2Z2XA

Crystal structure of mature form of tk-subtilisin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Four new crystal structures of Tk-subtilisin in unautoprocessed, autoprocessed and mature forms: insight into structural changes during maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 115
structure length 317
sequence length 318
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2z2xA00
1AU9A 1Y48E 5AQEA 1WVMA 1SUPA 1SBCA 1ZVKA 3LPAA 2HD4A 3QTLA 1Y4AE 2GKOA 4ZOQI 4DZTA 4YN3A 1R0RE 3DVQX 1GA6A 1C9JA 3GT4A 3LXUX 3DE3X 3DW3X 1BFKA 3CO0S 3GCWA 3T41A 1SIOA 4C3VA 1PJ8A 3LPDA 1XF1A 5JXHA 1SIUA 1NDQA 1TO1E 3CNQS 2WUVA 1SUBA 3WQBA 3GT3A 1TMGE 1MPTA 1SN7A 1C3LA 4FONA 2IXTA 1THMA 5JXGA 1P7WA 4KPGA 1MEEA 3VYVA 2W2NA 2WWTA 4Z2AA 1P8JA 1R64A 2PQ2A 4KG7A 4NMXB 4J94A 4DJ5X 4M1ZA 4H6XA 1S01A 1Y3CE 1BFUA 1YU6A 3P5BA 3HJRA 2PMWB 2IY9A 1SUAA 1T1GA 1SELA 1TK2A 2ST1A 5JXJA 3LPCA 3ZXYA 1GNVA 1CSEE 2PYZA 2V8BA 1ST3A 2X8JB 2W2MA 1AK9A 5JXIA 3QFHA 1HT3A 5AVKA 1PTKA 5SICE 5B1DA 2SICE 1YJBA 4CFYA 2WV7A 1GTL1 1TM7E 1T1IA 2X8JA 3AFGA 4MZDA 1TM4E 5JMOA 3DWEX 1KE2A 4C3UA 3EIFA 3WIUA 2ID8A 1S02A 1KDYA 1TO2E 2XTJA 3A3OA 2Z58A 2DQKA 3D9QX 1SUDA 5FAXA 3ZXXA 2ZWPA 5CW1A 1Q5PA 1SPBS 5FBZA 3BX1A 1AF4A 4LVOA 1IAVA 5ARBA 3DVRX 3DDZX 3VHQA 1V6CA 2W2PA 3F7MA 1OYOA 3DW1X 3QMPA 4HVLA 3A3PA 3F49S 2WUWE 1LW6E 5AMXA 1WMEA 1SCBA 1KDVA 1GTG1 3H42B 1Y9ZA 3EDYA 1GA4A 3L1KA 2G4VA 1WMDA 1C9MA 4KB5A 3AJ9A 3GCXA 2B6NA 1AQNA 2ZRQA 3TI9A 3TI7A 3PRKE 1GCIA 1ST2A 3DE5X 1YJAA 1DUIA 4H6VA 5AVJA 1SCJA 4OMCA 1OT5A 4LVNA 3WHIA 4RYDA 2Z2XA 1JEAA 1Y3DE 4HX2A 1EGQA 4OV6B 1Y3BE 2SNIE 1BE8A 1KE1A 3Q40A 3A3NA 1GT91 3BPSA 3OSZA 3PTLA 1DBIA 3VTAA 2ZWOA 2Z2ZA 2Z2YA 1YJCA 5B1EA 3DE4X 1SVNA 1PEKE 2PRKA 2Z57A 3EE6A 3BGOS 1S2NA 1TM1E 2PKCA 5FFNA 4WOBA 1GNSA 3VV2A 1SCNE 4B5LA 1WMFA 1Y33E 4K8RB 3VV3A 1SUCA 5K7SA 1VSBA 4NE9A 1SH7A 4NE7A 3DVSX 1EA7A 2W2OA 1ZVJA 1Y34E 4DWWA 1SBTA 5ARCA 4CG0A 2XRMA 2SBTA 4ZARA 1UBNA 2Z56A 3Q5GA 3DE7X 1SBNE 1PFGA 3F7OA 1SBIA 2QTWB 4WOCA 1SCAA 4AKSA 3AJ8A 2W2QA 2PWBA 4BWGA 2DP4E 1CNMA 1A2QA 2SECE 2P4EA 3DYBA 1NDUA 1V5IA 4OMDA 1Y4DE 4I0WB 3SQOA 3DE0X 1Y1KE 3DE6X 3DE2X 1GTJ1 2TECE 3I2YX 1BH6A 5ARDA 3D43A 1WSDA 1TECE 1Y3FE 1SCDA 3I30X 1AH2A 1AV7A 3SICE 1C9NA 4AKTA 1AVTA 3DE1X 2DUJA 1OYVA 1IC6A 4JP8A 2Z30A 2PWAA 1SIBE 1TM5E 4GI3A 4H6WA 1TM3E 1SBHA 3I37X 4CFZA 1NLUA 3TECE 5I9SA 1KDZA 2ID4A 1R6VA 3VSBA 3WIVA 2E1PA 1P7VA 1GA1A 1SUEA 1T1EA 1BE6A 3I34X 2HPZA 3UNXA 1BJRE
chains in the Genus database with same CATH superfamily
4ZCRA 2HN9A 1WW2A 4QUAA 4YAJA 2YJ4A 1ZX1A 4MIYA 2JGNA 2HMAA 2GAJA 5TE9A 4X66B 3A4NA 2NV2B 4IILA 3VZQA 1WQ3A 3CA8A 3E7FA 2O1SA 3I1FA 4M8SA 4Q12A 4AMGA 4BTLA 1JHVA 1ZGJA 2JJ2A 1KL7A 3FZYA 3I6QA 4HLCA 5DNYB 1NW5A 3PLRA 4ZOAA 3ZGZA 4GKKB 4UBLA 3PRHA 2OB1A 2PH3A 2WSBA 3REQA 1E1QD 3WYEA 3I5XA 4RPHA 3BWVA 3BBLA 3CIOA 3DEHA 4KN9S 2B0JA 2CDCA 2H2WA 3JY6A 3PFFA 4BUZA 1KGDA 4YN3A 1THZA 3SJCA 3OPYB 4P82A 2GMWA 3VDQA 1ZD5A 1P3DA 4OYRA 1E7MA 4YMVA 4PLYA 2QRQA 4RQBA 3V8BA 1YUNA 3QI2A 4ND3A 2B61A 5ITZB 2HCRA 4Q82A 1WUYA 2VHYA 4TTSA 5FV4A 5IK2A 5CCDA 2GB4A 4JUIA 2HIHA 2VDVE 3S1LA 1SO8A 3P0RA 4TL7A 4I1VA 5C3MA 4E1BA 4H08A 3K2IA 5BYKA 3VUEA 3A6ZA 3IL2A 2DB3A 1IZ0A 2REQA 4PTYA 4DSTA 5H3LA 3LUKA 3SLRA 3NOQA 4KV7A 2ZJ4A 3OZFA 1SIOA 2Z4RA 2ZYWX 3R0XA 4FOLA 2AC2A 4LY9A 4OHWA 4P5DA 4PLCA 4HNRA 5FOTA 1ZL0A 3SLGA 4F4JA 7REQA 1GTVA 4R8KA 1E64A 3TZEA 2VAXA 3EPLA 1DT3A 2C8KA 4HR7A 3CX8A 4FD2A 2AA3A 1ZMOA 3L4BC 3NTQA 5EMLA 2BEVB 3WO0A 1U2GC 4HNGA 4CMIA 4ZGWA 4LJAA 5A9SA 2X4LA 2G1KA 5A4KA 3OP1A 5KYUB 1ZCFA 3HV0A 2YRFA 1L6RA 3OZTA 2HHLA 1GUFA 3C48A 3G2OA 3N8KA 4LZWA 3KYIB 3D5TA 3VH4A 3WLRA 1NX6A 5LR6A 2JCVA 5TIIA 1KTIA 4OLBA 2D1YA 2A59A 1SU8A 1G1AA 1VG8A 1Z5NA 2VSYA 3EUFA 3QU5A 4OHPA 3LHSA 4R2XA 3CNQS 3AY7A 2OHOA 1MOZA 3G8YA 5HX7A 3VJRA 4DV2B 1JEYB 4N5MA 5EUMA 3FY4A 3KX2A 5A7FA 3G5TA 4R9VA 3ZDXB 5B7PA 5HQ3A 1E96A 5KOJB 2QSUA 1N3YA 2JJQA 2YV4A 2FCRA 1K5PA 2G1AA 1ZOSA 3F7TA 3FJYA 3QW2A 4BVLA 2X5XA 4E31A 1N7IA 3U3OA 1KJZA 4E3ZA 1L7DA 4Q9JA 2ZSKA 3G2JA 4L07A 2MINA 4NDNE 1M2VA 4PG6A 2EU8A 4RYLA 4S1NA 1H8HD 3ACCA 4Y6RA 5CBPB 1R6XA 3L6OO 2DWUA 4QASA 2Q0XA 5HRAA 3QMWA 3CPJB 3O1JC 3NOXA 3KFVA 4TXLA 4R54A 5EJ7A 4D3FA 2Y0CA 5FL7D 4N76A 1WO8A 4E2WA 4IUYA 4EA8A 1G3UA 2WWTA 2R6AA 1FU8A 3BKXA 3LM8A 4MKRA 2A5LA 1LNZA 2H1VA 2PNJA 1IY8A 3OCJA 1GZ3A 4D9BA 4DNFA 3MHTA 2BN4A 4Q1EA 1FXUA 1YMVA 1E3JA 3Q2KA 1LK0A 1G8SA 3BTVA 1DBSA 4CL8A 1FTYA 4J0EA 3HCCA 1OFGA 3ZDRA 1RT9A 1P7CA 1KI6B 2CXSA 2BZSA 2OV6A 2ECOA 2AOWA 1QZUA 2QHXA 3NPAA 1Y8ZA 2YWCA 3ESAA 1CRQA 3JAKB 4LXYA 2O8CB 1A9TA 3ZEAA 1Y3IA 1N25A 4RHYA 1Y3CE 3M1LA 1BMTA 3L79A 3PUYA 3O83A 1T6ZA 4GZMA 5B3LA 4Q19A 1Z5VA 2L42A 1PZFA 1BRTA 4Y9TA 2ZRHA 1K08A 1TLLA 3C5HA 3IVXA 1E0AA 3IRVA 1SUAA 4GOLD 4P54A 3MCAA 4MVJA 4Z4QA 1ODKA 2FUEA 3SHTA 1W8IA 3F5SA 4QNMA 4YRQA 2QVZX 3F2IA 3SC2B 4LS3A 4WZBE 2I3AA 4WERA 1U3TA 2VNKA 4HFJA 4MVJI 5H81A 4W5OA 3A05A 3W5AA 2N9UA 5AI9A 1Z4PX 1GAJA 4HATA 3FB4A 5LP6F 3ND8A 1MKYA 4L16A 1C3OA 5SYNA 1U28A 1A9RA 4DILA 3CSSA 