FD8A 5FPPA 5IN5A 3HCFA 3AR9A 3MRXA 4ZCTA 1YV9A 2JJQA 1SIUA 4IJMA 1DJOA 1NLMA 2R3SA 4B4UA 3PPWA 1U5BB 5T6BA 4PGGA 1X1SA 3PDWA 1TJYA 3A2KA 5JC1A 2YY6A 4UAGA 3O2SB 3BWYA 1G3RA 2CGEA 3MQ4A 2RG7A 4TL6A 4IJUA 3O8QA 5KYNA 3R9XB 1NGSA 1EHIA 2AKAB 2YVLA 2YJ6A 3PSHA 2PNJA 3FWZA 3KJNA 4V1CA 1R10A 5AHXA 3DFIA 1OASA 1PZMA 1DEAA 3I5AA 4JI6B 4Y2TA 2Q4OA 4XFKA 4K86A 1MRNA 2VJPA 3A0RB 2QX7A 5MF6A 4KWCA 3B70A 2ZPAA 3DDZX 2B61A 3Q8WA 2ZIUB 4QDJA 4YAFA 1LQ2A 3ZUPA 4DLSA 5F2KA 1D2HA 3WKEA 4X20A 3JSAA 1S2NA 4DR1B 1D7OA 3UJBA 3ORYA 1BCRA 2R6FA 1Y1LA 2ZREA 4LWZA 2OLEA 3TOCA 3RWMB 2SKEA 2Q6VA 4KO3S 1BD3A 2IYFA 5ESDA 1P7PA 5C80A 5JYBA 4HADA 2OCLA 4I66A 5TQVA 1Y63A 4LC0A 3RREA 1NURA 2Y1DA 3C3YA 3L8YA 1BMTA 1VG8A 3OBBA 3BHIA 3S2EA 3WLLA 3V3KA 1OFIA 4EHKA 2MWMA 2QD3A 4HNTA 1GPJA 2ZYAA 1J6UA 1YDWA 2OILA 3A10A 5CPFA 1G7RA 3WRXC 3PUYA 2LE0A 3NRCA 4MR9B 4NJMA 1F1JA 4BGIA 1FXWA 3NNDA 4LNUB 5TV2A 1PBTA 2PR2A 1RHKA 4I4TF 3BFKA 1J8DA 1JHYA 2O23A 3PGKA 4RM2A 4F3CA 4WKNA 1KWGA 4UCXA 3N1UA 5E6RA 2BHNA 3WFJA 4AO7A 1DPGA 2ZTVA 2Q3FA 3SM3A 3USCS 1UBUS 2H57A 3HVHA 5KREA 4OAQA 1H8ED 2HPAA 2HREA 4M55A 1ODSA 3M6AA 2V97A 3V4SA 3VX4A 5KYKA 4XJVA 2VSOA 4U0JA 3G0OA 1THGA 4K9SA 3P5BA 1KVSA 1M5RA 5GVSA 1C1XA 3D3EA 2PGOA 3GJXC 3O91A 1WHTA 3ABSB 1NIPA 2PGLA 3Q10A 4BKUA 3OTHA 1BE6A 4R1QA 3RIMA 2PGNA 2VHYA 4JELA 4AJ9A 4MO9A 1T3HA 1X1AA 1O0SA 1CJKC 1JJVA 1KK0A 2CHQA 3NHWA 4L5YA 1AQNA 1HDXA 3L7OA 3WISA 1OMOA 4UMVA 1RYBA 1EXNA 1UIRA 2HFJA 4ZOLB 4H0FA 1PG2A 3D9QX 4LOKA 4RTJA 4KWIA 1G2OA 2FZGA 1JP7A 3SQLA 2FMUA 2PTHA 3VH3A 2YV3A 3BMXA 4NIMA 2XUKA 2A5YB 3ESXA 1WM1A 5M34A 4BEJA 1G6KA 1N0IA 5JWRA 2NPOA 3SHOA 2Q1XA 2B78A 3QOWA 4M76B 1ZI8A 3IO3A 1JGTA 3ETEA 1K7CA 2PQ0A 2D2FA 3K0CC 4ITUA 1X1CA 4C07A 2WSLA 4Q12A 1CETA 3W4JA 2AFIE 5DW0A 4BHTA 1RWKA 1P1CA 1Z5GA 3MK31 4NDZA 2QVLA 