4WWHA

Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi-510967) with bound d-galactose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
329
structure length
329
Chain Sequence
b'AKGTVGIAMPTKSSERWVADGQNMVDQFKAFGYDTDLQYGDDVVQNQVSQIENMITKGVKLLVIAPIDGSSLTNTLQHAADLKIPVISYDRLIKGTPNVDYYATFDNTKVGVLQANYIVDTLGVADGKGPFNLELFAGSPDDNNATYFFQGAMSVLQPYIDSGKLVVKSGQTTFDQIATLRWDGGLAQSRMDNLLSQAYTSGRVDAVLSPYDGISRGVISALKSAGYGNAAKPLPIVTGQDAELASVKSIVAGEQTQTVFKDTRELAKAAVQEADAVLTGGTPQVNDTETYDNGVKVVPSYLLDPVSVDKSNYKKVLIDSGYYTETQVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
molecule tags Transport protein
source organism Mycobacterium smegmatis
publication title CRYSTAL STRUCTURE OF AN ABC TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM MYCOBACTERIUM SMEGMATIS (MSMEG_1704, TARGET EFI-510967) WITH BOUND D-GALACTOSE
rcsb
total genus 124
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 3.6.3.17: Monosaccharide-transporting ATPase.
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wwhA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wwhA02
4H3KB 3TO5A 1NXPA 1ZH4A 3D02A 3VNBA 2F8SA 1RZRA 4NV3A 3RVSA 3HO1A 3LUFA 2A9QA 3O1IC 3Q7RA 2PUEA 4XASA 1E2BA 1NXXA 1EHCA 5DGCA 5JNRA 4IF4A 3N0XA 2MYPA 4RY8A 5TQ0A 2FMFA 1DP4A 4L85A 1CHNA 2PUGA 3TD9A 3CNBA 4W5OA 1C0EA 3QX8A 4RXTA 3OLWA 2M98A 2FMKA 2QZJA 4MAAA 3KLNA 1MAVA 4LE2A 2MSWA 1D1PA 2FSPA 2GI4A 2E4VA 1QO0D 4RY0A 1QQBA 2E4XA 1DRJA 3HVRA 1XWWA 1Z18A 2GKGA 3O75A 3HUUA 3QELB 4Z4EA 3MF4A 3RH0A 3B2NA 2LBPA 4N0QA 4IMIB 3H5IA 4LDAA 3RVMA 3I45A 3P9YA 2WWVD 1UDRA 3M9XA 3H1EA 4WZZA 1TLFA 1A04A 1NXVA 1KMIY 4MR9B 4IRXA 1IIBA 4RKRA 1D2AA 1A2OA 1Z2EA 4UHJA 5KC8A 3HSYA 3A10A 3KCNA 4HNQA 2FLKA 3D8UA 4N76A 1S8NA 3T6KA 3GYBA 5CNMA 3H5WA 1Z12A 1DCMA 5TPZD 5I4CA 3EAFA 1YMUA 5KI6A 4WWHA 1TMYA 4NICA 2IOYA 3RVJA 3G85A 2GBPA 1M2EA 2CHFA 3C3MA 1JX6A 2FMHA 4MS3B 5IULC 5C5CA 2IKSA 5JNUA 4EYKA 2I6FA 5CNJA 2FW0A 4LE0A 3RVRA 2ID9A 4ETIA 3BBLA 2L19A 1KRWA 3SG0A 3GWGA 1QQAA 1JDNA 5JNTA 1DJMA 3LUGA 3NBMA 1PUXA 1APBA 3W9SA 3OQNA 4NCAA 5JNSA 3H6GA 3CG0A 3ROTA 3C97A 3H1FA 4G0XA 1JL3A 2P4UA 4MR8A 1FFSA 4WXMA 2AYXA 3BREA 3K4HA 3KLOA 1VRVA 3TB6A 3CRNA 4HNSA 4N0PA 3HEBA 1U2QA 1DC8A 2A9RA 1LJUA 4Z0NA 1DCFA 1QP0A 2R48A 3KG2A 2FEWB 4JASB 3R0JA 1GUDA 4MQEA 2ID7A 3QEMA 1GLGA 1OXKB 3GBPA 1VKRA 3OMWA 4RKQA 2IPMA 4W5TA 1EWVA 3FFWA 4XARA 3QLTA 5PNTA 3RVLA 3RVKA 2V0NA 1QNLA 3RVPA 3HJFA 2Q5CA 4Z4IA 1LJLA 2YHAA 3DLBA 2L18A 2MYNA 5HSGA 3K9CA 5KWSA 2HQOA 4O1HA 3QK7A 3Q7SA 4GPAA 1JFTA 3LUDA 3FMVA 3H5TA 3E3MA 3HZHA 4EVRA 5FWXB 4XXHA 4ZMRA 5HKOA 1LBIA 4MQEB 5IBQA 3FFXA 4G0PA 3G1WA 3UUGA 4RK4A 1RNLA 3OLVA 1Z17A 1SRRA 3I5AA 3ROFA 4KREA 2LIVA 2CWDA 2FMIA 4G0YA 4MS4A 3UK0A 1EWKA 4WT7A 3VNAA 3OM1A 4KPYA 3QLUC 2JBAA 2YHBA 3BRSA 3KSMA 2FVYA 1USIA 3IPCA 4G97A 4QICA 3O2SB 4LRQA 3RQIA 4Z4CA 8ABPA 1MB0A 2QR3A 1M5TA 4M88A 3N0WA 4DADA 4RXMA 5B3JA 1YIOA 4PICA 4YGXB 3IDOA 1P8AA 1YS6A 4Z9BA 1ISRA 4HNRA 4YWHA 4ETMA 2IPLA 1NATA 1JDPA 4XFKA 1JH9A 1BAPA 4P98A 3H5OA 4Z9AA 3CZCA 3KJXA 4YS6A 3T95A 3GT7A 3KKEA 4LZLA 3DBIA 4B09A 2NZVG 2WMYA 1ISSA 2FN9A 3FFTA 3OM0A 1P6UA 2JRLA 1LBHA 3KYIB 3EQ2A 2PLNA 2JVJA 3L6UA 4N03A 3SY8A 5D2CA 3Q41A 3NNSA 4DQDA 3F73A 2IYNA 4L4UA 2O20A 1URPA 2L17A 2L2QA 1RXIA 3L49A 4FE7A 1D5WA 2VUHB 4GNRA 1YMVA 4RV5A 4F11A 2QVCA 4YCSA 1XHFA 1U2PA 3N53A 4MLCA 5E3JA 1PNTA 4MYRA 5F64A 4RDCA 4CBVA 1JYEA 3C3KA 3MA0A 2FXIA 4IILA 3SAJA 4Z4GA 4EYQA 4JA2A 4S04A 4MS1B 3MYYA 2PUCA 4EYOA 2FQWA 4ZYLA 2IDMA 5GOTA 5TE9A 2WY2D 3A0RB 1JBEA 3I09A 2TMYA 3F7NA 1JF8A 3N0RA 1J56A 4RXUA 2FLWA 1DBWA 1DRKA 4YR7A 2RGYA 4RK5A 3EGCA 4RU1A 2FN8A 3OLZA 5HQJA 4H3HB 1YK1A 5IC5A 1ZN2A 4RK6A 2PE5A 1ZY2A 4TMYA 4OBBA 4YP9A 3JTEA 3M9WA 5FBKA 5GQSA 3H6HA 3Q15C 1ZGZA 1YK0A 1ZITA 1MVOA 1NTRA 1YTUA 2WJAA 4MR7B 1BDIA 2B1JA 2NT4A 4G0ZA 1A0OA 2ZWMA 4RK1A 2PMCA 2WRZA 4Y9TA 4QPJC 5T3YA 1JFSA 2MYUA 2VK2A 1GCAA 3KHTA 4F3TA 4E7PA 4KZKA 5TPWA 1DCKA 1JFVA 1FFWA 1M5UA 4FE4A 1F51E 4QYMA 5IUNC 3KS9A 4MS4B 4ML3A 3MMNA 3LKBA 3EJWA 1EWTA 1YVUA 1GCGA 4W5QA 4JAVC 4W5RA 2QW1A 3QEMB 3DZDA 1DBQA 1TVMA 1U0SY 1CYEA 3N6VA 5KQGA 4O5AA 2PAFA 4QYWA 2R47A 2RJOA 2H3HA 3TMYA 2A9OA 5TQ2A 3CTPA 3GA5A 5EWLB 1ZESA 2QU7A 1FSPA 3CG4A 4JOQA 3EULA 3H5LA 4MRMB 4TLLB 1ZAYA 1W9HA 4EYGA 5T7BA 1VPWA 3HK2A 4Q7EA 4HYEA 5BRAA 2MYTA 5KQLA 3EQZA 2HQBA 3IP7A 3RVOA 1Z26A 5KQPA 1SXHA 1OXBB 2PUAA 5TPWB 2OENG 2HSGA 1HEYA 1RXEA 4G86A 5IUKC 1BVHA 3O2QB 2NZUG 4NQRA 4YV7A 5B3JC 3MQ4A 1XHEA 2R25B 1PEYA 2PJUA 1K68A 1DC7A 7ABPA 3SQNA 1ZH2A 5BR1A 3RVNA 3CLKA 2FEKA 2F8TA 3SNKA 2ZAYA 3N75A 3QLUA 4WXEA 3IPAA 5BRJA 2CHEA 3HUTA 1QO0A 1GUBA 2HPHA 3NNNA 1E6LA 5TPZA 4Z4FA 3H1GA 5FWYA 2GWRA 5JS2A 2VYCA 3HV2A 2IPAB 5IEJA 4F8JA 4EY3A 2PKXA 2FKAA 2JBAB 1JYFA 4PZ0A 4YRZA 1Z13A 2QVGA 2JVKA 3HXMA 3JVIA 4MRMA 1Z15A 2OQRA 3IP5A 5IX8A 4JB2A 1QKKA 1SXIA 4XLTA 3LMKA 1NXWA 1P2FA 4TN5A 1P6QA 4ZMSA 4NCBA 5FWXA 2PUDA 9ABPA 3DGFC 4D74A 5CNKA 3OO1A 2VUIB 4MS3A 4ZPJA 3OMXA 4Q6BA 2FEPA 1USKA 1DG9A 2M1ZA 5BQ3A 3CHYA 4G0MA 6ABPA 4UHKA 2FQYA 3T8YA 5C5EA 1Z16A 3CU5A 4F06A 2FQXA 3C3WA 1M2FA 1NY5A 2E4WA 4KNYA 5DTEA 4LX8A 4D6XA 2QXYA 1U8TA 