2Z2XA

Crystal structure of mature form of tk-subtilisin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Four new crystal structures of Tk-subtilisin in unautoprocessed, autoprocessed and mature forms: insight into structural changes during maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 115
structure length 317
sequence length 318
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2z2xA00
4AKSA 1BE8A 3AFGA 3WIVA 1SCJA 1SPBS 3H42B 2IXTA 3LPCA 4I0WB 1MEEA 1Y3DE 3TECE 2HD4A 3GCWA 2ZWOA 3AJ9A 5AMXA 1ZVKA 1VSBA 3DE3X 2PMWB 4KPGA 4WOBA 5AQEA 1SUEA 3GT4A 1XF1A 1KDYA 3DDZX 4OMDA 3SQOA 3DVRX 1SUPA 2ST1A 2XTJA 1AU9A 1R6VA 1NDUA 5JXIA 2ID8A 4DZTA 4FONA 1PJ8A 4GI3A 5JMOA 3AJ8A 3LPAA 4RYDA 1GNVA 1GTJ1 1WVMA 3PRKE 3DYBA 2HPZA 1P8JA 2WUVA 1ST2A 2XRMA 3F49S 1S02A 2IY9A 3VV3A 1TO2E 4OV6B 1MPTA 1S01A 1DBIA 1GA4A 1T1GA 2PKCA 1TM3E 2W2OA 1AV7A 1C3LA 1WMEA 1SBCA 4K8RB 2SNIE 3WHIA 1R0RE 4J94A 2WUWE 1GCIA 1SBHA 1PFGA 2PRKA 4JP8A 3SICE 5JXJA 1TM4E 2Z30A 1R64A 1Y1KE 2DP4E 3TI9A 1SCDA 5B1EA 2PWAA 1Y4AE 2B6NA 1KDVA 1C9JA 1Y34E 1PEKE 2Z57A 2P4EA 2SICE 4Z2AA 1PTKA 1BFKA 1SUDA 2W2MA 4NE7A 1SIOA 3QTLA 1OYVA 3D9QX 2W2QA 2ZWPA 4CFYA 5CW1A 5K7SA 2WV7A 1WMFA 1LW6E 5SICE 3P5BA 4MZDA 2W2PA 3PTLA 3DE0X 5ARBA 2PWBA 2Z2XA 1YJCA 4C3VA 3WIUA 3CO0S 4M1ZA 3VHQA 1KE1A 4DWWA 4LVNA 1IAVA 1Y3BE 3I2YX 2ZRQA 3EDYA 1TK2A 2SECE 2DUJA 2ID4A 1TECE 1YJBA 1WMDA 3CNQS 1EA7A 4BWGA 2TECE 3LXUX 3GCXA 2W2NA 3A3NA 3EIFA 5ARDA 3DW1X 3VV2A 1ST3A 1TMGE 3OSZA 5JXHA 1SBTA 1KDZA 1OYOA 1SCNE 4ZARA 1AVTA 4H6WA 3VSBA 2Z58A 1P7VA 3DVQX 3DE7X 1IC6A 3A3OA 1CNMA 1GT91 3A3PA 1T1IA 1C9MA 1CSEE 2Z56A 3TI7A 1ZVJA 5AVKA 3Q40A 4H6VA 4DJ5X 3WQBA 4NE9A 2GKOA 1AQNA 1OT5A 1TM1E 3BPSA 3HJRA 1P7WA 4LVOA 3QMPA 3VYVA 3ZXXA 1SIUA 2PQ2A 1AF4A 3DWEX 3DE1X 3BGOS 4AKTA 4C3UA 1BE6A 1Y48E 1NDQA 3DW3X 3GT3A 1GA1A 1Y3CE 1Y3FE 1JEAA 3DE5X 3I30X 4CFZA 2G4VA 1EGQA 2X8JA 4H6XA 1AK9A 1GTG1 1SCAA 3VTAA 3T41A 1SCBA 1V6CA 5I9SA 5FAXA 4NMXB 1SIBE 1KE2A 2DQKA 1SELA 1Y9ZA 2PYZA 3DVSX 3EE6A 4CG0A 1Y4DE 1YJAA 1BH6A 3F7MA 1YU6A 4WOCA 1AH2A 3ZXYA 1SBIA 4HX2A 4YN3A 3DE2X 5B1DA 3D43A 1UBNA 5FFNA 1SUCA 3I37X 4KG7A 1A2QA 1SH7A 5JXGA 3LPDA 3BX1A 3DE6X 1SUAA 2SBTA 1SBNE 1SVNA 1SUBA 1WSDA 3I34X 3Q5GA 1GTL1 3QFHA 4HVLA 5AVJA 1C9NA 3L1KA 3DE4X 1NLUA 1Q5PA 1V5IA 1HT3A 1T1EA 2E1PA 4ZOQI 1BJRE 4B5LA 1S2NA 5FBZA 3UNXA 3F7OA 1DUIA 1TM7E 2X8JB 1SN7A 2V8BA 1GA6A 1THMA 1Y33E 5ARCA 1TO1E 1TM5E 2WWTA 2Z2ZA 4OMCA 1BFUA 2Z2YA 2QTWB 4KB5A 1GNSA
chains in the Genus database with same CATH superfamily
1RTKA 1N7JA 2W6PA 4PBSA 2FMUA 2ZR8A 4C76A 4CIYA 1C0EA 2KMLA 3IQEA 3QU5A 4FSXA 4GM4A 2GERA 2R66A 3L7NA 4BN5A 1L7NA 5AMXA 4D97A 3IBTA 1T8TA 1XTTA 4BB5A 1U80A 2GBLA 3G9XA 1BXGB 1CC1S 4FW9A 3H2YA 4BUZA 1G38A 1F3OA 1A2BA 2IOHA 4NYMR 5AM4A 1BW9A 5E6SA 1MGOA 4LOJA 3ND9A 4BJHB 5JEEA 3ZLBA 4RGYA 2ZULA 3ZOKA 2HWUA 1QHEA 2EJUA 2PL9A 4MQEB 1OXSC 4A0QA 5DBHX 1RC8A 2PKCA 3NHUA 1TJPB 5BWMA 4ZQGA 2J3IA 3ZWQA 4HQOA 4NTZA 1HLGA 2WFAA 1UFQA 1B6RA 5KAMA 1ZL0A 3HO1A 4Y2QA 2EIHA 1ENOA 5HF6A 1QRDA 5GJBA 3OPYB 1T24A 1DC6A 2H1IA 3NHRA 1U8UA 4ZT7A 3U3KA 2B3DA 4B5KA 5BQ3A 5SY9A 1HPLA 1U8XX 2YNMA 1GQFA 3QEMB 2OAQ1 1GEGA 2ZR7A 3AHGA 4G41A 3GLQA 3I53A 2ZPUA 3OQJA 3R5FA 1PG0A 3GPDG 3IO3A 3WS7A 4CODB 1K97A 2C58A 1Z4OA 4G9GA 4NPHA 4F8YA 4DR1B 1U8EA 4ENQA 5SZHB 1E1QA 3P4YA 4N9WA 4GLJA 4C7VA 4QPNA 2FMTA 5CBPA 4A92A 2O8CA 4PHGA 2LRHA 2M98A 1R6BX 5D86A 2HNKA 5CX1A 2P41A 4S1WA 2ZJBA 2QMYA 2O4CA 4F85A 3LZ6A 4YMSA 3WGLA 4MW1A 2DETA 5FTKA 3GARA 4WXMA 1Y7PA 3UYLA 3H6HA 1Q6YA 2F48A 1A71A 2O2HA 1MO5A 1W30A 2AC2A 3L7MA 1YTLA 3MAJA 1JS1X 5CVDA 2LGJA 5UKDA 4GF5A 4J43A 4EJFA 4I9HA 1DBPA 5F78A 4DREA 5KOIA 1J8QA 1ZJYA 3IDAA 1Z7YA 4OATA 4DCMA 4FCTA 4QBGB 4QIHA 1U8CB 2QTFA 3ORHA 1ODTC 1XZHA 3P2YA 4MB2A 1RWMA 2I54A 2JANA 2YZMA 5HJ7A 4AKIA 1XHEA 1XT6A 2ZI7A 5I7SA 1GUZA 4LUCA 5H7XA 1KP3A 4NXMB 3VA7A 4U9UA 4YJKA 4S05A 5EIXA 3H16A 4YPOA 1E1RD 2HF9A 3U7EB 1D2NA 4WOKA 4EM6A 5I7RA 2QNIA 4WKCA 4WNCA 3K70D 1D2CA 1ISMA 3M0EA 2VTBA 2DRIA 1IUPA 3OZVA 4E2XA 3D64A 2BSXA 4WKNA 1REQA 3WTCA 3OPYA 1CPYA 2N47A 4QOJA 3KELA 4JLAA 4WD3A 3FIJA 2F1IA 4WCVA 3I01M 1SQ5A 3PITA 4QDTA 1RRCA 3DAHA 2X1LA 4RXUA 1W4AA 2JA1A 3DKKA 2IZOA 3GJ8A 4GU5A 4XQEA 3ZZ1A 5LPNA 3W9UA 4PIPA 3HVUA 4EK9A 2J1LA 3DVLA 4IQ4A 4BL5A 3C8ZA 4LRSB 4BMOB 1JA0A 1G60A 4RSMA 3A6HA 1LJLA 4B3DA 1E6CA 1RQXA 3MGKA 1QE0A 2PX3A 2WAYA 1TZKA 1XU4A 4LQDA 4P58A 4IS3A 4UUBA 4BFVA 2XBMA 3KG2A 3HB5X 1LNSA 1ODFA 4GIBA 5LA6F 4ATNA 3W1WA 4A6PA 1TM5E 4J0HA 1ZAKA 2OPBA 1G4AE 4IJ5A 4JCCA 1M72A 3LHKA 1WBJB 4E5SA 1CRWG 1DADA 3STVA 2FPMA 3L93A 5JAQA 4CTMA 5A1TA 2I33A 1JG1A 2WU8A 3T3EA 4BRUA 2J0SA 1Y9JA 2HW8A 3C41J 2P2CA 4GZMA 2QLFA 4X41A 3OEWA 2HNBA 4KPGA 4KQWA 4MV4A 2CFSA 1TMOA 3FI9A 5FI5A 2K4MA 4FOTA 2Q1SA 4IOLA 5BQXA 1DTSA 3AILA 3ZDBA 1HO3A 1TOAA 1WMBA 4R69A 1B8UA 1M2VA 1LNZA 5AW5A 2X4DA 3PRKE 4WBXC 3RVNA 4DABA 2R1TB 1LLQA 3ZXUB 4MW2A 1J5PA 2CNKA 3Q7PA 1G18A 3FLMA 3ZDRA 4CQLA 3PHBE 4CKEA 1V7ZA 1JVNA 5KYVA 1L4HA 1ZFNA 1T9KA 2WUWE 3E9DA 4AS3A 3SWWA 3AIMA 2Q4OA 4QGHA 