1U0SY

Chemotaxis kinase chea p2 domain in complex with response regulator chey from the thermophile thermotoga maritima
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
b'GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title In different organisms, the mode of interaction between two signaling proteins is not necessarily conserved
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 43
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u0sY00
3O1IC 4D74A 4G0YA 3DBIA 1M2EA 3M9WA 2JCGA 3O1JC 3OMXA 3RVJA 3OM0A 5EWJA 5TE9A 1D5WA 2XDYA 2YHBA 5EWJB 4EUKA 2PUAA 1CYEA 2E4WA 2OENG 4Y9TA 3LUHA 2WWVD 2QXYA 4YP9A 4B09A 2QZJA 3FDFA 4DQDA 1JBEA 1JYFA 3NHZA 4LRQA 3LMKA 2BGGA 1NXXA 3HV2A 1EFAA 1NXTA 3JS5A 3KTOA 2R25B 4S05A 3TB6A 1TVMA 3W9SA 1WETA 4FE4A 4ZYLA 5ED4A 2PUGA 1P6QA 3MA0A 9ABPA 4IF4A 4RK1A 5EWLA 1L5ZA 1R8JA 5E3JA 2OQRA 5EWLB 2FMFA 2PLNA 4MS4A 2HPHA 1YMVA 4MS4B 4FB4A 3C6QA 4RK6A 3F73A 1JHZA 2AYXA 3A0UA 4JB2A 4MR9A 3HZHA 1E6MA 3QELA 4YR7A 3QELB 1I3CA 3NBMA 1JFTA 1XHEA 2GKGA 1M5TA 1APBA 3LTEA 4MQFB 1QNLA 2AYZA 4W5TA 1JWLA 1DCFA 4H3KB 3M9XA 5I4CA 1D1PA 4YV7A 2L18A 3FFXA 4G86A 4UHKA 3IP6A 1PNRA 2IYNA 4IMJB 6CHYA 3QLUC 6ABPA 4KREA 2FMHA 3QLVA 1Z2EA 3QLTA 4MS1A 3KKEA 2IKSA 3Q7SA 3O2QB 3R0JA 5IEBA 3RQIA 4OLBA 5DCLA 1RNLA 3LKBA 4F11A 2RDMA 3RVOA 2LBPA 1C4WA 1A0OA 3I5AA 1DJMA 1DC8A 2QVGA 1SXIA 1AB6A 2MYUA 4N0PA 3UUGA 5HQJA 1URPA 1NXVA 1DRKA 1DBPA 4OATA 5T3YA 1A04A 1RZRA 1RXEA 5TPZD 4RK5A 3ROTA 3CZ5A 3GL9A 5BQ3A 4YWHA 1D4ZA 2IPNA 3E61A 1SRRA 2TMYA 5FWYB 4D6YA 4EY3A 3FGZA 5IULC 3OQNA 1SD5A 1TM2A 4PYRA 5DKFA 1YS7A 2IPAB 5JNRA 4OBBA 4KMRA 4PE5B 4ZJPA 2DRIA 4XLTA 2JRLA 3EJWA 1CHNA 3QX9A 4KRFA 3OMWA 3LUDA 4JP1A 3IPAA 2FW0A 1QMPA 5TPWA 2FN9A 5TPWB 1EWKA 3BREA 2X7XA 3H6GA 4KV7A 3SNKA 2J48A 3CFYA 4LZLA 1ZGGA 4RXUA 4WUTA 4G0OA 4EVSA 4TMYA 2NT3A 