4WWHA

Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi-510967) with bound d-galactose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
329
structure length
329
Chain Sequence
AKGTVGIAMPTKSSERWVADGQNMVDQFKAFGYDTDLQYGDDVVQNQVSQIENMITKGVKLLVIAPIDGSSLTNTLQHAADLKIPVISYDRLIKGTPNVDYYATFDNTKVGVLQANYIVDTLGVADGKGPFNLELFAGSPDDNNATYFFQGAMSVLQPYIDSGKLVVKSGQTTFDQIATLRWDGGLAQSRMDNLLSQAYTSGRVDAVLSPYDGISRGVISALKSAGYGNAAKPLPIVTGQDAELASVKSIVAGEQTQTVFKDTRELAKAAVQEADAVLTGGTPQVNDTETYDNGVKVVPSYLLDPVSVDKSNYKKVLIDSGYYTETQVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
publication title CRYSTAL STRUCTURE OF AN ABC TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM MYCOBACTERIUM SMEGMATIS (MSMEG_1704, TARGET EFI-510967) WITH BOUND D-GALACTOSE
rcsb
source organism Mycobacterium smegmatis
molecule tags Transport protein
total genus 124
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 3.6.3.17: Monosaccharide-transporting ATPase.
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wwhA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wwhA02
3I42A 4IF4A 2P9HA 3CNBA 2LUOA 5D2CA 3GBVA 4RY0A 1URPA 3ILYA 1DCFA 2CHEA 4DQDA 3QEMA 1LJUA 4UHJA 1VPWA 3E61A 4LE1A 1USGA 1A0OA 2FW0A 2QXYA 2RGYA 2VUHB 3F6CA 2GX6A 1VLZA 3K4HA 4RY9A 5JNTA 1P6QA 1EWVA 3T8YA 3BBLA 1JF8A 2WJAA 4G0PA 1YTUA 2GBPA 3QLVC 3QEMB 4NCAA 1E6LA 2WMYA 3N8IA 1XWWA 4G0YA 5HSGA 1QQAA 3DZDA 3KJXA 1NTRA 3LKVA 4JP1A 3DGFC 3RVPA 1NXXA 3RVNA 5IEJA 2RJOA 2LP4Y 3KG2A 5IUKC 3HK2A 3JS5A 2B1JA 1JDPA 4G0OA 1D2AA 2L19A 5FBKA 2CHFA 2A9PA 3KSMA 4TMYA 3DLHA 1LBIA 4JASB 1OXKB 2WRZA 2FVYA 3L6UA 2FMHA 4TLMB 1W9HA 2XDYA 2PUAA 3TD9A 1D1PA 4PYRA 1W25A 4NICA 3SY8A 4XAQA 4N76A 2E4VA 1FSPA 4Q6BA 3MM4A 1ZN2A 3RVJA 1CEYA 5IBQA 3QEKA 1Z12A 3JVDA 4Z4EA 2O20A 3CG4A 4N41A 2VYCA 4W5NA 4G0QA 2MYNA 3EQ2A 3LOPA 2CWDA 4W5QA 4RK5A 4OLAA 3JY6A 4Z99A 4PZ0A 3T6KA 4LX8A 4WZZA 3DGEC 5JS1A 2QV0A 5FWYA 2L17A 2PAFA 2AYZA 4LE2A 5IX8A 3G1WA 2E4WA 4N0PA 4MR9A 3O21A 1D1QA 1ZVVA 2FQXA 2QU7A 1DG9A 2GKGA 4G0MA 4G97A 4TN5A 5DKFA 4O1HA 1USKA 4RWEA 4B09A 2PUGA 2FXIA 1U04A 3H5OA 3OLYA 3OM1A 1GLGA 3QLVA 4RXUA 1QP0A 5HM6A 4MR9B 2OQRA 2IOYA 1DRKA 1FFWA 1QKKA 2LPMA 3TO5A 1D4ZA 3H5LA 1B00A 2WWVD 1BDIA 1VKRA 1I3CA 4IRXA 1USIA 1PEYA 4MYRA 1P2FA 4UHKA 3GWGA 4Y9TA 4L4UA 2HJ9A 5DTEA 2KYRA 3GV0A 1YS7A 3OO0A 3UKJA 4CBVA 5DLEA 4MQEB 1AB6A 5T7BA 4RZSA 4NV3A 1JYEA 4MAAA 1MVOA 3HEBA 1BA2A 4NCBA 1U8TA 3VNAA 2GWRA 5EWMA 5I4CA 1JDNA 3K9CA 4N47A 3KHTA 4MRMA 2E4YA 3OMWA 1AB5A 4EYKA 1KRWA 3IPCA 3Q7TA 2MYUA 3B2NA 3N0RA 4YLEA 5IULC 4YRZA 4RDCA 4MS1A 3O2SB 5EWMB 2A9OA 1KGSA 5ABPA 3BREA 4MRMB 2JVIA 3A0RB 1E6MA 5GQSA 2A9RA 2WB4A 3LUJA 5JS2A 4WT7A 3H6GA 1NXVA 1C0EA 5JNWA 3A3KA 3GT7A 2FSPA 1DC8A 3M9WA 5PNTA 4EYQA 3EQZA 1DZ3A 1FFSA 3F7NA 5FWXA 5EWLB 4KREA 4FE7A 1RZRD 2PUDA 4QPJC 3QLUC 3OLVA 2P4UA 5BR1A 4MS4B 2CD7A 4WXEA 1U2PA 2HQOA 2VUIB 1E6KA 5BQ3A 2FQYA 3N0WA 3HDGA 4YP9A 1NATA 3M6MD 5CHYA 5FWXB 4D74A 1QO0A 1IIBA 1ZH4A 3RVSA 2E4UA 4XARA 1DBWA 4JOQA 4RK7A 4E7OA 5TPZD 3ROFA 1RNLA 2H3HA 1DBPA 4RY8A 1QPZA 2FLKA 3H6HA 2A9QA 3LKBA 1JL3A 1DBQA 2NZVG 1XHFA 3QX9A 4MPTA 3R0JA 5C5EA 2PL1A 4Z4HA 2RDMA 4TLLB 2PE5A 4OBBA 1OXBB 3SM9A 2VK2A 5BRAA 1NXWA 2PKXA 1SXIA 4G0XA 1PNRA 2JK1A 4XXHA 4YR7A 1BVHA 1E2BA 4MR7B 1ZDMA 4PE5B 5B3JC 3OQOA 2FMFA 4GNRA 4KZKA 3H5TA 2ID7A 3SG0A 3H1GA 4KK3A 4N0QA 5ED4A 3P9YA 3Q15C 3CFYA 2FEPA 1YS6A 4RK0A 3FMVA 2FN9A 1DC7A 3MYYA 4RKRA 5CNIA 4LE0A 3FDFA 2MYPA 3Q7RA 3Q9SA 3I5AA 1U2QA 2L2QA 3NHMA 4EYGA 3IP6A 3D8UA 4W5OA 3QLUA 1MB0A 4RXTA 1RXIA 4JAVC 4RS3A 1L5ZA 3HO1A 3BRQA 4ETMA 1P8AA 1YK0A 2JBAA 1ZESA 3MMNA 3GYBA 3OO1A 5CNKA 3TB6A 4RK6A 1VRVA 1Z2DA 3MQ4A 4L85A 5TQ0A 4XASA 5IC5A 1PHRA 5KC9A 4RKQA 3RVLA 5JNRA 4MQFA 5KWSA 3FGZA 2JBAB 1DCMA 3CU5A 4EGSA 4IMJB 2FKAA 5TQ0B 3F73A 3KYJB 1FFGA 1ISSA 1LBHA 1TJYA 2R25B 2X7XA 4D6YA 3LUGA 4ML3A 3HS3A 5TQ2A 2LIVA 4N03A 4MQFB 3C3MA 5EWJB 3OM0A 4KV7A 5B3JA 1M2EA 4F11A 4W5TA 2WY2D 3GRCA 4F3TA 2QR3A 3EJWA 2W42A 1KRXA 1MIHA 2FMIA 3CLKA 4RXMA 5TQ2B 2PL9A 4S04A 1CHNA 4MQEA 2AYXA 4G86A 2E4ZA 4QYWA 1TM2A 3DLBA 4F06A 2FMKA 3H1FA 2FQWA 4XFKA 5KQLA 2B4AA 3QK7A 3NNDA 4IILA 4KPYA 1Z26A 5KQPA 4IMIB 4MR8A 2QW1A 1Y1LA 2IKSA 5GOTA 1XHEA 3L49A 2L18A 1SXHA 1TVMA 2JRLA 5HQJA 4LRQA 3CS3A 4KNYA 4MGEA 2PJUA 2R48A 3RQIA 3KLNA 3CKMA 1QQBA 2PLNA 1YK1A 4MR8B 4Z4CA 1Z25A 4PEVA 1P6UA 1SXGA 5TQJA 3TX6A 7ABPA 3CTPA 3HM9A 3H75A 3RVOA 2WJWA 2OENG 1NXTA 3NNSA 2PUCA 5EWLA 4OG2A 4EVSA 1T34A 3QX8A 5KQMA 3URMA 3KYIB 4KFCA 1QMPA 4HNSA 4MS4A 4RV5A 1K66A 2QVGA 3LTEA 3O74A 3H5IA 3Q41A 1F4VA 1ZGZA 3LUDA 3HJFA 3IDOA 3RVRA 3SQNA 4O1IA 4YCSA 1F51E 3H5VA 4YO7A 1JFSA 3A10A 1MAVA 5E3JA 4WXMA 1EWTA 2JCGA 3LUAA 3I45A 4LZLA 4Q6WA 2HPHA 3C3KA 4PICA 3VNBA 4EVRA 1QP7A 4NQRA 1JLKA 3MA0A 2QVCA 4KK4A 4OTZA 5TPWA 2BGGA 2IYNA 5FBHA 4Z0NA 1APBA 2LBPA 1M5TA 1K68A 3JPYA 2HQRA 3QELB 4HNQA 3HZHA 4Z9AA 2NT4A 1LJLA 1BAPA 3RVMA 1ZGGA 1ZAYA 1M5UA 4MR7A 1GCGA 3EULA 3N53A 3CZ5A 3M9XA 4KQCA 5TPWB 4G0ZA 2F8SA 3CZCA 3QLTA 6ABPA 3KKEA 1GCAA 3D02A 4LDZA 4W5RA 2RJNA 3GL9A 3W9SA 1WETA 1KMIY 2I6FA 2JVKA 3LUHA 3ILHA 2PUBA 1ZH2A 4EY3A 3I09A 5JNVA 3Q7SA 2MSWA 