3V7NA 4RJIA 5EERA 1NXOA 1TUBA 3VZDA 3ZD8A 1QF6A 2F9FA 3A27A 4HXEB 3UB4A 3NIDB 4KYVA 2L69A 5FDFA 2DWOA 2PZEA 1BXGB 3R9KA 3OZ7A 1WKVA 1J6UA 1Q0HA 1SQFA 4QVIA 5SICE 2V55B 2VJAA 5J47A 3WLOA 1N78A 2IOHA 2OV8A 2ZJZA 4L8FA 5B1DA 1JMYA 1TF7A 3CF4A 3MYRA 4AIIA 4B6EA 3HVJA 2OECA 2EDCA 1OY1A 2QS9A 3R3YA 1MGPA 4FJ0A 4U7PB 1LQ2A 3TDKA 3VSEA 1KHTA 2H2HA 3LPMA 1UXJA 4NBUA 3WJ2A 4AX8A 3DFFA 4QYXA 2H4JA 2BKAA 2JPDA 2MSWA 3IOMA 2H1FA 4P93A 3SS8A 3TXYA 1PG2A 3FMIA 4UUAA 3R6WA 3SKYA 2FY8A 4A8PA 5JMOA 2FZLA 3DWEX 1C0IA 4L0DA 1S8NA 4O0MA 5C1OA 5LMCA 3EIFA 2LE0A 3R5TA 5EJ9A 3ZWKA 3NEAA 5HA5A 5KWIA 2WINI 1BCSB 1E9FA 1RFLA 4OQLA 3ZNQA 1WOYA 4R2JA 2EP7A 4A8HA 2BMWA 2JBHA 1PJQA 5CD9A 2B37A 3PC2A 3UTCA 2UUBB 3IUYA 1TYEB 3OM9A 4UHHA 5FCDA 3RQSA 4GOJA 2R25B 3MWDB 5DM60 1UAGA 4D4MA 3GRUA 2AD1A 5P8WA 4KHZA 3UUFA 1H05A 4MV4A 2VNHA 3GX1A 4Y1GA 3ZBUA 3JQ6A 3MWFA 5CW1A 3C3PA 2Q5CA 1U6IA 3K6JA 3HBLA 4XZ3A 2YVQA 1E6KA 2QGNA 2XVYA 4TXHA 3KEMA 3BX1A 3Q1LA 4XSGA 5G53C 5EHXA 4NFSA 5JG7A 1H1LB 5AI6A 1IAVA 2HBQA 2HNKA 3D6NB 3Q7PA 4H7KA 4G5RA 4EF6A 1RE0A 3F98A 2XDWA 1TVMA 2VT7A 4U4AA 4CV2A 1QLJA 2WM3A 1W85A 2IUUA 5DP1A 4EHKA 1G2OA 2CE7A 4G1FA 4MGKR 3UMBA 7ADHA 1HDEA 2NAPA 4L7QA 2VJPA 3LUAA 3WLMA 1HI9A 3KHSA 4NV0A 1A7JA 4PNEA 3JQEA 3NH9A 3TQFA 5FJIA 5AKKA 3H2BA 4KPEC 1DAOA 2FPPA 4M1EA 1QM5A 5BW5A 4D9KA 4BY9E 4OQQA 4FGLA 1LNQA 4LOLA 2YUTA 4NCJA 3V97A 4DHEA 4ZZIA 3THWB 3GNSA 5JS7A 4PSCA 4X90A 3RG2A 4E2ZA 4UATA 2VAPA 3SMVA 2ZE6A 3N2IA 4J2HA 1RYEA 5JVDB 2LVBA 3QPAA 2WTNA 3NDRA 4HVCA 3NHSA 4ZVSA 5JASA 5CFOA 1HDCA 2AK2A 3CUVA 3B1JA 2E4XA 4LHYA 1JR4A 2EBUA 4AZ0A 4ZVNA 1JJFA 3M3DA 2CV1A 3P9YA 2QSYA 4CTMA 1T3LA 3WC4A 1WXGA 3ESBA 4PHFA 1F14A 1V3QE 3INRA 1GAWA 4A8JA 1YNSA 3TI7A 3AHIA 3RIGA 1L4GA 2I3DA 3ZWOA 2IU0A 4TZKA 1ZUD1 3RTGA 4WJLA 1GCIA 2O07A 1E4YA 1Q92A 2CVFA 3E0XA 3E6AA 2ZRLA 1HKUA 3M3PA 2QUHA 1PZNA 4L4RA 4KMOA 5JROA 3TF5A 3U5TA 2PZMA 1K3TA 2QD5A 2GHQA 2RGGA 4QBFA 3QWAA 2I4MA 1DRVA 4XTCS 3CKKA 3U40A 5DNUA 1ZU5A 1WCIA 2VHUA 4QZVA 1P5JA 1L8LA 3DTVB 5K8UA 1ZHOA 3TW4A 4DCOA 1LXCA 3AUYA 3AYZB 1EU1A 3OQJA 3W9SA 5M04A 2BTOA 2OHIA 5JFTA 3CURA 4IXDA 1EDDA 3GVXA 5AXAA 4KQMA 5L40A 1NTRA 4MXDA 3QA3E 4ESHA 4P36A 1OZAA 2A9JA 4FNAA 3CRNA 4HGNA 4OD0A 2CVOA 1NJ6A 4Q3EA 2FMTA 4OK3A 4OQDA 3X2EA 2QUZA 2DH6A 1PR2A 4ARUA 3ASYA 5IT9A 1JQKA 3MCWA 2Q4DA 2QAGB 5C35A 2BOVA 1V6AA 2OQRA 3IMCA 1V1RA 1APBA 1RQ2A 2G9ZA 2H2GA 2YJGA 5AOAA 4URUR 1DTWA 2OQ2A 3A4TA 4HWOA 1NHGA 5HIAA 3ESQA 1UC5B 3N1UA 4B7UA 1K7CA 1KI2A 1XA0A 3OFSA 4RK4A 1VJ5A 1M8GA 3JZMA 4PHCA 4GICA 5IXSA 1GGHA 4B4UA 2D7DA 3IPCA 5F78A 2HF2A 5BQ5A 1XTZA 5LZ5A 3MS4A 3WJAA 2JJMA 4IDDA 2ZZMA 1X1DA 5FQOA 2D74A 3RWMB 5IS2A 1XN1A 2WFLB 4LNUB 5F33A 4TTJA 1J5XA 1E6UA 3GLGA 3FYTA 4XX0B 5AKJA 2OMKA 2W48A 3U7GA 1RQXA 2AJBA 4YRJA 1LBTA 2HK9A 1VE6A 4UXIA 3B5EA 2WIBA 3R74A 3EBLA 4UHEA 3BAFA 1WPXA 2Z9DA 1W25A 4RZUA 1UAYA 5C1PA 1Y42X 4QATA 2DUNA 5C18A 2CMDA 4PQFA 1LS6A 4G4IA 4YAWA 3RKUA 3WGYA 2PH5A 2MDTA 2UKDA 3HUFA 5FAKA 2XD9A 3A6JA 1GCOA 1JUDA 1AZTA 3H65A 4YRFA 4GX5A 4Z9FA 4JY7A 3HH8A 4GSLA 4AZ3A 3ZCRA 3T34A 1AMOA 4P5EA 4CLEA 2I6XA 1BWRA 1WXIA 2PT5A 2PVPA 2R1ZA 2WDZA 4WXRA 1VZ2A 2QL7A 5FOUA 1I3KA 4B75A 1Y6RA 2O7NA 4LJ7A 3KKNA 4N1AA 2ISCA 2ZRNA 2OUIA 2OZKA 1QRUA 3H1AA 1EXNA 1G63A 1K7XB 3IJEB 4N0QA 1T3GA 5JI3E 1NZDA 4DJJA 1VG9B 4Q4CA 3QFRA 1I33A 1D3AA 2V97A 5BNFA 3WHPA 3FTCA 3NNSA 4J90A 4LFAB 2BELA 1UBNA 1JLLA 3EF3A 1DT5A 2IBMA 2YICA 3H05A 3STVA 5DHPA 3RVJA 4BO6A 4MI1A 3RC2A 2IUTA 4HAIA 4D74A 4DCSA 2W2LA 4ZU1X 3CEHA 1SBNE 1R15A 4ZKDA 4EQZA 1QCDA 1P9NA 2C2MA 3IT2A 3BMQB 3Q6IA 4J75A 1XCBA 3T35A 1VHTA 4JKIA 5KAPA 5K09A 4QLBA 1AS3A 2VJMA 2FPRA 3GJQA 5HKBA 1QO0D 5BV2P 1QHXA 1HDOA 2AMLA 4RU1A 1HE4A 3P0EA 1Y6JA 4DZZA 5H9WA 1C8KA 1JPJA 3PF9A 2X0DA 1E0SA 2A0KA 3F6PA 2QPLA 5GJCA 4BP8A 1R6TA 2VBGA 4MWSA 1J22A 1XEWY 2WHEA 1H85A 1X19A 3FI0A 5ECDA 5A2GA 5AM0A 2X6TA 2NTNA 2P4EA 4C4RA 2UV8A 2X19A 2ZJ0A 3PB3A 3UWDA 1AY0A 1JGTA 1MC5A 3UGTA 3V6MA 5JISA 1EG2A 4UQPA 1RJGA 4RWZA 3ZHSA 3OPNA 4L15A 2X2PA 1KAMA 1H2EA 1HSZA 2BMVA 3AM4A 1U11A 3FVWA 3NT5A 4ZQFA 1Y1SA 3H8SA 4GC9A 1RQLA 2BFBA 1E98A 2Y0EA 1BMFA 4PPQA 3B2QA 2HT6A 3T3DA 3GVIA 4Q7EA 2XECA 4B9AA 1CEEA 3GOQA 3GJ3A 3GUZA 2JJ2D 1XZBA 1XYYA 3CEPB 3Q4GA 4K0RA 1J1IA 3BIOA 3HB1A 3EUAA 1KIFA 1T9GS 1ZHFA 5T3UA 3DMTC 2XZLA 2Z95A 1G2QA 2VZLA 3EZYA 4H7JA 3S29A 4S1TA 3UXYA 4LRUA 3W5UA 4Y2XA 1IOWA 5LQSA 1XMVA 3P32A 2C92A 3DKIA 3LUPA 3ZE1B 5LOVB 3UJNA 3E2IA 3MQ4A 4DUZB 5HK8A 4E13A 1NXWA 5BWMA 1K8QA 1NLZA 1FSFA 4DG8A 1TEVA 2G9UA 4FOTA 2R2AA 4DV3B 2FX5A 1NXTA 2I71A 4QFMA 3OAAA 5DHRA 4C2BA 1XAHA 2GK6A 1E8NA 1M1YB 1T3ZA 2RH4A 3RWOA 2Q9BA 3RG8A 5BR1A 3AKEA 1TM3E 3RE1A 5HQTA 2B4KA 3OF2A 4IIJB 3BMNA 1KYTA 1OVMA 1JNXX 3NEJA 4HQFA 2XUDA 4L08A 5KYVA 3WNQA 3WXMA 3MJ4A 4F84A 4UPVA 3ZW7A 1K4YA 2PA0A 4PSUA 2PZJA 4EFDA 3A7EA 4PYRA 2FUKA 2QX7A 1U5BB 2EX1A 1NAIA 4PGGA 5GV7A 3BB3A 4C20A 1KI3A 2O2XA 1JLSA 3O26A 2HUPA 1X0VA 3PHIA 2QRZA 1Z5ZA 3PNYA 2R6HA 4LX8A 3USCS 1HZJA 4JL5A 1K2WA 1XMIA 1SUEA 1UBMS 3AVXA 1SIWA 1DJPA 1V16A 1NYTA 3CNOA 4LGVA 4MX8A 