1ZOOA 4YTEA 2FWAA 3EXFB 3LBFA 4R4JA 3CJTA 1T5DX 4JI4B 4DLRA 1Y5RA 5FPKA 3J81A 1QRUA 2Q3FA 1B41A 3CXUA 1V7QA 1GCUA 3GRUA 1RXIA 3GVPA 4ABYA 1V5FA 4KEAA 3GP8A 5KNDD 3T15A 4G25A 1S3FA 6REQA 2B30A 3D3WA 1F60A 2W4IA 2ZJ6A 3T61A 3IKVA 2VDLB 4WAUA 5HUQA 2RHJA 3LI2A 2OFPA 2HHAA 3PVZA 1AKMA 3RTBA 3PT9A 1D04A 4IDHA 1JTFA 5JIBA 1TRHA 2OP1A 1UWVA 1VHQA 1Y7HA 2G0TA 2ODWA 3BE8A 4K2AA 4RJLA 5L6MB 5JXHA 1FYWA 3PZBA 3JQCA 4X6LA 2WZDA 2HRDA 1RAIA 4H7PA 3V2HA 3ZGXA 4A2PA 5CA0A 4BCBA 1UPUA 1CNMA 4MRVA 4C03A 4YT2A 4XLZA 2VXOA 3MMZA 2BEVB 2WIDA 5IS2A 1QIEA 4QNRA 3VGJA 3K9WA 2O1WA 4C08A 3UA4A 2XVYA 5EAIA 4KNVA 4P6VF 2COUA 2R8EA 4AL4A 5JW6A 3T5DA 1IN4A 1R9NA 3BH6A 4XAQA 4URVR 1N7HA 5KMGA 3MQFA 1U0SY 1RIIA 4CG2A 5I9MA 2XMZA 2MSNA 1IBKB 3GT7A 1TPYA 5B36A 3EZGA 1D5WA 1A72A 4ZIRB 4NZYA 5G0VA 3STTA 4D6XA 3OZUA 1E0DA 3O94A 2R6JA 3QHAA 1TVMA 1ESDA 1NF8A 4WVLA 2B0JA 5GVRA 1C1XA 2BEUB 2YWRA 3B5IA 4MMZB 3T3MB 1E0AA 3F4KA 3WY9A 4RUKA 3OQ1A 2WWFA 4MVJH 2F43A 5DF1A 5GVSA 5M29A 1OXBB 4L2IA 1L7AA 3OQHA 1KBZA 2FWIA 2OGTA 2CUKA 1E9EA 1VSTA 2ZPAA 3LM8A 4LCBA 4EB6A 1UKBA 1T1EA 4LJAA 5JJLA 4AT1A 4B5LA 1G2IA 3FWZA 4EB3A 2P90A 4OQDA 5JT1A 3CB4A 4RULA 2LWIA 1E1LA 2L17A 4E2ZA 1TYAE 2H11A 5FFMA 1JHPA 2FPGA 2ZUCA 3EEYA 4B74A 4FJ2A 4J1TA 5B6JA 2ZXEA 1ZO8A 1XPJA 2E7ZA 3WHKA 1V9CA 1XZLA 4R8MA 2R1VA 3JQ7B 1E3TA 4LXYA 5AK6A 4MKIA 1W85B 4BXOA 2A9QA 3DE3X 4TTRA 3SX0A 2WVHA 4M8LA 4RAOA 3SQNA 4QGBA 2LDBA 2F3UA 1E2JA 1KI2A 5K8CA 3TEJA 1EJ0A 2X41A 1U0EA 3P52A 2Q1YA 5CK5A 1KO1A 3TZ6A 3EPHA 4QAJA 4RK5A 1ORWA 2BKEA 4L07A 2XB2A 4KGVA 5JSQA 5GOZA 3A58B 1KHHA 1P4AA 4XOIA 3DC7A 1QDEA 1OZ0A 5P8WA 2XLCA 4JFAA 4W63A 2QM0A 4ZQIA 5G3ZA 3WHIA 4H3HB 2QN9A 1IQ0A 5BXYA 2XB8A 1EVJA 4J94A 1KMCA 1N2OA 1HURA 1R6XA 1XXHE 3ANLA 3R24A 4YAJA 5A62A 4Z4CA 5KWSA 1T9HA 2YJ5A 3SLGA 2WJ4A 4F3CA 2C94A 2PZGA 1HL7A 2FWPA 2JIRA 3IA2A 2P6MA 3RASA 2C7QA 2VLBA 1Y4AE 5HDBB 3HC7A 4CDNA 2H7CA 3DO5A 4MUXA 2IRWA 4KFRA 1JAHA 4HADA 3AVUA 2GESA 2QZSA 4HN4B 3MMPA 2WIFA 4R8RA 4S1PA 4BVAA 5K8IA 2AOUA 2F1HA 2PLAA 1V2GA 3AKEA 3B52X 4DLYA 3AHEA 4LVCA 1BKSB 1JI3A 3ACDA 4PZCA 4HYTA 4KYTA 3QMVA 3ID6C 1PQ4A 1T9BA 1BVYF 2WILA 3NP7A 3VVCA 1VL5A 4R1OA 5CGQB 4BP9A 3VR4A 2G0NA 4NJMB 5EMKA 4B3MB 1DTEA 1SHTX 4RPGA 2QQGA 4I55A 1JLLB 3O2NA 4RZ2A 2GLUA 4ZAFA 5BSRA 4NAHA 4GX2A 3QF4B 4C0AC 5CD9A 3SS9X 3KR0A 5JG7A 3DFKA 5JAUA 2JI4A 4CLOB 1CS0B 3GEIA 5IAGA 1KVUA 2CMFA 1E2MA 2A30A 2W6JA 3ILHA 1OXUA 1UP6A 4K1XA 4DIBA 5ITZB 4WIAA 5L6LB 1O96A 4BVHA 1JQ5A 1C1HA 3KYCB 4IDCA 4C3UA 2J7PA 3AJEA 3P9NA 3TMKA 1KY4A 1Z0AA 4CKCB 1XQ1A 3I30X 1YKSA 2EFDB 1CEXA 1V26A 4KRXA 4Y2JA 3T7IA 3A9TA 1FZTA 3GJYA 2X4GA 2VK1A 4WKOA 3ACBA 4UPEA 2P9YA 4AO6A 4RYLA 4NENA 1VL2A 3MZ0A 4L9RA 2CYBA 1A04A 4KR0A 3V7NA 3AF2A 1YD7A 3WLSA 1Z2DA 2WWWA 2PV0A 1R4MA 1MJGA 4GLFA 3IUNA 4MVCA 2BV3A 3HUDA 2I4LA 1DRKA 1MVOA 4NYMQ 1JQLB 4RD3A 5CDFA 3U9SA 5LD2B 2PZKA 1T0BA 2QL7A 2BKUA 1O6BA 5DM4A 4IIYA 3X44A 4M3NA 4O4IB 1CQJA 2ZCUA 3IDOA 4QYWA 1G5IA 4OFWA 3IMCA 2GARA 3PV0A 1H6BA 4OQZA 4P08A 3UCFA 4IXWA 1OA1A 1EKXA 3TM5A 2CSUA 3U7GA 2BGWA 2I2BA 3K1AA 1IMOA 4EG7A 3K70C 1QF9A 1G3MA 2IPXA 1CY7A 3D6VA 4HGRA 1GARA 2C9CA 5JJ5A 1M66A 4RMNA 4B48A 4NP6A 2FPLA 5J3JA 4X45A 1RCTE 2D1RA 3BTSA 3HFSA 2GN1A 1RJGA 4ZK2A 4S1NA 4RVSA 3PUIA 4H1TA 4C7OB 1CS0A 3AGQA 3A6FA 5F51A 1XVIA 1Y3DE 3NASA 4FDAA 2AEJA 4D8WA 2ZRIA 3DT6A 1SVKA 3TTSA 2C4HA 2HXYA 3JRWA 5SY4A 3JAWA 3GIWA 2W0MA 5JCJA 1TFRA 4EFDA 5AKXA 2F9MA 4TS3A 2V7XA 3NXSA 4B6JA 1DEAA 3ZWPA 1YDMA 1I7NA 3AWDA 4UQOA 5KTMA 1D4FA 1PWYE 3ENWA 2N42A 4A7PA 5H3CA 5CFOA 3ENZA 2DHRA 1LY1A 1TE2A 3KD3A 4U7WA 5IJXA 1GUDA 1WV1A 1AQJA 2H0RA 4M36A 4LC9A 3WZMA 2JFQA 3ZD7A 1VCNA 3QXHA 4ZGWA 4KFCA 1ZCAA 4B7XA 3DQZA 2H9YA 5DIFA 4ENSA 2XWJI 4NJEA 6Q21A 2CEAA 4YRFA 4LDZA 3MTEA 4N5IX 3ER6A 3CX8A 1FCJA 3G1UA 4JLWA 4KOEC 4NONA 1HEUA 1XK6A 3TLCA 4W8GA 3V5NA 2Y1DA 2IK8A 2JARA 4RJIA 4WCFB 4HT3B 3PUYA 4ZGGA 3GEPA 3RTCA 2C7BA 4ZCMA 5HOEA 1KI1A 1PGOA 2XCSB 1YSCA 1YJCA 4R2JA 5DI3A 2W9XA 1N7IA 2Y05A 1N3LA 3BJRA 3QKUA 4POOA 2BMFA 3BWXA 3R4VA 4A27A 4A9AA 4TV8A 1JT2A 2VRCA 4ZI3A 4KLZA 4YJHB 5HILA 2I1VB 4WCDA 4DLLA 1HX7A 1T3TA 3O5AA 4Y1RB 4MKZA 3HRHA 2PIDA 4PTYA 1A9XB 2BHRA 2ZI4A 5BR8B 1MT0A 1NG9A 2OHOA 2R5WA 1U0FA 2JCYA 2C7RA 4R54A 3AX6A 1OWLA 3E9QA 1VJRA 1UOQA 4EKEA 2XIQA 4UBIA 1HUQA 1YB2A 4GC5A 1PFYA 4TT3D 4A0HA 1ULTA 3MK31 4JLDA 3IALA 3TUIC 2Q3BA 4HEA1 4W5WA 2PD3A 4QT4A 5JXIA 2JIOA 1I2ZA 1OZFA 1Z45A 3CSSA 3V1MA 4X95A 1Y48E 1R0WA 3BRWD 3GPBA 5ENVA 4ZDJA 2VEOA 1WMAA 1DE0A 2PPVA 3ELUA 4J75A 1N8SA 2ZWVA 2L18A 5EA2A 1GTG1 3VPHA 5K3OA 5A2GA 4PSKA 3GLGA 4LYJA 4DZZA 3KSAC 4F4HA 1THTA 3LUHA 3VKHA 1K75A 4F56A 1YVPA 1PSWA 2P9QA 2DFVA 4X90A 1M2FA 1MTOA 2VAMA 3T1TA 1I1OA 2B4KA 3OE7A 4IV8A 1A9PA 3IT3A 4NZOA 4KXUA 4MRPA 4C78A 4B4KA 4OQPA 4UZSA 2OMEA 2QRVB 3TINA 1PR9A 4FNOA 4XQGA 1OPRA 4WXPA 3VXKA 4GR9A 1I3NA 2YDYA 4WKPA 3DWIA 5FR2A 2P9BA 2YDXA 2FP4A 4E22A 5H9WA 1V5IA 3KLPX 1CJSA 2HRBA 4V2UA 4G1VA 4OHCA 3U4GA 1GA6A 3VBCA 1BCRB 4ZRMA 1TO1E 2JAUA 2P27A 3LFHA 4CEHB 1OAOC 4TSKA 4FEYA 5C3UA 3ZCRA 4YVFA 4ZPJA 2HN9A 