1SD5A 3CRNA 1ABEA 2N9UA 2IPMA 1JFVA 1FQWA 4MLDA 1JWLA 4MLCA 1D5WA 2ID9A 3CHYA 2R47A 1YMVA 2HSGA 1GUDA 3HSYA 4GPAA 2YHAA 2JVJA 5CNMA 3LUFA 1DRJA 3EAFA 3O75A 2IDMA 3OQMA 3LUKA 1SRRA 4JA2A 6CHYA 2R4QA 1NXOA 1Z13A 2HQBA 4RSMA 4ETIA 3CG0A 4YV7A 1L5YA 1RZRA 3HVRA 1JYFA 1YMUA 1A04A 2FTKE 4DADA 3O1HB 4MS3A 5EWJA 5F64A 3GBPA 4YGXB 1JFTA 1H9CA 4EVQA 1DP4A 4KVFA 3O1IC 2M1ZA 2FEWB 2DRIA 1DJMA 5BRJA 5TPZA 2NZUG 2ZWMA 4D6XA 3ROTA 3EGCA 1Z2EA 3NBMA 4MS3B 8ABPA 5JNUA 2J48A 1ZY2A 4E7PA 3A0UA 4ZMRA 2NUBA 1Z17A 3RVQA 4QYMA 3RVKA 4Z4FA 1LK0A 1A2OA 3HXMA 1Z15A 3EDCA 3BILA 4HNRA 4S05A 3JPWA 3JVIA 3HV2A 1ZHHA 4H60A 3RH0A 1UDRA 4LDAA 4JB0A 3SAJA 5C5CA 4KRFA 1U0SY 3EODA 2YHBA 5IUNC 1NY5A 1PEAA 3JTEA 3KCNA 5KI6A 1JH9A 3LMKA 1JBEA 3IPAA 3GA5A 4RU1A 1C4WA 3NNNA 5DCLA 3HDVA 2MSLA 2IPLA 4DN6A 4KQ9A 4IGAA 4YWHA 3G85A 3C3WA 1PUXA 4P1ZA 3UUGA 4Z9BA 3O1JC 4XLTA 5FWYB 4F12A 3N75A 1J56A 1NXPA 2FLWA 4H3HB 3FFWA 1YVUA 2MYTA 1QO0D 4JB2A 5HKOA 1HEYA 4EUKA 1EHCA 3TMYA 4FE4A 5JNSA 2IPNA 2PUEA 3SNKA 1Z18A 3OLWA 3BRSA 1PNTA 2NT3A 5IEBA 1ZITA 4ZYLA 3LUCA 4O5AA 1RPJA 3MF4A 3HUTA 1ISRA 1ABFA 2QZJA 5DGCA 4Q7EA 2M98A 3NHZA 3HUUA 5T3YA 3UK0A 3T95A 4ZJPA 3OQNA 4HYEA 4ETNA 3T38A 1DCKA 4Z4GA 3F6PA 5TE9A 4OATA 3FFTA 3E3MA 4YS6A 3OLXA 2F8TA 4OLBA 4RK4A 1TMYA 1QNLA 2TMYA 4P98A 3MIZA 9ABPA 1M2FA 1EWKA 2FN8A 4ZMSA 4WWHA 5KQGA 3QELA 1YIOA 3O2QB 3C97A 4QICA 2E4XA 3KS9A 1BDJA 3N6VA 3OMXA 3IP5A 3OLZA 1QP4A 2PUFA 3O2JA 2QSJA 1TLFA 4F8JA 1GUBA 2FEKA 2H0AA 4WUTA 4MS1B 2PMCA 4FB4A 3HCWA 3IP7A 2JB9A 2MSKA 3N0XA 4KMRA 5IUJC 3IP9A 4EYOA 1MB3A 1S8NA 3S99A 1JHZA 1R8JA 3LFTA 2IPAB 5KC8A 3H5WA 2Q5CA 1RXEA 1Z16A 1NXSA 2V0NA 3KLOA 5CNJA 1EAYA 4RK1A 1BDHA 1JX6A 1EFAA 3H1EA 4M88A 4Z4IA 3DBIA 2GI4A 3KTOA 3C6QA 2ZAYA 1CYEA 4H3KB 4ZPJA 3FFXA
chains in the Genus database with same CATH superfamily
1UQTA 5K0FA 2GQ0A 3KR2A 4I46A 2FP4A 1C4OA 4PV7A 3C5VA 3IIKA 1FU7A 1IQRA 5C7IO 3ZU6A 2VTBB 5BWOA 3NTRA 3WXBA 2XITA 4RYDA 1ZRSA 1IRIA 1X3SA 1VFPA 3FPCA 4UW9A 3OT4A 1QAMA 1YR7A 2CLDX 3WISA 4DSNA 5BV7A 3O3CA 1HF3A 1OBFO 4YJHB 2XUJA 4F3RA 3Q88A 4V1CA 1N34B 2X19A 8LDHA 2UVDA 3BORA 2F9FA 3ESRA 4MRAA 2WM9B 3UMRA 5I45A 4K9MA 1JIJA 1EYZA 1R1DA 3I6ZA 1E6LA 5AUOB 1SXJA 1EXDA 4MVJM 3IUPA 3IERA 3DFIA 4HN9A 2LP4Y 2P6MA 1EFHA 2CE2X 1NI4A 2B1JA 1SCBA 5JTTA 1X7GA 4JELA 1L1QA 2ZUCA 4N6OA 3LECA 1UDXA 3DBHA 2XXBA 1GKUB 3F8SA 2WG2A 2NO4A 4Q3KA 4ZOLA 4L4ZA 1SUSA 4HADA 4AMBA 1BE8A 4PLGA 4TYWA 3GZ4A 4NICA 3RS0A 1AMUA 1VCMA 1IFXA 2AS0A 3MM4A 3V97A 1G20B 1GUZA 5IBQA 5ARBA 3FTPA 3E84A 1NQWA 4D4GA 2NSDA 6GPBA 3K0KA 4G84A 4EPTA 3MS4A 1MENA 3JY6A 5K8VA 4LX8A 1VB5A 4YY3B 3GJXC 3DLTA 4X60A 3V1NA 3RAFC 2QPAA 2RAUA 2Y4NA 4LE2A 4LRSB 1N3LA 2E4WA 3KQQA 3FWHA 1LPOA 4AO8A 3NO4A 5IM4F 3AILA 1FMLA 3JZAA 3SSNA 3WNCA 3R4VA 4TN5A 4DJAA 1YZLA 3A9SA 3DOOA 4P7KA 5IZCC 4GO1A 4TM7A 3L9XA 5CMLA 4K6OA 3PEFA 1QV9A 1NN0A 1TPYA 1MW9X 2WIDA 1U04A 3SJAA 4ZGBA 2IIPA 4RJJA 2FZWA 2OCXA 4P34A 3JQ9C 3TW0A 1DELA 3KJFA 2O3SA 1QXSA 5GOZA 4AY4A 3ZGVA 1AQ6A 1WXFA 3FWKA 1YACA 4Y2XA 3LC1O 3E15A 3GRUA 1GAWA 1LSSA 3PGVA 1Y81A 1E2KA 4PSKA 3A6PC 1ODKA 1NR5A 2QTMA 2ZS9A 4FCCA 2Q2VA 4XD7A 2AN3A 2VJQA 3R9XA 4HZGA 1YGYA 3G2NA 4KO2S 4RFSB 4PINA 5K09A 2R8OA 2ZYWX 1F0PA 5JAOA 5KHOC 2HJ9A 1A4XA 4P38A 3H3XA 2XIJA 3UKJA 5IBCA 3LTNC 2NWQA 4TKUA 4OQZA 1SG9A 3V8MA 3RAGA 3REQA 2I3AA 4QXMA 2RAPA 2WFLB 4P58A 1E20A 4A0HA 1E3EA 4NFHA 1P44A 2ZFUA 2NTEA 2J9FB 3EDQA 3DXYA 3OMWA 2I4IA 3IJEB 3ZZTA 1JG3A 4ZIRB 3H84A 2OKCA 3WRVA 3ZHSA 4F1KA 2IVFA 4IZIA 1XVAA 1I1NA 2VXCA 3L46A 1QFYA 1NT4A 1FMJA 3A6EA 3MD9A 1H05A 4AJHA 1G5TA 2BGKA 1PD1A 1Y37A 4MI9A 2ONJA 1D5CA 1EFLA 1A7KA 5JSYA 3W1VA 4YRBA 4F2GA 1WL8A 5H1YA 3R6GA 1JLSA 1RQLA 2YJZA 2I2DA 3E5MA 2VH1A 3IAM1 3LT0A 4GMFA 4TMZA 3TUIC 3K9HA 4NEQA 3H6GA 4DDTA 5A5EA 1C0EA 1E64A 1TF7A 1Z0ZA 1DC8A 1TM7E 2GZHA 3V00A 3WGYA 3DFFA 4IINA 4Z6KA 1YS1X 1WB9A 2YHIB 1UAAA 5EWLB 1UKEA 5JWOA 1W1IA 2AOVA 3QG5A 5MDHA 5KKCA 2ZJ3A 4HLUC 4OJYA 2P6OA 1KL7A 3N74A 3UK1A 1NW9B 4WZ6A 4YUAA 2FQYA 5CB4A 1VCHA 2XUDA 2IYAA 4F56A 2J0QA 2ATIA 3FZQA 3H4TA 2FRDC 1FRNA 4EF6A 5IK2D 3FROA 4GP6A 4WDRA 3ZW8A 2ADOA 1O1YA 4O1MA 1Q84A 2CLHB 5GTDA 5IU6A 4E7OA 4I4LA 1PZGA 3GQBB 4MV6A 1QPZA 2FLKA 3KLPX 3FIUA 3WGTA 2XYHA 4A0RA 2LNDA 3ICPA 3NGLA 1XO1A 1JJ7A 3F6BX 2IOQA 3QWFA 4ZXFA 5D1NA 5B58T 3RC7A 1AK1A 1L5HB 4PU0A 3IO5A 3U26A 4FGSA 4JYMA 4JLSA 4JI1B 3W7BA 4JL5A 2R1TB 5K1ZA 3ZGYA 5LDDC 3PK0A 4TLEA 1EJ0A 4K1XA 1V3QE 1P4GA 1PNRA 4BLSA 3ESAA 3GLIA 3OEHD 4X95A 4MWZA 3WLQA 2ZJ2A 1LS1A 3Q4GA 4GBJA 1P9RA 4DCTA 1GYPA 1YQDA 3FWNA 3PCTA 4DT1A 5E9WA 2PD4A 2YN2A 3HCEA 3P9YA 1T13A 2DAPA 3VAAA 1KEZA 2IYUA 4A8JB 1G4AE 4PCLA 2H52A 4PZPA 2QD3A 3AY3A 4HGPA 1U2QA 2XYVA 3PDIA 3AUTA 4HRVA 5FOVA 2FFHA 2OZPA 4A0GA 1YUMA 1BRTA 1GD1O 2JEZA 1M34A 2E4AA 2OV4A 3KJGA 2XF2A 3LL7A 4KGXA 4HNUA 3W90A 4PPQA 2IYLD 4DR6B 4TSFD 1GU0A 1C3XA 3OOSA 3SMVA 3UWOA 1HYGA 5B2FA 1YBHA 2ZBUA 3B1YA 3EQ7A 1W0KA 4NOLA 3TQFA 5JXJA 2YKGA 2WJVA 3CO5A 4NENA 1N5JA 3BIJA 3C8DA 1SZJG 3OPMA 2ZREA 1K4MA 2YOHA 2WWIA 5A0TA 5DRTA 2I2FA 3QVMA 2DHDA 2WAXA 4IR7A 4HGZA 5HDBB 1ZJ6A 2Z30A 4YO8A 3BEDA 1ISSA 1LBHA 2HFKA 4ALMA 1B3RA 5MFPA 3L7IA 