4WWHA

Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi-510967) with bound d-galactose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
329
structure length
329
Chain Sequence
AKGTVGIAMPTKSSERWVADGQNMVDQFKAFGYDTDLQYGDDVVQNQVSQIENMITKGVKLLVIAPIDGSSLTNTLQHAADLKIPVISYDRLIKGTPNVDYYATFDNTKVGVLQANYIVDTLGVADGKGPFNLELFAGSPDDNNATYFFQGAMSVLQPYIDSGKLVVKSGQTTFDQIATLRWDGGLAQSRMDNLLSQAYTSGRVDAVLSPYDGISRGVISALKSAGYGNAAKPLPIVTGQDAELASVKSIVAGEQTQTVFKDTRELAKAAVQEADAVLTGGTPQVNDTETYDNGVKVVPSYLLDPVSVDKSNYKKVLIDSGYYTETQVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter
publication title CRYSTAL STRUCTURE OF AN ABC TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM MYCOBACTERIUM SMEGMATIS (MSMEG_1704, TARGET EFI-510967) WITH BOUND D-GALACTOSE
rcsb
source organism Mycobacterium smegmatis
total genus 124
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 3.6.3.17: Monosaccharide-transporting ATPase.
pdb deposition date 2014-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wwhA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wwhA02
3FFXA 1DCFA 4YRZA 3VNAA 3C6QA 3E61A 3DZDA 3H1EA 3Q9SA 1DRKA 1MAVA 2QV0A 3O1IC 3P9YA 2FQWA 4Z9AA 1DCMA 4Y9TA 5EWMB 1LJUA 1UDRA 2NUBA 3EULA 3HEBA 5IEBA 3O2QB 3HO1A 3H6HA 1BAPA 2WJAA 1VKRA 5HKOA 4YO7A 5TQ2A 1D4ZA 1ZVVA 4KVFA 2HPHA 3CG4A 3CZ5A 4YV7A 3MMNA 3RVNA 1DBPA 2FEKA 3F6CA 1ABEA 4MR8A 1B00A 4MR9A 2IYNA 1DCKA 1ZN2A 3L49A 1WETA 3OM0A 1JYEA 3OLXA 4WZZA 1PHRA 4YCSA 2FQXA 1NXPA 2I6FA 4MQEA 2PL9A 4MR7A 4MS4B 4P1ZA 3E3MA 4WT7A 4Z4IA 5IULC 1L5ZA 5JS1A 1RZRA 2Q5CA 2FMFA 4FE4A 3HJFA 2OENG 5DLEA 3IP7A 2E4VA 3O74A 5TPZA 3H5OA 2YHAA 3LUFA 1RZRD 3HM9A 2PKXA 3MQ4A 3GRCA 2A9OA 4EVQA 1JBEA 9ABPA 3NNSA 4XAQA 4GNRA 1EWTA 4XFKA 5TPZD 4W5RA 4ZPJA 4RKQA 1JF8A 1M5TA 4Z99A 3CS3A 5KC8A 1F51E 3CU5A 2PUDA 4N0QA 5HM6A 2B1JA 3MIZA 5CNKA 4TN5A 2QVCA 3Q7SA 3TB6A 2IDMA 2CD7A 2GBPA 1OXBB 4KK3A 1IIBA 1ZH2A 2QW1A 4N03A 3OO1A 3GYBA 1NXSA 2QXYA 2J48A 2IKSA 3QEKA 3BILA 4NICA 1ZGZA 4O1HA 3A10A 1ZESA 4F11A 1LBHA 1SXIA 3F6PA 5KI6A 3O1HB 3JY6A 4S04A 4ZMSA 3O1JC 1D1PA 4QICA 4G97A 4RY0A 4LZLA 2FXIA 4RV5A 5PNTA 5KQGA 3CG0A 3KS9A 4MYRA 4KNYA 4EVSA 3B2NA 2FLKA 4JAVC 1YK1A 3QLTA 3D8UA 2FN9A 1BVHA 2ZWMA 4O5AA 2A9RA 3I42A 3F73A 1PEYA 5IC5A 3RVRA 2BGGA 4KREA 4JB0A 5B3JA 3T95A 1USKA 5IUJC 4H3HB 3NHZA 3GT7A 4EY3A 4KFCA 1SD5A 1W9HA 2O20A 3GWGA 1YTUA 3KG2A 1YK0A 3QEMB 1URPA 3C3KA 4MQFA 3O2SB 1U8TA 4TMYA 2LP4Y 5CNIA 1U2QA 2R25B 2E4XA 2CHEA 2X7XA 2M1ZA 5JNSA 5TPWB 3LMKA 4EYQA 3LUJA 3H6GA 2PUEA 3LOPA 2L17A 3BREA 1KMIY 4ZMRA 1ZY2A 4G0XA 4G86A 3HVRA 1QP0A 2E4UA 3N8IA 4RY8A 1A2OA 5EWMA 4RDCA 1VRVA 5DTEA 3N75A 1CHNA 5JNRA 1A04A 3H1GA 2IPMA 4H3KB 4W5TA 3H1FA 2MYUA 1LK0A 5DCLA 5C5CA 1W25A 1ZITA 2FEWB 4OBBA 1ISSA 2FKAA 1JFVA 1Z12A 2B4AA 5BR1A 1DBQA 2FLWA 2JVJA 2PUBA 2FMKA 3SG0A 3OO0A 4MS1B 4NV3A 4LE2A 4PICA 4RK6A 2M98A 2PUAA 3HV2A 4NQRA 4WUTA 1PNTA 3SAJA 4XASA 4ZYLA 4EUKA 4MS4A 5GOTA 4PZ0A 1Z17A 1FFSA 4Z4CA 1M2EA 3LUGA 3QLUA 3KJXA 3NNDA 1AB6A 2JB9A 1Y1LA 2L18A 1KRXA 1CYEA 2AYZA 1APBA 4P98A 2PUGA 2WMYA 1T34A 3H5IA 4RK7A 2DRIA 2PMCA 3CKMA 5IBQA 1EWVA 1ZDMA 2PJUA 4XARA 4W5OA 3Q15C 3JPWA 4G0QA 3SQNA 5TQ0B 4F3TA 4RSMA 1NY5A 4OG2A 4OATA 3VNBA 5FWXA 1GCGA 2FMIA 3CFYA 4HNRA 1EWKA 4MRMB 4QYMA 5DKFA 5KQMA 4KPYA 4YLEA 3I09A 3DBIA 4EYKA 3H75A 2NZVG 2RDMA 4WXEA 1Z18A 4WWHA 3JVIA 4RK4A 3RH0A 3CHYA 4L4UA 2GWRA 4EYOA 3SM9A 3FMVA 5D2CA 3HSYA 4F12A 2FTKE 4IGAA 2QZJA 1LJLA 2TMYA 4XXHA 5B3JC 4TLLB 4TLMB 4RXTA 2MYTA 3DGFC 3RVSA 1JX6A 1FQWA 2JRLA 5CNMA 3C3MA 4HNSA 1U0SY 1XHFA 3MYYA 4G0OA 1QP7A 2WB4A 2PLNA 1EFAA 6CHYA 5TQJA 4IILA 5EWLA 2MYNA 4JOQA 1YMVA 3M6MD 4N41A 1YVUA 1JH9A 2H3HA 1QPZA 3QELB 4IMIB 5EWJB 4Z4HA 4ETNA 2VK2A 1Z15A 1YIOA 3IPAA 2HQRA 1P8AA 1J56A 4LRQA 3MM4A 4ZJPA 4NCBA 4F8JA 2QSJA 1RXEA 4RK0A 5E3JA 5I4CA 5IUKC 4YS6A 4IMJB 5C5EA 3HK2A 1JFTA 5JNTA 2LPMA 2QR3A 3IP9A 3URMA 1ISRA 3M9WA 4RY9A 4MR9B 3N0XA 1JHZA 1VLZA 4KQCA 2L19A 5DGCA 3T8YA 3O2JA 1F4VA 3RQIA 1NTRA 3LKBA 1NXVA 3L6UA 3QEMA 3OQOA 5HSGA 3KSMA 4HYEA 1PUXA 3HXMA 4RZSA 2HSGA 2JCGA 4KZKA 4MS3B 4QPJC 3N6VA 4OLBA 4S05A 2PUCA 1QQBA 5TPWA 5T7BA 1C0EA 1DG9A 3RVOA 3RVMA 4KQ9A 3D02A 1RNLA 2WY2D 3TX6A 5ED4A 4ETIA 1P2FA 4UHKA 1E6LA 1U2PA 3EODA 2VUIB 1DJMA 5FWYB 3JS5A 1QQAA 5T3YA 3NBMA 3LUKA 3KYIB 3QLUC 1OXKB 1GCAA 4YGXB 4IF4A 2ID9A 2A9QA 2NT3A 3C3WA 3OMXA 1BDJA 4N0PA 1PEAA 1ABFA 4GPAA 2NZUG 1NATA 4Z4FA 1K68A 3UK0A 5GQSA 3RVKA 5BRAA 4LDZA 2QVGA 4MS1A 3GA5A 3BRSA 2WRZA 1SRRA 1YS7A 2FN8A 4D74A 2R48A 2A9PA 2F8TA 3OLWA 4W5NA 4G0PA 4JA2A 4JP1A 4Z0NA 4N47A 2GX6A 1H9CA 2JBAB 2JVKA 2FQYA 2E4YA 2HJ9A 4RK1A 4YR7A 1RPJA 5BQ3A 3ROFA 2IPNA 3KLOA 5HQJA 4Q6WA 1MVOA 2W42A 4EYGA 1DBWA 4MGEA 1Z2EA 2VYCA 3CZCA 3UUGA 3G85A 3EQ2A 4M88A 3BRQA 1E6MA 1MB3A 1ZGGA 3FFWA 3Q7TA 5TQ0A 3I5AA 1JLKA 5FBHA 3GL9A 1MIHA 5BRJA 4JB2A 2LBPA 3HUTA 2PL1A 3IP6A 4PYRA 4LE0A 1USIA 3I45A 3O21A 2RGYA 2XDYA 1E2BA 4WXMA 1DZ3A 3QLVA 2PE5A 3H5WA 1ZHHA 4MPTA 4MQFB 1R8JA 5IUNC 1L5YA 2FVYA 1TLFA 3H5VA 3KCNA 4PEVA 4E7OA 2FEPA 3MA0A 4KV7A 2RJNA 1JDPA 3K4HA 5IEJA 4RXMA 1M2FA 4QYWA 1QP4A 4RWEA 1JFSA 4XLTA 1M5UA 1XWWA 2WJWA 3QX9A 3G1WA 