3ROFA 3R0ZA 4MVJE 3N05A 5ARBA 3D6FA 2FE1A 3R5TA 2DH6A 1IHDA 1KVTA 4ZQHA 2YQ5A 2A7QA 4Q3EA 5L40A 4CG3A 1BE0A 1L5KA 2BCJQ 1Z38A 2CWWA 1DIGA 2WM9B 3IVGA 3WRYC 4FCVA 3MUNA 5CHEA 1CUFA 3G1TA 4KH1A 4O8CA 3TTYA 1WZ2A 3ILYA 2ZR0A 2RKWA 1H22A 1MTZA 2Q46A 5DEOA 1P2SA 3K2IA 1TLFA 3H11A 4JAVC 4E5SA 2XCTB 1YTLA 2FV8A 5ELLA 1WPRA 2EIXA 4G3XA 1YNOA 4M4SA 3N8KA 1L5HA 2R6R1 4CG1A 2WWFA 3CZ9A 1SBQA 3KRTA 4Y1EA 5IPFA 4HTFA 1GQQA 3WMFA 1Q1NA 5KOHB 3K1YA 4J6FA 4F3TA 1GRRA 1BJRE 2I3ZA 4XAQA 2P5SA 2DTXA 2QTRA 2AK2A 4HUQA 3PRYA 4IP0A 3JQGB 4ND4A 1FPQA 3U37A 1XPRA 5JJLA 1P7VA 2JH3A 3CZAA 4BO7A 2WWTA 2OV2A 2OCIA 2Y0CA 4LQCA 4OHRA 4EKNB 4OVKA 1WWKA 5JAPA 4TZ6A 4JT8A 4Q18A 3VSAA 3ZE7A 2W2OA 4N0MA 3JCZA 4PGHA 5AMXA 5H80A 2XTZA 1VIMA 1M76A 3GA0A 4JIMA 2PUDA 2HJVA 2ZVQX 1QCCA 3WQQA 5FFMA 1T24A 4RMJA 3WYAA 1Z4MA 5FBHA 2OAQ1 3I01A 3P9NA 1K7FB 4PX5A 4M1MA 2G4VA 1DU4A 3U3KA 1J70A 1ESZA 1P17A 1RQRA 3RH0A 1ODCA 4CKWA 4JQYA 1CUHA 2ZRAA 3DWIA 3QEJA 1KVQA 1E3LA 1E5TA 1KRHA 2MDTA 4JOCA 4C78A 1Z36A 3IOBA 3LBHA 5JU6A 1M1ZA 1MA3A 4FMCB 2TRSB 1E1CB 1U2TA 1A1VA 1F5NA 2AV6A 2NU8B 4B17A 2VDVE 4BEVA 4L3WA 4KL8S 4F9FA 1A27A 3KLNA 2XE6A 2ODEA 1UDWA 3BH0A 4FGSA 4Q19A 3UAZA 1GGFA 4P3XA 2F8SA 4J9UE 4AF8A 3I9KA 1HYEA 1F06A 3ZGLA 2X4DA 3U4AA 4DJTA 2V7QA 1L5RA 2DG2A 4I1YA 5C51B 2A9PA 2PL3A 4MUHA 4FNGA 5JD6A 4C4PA 2DBYA 5A4KA 5CNKA 1N6PA 4TT8A 4O8ZA 3I0MA 3ZYZA 1WCV1 4HAYA 3FR8A 3K9GA 3TLMA 5EIBD 3ZWNA 4MYSA 3KNZA 3SJZA 4KO8A 4AZ0B 1RLJA 3EDRA 3V3TA 4DRXB 1WP9A 1EVJA 4IQ8A 1QORA 5G4KB 2Q6TA 3FCYA 1H2HA 3IBSA 4YV2A 1USIA 2CXRA 1IN1A 2X0DA 4B74A 4D99A 2FW7A 4LTNA 5JI3E 4A2PA 1DWUA 1ONNA 2W2PA 3AHDA 4IIJF 2YZNA 3QEKA 4Q01A 5FUXA 3T95A 1YZFA 3K96A 1KFCB 2QAIA 2WU1A 5G4LA 2FPLA 3IBGA 5IK2A 4P7FA 2HHCA 2ZTSA 2HHHB 2P9JA 3ASZA 4GYKA 3GDGA 3HP4A 3RHTA 2G0TA 1U2RA 2DPMA 