3N8IA 4S05A 4KVFA 3C6QA 1D4ZA 5EWLA 2PL9A 3EODA 5EWJB 3T38A 3GV0A 5TQ2B 3LFTA 1T34A 5CHYA 3RVQA 3F6CA 2W42A 3QELA 3HS3A 3NHZA 5HM6A 1MB3A 2H0AA 1Z2DA 1QP7A 4Z99A 3KTOA 2E4UA 2JK1A 3OLXA 3JY6A 4YLEA 3DGEC 4MLDA 6CHYA 1ZHHA 4N41A 2PUFA 3KYJB 5ED4A 3BILA 1KGSA 3FDFA 3OQMA 4PEVA 2QSJA 1JHZA 5FWYB 3QX9A 3MIZA 4EUKA 4LE1A 3I42A 1QP4A 3O21A 5IEBA 4MPTA 4MR7A 1B00A 1LK0A 3HDVA 3IP9A 1AB5A 3JPWA 4H60A 3CKMA 2CD7A 4KV7A 4Z4HA 4OLAA 1H9CA 5EWJA 5IUJC 4LDZA 1ABEA 2NUBA 1NXOA 3LOPA 4RZSA 2HQRA 2R4QA 1WETA 3A3KA 4MR8B 4XAQA 4MGEA 4MQFB 1DBPA 2E4ZA 3H5VA 3Q9SA 4MQFA 2BGGA 2WJWA 4FB4A 4KK4A 1EFAA 3CZ5A 4KRFA 3LUHA 5TQ0B 3GL9A 1R8JA 4JB0A 2JVIA 3F6PA 4E7OA 1RPJA 1VLZA 1CEYA 3URMA 3DLHA 1ZDMA 3Q7TA 2B4AA 1PHRA 3OLYA 1W25A 1MIHA 3UKJA 1TJYA 3M6MD 1SXGA 5EWMB 4ZJPA 1JWLA 1F4VA 5KC9A 3E61A 5JNVA 1U04A 3LUJA 1E6KA 2PL1A 4KFCA 2MSLA 3ILHA 3GBVA 5JNWA 1ABFA 4PE5B 4RWEA 2JCGA 3IP6A 4YO7A 1BDJA 1DZ3A 3H75A 4RY9A 2DRIA 4G0QA 3HM9A 1AB6A 2N9UA 4MR9A 4OATA 1QMPA 4N47A 1EAYA 1L5ZA 4MS1A 3TX6A 4KK3A 2IPNA 1TM2A 3HCWA 3LUAA 1QPZA 4RK0A 4D6YA 3ILYA 5CNIA 4WUTA 4P1ZA 2J48A 2A9PA 3QEKA 4KMRA 3OO0A 4EVSA 3NHMA 1BA2A 3CFYA 1FFGA 2KYRA 2X7XA 1C4WA 4KQCA 3GRCA 1NXSA 3QLVC 3S99A 3JPYA 5ABPA 2QV0A 5TQJA 1PEAA 2HJ9A 3LTEA 3MM4A 4ETNA 4RSMA 2LP4Y 1ZVVA 3O2JA 3LKVA 1YS7A 2AYZA 3O1HB 1Y1LA 4W5NA 4IMJB 2XDYA 3HDGA 4PYRA 4EVQA 4RK7A 3LUCA 1NXTA 4F12A 2PUBA 4DN6A 3OQOA 1L5YA 5KQMA 5DLEA 3JVDA 2E4YA 2RJNA 3O74A 4JP1A 5JS1A 2MSKA 3SM9A 1JLKA 1K66A 2P9HA 2GX6A 4KQ9A 4G0OA 5DKFA 4EGSA 1D1QA 2LUOA 3EDCA 3NNDA 3CS3A 3FGZA 2FTKE 3QLVA 4IGAA 4TLMB 1KRXA 2LPMA 2WB4A 5FBHA 4RS3A 4OG2A 1SD5A 3LUKA 2JB9A 4O1IA 4OTZA 4Q6WA 5DCLA 1BDHA 1I3CA 3A0UA 2NT3A 1Z25A 1FQWA 1ZGGA 1PNRA 1RZRD 1USGA 2RDMA 3JS5A 3BRQA 3O1JC 1E6MA 4OLBA 5EWMA
chains in the Genus database with same CATH superfamily
2FAXA 2HY7A 4INJA 1U8CB 3B85A 4PRZA 4W9NA 3ZEAA 3VJLA 2IZ7A 5BN4A 2JATA 3FUUA 4RF2A 4D9EA 1H2BA 2OR3A 4ZTUB 4B3XA 4DG5A 4PXYA 1W73A 3HDJA 1W36B 3AESA 1MD9A 1OI3A 2AMFA 2H4XA 4EQ6B 5ADWA 2DFDA 1Z4MA 1XTZA 2F3TA 1YE3A 3DEYX 3CF0A 4HFNA 1E2FA 1E7MA 1RKBA 1SVWA 4G1FA 4XUDA 4Y1FA 3RUAA 1JE1A 5EHZA 2C92A 1RMTA 6LDHA 2D7DA 4XWKA 1D2CA 3HA7A 3UT0A 4NJEA 1GGEA 3QSGA 5E6UB 3WRWA 2PMFA 3KLPX 2E4VA 4RY0A 2I2BA 3FOFC 1G1AA 1QMGA 3R9XB 3DEHA 2CEAA 3KWJA 3LBNA 3KL4A 3V1MA 2OGWA 4FYKA 3G2NA 4Q39A 5BSKA 4CMIB 1IJFA 4N0QA 2MIIA 2PS9A 4S1TA 3SYNA 3BQ9A 5KNBA 2LV8A 4ZT3A 4IZOA 3EGVA 5K0LA 5K0FA 3V8EA 1N6RA 1GKLA 1O94A 4Q1BA 5BQ5A 3WYEA 2ZSUA 4PG5A 1QX3A 4X6YA 4QECA 4BFTA 3DQPA 4EITA 5F2NA 4N76A 1Z56C 1S8NA 1RWPA 4LY9A 3DF9A 4AJ4A 4DAEA 3P9SA 4MWSA 2ZXFA 3PPXA 4O4IA 3STWA 4B9EA 2Q9CA 2XNDD 2J3EA 3VR2D 3IVRA 3FF4A 5GTDA 4FOOA 5J5VA 2ZTLA 1KZHA 3T7EA 2PWAA 1J24A 4HNVA 5FHQA 4IDAA 1N5DA 1SUFA 2J3LA 1JX6A 1NR1A 1YU6A 2XEDA 3O6VA 2DWQA 5I45A 2QBYB 3SZLA 3QXGA 2EJUA 2QL6A 2UZ1B 4Y6QA 5CNJA 3NXKA 4FHEA 2ZRPA 4EPXA 1XJCA 1J8YF 1N2OA 2QRNA 3VR6A 4MA5A 1ESNA 1W59A 2IY7A 1A96A 1YI8A 2J33A 1X7WB 2GVZC 2P9GA 3NFYA 1OX4A 3AHEA 5IAOA 4JT2A 1VDMA 1IY0A 3RRFA 1K8RA 1RXVA 4CKWB 1ACMA 3OQNA 3TOVA 4NCAA 4GYJA 3UJAA 4ZJZA 2BUCA 4E94A 1RRKA 1DEXA 1IZ9A 4A7PA 1YQGA 3D64A 1J8QA 3IH5A 2LTAA 3K4HA 3OWXA 5J59A 3LV8A 3ZW7A 3ENQA 2VF8A 4MK4A 1W0CA 1NVGA 4UD2A 4MYHA 2VDWB 4N0PA 1DC8A 1W6RA 1D09A 1AKUA 2Q7XA 2X6RA 3R0JA 1P1RA 4MVJF 3SR0A 3WNDA 3KU4A 2FZKA 3GP3A 1BKYA 2ERXA 3B6MA 3DMTA 1JLLB 1C1HA 1AXRA 1L8AA 3PRYA 4QWWA 3WBFA 1AD2A 4DQLA 3IUQA 5JDCA 4YA6A 1DI0A 2J3KA 1UFOA 4LC9A 1R6UA 3CO0S 4DV4B 3RHZA 4JJIA 1EEXB 4BGDA 3KDPA 1NUHA 2G6TA 3T34A 3ZHBA 4RORA 4BV2A 3V6LA 1ODKA 1UMCB 2P1DA 3RM3A 3ZXUB 2C8KA 3PC6A 3FMOB 3QMVA 3HJFA 1S2IA 5KCZA 3QQPA 4KLZA 2VI5A 4N9WA 1I01A 4F9TA 2Z6UA 1WCXA 2FX3A 4XIIA 1WP4A 2A0KA 2MWMA 4O02B 2BBOA 3FUTA 3LUDA 4MQ5A 2GK3A 4G63A 2GMWA 2FFJA 3M1IA 4M7OA 3ADBA 1EDEA 3HE3A 3Q2KA 1PL0A 1HSZA 2FN3A 3MHPA 1BU5A 1SC1A 3SNHA 3VU9B 1NVVR 2G67A 3A4YA 3ELDA 3TDNA 3ZGOA 3U7EB 2E21A 3GRUA 3EH2A 1J1IA 3BQNB 3ZHRA 4IW3B 1EWKA 5I4BA 2RMKA 2Y4NA 3B48A 4ZTZB 4NXNB 4WNCA 4S0XA 1FZTA 3BXGA 3OOEA 1UXHA 5FOUA 4B84A 1BD4A 2VIIA 4DGSA 4XEHA 3WLEA 1W4CA 4NIMA 4Y9DA 5JHHB 3O2SB 3ENKA 2QWXA 1VYUA 1SB9A 2VOJA 3VTFA 4HL6A 1HZJA 1VL2A 1EFVA 2PXAA 2XMQA 3AEZA 2VUUA 5B3JA 2QXUA 2QMHA 4WACA 4F4FA 4DR1B 4EFNA 1AGXA 4MKGA 1PJBA 4UAUA 4CM8A 4ZT7A 2W11A 1FE8A 1NW6A 2PSHA 4AUEA 1GGJA 1II8A 3RVDA 2I3DA 4P0QB 1EVLA 1PV2A 1EIZA 1KDRA 3QP9A 3H1PA 1W8IA 4MW9A 3RS4A 2PH5A 4J75A 4UASA 5K3OA 4Q48A 1YL5A 4YFVA 1LBHA 4EABA 5HFJA 5IAKA 4UTPA 4TMFA 2G83A 4DZRA 1O96A 5D2CA 3Q41A 5B55A 2YHUA 3UQYS 4DOMA 3DPSA 4H16A 4JJZA 4BVLA 1CUYA 1QG6A 4DMMA 4MO9A 2EWVA 2CJXA 3JRNA 5GV8A 1U2GA 1T3SA 4QTXA 4G0WA 1O03A 4OJQA 4RDCA 4RA6B 3H0KA 3R23A 4G8JA 4ND2A 2J3IA 5ALEA 1XNGA 3ENWA 3T3GA 4C4SA 2JDIA 3ZWAA 1RBMA 4YJFB 3I2JA 1VG0B 4F04A 2VATA 2GDZA 2F00A 2CV2A 2C2ZA 1QCDA 3WE7A 1VL8A 2VEDA 4CU5A 4W4TA 2PUVA 4G26A 2SKCA 1KY3A 3FTCA 4QELA 5H59A 2PS0A 1VHDA 3QRWA 3TUIC 4QTYA 3HKEB 5KTYA 1Q0TA 3EGEA 4RK5A 2OQVA 3NEJA 3QVJA 1LI7A 3H7AA 1V8OA 4KU4A 3ZD9A 5KMGB 4UEOA 2WD7A 3AINA 1CDDA 3AFNA 4EJMA 3RFUA 3UJ7A 4LYDA 2AHOA 3M6LA 5JZOA 5B1HA 3ETJA 2XOKA 3KUDA 4DLUA 2GEVA 