2X4IA 3JZMA 1BE8A 2OC9A 4JLNA 1QHFA 1PZXA 5B2FA 3RCBA 3LQ2A 1H3NA 5LC1A 5TQ0A 2X5KO 3USCS 2NUTB 2X2EA 1M2GA 1II0A 4LJRA 2AN1A 3HXQA 1G7TA 2C4WA 3QLVC 4XQ0A 4TRJA 3H5OA 3L8MA 3UUFA 3FPGA 3K09C 3QIVA 2HTFA 3CR8A 3QFHA 4OIMA 5LA6B 4GMXA 4MVJD 4KLAA 3HFRA 2VT7A 1Z5ZA 2AB0A 2PL3A 1J0CA 5C1BA 1U99A 2O3RA 2PAAA 4EY8A 4AVYA 2AJTA 4TN1A 4Y2HA 2ZRCA 3NHLA 3HMQA 3P2OA 2AJLI 3H1PA 1SHKA 2FW1A 2WWRA 4DYHA 3FTPA 2JI6A 4L6CA 1UJNA 1BW9B 3IR5A 3QUAA 4MDHA 4OH1A 1AGRA 1F5SA 2H5LA 3CLUD 1XXLA 4ALKA 5JXJA 1P5FA 3W5AA 2Z6QA 5E4FA 3U7QA 4RE6A 3CCFA 2QRVA 4JGGA 4R1SA 5GV8A 2LCIA 1HMYA 1GGNA 2X7XA 4LNUA 1BD3A 3R09A 2FCAA 2ORYA 3RBVA 4ZAGA 5J5CA 4LGCA 1XMVA 2W2QA 5ENZA 1JG3A 3S1AB 4J0FA 4MPPA 4BMDA 3S2FA 4D4HA 5A4MS 4CGZA 1WO8A 4FE4A 4LSWA 1NVGA 4V0ME 3IUBA 5D3ZA 3WV5A 4B2IA 1TAUA 2OCYC 3V2IA 4GWKA 1JBEA 1ENYA 1XZKA 3ET5A 1BCRA 3ED1A 5LMUB 2HWYA 1ODIA 2A57A 2DPGA 1QHHA 2SECE 4NMHA 4RKWA 1WXWA 3IQWA 2VN8A 3LZDA 5JVDB 4BQQA 3GCXA 3MS7A 4WLEA 2PRJA 1RIFA 3N8GA 5BNTA 1GSIA 2EDCA 3BHNA 1JDSA 3DKPA 3O1IC 4MR7A 4Q1VA 1R0YA 1JR2A 5B58T 3CUYA 1G9TA 1RP7A 1SIWA 4Y18A 2OBYA 2Y4NA 3HEMA 4ETMA 4EX6A 3JQFA 2GPWA 3DR5A 5IXYA 3K0SA 1NW9B 1VPEA 3OZXA 2YZKA 2GPAA 4FC7A 5EWMB 5FI3A 4KDCA 3DZDA 2BYTA 3AINA 3HSKA 2XB9A 4GPAA 3K0HA 2HK6A 4MQMA 4R05A 3VTAA 3OPNA 3N7AA 3QOFA 4WVFA 3TLKA 1H2WA 3WYAA 1A8QA 2JFGA 2O5RA 2FE4A 1XPOA 4HOYA 1FU8A 4HUJA 3TDKA 2HOQA 1H0SA 4YRAA 3CE9A 3EOBI 5DBFA 2JJYA 3BXFA 3NBZC 1JIIA 3L8CA 2PZEA 2W6OA 3GZNA 4Y6GB 1RPZA 4C1NA 1RXSA 3QSGA 1T2CA 4JYPA 4NR0A 1YBFA 3KJNA 1OB2A 2PTHA 2ZRMA 2OBLA 3K15A 1PVVA 1RPTA 2ECKA 4BB0A 3HJGA 2AKAB 5EJ5A 4G85A 5BQPA 3EGEA 5G1PA 4LHYA 1XQVA 1MEJA 1VE5A 4LHWA 3B3QA 3RU9A 5I9IA 2A88A 4CR8A 4E5YA 2JAPA 4XI9A 4XB1A 2GCIA 1PLJA 1WETA 1WDWB 5M34A 2ZE8A 5CJ2A 4ENRA 2FX3A 4L08A 4JGIA 4IHAA 4HJRA 2VZEA 4MUYA 4F04A 3U44A 1VA5A 3K94A 3JVVA 3CWZA 4HTFA 3RV4A 4EF4A 1QF6A 2GAAA 4GP9A 4IG9A 3T54A 2H1WA 3QHPA 5JJIA 1QTIA 2WNSA 4D26A 3JWEA 5FA5A 2UUCB 2W6CX 1JA9A 3E1KA 3DJYA 4GI3A 5COAA 2OCAA 1N4AA 4TLMB 5A4FS 1N2BA 1W93A 1TTTA 2V7EA 4KYVA 4PC6A 2PPLA 3MIIA 3AEQA 2ZB4A 4Y2UA 2HQSA 4V0NA 4DWJA 3PUKA 4I4CA 1V37A 5DPMA 5ADUS 2AOVA 1QGED 1SXJD 2AFIE 2RONA 3FF1A 4PZPA 4QEZA 1YHYA 3KKZA 1SBHA 3M33A 2H4ZA 1D5CA 1LBEA 3OCXA 5BRAA 3C5EA 5K4GA 1M8PA 4WGGA 4XTCS 4DDWA 4Y1EA 3BXXA 1VYHA 2PS1A 2ZSIA 3NCHA 3X1MA 2DC1A 1H0RA 2I3GA 1V8DA 4TUYF 5DW3A 1SEPA 3BYZA 4WXHA 4F6RA 4EGQA 1JDTA 3DFIA 4FFOA 4Y6RA 2ZJYA 1QOZA 2QKYA 1L5OA 2BEJA 2J4CA 5LQMA 2KWIA 3HSSA 2RB5A 1T5HX 3VDMA 4CT4B 2C2BA 1CR1A 5FWYB 5CYGA 3T3DA 1RVDA 6ABPA 3JX9A 1FPQA 3JAMA 4GYYA 3OLZA 1QGAA 3IQIX 3EVTA 5MF6A 2HMWA 4I99A 3U7JA 2ISSD 1EK2A 1I94B 3ZW9A 2CNWA 1OYOA 3BWBA 3T35A 4ND8A 1P6XA 5CP8A 1H23A 1M2JA 3KXPA 4M7RA 2BR3A 4BQNA 1N32B 1FMFA 1X7WA 2AKYA 3MFYA 3TW8B 2JH8A 2O2YA 3P45A 3WYNA 5L3SA 4DV5B 3TSCA 2C2XA 3KS9A 5LP6C 4U6QA 4MGZR 3VHLB 1RBQA 1BRTA 2GKSA 3CXRA 5K3AA 2G0AA 2VJMA 5T6BA 3RPEA 3ZXXA 1LD3A 1DG1G 2CXSA 2VUSA 3KYBA 3PZRA 4JJEA 3ZQJA 5AT1A 4F86A 3PKJA 1EM8B 1EZ4A 4TMKA 4U7GA 3RUEA 3K9FC 3F6YA 1EWRA 1GA1A 3QX9A 3AP1A 4LJ6A 4UAUA 5K0GA 8OHMA 3R9XA 2E3JA 4J07A 4DLNA 4HPXB 1Z6XA 3OJXA 4MK4A 2ZJ2A 3ABSB 3T3PB 4BLRA 3GLIE 2IUEA 1T8YA 2AWNA 4U39A 3KL4A 3QXJA 3K0FA 1P91A 4XGRA 1KIAA 3K6JA 1JYFA 4FCVA 3T8YA 4UZFA 3EQ6A 5B1DA 5EKUA 4K0KB 3TXYA 1XG5A 1NNLA 5JZBA 3WB2A 2DT8A 4DCTA 3C3PA 3AI7A 2UYYA 1Q44A 2ZBFA 3NYWA 1PKEA 4ZQBA 1WSDA 1QFYA 2GTIA 3PD1A 4GICA 2J0VA 3K4QA 5F4ZA 5IHPA 5LQKA 4AURA 4PW0A 3OHSX 4NFSA 2ACVA 4KRFA 3TLZA 4JYBA 4MS1B 4XDZA 3PVCA 3ANTA 1AY0A 2Q9CA 2PLNA 1NAIA 4GZLA 1IPFA 4H1UA 1XC7A 2AN9A 3HG7A 4MV7A 4Y8VA 3WK6A 1DVRA 2WKSA 1NVTA 4MVJG 1GL9B 4Y6QA 5JSYA 3TIFA 3WLLA 3CEMA 4EVQA 5DX8A 1GKUB 1N6KA 4LZLA 4BQRA 2B61A 2C1EA 1X9IA 2RGAA 4YRTA 5LQSA 3TGWA 3JQ8A 3TJRA 3L7YA 4V3CA 4BEVA 4LJ8A 5LVAA 4DLXA 1VJCA 2CMHA 3WGGA 1YCHA 3ESQA 5HQ3A 5LKAA 5GIPE 3VJLA 3R6LA 2FEWB 2BJVA 2DT5A 2JK1A 1LDMA 1NDUA 1ZIPA 2QX4A 3GDOA 3F6SA 1EFHA 1OU0A 1X14A 3G02A 4WZBB 5IVPA 3L01A 4ENTA 1WU8A 3QW4B 5LP1A 1M34B 3AB8A 5E6RA 3ZI4A 4NNPA 3F7TA 4XVRA 3S2SA 2O2CA 3MINB 4HPJB 1FP1D 2Q1UA 1RZRA 4IO1A 4DCSA 3MJSA 3H99A 3ROFA 5J2TB 4CKCA 4JJFA 5B1HA 1GR1A 1L7PA 2Q29A 4M83A 1CZUA 5CVVA 3BL5A 1MA0A 3DP7A 4MUGA 1J2EA 1QDLB 2C54A 2H08A 3GDWA 3MJHA 3GFRA 3JYLA 4FMDF 1J5XA 2IDKA 1DKRA 3LWBA 2X7HA 3B6ZA 4WLVA 1NQAO 4OAOA 4G67A 2I62A 3PLAE 5FTLA 1ZOIA 1FXSA 4W6ZA 5ALIA 4YUYA 4B73A 3AZPA 5F3RA 1OLXB 2CL6X 2H1OA 1BHO1 3O8QA 2GZMA 5B64A 5IKMA 1FP4B 2DHEA 1CQJB 1P19A 3F1KA 1COWA 3PJDA 3DOFA 3WL7A 3LOPA 3NTVA 1XD2A 3PPYA 1X2EA 2W4MA 3IYLW 3PC4A 1TF5A 1OT3A 2Q3LA 5D3MB 5H59A 3E1SA 1FYFA 3BILA 5IXSA 4Y7DA 1Z2PX 3EF3A 2B1IA 3MN1A 5BUCA 1QH1A 1QS0B 3WYCA 3I04A 4O4JF 5E0KB 5D5HA 4BGUA 2Z0MA 5KC8A 3WI7A 1USVA 3EMVA 4XCXA 4ZC8A 4EBBA 4ESHA 5AM2A 3IEVA 3DL2A 3EEQA 3IP8A 5EXDA 4NCAA 1ZMXA 3W77A 4CMIB 2V3CC 1QCDA 4CL3A 4H7FA 1J0XO 2VCEA 1U9CA 4EATA 5BSGA 4Q7LA 1DT5A 2VDQB 3H5VA 1L7BA 4YO8A 4AD8A 1H69A 2ZM5A 2W00A 3FMIA 1QVAA 3IP6A 3LIPA 5LDHA 1EX6A 3KHKA 1CE8A 1K4MA 5DLQC 2PR2A 2ZR9A 2FDCA 4ENVA 4DBZA 1FU7A 