2FG5A 1ISIA 3NHRA 3ZK7A 1YWGO 3HRHA 2R8BA 4KI7A 5EHQA 4PQFA 3ICQB 3U7QA 4QLAA 3LVBA 1FDIA 4ZO6A 3RIYA 3H5AA 1SCAA 2VI5A 3RO7A 5KDDA 2V0CA 2G1PA 1XDDA 3AV3A 4HUJA 4C4YA 2Y05A 5B55A 1UC9A 3PXDA 1VHJA 3F5DA 4WDRA 3LPDA 2G07A 3WL4A 1F60A 3L0PA 1VE9A 2ETVA 1NW6A 2P4EA 5AHWA 1XLUA 1V25A 3T06B 3ABQB 4MWTA 3B1WA 5B1DA 1RZUA 4ZVLA 1L5SA 3QXHA 4RY8A 5CYPA 1AJEA 3H2JA 4KNWA 3BZUA 5B3LA 2P7IA 5CXSA 3HH8A 3BJEA 1J5XA 2RKBA 1I4TD 3M5CA 1EFPB 2P77A 3FDZA 3NHZA 4R84A 2J7KA 5LSAA 4PHGA 2KLHA 5IXJA 1ZIDA 3LBAA 1WJGA 3H3XA 1VKOA 4N48A 2PHZA 2ZJZA 3L7BA 3NM6B 5TQ0B 1KXJA 3W2HA 3X1MA 4CW7A 3ITDA 2ONYA 4U7PB 2B98A 4ZQCB 5BR8B 4OUKX 2UDPA 4D8TA 3OJEA 3CUTA 1UKCA 4LECA 1Q1QA 4U2GA 4OHUA 3EVGA 4HLCA 3M7IA 2D06A 1SBNE 3B6KA 3SWWA 3N2GB 3WNBA 5MDHA 4HZUB 1IRXA 3S2IA 3DDNA 2ZWVA 4ETWA 2WU3A 5DXAA 1MIOB 1G19A 3THYA 2DB3A 3PTAA 2G8LA 3OFSA 2XWJI 1ZJ5A 2WUVA 1RQ2A 4DEYA 3R40A 4LX8A 1TRKA 4M21A 1SKQA 1W5TA 5ES3A 2ENWA 1VL1A 3SS7X 4GRIA 5BMVA 2V54A 5AM2A 3H5NA 3I01M 4M1EA 3TQSA 4DCMA 1OT3A 2EX1A 5YASA 2I91A 2AHOA 3LP6A 1WD7A 1EIZA 4EPTA 5AW3A 3IAFA 1GN8A 5TEVA 3JQRA 2O07A 3EC2A 3WRXA 2HA4A 2OD7A 2VJNA 4FGUA 4ZD6A 4FP9A 4AAYA 1G8GA 3BE4A 4HDSB 2YV4A 3EXHB 4OL0A 4U63A 1YE5A 3CUSA 1UXHA 10MHA 2OC4A 2V7QD 1ZISA 4GNRA 4PQEA 4Q4LA 5FADA 4TL8A 2KYRA 1C9EA 2AYXA 3AFHA 2NO4A 3IUBA 1T6BY 3MMNA 1DLJA 1BKYA 3K53A 3H1PA 4YJ3A 2IOYA 2OM2A 5K1ZA 4PSUA 3RSOA 1AC5A 1RWVA 1X7ZB 1ODTC 2RB5A 1MEJA 5BSFA 2HU7A 4PU0A 2NUAA 1P5FA 3HI6A 4GXQA 4KU4A 4LQDA 5ECWA 4XLZA 2AC4A 4GR5A 3VHRA 2PMCA 2Q6LA 2C0CA 1FCJA 4YALA 5FA6A 3ZE8A 4FHEA 3W5AA 3QX7A 1HNWB 1DAEA 2D3WA 2FRDC 2JDIA 4EHBA 2J7PA 2VAVA 3GQBB 2O2DA 1EH5A 4QRIA 1JDVA 5LDHA 3BCRA 5DTEA 1EX7A 4G56A 1UXGA 2BKLA 3BK1A 2IWRA 2EQ5A 1VZ3A 2B5WA 2R2AA 1RPAA 3FTCA 4KQHA 3DR3A 2Q0XA 2FEOA 3PC8A 5IK2D 1QSGA 4XQCA 4TV8B 2HLHA 