4GXQA 2QI9F 4DCUA 3MXOA 1QLJA 2UVQA 2ZJFA 2IRWA 3KM0A 3OZIA 5DHTA 2KJQA 2FPMA 4FSHA 1VE7A 4ACBA 4CTJA 4D8VA 2ZU6A 3B3GA 1ADBA 3FRHA 2HPVA 1MOQA 1QIDA 3CIFA 4NFHA 4B4VA 1E60A 3I01M 3ZEIA 4GKBA 4E7PA 4ZDJA 4MRNA 4NZMA 1P4HA 4J49A 1G59A 3UAXA 4NNJA 1MOSA 1YB4A 1ZG3A 1O0SA 3IQHX 3GOQA 4J3FA 4KQEA 4LXQA 3CZMA 5TB5A 4QHTA 5CIWA 2YJ4A 3AILA 2GPBA 1BS2A 3RFFA 5IUNC 4ZHSA 1I7QB 4KMSA 1NFQA 5HUQA 1A7JA 3SJUA 5AHXA 2PXHA 1IQ0A 3GLHA 3PX2A 1EWTA 2QRHA 4IVRA 4IZ6A 3PXAA 3WRXC 3ZE2B 5JDIA 1GUZA 4YONB 2QXTA 1AKRA 3KKNA 3PNYA 2ZJ8A 3VRHA 3V8PA 1T0BA 4O5AA 1CYEA 4JR0A 3ISJA 3KBBA 3KRTA 1UOQA 2GZ3A 1ST2A 1NXQA 4V1CA 4Q4JB 2A9OA 5TQ2A 1O54A 2JIBA 4AIIA 2YMMA 3DO8A 4ZHQF 2AW3A 2YHIA 1S02A 2UYQA 3DH0A 1KAGA 4ENPA 3HBAA 4F21A 4UNIA 3DC2A 4GZ5A 4IOMA 2P90A 4LHEA 5AXDA 5FWDA 2OBLA 5JQGA 3CPSA 1MCZA 1OE0A 3KIPA 3BE4A 4TYMA 3EEBA 3TIXB 5J4LA 1XLVA 2AC2A 1UM8A 1KJJA 1TD9A 1WQ3A 3UUEA 3OIGA 1T4BA 1KOFA 2BMFA 2X2FA 2P7HA 4WESA 5GJBA 2HF2A 3I32A 3A3NA 5CHEA 5JCOC 5I9TA 4IINA 3DFUA 4O29A 5LU9A 5D85A 2VSNA 1ADYA 4NBRA 4R2WA 3UXHA 3EIOA 4EJ6A 9LDTA 3HUTA 1F3OA 1R9GA 3E8SA 5BV0A 4XX1A 4RTMA 2ZBGA 4CL3A 5HK9A 1YBMA 1C8KA 3UCXA 1R6DA 1Z68A 4G67A 1Z5PA 3LX5A 2C20A 4F84A 4LY3A 5D5QA 4B6EA 3LT5A 4DVJA 5JMWA 4JI7B 3GD7A 2VFAA 3UH0A 5TR9A 1XAIA 2HD4A 1XKTA 1Z13A 3FW1A 2P0YA 3IT0A 4UNQA 3FPKA 2XGMA 3GRAA 2Q27A 1TDJA 5FBWB 5CCDA 1KKLA 3JQ8B 4BIIA 4FDMA 4TTSA 2YL2A 4BQOA 3C87A 2J30A 3AIOA 3HKBB 2ZJOA 3P4YA 4HPWA 3PUXA 4IQFA 4YRDA 4UU8A 1E3JA 2KMLA 3VAYA 1ZZGA 2R6R1 2WWHA 4NYIR 4LY0A 2PT9A 1NC1A 3IODA 3HKCA 4II2A 4ENSA 3DGFC 4PC2A 3JWGA 2JGNA 2Y9MB 2JLXA 1BH2A 3ESAA 3OJLA 4E5YA 3KB1A 4CKXA 4Q6BA 5SICE 2WTUA 5CDYA 3QGMA 3WIUA 5MN5A 4OSEA 5LIPA 2RGNC 1YULA 1FFAA 2ISQA 3ZYCA 2BHNA 3A9SA 3E1SA 3UOAB 1NBIA 3IO5A 5C1IA 5KTMA 2YN2A 1D4OA 3GLIB 1F14A 3QY9A 4Q7LA 3MMXA 3AHHA 2WOOA 2VP4A 1QJCA 3HR8A 4EG4A 3KQNA 3R3WA 3TXAA 3GV0A 4YT5A 4LSZA 5FEMA 3NOVA 3ER6A 4RD2A 3RRZA 4JFRA 3H4TA 4RA6A 1EE1A 1M66A 5ECYA 2VHUA 1UBFA 4IIXA 2NVUA 2I87A 4N5IX 4KEAA 5AVVA 5E95A 4RTSA 3UKDA 3TW6A 3PHGA 5DSZA 2PBRA 3MYRA 4EM6A 4BVBA 5EPOA 3B1FA 4CI9A 2O0HA 1EAMA 4F4HA 4H77A 1ABBA 2PQ0A 4IWYA 1GEEA 4M37A 5JPDA 4XCQA 5JANA 2B30A 2C42A 1O96B 3KNZA 2W37A 5TS2A 1UEXC 4L0CA 1WBJB 4BRZA 1T6ZA 2VJKA 2EW8A 4B2YA 3A1CA 2H1VA 1OX6A 2QRVA 2VJBA 3U2QA 5IW8A 3A6EA 1Q0PA 3KR2A 4L3VA 4MR7A 2O3JA 2ZRIA 2X5OA 3OQIA 4FYHA 4QYIA 4C43A 5BSGA 4Z3KA 4EKGA 2EW2A 5DGDA 1WW3A 1AUPA 1WMSA 2BN4A 2MU1A 3FY4A 4IIUA 4IIBA 5G4KB 4ED9A 1WMEA 3E03A 3EDOA 3H5RA 1KQGA 2YNMD 4G5FA 4W5WA 2IHNA 3AR4A 1NXOA 4UPVA 4ZVPA 3A2MA 3IXLA 4PYMA 3IE2A 3NTXA 4OSOA 2E0IA 4QUHA 3IA7A 1JPNA 4GMFA 1SXJE 3MJCA 4A0GA 4WQMA 2C5AA 5CFOA 1WETA 2GJKA 2FMUA 2KE5A 3C39A 3I37X 3K8OE 3EXFA 2PMKA 1T36B 3N74A 1CIPA 1WEKA 1NJFA 3NV7A 4FB4A 3FCXA 1CG6A 4I1SA 1NVDA 3MOGA 4RLSA 2FSFA 3VPCA 2YS7A 4TTRA 2XMGA 5FBRB 3EVGA 2O2JA 1U90A 2V59A 4OH7A 4B7AA 2X14A 4OBWA 3FG9A 3OY2A 5D3KA 3IMGA 4LXGA 1NFRA 5EUBA 1FTYA 2ECOA 5HBGA 1ZDMA 3UENA 3QTTA 1KF0A 3VU9A 1GN9A 2FQ1A 4U5QA 2O50A 4INPA 4WXPA 4JQYA 5JCPA 3V4ZA 5JHGB 1DO2A 1B6SA 5AT1A 4QT4A 4ZV7A 1EM6A 1K3TA 3E61A 1VCNA 1SCDA 2K7ZA 4QDOA 2OM6A 1KOGA 2PAAA 5DK4A 1EG7A 2W4QA 4XWOA 4KFCA 3GGSA 3ILHA 2XOXA 3FROA 3KWMA 3QFHA 1ZBQA 5BSRA 4RWEA 1E7YA 2QTTA 3IP6A 4O8CA 2JFOA 1CR1A 3RD5A 2AK2A 3FKJA 1N8KA 2N47A 4R5HA 3TCNA 4PN3A 4J4TA 5IT4A 5ISMA 4IDCA 4D7AA 5JALA 4MYCA 2BFEA 1U7HA 4PPYA 2PVPA 3BULA 2J5KA 3KSUA 3MFQA 4MVCA 5D3MB 4J7UA 2VCHA 3STUA 4DY6A 4O0LA 4YJDA 2EIHA 3L4BC 3ZYZA 1E9DA 2QZPA 3BD7A 4PAGA 2I2XB 1JIQA 3MGKA 4JLKA 2Q1WA 2AG5A 4JK3A 2NO4A 4MUAA 3UFXB 4CDMA 5BSEA 3EX7C 5IJWA 1XNQB 1S3IA 2ES4A 1KZ4A 4EVSA 3GLHB 1HDRA 2NXWA 3LVQE 4HWPA 3KQHA 5CYOA 3EMKA 4RZUA 7REQB 5LKAA 1DG3A 3QLVC 2C9CA 3H2HA 1RQNA 1ZOPA 2GKSA 1WDTA 4EF5A 3FPJA 2ZRDA 5JU6A 2IP2A 4KZPA 2C0CA 4ETNA 3EVFA 2NX2A 3HP1A 3DS8A 3USZA 2EGHA 3VNUA 1NI5A 2OXEA 1PN3A 2ZRLA 4GX0A 1SXJD 2XDYA 3AFHA 2Y8EA 1UJNA 4PHTA 5TF4A 5JVDA 2JGMA 5AI9A 1NXTA 2RGDA 2YH2A 3VU3A 4X66B 2EYQA 3NDJA 1IK6A 4GBGA 1OBHA 1TTPB 1TKRA 1Z63A 2DPHA 5DLEA 2QX4A 1E94E 3QOFA 5DWVA 4PZCA 3LX8A 4PCLA 2P5SA 3P94A 1NE2A 2I22A 5KYUA 2PUJA 4EHLA 3P5BA 1E2EA 3WZ2A 1ZUNB 2D54A 3MWYW 1CFZA 2RB4A 3VVLA 4DUZB 3EDCA 1E0JA 4CFZA 1Q74A 2N0SA 4IGAA 4LMAA 2ONKA 1NU6A 2FR8A 5A4JA 4FNMA 4ZVQA 5TS3A 1ZYUA 2CKMA 4NESA 4RS3A 4LTDA 3TSYA 2JI6A 3WGHA 3WVNA 2GJ4A 3K9FC 1UZNA 3A0UA 4JY7A 1S1CA 3NAGA 3NAZA 1BG6A 1QG4A 4XWTA 1AXGA 1H6BA 1C9YA 1X7GA 2FV8A 2GA8A 3X1DA 5FJJA 4A23A 2B4YA 4JP5A 3QHQA 5LWQA 4EA9A 1IWBB 3LA8A 5I9BA 3UMGA 4J90A 1TA4A 4YIKA 2CVFA 1O77A 3BFVA 4JP3A 3TUJC 2OB2A 1UKEA 4AM8A 1J5XA 1T5BA 1X1RA 2AWOA 4G85A 5ICFA 2KS6A 1XXHA 3VPFA 3WLMA 2G40A 3C1UA 4C4PA 1YHYA 1JI0A 3GCGA 3IBCA 4TTTS 3WTBA 5KVCA 1CQPA 3V46A 4QD3A 4UE2A 5CAEB 3A26A 1ZIPA 1GPBA 2D1QA 5A0FA 1Z7EA 4WOJA 2A57A 2R6DA 3V97A 4NNOA 4EG6A 2HRZA 3EZNA 1IMJA 1ZW1A 2VHYA 5K0GA 1DKMA 3TCKA 3WWZA 2PUGA 1L4YA 3FYUA 5J3JA 3W3AD 1F0YA 2B6HA 3QOXA 1EWQA 1V16A 1S5PA 2H08A 4Y0NA 2X7HA 1RU3A 4W9RA 1XOIA 1MAVA 4KH1A 1CUAA 3H97A 5KNBD 4PPQA 1JHDA 4K1XA 3B6JA 5K6TA 2H59A 3B1ZA 3VPAA 4HQKA 4FTWA 1T2EA 1K8YB 1EVYA 3MTIA 2EP7A 2IUFA 3FLAA 