5A9TA 4JYZA 4U0JA 1Y8QB 3F8TA 4X6UA 4F12A 4E94A 2DR3A 4ERXA 3AVYA 3RREA 1P60A 4XD7A 3W06A 1LBQA 5IDXA 3F78A 4U63A 1W88A 3TRJA 1T4MA 2DBZA 3UENA 3ANTA 1OWNA 3KXIA 1DDIA 2O1EA 2FPWA 2QRGA 3QOYA 4YJFA 5E3IA 4KRGA 1XXLA 4HPJB 3VRHA 4K6FA 4MW0A 2VTBA 5ADUS 4C5BA 1KK1A 3L43A 1X94A 3I9OA 3N75A 1Y4AE 3ZLBA 4F38A 4Z4GA 2PGDA 1E7RA 3RNOA 2P5YA 3JVDA 4O4LB 1KMMA 3PQDA 4O2BF 3X3HA 1NLMA 3RSGA 4PLWA 2Y6VA 4N6GA 3N59A 5EE0A 3ANSA 4DB4A 1FLAA 4LOHA 1C0KA 1SKMA 2RB4A 5EKUA 1KJIA 5DYGA 3ZS8A 3IT0A 3QWFA 4D45A 3DAFA 2BYTA 5MFZA 3GLFE 4MV6A 1C9JA 1KSJA 1OU0A 4L2IB 3K0AA 3UH1A 3I23A 1YOVB 3IURA 3LQRA 5KNCA 4CHGA 3V46A 4FHEA 5ISMA 1R27A 2KYRA 3DW3X 3QIVA 5DHFA 1GNRA 3RS0A 2QM3A 2YXNA 2IYPA 1OBHA 3DDUA 4JYCA 4WZAA 4HMQA 4Y6SA 2OOSA 4LYEA 1R1DA 3R6LA 2OYRA 4DYHA 2R00A 5REQB 4RORA 3T41A 1P1IA 3V1TC 4Y7DA 1GQOA 4XAQA 1PJ8A 2PKWA 1JHMA 4UDOA 3N76A 5C1DA 4MUNA 4DG9A 2B2CA 3UIEA 5CDFA 8OHMA 1PQPA 3NYWA 2J30A 5DM1A 1PJ4A 3SC3A 1SXPA 1HL3A 1UMBA 2IXEA 4KOAA 4WCDA 5JXHA 3MCTA 2OFPA 4GSYA 1V8DA 3BRSA 2X0JA 4NZZA 1HY3A 5HJ2A 1U2ZA 3QVVA 2XDQA 4IV0A 4KAAA 1PFQA 2F59A 3BD8A 1XMOB 3IDAA 1BGVA 1BS9A 1E2HA 3A25A 3N58A 4KXVA 4RABA 1JXMA 3R5XA 2CGEA 4O59O 4D98A 1NXQA 1JHYA 2K4MA 5TT0A 1W5SA 2CL6X 2QSZA 5E9AA 1F6WA 5KWEA 3KLMX 1Z7GA 5LQKA 5EUCA 1Q20A 1XZCA 3T12A 2I2CA 1V2GA 3ACDA 2ENUA 4FFWA 1RM3A 2G1UA 5CA1B 5AJTA 2X15A 1AHIA 3SYTA 3GNLA 3VKUA 3QPCA 1SCUA 3E7WA 2EW8A 4ZVOA 1REQB 1IIRA 2RKOA 5D5QA 5JJKA 3OCYA 3CPHA 3ZJUA 3F47A 5J9FA 1SN7A 3K9FC 2PK3A 3FGZA 2HA0A 3H5VA 2GILA 3TN7A 3AT1A 5C8ZA 1OT3A 2OZEA 3WOHA 3R9WA 5T41A 4BZZA 5FI0B 2QY6A 1CRLA 2J45A 3WDLA 1S2MA 3EGOA 4B3XA 1SZJG 3A36A 4GT1A 5IZCA 3C3AA 2WF6A 5GM2A 4R41A 3OWHA 4Q37A 5B55A 4WLNA 1TRHA 5M7EA 3PQ5A 4E7OA 2O2ZA 2EIHA 4G23A 1SVUA 4MI9A 4TVSA 1SULA 2R4TA 1UPFA 1O5OA 3LY5A 4KKXB 1EDEA 4B6OA 3WJ1A 1PG5A 2F1OA 3H2YA 2ODPA 3QVMA 5LQDA 2GXSA 5ECGC 4W1PA 1EVJA 5D6NA 4EX6A 2WIGA 1OLSA 4A26A 3PZRA 3PSAA 2D3TA 1KYIA 1TDJA 3LQQA 3N7AA 4XVUA 3JQ7B 3U7HB 2HH9A 3HI4A 4H6XA 1ARZA 4TTRA 4LG1A 4PZDA 4TXNA 2R7AA 4NECA 3E5NA 2HL6A 4OATA 4UNPA 2GYYA 1H66A 3IIIA 4I50A 1O7JA 3OI7A 4CR6A 4FMDF 1E3LA 3B1WA 2BHSA 2PSSA 4BDSA 1FYEA 4H1VA 1MC4A 2QMOA 2P2LA 3RYIA 3FGPA 2NZVG 2VDUE 4GX1A 4HL6A 1UZAA 2V4MA 4ND7A 1OLOA 1M73E 1RPTA 4CM8A 1B2LA 4LE2A 4W1RA 4F91B 4LMPA 4ZO8A 2VK4A 4B7AA 1QGYA 5AW0A 2Q2WA 4F86A 4TRRA 1L5LA 1FYWA 1S2OA 1UOOA 3KTDA 2DY1A 4NFLA 4AG3A 4L8WB 3TOZA 4QQ8A 821PA 3VU0A 5KTOA 1OXSC 1IK6A 3ROEA 2W6QA 4ZMRA 4Q7MB 3NDJA 3AL3A 1Z0JA 4OM8A 2JC3A 3AKYA 3AR6A 2JLVA 1L8QA 5KX5B 2CSXA 1OU4A 3NYQA 1AK9A 1N9ZA 5K0ZA 1SD2A 4LY0A 2WYOA 4X8MA 2XB4A 1VL1A 2C8VA 4CL0A 1LSSA 3LYUA 1VCHA 1YI8A 3ZQ4A 2GCIA 3SIRA 4KL8S 2J6CA 2R6FA 1FOEB 1G3MA 3LLVA 3R40A 2ZRGA 4RHEA 4YI5A 4A6PA 1YS2X 1Y5IA 4K9LA 5E9QA 2P9CA 2PMFA 2FW6A 1U0GA 2V7XA 1UEIA 4XASA 2WIKA 2OZVA 4CFYA 3DMHA 4XGKA 1GTL1 3MINB 4ASUA 4OU4A 2Y05A 4MVWA 3I6IA 4MZDA 1VBNA 3FUWA 5K5EA 2V9ZA 3HYNA 4RPKA 4G2NA 2IS2A 2YC4C 3TZKA 2SCUB 1JG1A 3KZ1E 2GBIA 4DJFC 5DGDA 3A6LA 1XZEA 2ZQZA 1FSPA 1J20A 4BMDA 5K3DA 4Q9AA 3AKCA 2W0SA 5KREA 1KDYA 1NBME 1TO2E 3CS3A 3N5KA 1WDKA 3E05A 4JC5A 4RTJA 3TOCA 4HTAA 4P84A 1W4RA 3LYLA 4Y98A 3TJRA 1UWCA 2ZIWB 1N4AA 5KI6A 4BQPA 4BLQA 1GLGA 5ALHA 4DN6A 1QF9A 4YNBA 4D42A 2WYWA 4YLYA 1WP4A 4MO2A 6Q21A 1NU8A 1CCWA 2F3SA 5D3KA 3A9UA 3W5SA 3I9NA 3OQIA 3T7DA 1JX6A 4U6NA 1IN8A 3VBEA 3AXSA 3GK3A 1T9CA 2YN0A 4K2AA 4D3SA 2RHOA 4PSKA 3ROQA 4DM3A 1QVAA 4JC8A 5KDOA 3SQDA 4BX0A 1J0XO 3IEPA 3CNEA 2GZMA 3AI7A 3TW8A 3OH8A 3VGJA 3P4UA 4NXNB 2AGVA 1FEZA 3OTWA 4Q03A 4ACAA 4QQRA 5BN4B 3CZCA 2NSYA 1P2GA 4ZO7A 5TT1A 4HNTA 5CLIA 5EIBD 1DBWA 2EW1A 1XZHA 2GPJA 3I0MA 4FGUA 3EF0A 4JUDX 3EGXA 3VR2D 3I1YA 2PZKA 1GFIA 4WVFA 3GFFA 4X24A 1UT6A 3WK7A 4UE2A 3SXJA 5HP4A 4N3BA 1G38A 3RTAA 5FUMA 5KHOC 1XVUA 4QUEA 3EB9A 4EYEA 2E85A 1T15A 2QTHA 2RGXA 4FBLA 4GH5A 4RSHA 2ABWA 3ZU6A 1U0SY 1NN5A 1SCBA 1H2BA 3L41A 1KZ6A 1U1EA 5DNVA 5T3YA 1JKIA 5BUQA 4Q66C 4MK4A 1ZJWA 5LZ8A 4J6EA 3P20A 2XDAA 1UBTS 1G5QA 3KUCA 2IZ6A 3H42B 4LYYA 5AW2A 1ISRA 1Y4ZA 2WFAA 3FW1A 1LZLA 3RKSA 5HRUA 2NSJA 2ZJYA 5SZIA 4NENA 5HFNA 2JZCA 4XQ9A 4IUCS 4XIJA 3NALA 3PR3A 1AXEA 4W7IA 5ETJA 2H2IA 3H2KA 3GGJA 1IDN1 3MA0A 3ORSA 3VU9A 5EHGA 1Z35A 1D6MA 2VWQA 4YS6A 2IUFA 5JT1A 2HC9A 4BCBA 3RFVA 1XN4A 3H7AA 4YYZA 3IXLA 3LKBA 5DU2A 2BMDA 3A9SA 1U8CB 1G7SA 2DHCA 4TUYF 2ZSIA 2E4ZA 2UZ1A 3FF4A 3PX2A 2A0FA 4MB2A 4DDMA 3TAHA 1ONBA 3STXA 1DQZA 1LTQA 3N2GB 1FNNA 4MVCA 4HN2A 3UCFA 3CNHA 4BNUA 4EBFA 2UZ3A 3BXEA 1V41E 3NLLA 1ZI6A 5DXFA 1RXCA 4DV4B 1N6IA 4LYDA 1AMUA 1K7EB 5GADl 3IP3A 1JHAA 3R5SA 4JDUA 1XPJA 5AVJA 1NUTA 4OGLA 4G0VA 4YREA 2AZ4A 1L3IA 2I3BA 1PX2A 3KR9A 2BC9A 1F1BA 2CLKB 2I6QA 4DREA 4AF8A 4OI1A 3HP7A 3I05A 3I04A 3C6XA 1URPA 1S8OA 2O2DA 3PQCA 4HQNA 4QTUB 1K6JA 5CNJA 3UMFA 1P77A 4WIAA 3T7TA 3N0WA 4L76A 2FGKA 3MSXA 1GPKA 4MWCA 3E7XA 1DQYA 4PO9A 2CFOA 4UAGA 5D7BA 2GAOA 3UANA 2VKQA 5IBQA 4FYMA 1FFEA 2CUKA 4N5IX 1QZTA 2HQOA 3BMCA 3I32A 4G1MB 3HB9A 3ERCA 2JK1A 3OLCX 3KALA 2QDXA 3OJCA 1NLYA 1V9LA 1MV8A 1HV8A 4R68A 5BNIA 4IQ8A 1WPRA 3T5TA 