3N0RA 5JNWA 4LE1A 4D6YA 3IP5A 4F06A 1CEYA 3RVQA 2GKGA 5IX8A 4Z4EA 4RK5A 1GUBA 1D5WA 3CLKA 2P4UA 3QELA 5EWJA 3ROTA 3T38A 4D6XA 4HNQA 3UKJA 3LUCA 4O1IA 3DLBA 4RS3A 3JTEA 3GBVA 4LX8A 1A0OA 5JS2A 1TM2A 3KTOA 5FBKA 2JVIA 1JL3A 2MSLA 1SXGA 1KRWA 1S8NA 5KWSA 1U04A 4OLAA 4MLCA 7ABPA 2FW0A 2IOYA 4OTZA 3OLZA 3DLHA 1JWLA 3LTEA 2IPLA 4KMRA 3H5TA 3KHTA 3N53A 4YP9A 2N9UA 2GI4A 2P9HA 3K9CA 3A0RB 4IRXA 3JPYA 4MS3A 4FE7A 3NHMA 2WWVD 1Z16A 2HQBA 1D2AA 1GUDA 3EQZA 4PE5B 5CNJA 3FFTA 4L85A 3GV0A 4Z9BA 3RVPA 1Z2DA 1Z26A 1JDNA 1SXHA 4JASB 2NT4A 3CNBA 3EGCA 3LUAA 5TQ2B 1E6KA 5JNUA 1BDIA 2R4QA 5JNVA 1QMPA 4Z4GA 3JVDA 2FSPA 3A3KA 5FWYA 4MR8B 4CBVA 3CRNA 4G0ZA 1QKKA 3HCWA 3OM1A 3FGZA 5FWXB 2LIVA 4MQEB 1VPWA 4NCAA 2AYXA 2PAFA 4MR7B 3C97A 5CHYA 3OQNA 3A0UA 3Q7RA 8ABPA 5KQLA 3HS3A 1HEYA 1JYFA 1ZH4A 5KQPA 1TVMA 3OMWA 2E4WA 3EAFA 3SY8A 6ABPA 3KYJB 3HUUA 4RXUA 4KK4A 2QU7A 1ZAYA 1NXTA 1K66A 3QX8A 2FMHA 5ABPA 2JBAA 2V0NA 4DN6A 1LBIA 2OQRA 2L2QA 4H60A 1NXXA 3QLVC 5EWLB 3M9XA 2ID7A 1DRJA 3HDVA 4E7PA 1KGSA 1FFGA 2H0AA 3LFTA 3EDCA 4G0YA 4RU1A 4EVRA 1FFWA 2KYRA 1TMYA 2R47A 4DQDA 1Z13A 3T6KA 3IPCA 4ML3A 1P6UA 4B09A 3DGEC 4G0MA 4UHJA 4W5QA 1PNRA 3OLYA 4MLDA 2YHBA 1AB5A 3TD9A 4EGSA 3ILYA 4ETMA 1DC7A 4RKRA 4LDAA 4FB4A 2CWDA 3H5LA 2MYPA 1NXOA 1XHEA 1BA2A 1Z25A 5KC9A 3Q41A 4Q7EA 3S99A 1EAYA 3LUDA 3BBLA 1TJYA 3MF4A 4YWHA 1QNLA 3OLVA 3NNNA 3OQMA 4DADA 2E4ZA 1GLGA 3TMYA 3QK7A 1DC8A 3F7NA 1RXIA 5F64A 2JK1A 1MB0A 3HZHA 3KLNA 3CTPA 1EHCA 2LUOA 1P6QA 3ILHA 2MSKA 2VUHB 1USGA 1QO0A 4MRMA 2F8SA 1FSPA 5TE9A 2MSWA 3SNKA 1NXWA 3EJWA 4KRFA 1YMUA 4Q6BA 1D1QA 3O75A 3FDFA 2RJOA 3RVJA 1C4WA 1I3CA 3RVLA 1DP4A 4N76A 1QO0D 3TO5A 2HQOA 1BDHA 3KKEA 2ZAYA 3W9SA 2IPAB 3LKVA 2CHFA 3HDGA 3IDOA 3GBPA 3LUHA 2PUFA 3N0WA 3R0JA 4MAAA 1YS6A
chains in the Genus database with same CATH superfamily
1Q1AA 4HPWA 1YZNA 3JYOA 4GE0A 2GERA 2CL7X 3U4IA 4O8CA 3H1EA 3L02A 4H1WA 1DRKA 3JARB 5JDIC 3EGIA 2YHUA 4PX3A 2DBRA 3BWYA 2AG6A 3SOZA 4QE3A 4UUOA 2GK6A 1MZVA 1FW8A 2G0TA 1KPIA 2GF2A 3K2IA 4H0NA 4E09A 5BVHA 4V1CI 5GZ3A 4UPDA 1VFPA 5CB0A 3ZJTA 3KB8A 4HJRA 3GHYA 4DR7B 1F48A 3D2BA 4FD2A 4HWKA 4YBRA 1P3JA 3SS8A 2BM8A 4KVFA 1BX1A 3EQ9A 4EKNB 4H59A 3ZV4A 1BWPA 1E2DA 2EZ4A 3SJAA 1J39A 4KO3S 5DN6A 3TXXA 3O3MB 1WDLA 4G1VA 4QU9A 4YMWA 2HQSA 4B73A 3FPSA 3BJRA 3AC0A 1G7SA 4LNUA 5FTKA 1JYEA 2ZAIA 3DKKA 4A23A 2YS7A 5ADWA 1Z6YA 2YR0A 2PL9A 1JBQA 2J3IA 3KYCB 1J2TA 1U90A 3F7OA 4CU2A 2AR7A 4WJKB 4B4WA 1R6UA 4IIJF 4P7JA 3CUUA 2A3NA 3T3NA 1XP8A 4AAYA 1SAYA 4L8GA 3STTA 2CKDA 2IW1A 1ZNZA 4I5EA 4TZTA 3WOVA 5KOJB 3AVOA 2NP6A 3KPUA 2EBWA 4MTCA 1VG0B 4RMIA 2P9CA 2GLTA 1RAGA 2HSZA 2G25A 3B3QA 4BLPA 3MD9A 3ZWBA 4K86A 3M6IA 2QZ4A 4G9GA 1MR3F 4WNIA 4JZYA 4RCVA 5JPCA 3BB4A 4WKBA 1YB7A 5AXCA 1ZOLA 4CMIB 1FTWA 1FFAA 3HEAA 1G20E 2WEKA 4QQRA 4DSUA 4LQDA 1E2LA 1RAAA 3ZV6A 3JZIA 2G9UA 4RKWA 1SGWA 1VE7A 5C1DA 4D81A 1XEWY 5BRNA 3VQTA 4MB2A 4S2UA 5F7ZA 1C7ZA 1M6EX 3C1OA 3ZK7A 2JIQA 2IDMA 2IXFA 5EIOA 3IP1A 3AT1A 4XGIA 4BKQA 3HKDB 3RUIA 3U7HB 4MCHA 3UAOA 2I55A 3R24A 1Y9DA 2JFUA 2BSXA 1K4YA 2R7AA 4DCUA 4QQKA 4BO5A 2HHHB 1MAUA 4HH4A 4O1HA 1ZESA 4S04A 1X77A 4FGKA 1IHYA 4MUGA 4O25A 5BYAA 1XXHB 1UM9A 1QR6A 2NTNA 3KX2A 5C80A 3PNPA 1EGHA 4O4HA 1Z73A 4PLGA 1W8IA 1YKGA 3M5DA 3WJ1A 2DU8A 5ALRA 1WB9A 4WI1A 1YHZA 3QLTA 3OT5A 4YCCA 3WDSA 3GROA 3TOSA 3OZDA 4YY3B 4N39A 4A2CA 4CDMA 3QUBA 1ORTA 2ZETA 5TJ9A 3QPBA 3RVRA 3VSBA 1YZYA 4DC0A 2ETXA 1LI4A 2G80A 3UZUA 2Z4TA 1E0KA 4FBGA 4H3HB 3NONA 1P9LA 2WW8A 4JYCA 4LNHA 2BTQA 1PFQA 2BW0A 4IKPA 3O8LA 1WX1A 1S2NA 2QD5A 3Q40A 2GESA 2NO9A 2VUUA 3PEFA 1VJ1A 4HAUA 4R8SA 3WMXA 1O77A 2ZPAA 2JLYA 2NU8A 1YVDA 3L0OA 2CLOB 1YRQA 2O8BB 2OILA 1DJQA 2QAGB 1ZM2A 1B0PA 2DPHA 3FDZB 2VJMB 3QV1A 5CJPA 2H7YA 2HB6A 4MYHA 4QJIA 3PC3A 1P39A 4D5EA 3DAYA 4WBXC 4TV9B 3UJ8A 2QQEA 3LT4A 2EZTA 2A9FA 5AVXA 3OBIA 3MG9A 5DYIA 5AQ1A 2IHYA 3DYIA 1U7OA 3JQ7A 4RDCA 3JQ9C 1WXXA 4B3XA 5IHXA 3HJNA 5EQDA 1A04A 3D9QX 2A8YA 1M2NA 1PJSA 1ID8A 3VYRB 2W2KA 4HNAB 1UBTS 1EK6A 1XZNA 2ZTMA 4OFZA 5FD8A 1C9JA 3DA8A 3H18A 1U8AA 2QRVA 3K9QO 1JQ3A 5I3CA 2P77A 2FPOA 2LRHA 1VIYA 4YHBA 1P6XA 1T6BY 1KYYA 1NW7A 1S2LA 4NOLA 3SG0A 2BIFA 3T9BA 3WV5A 1EFVB 2JZOA 5JSZA 3NH6A 1KFEB 3U7EB 1GKUB 4IWYA 4G4SP 2AC7A 1HRDA 3B2EA 5JJLA 2XXAA 2R96A 3AEQB 1M2OB 2H6EA 4MAFA 4HGZA 3SAJA 4I9FA 4EUKA 3K0BA 3EEIA 1Z22A 1NBEA 2Y1GA 3I9V1 3VKFA 1M2EA 4Z4CA 4CIYA 1AURA 5I9SA 4A3SA 2IX3A 1R5JA 1BXGA 2G5PA 2OYSA 3HFRA 3ROZA 4XUDA 2FLVA 3GLVA 1KQNA 2P5YA 2Q6OA 2ZW9A 4WL0A 3RU2A 5M34A 3F6YA 1LPMA 2D4HA 5EXXA 1T34A 2PMCA 1XJCA 3K5IA 1IK4A 1L3BA 1RHKA 1Y8RA 2PFKA 2J0UB 3O47A 1PDVA 4LRXA 5J43A 5HW0A 2R751 2JKVA 4HADA 1L5KA 5A6VA 3IEVA 5I9NA 3KVVA 3R6TA 4HMPA 4P0TA 3BK2A 2ZE6A 2NPFA 2X58A 4PZAA 2ZVJA 3DEFA 5JFTA 2VWGA 5KQMA 2O5RA 2UVPA 3AG6A 2WAMA 3RYCA 2ONCA 3IUQA 2WK1A 1P1BA 2IYUA 3IVMA 3C6MA 4FGZA 4IGFA 3SKYA 4CHGA 4WXEA 5ADUS 5L6LB 3IAM6 2LNDA 3KLMX 1XE3A 2NU9B 2GPBA 5LCXA 3MJRA 1XRSB 1V5IA 3GJ7A 4OQ4A 4P86A 3KWMA 3ZQ4A 4ARZA 2W0MA 1E61A 2YXBA 1OREA 1U6JA 2QLBA 4BO0A 2PCLA 1Q57A 5GIPE 3B3JA 3DV0B 3OJCA 4I4NA 2ZJ7A 3J81k 1F2UA 3A4IA 3V42A 1LSSA 1G3RA 4ND8A 3A31A 4P36A 5FWDA 3T3EA 