1KAOA 3NOOA 5FI1B 2CY0A 4HUQB 3IAFA 1PQWA 1T9AA 4GBMA 5FD8A 5C4GB 1ML3A 2OAP1 5FBRB 5TQ2A 3UKOA 5LN1A 5EWJB 4HF7A 4KV7A 4EG3A 1PWZA 3ESZA 3WL4A 3AESA 4BNXA 5GY7A 3TUJC 3DHNA 2YVQA 2HXGA 3E70C 3OKPA 4HDSA 1KJIA 4HPWA 5F3WB 3RFVA 4DMHA 3D6VA 1X9GA 3VNSA 4ZXPA 1NQUA 4PTYA 3TSWA 2Q3MA 2P9ZA 3DTVB 4MUNA 5KNBA 1LNSA 1S0UA 4D4JA 3KQYA 3ANYB 4UXHA 5JSZA 3NVMB 5IJZA 4GWLA 3EGDB 1NJ5A 4JU9A 1V8DA 3JQGA 3HB9A 1S2LA 2CUTA 4L4RA 5J5AA 1ANKA 2PR2A 1H65A 1W5EA 3H9JA 4FZRA 4RX1A 2XE6A 2G36A 4DR1B 5EQTA 5LXTB 3NHPA 4HJRA 3DCNA 1BNCA 4CU2A 1M5RA 2C4VA 4MJLA 3RG2A 2EZUA 2AN9A 3MWYW 5JZSA 2X42A 4Q3NA 4F1WA 1GNTA 4KWCA 1S3GA 2EW8A 1SUDA 2R48A 3P2YA 2IHUA 1AXEA 1TA0A 3I6IA 2WZQA 4MCJA 4R05A 2KX7A 5L4NA 3ZNOA 1LBSA 1N92A 1R74A 3G0IA 4G1EB 4TMWA 4FFMA 1I6KA 1KZ9A 1PVVA 4KWEA 2O8FB 3IT3A 3NUZA 4WRRA 3IQIX 1RM5A 4MQMA 4HTAA 4A8JC 5DGHA 1N2HA 1SCJA 4I6GA 1RHRA 5SZHB 2C88A 1G6KA 3PFWO 4ZYUA 4C2TA 4L51A 1W73A 1AVTA 2B4TO 3I4CA 5FTJA 3OOEA 4YXWA 4A91A 4DMLA 1AZWA 1CIJA 1K66A 1NBME 3INGA 1DIGA 2Z1NA 2ZR9A 1DNPA 2XSZD 1H1TA 3DG9A 5DULA 3RUEA 2AE1A 3ICEA 4G5QA 1JQEA 2C5SA 3GAMA 3KU1A 4YCSA 1RE0A 5T4EA 3QKIA 3BWYA 3C87A 3NCTA 4YO7A 4DPMA 2P3SA 3AR5A 3D0OA 4K26A 1WULS 2O3TA 2QUKA 3VYVA 3TBFA 1LPSA 3DW3X 4GE3A 4V0RA 4X71A 5CJ2A 1E3JA 5T64A 4EVRA 2GFHA 4HO1X 3V7UA 5KOHA 4RVGA 3DV0B 4HC4A 4KGZA 1NFQA 5DE3A 5FPTA 1GRCA 1OWLA 1XB2A 2O4UX 2ZRFA 3SQMA 4G2NA 1DC4A 1TA9A 2JCBA 3NAQA 3VHXA 4BY9E 2EF1A 4FC7A 2QYOA 3OURA 1M66A 3IAS1 3OJWA 4Z9AA 4ERNA 1G6OA 1LJLA 1X15A 2DHCA 4KQKA 2W83A 4PAGA 5EIWA 4FB5A 3A1FA 2Q6VA 3CZ5A 4C0AC 1FL9A 3FNQA 1U0NA 2GNPA 1QH0A 2PQMA 4C76A 3VBEA 2O54A 2FR8C 1V8FA 1D2HA 4P35A 1WUTA 4PO1A 4P4SA 1ENYA 1NOJA 4COOA 5HOQA 1E5LA 2Q4TA 3HJRA 5CYGA 1VLVA 3H65A 2QTAA 1RJ9A 2WABA 3L0IB 1XIVA 4ZC1A 1I3MA 1KHTA 4NU6A 4AYWA 5CCXA 2C84A 2WNHA 1LEHA 3G6WA 4ECEA 1QHNA 3I09A 4PC3A 4KLZA 1WHTB 3TUZC 4H31A 1GSHA 1RCTE 2B5WA 1TYAE 3N7AA 5FBWB 4HQRA 1UMBB 2W6MA 2P67A 4KV9A 4MLDA 3T0GA 4HT3B 2NN3C 4RZIA 2PXAA 4AM8A 5LP6F 1DFGA 1E7WA 1F2UB 3CXRA 2H07A 4PSUA 4ZO4A 3K0BA 4K81B 3D3WA 3C3YA 5JWHA 3CF2A 4R1OA 3NM5A 3QRWA 4UBKA 2O2JA 1I7QB 3AB3A 1TM4E 2YZGA 2F8MA 2UYHA 1G4UR 1VSVA 2EVWX 1ZM2A 1D0SA 3Q3VA 4LZAA 1CWUA 2RHGB 1LC3A 2R4TA 4RSMA 1L7AA 2P77A 1M0EA 3BJZA 4KFSA 2R6CA 5HCUA 2OV2A 2B4QA 1CUDA 3V4LA 5KX5A 5GINE 2J9RA 2C00A 3SF8B 3WC4A 3NVKI 3JAWB 4V1CB 4Q4DA 1WPXA 1B6SA 3F3MA 4QT0A 5JEDA 5BSRA 1KBOA 2O1XA 4NHOA 2WKWA 2KSQA 1BD4A 4Q47A 1M9NA 1SXJB 1JR3A 2P2SA 2C61A 5K3SA 2YFKA 4JVSB 1C7RA 4EELA 5FX2A 1ZXXA 2YV5A 1Z39A 4KDCA 1N7JA 1EUCA 3DT6A 1ES9A 4QARA 1G1MA 1FY2A 1NI4B 3UGKA 2YZKA 5LIRA 1K8RA 3VVBA 4I9UA 1ULZA 5LSAA 3RI3A 2JI9A 1Y3BE 2R1ZA 4MLPA 4WLNA 1V9CA 1MW8X 3KQNA 3IHTA 3PNQA 4EI9A 4PAMA 3JPWA 3DBHB 3ZGZA 1P45A 3KFLA 4GZ3A 1I5RA 2HMUA 1TLTA 1LDBA 4I5EA 4L4XA 2O3UA 1AQJA 1LNZA 3U7FB 1DIRA 1ODCA 1WS6A 4EY5A 4N7BA 4OFBA 4QG3A 2XUKA 5CFZA 1GTL1 3Q10A 1Z0UA 1YI1A 4E12A 1PJRA 4MQBA 2PANA 3OA0A 3W3AD 4F6RB 1U3UA 4WTOA 3LLCA 4CKCB 2CJXA 4NWIA 3RVBA 2D1SA 3NNNA 4LSWA 4GKJB 3RS5A 3JW8A 4DN6A 1F9EA 4KYUA 4NYMR 5GZ6A 5LC1A 1JKMA 2ZT7A 4QWMA 4PG6A 2WWHA 3EISA 1B8PA 2ZUWA 3LM8A 1C9NA 1M76A 1PUXA 2AFVA 2O3JA 4P1ZA 3D7RA 1VLHA 2BFEA 4I9GA 4MRSA 2WYHA 3G9TA 1NXPA 2JLRA 3NAGA 4DLUA 3U56A 1LQ2A 1YF3A 5F1YA 4JB2A 3PUVA 1XCOA 4M7PA 4F04A 3PHCA 2JI4A 2KBFA 2FW6A 5LYYA 1LV8A 3U62A 3GW8A 3ABOB 4MVJI 3QV2A 5FUQA 2ZYDA 1QV7A 1Z18A 5ENDA 3FVWA 3TNFA 3V4RA 1IAVA 2AI3A 1DDOA 2EKZA 3GFQA 1Q20A 4QUGA 2OZVA 3FIJA 4PIVA 3UTDA 5T3YA 4EBBA 3S2FA 3G2OA 1WCIB 5SZJA 4DDKA 4DLYA 4NYJQ 2GOYA 1CJMA 1WOYA 3I83A 4YRRA 4BMYA 4G0UA 5AD1A 2SBTA 5AH0A 1YR9A 2DVMA 4A2PA 3H8WA 2NP7A 4TKUB 1CUVA 3L01A 3U3RA 4C20A 3LDUA 1EWKA 2AUMA 2BUBA 1NKTA 4GKBA 3AIKA 2YS7A 3Q11A 1E32A 2QQ0A 4R9VA 3UCEA 3WJ2A 4B6GA 3PRKE 2HMVA 2VDNB 3E8SA 1U7HA 4B84A 4PZEA 2HLDD 3MILA 1KQOA 1UPAA 4IP0A 1F6BA 3EWNA 5LB2A 4O2AF 1MC5A 5AM2A 1II9A 3NALA 4G1MB 4QDUA 4F8JA 1SXJC 1PG5A 3BXPA 3C3EA 4N5NA 1EUDA 1ZMOA 2A35A 4X8HA 5AUPB 2PMCA 2CT8A 2QQ5A 4HQ0A 3FNFA 2Y77A 4KHZA 3UHJA 3HB5X 3T54A 1EHIA 2WF7A 3LL4A 5LMZA 1AS0A 2HBQA 4KMRA 4IS2A 1G9SA 1YVRA 3IKJA 4KQJA 4ZRMA 4CF7A 3TLBA 4LOJA 3P9QA 2OZKA 5FDFA 4TVSA 4WXYB 2DLCX 2A1TS 3KT8A 5SYNA 4DY4A 1QHEA 2Z4RA 4GVXA 4MB2A 4RC9A 2BR5A 3G59A 4FOOA 4V0LA 4WMLA 5K5EA 5KC8A 3RKSA 2ZIFA 2C0QA 3SP1A 2A30A 5IBRA 4BIIA 4P54A 4R9RA 1N78A 2OM6A 4CV1A 4RZHA 4E70A 3ITEA 1PZMA 4K8OA 4KAJA 5E4FA 2A0UA 1JDTA 4XB6B 3JYQA 3VR5D 1E7SA 3K1AB 1XJWA 2EHJA 1N6LA 2VDPB 3LZDA 1EDDA 1GAJA 5CT4A 3DA8A 3WWZA 2D7CA 5B4VA 2FPPA 1CQJA 2F4NA 2QXYA 2EZTA 2G63A 2PWAA 4IZOA 4QPNA 6PFKA 3K4HA 5EFZA 2E2WA 1N6OA 3RTDA 3WYBA 5HZHA 3VPSA 1TGVA 2BMVA 2XUZA 4LHSA 2X6RA 3ED5A 1QORA 5DCYA 4HNTA 3ZOZA 1AE1A 4M7OA 1TF2A 2HU2A 2XNCA 4HDQB 4WOJA 3N8IA 5B3KA 3VOBA 1UPUA 4TLDA 5LBTA 4BZZA 1TJPB 3MOIA 3UMCA 1UINA 3DKIA 1H2BA 3KG2A 4OQFA 1DTEA 4A73A 4F7DA 4F8EA 4BS9A 4RJTA 4ZKDA 5GADl 1D2AA 3DFMA 1M8PA 1HYBA 2ANCA 4H17A 1AKVA 5BQOA 3AW8A 1B3BA 1P33A 2HRRA 3LW7A 3WNBA 2FEOA 3AVWA 3H2BA 4JASB 2Q0QA 1AQLA 5HUQA 4UDOA 1VPLA 2D5CA 4LXTA 5AJTA 2VDKB 2FMHA 4QE3A 1ZOIA 2GGSA 4JLAA 4LDJA 1MD9A 1RMYA 2VHTA 4LOAA 5BNZA 2XTAA 