4WOCA 4ZDWA 3LHSA 3O7WA 3E6AA 1U4SA 1NN5A 4KBGA 1E5XA 4FILA 4IGIA 2BHSA 2WMDA 3KJIA 3BX1A 5K9ZA 4CUKA 1QC5B 1YBMA 2JGNA 3ZD9A 2PKRA 2EVWX 4RGBA 2P35A 1WNFA 3LP6A 5ILOA 2QPAA 3O8QB 3GCZA 5FFFA 2C2ZA 1W2GA 1CR6A 1W5AA 1CQIA 1X74A 2JI7A 4XYGA 3S99A 3ZDEA 5D84A 4R1TA 2B8NA 4AY5A 4KRYA 2OTCA 3DBHB 2G6TA 1QYRA 1Z18A 3ASZA 1PWEA 3DDUA 1JR4A 2HKIA 3Q7RA 5DI3B 1E5QA 1NI5A 4MS1A 2W43A 1U94A 3BFPA 3ZU6A 5KNBH 1Y7IA 2BSAA 2IUYA 1C3VA 1A8SA 4LPKA 5SYAA 4C01A 3TOSA 4Y6OA 5I47A 3T41A 4BLUA 2ZGVA 2J9FA 2EF0A 2VHYA 2GN8A 3LXRA 3GLSA 2XW6A 3CJRA 3QY9A 4MW0A 2PLFA 3HXLA 3S8MA 1ODJA 5E2IA 4ZAZA 2N75A 3LY5A 3S2YA 3UBMA 1O8BA 1NY5A 1OLUB 3SC2A 1M2NA 2F3TA 4DQLA 4E5MA 4MA4A 3C3JA 2WVAA 4M8KA 4LN1A 4WX2B 5HRUA 1QP0A 2AR9A 3H2GA 3FNEA 4Q3LA 3ROQA 3ZJ4A 4QICA 5CFMA 3EC1A 1RTTA 4LTMA 1C9DB 3RJTA 4QBKA 1NWCA 3OA0A 3PHCA 1OX4B 5BOVA 5CEJA 5JWRA 3L5KA 4JENA 3A2MA 4DTCA 2IXDA 4ER3A 1EFRD 4URFA 3V6MA 3JW8A 2ZVPX 1Y80A 4OXYA 4MYSA 3X3HA 5A7GA 2ZRPA 4MUMA 2UYGA 3N6VA 1IN5A 4NLLA 4WA7A 1X0VA 2Q6IA 3GRFA 2CYCA 4FHDA 4C4SA 1NVAA 2GNOA 2QRLA 3MUNA 1UMBB 2B3TA 3RSFA 3BA6A 2XDQA 3I04M 1G41A 3ZWYA 1EDOA 1N6PA 3L1VA 1M1XB 1X70A 3E22A 4A0FA 1KK2A 2QN8A 2P30A 1LC3A 2ZAMA 4R2XA 4YRIA 4ZI7A 1OI4A 2CLCX 4LJ7A 1IVNA 3B20A 3EODA 3EQ8A 4C0QC 1K3FA 4JJ8A 4YMVA 2CJWB 5EJEA 3FLEA 2NVBA 3T5CA 2QMZA 4X6YA 3C6YA 4LJ9A 3F7NA 2DQSA 1Y4UA 2OZLA 2V4MA 4EG8A 1QAOA 1YQQA 4W1RA 4IMPA 2J09A 1O4WA 4BQFA 2XEXA 4J29A 1HETA 1XA0A 2QJOA 3C45A 1UBJS 1GZDA 5B3LA 2IS4A 4XX0B 3VR6D 1PO7A 1IU9A 3CMMA 5GPBA 5DXFA 3CX7A 1QH1B 1JXAA 4IDBA 2H85A 4QBHA 3U4QB 3RF7A 4J49A 4UEOA 4UBJA 2FPGB 3U1BA 1W7AA 2I67A 3RS5A 3M3DA 1I6WA 2UAGA 2XTZA 3KTAB 4DVGA 1DDOA 1K8QA 3EZFA 2JBAB 2GTPA 2X8JA 1TYZA 4EECA 4FMCF 5K5EA 4ND6A 4HG2A 4ZT4A 4CMIA 4GL4A 3K31A 1B8NA 5DYIA 3RAGA 1XZGA 3KYCA 3WWYA 4BXOB 3I3SR 3R8CA 1JJ7A 4PLVA 1CQWA 4ZA2A 2VCHA 3RTEA 3FGOA 1LPNA 3EUFA 3H75A 4Q4HA 4V02A 4GX1A 3VFDA 3MOGA 3QEAZ 1EI9A 2Y9PB 2WT9A 4YROA 3NHFA 2OCGA 3H9CA 2OVBA 4M22A 3S44A 5M2QA 5JDCC 1KH3A 4ASUD 2J3QA 5HIJA 5C32A 1RMYA 1RYHA 1W94A 4FMDB 5KSZA 1Q1QA 5CCEA 5T3UA 1P2SA 1RKUA 5L40A 1BWSA 1YB6A 3P9YA 4L02A 4JLOA 1Q16A 4RHTA 2ZB7A 3TNDA 4FYJA 3LUGA 5GINE 1WZUA 4OQFA 4KQFA 1J97A 5DTIA 1FDOA 2IW3A 4N12A 2BF4A 2LD4A 3K32A 3PS9A 4D9NA 2HCRA 3IQZA 1UMDA 3P94A 4TXHA 4EHIA 2WU3A 2PEYA 2VJBA 3QW2A 3S7ZA 3SM9A 5IWCA 3ZZUA 1FU4A 4JVOA 2V0GA 1KJJA 3B12A 4K9DA 1GL3A 1ZMRA 1FYDA 4HAUA 5A05A 5TIIA 5IVKA 4LHXA 3IMGA 2CBZA 3WGKA 1SKYE 2BFCB 1AE1A 3VDQA 4BJ5A 4CCYB 2O54A 3DKRA 4KVZA 2OYRA 1THGA 2CF6A 2GN4A 1APBA 4OSPA 1XTUA 5GQSA 2VZLA 1X7HA 3EGIA 3K9CA 4F4FA 4CUJA 4DNXA 1JL3A 3Q7TA 2CLLB 5C5IA 3ZZ0A 5AVUA 2HJSA 3U1VA 3PHLA 4AZ3A 2FOIA 3AYXB 3RQSA 5CXQA 5JZVA 1JKJA 4HDRA 4WCFC 2G9NA 4KLNA 4UOQA 5EWMA 4KX3A 4BQOA 2UZAA 3GY0A 3MOSA 3KNZA 3L0SA 5AJYA 2GM4A 4OK5A 4UM9B 1CUXA 2AFIB 3O8RA 5CCBA 1IY8A 3K1TA 5CB4A 4HDSA 2O07A 1IN8A 3CH4B 3U3JA 1PJLA 3U16A 3LH5A 5F1KA 4YAUA 2ZBDA 4JYMA 1RM5A 3FHOA 5DCUA 3D6NB 5GGYA 2C3PA 4I8IA 4FR0A 3F1LA 3P2EA 3EW9A 5K7SA 1G1AA 2Y0BA 4NNJA 1J33A 2VBFA 4FC6A 1P6UA 3OX2A 5K0BA 1ECLA 2X22A 1S89A 4MIKA 4G01B 3RBXA 3E22B 2B1JA 2R86A 1A4XA 3P4UA 2AMYA 1AG9A 4QXRA 4RZIA 4W5JA 2Q6KA 4XCVA 1EA7A 5KTPA 2HV8A 4YP7A 2HGZA 2PXXA 1ISSA 3H17A 5AJUA 3D3EA 2IYXA 1YS7A 1G5QA 3R23A 1NLYA 3D6FA 4RFLA 1ZN2A 3F46A 4LJSA 5IW8A 3WL3A 1XL1A 3PXDA 1RWXA 2YVLA 4LF4B 4FDVA 4E07A 4H77A 5AW7A 1C9MA 4C0BA 1PK8A 5LQJA 2UYHA 1RXCA 3GQVA 4XUDA 2AE1A 2R4QA 2VJLA 3V8VA 2VNIA 4RM3A 5H5JA 2Q3EA 2HLDA 4O2BF 5I9BA 4QOIA 2IHTA 4Z4HA 1CW2B 1C14A 3K0EA 3M4YA 1OBVA 3QBVA 3QJYA 3R6GA 4L22A 5EHIA 5K0NA 3STYA 3V2GA 3BGOS 3QKSB 4MS4B 2I03A 4PFJA 1P80A 4YB8A 3C7CB 1US8B 3QEKA 3SC4A 2R6CA 3T4EA 3TG2A 3NV7A 3WQRA 4H7EA 4ID9A 1P5JA 2HHJA 3CFYA 4RSGA 3VU0A 1X13A 3DXYA 3HJAA 4O4HA 4X85A 3VZQA 1NJGA 4K88A 4HX2A 3AHIA 3BL6A 2LE0A 3AR8A 1F7UA 2YHIA 1JDBB 2FR8C 1HRKA 1I1NA 3L7CA 5DU2A 5JO0A 2NZWA 3OOYA 4HTAA 3AUXA 4LI0A 5JJBA 2PO5A 1BS9A 3GJ4A 3T7AA 1F3LA 1MFZA 2WT4A 5DCYA 3VC2A 4WRRA 1M1YB 1ULHA 5IDVA 2O7VA 1M6EX 1HNZB 4EKDA 2C2HA 1T2NA 3B70A 2BZSA 1USGA 3H97A 4CDMA 2WWTA 1C0LA 4YCLA 1JIQA 1O9HA 1ANKA 3LF2A 1D6SA 1Z0JA 2PJZA 4JODA 1U6IA 4QUEA 4B85A 4S2EA 2WJHA 5FULA 2H2AA 2AI3A 2ZUWA 4YCSA 1GOTA 5BORA 2JLRA 3RSHA 3ICPA 3BJEA 1VG9B 1TFUA 1ZIXA 5TJ9A 2IF2A 3PWZA 4QLAA 1NMXA 5AI0A 5EUCA 4YJGA 3TRJA 4KN9S 1U0GA 2PJUA 1T34A 1SUEA 5B3JC 1XCBA 3PIRA 5KIAA 1SUPA 3RC7A 2NAFA 1VKOA 3HYRA 4RK4A 1Y82A 3K96A 4M0KA 2P2NA 3DXXA 5JMOA 3A6KA 3AY3A 5L3VA 5IUNC 4IHJA 3O2SB 2ILTA 2WF5A 3K6KA 4IUDS 3JAKA 3M3PA 1IDN1 2DFNA 2LZ0A 1VM6A 3BIJA 2PZ8A 4MPJA 1C3LA 4PSVA 4IJKA 4KV9A 1I3OA 4FDUA 4CMEA 1T2UA 3FYDA 4WLNA 3WB0A 3DEHA 4AP6A 4RXTA 4GUDA 4M9CA 5JADA 4AZ3B 1AX9A 3SDSA 3EC2A 3G7NA 4OHMA 1HLDA 3LS2A 4HWOA 4FYVA 4XRRA 3WGJA 4EJSC 5B1SA 4DA9A 3WHLA 3E48A 1JYSA 2GO7A 4IOJA 3BRSA 4AX8A 2X86A 2NP7A 3MSXA 4ARZA 1CETA 3N2NA 4JUAA 2OORA 1EK0A 2OO3A 1YIAA 1BU5A 4IIGA 4QXQA 4D0LB 4BCCA 1N2JA 4ASUA 4LGMA 4XOUA 4LRTB 4P7BA 2QG6A 5K3DA 4MGIR 3QYPA 5AHKA 1GU1A 3DZBA 1WDLA 1TU4A 1FS5A 2F6RA 1MX3A 3DDOA 