3AGQA 4K26A 4XWAA 5AM2A 4RENA 3UGKA 1EFAA 1X80A 1JG1A 1I3LA 3NCTA 4WK2B 2YHSA 4Y0AA 1RIFA 2PGIA 1VI2A 1WB5A 2RAVA 4IV5A 2YWGA 1NPTO 4J0IA 2XEDA 4H7IA 4TUYB 2W4IA 4DLBA 5KUTA 2POQX 3TAUA 3C6XA 4HTFB 4ZO4A 5EWJB 1ODSA 3OZFA 4RIIA 3EXFB 1XNJA 2DGDA 3K1TA 1EFRD 1XU9A 3VH1A 5KU7A 3X2EA 1QM5A 3BWXA 4OXNA 3O4HA 4CLOA 2QSJA 1B3BA 5KS2A 1IVYA 1QGED 3ZGZA 2ZE7A 2W2LD 5JZOA 1HGXA 2WVHA 1L4BA 3URMA 3D2LA 4HN2A 3CW8X 1EFDN 1LVUA 2WR8A 4N5NA 4QLOA 1JHZA 2EZ9A 3E9ZA 4P93A 3V3KA 2ZIVB 1OF1A 3MJSA 3ND5A 1E79D 4RVSA 3RQIA 3LKBA 2F3TA 2HD4A 4QQFA 4WQMA 4OK6A 4U0JA 2A7XA 3L4BC 3O84A 4AMBA 2W58A 3FFBA 4PSDA 4HAZA 1YJXA 4TTRA 4UTXA 1LVGA 3GGGA 2DUWA 4X8MA 4HEQA 1R4NB 4BLUA 2XB9A 5JZVA 4LCJA 2BLNA 2XMQA 4PWZA 4YAFA 2HWXA 2QTBA 3U4DA 2OC9A 3BL5A 1UXJA 4Y2JA 4UHKA 3RKSA 2PGLA 5JXJA 3S1AA 2C4KA 3JS5A 4R9RA 1TGYA 2PVPA 4B84A 4WNAA 2I8AA 3GZNB 3JQEA 5F2EA 1OFIA 5K45A 3Q3JB 4OHYA 2QTNA 3UM9A 2DLDA 4PG6A 3UJHA 3ZG6A 5CRIA 5EJEA 4HDOB 3I30X 2NAPA 4ZKDA 4N0PA 1YGPA 1OI2A 2HWKA 1XZLA 2F48A 4TMZA 3S6JA 4ARUA 3RRNA 2B7BA 3CUWA 2AFHA 1U2DC 4W5WA 4ZVMA 2WA2A 3WKCA 4OYRA 2HCRA 3WB9A 5CB4A 5CVDA 1AY0A 2A9PA 3OLWA 3RADC 1DGQA 1JAXA 5KYWA 1DBIA 3NUQA 4JHLA 3H9CA 1PJ2A 1QH8A 3OQVA 4IOMA 4TXNA 2IC5A 2CXQA 1BWRA 2PBFA 3CLVA 2EKBA 1TPZA 3REFA 3VA7A 2JFVA 4QTUB 2R0QC 3IDZA 1IZ7A 3UENA 2Q1UA 4QOIA 2Z56A 3EUFA 1WG8A 2YH2A 2QZPA 4BDTA 3DAHA 5A5VA 3BHMA 4WBNB 1QWOA 2QVXX 1EHIA 1UT5A 2D1RA 4J7XA 4L50A 3RS9A 4GSYA 1P17A 1P0QA 3P9SA 3TMAA 1KYXA 4UOEA 1J1ZA 1XTZA 3WK7A 4E70A 2YNMC 3O8OA 2JGAA 4TMTA 3E5MA 5C7OO 5J4HA 2VTDA 5BNZA 3BRQA 2OUIA 3Q7TA 4F9TA 1OPXA 3LUPA 4INJA 1TRKA 4RD3A 2YJ6A 2D3WA 4GXRA 4BZWA 1E5LA 2WSMA 1MJ5A 1ENPA 1G1MA 2AG8A 2QN9A 2AZTA 1UKBA 3ZCXA 2I8LA 2R5FA 4H4DA 4BN5A 3P0HA 1SG9A 4BP9A 3M4ZA 4PHHA 4AULA 2PXAA 2ZIGA 3HJUA 2PO5A 2ZDQA 3DKIA 4MQFB 1BKSB 4TL9A 1DB3A 3CRQA 5IUNC 3OECA 3EUWA 1FDIA 4D9HA 2WJJA 2X9QA 2PJDA 3B5IA 3OIDA 3EVFA 2RJNA 4KACA 4P22A 4XUEA 5I9BA 3MINA 4HDQB 1ZSVA 1AV6A 1QFJA 3FBTA 3N2NA 3QXSA 4PRYA 4KAXA 3SHWA 3TSZA 3GLIE 3WSTA 3T7JA 5EXEA 1ZD4A 3AY7A 3R0XA 5IJ9B 1XZDA 1EDZA 4QQNA 1YZGA 5LKRA 2P35A 3KL2A 3OFKA 3QU2A 2AUTA 3L1JA 1DO8A 1EP2B 5CM9C 5D86A 3UFBA 4D3XA 1BMQA 2FSVA 3ZHBA 3IHWA 2GKGA 3IT2A 2HJGA 4TMFA 2ZCJA 4Z4EA 3VSCA 3ROTA 4FNMA 1QGZA 1S7CA 1U5AA 1RC1A 4KQGA 3GJ3A 1NXQA 2EX1A 3LUCA 3PEUA 4O1IA 3TXAA 3FSEA 3K6SB 1NZJA 1FUKA 2FEAA 1YR6A 3PPVA 4LV6A 2H9YA 3V8BA 4BFVA 5KWSA 3OTOB 1FPMA 3ZQJA 2I1QA 1JHMA 2OV6A 2XUZA 3PA6A 2VA8A 5A4JA 4OVKA 2FH5B 2Z43A 1TIPA 4MITA 5ESDA 1Q7BA 3P0JA 5FUBA 4BFZA 3BA1A 4HNVA 4BJHB 1ACMA 3H11B 2I9PA 1DFIA 1AQYA 1X9GA 2EKLA 2ONJA 1DEAA 3GFQA 5TMPA 1YRHA 4AMUA 2ZT8A 1GTJ1 1FYDA 3MTBA 5TVKA 2JS7A 1I2AA 3NJRA 5TS3A 4LXXA 1DWQA 4BVJA 4PE5B 4Z9BA 2HJRA 4IVNA 3GLGB 4K9NA 2PSSA 3SYNA 3FM9A 5G41A 4G9EA 2ZUCA 2D0DA 4QGBA 3I12A 2IYWA 4R8MA 1GUZA 1L9XA 3GH1A 5D1HA 3QG5A 4XTRA 1ZJ6A 1EESA 2AOTA 4YI5A 5BV1A 3PNBA 1LLFA 1M2VA 1PL0A 3ND6A 4PTLA 2R00A 4NLLA 1Z35A 3PJGA 2KWIA 4Y6OA 1HFEL 1TA0A 3ZH2A 1JWBB 2AJTA 1ARZA 2VF4X 3R0VA 4K28A 2Z57A 3K96A 2I66A 2ZJBA 2QRZA 5A1TA 3I9MA 3PDIB 2UXBB 4KZPA 4NS1A 5KQLA 4OQMA 4HHEA 4OM8A 1UXHA 2GASA 2J5RA 2HR1A 4KQJA 1KMHB 2VDMB 2PKYX 4BGIA 4X95A 4EHBA 3EAFA 5K0LA 3HCFA 3NDIA 2YCBA 3R8CA 3N2GA 1Z82A 1W88A 1G17A 1YU9A 1ZN7A 2WM3A 3HUUA 3S7ZA 1XLWA 4COKA 3KUUA 3W7BA 1T5SA 5THQA 1Y5LA 3E5HA 1X1DA 4L3VA 3SVTA 1U9IA 4QDOA 4XM1A 4ZO7A 2JBAA 3TUIC 1H2WA 2AEJA 5A3SA 5JYDA 3TSWA 4HAWA 1NXXA 3CINA 3OHPA 4PFKA 4Q3CA 4AF7A 2ID7A 5JDCA 2VYVD 3W9UA 1YJAA 1P2VA 1U0EA 1UZLA 2AEEA 3QU4A 4P32A 4EAQA 4QVIA 1VPEA 2ON6A 1WZIA 5HYVA 2REBA 1KBZA 3C3XA 4RVGA 2ZXUA 4RTNA 2NW6A 4FZJA 3QU5A 4CKCA 2VJQA 3REOA 4HAOA 4B74A 3RANA 2XB2A 2ZIXA 2VNSA 4UE6A 1QHNA 3WS7A 1M0SA 1WM1A 3SC2A 1T2VA 3I39X 3PF8A 1Z6PA 2E21A 1PJ3A 4YMVA 4NJOA 4HUTA 2ZJ0A 1P60A 3WA6A 3RS0A 5J4LA 2NWQA 2R6ZA 3G2HA 4IUCS 5K4HA 4TWIA 3GCZA 3LRTA 4BKPA 1DQZA 2IEIA 3BTUA 1TPYA 2WVAA 2REOA 2Y8EA 4Q7EA 1LX7A 3NC1C 1Z74A 3F71A 5DB4A 5HIIA 1RLIA 2ZQYA 3EA5A 1QR2A 4ZMBA 5F7OA 2JHFA 5CVVA 3UA3A 4MV6A 3ZHXA 1K3TA 5FRDA 5LNK6 1ADFA 1GXSB 1RHQA 3IEIA 4WE3A 5CVJA 1EPUA 1F8UA 3PXBA 5IAGA 4FK8A 1I1OA 5JT1A 4CCWA 1EHCA 1V11A 1XMQB 3HUDA 2K87A 3RBZA 1IN1A 3NORA 3X1WA 1HZZA 1ZMOA 2QDXA 2WOJA 3A8TA 4LJAA 2OXTA 1W4AA 3Q6IA 1FLDA 4OMCA 3QHPA 5C81A 4PHTA 4B48A 1QGOA 4YUVA 4B6GA 2PS9A 1JLSA 3ZI7A 2J08A 2EQ5A 3HVJA 1XZKA 3G6WA 5LL6P 3KBBA 3ZHOA 1QF7A 3VU3A 4QPJC 4R1MA 1V7PC 2OXCA 4E94A 1IXZA 1C7FA 5IBRA 1XZ8A 1UBKS 1X74A 4HP8A 3AHCA 4OMUA 1BXRB 2QMYA 4UD6A 1XXHE 3UWOA 4XR4A 1ZJWA 3E9EA 5FTWA 2CCGA 5EWMB 3DWFA 5DYGA 5JCOA 4ZTZB 2B94A 2EEPA 3DQZA 4UNPA 1LJ8A 1OVMA 4JU8A 5ECDA 1EFTA 2PRJA 4D96A 2IOQA 3N87A 1Y6ZA 4R98A 4B44A 4HFRA 3NGXA 2JHCA 4ZU1X 2GEFA 4D3DA 5M2QA 1K6MA 3UB3A 1PFKA 2GCOA 1RKBA 2IEAA 2H92A 1EK2A 4MUXA 4YV7A 1DELA 1KVQA 5JJ5A 3R40A 4KX3A 2KI5A 2FG6C 3JW8A 5AUPB 2H17A 3FI0A 4BNTA 1N33B 2F1IA 3H05A 4UFPA 1Z3IX 1U3UA 2Q5IA 1GRCA 3V9PA 3GK3A 5KHAA 4WZZA 3DQQA 2BEVB 4N49A 5A71A 1D0SA 2V3WA 5SV2A 1SQ0A 2PWPA 1FYVA 4MR7A 2OT3B 2WJGA 1PV2A 5B5SA 1J9GA 2CMHA 5FTJA 1KQPA 5JQGA 1OZAA 1Y8QA 4JD5A 3PRJA 4HUQA 2F1RA 4B6JA 1NIJA 2O7VA 4HQFA 