5B36A 5FPKA 1W4ZA 2XJ4A 4LDAA 1YQTA 2C3PA 2Z3VA 4YAOA 4B45A 2H1WA 3CT6A 1WHTA 1E63A 2NUTA 2CV1A 3GLFB 1A04A 4HXGA 5IMBA 3AEYA 4GE0A 4IRXA 5HRAA 3ZWCA 3S3TA 4X61A 1JA0A 4I3GA 4MV6A 5EIFA 3FYUB 2C9BA 1XAHA 3KJNA 2X22A 2EIXA 4HB4A 4TQUS 1DCMA 2HNBA 2HWKA 1K6JA 4HDNA 1O3YA 2II6A 3A37A 4Q4AA 5TPZD 4TT3A 5KI6A 3ROGA 2RHRA 1C3XA 1HOTA 1P7CA 3CX6A 3L02A 3P32A 4R8SA 5ELLA 1WB6A 3C3MA 2CHFA 3DULA 3PSHA 1GRNA 4JBXA 1TIPA 5IJXA 3T9DA 4WAUA 3UJPA 4B44A 4C03A 2ATXA 5C5CA 5K0BA 1ZI8A 1Z33A 4R81A 3FZYA 5BN3B 1A4XA 2P67A 1QONA 1K7YA 4KB5A 1IY1A 1PGPA 1G3RA 3I1FA 4IVNA 1UBRS 5L7TA 2VP0A 1NIPA 4O33A 3QMWA 2Q5OA 3DFMA 3HNPA 3K71B 3VDMA 2Y1XA 3M6VA 4X3CA 1JQBA 2VDQB 4JMLA 2CGEA 4LISA 4C0XA 4GQBA 2WAMA 3AKCA 1T6BY 4G0XA 2P27A 1YFLA 1C0PA 2VUTA 1J2RA 3Q0EA 1BE0A 5JAUA 4FUQA 4FNGA 3W9BA 1AE1A 5GZ6A 2R8EA 4DRYA 4MGZR 4QNMA 5KTSA 4G0UA 4Z0NA 4OXKA 2EZUA 5FORA 1NJSA 3DMRA 1KYYA 2HH9A 2PRZA 3GFSA 5BYKA 2PA3A 1ZK1A 2J5XA 4NARA 2OZLB 3TBFA 1MC8A 2Z09A 3PQ4A 1IQRA 3QITA 1P9OA 4GPTA 3KC2A 1KXZA 1LBQA 1NFFA 3D1LA 4YP6A 1QQ7A 3KD2A 1HG1A 4GS5A 4XIYA 1R37A 1AKEA 2O3QA 3VYWA 1IBRA 2BRUA 1DPGA 2PIAA 2IH2A 1JQAA 1EWRA 1MZPA 1QNLA 4IAOA 4ZAZA 5G3YA 3KYCA 4BQSA 1FFDA 2EG9A 1E96A 3X1KA 2FFRA 4QTZA 4EB6A 2XUZA 2V0CA 3QKRB 3BERA 2RAPA 3NXSA 2MYNA 5T6MA 2R62A 3OT1B 3WQQA 4GZ3A 5BR8B 3AVVA 3JZMA 2AB0A 1ESMA 1P45A 1Y1SA 4RA9B 3GAFA 1WOYA 2PVSA 4PLPA 3VPGA 3QSYA 3M0EA 2BSAA 4EVRA 2G4CA 2FPPB 1HKHA 3IVGA 4XJTA 2EZTA 1LGYA 4M7PA 4PHFA 4G84A 5IBQA 4X00A 3BMOA 4C3VA 4C20A 3CJTA 4OX9Y 5E1MA 1IB0A 3PJFA 4FOPA 4G1MB 1FLDA 1SRRA 1WHSB 4F96A 4UAVA 5FUXA 5JD4A 1P1IA 1CYDA 2BONA 3LFHA 3QVKA 4E31A 3HFRA 1QR6A 3EWAA 1TEXA 5CJJA 1O97C 3EOZA 4RFLA 2CCJA 2GNAA 1H2ZA 4HMQA 3BPSA 3ZVKA 1NF8A 1EBFA 3G79A 4G97A 3FLMA 1E9RA 1M8PA 4DA7A 1YUBA 1TCUA 1VE3A 1EVJA 2QR3A 1VRWA 2WNHA 2Q6KA 2NU8A 1UBOS 2QVBA 3FTPA 3I9MA 5AVRA 5JARA 1YS6A 4RLHA 3ZY3A 1ISRA 2HCBA 5A2QA 1OLUB 3CO5A 1ADCA 1XEAA 5FPYA 2PEZA 2ZZMA 3GT4A 2WAYA 4OL0A 1RFGE 2Y0EA 4CV1A 2BYTA 1Z5ZA 1JH9A 2R11A 5IFLA 1MJGM 4UPDA 2G9ZA 4PIMA 2CXNA 2WA1A 5ALMA 5AVZA 2OFXA 2HJWA 3FDZB 1R0LA 1Z47A 1ISSA 1JAHA 3SP1A 3BGOS 1JXOA 1UBNA 1UJMA 2XCIA 3L0IB 2QTGA 1OROA 3EUWA 4CQLB 5B12A 5F2KA 3LHKA 1A4RA 1U1IA 2IV3A 2LKCA 1A9TA 5AJTA 3Q6IA 2XWBF 4L4UA 4P38A 3SE0A 1LDYA 4M1ZA 2QW8A 4P3XA 2G7MC 4PV7A 3WMRA 4M1EA 3ZXIA 3HXQA 3D4BA 1GZ5A 4BPRA 3GPBA 3HN6A 4MHOA 4RNDB 3JARB 3FE2A 4W99A 1EBUA 1ZGAA 1JN0A 2QB5A 5E4JA 5IYZA 5DGIA 2PG3A 3EXG2 2IUTA 1MC5A 2QD4A 4FDAA 4TYYA 4DSNA 1DDIA 5ES3A 1G6Q1 4MKIA 3ORFA 1XA0A 1WPRA 4L0MA 2M6RA 4YUVA 3STXA 2DFVA 4QYIB 4BU1A 2GEJA 2R96A 3KKMA 1Q91A 2GS9A 1RMYA 4NS4A 4O1MA 1B73A 1C0LA 3GDGA 4UOQA 3I8XA 3AG5A 4NMMA 3H4IA 2E48A 4C5CA 3DOUA 2WY2D 1PLLA 4M38A 3U9SA 3TL6A 5IHPA 2QN1A 4YXWA 2OD7A 4XPIB 4UU0A 5AKJA 1V1MB 2GFHA 1H3EA 1T1GA 1AQLA 3UGKA 1ECPA 2RHBA 4KIJA 1ZA1A 2XODA 5F12A 4LZWA 3MTDA 3RABA 4CLOA 2ZITA 3GRFA 4YXWD 1H9BA 1I8TA 1QVAA 1QYRA 2IZ0A 1LZLA 4EY5A 2ZE7A 2PR7A 2JHGA 3B1WA 3DHWC 2FSUA 3D3QA 1R88A 1EI9A 4MW4A 4S1PA 5K05A 5DCYA 2J9YB 1K8XB 1F4PA 1U0HC 3DBOB 4O4JB 1SBNE 4UEKA 4WW0A 2GBLC 3TH5A 4HBGA 3TDKA 2HL6A 1LXCA 3D3EA 1KI6B 3ZC3A 4M3NA 4F0JA 1QRRA 4LXHA 3K05A 4L2IA 221PA 1RYZA 3NJ4A 1CNFA 1DQSA 3ZHTA 3S44A 2R5WA 4EKDA 1QFYA 2XWJI 4YASA 3H8WA 5JCJA 4RPCA 4FP9A 5KWVA 5BURA 2JIMA 1ZNZA 2ZBUA 3NBAA 2DP4E 4CMEA 3GLFE 4FI3F 4CDRA 1PYGA 2ZJBA 3EXEA 1QHSA 1U0SY 3MLBA 1I6MA 1RJ9B 1H1DA 2FH5B 4MEAA 4NU8X 3U1BA 1UDAA 4ALKA 2Y76A 1H2HA 5CPFA 5JCJD 1KVUA 2UVDA 3SC2A 1U11A 4CG2A 1FSPA 3IV9A 4CL0A 2EZ4A 1L7PA 5FV4A 1SHZA 4QUEA 4XX0B 4JLJA 3HN2A 3M6IA 2QLJA 5ALGA 3VO2A 1VCHA 2GYYA 3DYIA 4JL8A 1N2JA 2X4IA 4MV7A 2OYRA 3VISA 4D43A 1Z26A 2HA2A 2HXYA 6REQB 2VDVE 3OA0A 4CCYA 3RKRA 3JASA 5AHRA 1UJ2A 3FUVA 2CE7A 2IYFA 2QVYX 2QJWA 5C34B 1BVHA 2NZUG 5FPTA 4YV7A 4JEIA 4ZOLA 5AW3A 2WDPA 3WX0A 4B32A 3SQWA 4AMZA 1IZZA 3KO8A 3W6NA 1FP1D 1QV6A 5DO9A 4QUJA 4JJ8A 4TXNA 3EDYA 5H7XA 2IHTA 3INGA 2A4KA 1WABA 4N7RA 1BEUB 4JVSB 1GUBA 1BE1A 4P4SB 4J8PA 3QKSB 1E5LA 2LWIA 1E4OA 1K4MA 5BWLA 5A9TA 5IEJA 1VLHA 1UZLA 4TSKA 3PX7A 1DC5A 1LC0A 1JYFA 1LQ2A 1DAFA 2ZYRA 3ZLVA 5C80A 4CQJA 5JFTA 4FINA 2VDUE 3COVA 5DXFA 2O8DB 3UT6A 3C70A 1TYCA 4RYLA 3VR6D 1JEYA 4ZQIA 1CR2A 4R2KA 1WB9A 2DAPA 2QUIA 9GPBA 3WWOA 4DDWA 2Y99A 3QTLA 4LVUA 5JAOA 3R76A 1GZ7A 1SIOA 4RTJA 2PDAA 3OOJA 3CZPA 2NPFA 1TPYA 3FCCA 1FLVA 1REQB 2IZOA 4ANFA 3K09A 3UGJA 4CGZA 1R3DA 4MHTA 3SXJA 4YALA 1YC5A 3TLGB 2WU4A 5E7IA 4KQIA 5IBPA 3DONA 3FPAA 2Q9AA 2PT6A 3PQ5A 3TG8A 1MG5A 5I7UA 1HYEA 5CVCA 3P2MA 3QUTA 2CKDA 1W1UA 3FXAA 3FVWA 3GDFA 5JSYA 2AC4A 4HEQA 1KS9A 4W7SA 3LSYA 3EIFA 3JWJA 3O1LA 4MV0A 4ZD6A 2IIQA 3VYTB 5G0WA 1ZR2A 3NVMB 5LQUA 2JGDB 4B0PA 4NZ9A 5A9SB 3BHJA 4LXTA 4N0MA 3ROMA 1ID1A 4RIEA 2YC4C 3W7AA 2P2CA 5KVSA 4KBFA 2I8LA 7GPBA 4RBNA 1XTPA 4J91A 2ZI3A 3T41A 1HYHA 4GBMA 2PCLA 4TQGA 4BRSA 4YMUA 1L7MA 3L7DA 3OLXA 5CA0A 3OPYI 4QSMA 4YLEA 4BNDA 1SU7A 4K8RB 1ZHHA 5FHRA 4AQYB 4NG4A 2CT8A 1XNRB 1FFBA 3VVBA 1YR3A 1QC5A 2AL7A 2HT1A 5GMOA 1JFFB 2Z8YA 3L9XA 5AESA 3LQ2A 2YY5A 1TL7C 4V0NA 4LJKA 1M83A 2XB8A 4CLRA 2QL5A 3EGXA 5SY4A 4EHDA 1ZJ4A 1A8PA 3LXRA 1L5SA 1DDOA 1X8JA 4H60A 