1JWBB 3DZIA 2Y2VA 4DW8A 1USUA 4G63A 4DLPA 4KX5A 3T1OA 2XWQA 3B85A 1PHRA 4A8JA 6GPBA 3GUUA 4FFWA 4EPYA 1JAYA 1D2RA 1JLSA 1FIUA 1FLDA 3G0DA 3AR6A 3U1VA 5LFAA 1A98A 3PJRA 4C4ZA 1O95A 4KXWA 1K86A 3CRRA 3N5KA 1ZMOA 3TNJA 3X2FA 2PJZA 4OXXA 3PX7A 3IOEA 5TSDA 3RKSA 4K1LA 1Q16A 2HAEA 4WBXC 1UBSB 1FF9A 5IVDA 3AM4A 2VJAA 2QP9X 4PGFA 4CMIB 3HN6A 5IF3A 5KYXB 3QE4A 4QOSA 3LO5A 2RI1A 3QU2A 1T8SA 3BOSA 1WHSA 3HDYA 1VXOA 1SHUX 1JFRA 4AP6A 1HE3A 2AD5A 2OO3A 3FFTA 4HGNA 4JXJA 4WLEA 4AO6A 4WGFA 1M66A 4CHTA 3U7HB 4OD0A 1XCLA 4TKMA 4K6KA 1W85A 4FEEA 5H81A 3QNWA 3E4DA 3TZLA 2QN7A 5L8VA 1RTTA 2RHWA 3O1HB 3GXOA 1YU6A 1L4UA 1P5ZB 1PL6A 1IMJA 2HW8A 3W5JA 1TADA 4PGAA 1P5RA 1BWRA 4G0MA 3VRHA 3QFFA 1K5GA 3OT4A 3TRDA 1CQPA 4NV1A 1X80B 1PJ8A 2QX4A 1ZL2A 2EL9A 4GOND 4CLRB 1F12A 3UFXA 4JGGA 3R2JA 3R7NA 1SKAA 2QW8A 5TF0A 2A1IA 2XZOA 1Y7IA 3AW9A 4RVCA 1CF4A 4B7CA 2V6MA 3FCXA 4F3NA 3B9RA 5IFKA 1AHNA 3B51X 5JJIA 2R25B 3PIRA 4RADA 5K09A 1L5MA 4RPGA 3QKWA 3UMRA 3DHYA 3OWXA 2QJRA 1LNSA 3DAPA 2C4VA 1KU0A 2H18A 5JSZB 1HG1A 1MW9X 3A1NA 2YXDA 3NAZA 3M9XA 3X1JA 2C9MA 4JR2A 1HOTA 4J0FA 1E5VA 3ET5A 4PWYA 1PGJA 2V6GA 4NZ9A 4D7AA 4YPVA 2GAJA 1T8WA 2IYLD 5EHGA 4G01B 3TS1A 3LT1A 1Y3BE 4C5CA 4KBYA 2EAUA 3CPSA 3U60B 3SYTA 2R6ZA 1CIPA 4BAUA 1LK0A 2AF3C 3DGFC 4I1RA 3NTOA 3QQPA 4KAJA 5FWNA 4UJ5A 2RAFA 4QFCA 4XOIA 1LPAB 5T4HA 2WSSA 5FFFA 1VG1A 2C5FA 1QR6A 2P5YA 4YASA 4AXXA 5AJXA 2J87A 2LIPA 2JFOA 2W71A 3FWHA 1WSWA 1U8AA 1JKFA 2FQWA 2FJPA 4HLNA 3H3FA 4KXLA 3OOJA 1PEYA 3COJA 3JQ7A 3D31A 5BOVA 1B4DA 1ECJA 3JQ9A 5SZJA 1Q1AA 2C0PA 3DP9A 3PZRA 3RYCA 3E82A 2NADA 2NTEA 5FJJA 1GHTA 2QVXX 4OBBA 4OJQA 4P2GA 1CJMA 1CNMA 1E9RA 3MYRA 3MTDA 5SICE 3HCEA 2ZT6A 4EKYA 4P33A 5FBQB 1EFLA 1VGQA 4LOJA 5LZ8A 2C7PA 4E1AA 3TQQA 2XCSB 3FOWA 1PV1A 2GM3A 1FZTA 3BJMA 4JMPA 4CDNA 1DRUA 2GQ0A 