3TRKA 3OZRA 1W75A 2RGAA 3B13B 4MO9A 2VRWA 1KYQA 1PG2A 1XU7A 2QIPA 4PQRA 2CVFA 5DLEA 3VR2A 4XRGA 4CKZA 1I7DA 2H5IA 4P7KA 3TEFA 4KL8S 3WMWA 5C51B 5L3QA 3AVQA 2XYRA 4U4AA 3VR4H 2P62A 4KQWA 2CDAA 3SJBA 2WP0A 3GRCA 1N5MA 2J07A 5SZKB 2Z6VA 5CT6A 5CDGA 4HPJB 3P26A 2QVLA 2GRAA 2WJ3A 4KQKA 4CM6A 1XEFA 4OHKA 1Z0SA 3FY4A 4HDRA 7ADHA 3RRYA 5DHRA 5AVOA 1C1DA 5T57A 2CUZA 3OZWA 4M3NA 5LSAA 3IPLA 1SM4A 4P4GA 5J4VA 2P67A 2VDWA 1UJCA 3LDHA 3VR0A 4PCUA 4KR0A 3RHZA 3TB6A 3KQKA 5IPFA 1BYIA 1ZCZA 3HDJA 3K8QA 4FBLA 3EXHB 3N2EA 4IDGA 3WMRA 3LAWA 5AW3A 3CJTA 3K09A 5CPBA 5CG2A 2IKSA 1UMDA 4NICA 4BNDB 3E9CA 4YJHB 4Z3OA 2ARKA 4D4KA 1XD2B 3SYKA 2Z5LA 4G97A 1MHPA 1DRVA 2FXIA 1U65A 1X7DA 2P9EA 3R0ZA 3CG0A 3P52A 3RVDA 4RKFA 4CLXA 4MYRA 1YL5A 1SU8A 1ULSA 4DV7B 1OW3B 2VQDA 3T94A 3WGNA 3PWKA 1AKNA 4C30A 4AZ0A 1EXWA 4BMXA 4O5AA 1POXA 3DTVD 1AKQA 5LA6B 2R60A 1QE0A 2J5KA 1KIFA 1FFDA 1E9RA 2FVXA 1Z0UA 1LSOA 3A1VA 3LHDA 3U44A 3W79A 1YVEI 2ZCUA 2CNWA 2YQ5A 3KR0A 4GX1A 4X8OA 1DAEA 1R1DA 3CT6A 4XOIA 1D1TA 3VOBA 4KITB 2BJVA 2I65A 1MOQA 3AI2A 3MB8A 3KETA 2BFPA 4DLUA 1U8TA 1OYWA 3D64A 2E89A 3OPYA 3CIOA 1QLWA 3PE4A 1K0UA 1MEJA 3VKGA 3W8EA 4EUFA 4M6WA 4YB8A 5JSQA 3TQOA 3H6GA 3IOMA 4LCEA 3AVTA 1Z8FA 3NOOA 4YK7A 3A06A 3TQRA 1PZGA 2CV1A 4I3GA 2N3ZA 4DXDA 4O2RA 3ZKAA 1AKMA 1X7GA 3DZBA 3LFUA 1DSSG 4L72A 5B4TA 2AF3C 1UBJS 2G8LA 3DZJA 2ECOA 3GMSA 4P8RA 3ZH9B 4EO9A 1W1WA 1Z56C 1N5KA 5AW8A 2YUTA 5JI2E 1FDOA 4GX2A 4A0GA 4S1WA 3R6DA 4F96A 1YB5A 1FSFA 1W2WB 2IU6A 3DEHA 4ZOEA 4PBRA 4RBNA 4ACBA 4LHVA 1MX3A 2Q4DA 2VHVA 1XRLA 2PVCA 3WHPA 2IEZA 2FMKA 2PRIA 3OO0A 4RZXA 5REQB 3W2IA 1GTVA 1VPLA 4P7FA 2V9ZA 3DMTA 3HXLA 2IXDA 2RC6A 3PZBA 3K0EA 1JHQA 3LDAA 1RQPA 2R6AA 3C4QA 3RSSA 2ECFA 5B6JA 5CA0B 2WF7A 2OECA 3HUFA 4TV8A 1A9SA 2D5CA 2KE5A 3JQCA 1FFSA 1VGVA 1SC3A 3RC1A 3QLUA 2R4UA 2I78A 5K3DA 2BFNA 3NNDA 5GM2A 4C14A 1RXSA 3AEZA 2X0FA 4GOJA 3GPLA 4F9EA 3IQWA 3WGUA 4DBVO 4WVLA 3G0BA 4QDZA 3B6ZA 3DTNA 1GPAA 3CKMA 3U3RA 5LLTA 3KSZO 3NPAA 1KS2A 1SKYB 2PJUA 1LC0A 4Q4HB 1GZ7A 2V58A 3DT9A 1YDMA 3CVYA 4KP7A 2UYHA 2CLDX 4MWCA 5AKKA 1RI5A 2ZUUA 4K8OA 3PLAE 1M6HA 3ZD9A 2J0QA 1MO6A 3BF8A 4DBZA 1RRVA 3WQSB 3J7TA 4M1YA 3VNBA 2A3RA 2FMIA 3MYRA 3L06A 1OOEA 2DP4E 3P4YA 1CHDA 3W3AD 3RCBA 4A6DA 4C6HA 3P9XA 4I50F 4LKRA 1FXSA 1TKBA 1E2KA 1U8ZA 3B5JA 3HXKA 1JMYA 1LBTA 4QFMA 1KDYA 1BE8A 4KH1A 1C7IA 5D2CA 4BNIA 4YRSA 3M3HA 4J43A 1FP6A 1XQVA 2ANBA 4IUBS 1SA0A 3R3XA 1XCLA 2VSFA 3P9PA 2NZJA 3OIVA 5HBGA 3A2KA 4QOHA 5C8YA 2QTCA 1SBZA 3AUYA 3N76A 1TT5B 4JOSA 3ZY2A 5JXWA 4R5MA 4CR7A 1Z37A 4BO4A 5J4KA 4BNYA 3UKOA 1EDOA 1IZZA 1UK7A 1XTTA 2VOJA 3W5JA 2NVWA 1F20A 1DZIA 2Q5QA 4LRTB 1N7GA 3D4LA 4IIXA 3WDLA 1ZO8A 4EELA 3AL3A 3EFOB 4EECA 1A97A 1XEWX 3B6IA 5C1OA 2ZSBA 2J4FA 3MM4A 4CKXA 4H77A 4U63A 8OHMA 1R64A 1RXEA 4AJOA 5I7WA 2IS1A 1D4OA 4A16A 621PA 4RWZA 2BFOA 5AI6A 1Z0KA 4DABA 3N3AC 2HIAA 3BIJA 4ZV9A 5LP6F 3ZZUA 1Y7LA 721PA 3EIXA 4AY4A 3NBKA 3QIVA 4TRNA 4ZP1A 3UJ7A 1MH9A 1TNDA 4WLNA 4C05A 4D9NA 2W22A 3WQHA 1CR6A 1J0EA 1NR7A 2OC4A 2HKIA 3E18A 3R1IA 4FR5A 3ETEA 3MIIA 5GGYA 4LIPD 5IFLA 1E63A 1LBSA 2QN8A 3M1LA 4WVFA 5E2BA 4CL3A 5DPMA 2OQ2A 3KZOA 2EZUA 2NZ8A 5LLDA 1T2UA 3LL4A 1QRDA 3P8ZA 4ARAA 1HQDA 4U7FA 4Q39A 3QUSA 5AKZA 4UDXX 3P9QA 4UXHA 5FL7D 1F6WA 2RHCA 3UHJA 5EMJA 1KBQA 4QZVA 3DBOB 3UUEA 4UTRA 4K3UA 1VKNA 1K2WA 1P8JA 4MWZA 3UT5B 4UU7A 2UXCB 4WZAB 4KBYA 3WIBA 5CIQA 1AGNA 1OXKB 1R0YA 3A36A 4LXQA 3RU3A 1HE2A 4Z1MA 2ZJ3A 1IY8A 2JKZA 4Q93A 3BCUA 3FROA 1KIMA 1NATA 3B9QA 1M72A 5G1NA 2DHCA 2NO4A 4U6NA 1B76A 4RY2A 1G0OA 1W7AA 2V6BA 3RRXA 4R1SA 4V0RA 2D54A 3UAZA 1Y3FE 3FPKA 3PUJA 1UZNA 4C87A 4CM8A 2FUCA 2YJTD 1ZCAA 4X90A 3ECAA 5E0OA 1XYVA 4OHVA 5JY1A 2XXJA 3C70A 2RGRA 1E2QA 2BMDA 1XZMA 4L8LA 1V5EA 5K0GA 4UAJA 5C2JB 1QVWA 2QRGA 3I76A 4JSTA 4NFLA 2CXUA 3USES 5HOQA 5LMCA 2WG1A 5GPBA 1I2DA 2VHWA 1J2UA 5ALHA 4GXQA 5DTJA 4F3KA 1RRCA 5C52B 4AJPA 2XWPA 3DBHA 4EO7A 2Q27A 2DFDA 3WI7A 1QV7A 2BZGA 2IA5A 4PQYA 1Z5WA 2HA5A 3QFTA 2Q4OA 4LRSB 3C48A 3PLRA 3T3DA 4AJLA 1B7GO 4K81B 2CNBA 3GP3A 4A8JC 1E6MA 1ZJ4A 1Z4PX 4V0QA 5HX7A 2O0KA 4YFVA 3GL9A 1H2HA 2LBPA 4F3RA 4C7BA 2DEUA 3BRWA 4EJ0A 4GEGA 3HRIA 1IYZA 4I4TF 5FLEX 3UOWA 4DA0A 4JBXA 2XDYA 4DCTA 4WCDA 1YH3A 4OXIA 3NHFA 1SHZA 4FMDF 4D0SA 2ZJ6A 3QLVA 4GOXA 4J3FA 4FLEA 2H2DA 4NBUA 4PZEA 1L7MA 1OQAA 4Q1VA 1HDGO 1YI0A 1RRMA 3B9PA 3RIYA 5J2TF 3AMVA 4MKHA 5K8JB 3TTYA 4HB2A 2VSQA 3NAMA 5T3UA 1EUYA 4AZ3B 3L07A 4KQ2A 5HS6A 1JR3A 1CEXA 2OCXA 3EQ6A 1X87A 3AKEA 3VU9A 4GGOA 3V7YA 2WJWA 3G1WA 1OXMA 2DWUA 2WYHA 2W6IA 2UV8A 2DR0A 3E84A 4G89A 3A9TA 1RMTA 4IIJB 4IS2A 5JE8A 4BFCA 4D6YA 2BHLA 1GUBA 2DBQA 1KS9A 1XK6A 4HNQA 5GJBA 4RGVA 4ZVUA 3P9NA 2C3UA 3TRIA 4NZMA 4QVKA 1A0OA 2ZB2A 1TM2A 4PGHA 5IJXA 4JQYA 4A0HA 4BEVA 1WPRA 2XGOA 3BXOA 3F8SA 1JZQA 1OU0A 4W8HA 2HWUA 3WBKA 2X1LA 4DCCA 5CVTA 3EXG2 3JATA 1YMQA 4BQOA 2Q3EA 3ZLBA 3PB3A 4YMTA 3DFUA 4D3FA 1NFQA 4RGBA 1CJVC 4Z8XA 2CFSA 3OQ1A 4KDRA 5EMHA 3N70A 1ONPA 4DYDA 1N57A 4PZ9A 5K4AA 1DWOA 3VOTA 1MO4A 3PNMA 3UPDA 2IUFA 4ZOCA 5JBIA 1WKBA 3O4VA 3IX7A 4WKGA 3VISA 3ZWQA 3PPXA 1P1FA 4J16C 1GAEO 3KUXA 4MS3A 3EVEA 1A9XB 5CB8A 2I4NA 4GZMA 1NU6A 2JEZA 3PGKA 