4IRMA 4CCWA 4TROA 1DBIA 2I7XA 1JE1A 1FYFA 1RWBA 1K8YB 1T8WA 3JVEA 4KQ6A 1UDCA 4LYGA 5DYYA 3R9XA 4LVUA 1D2RA 2RHTA 3PR2B 3NBQA 4JOQA 1T43A 4BWFB 3CB2A 4GBJA 1A50B 4FIDA 3U2QA 1U0JA 4G0WA 1Q7BA 5DW3A 4NH0A 3JAWA 3KJQA 2QLTA 3PCTA 1M2GA 4G1EB 2H1LA 4OBWA 4WQMA 2F1KA 3OF3A 4RMNA 5CA0A 3MMNA 1TF5A 5C7LO 3FZQA 3DV0A 4OHKA 2AIRA 4MUHA 5FFNA 5CFRA 4CG3A 2HF8A 2YRXA 1YCDA 4YAOA 1GNSA 3CRW1 2FX2A 2FWRA 2YY7A 3DAOA 5HK9A 5DYNA 1DLIA 5BRAA 4IO0A 4I8DA 5D1NA 2R1TB 3BSSA 5G0SA 4ZYUA 3ONDA 2P9ZA 3VV3A 3ZD9A 3K7EA 4CKWB 1SXJE 4JASB 4KO1S 4L5CA 2JFXA 4WLEA 4N8SA 4C0WA 4N40A 4F0JA 1N2OA 3NDBB 3VH3A 2WPNA 1OV6A 3O0DA 2GXUA 4Y1RB 5KYWB 3HCRA 1C80A 2HTEA 3SIPA 5JY6A 3WG9A 5I9TA 4YP9A 4M9UA 2LWIA 3ZCUA 3KD3A 3B5JA 3GJ7A 3LL7A 1MO5A 1JFLA 2DT8A 3HPRA 4JVLA 1I5RA 2NUTA 4DV1B 1NUAA 2IDZA 3AU9A 3IT3A 4URVR 1SH7A 2EJWA 5K6RA 5AK5A 3SVZA 4D44A 2C97A 1WETA 2X22A 3GZTB 1XFDA 2HEIA 1O96B 4TLEA 3KZVA 3WSVA 1NUPA 3UF0A 2ZR8A 4DR5B 4CKCB 2J5BA 2XB6A 3N7TA 2B8JA 2LP4Y 4WL0A 4QODA 1V8OA 3P97A 3HJCA 1B0PA 2H3HA 4LV6A 2QL9A 4YUZA 1A3CA 1S2LA 3HFJA 3S55A 1LBHA 2FRVA 2IUYA 2N0SA 3HXMA 4UM5A 3JQ8A 2EZUA 2NADA 4K46A 5L3QA 3AWIA 1YTLA 4XGQA 4DTIA 4P3XA 4PXSA 4AZTA 4GIBA 1XPRA 3Q7RA 4YWJA 2AN9A 1WW8A 3AESA 4JJKA 4YXFA 1O57A 4FT2A 1W47A 4C22A 1F4VA 5KOYA 2GYVA 5IF9A 3VDRA 3NWJA 4MAFA 3WDKA 2XOKA 3F6EX 4M8NE 1YB2A 5HG0A 2C77A 2QUKA 1VI6A 1MNAA 2G0TA 2QZ4A 4HGRA 1ZHHA 1ZM7A 3LGSA 4JJ6A 1WHTA 3GFTA 3W5JA 3FHTA 1Z68A 2R65A 5B30A 2K5UA 5AM5A 5F52A 2I22A 3M2TA 4W4TA 4QPPA 3AETB 3R0QA 2BTQB 2YWDA 4OQNA 5J23A 2OHFA 2ZYIA 3IQZA 5D51S 1Y9DA 4G5GA 5ARDA 2WVAA 2B9EA 3A3KA 2J3JA 3KC2A 3P2MA 4BRUA 1WLYA 4BP1A 1BEZA 1TW3A 3VAAA 4ENWA 4R9UC 1DX6A 1C9YA 1HLPA 1V7CA 2HNAA 1BW9A 2YHBA 1N92A 1NZJA 1Z2EA 2IYEA 1M6EX 3QX7A 3QW4B 4S35A 3H4VA 4GOOD 1JN0A 3EGVA 4DM4A 4QUDA 4LSZA 3W6UA 1WVGA 1NQVA 1L0BA 3NOOA 3RB8A 4A82A 2JGKA 1GJRA 3DQQA 2QYOA 3IBFA 4MGEA 4RK7A 1MGOA 1NQTA 1Y98A 2JLQA 4M9ZA 4UAVA 4I3HA 1DGQA 2CDBA 1BVRA 4ARSA 4IX9A 2II6A 4X1KA 4B3HA 5KNCD 1PW5A 2JI9A 3KB6A 1OSNA 3DVAB 3M1YA 4C0LA 3C3BA 4NS4A 4RLHA 1U2DC 2CXOA 1OD6A 4ND8B 4P08A 4QXAA 4RPIA 3L7KA 1Y5NA 5DLYA 3RFFA 4P0PB 2H5IA 2J0VA 4BV3A 1MIOA 1ONNA 5F7ZA 1XXHA 3G9ZA 2D5IA 4KQEA 1F2TB 3P26A 2HHHB 2YW9A 2NYUA 1Z16A 2Z2IA 2J5KA 3PEVA 4G41A 3S1AA 3PU6A 2OC4A 4TVBA 4YJHA 1GPYA 1DRWA 3MAAC 2DOKA 3G5LA 3ASZA 6PFKA 2QTZA 3PGJA 4P4SA 3EW9A 5EKTA 3RIEA 2G5PA 2FJ0A 4MRMA 5AKIA 3EW7A 1CQJB 3ODGA 4JWKA 3RAFC 1QC5B 3UQYS 3RSFA 2C54A 4RZ2A 1PKXA 3JD1A 5B3AA 3HWSA 2PWZA 3MWGA 1JFVA 2O7VA 2JLRA 3O3NB 2GWRA 3SYKA 1MW9X 3H11A 4P3NA 3PPXA 5JYEA 2FWPA 1BDIA 1RWNA 2FMIA 1YDGA 3K09A 3NFYA 3PENA 3S7ZA 3T9BA 2QB5A 4I9NA 2ZCVA 4PZCA 4Y6OA 4YAFA 5ES4B 2L2QA 1LNSA 4CEJA 3D2AA 5J59A 4OYLA 3CIFA 1MH1A 2BCEA 2GBGA 4HN9A 1E1DA 4MCIA 1QO7A 2BISA 3AF4A 2QN7A 3R3WA 3C74A 4EW3A 1E1NA 3A2KA 4HTFB 4WA7A 3IR7A 3G2MA 4RF2A 2OWDA 4F56A 1A8PA 5JDCA 2W70A 4X20B 3DQZA 3HDGA 5ALXA 4IXTA 1XTVA 2IHTA 1WPGA 2UYQA 3D6TB 3BFVA 1NVTA 1E1KA 2HIAA 2Q6IA 3D8RA 3O2SB 1Z38A 4MVJE 3T6KA 5KOHB 1GA6A 1WR8A 2R60A 3QPDA 4QO7A 3BSFA 3Q0IA 1AGPA 1X7WB 1S4QA 1BYUA 3Q5EA 5CX1B 3ET4A 3FR8A 2RAPA 4YH1A 5C37A 2DERA 5LYJB 1FFGA 4IJWA 1TIBA 4EA6A 4JBGA 4C4PA 4ZJZA 1EXVA 4DLUA 4YRRA 4JENA 3GCWA 3SSOA 4B79A 1E9DA 2BFFA 1DCTA 2BT4A 2GH1A 4KJXA 1N4DA 1XWIA 3W7AA 1H2XA 2RHMA 4UHKA 5AI5A 4PG4A 1OYYA 2PGIA 5LXTB 4D4KA 3HHEA 3FOEC 1V5FA 4ZOLF 1VSTA 3PLAE 3TD6A 3LOQA 1DVRA 4D9CA 5IMSA 3AF6A 1EFVA 4MB0A 3WL7A 4ITVA 3T9AA 4BKQA 2WPDA 2ZE7A 5CIQA 5JARA 3ZDCA 4PG8A 6NULA 5JRZA 1E79A 3K8YA 3O21A 4GKVA 4IINA 4MUEA 1I7PA 3CONA 3R3ZA 1T9AA 1ZYUA 2X3FA 4JROA 1MBZA 4PBRA 4BU1A 1I2DA 3Q8WA 1RAGA 3MUFA 3LV8A 1ITZA 3KSUA 3EQ8A 3MB5A 2HO4A 3WB9A 4D26A 3T9FA 4XVCA 1TTQB 1U4OA 4RY8A 4X71A 3A6DA 1TJ5A 4P31A 3AV3A 4MWEA 1KS9A 2XJ4A 3EYAA 4MKHA 3RSZA 2DR2A 5C46F 4YIKA 1UJMA 2NM0A 1BG6A 3T3NA 1Q7CA 1XTRA 3M6FA 5KNBD 5AYVA 4C0HA 4XWKA 2A5GA 2JRCA 3PUKA 4N7RA 5ALEA 2WC1A 4O02B 4GLLA 1DEOA 4HUQB 5CHYA 3UMYA 1II8A 2WJVA 4I9FA 1CUYA 1X1BA 1ZJJA 3IKTA 3TLKA 1NW7A 3PX3A 5CTAA 1XTPA 1Z4IA 4II3A 1P7WA 4XIYA 4Q9HA 1C30B 1TAGA 4F6RB 3P9PA 1NWHA 1GGJA 2C8JA 3MQ2A 4YUVA 4KXXA 1FFBA 2PLAA 4RE5A 3U7JA 2ZSEA 3AZQA 2XF8A 3H1FA 3RT9A 4ASUD 4MUAA 1OE0A 5ALWA 4Z0PA 3TFWA 4JP3A 4EI2A 4HADA 2VT6A 1DX4A 2EP8A 2XA1A 4J94A 1O94A 4PFKA 2A58A 4XCXA 5F51A 2ZAIA 4C0BA 5LQJA 4U7DA 4ANFA 3ZD6A 2I78A 4OKSA 1H9BA 2JJ8A 4H6PA 2R85A 2CLSA 2GUGA 4HNAB 2O4CA 4MYUA 4AXBA 3QEAZ 1J99A 1PJ2A 2HJVA 3QELB 2AI3A 1DTEA 5BWOA 1D4ZA 3QMMA 1MA3A 2X8LA 4HQKA 4D81A 5JDIA 2GN8A 1P0PA 3TYXA 3KO8A 1M1NB 1VBFA 2BP7A 2QR2A 3D2BA 3NT4A 1M2WA 1NXXA 2IVFA 1NKVA 2G80A 2YWJA 1V1JA 3IMEA 3NIBA 2X40A 4RKYA 4RJLA 2XMZA 2AC7A 1A7AA 1LZKA 1U8UA 1K0UA 1XEXB 2ZROA 1VPTA 4P83A 2B35A 2FW0A 3U3KA 1W36D 3DFIA 3ZXYA 1UF9A 1J49A 3C1TA 4A2PA 4M7WA 4C06A 5KNLA 4LJ8A 4CWAA 1ZLXA 2VQ3A 5T4HA 4ZIRB 2V8BA 4CKBA 1NPTO 5ER6A 3I5UA 1GU0A 2B8TA 2HRDA 5GONB 1YMQA 1ZC4A 2D5AA 3USZA 2WWIA 3AW9A 3B7WA 4MIOA 1QTQA 3PQ8A 3COVA 4DF3A 2MT9A 1N5IA 2PZBA 2Y4OA 4ZC1A 3KTAB 4I6JA 3UA4A 3MZ0A 3U3RA 5JZSA 