2QYSA 3L79A 3QX9A 4X1IA 2PZBA 4DANA 1H3FA 2EG9A 2JDID 2J7PD 4JCOA 4YVFA 4UFNA 1J8MF 4LF6B 4KGDA 4BAZA 2BELA 3LA6A 1Y7HA 2CLEB 2PSHA 4LXQA 1SFRA 2VXBA 2HK9A 2W90A 1KARA 1VMDA 3N0RA 4DGSA 1W75A 1RWOA 2A4KA 2GK3A 5LDGA 1UEJA 2EP7A 3VU9B 1X7YA 1P2FA 1WDTA 2BMDA 3BIFA 4HQFA 2IXEA 4NSNA 4REQA 5K3OA 5KBYA 1XV5A 3VTFA 3OM8A 5K0FA 3MYYA 2YJZA 4CM7A 1O95D 3C3MA 2O57A 3CTMA 5BRJA 1M8PA 1SGWA 2EFHB 3MSCA 3NRJA 3O2NA 3MWJA 4DLXA 5KTPA 4PSKA 3O8NA 4C04A 1K92A 3VZQA 4QBHA 4Z5XA 4RAOA 5LOVB 3RNLA 2X3YA 5IH7A 1NVWQ 1ABBA 4CL2A 1RKBA 1V5FA 1N5KA 3LUFA 2FRXA 4E5MA 2IYQA 1OJ7A 1EZ1A 1GIAA 3QYJA 4LV5B 3PBKA 3ZK9A 4G8DA 5IW8A 4DA0A 1CR6A 5DLQC 4ETMA 2W6PA 5HJ5A 2H1WA 3JTMA 4MWGA 4P0PB 3UCFA 1NU6A 3KQTA 1M7GA 5E7QA 1L1FA 5TE9A 1B8VA 4NMWA 4A7PA 4LXTA 2ZYHA 3A04A 3DFKA 1E5QA 3PFBA 4N5MA 4NBUA 3LJKA 4WKOA 2FZLA 5FNVF 3V7NA 4TKVA 5DNEA 1D6NA 5EE0A 2ONJA 1SIBE 3SNHA 3OZVA 4YP5A 1CZKA 2C2HA 1QQ6A 3RE1A 3KK0A 1L7MA 3S29A 4EG0A 1T36B 3ZDZB 4Q4JA 4MCIA 2GASA 3EFOB 1MFPA 1EDZA 2Y6VA 1ENPA 4Q9AA 5FLEX 1EJ2A 5K3SA 3UZUA 1ZFNA 3VO9A 3VVMA 2ZJ6A 4DLTA 1SD5A 2ZRMA 1CS4C 3B13B 3AKYA 5CTJA 3T4UA 1S4MA 3JPYA 4YONB 5KJCA 4Z9AA 2IIQA 2W58A 7MDHA 1CLEA 2XUDA 1Y4ZA 1WB4A 3FMGA 5ALUA 3WMXA 4FM9A 5A05A 3QKUA 3U09A 1PI3A 3IUYA 4QBFA 2HPZA 4LHXA 4CUZA 3QG1A 1JS1X 2HJ9A 4YHBA 1NVVR 1JVNA 1W4BA 1UQUA 4X64B 1CR4A 1WVGA 3L0ZA 5IKEA 3CONA 2AXNA 1V41E 1NIJA 2GPSA 2ZJFA 4ALMA 2F62A 3THRA 2TSYB 3DT6A 3REFA 1X1TA 2XGGA 2A94A 2I55A 2YWRA 4HNAB 3CCFA 1OBCA 1FTWA 4LIPD 4QOEA 4RVDA 5GONB 1JE1A 2WSSD 1HK7A 5JS1A 4CM1A 2HXYA 1FRVA 4RCZA 2ZS9A 1H2EA 1PGPA 2DQYA 4ZV7A 4CHGA 3PL1A 4OBXA 4W8OA 4BLTA 3CUUA 2BFFA 4YWHA 3CX8A 3OTGA 5F77A 4V0SA 5DHFA 5EKDA 3U48A 2B2NA 4B2PA 4BV8A 1VG9B 1OYVA 2ZG6A 3GV0A 3PDCA 1QIMA 5HCIA 1MLDA 3IHTA 5ALPA 4HWTA 4UKDA 1QGDA 2XRZA 1OKKA 4OV6B 