1DAGA 4QBGB 1J99A 2VJBA 3RVPA 1Z26A 4B5LA 4CM1A 2R5NA 1L5FA 2ZE5A 3CNBA 3K94A 4NZZA 3WP1B 1WSDA 3ZEAA 3GIDA 4IIYA 2AMYA 5TARA 5KINB 3LJKA 1WCIA 1A7JA 2P4HX 4G0NA 221PA 2QRUA 2LD4A 2KBEA 3JVDA 4PCAA 3BTVA 4C78A 5HXAA 2FRVA 4NCIA 3PJRA 2PDAA 1LLDA 2HJHA 1P19A 3LGXA 5FADA 2Z1DA 3ONWA 1OLOA 1T1JA 4PR0A 2PANA 3VZRA 1XT6A 1GRNA 1OTHA 3C97A 3M83A 4IX1A 4JBWA 4QPDA 4ZO8A 5T67A 3NQ41 4M8IA 1JLLB 5E8RA 2VQ3A 1XJ0A 4DM3A 2IBTA 4KN6A 4WCFB 3B7WA 5SZIA 4IZOA 3AETB 3LVRE 4KDEA 5C18A 2KW5A 3B36A 3CA8A 4JL6A 5AOAA 3PXEA 4BGVA 6ABPA 1SO8A 1C9DB 3EIWA 1PW7A 1ESEA 3BIOA 3K0FB 4J3JA 4NYIQ 3VO8A 1TCVA 2C7GA 2GZDA 5EP2A 5DBFA 4A4DA 3TPZA 4OQFA 3KSBC 3G5MA 3FJYA 5ITZA 2AG5A 2PY6A 3P2MA 3UT0A 3WXMA 4RFVA 4E6PA 2QRLA 5ABPA 4WKNA 3TDNA 2W83A 1QPBA 1E96A 3NHBA 4A1FA 5JVDF 4DV4B 1T6ZA 4DNPA 4F5WA 4DB4A 5JLJA 5EWLB 4UCFA 1DRJA 1EVJA 3H8WA 4F60A 1WZCA 3AFNA 3G2OA 4MVJF 3T1VA 2Q3MA 1DJPA 1NRIA 3DT8A 1HLPA 1QH1B 4F91B 2CDNA 3WLLA 1CUEA 1NWHA 5FDFA 5BV0A 5CD1A 1B93A 4EL5A 1T4MA 1XQXA 1AIPA 1FOEB 2PLAA 4XVHA 4CEHA 1W47A 3E27A 1QHXA 5DNYB 2ZRJA 3OLYA 4HLUC 3AOEC 2ZB8A 2UKDA 2WFZA 3MJCA 1US8A 3BJIC 3P0RA 4F1JA 4I46A 1D2GA 2ZJOA 4TXMA 6LDHA 3PNSA 3TMKA 4E51A 1QNFA 2QT9A 3AVVA 3FH0A 4JBIA 3Q8MA 1P3DA 1IAVA 3IH5A 3UQZA 3PG5A 4ZOLB 2WJ4A 1IY1A 3VAYA 3PNVA 3DOUA 4MW5A 4XFJA 3FZQA 5DASA 3GYGA 1X7WB 1SHUX 4J4BA 1ZWLA 1UPFA 5A1JA 2E87A 1T0PA 1YE3A 1WA5A 3T9DA 1Z5PA 1ODFA 1TO1E 2WD8A 1AO0A 1VCHA 4HDMA 3U19A 1YOVA 4HAVA 5BY2A 4AYWA 1EUCB 3TRJA 3T1NA 3DOIA 1FX0A 1DUSA 5AKGA 4RTKA 3ZVNA 1JG4A 2IGBA 2MSKA 4M7PA 5IVDA 4IJWA 4CMKA 4EP1A 5E0KB 4NBTA 5DNUA 4Q6BA 2XCIA 1P5FA 5ER9A 3L05A 1SCQA 3ZNOA 2ZRIA 5E7JA 1JDJA 5KVSA 2VR1A 3OESA 3JD1A 1UDCA 3OWXA 4XWGA 4HEJA 3D1JA 4JEUA 1OH7A 2JAPA 2IEYA 2VSNA 4PIPA 3LKVA 3SN6A 3WB2A 1W94A 3HCPA 1LQTA 4O4HF 3TTUA 3IB3A 4DM4A 2IVFA 1VJCA 3KC2A 4K0RA 1JHDA 2VDPB 4KI0A 4MKXA 4MULA 4BE7B 3SC4A 1WCYA 2A4KA 2VTKA 5HQ3B 4E0BA 1SC9A 1UC9A 3E61A 3T5PA 4M4SA 3ZOZA 1R6BX 3DBLB 5DXAA 2FQWA 2GPJA 5GJWC 2Y68A 1JHXA 1MRNA 4W1PA 1E5DA 2UZAA 3GBSA 3I9V6 3KWJA 4XQEA 4C4SA 3EBOA 3PPWA 1FA9A 4G4SO 4JBLA 4BV3A 4D9EA 2M9MA 5AW2A 2WJAA 1F60A 2JD2A 1OFGA 2OGSA 3DXYA 2C78A 1UZAA 3O3NB 5G1OA 2G4VA 3F6BX 4WY2A 3USCS 2I22A 2ZDGA 5HKOA 1JXMA 4RTMA 4I1RA 1A96A 4FX5A 5FOWA 3LC7O 1FMFA 3BULA 4BATA 1EUQA 1CU1A 2FEKA 2Z95A 2P3SA 4YQYA 3ZGVA 4BE4A 1NVMB 1F8YA 4ZVSA 4B80A 2QMEA 2C0PA 1KYTA 3HGMA 3GARA 2CV0A 4M54A 4GD3Q 3NIWA 5KTTA 3WYDA 1NXPA 1V26A 4KWTA 1IVSA 2OZPA 4ZRMA 4YA6A 1O1YA 1O96B 4KXNA 1HMYA 2O07A 4ZVQA 1GZVA 4R8LA 2QBYB 4BO3A 2B2NA 3SHTA 3A4MA 3FCCA 3FDIA 3GLHA 3LPAA 3OD5A 4CIVA 3AL2A 2HO5A 4I7EA 3WLTA 3E9DA 3NEJA 4BASA 3L0CA 3IELA 3H5OA 3HN7A 3AR8A 3TZHA 4PLFA 1GDDA 4PLWA 4DDKA 4LHXA 1YDHA 1BEEA 1N78A 1XQYA 3FD8A 5BVGA 1U81A 3VYTB 1JBEA 8ADHA 5KAPA 2UZ1B 1X8XA 2HH9A 2JFNA 3F74A 4TLAA 4A8HA 2CL5A 1HX7A 1DKNA 1JEJA 3F2IA 4CXMA 1XMJA 1GCIA 1DARA 4OP1A 1U0FA 3AI3A 1QSGA 1R74A 2H4WA 4MGHA 4XX0B 2OPBA 3BWEA 3IC5A 1NLZA 4MJLA 4RQTA 3VZCA 2WSIA 5EKTA 2IJGX 4L02A 2XYQA 1BCSB 2Z58A 3PJEA 3CF4A 4EHKA 2B1JA 4BKMA 4IS3A 3NXSA 4YCMA 3LOUA 1W4CA 3TLGA 3A4TA 2CD7A 1ZA1A 1E9EA 3GFBA 2OCPA 1MXFA 2QXYA 4KIJA 1FP2A 3ADOA 1BEUB 4GS5A 4CQNA 1P2UA 4FEYA 1KI3A 1OZFA 3MGAA 1XK7A 4A27A 2GEUA 4ZMSA 4K88A 1D1PA 3K92A 4GBGA 1R0CA 1EAMA 1O3YA 1R4ZA 2GFQA 2XUFA 5ANRB 1TKCA 4LSMA 5GWXA 2CJXA 4TMKA 5CTAA 5C31A 1WDTA 4EPVA 1SKYE 3D8UA 2WABA 5E95A 4URWR 1I6KA 1IXYA 3PHIA 4I36A 2AJBA 2BFFA 2A9RA 5AVVA 1N2CB 3BXZA 5IC5A 4KYVA 3RJTA 2CB0A 2DBVO 3EZNA 2W8BA 5DWQA 4EG1A 1DTSA 3UGTA 1J8MF 3OKFA 4XH9B 5C53B 1KQOA 1Z39A 4GHWA 4MUMA 4DIKA 1BJTA 3DFMA 2VFAA 4OHWA 1U28A 3ENVA 1PTJA 4QWWA 5DP2A 1NWCA 1TIKA 2C94A 2BFBB 3FOWA 1CY1A 3JASB 1T2NA 1I3NA 3QVLA 1O6BA 3KQLA 2LP4Y 3BXGA 3ZKWA 2QN1A 2XCUA 1ZGHA 2FV8A 3OFNA 5CLLA 4WOBA 5LB2A 1PK7A 3MW8A 3JWPA 5TS2A 4OU5A 1K75A 3ZIDA 5E6UB 1YZ3A 3BMNB 3A9WA 3CTMA 4ERXA 5L4NA 1C7RA 5KSOA 2X1HA 1YQUA 3FDXA 3OTWA 3QUTA 5LXTA 3KWLA 2PJRA 4R8RA 3V97A 3SBXA 3AF6A 3ROMA 1E1MA 4EY4A 5JRDS 4DRXA 1VRVA 3DCNA 2GNAA 4J91A 4AO8A 5DTEA 4XJVA 3CUKA 3N75A 5CCDA 4W99A 2VZLA 4TN1A 3PE3A 2XE7A 1YS4A 2X6TA 3K1ZA 3DLAA 3NX4A 3PNYA 5L3ZA 3SF8A 3SZUA 5F9FA 2O2ZA 4C0QC 1QK5A 4J8PA 1QRSA 1KI9A 1THMA 1K5PA 4DQXA 1ZMRA 3W77A 4ND6A 3UJDA 1CZHA 2AA3A 3LY8A 4FONA 4GVPA 1RMQA 4LE2A 3CUTA 1RM3A 2OVFA 2C0QA 1XLVA 1TLLA 4NKRA 5GV8A 4NBNA 5HIJA 3TZKA 3QKWA 3U2QA 3IHKA 1YVPA 1OZHA 4Q00A 4C5BA 3UMMA 3IBYA 3E1GA 1XVLA 5AKJA 4QPZA 1YQDA 3KQWA 1UP4A 3FI9A 1AB6A 1JTEA 3IOCA 2L18A 1QCDA 1RP1A 3MPUA 5E9JA 4J2TA 3H2ZA 4R31A 4DCNA 5JAPA 4MRSA 1SCAA 2PYIA 4NTZA 1BW9A 1FTQA 1USUA 5IDQA 4W5OA 1Y3DE 3GUYA 4X24A 2EG5A 4EBFA 2II6A 3SZ3A 1P7CA 1OFHA 3QMVA 1QK3A 3DW3X 1FTNA 3CEPB 4RSMA 5H0IA 4F3NA 3U39A 2RGNA 1U0TA 3M1IA 5HGJA 4FOOA 4HNRA 3PC7A 1W2GA 4IEFB 4ZK6A 3CLSD 1ZWKA 4BTLA 1FF9A 1H8HD 4TMWA 3NM6B 2AMFA 3R7BA 1MN6A 3LRXA 4WJLA 5LDHA 3W5SA 1GT6A 4CTNA 1FDUA 1QYXA 5B3JC 3MMZA 2RHLA 2W6ZA 2JFHA 3LPMA 2MYTA 2BN4A 1ZM4A 4CQMB 1S89A 2MR6A 3ONFA 1VYTA 2V7EA 3AI7A 1PJ8A 3I6BA 2IIBA 1R0BA 2F43B 1M54A 5F98A 2WAOA 2X8WA 2Z9CA 4FYYA 1EFRA 4DT1A 4L0CA 6CHYA 5EXSA 3FGPA 4ZAVA 4NZOA 3U6KA 2CHUA 