1NXOA 2HJ9A 2NZVG 2ID9A 1SXHA 3HXMA 3FFTA 3GBVA 4XFKA 5T7BA 4MRMB 3I42A 3MM4A 5KQLA 4W5RA 4TN5A 1QO0D 4TLMB 3A10A 1NXSA 5IUJC 3RVPA 1USGA 2FLKA 1JYEA 1TLFA 5IUNC 5DTEA 1DCKA 2E4ZA 2IPLA 3O1HB 2JVJA 3N0XA 3QX8A 1GLGA 3SM9A 1DBQA 2FSPA 3EQZA 4E7PA 2FN8A 5TQ0A 4RSMA 5TQ0B 5B3JA 2FXIA 3QK7A 3SY8A 1DBWA 3G85A 4UHJA 4ETMA 4KK4A 3NNSA 2LPMA 2QU7A 1EWVA 1PHRA 4WT7A 1ZN2A 3KLOA 1GUBA 2M98A 4H60A 4MQEA 3KJXA 4EVQA 2QR3A 1BDJA 1MAVA 2YHAA 3KYJB 1XHFA 3JTEA 2IDMA 2WY2D 3H5OA 3QEKA 5GOTA 3VNBA 1FFSA 1Z18A 3L49A 5HM6A 3CKMA 4RS3A 2GX6A 4N03A 3HUUA 1DP4A 1JX6A 3ILYA 4PEVA 4Z4GA 5FWXB 4E7OA 3ROFA 1VRVA 3DGFC 1KMIY 2PUFA 4GPAA 4P1ZA 1AB5A 2NT4A 2HQOA 3T6KA 4M88A 3KSMA 1F4VA 3H5VA 2PJUA 3OLZA 2PL9A 1CEYA 3KG2A 3C3WA 4RZSA 3CRNA 2GI4A 2IPMA 4N47A 1E6KA 5CNIA 1ZHHA 1YMUA 4MR8B 3HJFA 5FWYA 4IMIB 4Q6BA 2E4YA 1ZAYA 2FTKE 1BVHA 5DGCA 1ZH4A 4G0QA 1E2BA 5KQGA 3EAFA 3MQ4A 1QQAA 1J56A 1T34A 3D02A 4RKQA 1H9CA 3GT7A 1ZITA 4YRZA 4ZMRA 4HNQA 5ABPA 2QV0A 5JNTA 1FQWA 1DZ3A 1NY5A 3D8UA 4MQFA 7ABPA 1IIBA 2WJWA 4RY8A 3GA5A 1L5YA 1BDHA 1M2FA 1FFWA 1YS6A 3BILA 1TJYA 1LJUA 1TMYA 4JA2A 4QYWA 2FEWB 2JK1A 4PICA 2GWRA 3O21A 4RY0A 3HM9A 4RKRA 2PE5A 5JNWA 1ZY2A 3CU5A 3EODA 3N0RA 4L4UA 1MVOA 3HUTA 3LUGA 3TD9A 4LDAA 4YCSA 5C5EA 1QQBA 1JLKA 4YO7A 4GNRA 4MAAA 1USKA 4RXTA 1Z26A 2L17A 3F6CA 3VNAA 1GUDA 2NZUG 3I45A 4QPJC 4KVFA 5KC9A 1D1QA 2H0AA 2A9OA 2JBAA 2JBAB 4DADA 3F7NA 4G0XA 2CHEA 3KYIB 2QSJA 1U04A 4WXEA 4XARA 2R4QA 4Z9BA 5C5CA 3K4HA 1ABEA 2WB4A 4Z0NA 4LX8A 3LUFA 4OTZA 3RVRA 1FSPA 2FEKA 2FLWA 4L85A 2PUEA 4NICA 2H3HA 1ZGZA 1YK1A 3O75A 4XAQA 4NCBA 2VYCA 1LBHA 4HNSA 3CLKA 4Z4FA 3N6VA 4RWEA 8ABPA 4NV3A 4KNYA 3Q9SA 4RK0A 1NXPA 1JL3A 3KLNA 2FQYA 4ZMSA 4F8JA 4KPYA 3GYBA 2RJNA 4G97A 4MRMA 3OLVA 4MS3B 4F3TA 3C3KA 4RK4A 5PNTA 2WMYA 3O2JA 3NHMA 3RH0A 3TO5A 1PEYA 1U8TA 4IILA 3BRQA 4YGXB 4OLAA 