2VAPA 1BRMA 1B00A 2ZS8A 2ZYUX 3BJIC 2ZBQA 1MV8A 1Z15A 5FYDA 4OY3A 2VK2A 1U2SA 3FUTA 4NQRA 3TW4A 5JS6A 1ZAYA 1U7UA 3UMVA 3G0GA 3IMKA 1G3IA 1DKLA 3TKAA 3H1FA 2EHJA 4KXNA 2EX0A 5C37A 2ST1A 1XEXA 2YW9A 1VLZA 3TRJA 1RAEA 3CR7A 2Z2IA 2WJPA 3U3XA 4D6YA 1CQZA 1M34B 2V7BA 5DHRA 3BPSA 1ZNZA 1MEEA 4UZFA 1FRNA 4WA8A 3FXAA 1E3MA 3ZBPA 1L4GA 2AI3A 1AN9A 1V1RA 2J9YB 4NMMA 1ZW6A 3DHEA 5F52A 1PK7A 1SHLA 5TGDA 4FZJA 4EGAA 1G8MA 4YQFA 4F4IA 5MGNA 4U39A 4Y2SA 2X5NA 4DLUA 3DDOA 2QGZA 4JJ4A 1G5RA 4NNJA 1N2CA 3DV2A 4FGWA 3VPXA 1GPNA 2WVJA 2NXNA 5DNDA 2FR0A 1DDIA 3NHBA 3F9RA 3ZH2A 2IYTA 3ZDFA 1F9AA 1GILA 1N9ZA 1OQAA 1PKEA 2BFEA 3GA5A 4MUBA 2AG6A 2V74B 4YMIA 4GUAA 4R1MA 4HWKA 1NE7A 1PJAA 2G40A 2VT7A 3D8UA 3M6XA 5ADUS 3FX2A 5CLHA 5K0CA 2EW8A 3PU6A 4WK4B 5A4AA 1SBHA 2YJGA 3CX7A 3OM9A 4JWKA 1K06A 1LI4A 3OKAA 4WOBA 3WO1A 1AB6A 4YCNA 1UPBA 1DIBA 1T1GA 4Q1VA 3MVEA 4TQUS 3VAAA 2ORYA 2XLBA 2ADOA 3M5DA 4YLYA 3LK6A 3L8EA 1I2DA 3PUXA 1WMAA 4OFXA 2CF5A 4K1XA 4DDTA 4P3NA 3W90A 3ENWA 5BXQC 1HQYE 4IVNA 2G9QA 3RTGA 3SXJA 4E32A 3FOCA 3OIGA 2X9NA 2PAFA 2A9KA 2WHEA 2HK6A 3PTLA 4E09A 5K4HA 2VAMA 3D64A 2P79A 5IAGA 1CYEA 1SWVA 1T3SA 3FUXA 3HSYA 4FMDB 1LW7A 1JG6A 3IKMB 2VK4A 3UGQA 4D9EA 1Q6YA 5BR4A 1ND6A 1KMHB 1VLVA 4QGGA 1W36B 4IW3B 3B1FA 3L1JA 3RF6A 3U31A 4Y9SA 3A4LA 3UMMA 2NYVA 2V3CC 1B15A 2BHTA 3IODA 2ZWPA 3L8MA 4XCQA 4YAEA 1F2TB 1MA0A 1UBNA 1XZQA 2WP0A 5DGHA 3TO5A 4MV0A 3ZNQA 4EGCB 5LYJB 1F2UB 2DWQA 4ZN6A 2TMDA 3NZEA 3THOA 2Q3LA 7GPBA 2RCNA 1Z6XA 1XOIA 4XA8A 4Y8VA 5CVUA 1VYVA 2KHZA 2G8NA 1XYYA 1GZ6A 3ELBA 1P4GA 3JQAB 3KKOA 3LCCA 3JWPA 1E2KA 1S89A 2J0EA 2ZIEA 3VI3B 2CYBA 2PS3A 2PBLA 3OCCA 1D03A 1GV0A 2YIVX 4HWGA 4X97A 4Y9UA 4DUPA 4F4HA 1AZLA 3J7TA 3KFLA 2PKWA 3H5TA 4CXMA 1XNGA 2R5NA 4L4UA 1XJCA 1NUQA 3CU5A 3IURA 5DLEA 1FXSA 1USKA 3RC9A 3H04A 3UXYA 4LE1A 