3ZCUA 1CZKA 4H2DA 5A4DA 3O95A 5HSGA 3I5XA 3EHDA 4DV2B 1MCZA 2BH9A 4X93A 4U0JA 1H1LB 1W96A 2KI5A 4IX1A 3HY6A 1ZONA 4GZ3A 4D9FA 3PL5A 1N5KA 3AHDA 2QM8A 1G9XA 1TEVA 3E7XA 3WDLA 1BXRB 5JCPA 2A9PA 2XT9A 3UGKA 4L27A 2NO4A 4MLCA 2NG1A 3A4TA 1V16B 2CSXA 3G9TA 4OYRA 1M75A 2PUAA 1H6DA 3QIAA 4JI3B 1FSFA 1XWFA 1XZIA 1NYLA 3G79A 3H1EA 2O6LA 3ND7A 3IUYA 3FNGA 5KYXB 1V6CA 2MSCB 2BCJQ 3K0CA 3L6UA 3WK4A 4EO9A 1JQKA 3IFSA 3RYFA 4GXNA 4N3GA 3QHQA 2F59A 3PG5A 4IIUA 3IJPA 1KJ8A 3M7IA 1A2OA 1F8GA 3PYMA 5TNXA 5JZSA 1GPBA 4GGOA 3UK1A 1N9GB 1R0KA 2LBPA 4Q19A 3V46A 3ZW7A 1R16A 4X8MA 1VBFA 1M2EA 1USWA 1X9HA 2OV6A 2VRNA 1T6XA 4ISCA 4WERA 4XM1A 3U3XA 1TJYA 2Z3WA 4UDNA 5CA1B 2OZKA 5KNCA 3PC3A 4UOZA 1QKIA 2R5NA 3LDUA 5DZSA 3X1JA 5BVGB 2QL6A 2QUJA 5C35A 2ODNA 3MBKA 2MSDB 2G04A 1C9NA 2WHPA 3AB7A 4K9LA 3REFA 3T1YB 4R8KA 3S0JA 3AQIA 3F9IA 2VHZA 1OFUA 1WR8A 2A3RA 3DTYA 2VT2A 2V65A 4DSAA 1QYWA 3FB1A 1KK3A 2JAQA 1FP4A 1GQRA 1ZNWA 2XDYA 3KM0A 4HNVA 2FSVA 1G8GA 2P9CA 3IDFA 4M0UA 4XWTA 5EZYB 3HCEA 4AMZA 2G6BA 3W6ZA 1H0KA 3GJRA 3O4RA 4K6CA 1VKNA 1AXGA 3OEYA 5ALVA 5JQWA 5CHYA 4TS1A 1E2PA 4P98A 2M1ZA 3N5CA 1VSBA 2JJ1A 1OTHA 2OUIA 2VF8A 3LBYA 5KKCA 3BGIA 3AL0C 1T8PA 2X3UA 3DDZX 4CR7A 2C1ZA 2Q7DA 1U3GA 4BJ3A 4AB1A 1DIOB 2ID8A 3O3MB 5GONA 1MW9X 1PJTA 1N9ZA 3I8SA 3ZH2A 3WLPA 2EX0A 2HPZA 4HR7A 221PA 3A1NA 3T9DA 5ADVA 3OFSA 1X86B 3OQ6A 5KBYA 3VHRA 4MUHA 3RFFA 3A11A 2O2JA 5KVCA 4HV4A 3VKFA 3TRIA 5KYWA 1IOLA 4BYMA 1ZNXA 4B46A 1PFGA 3D81A 2AZ4A 5JEDA 1Q0LA 4L9AA 2BFAA 1IH8A 2XGSA 4O4HF 3L5OA 4B3JA 1JBQA 4CTJA 2Z3VA 1FFWA 1R5NA 2F00A 3HBJA 2V0CA 3BD9A 5AW6A 3I92A 4G1UC 4KPEC 1EAYA 3OCUA 2ZRJA 3UUWA 4F4UA 3EZYA 2WWHA 2W8BB 4GXRA 5JO9A 3EWNA 3D1JA 4HNHA 1MQ8B 4IILA 4R7ZA 1KE1A 1P2GA 3RT7A 4PZLA 1CX9B 3LXMA 1U7PA 2HTEA 2Y2VA 1P44A 2ADFA 3O8OA 3ORQA 4QO7A 2JLWA 4HVCA 3C6ZA 3RSZA 3WG9A 2JFUA 3P2KA 1B6TA 5BSUA 3F6RA 2SKDA 4JBWA 3BQNB 3HXPA 1N3BA 4CI9A 4FFPA 1WB9A 2F3SA 2BTQA 1VC2A 2CZQA 2HWXA 3H4MA 2IV3A 4MZXA 4F2DA 2IXGA 1BYIA 1C3JA 2E4VA 1H05A 2FFRA 2EW8A 2X6RA 4E2FA 3EVBA 4BMSA 1TZMA 5JSKA 3HI4A 4ND8B 4XD7D 1O5IA 3FRIA 3KQSA 4A8JB 4EP1A 3U4CA 1PFQA 1VMIA 4RVOA 5DRTA 4EB6B 1OZGA 4B47A 1T0IA 1U0OC 2EOAA 2JVKA 1HL3A 5C8ZA 4G5SA 2PUTA 1XMOB 1BHSA 3A26A 1KJWA 1CG6A 2ADOA 2WYIA 4O2AF 4N7BA 4WQMA 3ZHVA 4INAA 1DFHA 1LC0A 4HDCA 3EBOA 1MO4A 3LK6A 3UQYS 1ND6A 2F64A 4RJKA 1JPJA 4GOLD 3DVSX 1OHHD 2RK4A 5IJ9A 2PIAA 2ZK7A 4MR7B 1GPNA 1TYEB 1ZH8A 1ZUWA 1JUDA 1KJNA 4J2TA 1P75A 4S0XA 5KJ1A 3VTFA 3R74A 4RNDB 1G7RA 4LPSA 3KXIA 3RLFA 2C04A 1W85A 1JE0A 2WFLA 3OHMA 1F0PA 4R5HA 1YRQA 4DA4A 3K5IA 2ZJZA 3QU2A 4QBTA 1WVGA 5BY2A 3R8XA 3L6EA 1XRQA 2Q6LA 4NPCA 7REQA 4PNHA 5LP6B 4KJZA 2UXCB 3RRXA 1RBMA 1RWBA 1Q74A 4WN9B 3AY0A 4O6VA 2X1VA 2LW7A 1EHCA 1AQ6A 3PNBA 4OPMA 2GN6A 2ESRA 2X0FA 5I51A 1CULC 1VLMA 2YC2C 4BVEA 2B99A 2ONKA 4WMLA 1NP6A 4D1YA 5H81A 2VPQA 5DM0A 1IOZA 1SD2A 1WXIA 4OQYA 1L7OA 2NNLD 4TKUA 4YCAA 3GJ3A 4M9ZA 5TEVA 4B44A 3PR2B 4C4PA 1XZPA 1N33B 3H42B 4ROSA 3RAEC 1UEIA 5I8WA 2PGXA 3RTGA 1Z73A 5A5FA 1K0FA 5DKFA 5BV8A 4ZICA 1XMSA 2YJ3A 2QUAA 3U09A 1R6TA 3K2IA 4LFCB 9ABPA 3OCVA 3EAFA 2CT8A 5DOZA 1Q7CA 1GG9A 3ZWDA 5IF9A 3VAZA 3U4MA 3KOWA 1FUKA 2Q49A 5H70A 1SEVA 1LX7A 2WHRA 2ZIGA 2R6FA 1P1HA 2ODAA 4OL9A 2C3UA 1LSOA 3BH0A 3K1ZA 1HV8A 3WO1A 4BNUA 3PL1A 5LSAA 3SC2B 1ZKMA 2GZDA 1EGHA 2Z5FA 3IUJA 1Q0RA 3WGNA 4RH3A 2H4JA 3FCOA 2IIBA 2HLHA 2WFLB 4OQMA 3KEOA 1C9JA 3FOWA 3MWJA 4QEDA 5H9VA 1PTKA 3A25A 4LHZA 1II8B 1WV0A 2AQ8A 3GLFB 4MPDA 3N07A 2H1LA 1K92A 3WMFA 1UJMA 2PX4A 2YFHA 4HGOA 2I1WA 4UNNA 3OFKA 2YN0A 4A26A 4ZKDA 3L0YA 4B6FA 2C5HA 2PFKA 1KMHB 3U26A 1TK2A 1TD1A 3D7MA 1QGUA 4G5HA 4X7PA 2B2NA 1AGYA 1KU6A 4JVNA 3PGVA 2WSSD 2XNKA 2P77A 5CM2Z 5FTNA 3X0DA 1RRPA 4QD3A 4C2AA 4F8EA 3C6MA 2GD0A 3ZYZA 4RK6A 1FRFS 5B6IA 2WP8J 2VKTA 5GTDA 3OWHA 3UATA 3DB1A 5CM8B 1ZW6A 3I6BA 3U3DA 3O82A 4Q3KA 3WYFA 5BSEA 4TXLA 5AKGA 2VJKA 4PV7A 4DQKA 3KR9A 4N5MA 3ESCA 4FQ7A 3KFLA 2GF9A 2Q0XA 2V54A 3H2BA 1CUIA 3N8IA 4FBLA 4KMMA 1UWCA 5DBEX 5TQVA 4MJXA 3SIXA 3KTDA 2AZDA 3D0QA 1MOPA 4CDRA 5CNKA 5TMEA 1FC0A 3ROGA 4DXAA 4JR1A 4YRLA 3HWRA 4LF8B 4W1SA 2VHJA 2N46A 1SXJA 1XVLA 1UZAA 2ZAOA 3ZZNA 3BZUA 4GVXA 4OA5A 1YQXA 4W8HA 4KN8A 4BYGA 4XUCA 2D6FA 1EM6A 2NO0A 3BJZA 4MB6A 4WL0A 1P45A 5EJMA 1AO3A 1JQJC 1TZ2A 2EKBA 3KT6A 1SBYA 2RJOA 3GWZA 1RYBA 4V0LA 4ARUA 2HMSA 3C3XA 3H04A 3ZE0B 1RMTA 3IPLA 1WABA 2OGZA 1NBHA 1T9GS 1OX6A 3KJEA 4NU6A 3R3HA 1B26A 1ZUHA 1QO9A 1EA5A 1ZNQO 3KOZA 4G89A 3I39X 4MQFB 4LGYA 1DEHA 1NQWA 4AJPA 3D3JA 4BX8A 1E62A 1QIFA 5C37A 2ORED 4GPTA 1ZMTA 4FGSA 3ZIUA 4CCSA 4E32A 3T3NA 1NMQA 3BA1A 2QP9X 3SE0A 3LVRE 4BMYA 1LRKA 1RZ3A 4CKBA 2CLIB 4P53A 1G5TA 4WNYA 1CQIB 5BO5A 1V5WA 4GOKA 4QRDA 1L5NA 1AK1A 4YUZA 3A1EA 4AJIA 4B34A 1XNQB 1RKVA 2MIIA 3N76A 4DR6B 3TBHA 3TTYA 4FFDA 5EJ7A 2GK4A 2YZNA 1MEEA 3UWOA 4TZKA 2Z9DA 4R0MA 3NTQA 2QDXA 1P7YA 2QQFA 3FWKA 1FA9A 5F52A 3WYEA 4EYSA 2VR1A 1Z25A 4JHLA 5KNLA 1OXTA 2CXNA 2IIVA 2W93A 3EC7A 2ZI6A 3MPUA 5LOVF 1XAGA 1J0AA 2PGJA 3CTMA 4CL2A 3ZWCA 4LG1A 4C14A 1BDHA 3DBLA 3UMVA 1EGVB 1J9GA 4EJMA 3I4FA 