2C7PA 4IIJF 5DNDA 1GITA 1MTOA 2CD7A 2IPXA 3ONNA 2NO0A 1NBAA 1MPTA 4AULA 4J0DA 5FADA 3A9CA 2JLAA 3CYFA 3FH0A 1G8GA 1GZSA 3BKXA 3LOPA 4RV4A 3W8DA 4D41A 3W9YA 5BR7A 2HGSA 1BCSA 3BGVA 4Z0PA 3L93A 1V1MA 3W3AH 2IFTA 3DDNA 4CMEC 4PZDA 4F56A 1TM4E 3NDBB 3KVOA 1RM4A 3UG7A 4YT8A 4KRFA 1RADA 1BXRA 1P29A 3JQGA 3DEAA 5EFOA 3P2OA 2HJSA 4RIIA 5CXSA 4KOAA 4HZUA 2R1VA 1YZYA 2X1MA 3W6UA 1CUSA 2RHWA 3Q7TA 3KEOA 4JIMA 1R0YA 3OLYA 3UEOA 2IYZA 3TR5A 1W85A 1XK7A 2RH4A 5EWMB 1C7IA 1OH8A 1J90A 1H0SA 5FBZA 1CQIA 1CE8B 2JFBA 3WA6A 2YV5A 4FSDA 2GRUA 2O6LA 4GL2A 3Q1KA 2ZQYA 5AW5A 5DBOA 4HX5A 3V00A 3U3DA 1Q77A 4C7MA 2ZYSA 4FNAA 1EFPB 3DFFA 3DZHA 3LCJA 4IUBS 3PFHA 3NIDB 4FEGA 5DNAA 5KOHB 2DRIA 1CHDA 5IT9A 2ZYIA 2YX1A 3UHPA 4MR9A 1JR3D 2GK4A 2QR5A 3W5DA 3ACBA 4G24A 1TM2A 4YUXA 5CAEA 4QPCA 3K9NA 1KDPA 1ZNYA 1YZKA 4XUGB 2J48A 5I7FA 2JK0A 2R65A 1AK1A 3AH8A 4KMRA 4A2QA 2QD1A 4RMIA 1DMSA 3AVWA 5FO1A 3QW4B 2X7XA 2GBLA 5J4VA 2YBEA 5GJCA 4Z54A 4Q16A 1Z37A 1LNQA 3E27A 4BMXA 2VJNA 1Q2UA 1QHIA 5FKJA 5AOAA 4JNKA 3OKPA 3ABZA 1WXHA 1ZRSA 4C7OA 1QGYA 3OPMA 1JV2B 1N1EA 4LYAA 4NC9A 4YDHB 3GHHA 2DHQA 2IYRA 4EVQA 3M2TA 3PGA1 2VQSA 1W34A 3NAQA 1PYDA 2P5TB 4COKA 4F12A 5LXTB 4FI3C 2YWBA 4DWOA 4I5FA 3H1BA 4K81B 3V4VB 4XFDA 3B1KA 5AK4A 2ETVA 5DTRA 4IDDA 2GX6A 4L5CA 2Y2UA 4QL3A 4ARBA 3PC7A 4OQ4A 4RHCA 2ZLBA 4K9NA 4MUJA 3CS3A 3PFBA 3DAFA 2NV6A 4JLUA 1P7ZA 1ZMXA 3EFHA 4O1IA 3ZXYA 4EFKA 5JTTA 4QOGA 2C3OA 3WLPA 1HE1C 3OEHA 2YV3A 1E2DA 4PU0A 1T10A 3FR8A 3NM5A 1FQWA 1T3LA 4KXXA 5DWDA 4CF4A 4G2TA 2V7PA 1SUPA 4P53A 4CKBA 4E5NA 4EMUA 1ID8A 1OX4B 1XKLA 5LP6C 2O4UX 2ZRQA 2HXGA 1RAIA 4OUDA 3HUDA 2WAAA 1OBFO 2J0QA 3CX7A 1UDBA 3TO5A 5BVGA 3VNBA 2GWHA 5H68A 4J2TA 2JLZA 1YI0A 2WKRA 3EYWA 2YJ3A 2IS2A 4QPZA 2ET6A 3JCZA 5LXTA 2G9UA 2HIGA 2P4QA 3E2PA 4NMWA 5D3MA 5EZ5A 1Z7WA 3O3MB 3HJHA 1Z74A 3AJAA 3VSDA 3WIVA 4EKNB 4F2PA 2AEFA 2G8NA 2IEAA 3OZAA 2ZSFA 1L5MA 4OQZA 2FWNA 1Q7BA 2PRIA 2W43A 3EIUA 4KXFB 2VH5R 3L01A 2VYND 5KDLA 1KQPA 1KK2A 4M9XA 4ZCPA 4LF8B 3KLNA 3OEYA 4A27A 1BE8A 4WK0B 1H22A 2FSPA 4H7EA 1KMHB 1KS2A 3DBVO 3DOOA 4OI2A 3VI3B 5CIYA 3CPJB 3H8VA 4YH1A 3CW8X 3UKOA 1DRJA 5FAKA 1B3BA 3JTMA 1QGOA 1V2HE 5EVJA 2YQZA 3ZHVA 3KYDB 1PUJA 2HNKA 2JFUA 4EHHA 4YQZA 5KSZA 3ND6A 3H5IA 4X1KA 3UUWA 2VZLA 2WINI 1EQUA 3QBEA 4BTEA 1CUEA 1G5HA 2QYHA 4EL0A 3QPUA 3H9CA 1G5RA 3RC9A 2C4UA 3RFTA 4CF5A 5K8UA 3ZE8A 4HNAA 4JKYA 1NQ5A 1PZNA 2Z2YA 3K5WA 5L3VA 1QU3A 2VUSA 3KQSA 3R0XA 2AEMA 2J8ZA 2JFYA 2RGNA 2YMQA 2AA3A 1XF9A 1EDBA 2YWFA 4W8GA 2R6CA 2IH5A 4NICA 1QVZA 3F71A 3DCJA 2GBPA 2XQJA 3NGMA 3K9QO 2HCTA 4FMDB 4M8LA 4X5OA 2V7BA 2X9LA 4YDSA 3F5DA 3TVDA 5IULC 1THTA 1CVLA 1U3CA 4G8DA 2FW0A 2XF8A 3E7FA 1P2BA 3DMTC 3IHTA 5ENDA 4KN6A 5LLSA 4EELA 2W4MA 3NBYC 4D02A 1VKNA 5ARDA 1C30A 1FZQA 1CF4A 3M4ZA 1I6KA 3OE5A 4RD0A 4KR9A 2I4IA 1OREA 4NYJQ 4D0SA 1DJMA 4RVFA 1BXZA 3EG9A 5J5AA 3QE9Y 3GEBA 2XB4A 4GP9A 3VVCA 4BLVA 3HUEA 4KFTA 2J6HA 3U6BA 3SJ7A 3FHTA 2O07A 4G1CA 4H3SA 5K09A 1JKXA 2P65A 3BREA 2OXTA 3U3JA 3HB0A 4IWNA 1L7OA 3PHIA 3HBJA 1Y8ZA 4HNSA 4QM6A 4BQRA 1LJUA 2YIJA 1QE0A 4Y0AA 1DCFA 2ZVJA 3B82A 2W6ID 1PTKA 4J0EA 3RARA 3TW4A 4P86A 2P9EA 4P4UA 3NPAA 4CKCB 4EL5A 4I7EA 4C6TB 2H1FA 3V80A 3RRYA 4H4CA 3FPLA 1VKRA 3ED5A 1KMHA 1MU0A 3RC3A 1CEEA 2VBFA 1C4KA 2ORWA 5F9HA 3DXZA 3ACDA 3DHEA 1K27A 3DMYA 2O3UA 4GC9A 2Z5GA 3V33A 4BO4A 5KQRA 3GH3A 4WXHA 4MGHA 1BKSB 3WL6A 3THWB 1V8PA 1YVRA 2FMXA 3KOMA 3K6SA 2WTMA 4GPEA 1E5QA 2L18A 3IBGA 1VJGA 3C24A 2LKDA 3C15C 4BEBA 1NKVA 4OHWA 3F2IA 1RLOA 4W1PA 2V6FA 4FFSA 5KYVA 2PLAA 2Z2IA 3WISA 2I9KA 1T9CA 3Q2IA 1L6IA 2IYPA 3E9MA 3PDIA 3ETHA 3CPHA 2TMKA 3MT9A 1FP4B 3QWFA 4BO9A 4MZDA 4WX2B 1NKSA 1EK6A 2ECKA 1A1SA 1BA3A 1IBLB 1N6IA 5AKHA 4XGRA 5AM2A 1H2XA 3WFIA 4E2FA 2VL7A 2FQQA 3UANA 1RHKA 4LHVA 2MMCA 2JGEA 4P2BA 1KAQA 3L0BA 4EJSA 2NU9A 1FSSA 4RQTA 1U8EA 1M5TA 3N0WA 4F72A 4GZ6A 3ZV5A 4KYIB 1OJLA 3A6PC 1KXJA 5JI2E 3AM1A 1A8HA 1F06A 3E1GA 5AQEA 1NR7A 4YWHA 1KY5A 3AHIA 3X1ZA 4NYIQ 5AVQA 1VIYA 1RWOA 3TTWA 1SUWA 4XJSA 2CFSA 3RC2A 4QXOA 3CPEA 4YEDA 1Z29A 3UOGA 3GT7A 3F6BX 4E5VA 3L4JA 2WJIA 2FRVA 2VBGA 1YB2A 3INTA 4LZLA 5JAPA 4FUTA 1NMZA 2TMGA 4B3IA 1RACA 5CGZA 5LB2A 3TLCA 3WIBA 3Q8MA 1P6UA 2WUWE 3DSRA 3EIQA 2H4HA 5LZ5A 4HLUA 2XIQA 1JHXA 1CQJB 3M4XA 3Q6NA 2B61A 4QDZA 5G0SA 5JT1A 2VHEA 2VNIA 2IYNA 4CXMA 3RADC 3KOZA 3KPYA 2BDTA 4U39A 2JD0A 3ITEA 4WCFA 3WL5A 3ZH2A 3E81A 1HNXB 2FW1A 3AW8A 3VDXA 4J7XA 5EP1A 4BPBA 1RTKA 1QK4A 2H1OA 4L9SA 2JKYA 3ZX5A 2XVMA 4II7A 4PCAA 3IEMA 2ZATA 3L8YA 5K03A 3H2IA 4AK9A 5FEUA 4ON9A 5EAIA 1N5LA 5A9RA 1VMIA 4QBGB 4TXLA 3ZS8A 3UHJA 2QP4A 2YJ6A 2H3EA 4MS1B 3NTLA 3SS8A 1LRLA 4ZKDA 1FYVA 4CF7A 2H92A 3KXDA 1JBEA 1VE1A 2P3OA 3ZUGA 3MCTA 3KZMA 1VPVA 5A7FA 3D6MA 4PIPA 4DDHA 4M9QA 4DLNA 1DRKA 4J29A 4TKLA 1XRNA 1YB6A 1UBMS 1UWCA 2XADA 1YRAA 2I33A 2NPOA 3EGDA 3FGNA 3L1VA 4GLOA 4OFXA 1DX9A 4PG7A 4WECA 1PEKE 1YK1A 2WWTA 1ZW6A 1P2TA 2XWSA 4IM7A 4MVJA 1ZY2A 1T1EA 3K35A 3FMFA 5HF6A 4OBBA 4U0KA 2O48X 4AZSA 2Y0PA 2EAUA 3A8TA 3DVQX 4M7RA 4WN9B 5DFAA 4YP9A 4XYLA 3E58A 4BV3A 1KEPA 4URHA 4KPEC 4MR7B 1U2EA 2WYWA 1G16A 2R9VA 4WDRA 3M1AA 4D2IA 2C3MA 5IDXA 4RK1A 4E5PA 3HP7A 3KEQA 5T3YA 