1IU9A 4F1WA 1XYYA 1YKSA 2JHAA 2G5CA 3LH5A 3DEJA 3HU5A 3O3CA 2H1RA 4UU1A 3TZQA 2OP1A 1DAOA 4M0PA 4B45A 4AZVA 3JWHA 2WHQA 5G1PA 5LMUB 3NFYA 1LCIA 2HUNA 1M67A 4EPWA 1HURA 1CWUA 3FPLA 5T8KC 3KQNA 1E79A 4QYTA 4DUGA 1SPBS 2QX8A 5E6SA 3AI1A 3I01M 3K5WA 3INGA 4DNQA 3DFKA 3M9WA 1NYRA 3LP5A 3N0XA 2QP9X 1T36B 3GFFA 1Y3BE 1UANA 1T3HA 3GA0A 2PGXA 4TQ9A 3NTQA 1KIAA 3DEKA 4WK6A 1XQ1A 2WUEA 3V4VB 1KJ8A 2XT6A 5A6SA 3BBPA 5ITWA 2ZSHA 2OD9A 1PUXA 1J1UA 1EYZA 1PQPA 2FE4A 3N6VA 4LY0A 1XP5A 3BHIA 2BEJA 3ZPXA 5JYCA 4RVUA 1UEJA 1UXKA 3OOSA 3L4JA 2N0SA 3UOGA 1JECA 1PSDA 3ETCA 3FWYA 3SHVA 1II0A 2XXBA 3LHFA 5BV2P 2AJ8A 5AOBA 4AB1A 3LQYA 2VAPA 4FZVA 5IKEA 2AW5A 3UBMA 3PX3A 4RTSA 2D7JA 1Z75A 1G4UR 1A8SA 3D2CA 3N8DA 3NBMA 1YCDA 3ZJVA 4RH0A 3PQFA 1MJHA 4AYTA 3ABOB 1MEEA 2RCNA 3C3WA 3GN2A 3N7AA 2Y0EA 1FXWA 3HLTA 4GR9A 2VJYA 1CDDA 4ND3A 1WUKS 3H2HA 5SYMA 3BMOA 2QTAA 3RVKA 3BZUA 4F21A 4F2GA 5EJ8A 2IF2A 1BS9A 4KFRA 5BXQC 2J3LA 3BRSA 3GD5A 4DV3B 1EK1A 1KPGA 1LZKA 1UWKA 2O7RA 4BZZA 3KKOA 3QSGA 2F8TA 1CEQA 5E2AA 5LQSA 4JA2A 2J09A 2B5OA 2WHPB 4TVOA 5BUSA 3UJPA 1GZ6A 1ZFNA 4KSCA 1T0HB 1NI5A 4X6XA 3RUHA 4FKMA 4ZVNA 5C5IA 3HXQA 3ICEA 2JIZD 1D8AA 3FXAA 1R0SA 2Z9BA 3GQBB 3MAGA 2WMDA 3FIJA 1N8TA 3DP7A 4Y30A 4CG2A 4ZHQA 1WS6A 4PLTA 3VVMA 4DLXA 1J2YA 4YNBA 3LI2A 4P3PA 1V8ZA 3OA0A 3EGDB 1QIJA 4FCCA 1OH8A 1ZC4A 2AR0A 5CYOA 4R84A 1JA9A 1Q92A 2TMKA 4ZODA 3VDRA 4LGCA 1NHGA 1GA1A 1U9ZA 4ED9A 4J1SA 3OPNA 3IURA 1YIDA 1P4AA 5LZ2A 2DE0X 1KAEA 4C0KA 2IUSA 4PLVA 1JFFB 1KE1A 1Y6GA 1H23A 1HYQA 1Z0IA 4I3FA 4PAGA 1B8OA 3WL3A 1NAHA 4DKJA 3PUVA 4HAYA 5IJAA 2P2YA 5EJ2A 5IF3A 1R2QA 3SEAA 1QHHA 1ZA2A 1NVAA 1L7EA 3U3JA 1N2JA 1NBOA 4TKUB 5ALTA 4GMKA 4IYJA 3SMQA 2JD0A 4CKEA 3IUNA 3U7JA 1JDPA 3A3NA 1U6KA 4LWQA 4M7RA 4KXUA 5HDQA 2GXAA 3H8SA 1IM8A 3HGQA 3I2JA 1PYGA 1T8YA 2EX0A 2VG8A 3DOCA 4NATA 4HDNB 1FNMA 2P9BA 4Z0TA 3S2FA 2KS6A 1T9BA 1XVIA 1WUHS 1HY3A 1Z68A 3H9GA 3KU4A 2JI8A 1P7WA 3AESB 2HSDA 1CUBA 1OR8A 4L76A 3E15A 4NONA 5K99A 4ZYUA 4ITUA 3OETA 1KSGA 3SVZA 1SZJG 1CR4A 3VAAA 4GM0A 3ZOKA 1OLUB 6YASA 2F55A 3C74A 3HSKA 4RS3A 7GPBA 3GBVA 3ICPA 3KXIA 2G4CA 2G71A 4B8WA 1D2HA 3BE6A 5DLDA 2FJ0A 5HEKA 1CQJA 1K6XA 1QJCA 2CVZA 1EJ0A 1Q77A 2Y71A 4BLQA 1C7QA 1U04A 2OBLA 3AR4A 1Y9AA 1N5IA 5ER6A 4EYSA 1RWKA 1DEXA 4BN4A 1OTXA 3D7RA 3DDUA 4LPSA 1XAHA 1S01A 2ZYUX 3ZWPA 2V59A 1RADA 2PMFA 4D9FA 3EEBA 1C0KA 1F5SA 3F67A 3PPIA 2G82A 4OLHA 4XUCA 5E2IA 4YJFB 3IAHA 4B6EA 4L74A 3C2QA 2MSCB 3Q8XB 1CJCA 1WCWA 4RUKA 1S3SA 5EE3A 2ZUTA 2VPWA 3V2UA 5CVUA 3V80A 5HQTA 2J5BA 4LF5B 3AVXA 3VKHA 2D2IA 3OSZA 3D5EA 3I72A 4EJSB 3PITA 4Y1RA 2PYZA 2GO7A 2XE6A 2QG6A 4JUCA 4F45A 4KN9S 3F98A 4KYUA 4R83A 4Q3NA 4BB9A 1RABA 2FEMA 3ETHA 5EYPB 1K27A 2C8JA 1C30B 2QS9A 4Y2XA 5JNVA 4DS3A 3THOA 4ER3A 1XDZA 1GQFA 1VBMA 5E9QA 4KMMA 3BXXA 2CVQA 5FWYA 2DWCA 2V6MA 3KLBA 4G0ZA 4O4JF 4Q9DA 3AP3A 5U4QA 1SVSA 3F5FA 1EE1A 2C2WA 2JCXA 1UWLA 3CZAA 4QJ5A 2BFDA 1ZUD1 5IJWA 1LPPA 2I0FA 1HI9A 3Q7RA 3D3WA 1UF9A 3HFGA 2X19A 3B3AA 5H9VA 4D99A 5DE3A 1BD3A 3FCSB 1KO5A 2E5FA 1TVMA 4NYMQ 1U9CA 2E4WA 4DLWA 1WU8A 4BMVA 4IQ8A 5CAEB 2AGVA 4UUBA 5GZ1A 5IM4A 3HBLA 4F2HA 1ONNA 3SS7X 1TJ3A 1R0WA 2WTUA 5E1BA 1DIGA 5EJFA 1SXJD 1XEXA 1D4FA 2PJZA 3MPOA 2BFEA 3EEFA 4REQA 3Q6MA 2OR3A 1SY7A 1V16B 1G60A 3E3AA 3JAMA 3D4NA 3EMKA 1RQNA 4II2A 4CFYA 1E60A 3VH2A 2ZB7A 1NOKA 1M2KA 4GI5A 4QUBA 4HXFB 1HK7A 2B7LA 2PT9A 3LLUA 4CETA 3E3OA 3NM4A 4Y1GA 4HN9A 1T3SA 1YL7A 2XE8A 3EDOA 3ETLA 3N2IA 2ADFA 3LFTA 4DMHA 4V03A 5K0ZA 1W87A 2G77B 2ZRFA 4JFAA 4QNRA 4RU1A 1QYWA 5FIUA 5AYVA 4KMOA 1I3KA 4ZIRB 4EK9A 3JWEA 4MWGA 5JUWA 4P84A 4WTOA 1RWOA 1B6RA 4GVLA 4OQDA 4HFMA 4DARA 4G8CA 3A7EA 3AERB 2K5UA 4RZIA 1UPBA 3HGTA 4LNAA 5J23A 3SQXA 4ZAXA 1QQ5A 1FNCA 1T10A 1WZUA 2ECKA 1A88A 4MUYA 3GCDA 3GOHA 5F33A 3K4QA 3G3EA 3A3YA 2MYPA 4Y6RA 4CF7A 1Z25A 3QGMA 4AIRA 5LYJF 1CQIA 4G8JA 5JIBA 2XWSA 1KEEA 4M9ZA 1ISGA 1CDOA 3H9JA 4HI0E 5K8IA 3JQPA 5NULA 4AECA 2R8BA 4Q3AA 2QVYX 3D7KA 3OQMA 1SHKA 5AK5A 4DV1B 4YIKA 4F3CA 3FTPA 1NBAA 1ZNYA 3K0AB 2JK1A 3WICA 1AE1A 5NLLA 3C14C 1WHSA 3AIIA 4ZEOA 3HU3A 1TQHA 1REQB 2EFGA 3AHHA 3N2YA 4FFDA 1Q84A 1UJBA 2O8FB 1YQ9A 1D1QA 1XZAA 3TGPA 1X9HA 3RVJA 2OBFA 1Z0JA 2RK4A 2VP6A 1VSVA 3MHPA 3Q7QA 1D1SA 5E7QA 6PFKA 1PT8A 1MOSA 1J8YF 3NAQA 3S2YA 3I2YX 4PAQA 3RE1A 3LUHA 2B34A 3SLRA 1EDBA 4TLCA 1VYUA 1THZA 4C7JA 4MAAA 4KR6A 1PVOA 5LZ4A 1VE6A 2EF1A 2I1WA 3Q0EA 4JC0A 4Z3DA 5FV4A 4CQLB 4FHEA 1E4EA 2O4CA 5DYTA 1FNSA 3GRFA 4ESHA 3P9KA 3UXMA 3PWSA 1V96A 2WKRA 4AD8A 4IXNA 2DT8A 4WERA 2MJLA 4C04A 4EABA 1WOMA 4D1YA 4U02A 2NN3C 3AHFA 3EZGA 4KUGA 3KK0A 5ALFA 2GJSA 3SKVA 3G8AA 5BV7A 3H6HA 1NYTA 3I01A 5LD2C 3Q98A 1FLAA 3HVKA 4LX0A 1N2CE 1CR2A 1JHVA 3CNEA 3IAAA 6GPBA 1KEPA 3DMYA 4N0DA 5E4FA 1D4ZA 2XUJA 1ZVVA 1YJCA 2ZUSA 4R05A 5KMGA 3E7WA 1NVVR 5FBLB 3K5HA 1ZH6A 3SR0A 4FHCA 2X22A 1GUYA 2JH8A 1L7PA 5KTNA 1ZN2A 1VB3A 2O8EA 5KVQA 3FZNA 3OLXA 3AVUA 1E1RA 1AUQA 1EX1A 4O29A 4D0NA 5I01A 3ESQA 4PC1A 1J0XO 4E21A 1XDWA 3VPFA 4RJJA 2MDTA 3MMPA 2ZITA 1W5BA 1P1JA 3CEAA 3ASYA 2R6R1 4OO3A 4P2BA 4I9NA 2FZGA 3ZLJA 2C5AA 2WNHA 4RF4A 5JRJA 3OU7A 1BVYF 2A0KA 1KXJA 3CUSA 3HFSA 5KOHB 1JA1A 1M8JA 4K1XA 2NYRA 