3OTGA 3LDGA 1JAZA 3B38A 3C74A 3LT1A 1YZGA 4PE5B 1W49A 1E63A 4J7AA 4U00A 3WGHA 3TF5A 1T1RA 3TTXA 3OSUA 2CLKB 3OI7A 1CY6A 5ALPA 4JCOA 3N2IA 4NU5A 2DHQA 3C6KA 2W2XA 4H7HA 1KI3A 1VIDA 2Q27A 1T9AA 1TM4E 3SEAA 1F17A 1L5HB 4PX5A 3WGMA 3DPIA 3FOFC 1ZI6A 4N03A 1GADO 1L5FA 3ETEA 1NVKA 3W79A 2W2MA 3TL6A 2C2YA 3JVDA 3V8NA 4YAIA 3A1SA 1MKYA 4I50F 4ZEXA 2CBXA 3GGCA 1UIMA 1AZTA 3A32A 3EBLA 4GBJA 4DQDA 1FIUA 1S2GA 2ZAIA 5AM5A 1JLRA 3LW8A 3WLEA 5DULA 1X38A 1TUBA 1M2KA 2QI9C 3EARA 1O57A 5E1MA 4EI8A 3A3NA 1EFPB 3QM1A 4CTOA 1G8AA 3N7UA 2CUZA 3UHAA 5AUOB 1NJ1A 2IYLD 3IXQA 1CY2A 3EQZA 4O4JA 4BNIA 1IULA 5J4KA 1DNPA 5J2TF 1IHPA 4HLCA 5IM5A 2NYRA 3R5XA 4EI7A 5LU8A 1O87A 5ECGC 4YP5A 3SI7A 5IVDA 3OCYA 2CZCA 1GQYA 4MRRA 5AVTA 3VPXA 1NYTA 2XSZD 1WXDA 4DCCA 3BMNB 3EGDB 3DHNA 4M9QA 1DQZA 1GNQA 4P4TA 3BPSA 2CZGA 3LT0A 4FU0A 4BUJA 4DW8A 4NATA 1K4YA 3URMA 5LB4A 1BAPA 1OLXA 4ACBA 1E2EA 1XLTC 2GBIA 3MC1A 4XARA 1J90A 1UXJA 2BBTA 4N8DA 4W7IA 3F98A 5I7VA 2YKGA 3C3YA 4D9GA 4PZYA 2O48X 3BGWA 2I6FA 2VZ0A 2HBZA 4K9OA 3FJYA 2OHGA 4PNPA 4QU0A 5E3IA 1FVHA 3OZIA 2NN3C 4D2IA 4P22A 1XJ5A 2BDUA 2EBHX 2VPTA 1W1IA 3FX2A 3WRXC 4US2R 1GYQA 3IGFA 2VJYA 1EJ6A 1T2VA 5DLPA 4GX0A 3U3OA 2H5IA 2VRWA 4KQXA 2QF7A 4TL7A 1Q19A 1YZ3A 3NWOA 3STWA 3H2JA 1MH9A 2IUTA 1JE1A 5KREA 4ZREA 3E23A 4ZCQA 3B9QA 2B0CA 2J3JA 2SBTA 2EZ4A 3NZEA 3ZGOA 5E9WA 4JMPA 1KJIA 3OZRA 2PVCA 3JZFA 2Q5CA 1K6XA 4PFSA 4IOKA 1L7DA 5G4KA 3UNXA 4ACAA 1E3JA 3FHLA 4R2MA 2EERA 2H7XA 3DS8A 5KOHA 2VK2A 1RKQA 4R81A 3L79A 2XCRB 2IV2X 1NW5A 2GEVA 2CVQA 3RHFA 3MS4A 4GEKA 1M76A 4MMYB 4GLOA 4IZOA 4TTIA 4E2WA 3R3YA 3PFGA 2C9BA 1IIBA 4ALNA 2ARKA 3WSVA 2C84A 4PLPA 4EA6A 2H2FA 1K4KA 4FFMA 1E64A 4ARBA 4CKZA 2I22A 4LK2A 5CPFA 5MN6A 1SCJA 3IP9A 1P0PA 5JS1A 4BZWA 1Q21A 1MG5A 4ZAYA 3DOEA 5AM0A 1DUVG 1W87A 3I01A 1SUWA 3VR6A 5JARA 3EH1A 2WD7B 5HXAA 1QU3A 1XDUA 1V2HE 4YPFA 4BNWA 4YRKA 5HKLA 1ZJ4A 3KVYA 5A71A 4IEIA 3ZQ4A 1E1NA 1V3UA 4LSMA 1PW7A 3MJTA 4BGEA 4HO1X 2FOLA 2V4UA 3V4PB 4HWTA 2JJQA 2J4FA 4AKTA 1DQPA 2UUBB 4V1CA 1MHTA 3EVEA 2CK3D 3VPGA 1YI1A 3T5PA 1ACLA 5AI9A 2P7IA 4J2HA 4OXNA 4Y9SA 1VCMA 3RO7A 1BHQ1 5B1EA 1BVUA 3QENA 4UULA 3K9LA 4FLFA 4XR4A 3ROZA 2CHQA 3TW6A 4FIDA 2O0KA 2GO1A 4PGFA 4RU1A 5J63A 1IEVA 3U0BA 4FNMA 5A4KA 1E79A 1P0CA 4FJ0A 1ISIA 5CPBA 2IKSA 3QNMA 4TUYB 3TS1A 1S3GA 4AI6A 1T3HA 2GK3A 4GWGA 4UVHA 1JPVA 2GPYA 1SQFA 3ISJA 4G37A 4LSGA 3Q10A 5T64A 2MMGA 3PDWA 3IBYA 1CY4A 1UINA 2BFDA 4V3BA 2N3ZA 3QU7A 5AJHA 2WF6A 1S1CA 4UBNA 2VDWA 1XTRA 2RAVA 2Q0QA 1E96A 2IBMA 4DCUA 1WIWA 3KU1A 3OAAD 3QOYA 4NFLA 5FO1A 5M7EA 4FM9A 2MYPA 1CEQA 3EK2A 3MHPA 2CE2X 4KREA 5C5DA 4Z7JA 5DWVA 2PM8A 3CKKA 2PO7A 2XUFA 3TSAA 1XV5A 3NWPA 2X0NA 4IKOA 4JKYA 4KVAA 1KR5A 4P35A 5EIHA 1K89A 1A5ZA 2FDRA 3H6KA 1D6NA 3JQAA 3KTFA 1IM5A 2PRSA 2IHYA 3QWFA 4NZPA 3D4BA 3MNFA 3PRHA 1BE6A 4IKPA 4BN4A 2RE8A 1YR9A 1BGVA 1H8ED 6PFKA 3QXGA 2HJ9A 2QSJA 1K2WA 2ZEJA 4MYRA 4ZMRA 2HA6A 4I1SA 1UMCA 4GOJA 2FP3A 2QG4A 3QKSA 2QJFA 4MS4A 1L7RA 4H31A 4WOPA 1CNEA 3KWLA 4FI3F 3EZ9A 1NVUQ 4RXMA 3DMYA 4DBVO 1UM9A 2P1RA 3CRRA 2EL7A 2D1YA 3PUHA 5FOQA 3IUEA 3AM3A 4OM7A 4MX8A 3THYA 1DAIA 1O54A 1D09A 1I51A 1KVSA 3AQ4A 2FZVA 2Q5OA 3R0QA 3MGAA 2P6OA 4HB3A 3RS2A 1E7QA 2ZW9A 4GR4A 4Q3AA 3KK0A 2P3OA 4LZOA 2IHBA 3OCJA 5DLYA 1KY3A 3G5MA 1M8FA 1N5MA 1LVHA 2VH1A 4BO0A 2Z5VA 3HB1A 4G5GA 2AYZA 3HGTA 3MCAA 1KQPA 4NCXA 1AQUA 1MV5A 2ERYA 3H2KA 3OTQA 3KYIB 1YR8A 4ZAWA 5AICA 1LPAB 2L0XA 5EE1A 2ZYRA 3BCSA 4BIIA 1M9NA 2Q2WA 1P2VA 3FD8A 5FXMA 1QRTA 1L8XA 2WUDA 4XWGA 3AFGA 5A5VA 1XYGA 3CH6A 4G5YA 2OA0A 2V7UA 3SVTA 2XTNA 1AD2A 2AK3A 3PFIA 1O0BA 3TBKA 4C6SA 1E1YA 2FCRA 4WOBA 3BZBA 3OO1A 1FUUA 3EA5A 3LYUA 4RZUA 5T3YA 3W4JA 1Q3KA 2XAAA 4G4SP 4JEHA 5DB4A 5BSWA 4TYYA 1DAFA 1XAHA 5CFPA 3R6WA 3LO8A 1NN3A 2G4CA 4U4AA 3MSCA 4AP9A 1HNXB 4DPMA 3EVFA 1QZZA 5JTUA 3L43A 3EG9A 1C4KA 3I1JA 3UQZA 2W6IA 3DLBA 4ZP1A 2QVGA 1PT5A 2X5XA 1HYQA 1CUWA 4NRDA 4RVGA 4UU7A 4HWGA 1MVLA 1SXJE 3OU2A 2CNBA 2ZYIA 2XGOA 3P2IA 4KXMA 4YJ2B 1NUPA 5JZMA 5KNDA 1UQUA 3LLMA 1XTBA 4OJNA 4C4XA 3UC5A 4KR7A 1VYVA 1N8KA 3UXMA 5BR4A 5G02A 4S1VA 3FCXA 4I1IA 1VE7A 2DBYA 2DLNA 1RPAA 2NVUA 5F12A 3RRNA 3TPCA 5K8JB 1UC4B 4M1EA 5EWJB 1V4VA 4FUTA 4PLTA 4J1TC 3OY2A 3KJXA 4C0LA 1HLFA 3ZH9B 1PEAA 1RP1A 4PO8A 1E9VA 2W6QA 3K4PA 1C7RA 1LDNA 3ZKAA 1RLOA 2YY7A 4C5AA 2IQIA 2VYQA 1Z3CA 4JUDX 4TWBA 2W8BA 5THXA 1K7CA 4QARA 1WM1A 4KVGA 5EGNA 5IJ0B 4DLTA 1E9BA 1QE5A 1SCKA 2NU6B 1EVLA 2RGXA 1YQGA 1RAHA 1TA4A 1QJ4A 3KEFA 3LP8A 4G1EB 4CTKA 4D8TA 2L69A 1M1UA 3O8OB 2BKLA 3OFJA 1P33A 1NX9A 2Y6VA 2OPHA 1QK5A 3HJRA 3IPXA 1CUYA 1KZGB 3R6DA 3TTVA 1FQWA 1VMAA 3MWDA 5IMSA 1LEHA 4EJ6A 3DYVA 2I3DA 4AF7A 3GT3A 1FXUA 1NZFA 2WB4A 5EUBA 4BNGA 3MMNA 3G1WA 4EUNA 1ZRMA 1W75A 1ZM9A 4N5DA 1EFLA 3GF4A 2E18A 1IN6A 3AETA 4NMXB 3I5YA 3D3WB 4EL5A 2IA5A 1YQEA 2CFCA 1PJQA 3V7YA 3G7SA 1YL6A 3P9QA 2HZBA 5BV1A 5EPUA 2R79A 3AFOA 2DCMA 1RM0A 3NUZA 1E6WA 1LK5A 5AW3A 3E70C 3QJ5A 4X8HA 2Y71A 1IWPB 1Q6ZA 2IWHA 1UDWA 3CPSA 1XEXB 3DM9B 4BE7B 4DMGA 3G8DA 1YI0A 3EUAA 5FUQA 1SUBA 1WP9A 4RKQA 3OC0A 4MUFA 2BBSA 2EIXA 2FSFA 4QYXA 