2WJAA 4MLCA 2F8TA 1B00A 3Q41A 2LUOA 4O1HA 5BR1A 3FFWA 1EWTA 2HQBA 3O2SB 5CNKA 3Q15C 3JPWA 3QLUA 4P98A 1RXIA 4OG2A 3FMVA 2PAFA 3CZCA 2ZAYA 2V0NA 3JPYA 3Q7TA 1DCMA 4Z4HA 4MR7B 2RGYA 4DN6A 1DG9A 3IDOA 3M6MD 3QEMB 5EWMB 5CHYA 4JB0A 3G1WA 1QP7A 1RZRD 4MGEA 5BRAA 1UDRA 2VUIB 5IEJA 1U2QA 2ID7A 4JOQA 3I09A 1K66A 3DGEC 4JASB 1U2PA 3TX6A 4Q7EA 3H5LA 4H3HB 5FWXA 1KRXA 1YK0A 3LKVA 2E4XA 3IP7A 2P9HA 1Z13A 3LUKA 4Q6WA 5KI6A 1MB3A 3LUCA 4KQ9A 2L19A 3T8YA 3QLVC 2O20A 2RJOA 1ABFA 1D2AA 4G0MA 4RY9A 2N9UA 1W25A 1JDNA 2JB9A 4KZKA 1YIOA 3CG0A 1ZH2A 2FEPA 1ZDMA 3SG0A 3NNNA 2E4UA 1SXGA 3H1EA 4EYQA 1BDIA 4RV5A 2PKXA 4MLDA 3GBPA 4G0ZA 4LDZA 4RU1A 4Z4EA 4MR8A 4NCAA 3MYYA 3BBLA 3OLXA 4O5AA 1JF8A 3KCNA 4EGSA 2M1ZA 4QYMA 1PNTA 3L6UA 4IRXA 4JAVC 2MSLA 5TPZA 1QP4A 5JS1A 2B4AA 2MSKA 3CNBA 4KQCA 3A3KA 4RDCA 4Z9AA 3H5WA 1NATA 2FQWA 2IOYA 4KFCA 3DLBA 4TLLB 5FBKA 3SAJA 1ISSA 4QICA 5JNUA 3HCWA 1LJLA 1VKRA 4W5QA 5HSGA 3H5IA 3MIZA 1PUXA 5DLEA 1BA2A 5TQ2A 5TQ2B 3HEBA 1K68A 2FMIA 3RVNA 4F12A 2LP4Y 3MMNA 2MSWA 3ILHA 4LE0A 2QVCA 5F64A 2CWDA 1C0EA 1JFVA 5CNMA 1GCAA 2ZWMA 2FMKA 3MF4A 3IPCA 4EYGA 5GQSA 5HKOA 3N53A 1QP0A 3DLHA 3T95A 1QKKA 3N0WA 3F6PA 3HDVA 4MR9B 4N0QA 3E3MA 3C3MA 2PUBA 4CBVA 4WXMA 4WZZA 3S99A 2MYTA 3H6HA 3OO1A 1QO0A 3H5TA 3Q7RA 4HNRA 3CTPA 4YLEA 1HEYA 3LUAA 4Z99A 4EYKA 1ISRA 5IX8A 2CD7A 4ZPJA 4ML3A 3CHYA 1QPZA 1EHCA 1Z25A 2MYNA 1E6LA 2PUDA 1Z15A 5KQMA 2HQRA 4F06A 3HDGA 1P8AA 4MYRA 2W42A 1U0SY 5B3JC 4D6XA 3A0RB 4MS1B 3RVKA 4S04A 1DC7A 3EQ2A 2GBPA 2L2QA 1P6UA 3BRSA 1KRWA 2FQXA 2A9RA 4KK3A 1Z12A 1NTRA 2LIVA 3B2NA 3NNDA 3IP9A 5D2CA 3OM1A 1Y1LA 3DZDA 3C97A 2FKAA 3H1GA 4LE1A 2E4VA 2JVKA 2VUHB 1PEAA 4RXMA 3OQMA 3JY6A 4N76A 4MS3A 4O1IA 1Z17A 3JVIA 1YVUA 1KGSA 5IC5A 3HK2A 1OXBB 3HSYA 3CS3A 3EGCA 3K9CA 3LOPA 5TQJA 3HVRA 4PZ0A 5IBQA 1P2FA 1ZESA 1DRJA 5KQPA 4LE2A 2PMCA 2Q5CA 1EAYA 