3UV6A 4CKZA 5KHAA 1B16A 3EQ8A 4QECA 4BX0A 3CYFA 4FEGA 5BSTA 5FH9A 3S27A 5G02A 1OWOA 3E35A 4Q9NA 3MS2A 2Z58A 2ZIXA 1Z6AA 4ZAZA 1JECA 1Y9AA 4B4DA 5F7OA 1S2GA 3DDHA 3OTIA 2H9AA 4H3VA 2O8FA 2B30A 3EF0A 2H7XA 1J5EB 1QUEA 5JMTA 5K01A 2AIRA 2I7CA 3ERCA 5EIOA 4CG2A 4GMFA 1KC3A 4BDTA 1M2VB 1Q14A 4FYYA 3U44A 3B3QA 5C1OA 1NR7A 3WL6A 3JAMA 2WAYA 1JQAA 1OKKD 3KM0A 4CKEB 1QIEA 5DLDA 2I76A 5AKKA 3GEHA 1P60A 2IP4A 3IUSA 5EMMA 1XNJA 3CG4A 1JKJB 1XEWY 2JLQA 4IJ6A 1M8JA 3IPXA 3SG0A 3TH5A 3LKDA 4Q03A 5TB5A 3C3DA 4PXSA 4B31A 6YASA 2AZDA 5ICCA 4G5RA 5GJCA 3HFGA 1O8BA 2QG6A 2XTAA 2IEBA 1TPYA 3O92A 3R7DA 2DE0X 1AS3A 2F55A 5D00A 1IK4A 2OLKA 4YA6A 4MV3A 3PYLA 4IXMA 1XCOA 3E1SA 3CB2A 1L4EA 2VDQB 4PO8A 3BGWA 4OQYA 1WX1A 5AI0A 3TI7A 3W05A 1SAYA 1U63A 3FMIA 4NBNA 2HM7A 1TVKB 4OH1A 4I7EA 3WTBA 3UOWA 3BEOA 1AY0A 2YR0A 5K8VA 4D9BA 3WGIA 4BB5A 4KGXA 2GPTA 1AX9A 2ROQA 4Y2UA 1N5OX 3KU1A 3PQEA 4DIMA 3IKJA 1ZOSA 5JTUA 4TGLA 5GZ6A 4LSMA 2IVZA 2R00C 5JDIA 1P9NA 4AY6A 3OD5A 2QX9A 3CLTD 5KC9A 2E7ZA 1JT9A 4CT5A 5KQPA 2QNIA 2C2XA 5AW8A 5HP4A 1SCBA 3D81A 4COKA 5DNYB 1JR6A 3VKVA 1Z83A 2NZ2A 4IGEA 4DFDA 3SE7A 2QDXA 2YWDA 3NV7A 4W9RA 1CX9B 3TXYA 1IZZA 4LDNA 2QJTA 3D59A 4OHKA 4E30A 4CFSA 1NQAO 2VLIA 3M6FA 3R0JA 1RWPA 1UWVA 2XMSA 3IJ5A 3ZCVA 1Z8NA 3J81A 2R4TA 5G3ZA 3ZEAA 2PJRA 4MHTA 1XZDA 3KPWA 4HVTA 1Y8RB 1DC4A 1LX7A 3LL4A 2VKQA 4QQNA 3TINA 1G38A 3HFJA 4W7HA 3PS9A 1W29A 4XRRA 2QRHA 1IJEA 4N3NA 1VJDA 3OE5A 1EWQA 4J0CA 2I6QA 5AOVA 4WWHA 4DSNA 1Y9DA 4G36A 2X5OA 2VHQA 5BVGA 2LKDA 1AF7A 3RQIA 3D5QA 3CRVA 1J2UA 4FN4A 1Z3CA 3QITA 5CYGA 4ZOEA 4OJNA 3I34X 5IYZA 4S24A 1L4KA 3N59A 1ZVMA 3I2YX 1NDUA 1XMIA 2QL5A 4P34A 3OPVA 5CW1A 3Q7EA 3TCKA 2WWWA 4N7RA 2R751 2ZJOA 3DFMA 4FWTA 4XPIA 5KNDA 3O31A 2Q9AA 1FU8A 1YQ9A 1NVVQ 3EMBA 1SBCA 2GTIA 4K9DA 3NH9A 4ZHQB 1QVRA 4LFCB 