2ZATA 3T7IA 3EGVA 2R8RA 3FYSA 1M0EA 1GTZA 5EE1A 1RZRD 2PRKA 3RUEA 4BRUA 2PYDA 4BNHA 3SWWA 3AEUA 1F8XA 2FZ4A 4X85A 1NLYA 5TPZD 3H3XA 3ONNA 2AQHA 5JWRA 1PR9A 2RGEA 4Q18A 4JI4B 5DIZA 1SQFA 4OK3A 3BS4A 3D3QA 1WZ2A 4LC1A 4MUIA 2EWMA 3LHKA 5B2EA 2WTEA 3ET4A 3CVWA 1XA0A 2D8MA 3DC2A 3D8HA 5ICMA 3EWNA 3K6KA 4Y2HA 4C5CA 3JQRA 4RNCA 3MRVA 3AUXA 2VTBA 1YO6A 3UWMA 1Z2AA 2REQA 4DVJA 3OD1A 5I3ZA 4KEAA 3BTOA 5IASA 4YYZA 3LECA 2B4RO 2PD3A 4RD2A 1XZFA 1ZGZA 4JWKA 4RTOA 1XVUA 4F6RA 1NYLA 1WE2A 3O1HB 4QNNA 1PL6A 3QP9A 1IEXA 3QKIA 4LY3A 4XWKA 1GG5A 3KTAB 1O54A 1W85A 1DC6A 1XCPA 1IZ9A 3BDIA 3W8RA 4BS9A 3KR2A 2X0JA 1MB2A 2EATA 3IKJA 2JANA 3D1VA 1EB9A 1ILWA 2I1LA 5JD6A 3ZLUA 1EKXA 1MBZA 4C29A 2BJHA 3FVTA 3RI3A 1I2BA 1NDUA 2CZQA 2ORYA 3DE3X 4BXOA 3S2SA 3UVEA 3C6BA 3GT7A 4J0CA 5A3JA 1SD5A 3MWGA 3DLPX 1FJXA 2YOHA 1KEZA 3MSXA 4HS9A 1T1RA 4MIKA 3LCJA 4OXKA 3ZHCA 4UNNA 3GPCA 1AKYA 4NP6A 4GKAA 2X8LA 4CMEC 1XU4A 1CJSA 1BTOA 1GCUA 3WKDA 3WRYA 1TM3E 4DAOA 5M04A 2QGNA 4QHTA 3OHMA 1H0RA 4QVGA 5ESWA 3VVLA 1UXOA 2FUKA 2NV0A 4GPBA 3AF3A 2FX2A 1RWXA 3TXYA 3R41A 2IVZA 4NCKA 4ZAYA 1XRPA 3CLSC 3QF4B 1K8XB 5AVYA 1J5XA 1I80A 2X9GA 4BQRA 2ZT5A 4I4TB 1Z7GA 1IULA 2QNIA 2XMSA 1Q19A 2FK7A 2H9IA 1IHDA 1WUYA 1TVEA 2AFIA 2VJLA 1S6YA 3JARA 4BVHA 1UP7A 5F9MA 3QM1A 3OHSX 4FMDB 4Q66C 1DTEA 1QKIA 1BGVA 4XM2A 3BORA 3IR6A 4HT3B 2Q8PA 5IZCA 2LW7A 2Y27A 3LA8A 3MS4A 3EXIA 1B1CA 3D6FA 3H1FA 1NVEA 2N1BA 2VJCA 3MTGA 3WNCA 4IH1A 2V5AA 1JU3A 4OBBA 3RSFA 4B33A 5J2TB 3T35A 4C89A 2F1KA 1FU8A 4BJ6A 1XMIA 2YBDA 2IU3A 5KKNB 3WP0A 1PWZA 3LQQA 4RTPA 1VJGA 2PUBA 4S35A 4MS1B 1E7RA 1ES9A 1QJ4A 4J0GA 1QAMA 3GDOA 4F1KA 3SF0A 2OGTA 3TSCA 1IDN1 5FLXA 4OGLA 5HJ5A 4WUTA 4QWMA 1EP1B 4CLDA 4BQFA 4UU8A 3QX3A 1U99A 2XTMA 4PZ0A 4RJTA 3KYCA 1Y1TA 1RQGA 5LU9A 3RSHA 2OWEA 2R1ZA 3L46A 4MRPA 3ZE9A 5AJWA 4BQIA 4E32A 2N1MA 4PXYA 4BX9A 1T2EA 2QLMA 2V74B 2WMYA 4HGRA 5KOJA 2KLBA 3G2MA 4G1EB 4RV9A 2VQFB 1YI1A 5E6RB 4LYEA 2GAFA 5M5BA 4EQZA 3LSTA 4LJ8A 1GV1A 1RWPA 2R8YA 5DNDA 4G0QA 3S5JA 3W3AA 3S28A 3EBPA 4RM2A 1T5OA 5KVVA 3IIKA 4DGQA 1QHSA 2PKCA 4CMIA 1FFXB 3AR7A 5FWXA 1GCGA 4J29A 4W7IA 4Y3UA 1LI5A 3BDVA 4MP3A 1KKUA 2ENWA 2QNBA 4RYLA 4RJ2A 2V4UA 2ZUDA 2E18A 2JLZA 1UIRA 2GD2A 2OBXA 4L4UA 1G5RA 1SNYA 2QLNA 2TMDA 3DZCA 1LWNA 2JGEA 4P3XA 3HKDA 4MKIA 4RXTA 9LDBA 1PWYE 5CXQA 1ECLA 1RWBA 1AF4A 2P8SA 1B6GA 2ZSIA 3NJ8A 3QMMA 3V55A 3MYYA 4XOUA 1JEOA 1J25A 1NSFA 1OKKA 1TRHA 2PLNA 2VKTA 2JI4A 2RGUA 1L8QA 1N1MA 3HVHA 1MAWA 1V8BA 5EP4A 3BDAA 4UE3S 5K3SA 3TL6A 1ZUIA 1U2GA 5FPHA 3B89A 5DTRA 3W2GA 1JH9A 3BD8A 5EAIA 3CRMA 5LUAA 3MT8A 3HCRA 1V3UA 3BSWA 4R2WA 2H1SA 1J56A 1Q7GA 1X70A 3DP9A 3VR5D 1R4AA 5GY7A 5DU2A 4EGCB 4HQNA 5JVDB 5DCUA 1PD1A 2BBWA 4IMJB 2W2TA 1D6SA 1CIPA 3I3OA 1OGIA 1ZIXA 4BLWA 1E2GA 3KNZA 2HFKA 4LNUB 4RLSA 2YVUA 2I5PO 2L19A 2AEMA 2ISCA 1CETA 4Y6LA 2DFTA 3QPUA 2AJLI 3QWHA 2ZAGA 4QAQA 2QNRA 2QAGA 3FDZA 3PJFA 3DZHA 2Q3JA 2RK6A 4KZKA 3W6NA 2HEGA 2BF4A 4CTOA 2ZBFA 4S05A 1FMTA 1Z6QA 1T1SA 3JZAA 1AS0A 2WD7B 5DGXA 2C9YA 4BYMA 1NVFA 1FJ2A 3HI4A 2VBIA 4HQ6A 4IJ6A 3QUCA 4UM9B 1E1YA 3TR5A 3B82A 5LPNA 4B83A 2YHIB 5AOCA 2EV9A 1N77A 4PW0A 5AKYA 5T3YA 4AIIA 1X7YB 2I7VA 4WECA 4J0DA 1TQDA 5DDIP 4WNCA 5DW3A 3WMEA 1RJGA 2GEJA 2GN4A 2NT3A 5ERGB 1CRPA 1T29A 4HNAA 2V3CC 1RXCA 5EC8A 2YYAA 4RZQA 4ZI7F 2GPNA 4GPAA 4XB1A 1N9GB 2I2BA 3ONVA 1OVGA 2Z30A 1FFYA 4XGQA 3FYDA 2B5VA 4W9NA 3KPVA 4GLOA 1LWOA 3UAYA 4EPTA 2P1DA 1NNUA 2C98A 3KDSE 1PR6A 1KZ7B 5IG2A 8MHTA 2NQ8A 3TAXA 1A8PA 2AK3A 2OV2A 2QPLA 1GPLA 2YV2A 3G5LA 4OAQA 2FFHA 1N5RA 1M2OA 1ZD1A 2OVBA 2BEKA 1FYEA 2QG4A 3JQ6A 2PKEA 3VZQA 2CE2X 1O0BA 1PWXA 2NV6A 3QVKA 4L27A 4IV8A 4QTTB 2X0IA 5A0FA 4XQCA 4BDSA 1X8KA 2XKBA 4RPHA 4BQNA 5LVAA 2PGOA 4Y7DA 2NTVA 2V54A 1UM9B 1RPJA 3BIFA 4WCVA 4O4HB 1ZISA 2G5TA 3QE0A 3H9BA 1GCOA 3U6BA 1C1XB 2D06A 1IPFA 5J3JA 1KK1A 2Q2NA 3CZCA 4O59O 1D03A 2J0UA 1ISFA 4E5NA 3FFWA 4MHOA 4C7VA 4DLLA 1ONOA 3WHIA 4JCOA 4RQBA 1T26A 1WEHA 1ZUHA 4MW1A 3AOGA 3STHA 5BRJA 2BTQB 2BM1A 4RHCA 3NVDA 1SURA 2O8NA 1VL8A 3O21A 2V7VA 2JLVA 1HRKA 1SD2A 1ZEMA 3U31A 1AHNA 3GP5A 2C54A 1XLUA 2PKWA 2ZM5A 2ODAA 2XEXA 2WUWE 3H5WA 4JLWA 4TRMA 4BO2A 2DPGA 1XTJA 5AT1A 5BQXA 2FVYA 1C8KA 5CITA 4BKUA 2BGKA 2BI8A 3OPVA 3QRWA 3VR4A 4PEVA 4FCVA 1XA4A 5I4KA 5KHOC 2C4NA 2HMYB 1O5OA 1OXXK 4BMYA 1QFMA 3TNDA 2G3YA 2NO0A 2J4CA 2P7HA 3BKXA 3VNVA 1SIUA 1JSXA 2QQGA 3Q88A 4MQUA 4YP1A 3GJRA 1R5BA 2WIKA 2HHCA 1IPEA 2ZT6A 3I3SR 1Q0PA 2VUSA 1KEVA 2NO6A 4B9AA 4MK4A 1DXHA 4R41A 2LKCA 2XBLA 2AOUB 1NW3A 4IIUA 1D07A 3RAEC 4E2XA 2ADOA 5CK5A 3MCUA 1SCBA 1SXJC 5EWJA 3GEHA 1YZTA 4CM3A 2VYQA 3EXFA 1YR2A 1CT9A 2ZRHA 4TYQA 2W2KB 4IHJF 2HTEA 2JI6A 3KTOA 1OHHD 2HLDD 1N2GA 3U13A 1I32A 2QRVB 2TSYB 4QEKA 3T5BA 1A4UA 4ZCRA 3N1UA 2D1QA 1E7SA 1QP8A 1GG8A 1XRMA 5JSZB 3D7MA 4MWOA 3TTWA 3I0NA 3OH8A 4KO1S 2BMAA 3F8TA 1AHIA 1NMSA 1UQUA 4GO1A 2XXAB 4K8RB 2LDXA 3IQGX 1U7HA 2GI4A 3PVSA 3HBAA 3P5SA 2QUAA 3B1JA 1BO6A 3INTA 2H16A 3A0RB 4GBJA 1MC8A 4GWKA 4Y2VA 2ATVA 3HY6A 3T12A 3TOZA 2IBMA 2J85A 1GFIA 3GGJA 1U5BB 3GV0A 3ML1A 3P9ZA 4WFQA 3K2BA 4BTEA 1HLDA 1XDDA 2NT4A 3PGMA 3LUAA 4PXSA 4UVIA 4TMXA 2QN6A 4AJEA 4AXBA 5LN1A 5LWHA 4Z4GA 