2X6TA 2MWMA 4J0JA 4WZBA 2RC6A 1NNI1 4QUHA 1BJRE 2VPXA 2ROQA 1EXMA 4PLHA 1JTVA 1K7EB 2ODPA 3IKJA 4K9NA 4AKHA 3IT1A 3ZNQA 4GC9A 2BTOA 1DHRA 5FX2A 2VTDA 3OLWA 3DMTA 3KC2A 2UZ4A 4LNAA 3GLRA 3TLJA 4TYQA 2CMKA 1SURA 3ZU3A 2FZ5A 3IVCA 1JMKC 1QUFA 3WFJA 1M5TA 4KO2S 1BMFD 5FP0A 5HRCA 2WD9A 2FSSA 2AI1A 2VHTA 4IF4A 4YBZA 3SQXA 2BM8A 4FDMA 2QTLA 5AVQA 2ODBA 1H22A 2Q2VA 3TECE 4RQTA 1FFHA 1PYOA 3OA2A 1JEQB 3II6X 3LCJA 1T4MA 3D54D 5C51B 1YUMA 2EEZA 1BOFA 3LKDA 5EKDA 2W2KB 3TW4A 5KX5F 4GNRA 3BF7A 1WXXA 1V8OA 2RH9B 4Y98A 1W0JD 4I9GA 3TVDA 4BVGA 2Z6UA 3TIVA 2DFPA 3I73A 4L6AA 3VV3A 2QRQA 4GRDA 5CTAA 1PBNA 721PA 3UHFA 5FBHA 1S01A 3EXAA 1O58A 1VSVA 3GRKA 3SHQA 1N77A 2V4ZA 4F4DA 2GWRA 1V25A 1EBUA 3C3CA 2MYUA 2OT3B 4JLUA 4XJSA 4JI0B 3OHPA 1ECBA 2PX0A 5DWQA 2OGSA 3FAZA 3NBUA 1U0JA 3KBBA 3I2IA 1AURA 1T0HB 3FJ1A 3TRHA 5CB4F 1Y9EA 3EN0A 1GPWB 2CY0A 4IIEA 3L04A 1K6MA 3RK4A 4J3JA 2VC2B 5JNTA 1R6DA 4DOMA 5IT9A 4Z53A 2V3VA 3OZAA 1EP2B 1TT5A 4RPJA 3CV3A 3E82A 3NEAA 4J1SA 5HBGA 1CZLA 3IDZA 3OZGA 2VH5R 2X7JA 3M5WA 4GFDA 2HHCA 4X1YB 5ABPA 4TYNA 1I5OA 1E92A 2PWZA 1KEEB 4O2AB 3RKRA 3THSA 1AIPA 2A1TR 4JNCA 3K5HA 2YMLA 4G56A 3HKDB 4LBWA 3MLAA 4NHEA 5AESA 1UJ6A 4CMCA 2UVDA 1Y3IA 2SCUA 1U63A 4HQLA 2CVHA 3BMXA 2JFNA 1ZIOA 4CMKA 3O91A 2CXUA 4AF8A 3NHKA 5DNCA 2R3SA 1UOOA 2F3PA 3DP9A 3GUVA 4FX5A 1YQ9A 4H16A 4WHMA 4MQ6A 5B3JA 5I7HA 4B3FX 2NIPA 2VAVA 1T2AA 1GT91 2FZEA 1V45E 3A3PA 1O9BA 3M5PA 3T12A 3HY4A 3SHTA 4OI2A 3ANMA 2G8NA 1DELA 2B36A 1EPUA 3GGDA 4TV8F 4FGJA 1DKOA 1DJLA 3FDJA 4LYHA 1MJ5A 3QXCA 1SPXA 2OAGA 3KRTA 1I7PA 4HS9A 1NT2A 3KBOA 1KOJA 1P1CA 3AU8A 1MDBA 2XZOA 3NDRA 1S5PA 1Z82A 3NRJA 2X0DA 4JJ4A 2JGDA 1JPUA 5EFZA 4EG6A 5B55A 1H2YA 2IYVA 5G3YA 5DV9A 1WF3A 4MGEA 4QC2A 1T3ZA 3N58A 4YQZA 4I1OA 3WISA 4H3KB 2ACWA 3TXAA 1GJRA 3JQ8B 1FK8A 4YDSA 2XXAA 4HK4A 2IPAB 3RK0A 1HKUA 1J7JA 4BC0A 5HCIA 1UANA 4PGGA 2W6ID 3BC1A 2HCBA 2HA3A 1Z26A 1QK3A 3BD6A 1SD1A 2IFTA 2QLNA 3Q8LA 3NIWA 3U9TA 1ZVQA 2B8WA 2DVMA 2JIDA 2QLBA 1NIPA 2HF2A 1WPGA 2XDAA 3P32A 1JN0A 4BU1A 4GXTA 2GLXA 5KYWB 4QGSA 2H0QA 4GE0A 2WLSA 3HKBA 2AUMA 3TLEA 2KE5A 4LGVA 4RHFA 5IDXA 2A2ZA 4ND7A 1W35A 4WGFA 1DKNA 1EFCA 3DUFB 3I5AA 4MP3A 5LD2C 1Z4LA 2MINA 3MT8A 3S8YA 1EIZA 5DX1A 2FI1A 1A69A 3MGCA 4PU0A 2IEIA 2ON6A 4XQ9A 4YS6A 5GWXA 1XEWY 1TRKA 3AG5A 4O2LA 3W5HA 2J46A 2VNSA 3EOZA 3HJHA 4YCMA 4INOA 5BYKA 2HD4A 3OE5A 2ZWOA 4JITA 1QB7A 4U2BA 2DZDA 1M74A 5DHPA 3INGA 3GRVA 3H2SA 1X1EA 1PIWA 1YE5A 1N2CB 3MQ2A 3CRVA 4P33A 1IBRA 3G5TA 3VH2A 3QVGB 2VDPB 1ZI9A 3WLFA 4Q9AA 4B4UA 2PJRA 1E1KA 1HDRA 3LYLA 4ZWNA 3IJRA 1SZJG 3MTDA 5ALWA 3LLUA 5K0JA 3P5SA 4FCWA 4HRAA 2DQ4A 1ZH6A 2REXB 3LWNA 3WLHA 5CVUA 1AV7A 1FNBA 1F8YA 2F4NA 5EXXA 4PAGA 2O8DA 4CCWA 1EFTA 4K9PA 4YJ3A 2HCTA 1FXWA 1BQEA 2Y68A 2W2LD 2Z1DA 4JS0A 1M83A 4EDHA 2C3OA 3ICEA 2FLWA 1N6RA 3DONA 4IIXA 1Z5NA 2OAEA 5FUYA 1VRVA 3VU8A 2A5YB 4KN5A 1MENA 1XKXA 3LDFA 3ZTTA 1STOA 5F1YA 1E99A 4UM7A 4MVWA 2LKDA 2YHSA 1LKZA 3B51X 4DDHA 3I9KA 2DY0A 1M3SA 4LYAA 1D0VA 3HVHA 1MC8A 3R75A 5AHWA 3T4XA 3H1AA 1PT7A 3OLQA 3V00A 2GTHA 2DCUA 1TT5B 4F5YA 4A6XA 5F2OA 2ODQA 3C2QA 2Y0EA 4GP7A 3NGXA 4L4XA 2Z2JA 4QODA 2A0XA 2J48A 4UHDA 5JBNA 2ZYDA 3SZOA 2P6RA 2VRBA 2BUAA 2IYOA 3ASVA 5C8VA 2I3BA 1C9YA 1PSZA 1S8NA 2HCFA 3GEMA 3IVGA 4J76A 2WIKA 1YJQA 3CZQA 4UVGA 3MOIA 4X3OA 1DIBA 2XQKA 4QG7A 3BREA 1NVVQ 5DTMA 4GECA 4XPIB 1HTWA 1Z12A 1A8UA 2XA9A 3A70A 1J49A 1QHNA 3CLKA 3JU3A 3R3XA 5FUBA 4C2UA 4BRWA 2GJ9A 3OZBA 2AN5A 2ZJ8A 3IIJA 4AN4A 5BSFA 1I2BA 5FPYA 2EGGA 1M2VB 4Y0NA 5ESXA 1WKVA 4F92B 4HEHA 3G2NA 3OQVA 3GGPA 3IV6A 1J8FA 2Z4TA 5ADHA 1LPSA 5BN4B 3DMDA 4B43A 1DC3A 1EWVA 3UN1A 1WVIA 1PSDA 1DTWB 4RQUA 1KYZA 1K6EA 4L7VA 1PK7A 5C4GB 5B4VA 5KOJB 2CFRA 4E5KA 1ADGA 4PPQA 3VR5H 2MT9A 2VKQA 1QFZA 3LVQE 2D1FA 5C1PA 3HL4A 2HGSA 4OJYA 4WT7A 4Z1OA 1NSFA 1F2DA 1XCLA 1F48A 3AUSA 3M8KA 1EK5A 1ZGBA 1BRMA 1RJWA 2PH1A 4ILKA 4MH0R 2WI8A 4ENUA 5I6DA 3C6QA 4MUNA 4UZEA 5HFAA 3BICA 5HTOA 1WD7A 1QK4A 3S68A 2X3YA 3HKEA 2CHGA 1L6IA 2QM3A 1KGDA 2OB2A 3FTQA 2QZ4A 3AR4A 3AWIA 4U7JA 1AHHA 4KSYA 2D54A 5IVIA 3QX3A 1KSGA 3GLFA 5C52B 4DGSA 2VPZA 3FTEA 1DWOA 2MINB 1PHPA 3KSRA 3EPLA 2H63A 1R9GA 3ZWMA 3KLNA 4KXWA 2EZ8A 3GLIA 2D2VA 3OE4A 3F8TA 3P9XA 4JQOA 3N2YA 2H59A 2BKVA 4XYMA 1KS2A 4C0JA 2BJHA 1NC1A 2ST1A 4HZUB 4F4CA 1JRLA 1X92A 1FFEA 3RVKA 3ZJUA 3FPKA 1WHSB 4HAYA 5ECWA 3EDQA 3H8VA 4MGKR 4LXGA 3GNQA 5IH7A 2J3MA 2Z83A 4EZIA 3JWIA 4BKPA 4C4RA 3ELDA 1XELA 3DBHA 3IBGA 2JD2A 1YR2A 2A5JA 4YRRA 4K81B 4QOSA 4E1AA 2QHXA 1OHHA 4QFBA 4ZVMA 2F8MA 1HNWB 2HSJA 2PMFA 3T1HB 2PRKA 3BM5A 2AOWA 4GMDA 3ZKWB 4UNQA 3R5HA 4N0DA 3D0KA 4PCAA 1Q0ZA 5IH3A 1ABEA 3GNTA 3OT1B 4IJQA 4MEBA 4CKEB 1UDXA 2GMWA 1J0DA 2R96A 2G1JA 1KAEA 1P5HA 4RJ2A 1BXKA 1H2XA 1XD2B 2JJ2D 2O0HA 3PWTA 4J4TA 4CLXA 4DGQA 3R20A 1KDRA 3O03A 2OVFA 2DPLA 4ZZ3A 4MYUA 5CXUA 5ANRB 1YU9A 1SHJA 3HL0A 4GOND 3IEMA 2O3UA 1N0UA 3QYFA 2QX6A 1I1QB 2Z2IA 3ZQKA 3ZPXA 3HKEB 4P3OA 2G1UA 2Z8XA 2ID9A 10MHA 3CN7A 4E88A 3LHFA 3SQWA 1MVNA 2GA8A 3THXB 3ZJVA 3MERA 2B1GA 3IDQA 5BSHA 2X77A 2KX7A 3BGDA 3LRTA 5ILGA 4DMMA 3E9EA 