1GDHA 3C14C 3HUEA 4Q6BA 4LFAB 3UC5A 3MVEA 1F60A 2WAAA 4LVUA 3P45A 4MTCA 4HDKA 3UOAB 4W1PA 3OJEA 1CUJA 4CM5A 2C4NA 1FNDA 2MYNA 3T1VA 4CEHB 2PSHA 1N2OA 1ORDA 1YKGA 2H1CA 1YE8A 3PGXA 4YRDA 3ROQA 1OXMA 3IVGA 1WQ1R 4J8PA 1ZMRA 2CZQA 5JS1A 1Z28A 2J5KA 4NENB 5KOHB 2AG0A 4LCJA 5E4YA 1EZZA 3UCXA 3ZWXA 1RAEA 1LTHR 2V0GA 3Q3IA 4L0CA 2GUWA 2OK8A 3FYUA 4EG6A 1GNSA 1U2GA 2K2WA 2Y9PB 4X8LA 4C04A 1DEKA 3SQXA 1II0A 1E0AA 4KMSA 4X41A 1YAJA 2CLIB 2HWYA 4Q1BA 5K2OA 5C34B 2AWOA 1WHSA 4EG8A 1GLGA 2GTIA 3QUAA 5IN5A 2NAPA 4MR9B 2IOYA 2LCFA 5FPQA 4M7WA 1B23P 3AV3A 2Y0BA 3LY7A 1QVZA 1XCPA 1RZUA 3TO5A 4AYXA 4TSKA 1EFAA 4ZJUA 3MEQA 3V1UA 3KLMX 4I55F 3SICE 1KH1A 4OBXA 4B4VA 1GSOA 2AQIA 2QRGA 3IQEA 5E0KB 5K45A 2X2EA 1SUCA 3I9OA 2F59A 5H3LA 1YS7A 5J23A 5JWRA 3ZD7A 1GM5A 9LDBA 5JSZB 1PGPA 5TC4A 1X7XA 4EABA 5I4KA 1BA2A 3JQGB 3QLJA 1OR8A 3BWCA 3CGGA 5DGXA 2WPDA 1PGOA 2AJBA 2Y0EA 3AKEA 2BFDA 4O4HF 3TWOA 2BGLA 2W11A 5BN4A 3QF4B 1NQOA 2Y2UA 3FZYA 4DLXA 3C3PA 2EQ5A 3TH5A 3CZPA 2MINB 4KAFA 3UH0A 3BCHA 4TS3A 2XCLA 1U3VA 3B1XA 1A9RA 3COZA 3VQTA 1G8AA 1JWAB 2HPZA 2XKJE 3ZU4A 2GCEA 4K86A 5DCWA 5AW0A 2R62A 4EG4A 1KOGA 1Z6TA 1SUPA 5EHGA 5BPFA 4ZVMA 3PYMA 4HSGA 4KR6A 1GT91 2VWQA 1GGNA 1E6MA 4MQUA 3ZBTA 4FSHA 4EB6A 4FHCA 3BC1A 1WZ2A 1OX4A 1NR7A 4UPDA 4XQCA 3MB5A 1XDWA 2IV7A 1N2BA 3IVCA 1GPAA 4WCFB 2YWXA 3GLIE 1EE2A 1GPNA 1I2MA 2IF0A 3GT7A 2O48X 4Y6QA 1O5IA 3RE1A 2PGIA 3ETCA 1VCIA 3JYNA 2G88A 4I8XA 2P4UA 3K5HA 3GVPA 3KJIA 1QKIA 2DWPA 2VUIB 2D1RA 5DXJA 3TCNA 3L0PA 3T3HA 3VM6A 3ZHVA 5BQ3A 1KIMA 5FQOA 3WLAA 1QIMA 2HNKA 5CHYA 5GONF 4D74A 4JI2B 2P69A 2PD3A 3B8HA 4C4RA 1GTG1 2FU5C 3Q85A 3FUVA 4EDHA 1I0LA 1QM5A 1VYUA 1M34E 3LYAA 3NWJA 2D54A 3BULA 1IBSA 3OJLA 3O8OA 4FW9A 4IQ0A 4OYLA 5TPZD 2ST1A 4B43A 1SKBA 1Y7PA 2A9QA 2XRFA 3CR3C 3JAKB 3LQ2A 4QVGA 4YCDA 4BNGA 1V96A 1ZC4A 2P4SA 2Q3BA 3QX9A 1QC5A 2BHTA 4QREA 4EGFA 3PX3A 5JATA 3JASA 3WGNA 1L5VA 3PP8A 4AT1A 1T26A 2ET6A 4OK6A 4EJ2A 2QPLA 4IXTA 2QAGA 2FMTA 5JC8A 3TGPA 5EEHA 3ZS9A 4ZFNA 4ZHSA 1VSTA 4PE5B 2FMFA 1EFRA 2I0FA 1J6UA 5C52B 3ZV3A 1KO7A 1EBFA 2H4WA 4ILEA 4EUSA 3NHUA 2GSWA 5EYPB 1KI8A 5ED4A 2P1DA 2R6R1 2ZQ5A 3LX8A 3OCZA 3ADBA 5LQKA 4NEHB 1RW4A 4P4SB 1M54A 5DN9A 4BFUA 4HY3A 3ZW9A 4ARZA 4I8DA 3WWYA 5EI5A 5HOEA 2E1PA 4FDAA 5C8ZA 2WJJA 1RJ9B 1TIBA 3ASVA 6AT1A 1A5BB 3MBKA 1CS4C 4R1TA 4JJIA 5EIFA 3ZCTA 4KO1S 4DUPA 3LBYA 4WIAA 4MKIA 4US2R 4XB2A 3Q6IA 4IIEA 3HO1A 1R6DA 2PFSA 4N3CA 1ZESA 5IN4A 4BB9A 4A5OA 3ZVLA 1FJXA 5BSVA 3CW9A 1DT5A 2Q6OA 2PIAA 3GOQA 2CDAA 3MT0A 4LBYA 4B3CA 4C05A 7REQB 4XM1A 1EG2A 1P2BA 1DS6A 4AQYB 4WDQA 3IEKA 4YT8A 1ZD5A 4IICA 2JI8A 1GPYA 5IYZB 1A71A 2R60A 5C51B 4IOKA 3ZY5A 1BA3A 3A1TA 4ZDWA 3MT7A 1BXGA 1GTSA 2DKNA 3U9TA 4BP8A 5JXIA 1Y5NA 4KBFA 2OXRA 1QYIA 2UUBB 1RHMA 3EPHA 1BO6A 4OQMA 4RUKA 5KNDH 3L8DA 4JEHA 2WY2D 1K0UA 2ZJZA 2XE7A 5KYUB 4K8RB 2VRBA 3EJWA 3THXB 3AR4A 4I6EA 3UY4A 3SSMA 5K6AA 4XIFA 4B45A 1JEYB 3JATB 1EUCB 4CM8A 2XEDA 2O0LA 2RG1A 3ZXXA 4MQEA 1NNSA 4CQMA 1K97A 1RYZA 1U4OA 2VHZA 1PR3A 4J91A 1TEZA 3TZHA 1V5FA 4NG4A 4WK4B 3GMTA 4GHWA 4IV5A 5IW8A 3GH3A 3ZWBA 4B6OA 5JBNA 1WDMA 2IIBA 2JIBA 3MD0A 2A1TR 1GU7A 1GPWB 3HLKA 3JQBA 4LC1A 4QJBA 2ISSD 4LF4B 5ILOA 1YR8A 2VPIA 1T29A 2BEKA 4E31A 4X94A 4OBWA 1R0LA 2ZRAA 4UHEA 1NBMD 3ZGNA 5A2QA 5LD2B 1SXHA 2P0AA 3GJRA 3K0AB 1VSUA 4PZAA 1WSWA 1VYTA 3QIVA 4FK8A 1AF4A 3QLEA 3LPNA 3L4EA 5GZ3A 2QTBA 3CE9A 4MR8B 4REOA 3VNRA 1TK2A 5DLDA 3RKUA 1EUQA 4WINA 2BFEB 7ABPA 2WIKA 4OOEA 3ZS8A 1CC1S 4S0XA 4TV9B 2FFJA 5BYKA 5H9WA 3TZ6A 2QBYA 1RDFA 2HM7A 4M1YA 2W00A 2VQEB 3GFTA 4RM3A 3DQQA 2I3BA 5CVDA 4K2AA 3KX2A 4LTNA 5IARA 3ZJYA 1E2IA 1EGQA 2H2HA 1X1RA 2OCPA 2NTJA 2FZCA 2ZRIA 5CP8A 4RV5A 3HCAA 1Q74A 1VPTA 3QU5A 3L6OO 4FOTA 2REXB 1L4YA 1OI2A 4HYYA 2OFWA 4QBGB 3UJ7A 3UFBA 4ESHA 3UMSA 1BJRE 3O4HA 4OFXA 1QTIA 1M1UA 3WL8A 4N9QA 4XTRA 2V9CA 1QVRA 5BW5A 1SURA 1O2DA 3PEEA 4AF7A 5DGDA 2J67A 3JWJA 4J90A 5LMUB 1WJGA 3S6JA 4JKIA 2D8MA 1G63A 5TMEA 1HI9A 1UM9A 4BB0A 1DQZA 4JUFA 4PY2A 4U00A 1Y6RA 4LI3X 1I6WA 5EJ8A 3FBWA 4FGUA 2VNHA 1L7XA 10MHA 3F4BA 3OBBA 2NT4A 2C3UA 1F06A 3ZEAA 3AVUA 2REBA 1NU8A 4I3FA 1U9CA 3KTDA 4YAWA 3W3ZB 1QYXA 3AP1A 5M3BA 3WFIA 4EJ6A 4WERA 3I2YX 4TKLA 3R6TA 1GKIA 4X3CA 3PNBA 5AVZA 1GHTA 1GCAA 4YPOA 2GYUA 1CEEA 1ZOPA 4BNTA 1EUDB 3KOWA 4AJ9A 4GXQA 1XZLA 4CETA 5E3HA 1Q17A 3CWCA 3CUYA 1USUA 5DHTA 1IPFA 4EHDA 4Z7JA 1J2EA 2GTPA 2NPIA 2X5JO 4D4LA 1BGWA 3H1TA 3IBCA 4L4YA 5TB5A 4DBZA 3ILHA 2J1LA 1F2DA 1UXGA 5G0SA 1PZHA 2C82A 2PT5A 1KDYA 1JR3E 1R8QA 2PX8A 3O1LA 5LMCA 1A98A 1KAMA 2CNNA 3S2UA 5AK0A 1TTQB 4GG1A 1E2UA 5KNCD 4UZSA 1S8OA 1RKUA 2R68A 3L2OB 3L9WA 3UFXA 1UKZA 1LPPA 2W6CX 2ZT5A 3A3OA 4M83A 1VJ1A 2F1HA 4NBKA 2PYDA 3UK6A 1NU6A 5LD2C 1PK9A 3C45A 4EB0A 2PS0A 4EY6A 3WI7A 1DQNA 1KERA 3OECA 3DAFA 4AICA 4XW2A 4AK9A 4BB6A 1TD1A 2WF6A 3AV0B 3WP1B 4BZPA 1L5WA 2A0WA 1TEXA 4JQSA 1NIPA 3TQQA 2B7BA 1ZVQA 1OX5A 2XWPA 5FOWA 1HGXA 4F4CA 3ZU3A 5B3AA 1SG0A 1G8FA 2IYFA 5TF0A 2FPPB 2JANA 3LD9A 1XCBA 4DLZA 1CQJB 3OE7D 1A04A 2PXHA 3ZIAD 2FTKE 1E0KA 3M4NA 4LDNA 2P90A 4IZ6A 1KSJA 3B1WA 1T8YA 4XSVA 4OV6B 4YCBA 4LJSA 2RH4A 1ZUHA 3MLEA 4Q1AA 1P4AA 3W5IA 5FH9A 1RWPA 2FMXA 3RS4A 