3H2YA 3UMSA 3VSEA 2EFJA 3MUEA 4H2DA 2WHEA 4ZVOA 3IRVA 3R8FA 5EE5B 1JA9A 1PX0A 3N2KA 2HO5A 3DE6X 3NBFA 4DIBA 2AKEA 4NTZA 2QE7D 3QBTA 4HGYA 4C1BA 2AKAB 4PGGA 4UNSA 5CEEA 1GM5A 2I3BA 2BMEA 1GYPA 4OKNA 4U0JA 3INYA 4WOKA 1M33A 2C8LA 4PO1A 3U44A 2XF2A 3PXCX 4Y18A 1LEHA 1JSLA 3SHFA 3MMNA 5CPBA 2O6HA 5C4IA 4KLRA 2Q0XA 1NMQA 1N75A 1GDHA 1YVUA 3BAFA 4L07A 4M9RA 2CVOA 3QEMB 2ZP1A 1OU0A 4CPDA 4MIOA 1X8XA 3AI7A 1MUUA 5KQGA 2JFVA 3LLMA 4TZ6A 1Q5PA 3A1VA 1QBKC 2H3HA 2EATA 2ZSKA 3BB4A 2IYQA 2R8OA 4XA8A 3U3XA 2CB9A 4W1RA 2H11A 1DSSG 1OTXA 2VTVA 1J1ZA 2E9SA 3LCVB 2W7TA 3U37A 3MINB 2NUPA 1R0CA 3K2BA 3C6YA 4KGXA 4I8DA 1E61A 5JS7A 4KSCA 2WUVA 3LY8A 3T7DA 3WYBA 3WGKA 1W2HA 3E4DA 3CQ9A 1DJNA 2OGSA 3QYPA 4EZEA 4R71A 4LF6B 1MORA 1R27A 1W46A 2L82A 2X13A 3DZJA 3AVQA 2WB2A 3OHPA 2ZSDA 4X63A 2ZT7A 4NQRA 2NW6A 2R25B 4GGMX 5M04A 1BFKA 3CRMA 3KT8A 1VSTA 4PFSA 2QX9A 5AKXA 1MEEA 1ZUHA 3LBIA 4MWDA 4D3YA 1E3LA 3SK0A 4ENVA 1SG6A 1CQXA 2J32A 1TTHA 4PX3A 4WADA 1DAGA 3HB9A 1YZLA 4C29A 1QO0A 1K7XB 3ADKA 3PVSA 3DLPX 4DUGA 2UUCB 5IS2A 4IDHA 4MARA 3RVBA 1EWYA 2QPLA 4B82A 1IOLA 3EGDB 3GFGA 1N8NA 1WPGA 2PVCA 1QIHA 2GBGA 2H63A 3KTFA 3GYGA 3O8LA 5AOCA 4ARAA 3L8CA 3NRJA 3H5NA 4J0FA 1BQ4A 5AP9A 5AD1A 1N0WA 1MB9A 3PYMA 1P61B 3S2ZA 5FOXA 4JUAA 1UOPA 1L4MA 2YWDA 4QULA 5JSZB 1M1XB 1WDLA 1OI7A 3ZR4B 3CVOA 5IX8A 4UDXX 5J2TB 1JECA 2DEUA 4JHLA 1T91A 1KZYC 1IUOA 1KEKA 5EKXA 3CKYA 2HEIA 3CJQA 4QAQA 1PKXA 5A3QA 2PL5A 5IH7A 3LC1O 1XYVA 2H85A 2NQTA 1Q92A 3Q8XB 3OO1A 1NLFA 3QWBA 1BEZA 2MSEB 4FM9A 4ZPJA 5A4KA 1GZDA 2CHUA 4OBXA 1Y98A 1ONOA 2DECA 3EOAI 1W36D 3O3NB 1Z2PX 3PEVA 2GR9A 2GSDA 2HDOA 2X1HA 1NN0A 1XDBA 4NU6A 4DC0A 1WLYA 2XCOA 1KVTA 4JYPA 2EF0A 4LX8A 2AR7A 2AH5A 4Y1GA 3T1NA 3VMMA 1R4ZA 1ECFA 5DBIA 3N8IA 1O6ZA 5DM70 3ZHOA 3PLNA 2PX6A 1TRKA 4ZEXA 1E1CA 2FWAA 4BX2A 4C22A 3GG2A 3HS3A 5BVGB 4ZZIA 3HGQA 2F43A 5IABA 4YRNA 2HA7A 1BE6A 1MC1A 1CRLA 1SIUA 1HEUA 2JJ1D 5CBKA 2AZMA 3GJ6A 1MJ5A 2GYUA 2I7TA 3KXKA 3U40A 3WLAA 1LLDA 5A2GA 3O90A 3LBAA 3JASB 3L1IA 4NBLA 2BUAA 2P9YA 3AM3A 1DOHA 3AF5A 3CLTD 5T64A 5DI9A 2JJ1A 4QJ5A 5CXXA 2PUFA 4M1KA 1TT7A 3FSGD 2VHVA 5GAJA 1N78A 2QSJA 5DLYA 1W5BA 3W4KA 4HEA1 5FWYB 5HRUA 1KYQA 4RGQA 4EB0A 1UK6A 3SGLA 2HYDA 1X7XB 5ALDA 5LVAA 3G1UA 4MV1A 1V8ZA 1E9SA 4AP5A 4RTLA 2IITA 1BWSA 1NONA 3EA0A 1W30A 3O93A 1GV1A 2BGRA 4H59A 4RH3A 2NTJA 3EVBA 3ITNA 2NNWB 1MX3A 3ACCA 4LOKA 4HX9A 5AJXA 4GECA 2HV8A 5JJBA 3I2IA 2V74B 2VZ8A 4YAEA 3VTZA 1U3UA 5HKAA 3DV2A 1EE9A 3QUQA 2IHVA 3ORQA 3UJ6A 4C5BA 3U4IA 1SKYE 4LWPA 3O4JA 1X39A 3RSQA 3UH1A 3V8VA 2OAEA 3IUSA 3I2GA 2MCFA 4YTEA 2I7DA 1Q1NA 4LV8B 4Y67A 4UXIA 1EFAA 1PW7A 1ZX1A 2AHRA 2VNKA 1JLMA 2V55B 3EEQA 3N2YA 3OPXA 1HWYA 4OMCA 5EEGA 4OXQA 4CIWA 3SMVA 4BYGA 3H83A 1X7ZA 1VLZA 4Q21A 1Z2OX 2HI0A 2ODQA 5CYFA 4L1KA 2J31A 4KX3A 4N54A 2YVLA 3GDWA 1W25A 2O23A 2WABA 1Y6QA 2HU8A 1U7XA 1ODTC 2JGAA 3I0MA 2GEBA 1ONBA 2AKYA 1BGVA 2WICA 2OCKA 4Q01A 5EQDA 1JDSA 4B3CA 3UWMA 4ZT5A 4BN0A 1OGJA 2AF3C 1JHOA 1HDIA 4ZA2A 3ZTTA 4KXWA 4EUNA 2EBWA 3LHFA 4H27A 1D1SA 2TSYB 3O26A 1BDJA 3BH0A 2O7RA 1KO1A 2VRBA 3PEUA 3QH4A 4LJYA 1N0IA 1WU8A 4AYXA 1Z06A 2NSHA 4ALJA 3OD1A 3AEQA 4K6CA 2JJ8A 3NANA 2Z6VA 1IZ0A 1BS9A 5D3QA 3GZNA 1T43A 3G49A 4E08A 4EFLA 1QHEA 3R5XA 5ERXA 4FR5A 5EHQA 2B3DA 2CBXA 1I13A 3TNLA 3T1HB 3WYDA 4R7GA 2D5AA 1IK4A 2BFWA 2C4HA 3H05A 2Q5EA 2VH2A 3L4BA 3NHMA 4RACA 2FPIB 4RE5A 1ESEA 3NRBA 4KQCA 5A5GA 3L5OA 4OQMA 4ZO7A 3RYTC 1V5IA 4ZARA 3DD1A 2N42A 4YRTA 1JMKC 1JR4A 5ABPA 1PEAA 4AZ0B 2I4TA 3PA8A 1P5HA 1T25A 1V7PC 2VHXA 4Z9YA 3AETB 3GF4A 3KZNA 2OM2A 5FBQB 3ZWXA 2PNJA 4AUMA 5HNKA 1ZD9A 1SBQA 4YMIA 4I4CA 1AQYA 1QVRA 5CFNA 2ZRCA 1QF7A 1NM5C 2PD4A 5FR1A 5A3JA 4JUCA 2GAJA 1R0BA 3V7NA 1V25A 2VT6A 4F9EA 4BAGA 1U9YA 1HT3A 2AEJA 2B5VA 3EOBI 4Q9LA 1T3ZA 2SBTA 1EXWA 2VK1A 3A7EA 3MUNA 2O52A 4YROA 2GM4A 5DSTA 2FRDA 4K0KB 4EGSA 4H31A 4KAJA 3U48A 4B6QA 3WJ2A 4E2XA 3TTVA 2V6JA 2ZVDA 1LF0A 2ZRJA 4TLMB 3P8ZA 3HV0A 4CIVA 1E64A 1J0XO 1HG0A 2IY9A 1DAPA 4X0EA 2F90A 1QHNA 2F48A 2GM5A 3BDVA 3P2EA 4UUQA 1GRRA 2ZJ0A 2QVZX 4DEXA 2M1XA 2BC9A 2P2YA 4P7JA 4Q1DA 4Q6WA 4UTZA 4WK2B 3D43A 3UAZA 2W2XA 2VYQA 1QCZA 1NX9A 1J8MF 2E87A 2XUOA 1DIHA 2OA0A 1MBZA 3RDPA 4JP2A 1KJQA 1XVUA 1N2IA 3B1JA 3JATA 2WG2A 2A1TS 5T67A 4RIFA 2C31A 4BB6A 3IX7A 4NH4A 2OKCA 1IQUA 5D3ZA 4U7PB 1SEVA 4QA9A 2FPPA 1O1YA 3R3SA 2B5OA 3HACA 3WGQA 3WLHA 1SCQA 2ZTSA 4OYYA 3CVXA 4Q93A 2XUIA 1PJSA 2QYTA 2QJRA 4V0RA 1Y8RB 5BO5A 1M7BA 1S96A 1J09A 2V6GA 3FB1A 5F1OA 1J99A 1Q7CA 1Y1RA 3OQBA 4DWWA 3DVSX 3F8SA 4X92A 1FNMA 2Y1FA 1L6RA 3IBSA 3QU2A 3TX2A 1XEWX 3QX8A 3F5MA 4RXTA 4IUCS 5C1OA 3NC4A 2YOHA 4MAAA 1NWHA 3QMPA 1AHPA 3M1LA 1E9EA 1A88A 4DMUB 3OTOB 1E3MA 2V58A 3I04M 1OX5A 2AG8A 2E4XA 2Q4DA 1LDGA 2Y4OA 4PBSA 1X7HA 4GVXA 3O75A 1GNSA 2UZIR 4P7FA 2V7GA 3IIJA 4WCVA 6ADHA 1KI7A 3J80A 4B4OA 4OX9B 3K4PA 5C5IA 4Y6PA 3K30A 3P9YA 1E0AA 4IDEA 4ZO9A 1R6TA 1JEYB 2D2XA 5CVJA 2WIBA 1IIBA 2QTHA 2G80A 3ND8A 3K0FA 2D4HA 1NUSA 4HNQA 1FSZA 4W9NC 4D4GA 4G8BA 3H8SA 4PNPA 1Y48E 3HVIA 4PZZA 1OIWA 1QRDA 3D2AA 1CB7A 2IEZA 3F9RA 4CV3A 1C0KA 3MW8A 3WS7A 3O82A 3PDJA 2IOYA 3BZWA 4B1FA 4FW9A 1VBKA 4XVUA 3AT1A 5CK5A 5ALFA 1JSRA 