3LAWA 3CIOA 3CZPA 3IXMA 3ZI7A 1M8JA 4GQBA 1OC4A 3C3MA 3UTDA 4YGXB 4ROTA 3V42A 4BGVA 4WBNA 1UOEA 3AO0B 4I3HA 3D4OA 3KJHA 4HDQB 4L5BA 3SVZA 1KK0A 5IVHA 4NY1A 4MVJF 5L9AA 2JEZA 3OECA 4KAJA 3RS7A 1U9JA 4ARSA 5L4LA 3ICVA 3KZVA 2C03A 3F73A 2JFXA 4DLPA 2BGJA 3AR7A 4JY7A 2HIAA 1KI4A 3R41A 2IHNA 5F73A 4WXRA 2OY0A 1MXHA 1N5JA 1XTZA 2P3SA 3H84A 3MUFA 4YRCA 4BVJA 3PFBA 3MTJA 3GG9A 4F9EA 3A6GA 2ZT8A 1YF3A 1SMKA 1G55A 2Q4TA 4U9HS 4F5ZA 1XKTA 3AZQA 2WTAA 3NXKA 3QVJA 2FEXA 1IBCA 2F9FA 1YDFA 3UPDA 3ZXSA 4U7DA 2V7WA 3PI7A 1Q7BA 5K0ZA 2QD5A 1VDMA 1N6LA 3INTA 2ZSDA 4KBFA 1SH7A 2H2IA 3C5HA 4TTSA 4UEJA 3ZBUA 1TQ6A 3TMYA 4YJ2A 3S40A 4DV3B 2WNIA 5L7TA 1G21A 2VF7A 3VZRA 1RC0A 3CUUA 4ZRDA 3S2EA 3EVAA 4CM4A 2YZ2A 3LRXA 4GBMA 1KO4A 2Q3HA 3FZYA 4FFRA 4M1MA 1XRMA 2E49A 2XHZA 3PFKA 4KOAA 1JHOA 4P5EA 5A3SA 3ZEAA 3CM0A 4XH9B 3IMFA 4Z4IA 1KJZA 3TLYA 1MR3F 3H18A 2YBEA 2ZE5A 1YA6A 4IY1A 5EINA 3B6KA 3F97A 3QV1A 5CJPA 3OKPA 3SIRA 4Q00A 4ZALA 4RV4A 4NIMA 4BFYA 1QV7A 1Q77A 4OHVA 1X80B 2GUWA 4N6GA 1G7CA 1RWPA 2HFKA 1C3XA 2X14A 1CK4A 1WW2A 1OX4A 3DLPX 3OM8A 4R68A 5EIFA 3VAYA 2RGRA 1NI4B 5AW8A 1UP4A 1KQGA 1JR6A 5BN3A 4IMJB 4WY8A 2A86A 3OBIA 1NNUA 1U8AA 2GN0A 2YXLA 3PC7A 1N0IA 1PDVA 4J6EA 5CFNA 5I8PA 3WGZA 4D9IA 4RSRA 3NO4A 1DBRA 5BSMA 3R7DA 1KL7A 2Q4DA 4BY9E 4K9RA 4BRZA 1TB4A 1UBHS 2VAXA 3C7AA 2CDCA 4HDOB 1RACA 5AI4A 3BDVA 5FB3A 3EEFA 2NZYA 3PVSA 3R5JA 4MQBA 3WK7A 1VFNA 5JI2E 4PTZA 4KNYA 4JJZA 5JQGF 1Y1KE 2J32A 4PPNA 3DV0B 3HU3A 4U9IS 3W5DA 1IWOA 1THZA 1W6UA 4D41A 3HB7A 2ZIFA 4R7GA 2BD0A 4N0QA 1JV2B 2UKDA 1LK0A 5DSZA 4K2HA 4POAA 3KR1A 3T9FA 3FFXA 1N3IA 1VGVA 3E1GA 3RAJA 3VU9A 5MN4A 4XIYA 3MRXA 3NTRA 5TC4A 2B4RO 1SBQA 2VDJA 3AVQA 4IX9A 4O4LF 4LVNA 1EIWA 1P18A 4BFZA 4Q9IA 5CJJA 4YI3A 2DUJA 1U6KA 3G82C 5CITA 2MTBA 5HCNA 5IM4F 5K20A 1LX6A 1S0UA 1UKVY 1VP9A 2HUPA 2NVOA 4J7XA 1M6HA 4TMZA 1ACMA 1GHTA 2OFFA 2Q9UA 5IKEA 2QMUA 4XB2A 1U5AA 2G25A 2HIGA 3G2JA 3WLJA 3ZNNA 2TMKA 3W0LB 4KI7A 4QYIB 3EZNA 1BE0A 3OX3A 4QSMA 4QPZA 4W82A 2X8WA 3OEHA 2FG6C 4QJ4A 2D1QA 2OM2A 5FKJA 2VUIB 2EYQA 1W4LA 4U3JB 3CLRD 2NU7A 4BBJA 1XDGA 1ZICA 4DV7B 3SU8A 3WB9A 3K3PA 4FZVA 5ERYA 4ZI5A 3VDNB 5KU7A 1CUFA 4HWRA 2ZI9A 1ZOPA 3CW9A 3M5DA 2WHPB 2VA9A 5F5LA 5LZ2A 1P3JA 1IK6A 1Z74A 4M99A 4PVCA 4YRDA 2L2QA 3E9YA 4XFKA 4YMWA 2C4MA 3EMKA 2YWHA 2GAOA 3DAOA 1HFWA 5EQDA 4PGHA 1JEYB 2REOA 4OBWA 4CZ2A 3F96A 1IQPA 1ESMA 3QJGA 1BYUA 4FX2A 4IFTA 4RTKA 3H3XA 3BH7A 5THQA 3M9LA 5HVNA 4ZVQA 621PA 2WKRA 5TT1A 2X40A 5HF8A 2HRCA 1KH1A 4EHDA 4ZOLB 3CNHA 4KI0A 2UZ1A 2FN4A 2G40A 2GRUA 1OLSA 2VPWA 3LYAA 4PR0A 5HS4A 1YHNA 5IN5A 4RTPA 1C3EA 3EIUA 4C4AA 1G3QA 1CS4C 3JASA 3L46A 4AZTA 4CM8A 1AJEA 2AJ8A 1LBQA 1R12A 1TCBA 3A1WA 1L4MA 2YMQA 4JXXA 1U2ZA 5TPWB 2WTEA 4DDUA 4YI5A 1PKXA 1L5VA 1UBOS 1FDVA 3AERB 3GEBA 4IV5A 4N7JA 3E3OA 3TE7A 2R7MA 1JEEA 1D9ZA 2MYNA 5MDHA 4NOKA 1US8A 2VWPA 4P82A 4XGIA 1E66A 3PNSA 2O0JA 3ZJTA 1F51E 4IOMA 4PGAA 4PC3A 2HSZA 2G3YA 1JZSA 3F6BX 5AKHA 4PYQA 2H5JA 2PMKA 3ZVRA 3OAAA 5KDDA 2W11A 3GP5A 2DSTA 3NIFB 4QJ3A 4PN3A 1G291 5TARA 3WQQA 1Y42X 3G5AA 5K2MA 1TA9A 4TV8B 2WOOA 1ZXLA 2IOQA 1T29A 1OZAA 3I28A 4MQEA 5ERGB 2GZ3A 3K0FB 3FBGA 1BXZA 1JHXA 1WCWA 1W4ZA 1GGMA 2A6PA 3JQDA 3LBAA 3RS4A 5JNUA 2PWPA 1G6KA 3G2HA 1PUXA 1JAYA 2JIMA 3N0TA 2NTVA 4PSUA 2WT8A 4BBAA 4G0QA 3ZNOA 1NFFA 1DCKA 2GSWA 5THKA 2JGIA 1H85A 1ZGGA 1P4HA 4HUTA 2CXTA 2QMHA 4D82A 1SXHA 1NVVR 1MZVA 4RTRA 5DIZA 2UV8A 3QY0A 3KHTA 2OWDA 2IE0A 3QUQA 4YLGA 4LYGA 3R3WA 1ZJZA 4JT8A 2VA8A 4OHWA 4HFNA 3CVJA 6LDHA 1V9SA 2JA2A 3AV3A 4ES6A 1O8CA 4CIBA 3LE8A 1SUDA 4PC2A 4YDQA 4NF2A 5DNUA 3EZXA 3FYUC 4NEQA 5FUWA 5F23A 1K66A 3U44B 1TKAA 2B4YA 4MZDA 1ONNA 1SOUA 2FP4B 1E1CA 5JYEA 1NVEA 1L5SA 4MMXB 2P79A 1D7AA 4V0SA 3X2EA 1KYXA 4XCQA 2YIMA 1QIDA 1I7QB 2IP2A 1YZTA 3IPYA 2C31A 5HNKA 3OJWA 5ARDA 1WHTB 4NV1A 4PINA 5SY6A 5AUPB 1C7IA 2PBZA 1S4QA 1E89A 5ALSA 3MWYW 2AI2A 4BFSA 2A5GA 1QIGA 2PUJA 4PIMA 2FSUA 5JJCA 3QE0A 1SKUA 4D25A 4AJLA 4FPXA 4C4TA 3HDVA 3KSMA 1VCHA 1ZNYA 2IL1A 2G5CA 2QTCA 1W5FA 3CJQA 3CQ9A 4CRWB 4QU8A 3TUJC 1NM5A 3HLKA 4Q9JA 4BO4A 2FN7A 3GLVA 3OIVA 4CQJA 4FBGA 1SNYA 5FBWB 3ZJ5A 5C7OO 2XIJA 5AM1A 4HF7A 3T6KA 5HM8A 2YMMA 3WWPA 4D0RA 1YA8A 5I9TA 2NSYA 3C3KA 4OB6A 3C3AA 3SKXA 4ZYLA 3CLTC 4D43A 4WESB 4RD6A 3R0JA 4GYJA 1J9ZA 4N5HX 5TQ0B 1SCBA 1IBSA 4EMUA 2Q3MA 2WNHA 4TV9F 4WLUA 1MQ9A 4BO2A 4NBVA 3Q1LA 5B3AA 5MFZA 3EDMA 1FTNA 1NF3A 1UDBA 4ML3A 4NU0A 2AR7A 4ZOBA 1LRJA 4R9NA 1RC1A 4A2QA 1YC5A 4BLTA 1YTUA 1JFFB 1ID1A 2IE8A 2VEDA 1M6VB 4UHFA 3LY9A 1EWYA 3ZY2A 3QFCA 4F1KA 2IP4A 4UM9D 1WDMA 4A73A 5A06A 3FWNA 3J81k 3L8EA 2J6HA 2ZBEA 3RSQA 4EUSA 2J0QA 2CLEB 1CUCA 1RYYA 4QJBA 3L8ZA 2NV0A 4FOOA 3QFRA 3R3UA 4OI0A 1DL5A 2ZCVA 4YASA 3UAWA 2NX2A 3R5TA 4HBZA 1ZUNB 3V1NA 2DHCA 2WA1A 3UJ6A 1JJFA 1T8SA 4LWOA 4A6DA 4ZOCA 1UR5A 3JQBA 2W6NA 1Y8RB 1KKMA 1P0MA 4KRGA 2D1TA 3WGIA 2OHIA 3BE5A 2H7YA 3TMAA 3G88A 4Z1MA 3GXBA 4KQCA 4MHOA 2QR2A 1T8WA 1TQ4A 3OETA 4OY3A 5E8JA 3WQHA 1G20E 3PI6A 5U4XA 3UYKA 3Q3GE 5DYWA 1QDUA 2RBEA 1RYMA 5JVDA 2F1KA 1PLLA 2IZ6A 3DZHA 3I1FA 2PA3A 3NDIA 1QFJA 2D5LA