2XGSA 1QNFA 2A0XA 1T15A 4LI0A 4ZK6A 4IIJF 1OLXA 3PPWA 5HFJA 3ZE6A 5C2JB 5CW2A 5JASA 3OTOB 5ALDA 2DBRA 3ZQUA 2ZVDA 1BGXT 2C7BA 2HK7A 3IC5A 2IW1A 3C85A 3GMSA 3K6JA 4PZ9A 3OEEA 2ADMA 3UBTA 1JSXA 1R0WA 5IG2A 3SQOA 4I55A 1AGXA 3GBSA 3K0FA 5J2TF 4Q9LA 3JQCA 4OF4A 2NV6A 2AJTA 4G85A 3IAEA 4KR7A 2V8BA 4NYJR 1Z5PA 2R2AA 5EE0A 3U1TA 1JQAA 2RHBA 1Y8QB 2VXOA 2RK3A 3E8XA 4XIJA 3ZZUA 1EM8B 1TO1E 4ABYA 1BQEA 2HUPA 2AUNA 1IN6A 3CZ9A 2QKYA 1E9BA 3T5DA 3ZJUA 1OPRA 2W9XA 4O4HA 4RIEA 3D31A 3NHLA 3PQ3A 4GWKA 4HDKB 1EA5A 4FSDA 4UAVA 4I1YA 4M0PA 1JTEA 5AXAA 4BFYA 1NBWB 5DT2A 4OXIA 4RCVA 1D04A 1JRLA 1LDMA 3MYRA 1XYYA 4FR0A 3WB9A 2QENA 3L6DA 3BXEA 4B7ZA 5L7WA 1X8XA 4B4OA 3R24A 3OZTA 5KUTA 5TARA 1R3DA 4BMOB 3C3CA 1UC5B 2AN5A 4U9UA 3OD1A 1H9AA 2X2FA 3BSFA 4UJ5A 1QCDA 2IUFA 2JFWA 1T6BY 2YQ5A 3AR6A 4S0ZA 5ALMA 1W1WA 3CISA 3PD0A 4BJ3A 5B36A 4PSDA 2HHJA 3GJTA 1S89A 2YZNA 4GIBA 4OVKA 1RI5A 3Q5GA 5C4MA 2AJLI 5SY4A 2H51A 1ZITA 3CN7A 1M75A 1AKRA 3DDSA 2XGJA 3GRZA 4B7UA 3JZIA 4AQ7A 5K3FA 3HKBB 2XMZA 3V32A 4ZJPA 4E11A 5HIMA 1UK8A 3JVUA 4NY1A 1ZEMA 2SKDA 2EFYA 3HB7A 3IBGA 3JU3A 4US0R 1PSWA 1WZUA 3RSSA 5ADWA 2AYYA 1EEXB 3SQLA 1E8NA 4MA4A 2VL7A 3SLRA 3NZEA 5IAAA 4IO1A 4RBNA 1RRFA 1QO7A 3EFOA 4PQYA 3KB1A 2A5JA 2OR3A 3CNHA 1NFFA 1X7XB 1FNNA 2A0KA 2RONA 1EDZA 2VYFA 4DQXA 4LXQA 4OQXA 5BR8B 1DC6A 1OX6A 1XL1A 2BAGA 3C97A 4OKIA 5BN4B 5KKAA 4B4WA 1ZIOA 1TEVA 2JH9A 4RHEA 4G1FA 4D9IA 1JU9A 1M0WA 3H86A 4XDGA 4BKUA 3N70A 4QRDA 2UDPA 1RPTA 3C8UA 1DUVG 2H1HA 5A9TA 4DSZA 3GGOA 3MC1A 4LYFA 5AKJA 2CSXA 3RJTA 3GIDA 3O4JA 1TM5E 2FG7C 1NW5A 1U81A 2E49A 3KUUA 1GKKA 3M3HA 3PA6A 4N5LA 1WNFA 2ORIA 2Q0SA 1GGVA 3IB3A 1XDUA 4G4JA 2C2BA 3LK7A 4CLOA 5A6SB 3SQDA 2R751 1IOLA 1R00A 2ZXFA 3WYCA 4EB6B 1P0QA 4DLVA 1WKBA 1OX4B 1SGWA 1X2EA 3TRKA 5CTAA 4AP9A 3NVAA 2BKVA 1EA7A 4D8WA 5LWHA 5IT0A 1XZBA 1ICIA 1U9JA 2GRUA 2OP0A 2VUUA 2Q5CA 2ZIXA 1RM4A 2WSLA 3EDRA 1JB9A 3H5WA 5K8LA 4GX1A 4M7RA 1WBDA 4RK1A 2VTKA 3FMIA 2F62A 2CNWA 5EMMA 3I64A 1PV1A 3SXUB 2XMGA 3TCXB 2ZRJA 3EUWA 2ZS7A 1VBKA 4Q1VA 4CQLA 2FEAA 4ZVUA 4F84A 7MHTA 3I58A 1J2YA 1ADGA 2WBLC 4MKXA 1L4LA 2CLEB 3A1SA 1EK5A 3DDCA 1XEXA 2ZAOA 1URPA 5I6DA 3GNSA 4Y2VA 2O59A 4ENTA 1J7JA 5KOJA 3N8NA 1LJUA 3O8OB 2BCJQ 2ZBFA 4AFNA 1Y8ZA 4JLMA 4AMVA 3EIUA 4OM8A 1S8AA 2DWUA 1H23A 2XHEA 3FYUC 2AHRA 1U2GC 3G2HA 3LS2A 3VDXA 5B7QA 3AUXA 3H2YA 3TTYA 4LBVA 2EU8A 4L1KA 3FAKA 2G17A 2XT0A 4ZTUB 4Z53A 1T5IA 1A72A 4PSAA 5F77A 3WHKA 1Z5VA 2QAGB 1KK2A 1ZBDA 3KD2A 3GDFA 4U7JA 4XVCA 2NYAA 5KNDA 1WEHA 3I1YA 2YC2C 3PRYA 4V2IA 5G0TA 4Y1RB 3L7BA 1XTJA 3TFOA 4XWGA 4AKEA 3KKPA 1IOZA 1XZNA 3UMVA 1WPGA 1I2DA 1XROA 1T5DX 2I6TA 3N2IA 4HFJA 4KXXA 2Z6QA 2GTHA 3VH3A 1SU7A 5FFNA 3DLHA 3II6X 1PYGA 4QSHA 3VOAA 4D79A 2C8JA 1JMYA 3HCCA 4G5GA 4LOHA 3C98A 3R44A 4ARZB 4YAIA 1I1QB 1NLMA 2NOAA 4DLSA 4YCCA 1NIJA 3K16A 3AX6A 1W25A 4FN4A 5KTYA 1SMKA 5KPDA 3HVUA 5JROA 3G8DA 1VB3A 3HYCA 1SC6A 4II3A 3WV4A 1M83A 1E6WA 2G09A 2F3TA 2YASA 2YBEA 1B73A 5KDDA 1WXIA 1ZC3A 3LOPA 1LDGA 4OI2A 4QFMA 1JHDA 1PSZA 1W48A 4RPJA 1EVIA 5LR6A 4XI9A 2R0QC 2GD6A 1NURA 4GPTA 3A32A 2PU5A 3IAUA 3NONA 2R3SA 2PPVA 4ICIA 3FNGA 5HZKA 1KA9H 4O4JF 4IG4A 2B30A 4R1SA 1P80A 1UBRS 5DYGA 4D9CA 4V1CI 4G0MA 2G5CA 2ZI9A 2QNRA 4KQ2A 2XT6A 2I6XA 2JHGA 1X86B 2EFCB 2GZSA 2B36A 1G7CA 1NZJA 4IQFA 4I3GA 1YR6A 5G0VA 4B40A 1WIWA 1BXGB 2JGEA 4RXUA 1U8XX 1FCJA 3M7IA 2Y1WA 3QBJA 3EXHA 4W63A 3ZUGA 4A0QA 4PAOA 3ICQB 3MJDA 2EW1A 2Z2IA 5TR9A 2D0DA 2GILA 2Z1MA 1XMSA 5DP2A 5HCNA 4QM7A 3GH1A 4QYSA 4BJHB 4BRZA 1USIA 1L4BA 1UXJA 2JIRA 3DMTA 3BXOA 1P39A 1VPDA 4IQGA 2QRVA 1ZKDA 4MYRA 1OWMA 4GPZA 1U0TA 2O07A 1LQTA 4X90A 1UM8A 3BE4A 5F52A 2Z2KA 1VA4A 2KYRA 3EXEA 3L3BA 3LI2A 4CM8B 1H8HA 4MQEB 4L5IA 3K9NA 3GFRA 4B3DA 4KPEC 2HCTA 2W90A 3DT8A 3LUBA 4NL4H 4QA9A 3ESCA 4F4JA 1U8TA 2QZSA 4OA5A 1HYHA 2X9NA 2NNWB 1JNYA 2JCSA 3PHGA 1X94A 4F9TA 1A77A 1BHQ1 2BHRA 1SQ0A 1NVXQ 3KHTA 4D9MA 4UQLA 2OFFA 1O5OA 1V5EA 4TTQA 5EPOA 4H27A 1KE1A 2HWXA 1HT2E 4FHFA 1MPTA 2QAGC 4C06A 5MN5A 2A94A 1UK9A 1JA0A 1FTYA 1PJAA 1YL7A 1IOVA 1HE3A 2WIJA 3KOXA 2IS1A 1E6EA 1ZGHA 3UM9A 1JW9B 1XE3A 4CI9A 9LDTA 1YFLA 3D0QA 4C4OA 5KHAA 3GNLA 3EMBA 1CNEA 1RMTA 2DQSA 5AKYA 4D0SA 4D02A 3UA3A 1W88A 2CLCX 3Q9LA 2B7CA 3N39C 1M6VB 2HRQA 3IVXA 4GC9A 4MPPA 5JS2A 3ZDFA 5CB0A 3CINA 1ZYUA 2A84A 5BSFA 5FLXA 4HLDA 4K9RA 3RIGA 1LF0A 3UG6A 1YS2X 3V7WA 1Z75A 4UBMA 3TJRA 5FWXA 2LGJA 3QI2A 3CM0A 3B70A 3U9SA 3ZWNA 2C9OA 2QE7A 1HDRA 1A9PA 3NM6B 3UV3A 4BUZA 1ZRHA 3LHDA 4WXEA 3U4QA 2R5WA 4CT0A 3S68A 4BBZA 5HP4A 1J33A 3GDGA 3TYXA 1K7YA 5JCJD 3MT9A 4LZOA 3WL7A 4F38A 2IZOA 4K6GA 4G5SA 4ON9A 1XTUA 4L5CA 3DEIA 2JGFA 3AHIA 1G4HA 1GILA 3D4LA 2WG0A 3AW9A 1I0ZA 1G8HA 1NYRA 4GF5A 4S1VA 1GPLA 2VDLB 4DVJA 2NU6B 1IN7A 5AK3A 3R5HA 3O5AA 5BMOA 1UBJS 5KYXB 2VJDA 1UWKA 3OM8A 1OWOA 3LY5A 1F17A 4IX9A 1RTKA 3WWOA 1X1EA 3FWPA 2XLCA 2YIDA 1VMEA 2M32A 4P4LA 3AGPA 4IFIA 5T8KA 4Z2YA 4YC7A 1J99A 2O5RA 1T9GS 4BBPA 1MXHA 1YJAA 1E1RA 1H2RS 3LQ4A 4PVDA 1BVRA 2MR6A 4UOEA 5BVHA 1KP2A 4PG8A 4ZO7A 4NK5A 2F00A 2YY6A 1V8ZA 2A5DA 3MTJA 5JRZA 2XB4A 1CJSA 1K2WA 1BHJA 3CFYA 3F8TA 3NIFB 3GJ5A 4RHCA 1BOFA 3I9V1 2CBXA 2NNLD 5D5QA 3ZHCA 4ND7A 