4UEOA 2MTBA 1Y8RB 5L40A 4K03A 2NU7B 4DTCA 2DLCX 1R6XA 2WIJA 2XNSA 1T3LA 1DX6A 3GZNA 2R3SA 2GJKA 1U7ZA 4FFSA 4HDKA 4M38A 2W90A 4MMYB 3U7RA 4EF5A 4M86A 1BHO1 1XAGA 2PBLA 2XYGA 3RO7A 5LP1A 3RYCB 2GPTA 4DA8A 3UUFA 2DWPA 4OJTA 3Q5EA 4OHBA 2OHOA 4Y9UA 2BMVA 2P75A 2WP8J 1AT1A 2FRDA 1HEYA 1Z33A 3HS3A 3TJRA 1UK6A 3IR5A 2VLBA 2PR2A 2BRUA 2O3QA 3KHSA 2QZ9A 3PPYA 2JJMA 4C3VA 4ARZB 5A7FA 4Z2YA 1X1AA 2WD9A 3OIFA 4FXPA 2HMAA 1F2UB 1GFZA 4K6HA 2ZR7A 3ZU6A 3AUFA 3OEWA 1JKFA 2OQRA 4M1MA 1X80B 3SJCA 5CFOA 2HLHA 1RAEA 3LHSA 3RIHA 2I3BA 4WBNA 2ABWA 2VF7A 3NGMA 3HDVA 4MGIR 5L9AA 1FDSA 1W0KA 1OX5A 2OZKA 3A1TA 2CXOA 4K9MA 1IWPB 3SMVA 3EXG1 3L0IB 3ZV3A 3EDCA 4B81A 4LRUA 3B12A 4TXHA 4X92A 4HSGA 2GK7A 2WWWA 1MQAA 1CB0A 2W2QA 4UM5A 4PO1A 1MB4A 2FSSA 1N32B 3RG2A 1UINA 1Y5MA 2YWRA 2NXWA 1WBBA 2EYQA 4X65B 3DEZA 4NENB 2OD7A 1FUUA 5H83A 3JYQA 3WTCA 3TQSA 4WKCA 4B6OA 4J0QA 1VLVA 4L9RA 4B3DA 4Q37A 4RHTA 2DR2A 1NQVA 1EGQA 4PHCA 2X6RA 5AXBA 1VBKA 5IVIA 4Z51A 2GCIA 4H35A 3TZBA 4U39A 1IBMB 3E70C 3L8EA 1E3SA 2XLBA 2X0DA 2O59A 1PLKA 3ABIA 4OI1A 1ECPA 3W34A 3MMSA 3OZTA 5FP0A 2ODEA 2QIOA 4P4SB 3VXKA 4QA9A 3QK7A 2H63A 2AZ4A 2D2FA 5AW5A 3HYNA 5K0EA 1U7DA 4ARBA 1C3OA 5BT8A 2HPAA 1G8YA 2FWIA 3HCEA 4EDFA 1F4LA 4LMBA 4ND4A 4QOFA 4TZKA 1NW6A 2I4TA 3HB7A 3CTPA 5AHWA 2C5EA 2FPXA 1WMFA 1Y8AA 1DX9A 1USGA 2AI1A 5GJVC 4X94A 4X9XA 4WNAB 5LZ7A 3IQIX 1K6EA 4OUKX 3OPXA 2WMOB 3K6SA 1MGOA 2VDVE 1SCUB 2P65A 2AXEA 1VB5A 4U8GA 1OXVA 4I1VA 3KCQA 5CX1A 5DV9A 3UK6A 1PJRA 2CF6A 4RIFA 1O5TA 2IXBA 2Q2QA 1T8PA 1ZMXA 2VXYA 4JVSB 1UBEA 3PHJA 4D97A 4LZAA 1KVUA 3V1MA 3IAUA 3DZDA 4J1TA 1RJFA 4LC0A 5KYWB 3H11A 4PC6A 2HHJA 1QH8B 5AR1A 3FMIA 3K35A 4YPOA 1DCTA 1QLJA 2ORED 3QOFA 4I1IA 5CR9A 3ZCPA 3TWOA 4QUHA 2OV1A 1QFYA 3KYBA 3HO1A 1JYSA 2RIPA 3GLGA 3HJBA 1N5JA 1KTVA 4P3YA 4DLNA 3OOJA 1D2NA 3EVDA 4RKYA 3JQBA 5FPKA 4CMJA 1QV6A 3GWZA 4RHYA 3ZI4A 4QDTA 2CKMA 1TYZA 2CN1A 1YZLA 1E9BA 4EUEA 3MMNA 3O8OB 1B00A 1R88A 3A6HA 4G9BA 4BL5A 2RGXA 3K2QA 4JT9A 1UQTA 4YDQA 3TLYA 5FB3A 1BMFD 1P9RA 3AUJB 4GZ6A 5LXTF 4CTJA 4DXHA 2GN9A 2YY5A 1L4LA 1OROA 3PDIA 4FWBA 3L1KA 1KMHA 1SQSA 3G2QA 4JR0A 4RORA 4P82A 4CVNA 3WWEA 2EIHA 1Y5NA 3MTIA 3R5KA 4ZREA 3TBKA 4D57A 5A5DA 1AKTA 2FW9A 1M34B 4K9RA 2ZUWA 3MINB 3TBFA 2W2VA 1W4BA 4C0JA 1TZ2A 1J6UA 2RARA 4EVQA 4P08A 1WXEA 1E8DA 2QAIA 4XFKA 2V7BA 5HZMA 3RW9A 1W96A 3D6NB 2O3JA 5JAUA 1A9OA 1YONA 2I3DA 1WXHA 1XCGB 4PONA 5BORA 2Y05A 4L95C 1OLXB 3L5KA 1T9DA 1BX3A 1NAIA 4A0FA 4IJVA 1UBGA 2ZWIA 3RFCA 4KO4S 4LZZA 2ZWPA 4F0JA 5HKAA 4PO9A 4QGHA 4D98A 4ZEVA 1ZH2A 1YASA 5JEDA 1EZ4A 1Q17A 3LY9A 1JKIA 4HH1A 3TLEA 2AR9A 3P94A 4IJ5A 2Q28A 2F90A 5K0TA 2PLRA 1JPNA 4N5HX 3B1VA 2ZB4A 3BD6A 4JODA 4ANFA 3G2KA 2AMLA 1R50A 2MSEB 4MVJH 3MRXA 4HNGA 4K2HA 3DKPA 3A9RA 4ID3A 4Q3DA 2FLKA 1QVAA 3G82C 3Q3HA 3KTDA 4L4SA 1BU8A 1KK2A 3H19A 5IWCA 4FN4A 1BVHA 3J81A 2DQSA 4KREA 1B8VA 2I6QA 3ZDQA 1EVEA 4L5YA 1AJEA 2J87A 1HSOA 3KKKA 1DRWA 3NHZA 4EY3A 1YB1A 1RHJA 2AOTB 2O23A 1G4HA 3K0HA 3KJQA 2UYGA 2NMVA 3W3ZB 1W9HA 3MRTA 1ZVMA 1M2VB 1NZDA 1PRYA 4WA7A 3ZX4A 3SC3A 5L51A 4NL4H 1PR0A 5GONA 2J6IA 5CMLA 3FYUA 3P9IA 3QEMB 3VH3A 2JFGA 2XVZA 3WGKA 3DZKA 1W93A 1XKLA 2G9RA 3C15C 4GGPA 1M0WA 3QJGA 2J6BA 2R65A 5E7IA 2NQ2C 3Q12A 3T0FA 3UJAA 2ZKIA 1QAOA 4H15A 4NV1A 3VSAA 4ZCQA 1P2GA 5G3ZA 3R5HA 1M1NA 1Q0ZA 4IKOA 3C3EA 4I1PA 1TL7C 3GMDA 1W88B 2MMGA 2VNKA 2L17A 1DJLA 2ERYA 4U6QA 4C4PA 1BXRA 4IP0A 2VBGA 1YE8A 2OP0A 1RYDA 5EWMA 3LC2O 3UXEA 4TLDA 1UPUA 3H87A 1WUJS 1W6RA 3HKCA 2IPMA 2YWBA 4LMRA 4Q1AA 5BP7A 1U2RA 2HC9A 2ISQA 2JFBA 4POAA 5F7JA 4OIFA 2RHDA 3CCBA 3I8SA 3TOCA 2XA9A 4AXXA 4UEKA 5B4UA 4P0PB 3P7MA 3WIOA 2PWZA 2J45A 4L75A 2LGJA 4D4HA 2XMDA 3OCCA 2GPYA 5EINA 4MV4A 1KH2A 4CKCB 4MVWA 3NYRA 3CRZA 4C4TA 4B43A 3RLIA 2ZIXB 4KKXB 2JAOA 4JMPA 4RK6A 1JFRA 5JNLA 1T9GS 3VO9A 1V1RB 4ZVOA 1D04A 1G9XA 2CFTA 3DHWC 2KJQA 1Y34E 3ECCA 1D0VA 4LTNA 3T4UA 1R00A 2BEVA 3M4JA 1MO2A 1JMVA 4WLOA 5CGQB 3V1NA 1JEDA 2X2EA 1ZUWA 4FUQA 1XN4A 4MW0A 1Z17A 5EIWA 4G81A 2OAQ1 1N3LA 2O2DA 3KJXA 1NMEA 2F3SA 4JI5B 1HTWA 1OV4A 1HT2E 1AKVA 1QYDA 2NTEA 3AXTA 2AW3A 2EW8A 3AB7A 4JJAA 5DGDA 4CHTA 4EKYA 5KIAA 1APBA 1H5NA 1JJBA 1Z08A 3I1JA 4FYPA 4KGDA 5B6PA 1YBHA 1EWVA 2DHQA 2OO5A 1LPSA 3VH4A 4F38A 3FN4A 4RMJA 2WAAA 5ARDA 3RK0A 2AN9A 2NLOA 3D2AA 5FUXA 1H8HA 4OP2A 5FOSA 5TQ0B 1OSNA 3UN1A 3X44A 4Z2AA 1KE2A 2WUDA 1V11B 5EZQA 1Y63A 4QYMA 3HTXA 5CLJA 3MGKA 2K2QB 1A5SB 1GZ4A 3K8YA 4KXQA 4Q3BA 2E4AA 4FM9A 5KVCA 1F8FA 4U9HS 5CPFA 2I2XB 2DKNA 2E82A 2QE6A 4NH4A 1YNOA 4MWEA 3EXHA 4NH0A 1MAAA 1UBLS 2H7XA 4W82A 5DBIA 3USZA 9MHTA 4Q3KA 4O4JB 5TJHA 4IEIA 3I05A 4BNDA 1IZ8A 4XKJA 1EG7A 4XVQA 3RIGA 1QC5B 2XA1A 4UBKA 5H68A 2MYNA 1TYEB 4IR7A 4JOQA 5DGIA 4MDEA 2IS2A 4X64B 2SCUA 1YVUA 3VI4B 4MMXB 1V95A 2AZXA 4IMIB 1IUNA 3G0GA 5KNDH 2AOWA 4N5DA 1WF6A 2GK3A 4ZARA 5IJ0A 5JCPA 5BWCA 2XV1A 5EZYF 1ECFA 3DMPA 4J49A 1DOAA 2XYHA 3DV2A 3QKSA 5AM5A 5LA6A 1M1UA 4FYJA 4GUAA 4EKGA 1XNQB 2ZZNA 5GZ6A 4HVLA 3KJGA 1WSBA 2XQGA 4IZIA 4B3HA 2JLXA 4RY9A 1YDEA 2YMMA 2AE2A 3HJAA 3K32A 4GP6A 2KBFA 1SEVA 1MRSA 4OGFA 3TOVA 4KE6A 4MWTA 1Q44A 3O2JA 4DSOA 1MW8X 1LS6A 2JFPA 3JVUA 1NTRA 1HDXA 3QITA 4XJTA