1HT3A 4L4ZA 4EUSA 1PTKA 2GZ3A 4MGHA 1RYNA 2X0NA 3SNHA 1LPBB 1TCAA 5CDSA 5HYVA 1P7ZA 5COQA 2C4KA 1P29A 3VPSA 2H7YA 3F8WA 5EJ4A 1N0UA 2AQIA 3Q3JB 2QRKA 2P9QA 4N47A 1F8FA 1WCWA 4EY6A 4XWTA 1W29A 5JEEA 3VNVA 5JJCA 4NKRA 1J8FA 1QXSA 3Q2OA 421PA 5CBKA 1TLTA 2IPNA 1DG9A 2GQ0A 1S9DA 2HJ9A 4OYHA 1PFWA 3BB1A 4XKJA 5F76A 1Z7YA 2OHGA 2HV8A 5K3CA 2DSTA 3VAYA 1WV1A 3B51X 4EGQA 3SX0A 1WMBA 1Z6QA 2X9LA 4LYHA 2XMBA 2IHZA 3G9QA 4HK4A 4HXYA 3I2KA 5IH7A 2H63A 1QH1B 1DDGA 1Y1QA 2PX5A 1YB5A 3LXRA 3PE6A 4FGKA 1CEXA 1YCFA 2FV8A 4F4UA 3C7KA 2NV6A 2IU3A 4JJEA 3TDMA 2G6BA 3ZBTA 3O2NA 5G1PA 2OBYA 1GRVA 4WECA 4WH0A 1CUSA 1M6WA 1JSZA 1BRMA 2YHIA 5FTMA 1YR7A 3E48A 4D0NA 3WFJA 2H4YA 1RQPA 3GA5A 2WB4A 1KMIY 3WP1B 4PG5A 4U1RA 5IVDA 2Q5HA 2OQVA 1ZGAA 3O4FA 3CTMA 3GWZA 1W7AA 1J2EA 5BN3B 1XLVA 2FP4B 3A26A 3OTIA 4G56A 5HDQA 4M7PA 4NOMA 1I0IA 2Q4TA 4QNNA 4YCJA 4A91A 1ETHA 4DZRA 4NCBA 1FFSA 3IQIX 3OUTA 2FDXA 2B83A 2HDOA 3I09A 5HGJA 1E4VA 2RGDA 2XYHA 4Z9YA 4JUAA 1EHIA 1HC7A 2YWXA 2D4AA 1EJBA 4KVFA 1DEKA 4B45A 1N9GB 3T95A 4AJKA 3U1TA 4LKOA 2PG3A 7AT1A 4RA9A 1PFVA 4YJ3F 5BOSA 3AVUA 2VK8A 3B3GA 4ENQA 3A7DA 1FP2A 1Z4JA 1SNYA 1HLDA 2EHDA 2FMFA 2GETA 2C83A 3A3PA 4MKXA 4HVLA 3DL2A 3PXCX 3CCBA 4NG4A 2DH5A 2JFGA 4W99A 3BKWA 1CY7A 2NGRA 2DFTA 3GDGA 3FGOA 3L04A 1P72A 1XSEA 4I81A 1B0AA 3KNZA 2QDKA 1LRKA 1CLEA 1U2TA 2P2GA 2V54A 3IB6A 1GQSA 1P6QA 3MTAA 1UBJS 4G1BA 4I4TA 4F2GA 3EPHA 2BRUC 2G4VA 4M88A 3F9RA 3CGWA 4K6CA 3HBAA 5TGZA 1QUFA 1L1EA 1RPAA 4D9IA 4F93B 1WBDA 3DHYA 1B16A 5KJFA 3P0HA 4LDPA 5LA6A 1ZMXA 3C7AA 5C34B 2NP7A 4LRTB 5GP1A 4P7GA 5FWYB 1A8QA 4C0JA 5JQGF 1KJYA 1NMEA 5GJWC 3D3NA 3SSAA 1J7JA 4K5QA 5CGQB 3U16A 2VTVA 2XUQA 3ICEA 3MTGA 1E3WB 3HVRA 2IEAA 1N2IA 1EESA 3GJ8A 3LX6A 5FBWB 4I2VA 2PO5A 3BD7A 3OFNA 4MH0R 1H22A 4MJ7A 4F2HA 3C3WA 3GLUA 1QFMA 4MW5A 5IH3A 5H9VA 3RRXA 2E82A 2F8MA 2PS3A 4CT4B 5LM3A 3AVPA 4NJEB 5HF9A 3VDMA 4ZGBA 1OR8A 4NIMA 1V11B 2ZRIA 3LY8A 4HZUB 4KWEA 4RCZA 4YCAA 3P4YA 2G83A 5HJ7A 2XKKA 4RVDA 1M72A 3WRVA 2E87A 1HTTA 3GIWA 2X1MA 3IDZA 3SFTA 4ENTA 2VDWB 5G4LA 5I7FA 5M5BA 3WSWA 1O0BA 2J0EA 4QGSA 1T9GR 2C2HA 3QG1A 2VHXA 8ABPA 4MAAA 4E6EA 1DAFA 3S2GA 4OLHA 1QP0A 1CJKC 5CIYA 2R8BA 1N2SA 3BVPA 1PQWA 3FBWA 1CQZA 3E5RA 3GUHA 3PE3A 4OFZA 3V7YA 4LF6B 1PLLA 1RAAA 1UMCB 1S3SA 1U9IA 5FWAA 1HOXA 2SKCA 5JFOA 1P2DA 4O4IB 3RAPR 4REOA 4YV1A 1SPXA 1DFHA 4RPLA 1PJLA 3A4YA 3KYJB 5I8WA 2Q3JA 4TT3D 3K5IA 3VUFA 3AKZA 5JZ9A 1TA9A 3UKJA 5IF3A 2ZEJA 4UEKA 4B81A 1OAOA 1V6SA 1QX3A 4BJ6A 3DE4X 3VR4D 3MXTA 5LZ4A 3R6DA 4KFRA 3ILVA 1GYPA 3H2IA 4YVFA 5C0OE 1AKEA 4IIUA 1MEJA 1N6KA 1Q44A 3INNA 2UYOA 2WMOB 2OBLA 1KDPA 1JDSA 3NJ4A 5CH3A 5IARA 1MP0A 2QQ0A 2JZOA 4P81A 2D8AA 1Q3TA 2KWIA 3WY9A 4Y1FA 1XRRA 2VSNA 4AS2A 4KITB 1V7QA 2VPIA 4WJKB 1YDHA 4RETA 4QUBA 2QTGA 3PA6A 3JCZA 4DTCA 1AKVA 3C1AA 3I1IA 4YV0A 3RRJA 4HHEA 5CH8A 5DTIA 4K8RB 2F2TA 4ATNA 4DA4A 2G36A 3KG2A 4V0SA 3OJLA 3FYUA 4IHQA 2IEBA 3QXHA 2BKLA 2WHRA 3K0CA 5AKXA 4D8WA 1T13A 1E7SA 3LQ1A 2HBRA 3H8JA 2IOFK 3W1EA 1WKCA 1ND5A 3DOHA 4EMBA 5D7NA 1GZ6A 4G0XA 3K5WA 2P1RA 4TOIA 3PIRA 5HDBB 4X6LA 2BFPA 3LCUA 1VYVA 3RYHA 1M1ZA 2E18A 1ISJA 4OKNA 3UTDA 4Q01A 4EX7A 2CNWA 4DVGA 2ATVA 4BVAA 4QGHA 4ED9A 1VC2A 1GKKA 2YHAA 3FCXA 4YMGA 1C1XA 4F3KA 4EGSA 3FIJA 1LLUA 4FS8A 3H2HA 4DA0A 2WHXA 3BQMB 3BE5A 1JSRA 3TBKA 2HRZA 1CB7A 4A4DA 3EWAA 4EFKA 1EKXA 1N5MA 1AOXA 2PT9A 3IQWA 4HGYA 5K0LA 1GZVA 1A96A 2Y1KA 3QNUA 2QV0A 2D0PB 5C51B 3B20A 5TVGA 1V3TA 1TK9A 3WGUA 5CUQA 3DMFA 3EQ9A 1QNFA 2OO5A 1L4NA 1N6LA 3AUTA 4AN4A 3GY0A 3RU2A 2NXEA 2AT1A 4NU0A 2ZBRA 3A1VA 4NYMR 4BN4A 3BHMA 4AYXA 1W93A 4WCVA 3MN1A 2NZXA 4YMSA 3Q72A 4HNHA 5I47A 2CHUA 1YIAA 2FSSA 2VVTA 5FOQA 3QEMB 2GCOA 3AJ8A 3E03A 3PKZA 5CVUA 4WADA 3G1UA 4DLLA 3M5DA 3GLQA 1E66A 4O6VA 3CSDA 1SEVA 1Z18A 3S2EA 1QP8A 1EQ2A 3JYHA 3WYCA 1AUQA 4UVDA 3WGHA 2AG5A 4NCXA 4R3WA 4BO2A 1IEQA 1NDUA 2C5LA 3FLBA 2XVMA 4XFDA 4MI6A 3LW8A 4QBGB 4XRRA 1Y4DE 2D1FA 4IFIA 1SKYB 2XNDA 2XZPA 2JD0A 2ZIXA 4JOSA 2ILVA 3RPEA 4S2UA 3VISA 4RVNA 3ML1A 3AIIA 2WIFA 1JQLB 3OURA 4FEEA 1WZ2A 4KR6A 3K0KA 3R0ZA 2ZJAA 4Y9UA 3A06A 1YR6A 2QD3A 3DE6X 3ZG6A 2YFHA 1ORHA 2I6SA 4J49A 4KXLA 4RZHA 2RJNA 5DTMA 2BGGA 3W5HA 2O3SA 5HBRA 4DJAA 3CY6A 1T9HA 3ESXA 5KMGA 3OA2A 4MITA 2LZ0A 1I3MA 4ENSA 3EJWA 4CM4B 1LUAA 5L4LA 4EA9A 1NP3A 3ON5A 1JAZA 3I30X 4ILEA 4QICA 3K8QA 1M0WA 4XGIA 5B1YA 5EIEA 1NI4B 2C03A 1GQRA 5IYZF 2BGTA 4G5QA 1AVTA 3FTPA 5JECA 4PYMA 2V1UA 4B85A 1OZHA 1T1SA 3K6SA 4D46A 1GCAA 2OENG 4UEJA 4DWJA 2EBWA 1FJXA 3MTJA 2BI8A 2GM3A 4JWTA 5EYPB 1MW8X 2PQ6A 1TM5E 1L7MA 3WZLA 1W87A 2H8GA 3OICA 1WXFA 4OQEA 4B6RA 1A72A 5LIRA 1ACJA 5DZSA 2H4ZA 5HFJA 4XJTA 2JAXA 4QT0A 5CB8A 4HRAA 2CCKA 5DXAA 4YMHA 4N39A 4U2EA 5BOVA 4QPJC 1EFTA 1RHQA 1QR6A 1R37A 2ZUFA 1K6IA 2PAAA 3A0RB 3IKJA 5CMLA 5EL0A 4CF5A 5INTA 3CJQA 1XDUA 3EXIB 4FMCB 1E0KA 1SGWA 4GM0A 4ICIA 4S2EA 1RTKA 2M1ZA 4AJ9A 2BBSA 1H3NA 1U3UA 2E6UX 3LC2O 5ABPA 5I9IA 2WPDD 1QQ7A 2GASA 2X5KO 3FWNA 2I55A 4CIXA 3MMZA 2VBFA 4AWAA 4ZEXA 2P6RA 1AGXA 3OKAA 1G18A 3C3YA 5BQFA 3WLTA 4MIKA 1PBNA 5E6RA 1XRQA 2DE0X 5K05A 2BGMA 