1E4VA 4D3ZA 4PM4A 3R20A 2V55B 1SCUA 1J5XA 2BKUA 2AQ8A 3CWQA 4R40A 1P9LA 5BNIA 4LF5B 1TF5A 2ZSIA 1BVUA 1VLJA 1UBFA 4DM3A 1Y8RA 4ZDJA 4H08A 5F5LA 3UFXB 2GVNA 4EPVA 1B76A 3VZSA 2VJCA 4L85A 4RENA 2YCBA 3G9XA 3PUIA 3JQFA 3C6XA 3EHEA 4P3YA 4WH0A 4AKIA 4RELA 1L7PA 2APJA 4GR5A 1IHPA 4L0QA 1KYIA 1W9MA 4P7JA 1GZSA 1T4GA 3C39A 3UKDA 1IM5A 2UYGA 2Y27A 2NXJA 2F3PA 3ADCA 2Q07A 2JFOA 2J45A 2V96A 3NHAA 4NAHA 1E5TA 3K8ZA 1TJYA 1UH5A 1U3FA 3EC1A 1QSGA 3LUGA 1THMA 4G09A 2OXTA 1XLWA 3WB0A 4N03A 2FSHA 5FOTA 5FNVA 5DM4A 3A36A 4DANA 3GG2A 2GK7A 1P2DA 5BWCA 2QNBA 4QGHA 4MMXB 4QUBA 1G8PA 4JJZA 1GQRA 5F4BA 1YZGA 2NU8A 3R7AA 1OLXB 2AD1A 3PVCA 2GAIA 4CQMD 2GA9A 3ETEA 4N3GA 3GLFE 4RGYA 1GQ2A 3EASA 3O47A 1CS0A 1FYFA 3RV3A 4MYTA 3L8GA 2M6LA 5EY5B 1KSFX 1NLYA 3OCJA 1YFKA 1COWD 1NMYA 1CVRA 3QPDA 1XTZA 4D42A 2OSVA 4BLUA 2VAXA 5AHXA 3RODA 1C4XA 1JKJA 4JC0A 4RLSA 5CLQA 1JAXA 1BKYA 2KBEA 2BR4A 2F55A 3E05A 1I2BA 3ZWAA 5FCDA 3UWMA 3C74A 3R0VA 2VF2A 1T9CA 1JQKA 2R7KA 1EP1B 4CM9D 3CNLA 2X2PA 4PFJA 2D5IA 2ZRDA 4BZQA 4JA0A 2X7HA 1VC2A 2HXSA 2DFLA 4HQNA 4Q34A 3W8DA 3ZYZA 3LHIA 2IHVA 5ALSA 1A2BA 3E53A 5EIEA 1ESEA 2P9CA 3OUTA 3AKYA 4GICA 2PLNA 5FL7A 3S7ZA 2JFQA 4K9NA 1PNOA 3E7PA 3Q7QA 1W7AA 1SXGA 3D4BA 3HWSA 3OAAD 4FT2A 4J9VA 3GDWA 4IIUA 2I4NA 3BXZA 1F0YA 5TQJA 3STHA 4AZ0A 4FUTA 2J6CA 4X92A 1NN5A 4F71A 5IJ9B 1RXYA 3MERA 4LWPA 5KYWA 3RU3A 4EQ6B 1FSSA 1ESZA 5G02A 3H1AA 3EPKA 4FDLA 4Y9RA 5C8YF 1DKLA 1RWOA 3FMFA 3H11B 4JP2A 4XRGA 1P5FA 1Z2PX 5JPDA 2VTVA 3IGFA 3WGQA 3D7SA 4TWJA 3VHQA 3R74A 4XSHA 3ZU2A 1B15A 4I36A 3SWWA 1MT0A 3O74A 1SVUA 1PFUA 1Z06A 2BISA 2JDID 2JJ1D 2YHUA 4W9NA 4BE9A 3THWA 1T0JB 1UDBA 1IM8A 3ND5A 3NEAA 4GDFA 3RREA 1ZGCA 2A78A 4UUBA 2XGGA 3MJSA 5M5BA 1X39A 3BSYA 4NG5A 3EVGA 4RL6A 2N42A 2PVSA 3L6CA 4C3UA 3HBJA 4ALKA 4IZHA 4LIPD 3O8RA 3WWPA 2PFGA 1M6HA 2ZBQA 2RGBA 2TYSB 3O4IA 4F6RA 2FE4A 4N3BA 4CDMA 4YJ2B 2ACEA 4Q3OA 4F72A 2DYKA 4E08A 2XAUA 4KIGA 2UZIR 1L8AA 4MUAA 1QRUA 3JPYA 3KB2A 4RNDB 4CIDA 1Z9BA 3HZHA 4MNTA 1GYRA 1BAPA 1UFQA 4N12A 3V1MA 2P2YA 1KORA 4G1UC 2B94A 1S2DA 2FPKA 3TKAA 1IAQA 2YJNA 2ZRHA 2X15A 3NBXX 3DVAB 2YZ7A 3QJGA 2OOSA 4RMNA 2DM6A 4Z0HO 4I08A 4D7AA 5HQTA 1T24A 3I37X 5ELLA 3W9SA 2P1ZA 4RVUA 1AM4D 1HORA 2EJBA 2F6RA 1KZ7B 2HA2A 3ROXA 3T9DA 3LF2A 1KWGA 5J2UB 4EITA 1J0AA 4P3PA 4I9NA 3HKCA 4RETA 2OA0A 3WTBA 3WQQA 4EARA 2GEJA 1T6YA 2BI8A 4CM4B 4QUAA 4CV3A 1DAGA 4PO9A 1C7FA 1L5FA 4K9SA 4WOCA 4HB0A 1U5BB 4MW0A 2HTFA 2ZYIA 4XE5A 4Q4JB 2ORYA 2QDKA 3KXPA 4R3NA 1H5UA 5H68A 2DBYA 2JGDB 2ZRNA 3CR8A 3KUKA 3R3SA 3KQKA 4PGHA 3SC3A 1YJCA 3BXHA 5IDVA 3PXAA 5TGTA 1SKUA 2ZT6A 4EX6A 1W0JA 2C54A 2Y68A 3BGVA 3O94A 2IPOA 1VXRA 2FOXA 4J3JA 2YVKA 1O94D 4DEVA 1BC5A 1NQTA 1SUEA 1X42A 1XEXB 2Y92A 3RSLA 4CG0A 3FOZA 1UUFA 5BV0A 4Q7QA 3IELA 3LWBA 9ATCA 4J49A 3ZQ4A 4I1UA 1DQPA 1JILA 1GL7A 4AECA 1C3OA 2NYUA 1O87A 2YUIA 3Q9NA 1KAHA 1CCWA 1M1NA 5CGQB 4DW8A 2QRKA 2ZAGA 4PGFA 1KBQA 3NEPX 1PFWA 3O1IC 2P79A 4JBHA 4JGIA 5DBGA 4D0NA 5BRJA 4LJ5A 2QWXA 2ZZNA 3GPLA 3I04A 3EGCA 3HR7A 4XVQA 1YIAA 4LJ8A 4YCNA 2O0MA 3I23A 4C4TA 1K8QA 4JV5B 1C80A 521PA 4KNWA 2QD4A 4BV2A 5IMSA 2WU3A 2QV7A 3SFZA 1JBKA 1COZA 5T4HA 3E48A 4IDAA 3FZGA 4QU5A 2B21A 4BNZA 1ISHA 3L8FA 2FOLA 4FYVA 4F1JA 2PWYA 2YHBA 2ZKIA 4JI4B 3HXLA 2KI5A 1JDJA 4UUNA 4OSOA 5I5GA 3GPBA 3RAPR 4BNVA 3ND8A 1BHSA 1DUIA 2GBGA 4BTLA 3QUTA 4BRUA 4DCNA 1ZL2A 2Z56A 2ZJFA 1AU9A 2IP2A 3K1YA 2IPLA 1J97A 3K1TA 4FZ5A 2XNDA 1PJBA 1ZONA 3M5PA 4KJXA 1L4KA 3MJFA 4GLBA 2QD2A 3HZRA 3I1JA 1R9JA 4BRWA 4L5BA 3KBOA 2VOEA 2P62A 2Q1WA 2BFPA 1Y7TA 2EKDA 3L7AA 4HFNA 3FKQA 5J5CA 3HUDA 1JHXA 2DECA 4DC9A 2VSOA 8ATCA 1O6BA 1ZBQA 1GPUA 3OOHA 3RKRA 3AK4A 3T3GA 5B30A 4ARIA 3R8XA 1MR3F 5JNSA 1BG6A 2OVFA 1OJ7A 4WK0B 2DQ4A 1HLGA 4N6GA 4EO7A 2HF2A 1RR6A 3CLVA 5C7YA 2K7FA 4EHJA 1FX0B 3SDSA 2HU5A 3WLNA 3OZEA 1HFKA 3AR2A 3O9ZA 4H0FA 2KB0A 1C2YA 3EXHB 3HCPA 1N1EA 2WJGA 2XF8A 4IDOA 3AMVA 3OIDA 2WWRA 1DTWB 4G25A 2QTGA 1UBTS 1T9GR 4Q7EA 4CMAA 1JLMA 1MO4A 3SR4A 4C4SA 3P94A 3PPXA 1W4CA 4WZAE 4MLZA 2P4HX 3EXEB 4LF6B 2ZULA 2HL6A 2QGNA 5H4GA 2X8WA 3F2IA 3IV6A 2X4LA 3ZH2A 3ZUPA 3LPDA 4UD6A 2FEXA 4IHQA 3O0DA 3KJHA 3TZEA 2BI4A 1XD9A 1KY5A 4EG0A 2XBUA 2VSQA 1NJ1A 4OSEA 1VI5A 1OAOA 2IXTA 4ES6A 3EUAA 4BWFB 1O0BA 3LUPA 4OL9A 4BHTA 1IHYA 3PXGA 3WLHA 4MUFA 4ER5A 3WIEA 2W0MA 3GQVA 4BFTA 1CP3A 2BBTA 4TVKA 4JBGA 4UHFA 1Z4NA 1IY2A 3W5VA 4DV3B 4ASUA 1SCKA 5G1PA 3C8HA 1YRAA 3JSAA 2QT0A 3K9GA 1DVRA 2CCKA 1V11A 1XX6A 3LGAA 3ZTWA 1RXEA 1WMBA 4A3SA 2ZRGA 3PVSA 5BOVA 5BSTA 1K0FA 3L43A 3Q6NA 4YLYA 2QAIA 4OYHA 3QEJA 4YRQA 4LYYA 1QE3A 4DPLA 4PANA 2DR3A 2QTHA 4ONEA 3E2IA 2ALJA 1BEUB 2GEFA 1XXLA 1GNRA 1LTKA 3CNBA 3FPGA 8ADHA 1NRJB 3IUNA 1T6XA 3CV3A 4UJ3A 4JEIA 1NPYA 5TDHA 4AZ3B 3WY9A 3QPBA 1A0OA 2RGYA 5DK4A 2ZIVB 3WIOA 3BGSA 4F9FA 4UM9D 1JF8A 2PRIA 3A04A 4M36A 3GPDG 1ETHA 1XLUA 1MJHA 4NFLA 4K3VA 4OXXA 4R0MA 4Q00A 3EZ9A 3P27A 1JXAA 1GZ7A 4MMYB 3A1UA 3AXTA 3EXHC 5DFAA 1VRWA 3C6YA 1L5LA 3Q8KA 1I7DA 3IQXA 4M37A 2F64A 1WOMA 2RJOA 5CA1B 2MMGA 5L3QA 4DV1B 1HE5A 3CUWA 2VYVA 1P7PA 2O57A 5BVHB 3HJAA 3DMTC 4HBGA 4S1WA 2HCFA 3TK1A 3EG9A 4NXMB 4L27A 3DD5A 2IHBA 3DP9A 3AOGA 3LCMA 4FHEA 2PIDA 