4BVEA 3U4MA 4C0WA 5HS6A 5A3VA 2J9RA 3BK2A 3N70A 4L9WA 3H84A 4IOLA 4LJ7A 2XZLA 4BB0A 2ID9A 4JYMA 4D97A 4LJ5A 2L19A 1E5DA 3CUKA 4L3WA 1RKQA 1QQAA 3HYLA 1EDOA 1WMFA 3F3MA 1RQPA 3FZGA 4X1YB 1VFPA 2D5CA 1DKLA 2FWJA 4C4TA 4E1AA 1FRFS 2I6XA 1OZ0A 2YWJA 3H0CA 1WV0A 4CV2A 1MRNA 3Q8KA 1TF5A 1JL3A 1YAJA 3ZV6A 4MVJP 1PGOA 4YYZA 5LYYA 3UT5B 1QZZA 3VDNB 2OCLA 3N0TA 3NWOA 3CRNA 3ZJ5A 2C83A 1HXHA 3VX3A 3R3HA 4MQMA 2Z4SA 1B16A 3F78A 2BVNA 4IEFB 2R1ZA 2PZLA 3EUAA 1EX7A 1V47A 2OSVA 4URVR 1L5WA 2FPKA 2CLEB 1FYFA 1RI4A 2UYYA 1ZK2A 4JD5A 3WL4A 3LDGA 1AG9A 1ZK3A 2SNIE 1OTYA 3JZDA 4HGQA 5DM2A 2DKOA 1K1EA 2D1TA 4GXTA 4EG1A 2J67A 1YKGA 2BGNA 2VPWA 3I39X 3TCXB 5BSVA 1Y80A 4PZPA 3CVYA 1XB2A 4IHJF 4EO9A 1G7CA 4ZVTA 3QNUA 2AXEA 1JR3E 3NRCA 4QU9A 5DDIP 5EXPA 5AKYA 1SUIA 1R10A 3Q1LA 5WRFA 4F91B 3NYRA 4EMBA 4AICA 5I6DA 1OGYA 4MMXB 5T5QA 5I7SA 4WBNA 2OZVA 5J2UF 4X20B 4HVAA 3LPLA 1F5SA 4BFCA 1GA4A 4MUBA 1JG1A 1MIOB 4TZ0A 3O94A 1L5OA 2WMDA 1H93A 5CW2A 4ZXFA 3TL3A 3ZY5A 2DF8A 1TYZA 3INRA 1LQTA 3G1WA 1G8MA 4PSAA 1RBYA 2BR3A 1RNLA 5E4YA 3RRMA 3TTTA 2QL7A 3BXFA 3WAGA 1Z17A 2F8LA 4H1HA 3EG5A 3T5CA 1G7SA 2HYIC 3RWMB 3OY7A 3K9WA 3N2NA 3CUVA 2OO5C 1KSHA 1QDEA 2YWHA 3DEZA 3GUUA 4P82A 3QLUC 4KPYA 3DJFA 4H17A 4HI0E 3P0IA 4RVUA 3VR3D 3IPCA 1S7GA 2QLMA 4PLWA 3TNDA 1KBZA 3ONVA 4AJ9A 4E46A 1NT2A 2JIQA 3O5AA 2HCFA 4OQXA 4Z4CA 1R4NA 4K7JA 5DGXA 2FDRA 5F52A 2V6IA 4M88A 4C2AA 4DADA 4DJTA 1A9RA 5JSUA 3A11A 4F1JA 4YGXB 1SZDA 3SVTA 1QIJA 1XZMA 2KLHA 2V5VA 4J0CA 1Y33E 4CLXA 4N6OA 5F3RA 2O8VA 5F51A 3GQBA 2W6ZA 3IOEA 3W6OA 2C7GA 4DSUA 3S2EA 1IEWA 4OYLA 1YDGA 4PLZA 5AOBA 4MGIR 3STYA 3G8BA 1TYAE 1CUZA 1HE5A 3I8SA 3R6DA 4X64B 1VBNA 1Y4SA 2JCXA 4BMZA 3SY8A 1N7JA 1EUZA 2OHHA 2CCKA 5COQA 1NJ5A 2OLEA 1XLWA 3KU1A 1I94B 3L0OA 3L49A 4G6ZA 3VC3A 2AGVA 2ID8A 4GNRA 1GADO 4RHFA 4UNPA 1M0TA 3USCS 1UKCA 4HY3A 2B2NA 4U2EA 3KOOA 1A9QA 1HH4A 3QPAA 3UWPA 4CU2A 3LLUA 1AQ6A 1P1FA 1SQSA 1K6EA 4RX1A 5THKA 1Y9ZA 4JXXA 4CBVA 4URZR 2JJYA 2Q4BA 2P77A 4D9KA 2NMVA 4BV8A 3LC2O 2C04A 4JA2A 4S04A 2PUCA 5G41A 3CF4A 1E9AA 4YAWA 4ZK6A 3MWEB 4Y2RA 3JSXA 4RS4A 1NUUA 2JZNA 2C29D 1MXFA 5A06A 2EYUA 4TT8A 3A2KA 4JA0A 2XY4A 4J0JA 1K5DA 1M5RA 2TRSB 4J6EA 4HB2A 3S2FA 2A3RA 3T0FA 4XTCS 3BFJA 3BSYA 5JXIA 3ZWOA 1E79D 1Y7PA 4JUDX 4MKXA 3FSJX 4EG3A 1MVOA 2WJAA 3BIOA 1US8B 4IG4A 2BJHA 4G0ZA 1VE6A 2H4FA 4Y9TA 4QPJC 3DO5A 4RGVA 4ZI7F 3DZCA 2ZXUA 1ICEA 1VMAA 4Q05A 4EGAA 3GLGE 4Q4HB 1OLXB 1N7HA 4BO8A 2JFGA 2OHXA 3I8OA 1P9RA 1T36A 1Q0LA 4PFKA 4X24A 1T2DA 1T24A 1DAKA 1IUNA 1XCOA 1B41A 1CZKA 4QYMA 4ZIRB 2AQ8A 3TQIA 3KS9A 4WA7A 1FNBA 1RXYA 4B3HA 1GRCA 3LKBA 3NBZC 3OTHA 3V4FA 4LRWA 4CV0A 2CYCA 4W5RA 1G9XA 3WHKA 1II0A 1XP8A 4BGUA 1JZSA 1E7QA 2OMEA 4M54A 1AKNA 1KZGB 1KK0A 1GWNA 1UPXA 2R47A 3CUEF 4DLTA 3JQPA 2LCIA 3CVJA 3RBZA 1T2AA 3D9QX 4R1UA 1E2MA 5A4MS 3E7DA 4MRMB 2HLDA 1Z4QA 1TO1E 1VJ0A 3KSRA 2Q4RA 5JW6A 3WWPA 1E6CA 2AOWA 3M49A 4C4ZA 2OORC 4AD8A 4FHDA 4LRXA 5K6RA 4RHUA 1Z36A 1K89A 1KEEB 1V4VA 1YXMA 3ZZNA 3EVCA 1GG8A 3PXBA 3QX7A 3WLOA 3NIBA 4DYDA 1RMQA 1SHUX 3U3KA 5JATA 4BRUA 1PVOA 1UWVA 4BNHA 1SKQA 2AN1A 2P0EA 3TQSA 2C7RA 3WGJA 1YDEA 3BCRA 3QQ5A 4Y2XA 4RULA 3FOWA 2JLUA 3GI1A 4O4LF 4OK3A 4DUGD 3IE0A 2WIDA 3BSSA 3SHTA 1H42A 3PFFA 3VKVA 4DG9A 1HNWB 4KIWA 1N6NA 3W7VA 3RVNA 1R50A 4US1R 2FEKA 4LOLA 5D6NA 2EVWX 1HF3A 1F0NA 2VPPA 4L73A 3N75A 4Y1EA 3SNKA 3T4PA 2HMTA 4NVRA 4BS9A 4E21A 1MO2A 2HT6A 3C85A 4P4TA 1JH8A 4G01B 4JI1B 2GA9A 4GSLA 4KNWA 4DM3A 1XEXB 1JB9A 4J2OA 1T5OA 4AZWA 5LMZA 3V5NA 3R4VA 4RV9A 2HPAA 1M76A 4LYEA 5EJGA 2B7CA 2VTEA 3EW7A 3HLTA 3DE7X 2BM9A 2HN9A 3T7KA 2PTHA 4CYMA 3RGWS 3DPIA 2IYXA 2QVGA 3C5EA 3GFBA 1I7NA 1O95D 5FUYA 5L4LA 3P9KA 2Y9PB 1TJNA 3GCWA 1VKHA 1Z15A 2XUAA 2XUQA 2BP7A 4N3GA 5KAPA 5BNWA 4PPFA 1JAIA 2QUHA 1KSJA 1FU7A 1OPRA 4XLTA 4YRBA 4WERA 4EGFA 2ZUDA 5G1OA 3IALA 5A6VA 2YVKA 2W22A 2H18A 2VF2A 2XNJA 5B7NA 2PUDA 3FNRA 5CURA 3U1VA 3V2UA 4D74A 1ONNA 2YMLA 3I92A 1SQ6A 2AYYA 2VUIB 4MS3A 3OMXA 4S12A 1GPH1 2XCUA 1SHLA 1QCYA 3CBGA 4QVIA 3KZ1E 1CDOA 2O2ZA 4UXJA 5HRCA 2P2GA 3ZZ0A 2QTRA 4RF3A 3L0CA 2PZ8A 4RCVA 4LVNA 4EX6A 5JR3A 1S8OA 2AX4A 1JAXA 1TZKA 2ACEA 3RNLA 8LDHA 1UBHS 3GMIA 1YHNA 1X74A 5JBNA 3IJRA 3SHOA 5DTEA 5YASA 2DX7A 3ESYA 3I2FA 5C2JB 4C2BA 4BNNA 1XMOB 4QUBA 4BECA 1UJ4A 4TM8A 4DAOA 2B94A 1TU3A 2F4VB 3ROPA 5LNK1 3PGLA 2RGUA 5MGNA 4REQB 3RREA 3KKQA 4J76A 3NMUF 1M2VA 1K6MA 1DKQA 1F12A 4WESB 1MH1A 2CLMB 3RU9A 2YY7A 4ZVMA 1O8BA 1YJAA 4R9RA 1AJEA 4K87A 4C14A 1PS8A 4LYFA 1Z4NA 4HKTA 3ADDA 1W29A 3GFFA 3ZKAA 4N41A 3LPMA 4KQGA 2ZT8A 3U80A 1CJMA 1J7KA 5EKUA 5HFNA 3U16A 2WLSA 2D2EA 2ZS9A 1N6OA 3JD4A 4GRIA 5EHNA 4ZC1A 2HV9A 3W8FA 4C78A 4NPCA 3D4PA 3LXUX 3CVWA 3VV2A 1QP4A 5LSAA 2PSJA 3NTVA 2E89A 3Q3GE 1Z4LA 3JPWA 4PFQA 4E1VA 3V8RA 1U9ZA 2P91A 1N3LA 4WNAA 5HKLA 3C16C 1ZU4A 2PU7A 1XD2B 5AW0A 4V2IA 4YVFA 3HPQA 2N3ZA 4US2R 2C2BA 4X6UA 2HQRA 5B7GA 1AMUA 1C4OA 2AJTA 3T7SA 1MABB 3QUSA 3SYLA 2ZUUA 4Y2SA 4MUEA 3FYUC 2O8EB 2YW9A 1MNQA 3IPLA 1ZEJA 2I0FA 1XJQA 2J85A 2QYOA 2X6QA 3Q9SA 1CD5A 3D3KA 2BEKA 4K9RA 2CYAA 1IVYA 2PMEA 2FG5A 5DPMA 1X1TA 4IGIA 2DZDA 4POAA 1CP3A 3BICA 1RS0A 1RPJA 3M89A 3IQZA 1LDMA 1TUGA 3DVAB 