5EMMA 2I2WA 1CERA 2B8WA 5CDYA 1L7EA 1KH1A 3I4CA 4QOFA 4CKYA 1ILEA 3RHSA 4XPIA 4IWYA 5EXPA 4BEBA 5ITSA 3KJEA 1LPNA 2P90A 2AG6A 2ZAGA 5DOZA 4QJ5A 3NCHA 1H4TA 4MW1A 8MHTA 1FIUA 2QNBA 1JQEA 1DEHA 2VPQA 4KDFA 4NOJA 2WABA 1YBVA 1HTBA 3UW3A 2G1PA 3KKOA 3R0VA 4PQEA 5IKOA 3MEQA 3SM3A 4LFBB 4JB0A 3HR4A 5AVZA 1CDOA 2VYVA 1JA0A 1K68A 3THRA 4M9XA 5K8VA 1Z12A 3JQQA 4HAYA 2Y0BA 3VC3A 2P3OA 3WWCA 1JXAA 2EJCA 1WEHA 1J0AA 1B7GO 1QZ3A 1T4BA 1Z25A 1ZUNA 1MLDA 3Q8XB 2FSFA 3GT4A 1KHHA 1L7XA 5A7GA 3VYSB 1QQTA 3WLAA 4ZMSA 2BBWA 4J1QA 2XBMA 2BM1A 1E3MA 4FS3A 4J0IA 2V65A 4INOA 2NZYA 2RGUA 5EJ8A 3HCNA 5K0CA 4BRWA 4W5TA 3B38A 5AJYA 3H5WA 5JNWA 1A9ZA 5AI4A 3ZS9A 2OFXA 1O94D 4PC2A 4NNOA 3PIDA 5TJHA 1KARA 1LWOA 2ASEA 3QOFA 4TZTA 2IXAA 1QFJA 4G4SP 5G4KB 4HNVA 2X4DA 5G0UA 1L5OA 1TVEA 1L7VC 1C7ZA 2B1QA 2R8OA 2GLXA 4IHJB 4I6EA 2GJ8A 3RUIA 1TYZA 1RQNA 4DXHA 5HRCA 1H2ZA 1XRLA 4WXMA 5KQPA 2JLWA 2MR5A 1QDUA 3P0IA 2J46A 3EVCA 2QZPA 3UQZA 2P78A 4KGXA 3BB4A 3F90A 2WT4A 4WK4B 1DELA 1ID1A 1F5NA 1PT6A 4J7UA 3PFGA 4XB2A 1IN5A 2GZAA 2XT6A 4KRXA 1WDMA 4RHUA 3VO1A 1PVDA 1TO1E 4LXGA 4DBZA 1G3RA 2JGFA 2WUVA 1RZRD 1DKMA 2H18A 2RKBA 1ZC3A 5LLSA 3Q88A 3H7IA 3IESA 5BMOA 2FXIA 1Z17A 2RI0A 3OZIA 3NOVA 3O6VA 4RVHA 3U81A 1X80A 4EEXA 3M4ZA 3KTOA 3MJRA 2WHQA 1I6LA 3NBMA 3FVQA 3QEKA 2WYVA 3FNRA 4RV4A 5C8YB 1JAIA 3HZHA 1CUAA 3QENA 1NR1A 3URMA 1ZY2A 1OC4A 4JGIA 4B46A 2R48A 1JIIA 1OH6A 2R5NA 1WXWA 4F5YA 1BO6A 4CI9A 1PNRA 2Q5JA 1UPCA 1ETUA 1SA0A 1AS0A 2HKIA 3GAFA 4HLUA 3DCNA 3W2TA 3ZBQA 2JFWA 1EBFA 3DEYX 3DKVA 2D0DA 4H7PA 2X8BA 4DIFA 1RFGE 2VL7A 3GARA 4KPGA 5JALA 1MEEA 5HTOA 3AEUA 2WQ6A 2VNIA 1U2PA 4Q3CA 4M54A 2Y1XA 4CT0A 1VM6A 4BMPB 2JJ1A 2JGIA 3UMRA 2BW0A 3OLQA 2CY0A 1JJ7A 3H1TA 3O47A 1NVGA 1SBZA 4GMFA 1AMNA 1A9OA 2R1UA 4FINA 1AUOA 2WIAA 5D3MB 3S4YA 4N0MA 4EELA 1QV7A 5BR7A 1KBZA 2EZ8A 1M7HA 3CEJA 5I7RA 3GLFB 2IH5A 2XB2A 1RZVA 1ZXXA 4EPWA 3KEOA 5BY2A 2R7MA 1G3QA 5IFKA 2J9FA 3FUVA 3HJFA 3E18A 1PQYA 4A3SA 3MVEA 4ZCSA 2JGAA 4N3CA 5H0IA 1UBRS 4CM9D 4CV0A 3KTFA 4P32A 4QQNA 1X39A 2OFFA 1NBOA 1YR3A 1YTUA 4LC0A 1E69A 5L9AA 2ZUEA 2EWVA 3EXEB 4NV3A 3KBOA 3QI7A 4RQAA 4CF4A 5FPKA 5JWOA 1EK6A 2WD9A 4D3ZA 4B3SB 1A5BB 1WB9A 4YRIA 3C8MA 3FG9A 3KUKA 4P8RA 4Z1MA 2I87A 2BFWA 1HETA 3ED1A 2JBAB 3O75A 4NAUA 3PTZA 4ZVKA 3QBTA 3BL8A 5I51A 4E21A 2L82A 2QVBA 1M74A 4Q3NA 4XJSA 3DDCA 4LWQA 4ALKA 2GN2A 2PRYA 5F3DA 5JSFA 4BECA 1HA3A 1ADGA 2JKZA 4N4AA 3MJVA 1JIXA 3OPVA 4OJNA 5EXSA 2RCYA 5EWLB 4EPRA 2IIBA 5BRJA 5F7XA 5JXIA 2Q3CA 1YE8A 1PO7A 1SC9A 4XX1A 5LCXA 4FYYA 3KSMA 1Q17A 3WYDA 1Z07A 4JNKA 2BUAA 5DGHA 2V6MA 1QGZA 3DWFA 3TAUA 4AXXA 2G4CA 2CYAA 3AGPA 3Q3EA 3ZGOA 1YFJA 1DC5A 3AONB 3EPRA 4L4SA 5CHEA 3GP5A 2CHEA 4DIEA 4J0KA 1YJBA 2ISSD 2HY7A 3B3FA 4RZIA 3UC5A 4LNAA 4RGYA 3TSYA 2OGZA 4PN7A 2X8JA 1UBHS 3QVSA 5KQGA 1XLTA 4HDRA 2IIPA 1R5BA 1SZPA 1CVIA 1UXHA 3OETA 4JZKA 1M34A 5EVCA 2QLMA 4E09A 4NBVA 3HFGA 1NAHA 1ZOLA 2HRCA 2QMQA 2ZRCA 3QLUA 1HFJA 2W83A 2ZIUB 3FPHA 3ONVA 2HWUA 2VPXA 5C53B 3I62A 3Q7TA 1NW8A 3CRZA 1E4EA 3FPFA 5H8WA 3KLOA 1DAGA 3F71A 3NS7A 2P41A 4YCDA 1MJGM 4JH0A 1NBEA 2P77A 4CODB 4G4GA 3QLJA 1YRBA 3TRDA 2Z9BA 4UTRA 3AYXB 4FLFA 1FMCA 5IAKA 1XUOA 5UKDA 5AI0A 1H6DA 5B7GA 5DYTA 3WX0A 5ESDA 2O2JA 4J2TA 5K3OA 5JW6A 1NMZA 3I0NA 3IEMA 3FPLA 3WB0A 1V1MB 5I5GA 1I7NA 1DKRA 1B3BA 5J2TA 5IEJA 3VZPA 1VCMA 2I7DA 4V0QA 1F2UB 1O3YA 1PR5A 4G1CA 4JQYA 4WV3A 4J1TA 5EVJA 3D64A 2VQEB 1NI3A 3SF0A 3MJHA 3TR0A 1IQ0A 3W8FA 3MT9A 4PFJA 1FMTA 4FGJA 3VHQA 3GA0A 3ROXA 2PANA 4YA6A 4ZHQA 3VHXA 1JLMA 1OBOA 4Y6LA 4N82A 5BWNA 2LRHA 4MYDA 3JQ9C 1IATA 1N5RA 3DZBA 4EPVA 3HA2A 3DYVA 3QK7A 1T9ZA 2R8XA 3DUFA 1TQHA 1RPZA 4FYPA 1PJTA 2ZW9A 5KINB 1E2NA 1FNSA 1V8FA 4YDRA 1KI4A 1C1HA 5LP6A 1TEHA 4OQXA 1XZGA 4CMGA 2AZXA 4MCJA 4ENUA 4B6FA 4JCCA 3TTVA 2A0UA 3P9CA 1RMTA 4R8LA 4PPGA 1ZD8A 3NBKA 2X0FA 4CW7A 5AUPB 2C5AA 1I1OA 3JQGA 1LLCA 1R9JA 2BHLA 2J59A 5AJUA 4BVHA 3UHJA 4QBKA 3PGXA 2BEWA 4RIGA 5NULA 1FYXA 1C1DB 2C9ZA 1RLJA 2DMRA 2H2FA 3MXOA 4FHZA 4M0FA 4RKRA 5EWMB 5AM2A 2BFDB 2Q2QA 3MS2A 4QO8A 1W44A 4LBYA 2OQIA 5FNVF 5L3SA 1AQNA 3R09A 4A8JC 3ER6A 2E6KA 1EUQA 5K0EA 1CUZA 4S05A 2VUTA 1ZESA 1EFCA 1R4MA 3KYCA 2NPFA 3UK1A 1PWXA 3KR1A 4HVAA 3NHPA 1S7CA 2EFDB 2IPMA 3D1JA 2YXBA 1CZOA 3FHJA 3L5OA 3P96A 4LJ5A 4X3OA 1PK8A 1ZR2A 4BB0A 1EK2A 2J08A 3GFQA 2F8TA 2FOLA 1VJGA 2P0EA 3K92A 1P75A 1D2GA 2ZSDA 2ADMA 1QHHA 4KN8A 4LYJA 3HZOA 2BZ1A 3L7AA 4XR4A 3ZY3A 4MR9A 4YV7A 1YR1A 2MMGA 5DCLA 4ERNA 3VPHA 1YCGA 2ARKA 1G5TA 3E4DA 3RHFA 3EA4A 1KAOA 3SX4A 4BFXA 4ND5A 2OHHA 5ESRA 1C7FA 3TQIA 3WHIA 3HMKA 2XWJI 4GYYA 1H2HA 3WE7A 4YBRA 3K71B 1JEAA 3IQDB 5EIBC 3DAPA 5J2UA 4D57A 3GL9A 4URHA 2WZBA 4ZVQA 5ICGA 4YT5A 2I2BA 2XXBA 3NBYC 4KXUA 1EUYA 2IY7A 1T4CA 4IOLA 2X2FA 3HLYA 1WMSA 2MR6A 1V4VA 3CN9A 1QB7A 3QVKA 3SGLA 3UFXA 3VJLA 1JA9A 3FOBA 1M67A 3UT0A 1Z4LA 1F38A 1AUPA 3H9CA 4Q9IA 3RIHA 1E1CB 2D0IA 2G17A 5LDHA 3W9BA 3EIHA 1IEVA 3N2EA 2Y67A 3O4GA 4J4BA 4C2AA 4KFCA 4B3GA 2Y71A 1N2EA 1PJRA 1VLZA 4HH4A 1JI3A 3L0CA 1Y5MA 4J2OA 4L9AA 4QXQA 3QJYA 1YC2A 4DMUB 5L95A 2Z2ZA 1G21E 1MZVA 4QDXA 4YWHA 