4EY8A 1KEEA 4HGQA 1E3WB 2FPIB 2YXEA 4LAFA 4ZYYA 3H16A 2XDYA 3RFTA 1W6RA 1H42A 1VL2A 1HQKA 1V16B 3AY6A 1JG7A 3C41J 5A06A 2X3UA 4B0OA 4Y0NA 1N9ZA 1SCUB 4ZAZA 4J1QA 3QU7A 2JG3A 3F4LA 2IYRA 4HDOB 4N3AA 3UJ3X 4D3SA 1YDWA 4H7JA 5A4AA 3CG4A 3NTUA 2KW5A 4WVLA 4JYAB 4Y9SA 1SBYA 2HBYA 3H9BA 1PF7E 2D6FA 1ZO8A 1SB8A 4RKWA 4PZ0A 1W5TA 4NK4A 2HB6A 3T6KA 2R79A 4W5OA 4Q7JB 1SBIA 1HDXA 1NUAA 2L17A 1J8MF 2ZJ8A 1BXRA 3D6NB 2BFNA 2JFFA 3PUHA 2AZTA 1D1QA 2NVWA 3LA8A 3SC6A 4F9EA 1M8FA 3PPVA 4L78A 4TMFA 4AXBA 5K01A 2PKEA 4CL0A 5I9TA 3A3PA 4AKGA 1VIAA 2XZOA 3X1JA 2RBEA 3PA8A 3H5OA 1SHKA 5B5SA 1GP2A 2N1BA 2VDJA 4ZOAA 4EJMA 1QP0A 1FYEA 1JV2B 3D43A 3WNDA 5FNVB 4KGDA 1E5QA 1OLSA 4QPCA 2H5JA 3B51X 4U7PB 5JLAA 4XEUA 2NU8B 1B00A 2WWVD 1U2ZA 4IX1A 4YXFA 3THOA 2J7PA 4U8HA 4AN1A 5AQEA 4E2FA 4ER7A 1QO9A 4ZVNA 1OLUA 3BERA 2AVNA 5DEIA 4UE6A 3P2OA 1Z37A 3SXPA 5C7OO 4HLNA 2CDNA 1JKJB 5C8VA 3V4OA 4F21A 1IZZA 2C5LA 1E79D 1PQPA 3IBFA 1K7XB 4HTFB 4XYGA 1GFWA 3DDOA 3N86A 3HXKA 3GRKA 3M6IA 1KRWA 3N2KA 1MKYA 5GM1A 3VVMA 2H3EA 4RDCA 2OQ2A 4R2LA 4RIIA 3ORQA 3ZEIA 5T8KC 4BU0A 2B5VA 1JTFA 1CJTC 4J7UA 3LT1A 4D8TA 4M2LA 1H2XA 1N3IA 3HL4A 4CGYA 5JR3A 2IIVA 1QZ3A 3CUKA 2CVQA 2P8JA 1G8MA 1DQYA 4DYVA 2WB4A 3VR4H 3QM1A 3DBVO 2OHVA 3FPBA 3LUJA 3TLKA 3TNYA 3D5QA 1POWA 1DAFA 1YZQA 1C7JA 3P8ZA 4AJIA 5KYWB 3WK4A 4XZ3A 5DEOA 3HA7A 3BL6A 3FFAA 1IVSA 2G7ZA 2VHJA 3NHBA 5DTIA 3WLTA 3CYFA 1FP7A 4FE7A 2PUDA 2OZLA 3OLVA 4KGVA 3RYIA 4NF2A 5C7LO 1VYVA 1RWBA 3BWVA 4D9JA 3HTXA 3EA0A 1MGOA 4H7EA 3ZU5A 2PWZA 1RIFA 4AJJA 4Y6SA 4C01A 5M34A 3GHYA 3E27A 2C96A 1YOVA 1EFUA 1HE1C 3CRQA 1IIBA 3Q2IA 2O9JA 5AICA 1W85B 3JQFC 4AMUA 4J6EA 3V2GA 3JZMA 1EPUA 4NZYA 5B7GA 1UIRA 2HJVA 1C50A 3DUWA 4OB7A 4RY8A 4ZVVA 3WNQA 2IY7A 2RH8A 1XHFA 4ENRA 2CHVA 2D0OB 3QP9A 2AEFA 4Q9HA 1IXKA 2ON6A 2ZSAA 1YOBA 4CLDA 4TLLB 3Q8WA 1QGUA 4A6EA 2PH1A 2WJHA 4FNMA 3KU4A 2ZJAA 3L7CA 1KZ4A 1C0LA 1HTWA 2JAPA 2PKXA 4G0XA 4IEFB 4OHWA 3A2KA 3KJNA 2GBIA 3OQOA 2PX4A 2PKYX 2YQZA 3AI2A 3OF5A 1E5DA 2VDWA 4ZD6A 4ZI7F 1Q0UA 4NU8X 2AFHA 1P5RA 2JGIA 5LMNB 4YI5A 4N0QA 2PGOA 1PJ2A 5MN6A 2G67A 4ZARA 4DEYA 3MWLA 1NW3A 2VYNA 1Y4SA 2B92A 2NTNA 1L4EA 4RKRA 1LNQA 3NIDB 4HDMB 4KWHA 4LE0A 5SYMA 1E2HA 4DGQA 2WR8A 3F2VA 3PGLA 3EPLA 3HKCB 3U4CA 4EFDA 1NM5A 2VHVA 1C8KA 1FFHA 5DOVA 3IP6A 5JAUA 2IHTA 4OHRA 2G40A 2GEBA 2OM2A 4LXGA 4RXTA 3A9TA 1A76A 1ZS9A 3AF2A 3ITDA 4UULA 3I62A 3D4OA 2BGIA 4J2OA 1M2GA 1D2EA 1X6VA 1YK0A 3B6MA 1VJGA 4D9HA 4E21A 2R5FA 5ELXA 1C8LA 1Z2DA 4AP5A 5EMNA 1SOWA 2WG1A 2WYIA 3MRVA 4GXRA 1OB5A 4RACA 2FF7A 2W93A 3AONB 4IXMA 4TS4A 1PQYA 1H4VB 2JARA 4C0HA 2EWMA 3K35A 2X3FA 1J22A 1PJ8A 2Q4EA 4INOA 2XKAA 1N0WA 2QMZA 1BXKA 1NV8A 3MJ4A 4QDOA 3KK0A 4RHXA 4ZAVA 2J3EA 4OXKA 1I4WA 1OE0A 1QIGA 3NW9A 1H9CA 3GYGA 2LRHA 1NVFA 4JI3B 3PG5A 2G04A 3AJRA 3VU8A 5LQAA 4DFDA 3ED1A 2AN1A 4CWAA 2GD1O 5FFFA 1K7EB 3RARA 4MVCA 4P8RA 4IV0A 1M1NB 3LPCA 3P96A 1SBNE 2LE0A 2W6PA 2GVZC 2W98A 4DWVA 4FYPA 3UYKA 3NBYC 1XRJA 2HRDA 3D3EA 3PQEA 4W9NC 5EINA 3N5CA 1ST3A 4KTTE 5BUZA 1ZM3A 3SE7A 2WJ6A 5HKKD 3P7MA 3ZDBA 1HLPA 1N9GA 1T3HA 1FBTA 2AYXA 4CN9A 2G0NA 2HSZA 1D2MA 2VJAA 4OP3A 1RQGA 5EXSA 2TRSB 4XFKA 3KTAA 2ID8A 1RWMA 4WACA 3D81A 4B82A 4PYNA 4OI0A 4TVBA 3O8CA 3HHPA 2JLYA 4B3BA 2ZRBA 2JATA 4QODA 1FOEB 1BKSB 2LTAA 4B46A 2Q5HA 2Y0PA 4PIMA 4AULA 5JBIA 3NKFA 2D3TA 2QRNA 2PZLA 5AK6A 5GOTA 5A3JA 1Z5WA 2FN3A 1KOFA 5HE8A 2I3DA 4QUHA 3TLXA 1O9BA 4Z5XA 5BT9A 4PPFA 4KQ6A 2LDXA 1N75A 3QBDA 1JQ5A 4KXMA 2P8SA 1WZEA 3DEKA 4TS1A 1ODJA 4RTNA 1YA6A 1YD7A 2BZGA 3DDNA 2QP4A 4R69A 2OLEA 4LC0A 5CDFE 4UZEA 1CK4A 1ZNQO 3VPXA 5ALWA 1N6IA 1OGIA 5JFGA 2HMSA 2W6JD 3V8RA 3I9JA 4IHAA 1S1MA 1ZGZA 1E2EA 1NW7A 2Z8YA 3MCAA 4JVMA 2X0EA 3GJQA 1I3KA 1ONPA 4IPTA 5D6OA 3VKVA 3TQTA 4CVNA 4IDCA 3NOQA 3VMFA 2A8YA 4MW9A 4E1AA 4XX1A 4JHXA 3I6BA 5KTKA 3B6ZA 1DAKA 1EWTA 1OBCA 5JO9A 2HPHA 2XT9A 5JQGF 3D1VA 4H7PA 4NQRA 2IZ5A 2RBKA 5G4KA 4CIWA 3E9QA 2ISCA 4RJLA 1A9XA 2BFOA 3GUZA 4URWR 1K7CA 3J81k 3FOAA 1NSTA 1RWXA 2D5BA 1BMFD 1KPGA 4MULA 4WOBA 3RVMA 3UGTA 2JA1A 4O2BF 4BPBA 1IY0A 1FUKA 4JC4A 4E32A 2R7LA 1L7EA 2JNWA 4OHOA 4FKZA 3LW8A 3QE2A 3EBOA 4LKRA 3V34A 4GSKA 4QDTA 1RACA 2X77A 1Q7GA 2YV4A 3IULA 4KO4S 3RSOA 5HYVA 2GD2A 1KYQA 1Y3AA 3IBTA 3WNVA 2ZWPA 4DXHA 3E3OA 4FX2A 5HBRA 3A6JA 1IJBA 2V7VA 3ZZ0A 3QKSA 3PVZA 1XXHE 2DXIA 1P1FA 4D5GA 3UN1A 1AQIA 3IUSA 1Z3CA 1TUBA 4ENVA 5EKDA 4DUGA 2UXBB 2C2XA 3L92A 1OI4A 2HF7A 1V11B 4PWYA 5D3ZA 3T15A 2ZSFA 3EEIA 1Z7WA 4UEQA 3ILXA 1BWSA 2RSLA 1DJLA 2ID9A 2GJAA 1YMVA 1P81A 1E77A 1CV2A 2WF5A 1QZXA 2WM3A 2ZRQA 4L8WB 1TO2E 3OIFA 3SX4A 2H4XA 1R12A 1DRJA 3OZIA 4CDGA 4JBWA 4G1VA 1UT8A 4RLQA 1RWWA 2HA7A 5JY6A 1RHQA 4JA2A 1QGYA 3H97A 2GZ3A 1YDFA 5DMXA 3HUFA 3FJYA 3G8AA 1RZRA 1QH8A 2AW5A 2AOUB 4DLLA 1RI1A 4JQYA 1IG0A 3W5AA 4HKTA 3N2NA 3QXGA 3IH5A 4V39A 2WSSA 4HWKA 3TQIA 4OXRA 3T9EA 3UHOA 3M1AA 3ZHZA 2WNSA 4EEXA 4N48A 3FNIA 3SLGA 3QENA 1T5TA 3CUSA 4ZV7A 1JIXA 2CNKA 1N8NA 2YUTA 1WCXA 4P4UA 3HI6A 5IMBA 2ZWMA 1PP4A 2NACA 3ROTA 3DNPA 2CJFA 2P9QA 4UD2A 3FBTA 4HAYA 5ISMA 4I4CA 2FZ5A 3SDBA 1A2OA 2Q46A 3EG9B 3OIWA 2UXDB 4TTTS 1RQPA 2CVFA 3G8YA 4EKEA 5CIYA 4I6JA 4Q3BA 3JVIA 4NAUA 2DBVO 2CXHA 