2I76A 2JAPA 4JJKA 4M1SA 1FYEA 4XLLA 5BRNA 1ZH0A 4NOLA 3T1TA 2CK3D 3WLQA 2H6EA 2CLKB 4AL4A 5TGZA 1NBMD 2A7XA 5LC1A 9LDBA 4JC4A 1LV8A 1RIFA 1SCBA 1C80A 3REQA 1UJ5A 2I8CA 4Q37A 3DFZA 3AEUA 3WAKA 4LQCA 2AN9A 4KRGA 1AQNA 3QG5A 3IRUA 2NQ2C 2F55A 5EQJB 3D54D 5BPHA 1MX1A 3HLKA 1QCCA 1R00A 1KI1A 2YC2C 4CZ2A 4JOSA 4N6GA 2LIPA 1TJ4A 3U7QA 4PO3X 4JCCA 4JKOA 1YQWA 3RSZA 2X8JA 3ET4A 3SSNA 4WJLA 4ZT6A 4I8XA 4B8WA 1XRMA 4L28A 3QEKA 2A9FA 1QGDA 4OLHA 4GLJA 1ZNXA 1XU9A 5ITZA 4JT9A 3R3XA 4ND8A 1N6KA 2DT5A 2HOQA 4JZYA 1M2NA 3OZTA 2DQ4A 1JRLA 3X43A 1GL9B 3E84A 1Y7HA 3A9WA 2OSBA 1OV6A 1SCIA 3OPYB 4UBLA 4EI8A 1VG1A 4HQLA 4BEJA 2A6PA 1IXYA 1EH5A 5D1HA 5DH9A 1Y1LA 2O7NA 4R8KA 2X1VA 1W94A 4G1EB 3B2QA 2BJVA 4YBRA 4ZI3A 1ONPA 2HUNA 1WVGA 5JFGA 2HBQA 5KQMA 1L4NA 3RUDA 3ILSA 1MR3F 3GG9A 2IEGA 2O3RA 2P6UA 2GEFA 4JSYA 1GPWB 3ZE1B 1L3CA 1VG8A 4L0DA 2QYSA 2NPIA 1ZC3A 2OGTA 1UH5A 1Q7TA 5F35A 1W4LA 1T8YA 3MWKA 4OQNA 1R9MA 4DJAA 3FYHA 2ZIAA 2WYIA 2C9OA 1U0TA 2V96A 2WM9B 4QGSA 1ZWKA 5DHFA 4ETWA 4RZXA 1Y89A 4PQYA 1VHLA 1OQAA 1XALA 3ESZA 1NG1A 3Q9UA 4HRAA 2QX7A 1DRUA 4G1BA 4I9NA 1N7IA 1TC1A 1IBKB 3PENA 2A7QA 3M5WA 4C4OA 3EUFA 3RHSA 3H7IA 1SY7A 3AVUA 2QOEA 1I5EA 3CF2A 3DL7A 4GWLA 1J33A 2SCUA 4LK3A 5TJHA 1XNHA 2PWYA 3GT0A 3EDMA 4LDJA 3DJYA 4YECA 2R6HA 4HNHA 5BWCA 5A04A 2XZPA 2CNWA 1P17A 1OA1A 3URKA 1WG8A 4F4UA 2JHPA 5FV7A 2JEYA 2PNFA 2CC2A 2PBLA 4IF4A 2B6NA 4C7JA 4F5DA 2DLCX 4ZYUA 1FX1A 2FMFA 2BWJA 2CHQA 4YT4A 4RHXA 4LVCA 4V02A 5CLFA 3TD9A 1SBTA 1U94A 2ESRA 2VLBA 3ENVA 4NYMR 4A26A 3PGVA 4HYYA 1H85A 3A6KA 5CA0B 1J0CA 4ECEA 5DCUA 3NC1C 3LP8A 4UEQA 3IAFA 4PCVA 4BO6A 1C1DB 1NLZA 4PCUA 1GARA 3ZOZA 2Y6UA 1KJZA 2JPDA 4JJGA 4DCTA 3HVHA 2ZB2A 2GKGA 1G8YA 1CUCA 5AICA 1PYOA 4E0BA 3MNFA 4IMIB 1E1YA 4MUXA 4BJHB 2YJ5A 4CKZA 4HYQA 5DHAA 3HKBA 4PPGA 2PPVA 1TW3A 5BORA 1A95A 1Z2CA 4XTRA 2XWQA 4E5UA 4MI9A 1F2TB 1Z2EA 4RO0A 4KW7A 3ROQA 4DLSA 4NBNA 1XZDA 4TS1A 3D8UA 2I66A 4IWXA 5FTKA 1P33A 3TLXA 2G5GX 2QN9A 3HP4A 4MW7A 4Q3EA 3SIWA 2QM3A 2JGJA 4DWJA 4F9GA 1IXSB 3GA0A 1RM5A 1UZUA 2XYPA 3II6X 4OVKA 4DM7A 1I7SB 1C50A 3GLGB 1KP9A 4MULA 4FDLA 5FA5A 2I2WA 4BKOA 1OSNA 4Q0MA 3Q8LA 2QTCA 1LK5A 3FDJA 2PX0A 3VDQA 2YZNA 4KC0A 3WBKA 4P3NA 5KKAA 5FI0B 2OY0A 1ND6A 1M8FA 2XE7A 5DTJA 1EA5A 1E5XA 2C4VA 1GA6A 2MMGA 1C3JA 1ZWLA 3G2OA 4DDVA 1P5FA 1XFDA 1SU4A 2ZSAA 3JQAD 4QU0A 4UOEA 4LFAB 1P7PA 2OOSA 3FWKA 3VR1A 3W9SA 2C9DA 3SOPA 2VPXA 5JQGB 2BGTA 1JBKA 2FG6C 2MJLA 3JWIA 2P4UA 4GPBA 1FFSA 2PD3A 3K2QA 4LCJA 2X0FA 4CIAA 5JEEA 2OORA 1SKAA 3JQAA 1DXOA 2UVPB 4OK6A 1DXYA 1KJWA 4M36A 5C31A 3S0JA 4O3MA 1GDTA 1ORWA 3OZVA 1DJLA 1QP0A 2NNLD 4XKJA 3ERCA 2FW8A 2WTNA 2XVXA 3K8YA 4HH0A 3SLGA 1ODLA 1EQ2A 1A98A 2LD4A 4MQEA 2FF7A 3UK1A 4UOZA 3OEWA 5DM1A 2NZ2A 2CF5A 4RFVA 3PQDA 3GJZA 4WVFA 3UMVA 4AU1A 1VTKA 2VTBB 4IUYA 4P2GA 2VO1A 1TAUA 3CNNA 4I3FA 5B1IA 1U63A 1WZUA 3O8DA 4GMDA 4L8LA 4O63O 2YIMA 3C1AA 1Q7RA 3OP1A 3TLZA 4JI4B 2VVTA 4HLCA 4IHAA 1AY0A 4FONA 1SA0B 2O2DA 4Z4IA 3FHCB 3N59A 3B3AA 1F2TA 1WO8A 4BXOB 2HSJA 4WBXC 4AO6A 1E99A 2XAUA 5C7YA 1ZOSA 3K9CA 4EJSC 3QXXA 3F8WA 1JVNA 3OTQA 3AF2A 3TVYA 1E1RD 3IUYA 4ITRC 4K9MA 4U7DA 1NRJB 3L84A 5JYCA 2KHZA 3KJFA 1IG0A 3GAMA 3MD0A 3W0LB 2Q6LA 3PPVA 4GI5A 5EIHA 3FFXA 3IESA 3VV3A 2DE0X 3SC6A 3RUPA 2TECE 1NLYA 3RUFA 2KQUA 1U0NA 5LN1A 3ZU5A 4P32A 3GMDA 2QRVB 5EJ4A 1UANA 3C7DB 5J4KA 1RYHA 1UPFA 1G8KA 1V48A 3AR5A 3ZCUA 1F2UA 5AKEA 2ORYA 4F2DA 3PC2A 1BDBA 2P8JA 2JBAA 1KI2A 3IAM6 4K05A 1YB7A 2PH1A 3TB4A 5BMVF 1TCCA 3LHDA 1WZ2A 2AF4C 3F5QA 1TQHA 2J4DA 5F1PA 3D8TA 1G0OA 2HFKA 2OUIA 4ZVNA 1C8VB 1EXNA 3UN1A 3ZNPA 3SLRA 4ILEA 1ZS9A 3P4XA 5EMKA 2FR0A 4O4HF 1YIOA 4A91A 1P8AA 3G23A 2Q45A 4RF4A 4NJMA 5ITSA 1L5RA 1P7WA 2IX9A 2P6MA 4C1NA 4M0EA 1JDPA 2O7QA 1BMFD 2XUHA 4XFKA 3WLSA 1A5SB 1BAPA 2IQ5A 3K1JA 3M6FA 3CZCA 1ZOOA 3OF5A 4P98A 1JP7A 4AO8A 5K3FB 2RARA 2V65A 4DCJA 5CCEA 2CUNA 1QIKA 3M4YA 2PZMA 2FN9A 1FUYB 3EWIA 3GGCA 2JRLA 1TZBA 2APJA 2OCPA 4L57A 4BTVA 3U4CA 1CT9A 3LYAA 3DR5A 4OJTA 5JPCA 3L8FA 2VOEA 4DMHA 4UUBA 4F3KA 5KU1A 4ZCTA 1DEHA 4DJDC 1F2UB 1KJIA 3GLSA 4DBLE 3CWZA 2PJZA 2BH9A 1V6AA 4N18A 4RWZA 5AW4A 1T5DX 1JKJB 1RZUA 4HH3C 4A82A 3VA7A 3IQXA 1BN6A 2XYQA 2FE4A 1AH2A 1D8AA 1ZU5A 4LOHA 1XTUA 2BFOA 5ALOA 5AVKA 3U3RA 3UC9A 4HSGA 3EC1A 1EDDA 1EFVB 2E18A 4TQAA 3T9CA 3BZUA 5JDIC 4EYOA 4ZZ0A 1JHVA 1I5OA 1ILEA 3IAXA 1E2QA 2LCFA 3K6KA 4IS3A 3S81A 4GKKB 2QNRA 3E0XA 1D7OA 1Q0UA 1POXA 3A2LA 3BTVA 1KARA 3F7NA 3K0AB 3L8MA 4TMVA 1YSCA 2VYVA 1NN3A 4KAAA 1M1YA 4TMWA 5JTUA 1H4VB 4R6XA 4KPUA 4W6QA 4AQDA 1QDUA 2E6KA 2Q6VA 1ATIA 2NO9A 3EARA 4IRMA 3IR5A 4LYGA 5B3AA 3KJEA 1BOFA 4D9MA 2XKJE 1EFHA 4CM9D 3IDAA 1G98A 1I2ZA 5ITZB 3TW8A 4CEHB 5GQSA 3LT1A 1VFNA 4E5MA 1BN7A 1U3DA 3HFSA 1CWUA 2JLQA 5HIAA 1M1ZA 2NT4A 2AJLI 3K8QA 3R5KA 1XLTC 2FNAA 1DDGA 2OMKA 1ISPA 2PMCA 3LUPA 3LXMA 1DPFA 4KGZA 4KV9A 3WGGA 1CB0A 2X0NA 2ZSHA 4BCBA 4K9SA 4QTUB 4CMBA 5CITA 4JROA 1NQTA 3HYSA 4ZV4A 5IM5A 5HE8A 5EHIA 4ZKEA 5GVSA 3PQ8A 1C8LA 2A78A 2XVAA 5FUWA 3ICCA 3U0VA 3G0BA 4ADSG 2RKBA 1MG0A 4EKYA 4CF3A 2C2XA 1ZO8A 4UHBA 4MS4B 3NHFA 1Q1AA 3GH1A 1HE2A 2BEVA 3QUBA 1MAHA 4W1QA 3KKZA 2PLWA 5C7LO 1GCGA 2WMOB 2X4DA 4JAVC 4P5P