2O19A 4X1OA 5B58C 2W93A 4BZXA 2YFQA 1J1UA 3OIWA 5E9JA 1O1YA 3OOEA 5F1KA 2PRKA 2ZI5A 4I8IA 3DZ8A 4KC0A 1UKYA 1FDUA 4ZU3A 3ZHTA 4CQMD 3RNLA 3A1UA 4QEDA 3ASUA 2I80A 1J07A 1RR6A 2GVNA 1N3BA 4XIGS 4X1YA 3VR6A 1EFHA 1UQTA 1T2NA 4IQGA 4UREA 1O89A 1XJ5A 4KQGA 4B31A 1H4SA 2WTXA 1F06A 1TADA 2FSHA 5I4IA 2UU9B 3SZLA 2ANCA 1EB8A 5GOZA 1Z22A 3HJBA 2CFSA 4Z53A 4QG7A 4RBNA 2XNDD 1KEEB 2AG1A 4RMIA 4AN0A 1Q2XA 3R7WB 2PIDA 1U1FA 2B82A 3GRVA 4Q47A 4OQZA 1Q1AA 4PPYA 1K4KA 2IYFA 2ONCA 3A58B 1PG0A 1VSBA 1PEDA 1MJ5A 2JI7A 4NBSA 4MS4B 2H17A 4RO0A 2R0QC 2OLEA 2PLFA 1ZNWA 2A1TR 4B0PA 2ZIGA 5B1IA 1LX7A 2CVPA 4PS0A 1BQ3A 3ICWA 4FFSA 4K6GA 4NE7A 1IHUA 2WUGA 4ZI7B 3IUQA 3FETA 1EVIA 3LQFA 1MUUA 2W6MA 4TLDA 5TEWA 1J0BA 4WRRA 2XNCA 3D3WA 3P9NA 3R44A 3OA0A 1R8SA 1ZK2A 2OM2A 3A6FA 3NKLA 1JFFB 4U2FA 4BOYA 4JQZA 5AOBA 4BNWA 4EY4A 4KRYA 1I7QB 3JQFC 4FR0A 1CUVA 2OKCA 2ASVA 3K1JA 5H1YA 2JAQA 1OILA 1SQGA 1TVKB 1ZXLA 2C3UA 2OO7A 4O8ZA 5CVDA 3OEHD 3WRXA 2W6JA 2CVHA 1PFGA 3O4IA 1YFKA 1FNDA 2FNAA 3F7OA 1E2UA 4XDZA 2GHTA 3N6VA 1CUHA 2FCAA 1U3GA 3DOCA 3GAZA 3L4BA 4NQRA 3W77A 1O6BA 4V1CA 4BWYA 3CX6A 3O03A 1SCAA 3FGNA 4KBFA 2P9TA 3L7CA 4TYQA 5J2TB 1H2WA 3MM4A 1FFYA 4MUMA 1EVLA 4O4HF 1Y7HA 3WNZA 4R8VA 1AQUA 2G6TA 2FPOA 3DO5A 3QLEA 4DBVO 5JAIA 3CR7A 3Q7IA 4ZAVA 5IUKC 1J8VA 4MS1A 5EJFA 1N3IA 2Q6KA 3N8HA 3BGWA 2OZLB 4WKPA 2ZVQX 1OXVA 2NVBA 4DR1B 4FFNA 1KI9A 3QFSA 1I2CA 4JITA 2V9CA 2JD1A 3MS7A 1LD3A 2FWMX 1IG3A 4S24A 3U3ZA 4RTLA 4FNOA 3TPZA 4CIVA 4Y67A 4OHFA 1GGEA 3JATA 2X86A 1G7CA 2BZ0A 1AHHA 2W6OA 4CLRA 1U6JA 3H2ZA 2ZDGA 3ILXA 3C16C 3QEOA 2ZTHA 1UFQA 4GMHA 4H27A 4KVGA 1PSDA 1KQNA 4CDRA 3INTA 4DNOA 2ZQYA 3KBBA 3PD0A 2IXDA 3CLTD 3A1DA 4R98A 5EP4A 2P9GA 3V7FA 5BN1A 1G7RA 3E9MA 3ZUPA 3N8DA 5BPHA 1JQ5A 3EMBA 4WN9B 3COZA 4QVKA 4RDHA 3EHDA 4BRZA 2H85A 2J3EA 4MDFA 4K6KA 4PVCA 3P2IA 4C88A 4PVDA 2VYVD 3PDCA 1MX5A 3HY3A 3OMWA 4N5LA 3RARA 2VWGA 2PN1A 4MVJH 3BXXA 4I5EA 4O2AF 5E6UA 1I94B 2EARA 1C7JA 2NN3C 1JKJB 3H8WA 4P6VF 4LDAA 2D6FA 3DC7A 4Q1CA 4IQ0A 4R16A 3FPAA 4WY5A 3IPRA 2C00A 3CWQA 2GNOA 4LSMA 2V1XA 4IEIA 5ALUA 2J4CA 3OO1A 1SHJA 3TECE 1FJHA 2Y1CA 3BJEA 2X7HA 3V7UA 3CE9A 4AU1A 5A4JA 4DL9A 4PX9A 2JGRA 1NBHA 2ID4A 1QH9A 4IJVA 1IWBB 2ZP1A 1AKRA 2WR8A 2FB9A 2YVLA 3HJGA 1GQYA 4DGQA 3ZHCA 1GNQA 5DH9A 3C3CA 3LIPA 2VDPB 3LDFA 3HYRA 3DBVO 4JQSA 1G5IA 5TX7A 2BGWA 4KYIB 4MSUA 4F5WA 4V0OA 4D6YA 1FTSA 1BE6A 1OZ0A 2FEAA 3DGFC 3WR5A 5A6VA 1E1MA 1BU8A 4GF5A 1DMSA 4KO3S 3REQB 1EVQA 3GBSA 3DBRA 1X8JA 1PSZA 5FOSA 5HE9A 3L2OB 4FWTA 4BJ5A 3LY7A 4MMXB 3RYTC 1F1JA 1DKOA 4I55B 5JJBA 2GAAA 3VDNB 2B36A 2VJCA 4DCTA 2D1TA 1D7OA 4DXAA 4EI8A 3C8DA 3ETGA 3HKEA 2JKYA 3NBUA 4U5QA 4COKA 2VTKA 4K9OA 2NX2A 4DYVA 1YR9A 1ZVKA 3AO0B 3WRYA 4PXYA 2FEOA 2GZ1A 1WDWB 3QX8A 2HSDA 3TZBA 4FN5A 4D82A 1BU5A 4TV9B 2REQB 4G5XA 4MPPA 5AJZA 1F8XA 2WSSA 4LSWA 3NHUA 4AWXA 2BJWA 4DB2A 1KH3A 4TWBA 4CXMA 7REQB 4DZTA 3EQ6A 5I9LA 3ZDEA 5F21A 5JCZA 1IB0A 2F8LA 5KSZA 4MVJM 3NYIA 4XYGA 1KMCA 1PQ4A 1YS4A 2WWWA 1MQSA 1L4YA 1SURA 1Z6TA 4WAUA 1KYQA 3L82B 3DE3X 1U0LA 4LJKA 4OIFA 1T4GA 1MQ8B 3W5CA 4JODA 4JBHA 4Q4DA 4QGGA 2D13A 3LGXA 1UL1X 4IKOA 3TMAA 3C85A 4C4XA 3IHWA 1OMOA 1Z39A 3COPA 3PYXA 5HNKA 2WWYA 1YFLA 3PHBE 1FLDA 3ECAA 1ECPA 1JLRA 1JJVA 3RIYA 2NO5A 3V4LA 2D2EA 2D8MA 3IHTA 3ZVKA 2PX0A 2QNIA 3PC8A 4DLXA 2AXQA 1EM8A 3L1HA 1VE7A 3B78A 3AB8A 1PR3A 1HMYA 3HFSA 4M99A 4C7JA 2WQ7A 2UUAB 2YFYA 4FMBB 3MYYA 3ORQA 2FZWA 1IBKB 3C3XA 1N34B 1W4BA 1X13A 3EYWA 3I61A 1YS6A 4G9GA 1X1AA 3B70A 1UPAA 3OEEA 2IXBA 4IEFB 4PGFA 5BW6B 4B48A 3M6LA 1H0SA 2FVXA 4PINA 4HAXA 1DFGA 2C2BA 4PAQA 3W2HA 2XI4A 4RADA 1CHNA 1USIA 3OQPA 4ZD6A 4A15A 1G8HA 4PS1A 1ORTA 4P4UA 2X9GA 2BD0A 2EC5A 2Q1YA 2ODNA 1QTIA 2IQ5A 2GEVA 2SKDA 2YJNA 1JG3A 3DAGA 1FP7A 3HVIA 1RZ3A 3T5GA 3NNDA 4EDFA 4BV2A 3TXXA 1E1RD 2OCLA 3GUCA 3TUZC 4TPKA 2M2IA 3KQNA 1Q7RA 4HS4A 5KS2A 3MF4A 2CF5A 2V5AA 1KY3A 4DT1A 1WZNA 4J76A 2D1QA 3KT0A 3IOBA 4LOAA 4G0NA 4Y18A 5BMVF 1GL7A 2E1RA 3QYFA 4EJSA 5LU8A 1ZI8A 3IAS1 5ALMA 1B93A 2H1WA 1JQAA 1F2VA 4O2BA 1O0SA 2QA5A 4C3OB 1PBTA 1DV1A 1SQSA 1P45A 2VDQB 3ODPA 4HFMA 4X7PA 1Z8NA 2CHGA 1HRDA 1L5ZA 3NDIA 1G5HA 4G09A 4IMJB 3W9YA 5CFLA 5GTDA 3RVLA 2WQZA 3ZW8A 1K9SA 1NQOA 2QGFA 4G36A 4BBAA 5ITWA 2PD6A 5L4SA 2I1VB 2Q1XA 3L01A 4I5IA 4KE9A 3VSAA 3FSRA 4JXKA 2XT9A 1KC3A 4EG3A 1ZPDA 1SHLA 2IUEA 2JVKA 2XSZA 4M1ZA 2NPOA 2PS0A 3FDZA 4HYEA 4BO0A 5E1MA 1UP6A 1F8GA 1BFUA 3RSLA 3WKCA 2QQGA 1GR1A 3EX7C 4LI3X 1MX3A 2ZYUX 4Z9XA 1L5VA 1A69A 1RP1A 3HJRA 3BFXA 3CF2A 2GN6A 3N0RA 4IVPA 1ZM4A 1AX9A 2PMWB 1ECFA 3N5CA 1P8AA 2LUOA 2GCNA 2J4DA 5LD2B 4IJMA 2V6JA 3BCRA 3TQOA 2VQ6A 4Y6PA 3W4JA 1HDYA 4WFJA 1T0JB 1DIHA 3GEPA 3DO6A 5CT9A 4D8UA 5KZMB 1W1WA 1GNVA 1UINA 1CJMA 5BRNA 2O5CA 2NQ2C 1BX3A 3NC4A 3MOGA 2Q3MA 1XTQA 1SVKA 2WHPA 1ST3A 3DOIA 3EMKA 4UUBA 4UNQA 2GXQA 3Q41A 3W2EA 2IYWA 4XM2A 2EFCB 1IH8A 2O5EA 3I2JA 2PL1A 1O97D 1NJ1A 1CIPA 1VLMA 2FW8A 4DG5A 5K8IA 2OCYC 2XCUA 4BX9A 3HA5A 5EP3A 3TR6A 1G55A 1T8TA 5EG5A 2O59A 5TLSA 2O2IA 4O63O 3DCYA 4LOKA 5T7BA 1OKKD 1X7XA 3BXGA 1ULHA 1P80A 2IYTA 1OTXA 1BH2A 3I2FA 