2GK6A 1KXJA 2Z5FA 3L0OA 2Y71A 1L4MA 4ACAA 1Q0SA 3QBTA 1PUIA 4OXYA 3KETA 1PCXA 2ZJOA 4JT9A 4BO1A 1XDBA 3U3KA 3C5CA 3LY8A 4J76A 1HLDA 4M1EA 5LA6B 5DBIA 3WK5A 4C5BA 1Y6ZA 1E2QA 4J0KA 1C4WA 4J03A 1J1IA 4PBRA 2VS1A 4ISBA 1DJQA 3FCAA 2VP9A 1OAOC 3E9RA 4RLFA 4XWYA 1UBCA 1EE1A 3LOQA 4P7GA 4UHCA 4L3OA 2IU0A 3S2IA 3UJPA 4C07A 4EA6A 4ZDKA 4CKYA 2RKOA 1U0OC 5KTSA 5LQRA 3A7EA 2XIQA 1D1TA 1BXRB 1G9XA 1V4BA 3BQMB 4GI3A 4YQZA 3ZHTA 1OWNA 1R2QA 3HWX1 3ORYA 4R8SA 4Y2GA 4CNBA 4CN8A 3AUAA 1VKOA 4GQIA 2BHNA 5DU2A 2IHNA 3VR4A 4BDSA 1IJFA 3ROPA 4D43A 4MW7A 4Q9NA 5BQXA 2OCIA 3I01A 3OLWA 1CZOA 2DH5A 5AKGA 2WWGA 3BWXA 4V2UA 3GA7A 4DRXA 4RPLA 2B0JA 3GLQA 4PQGA 4URHA 2CC2A 5LLSA 2QZJA 1H6AA 3GD5A 3BZWA 4GYWA 4QQKA 4TTJA 5SZIA 2GSDA 2Z43A 3KEQA 3QHPA 3IA2A 1QKJA 4ZAWA 1WZNA 1IN1A 2ILTA 5C37A 3VZPA 2WJZB 4XCQA 1Z2CA 4Q21A 3M33A 3QW4B 1ND6A 1DARA 1C5KA 1KPIA 4R3UC 4B6FA 4EW6A 1OBOA 4DR5B 2RC5A 2TMYA 2J59A 3GLHA 1TQDA 2ZYRA 3FHTA 2Q8PA 1YC2A 4WLUA 4MI1A 4K1LA 3AWDA 3EW9A 3VPFA 5JJKA 2XKBA 1W44A 3ORHA 3GLGA 1CD5A 3OX1A 5DLPA 4FNGA 2BFCA 1AIPA 3ADOA 1WW2A 2JI7A 3KZVA 3KDPA 3N2KB 1QZZA 1HYQA 2VDOB 4XR4A 2WICA 1IATA 5AIAA 3ZLBA 4DIKA 5FI3A 5LL6P 4DUYB 3TG2A 1T10A 1E60A 3GFSA 5LOVA 4BFVA 3IV7A 2X4GA 1XEWX 1NBOA 4MVJP 4GMGA 3E2MA 3B9BA 2ZJBA 1LC0A 4L50A 5FRDA 1BMQA 1RYEA 2EZ9A 3D59A 5BVGA 1KP9A 1XQWA 5KSYA 4EHHA 2LIPA 1QANA 3IALA 4QTXA 1LV7A 3ES9A 2XMBA 2GEKA 4UTPA 5IHXA 3ZX5A 1RXWA 3I2HA 3GEDA 2DULA 4HEHA 4JYCA 4NZNA 5H81A 5KTRA 1GUYA 1X8JA 2ZTHA 1DEXA 1E96A 1KVSA 2WZCA 5EMHA 2BI7A 4M88A 2IA5A 3LBFA 2NW6A 2ENUA 2ZAYA 4RHUA 3SQWA 1XHLA 2WUWE 4H3KB 3WKBA 1ZIXA 3M3PA 4JEUA 1H3EA 2JFUA 4DM4A 5H3CA 4YQFA 2Q1SA 3PGMA 4JI8B 3VA7A 1AZSC 3ER6A 3UUFA 3HNRA 4W4TA 4DIBA 1YOVB 3U3ZA 4PYJA 5BORA 1DAMA 5HRCA 4EPRA 1Z4QA 2WMOB 1M8KA 1EP9A 4MYDA 2CHEA 2ZRPA 3QEMA 3VTFA 2YH2A 2WQ7A 1H1LA 1ZR2A 3DZIA 4PYLA 1NVBA 3NRCA 3DMPA 3UV6A 1P7CA 1TXGA 2XMDA 3GIWA 4P3OA 3ZKWA 5CB8A 2F7SA 1FU8A 2GNAA 3EGXA 4ARAA 3IIIA 1HL3A 2WJAA 4YDQA 2KHZA 3OPXA 1SQSA 4LF8B 1C8VB 1QH9A 4QOGA 1VCNA 3R7WA 4FKMA 2H4ZA 2JD2A 5LCXA 3VC1A 3JQAD 4X85A 5DNVA 1GXSB 2Q45A 3RSCA 4L9AA 2QRLA 1P2VA 4LJ6A 4LXIA 4Q03A 1I7SB 2TMDA 3O93A 4RZQA 2P0EA 2AFHB 4XPIA 3I04M 3NPMA 4K9QA 5TXGA 3FPKA 4BTEA 4WOKA 2EX1A 1CULC 1W36D 2IBMA 3TE6A 1GSIA 2VBIA 2P5UA 4RJ2A 1XMXA 1N2CE 2W5UA 2JBHA 4J3NA 4DVGA 121PA 3MXTA 4L73A 1RAIA 1NVMB 4KXFB 3QXCA 4IKPA 5KOYA 3PQDA 3PX7A 2QXTA 4EI7A 4N76A 2K4MA 3DL2A 1K4KA 4Q4HA 1W2GA 4MW5A 2O20A 2ILVA 2W2QA 2PD6A 1FU4A 3THYA 2NPFA 4XUGB 7ADHA 1ZCZA 4AD8A 1V7PC 1YE3A 1PLJA 1NVDA 1SH7A 3A2LA 5ALIA 4JT4A 2AYZA 1QMGA 2CFCA 2OXEA 1IZ7A 4UMVA 1DBSA 5FR2A 3O21A 1XEWY 1N5KA 1B93A 2O1EA 1UXHA 3GFVA 4QDKA 4X1KB 5EZYA 3T9CA 3K09A 3DKRA 1VDZA 1YBAA 2PH5A 4LWQA 2PGLA 4N49A 2M6KA 5DCUA 2VJKA 1S9DA 4I5GA 1O08A 2QLTA 3DZKA 2AG6A 1WU8A 4JUCA 2X0IA 2R7NA 2P6PA 3N28A 3QI7A 2WHPB 2DP4E 5DHFA 4L57A 1AGPA 2YTZA 4B17A 4BZXA 2Q4BA 3DO8A 1PBNA 3BJEA 1FYXA 1ZSVA 1NAHA 1EAMA 3IMCA 4J4TA 3UW3A 4DE5A 2HA3A 1WDKA 3G2MA 3TMAA 4KE7A 4XKJA 4Y9TA 1IJEA 2DE0X 3MJHA 1UPCA 1TQ6A 2C5FA 3AOEA 1N9GB 1O0SA 1ZSNA 3NUGA 4ENQA 2O1SA 4FGLA 3KSBC 3DTYA 1ONSA 3NH6A 3OZDA 3UXHA 4FMBB 1T0BA 1WE2A 4Z3DA 3A7DA 4YJ3F 4WX2B 3RTAA 3WMWA 4IM7A 3ZWOA 4K46A 3CSSA 3WKDA 1WMAA 5B2ZA 2V3WA 2W8BB 4AQDA 3I1FA 3HLTA 2HC9A 1IMJA 1JEAA 1EJ6A 3JYOA 1Z8DA 1Y98A 3QFSA 4KIFA 1Z45A 5E1MA 3WHLA 2XODA 3D7MA 4LQ4A 4Q93A 1F0NA 3O4FA 2NYVA 3B2NA 3EDYA 1YZ3A 2VCHA 2GLXA 3D0KA 2ODQA 2BTQB 4L8GA 1E98A 1EK0A 4HEJA 5DHAA 5L3VA 1IZ0A 4GWGA 3STXA 4FS3A 3BREA 3C70A 1JHMA 2JVIA 2C3MA 1ILWA 1W34A 3A0RB 2BJVA 4C4YA 1OKKD 3RK1A 4DQLA 1L8LA 2H00A 5DHSA 3SC2B 5JQWA 4CMIB 2LKCA 2ZKLA 5E1DA 1U9IA 4K87A 3M9WA 1CZLA 1QG2A 2ORED 1FFSA 3F7NA 4QBHA 1ZVJA 1NM5C 4XCVA 1TDJA 1U9YA 5IVPA 3EMVA 4L02A 4A03A 4HQLA 3RRFA 3MFYA 1KZGB 2IYQA 2DFNA 1EVLA 1CUGA 4BYGA 3SYTA 5IT9A 3AEYA 1Y4AE 1SCQA 2DZDA 1U0GA 3EVEA 3GZTB 3UGQA 4WXPA 3PJGA 3QPAA 3QZUA 1J39A 4IDQA 3RS2A 4JQCA 4G0VA 4BN4A 4KO3S 4B3SB 4LXXA 4HYQA 4M1MA 4JX9A 2EFHB 3NU1A 1O8BA 3I3OA 2PXXA 2G72A 4BYMA 3USCS 4M9RA 5CBPB 1WLYA 4YMLA 4MPTA 3OTIA 4W7IA 4UVDA 1GPDG 4LRXA 3VPGA 3L4JA 3OE1A 1EVZA 3HSKA 5A9SB 4UM8B 4DYHA 4F4UA 1BCRA 1ZH0A 1AS2A 5DDIP 2ZRMA 3WGGA 1OXBB 1U6IA 3ZTYA 2PE5A 2HNBA 2VK2A 1SOUA 2XPCA 4GBGA 1NXWA 3LCCA 3OESA 2FWBA 4HGNA 4XXHA 1C41A 3EEFA 4ND6A 2AC4A 2M9MA 4MV8A 3UYLA 5KVAA 5FV7A 5KQSA 1Z62A 4HXYA 3BXFA 4FD2A 1C1DA 1ZD9A 3NASA 2YWJA 3ZC3A 2C2KA 1PK8A 1YR1A 4E5DA 1EE9A 4NJOA 4NMMA 4CCYA 1CZNA 1XELA 2VBGA 5HMLA 1L5NA 2EJUA 2RKWA 1EQUA 5AKLA 2PZAA 5JW6A 3ZV4A 5GMOA 4WCDA 1GPBA 2PLRA 1PLKA 3QFHA 2UUOA 2E48A 2ATEA 3PQ5A 4IKEA 4KVAA 1PGNA 2IODA 1QIKA 1TUBB 2XUPA 4TYQA 4YAJA 1YZUA 1ZM7A 2JAUA 2WT4A 1MB0A 3TR5A 2REQA 4LJYA 2YOFA 4FR2A 5F78A 4GM4A 3BRQA 5REQA 1A27A 1JI3A 2ZVQX 4JJ4A 1ODLA 1JALA 4FZ3A 1FFDA 2QMHA 4GAEA 4HNAA 3TI9A 3UIEA 3OP4A 2V8OA 3CEMA 2FB9A 1XZIA 1RTTA 3L7OA 1TD9A 3KTFA 4DV2B 1FQJA 5FTLA 4MIOA 5JNRA 2FUEA 3CTMA 4DILA 4WZBA 1LS6A 1DIBA 2JBAB 3ZY4A 5EJFA 4MPDA 2A88A 3SIWA 1JQDA 1BCSA 1EMDA 1LWOA 3V4FA 4MWOA 3HDQA 4RNCA 4B3HA 3V55A 3OHSX 2CYCA 1U0BB 1G17A 1U99A 2OY0A 3GFOA 4JBYA 4Q9IA 1GA1A