3QXXA 4JP5A 4WBNA 3CWQA 1B2LA 3NBKA 3F46A 3HPQA 3MEQA 4I55A 4EVIA 2NAFA 4IS3A 3HJHA 3QEMA 4H7FA 5E8RA 1XRRA 4IG4A 4Y6GB 1XF1A 2JPDA 1P5HA 4NH4A 2CMHA 1W5AA 3DBRA 1BX1A 1MTOA 4KQFA 5EUQB 3UAXA 2OMKA 4NK4A 4A16A 4ZYWA 2VH1A 1TYZA 3B1VA 1EDDA 2PDAA 1NQOA 3ILSA 3JQPA 2IEIA 2PL9A 5ALYA 1RI4A 5F1PA 3I05A 5K20A 3TW8B 3JQDA 1GU1A 2D59A 3FYDA 2REQB 4M1KA 3DV0A 4W5NA 1BVHA 2LBPA 3ND7A 1K7SN 3EDYA 3GBSA 1XMSA 4X3OA 1ZU4A 1U9IA 1WPXA 3BSYA 4AY5A 1WB9A 4CQNA 4O4IF 1QGUB 4J1QA 3RAFC 4KE8A 2IDJA 1WR8A 3IVXA 4UVHA 1FVXA 3WGYA 1E92A 4O4HF 2QQ0A 1IHYA 3V1MA 1TUBB 2YFKA 5B6JA 1JEJA 4JUAA 1RZVA 3B9BA 2CFSA 7AT1A 1V47A 5DX0A 1T29A 1ADYA 3FROA 4FXPA 3JR7A 4GE0A 4PTZA 4Y6RA 1YUBA 1LJUA 2ZYDA 2WWVD 3T5AA 1S3IA 4HKTA 6LDHA 3L6UA 4U9UA 3O9VA 3I53A 4QPDA 5F12A 5J2UA 1YGPA 1Z4LA 5J4VA 3I6QA 4BQNA 1XTKA 5JPCA 3D6TB 1IPFA 3BC1A 5HG0A 3WK7A 3QUAA 5A4IS 4M8IA 3VPGA 5BT9A 3PG5A 1CUWA 1Z88A 2QRMA 3VHXB 1QGZA 1VSBA 3ZCUA 4E33A 1BZYA 5LZ7A 3ZWKA 5T67A 1NW4A 4D4MA 5EQFA 4NXMB 2XGSA 2VG8A 4C7OA 2Y27A 5CIWA 5K0EA 2PGIA 2I67A 2O52A 3EAFA 4LGYA 4Y98A 1JA0A 5F7XA 2EWWA 3OOSA 3DO8A 3TZHA 1QF7A 4YR7A 1XO1A 2PUHA 5KKAA 3N2KA 3EOAI 1T5HX 2GI4A 1O6ZA 2OCKA 4U0KA 3VXKA 1Z37A 3D2AA 3BDIA 2R6DA 3WAGA 1D2GA 1Y8AA 2D1SA 3Q4GA 5LA6F 3U0BA 4E6PA 2UUAB 4D26A 1U0BB 3UATA 1EWKA 4UTOA 1OYYA 1QCDA 5DV9A 1TQ6A 1J22A 3E2IA 3NBXX 3ROTA 4L4RA 5BR1A 2GZ2A 2D5CA 3DOCA 4W1QA 3O95A 1BHSA 2V3WA 3OIWA 2RBEA 2C7OA 2XCIA 1K7EB 3TN7A 1Z0JA 4QBTA 4RYDA 2FGKA 3RC3A 3V34A 4D8XA 4ZTUB 1L8QA 1YZHA 1SHKA 2F9LA 2EU8A 2ONCA 3OHMA 4GE3A 4LX0A 4DQ0A 5EJIA 3W6OA 3KYJB 4HQRA 1XYGA 4R5MA 2V6IA 3L9WA 2Y71A 2PMDA 4YCDA 2RHLA 3X1DA 1N36B 4ZVRA 1GNTA 1GLVA 3B6IA 4M9QA 4MI6A 3RVJA 1MDFA 2IYZA 4QIHA 5CD1A 4B2IA 1VA5A 2BYTA 3DOOA 4G24A 1MUUA 4L3VA 4X20B 2HRZA 1G4UR 4PTYA 2PXHA 4WJZA 2A8YA 2GA8A 1Z12A