3QY9A 5J3JA 1R12A 2QP3A 5TPWA 1OX4A 4OJMX 2C9BA 4ZWNA 2FLKA 4WCFC 3C14C 4GLJA 1KSHA 1NMQA 3HP1A 4KQ1A 2EFEB 5EKSA 1JECA 2OC9A 1W49A 1ZD1A 3GIDA 1N7GA 3LHKA 1P91A 2JEZA 3NDPA 1VP9A 3BE6A 3CYFA 4KXWA 3WL4A 3AUSA 3ESZA 4FFRA 4H0FA 3ZWXA 3LQ2A 1O95D 2BBOA 2R6JA 5E0KB 1R7RA 2XTJA 1MNQA 3EFEA 4IXWA 3WBJA 3O9MA 1X1TA 2OCAA 5A7HA 1Z29A 1MH9A 1IBMB 1FPMA 1ZCAA 3PUWA 3C4JA 4R71A 3CMMA 4IEEA 5AP9A 1TD9A 2X9QA 2PVCA 6CHYA 5ALGA 4ZT4A 1RTTA 2NO1A 5LNK1 2VJOA 4BEJA 3HKDA 4CPDA 4EY5A 4XCQA 2XGMA 1Q19A 2FQ1A 3A9WA 3D8SA 5WRFA 5JTUA 4NFHA 2FPPB 1W36C 4M87A 5IJAA 1H8EA 1UC4B 4L50A 2Q4OA 4W9MC 1AF4A 3PDIB 4JHXA 2VXBA 3S68A 2VLBA 3RLIA 1A9PA 4XE5A 2NU6B 4R9NA 1GQFA 2CUNA 2KQUA 2Q2NA 4TSFA 4OXKA 5I4BA 4ZO4A 1QOPB 4DSUA 3B1KA 2Q6OA 4Q3OA 3W05A 1HFKA 3IEXA 3BRWD 1VMAA 4YJ2F 1W5AA 5EZ6B 1OPXA 3CHYA 1XLWA 3DVRX 4S1WA 3ZYCA 1ESCA 5BXYA 1L5FA 5KWVA 3D7SA 2GPTA 4G65A 3D3QA 1PZMA 3DXZA 2IOFA 2MIIA 3JQPA 1GRCA 4IOKA 4OB8A 4A5OA 4AZ0B 2HK6A 3DLTA 3LG2A 3AF1A 3OJFA 3W3AD 4GI5A 1P17A 3QKUA 2JLAA 3SKVA 3V8PA 1W94A 1XCJA 5COAA 1HE1C 13PKA 4NCKA 2IS4A 2IH2A 3TLXA 2GX6A 3VPDA 4C5CA 1RLUA 2VKTA 2HWWA 2C2OA 3E2MA 4QYMA 1A4IA 2HF9A 1GA4A 1L7AA 2PYDA 3AHGA 1KERA 3TTSA 2D2FA 3OC6A 1WCIB 1HDRA 3V4RA 1E20A 2F67A 2P7HA 4KO8A 4WXPA 3UUEA 1A0OA 5DX1A 2ERCA 5A1TA 3TQQA 5JSQA 5JR3A 1B6SA 4LBVA 2A33A 2HHCA 4NAHA 1RXYA 3FRJA 3KEQA 5U9CA 4ZCMA 2PKEA 3BDVA 4B6PA 4JT8A 1FK8A 3QF4A 2C31A 3VKVA 3DOUA 4XQGA 2HA2A 4ZK2A 2OCKA 4R81A 1VL8A 1W6UA 3CH5A 3P52A 5LIPA 1P9RA 1GLNA 4QU5A 3CLHA 3CLUD 3I2IA 2QRHA 1VFPA 1RSZA 5J40A 1PDVA 1PI3A 1HEUA 1N2JA 4BC1A 1DTWB 3OWXA 4EY3A 5DNCA 1R9NA 1CZLA 2QVLA 5JS1A 1OT5A 4QU0A 5CFQA 3TWOA 1ZH8A 3GVCA 1RYDA 4M98A 5JNVA 1B0UA 2G8NA 1UBOS 1NL3A 3A9RA 2Y1WA 4OSEA 5JV5A 2J6HA 3PF8A 3I4LA 1JVBA 3IMGA 2Y99A 4OV6B 4LHEA 2VF7A 5EC8A 3UMMA 2WUEA 2DAPA 5HEKA 1D2AA 2ZZKA 1FVOA 1ODLA 4NZMA 1WA5A 2UZ4A 4R3UC 5L53A 3GLGB 3JZIA 1AD2A 1NUUA 2IYVA 2ZU6A 5IWCA 1QSGA 3PBKA 3U37A 1U02A 3IH5A 2ZCUA 1QMGA 4E46A 1EQAA 3DEIA 3E0QA 4PWZA 4WZ6A 1FRFS 2B20A 3FJOA 5JBIA 3AFOA 4N7MA 4Y2SA 3UH0A 4BLRA 1MC8A 3FFBA 4YAGA 1IN7A 4IP0A 4RZXA 5EE5B 2WT8A 4Q7JB 3E1KA 3SEQA 5JU6A 2BH9A 2IH4A 5F1YA 2H0AA 1XTBA 2H4FA 5J43A 5JSUA 1GPWB 2Z2YA 1UT8A 4A0QA 4CV3A 4JQOA 4WOKA 3W78A 4B35A 1XX6A 4Z51A 1MU0A 1VBKA 2PU5A 3F5DA 4K2HA 4WBSA 4X6YA 2C4TA 2JAPA 2Y1LA 4CGYA 3X1WA 3TIVA 1TAQA 4AZ3B 3E2PA 3EE6A 1HGXA 1MB9A 4JR1A 1OLXA 1RQRA 1TM1E 1CC1S 4K7JA 4R2LA 4BZQA 2JCYA 4K1LA 4HV4A 4UTVA 1P4GA 1E2PA 2M32A 4ZVLA 5KNCH 1GM5A 3NX4A 1AGRA 1DPGA 1RRKA 3R3SA 1M2NA 2Q1WA 4QE3A 5ILQA 1RBZA 4I3GA 3SHOA 2D1RA 1UCFA 3A2MA 3SSMA 5TQ0A 4NAVA 1JMVA 5C1BA 5TDHA 1P9OA 2G4LA 5ANRB 4AKHA 3KPYA 4M38A 3GLVA 3PWTA 4R84A 3TUJC 3ED5A 2CXRA 5HKLA 1V45E 3CH6A 4PE5B 1E8MA 2C82A 2HJHA 4A8JB 1JLLB 1R6DA 3RVDA 1PUXA 1I3OA 5E1BA 5JCPA 1Z7WA 1VE5A 1OROA 1CYEA 1O4WA 2BDUA 3T1NA 4TUYA 3E4CA 3RVOA 4U5XA 4BJHB 4NCAA 4N49A 3EDQA 2YXLA 1NW4A 1DG1G 5G0TA 1YRWA 3JVUA 4J1SA 1E2FA 5H59A 5JMPA 3F3SA 5AESA 7YASA 5G2OA 1NZFA 4BGIA 1B1CA 2JCXA 4AULA 4U7WA 3N2ZB 2XYGA 4TYNA 1Y34E 1WB4A 2H1HA 3OU2A 2WP0A 3FH0A 4A16A 3QBVA 2HBZA 4W7HA 2Z56A 1GT6A 4YLGA 4C21A 3KOMA 5DFAA 3EQ2A 5HMMA 1I7SB 1OLUA 3KE9A 1KZ7B 5EKDA 5THKA 3ORHA 2RK6A 4QT4A 1E6WA 2YJTD 4FGZA 5SV2A 4DC0A 4R2HA 3LMKA 3GPLA 3TEMA 3QU4A 1NATA 3BJZA 1QHYA 4ZOBA 4LE0A 1ZW1A 5EQFA 2ACVA 4EFMA 5BUZA 3LBAA 2BPOA 3L8ZA 2WU4A 3IP9A 2BFBB 4DDHA 5K3AA 2B6HA 2XMPA 3SYLA 5ER9A 2GXAA 3D6JA 4QQKA 3QTTA 4OO3A 2IW3A 5ALQA 3RHZA 4RSRA 1E18A 2ZB7A 1KEEA 2DCUA 4HDMA 2VOEA 2BGLA 3V8VA 4BWGA 3H4IA 3H04A 4BYMA 3PC3A 2HADA 4XD2A 2JGJA 1JTEA 4OMDA 3HS3A 5KYWA 3AEZA 2RGRA 1CPYA 4CG2A 3OOJA 4CMJA 2CLMB 1WDTA 1XCOA 3AILA 4OEHA 1NVAA 1BFDA 1L4KA 3F97A 4HFRA 3WWEA 3LW7A 1UK9A 1YHNA 5BNZA 3QXJA 1QPGA 3HP4A 4UZSA 2WLSA 1NYRA 1T8YA 1C3XA 1XCPA 4C6TA 1S3GA 1Z3IX 4LW8A 2ZXUA 4XWYA 3O2JA 1AK2A 3FMOB 4P58A 1GL3A 3WGMA 3BMNB 4F97A 5AXDA 4EZBA 1RYBA 4FZJA 1EUCA 2DT5A 4JUCA 1LK5A 3DWGA 5BP7A 1U5CA 2WG0A 2AV6A 3OIGA 4M0EA 2H1CA 1RC0A 4UDYX 4NLLA 3ENWA 4S3MA 2KE5A 1FC0A 3ANXA 2HPAA 4EVIA 1DU4A 1F0YA 4MP8A 3TQSA 2PH1A 3SHQA 3R5JA 1KWGA 2DPGA 5BVHA 4DC9A 1HFEL 4QTXA 2BKXA 1ZA1A 3EC7A 2FMXA 3VH1A 1MT0A 4F2DA 4M8KA 4E32A 1PJBA 5KWSA 1CJVC 3OU6A 2OT3B 5EA2A 2EFJA 5EWJA 2IYQA 5EFOA 4W7SA 4HB2A 1EK1A 1W88B 1GUYA 2FEWB 2RIPA 4QPZA 5JPCA 3SM9A 1QYRA 2XUAA 3PE4A 1R6VA 2HJGA 3U0VA 3M6MD 4AVYA 4FCCA 3RRMA 1HDXA 1D7AA 1PJAA 2FR0A 2WE8A 4YJFB 3QWIA 1Z33A 4IUDS 3K6RA 2RB5A 4JB8A 4TLCA 2WYUA 1G8PA 3PA8A 3NEPX 1QQBA 1NT2A 1RPNA 2GEBA 3SLKA 5JQWA 4XIIA 3I52A 1ADCA 4MUGA 4DDTA 5CB0A 4TWIA 2Q2OA 1XJQA 2VQDA 1ZM9A 2GYUA 1MO6A 1CJSA 2NU7B 3CPEA 3F1LA 4AJ1A 1JBEA 2RJOA 4L3OA 5IASA 3EH2A 4GC5A 3E5MA 1GY8A 4FKBA 3L8HA 4MHSA 5DE3A 4EY8A 3NO4A 1IUNA 4MA0A 5GINE 3K09C 5ICSA 4UCQA 1U7UA 3LPLA 3TLJA 3I6YA 3UWKA 4CL3A 3WMXA 5CURA 1SG9A 4IMPA 1CT9A 2AI1A 3KPJA 4P3OA 2MU1A 2HJSA 3OEED 4EFNA 4UMDA 4DLRA 4GYKA 4ZK6A 1MPXA 5KJCA 4ZFNA 1LVGA 2K2WA 1QWOA 4HYTA 1GN9A 4M4SA 2QR5A 3FFAA 5FA6A 3FFWA 2I4IA 4WZAB 4R7TA 4JCOA 1IXSB 4PLGA 4ZZ0A 3Q0EA 5KKAA 5DV9A