3O74A 4MPTA 4NQRA 1Z2DA 4Z4CA 5BRJA 2I6FA 3RVSA 2MYPA 1VPWA 3OLYA 3OO0A 5KWSA 4IGAA 1OXKB 4EYOA 4W5NA 4G0PA 5FBHA 3UKJA 2VK2A 1JH9A 1ZVVA 1VLZA 1YTUA 3RVMA 4XXHA 1Z16A 3CG4A 2NUBA 4MR7A 2WRZA 1RPJA 2R48A 1BAPA 2B1JA 3QEMA 2A9QA 5EWMA 3URMA 1GCGA 2QW1A 3GWGA 4ETNA 3GRCA 3N75A 1LBIA 3TMYA 3UK0A 1XWWA 1NXWA 5JNVA 1JDPA 4FE7A 2JVIA 4WWHA 3T38A 2CHFA 3LUJA 4W5OA 4HYEA 5CNJA 5JNSA 3EULA 3EDCA 3LFTA 2KYRA 4ETIA 1USIA 1A2OA 2R47A 3IP5A 3OQOA 1W9HA 4EVRA 1FFGA 3H1FA 3P9YA 5KC8A 3HS3A 2F8SA 3SQNA 3RVLA 3H75A 3JVDA 5JS2A 4N41A 5IUKC 3HO1A 2PL1A 1MB0A 4MQEB 3KS9A 2FVYA 4Z4IA 2P4UA 3RVQA 3KHTA 1MIHA 1JFSA 1LK0A 2PUCA 4YS6A 1M5UA 4RK7A 3OLWA 3N8IA 1F51E 1S8NA 3GV0A 4XASA 2HSGA 2A9PA
chains in the Genus database with same CATH superfamily
4C6TA 1SCNE 4ZHSA 5A1TA 5MHTA 3FJ1A 4WA7A 2YC2C 1ZL2A 4O63O 3O1JC 1P72A 2C97A 2GSDA 4L8LA 2PUAA 1RYEA 1FUUA 4W8HA 3ZXXA 4UTOA 1YZYA 3O3CA 4DR1B 1P1FA 2QXYA 1MTOA 3L8ZA 1AS3A 1C30B 2PL3A 1ACLA 4EVIA 1PWYE 2WVGA 2C2MA 3H5NA 4JY7A 3WGVA 3ISJA 1Q6YA 1NXTA 3TLMA 1G4AE 3WHPA 2O57A 2A6PA 2KLHA 4DDUA 4HMQA 5K1ZA 1Z8NA 1K6MA 3D9QX 4X7RA 5JMOA 4HQFA 2OT3B 4Q3BA 1I0IA 5BYBA 3B5JA 3GFTA 1XRRA 2RGAA 2ZIFA 4I1IA 3FG9A 4MS4B 3TMAA 4FB4A 3OHMA 1LPOA 2JPDA 3THYB 2R3SA 4C9BA 3IOEA 1AXRA 3GEBA 2V96A 1IEQA 3M6VA 1VL0A 3HR4A 1Q1QA 1YB7A 1KWGA 5AJZA 3E05A 2I2XB 3TQRA 1G2QA 3BEOA 3T7CA 3VPXA 3DBVO 5BNTA 4XIFA 3ANNA 1DCFA 5I4CA 3QEBZ 4JB8A 1FVHA 1TQ8A 2EW8A 3QU5A 3WLQA 1Z4IA 2RBEA 3FGOA 2VJQA 5FLKA 2KE5A 1YI1A 2UZ1B 4HF7A 5A04A 4P4SA 3SIXA 3W3ZB 2PZEA 1EUQA 3DEKA 4QQ8A 3CKLA 4DWOA 2ZR9A 2AR7A 4L5BA 3RQIA 2O3QA 1RJEA 3VC1A 2X1LA 4FR5A 1Z8HA 4D97A 5BNWA 1UKAA 2DBVO 1BMFA 3RG2A 3SZOA 3JR3A 1YKSA 1X39A 5JJKA 1EFRA 2FSVA 2VQ3A 1PT6A 1WXDA 2FSSA 1A0OA 2LBPA 2QRVA 1NJ8A 5FUVA 1BEZA 4HFJA 4CL3A 4L8WB 4ZAXA 3NGLA 3L1IA 1RACA 5E9AA 1CUCA 1URPA 2ZTVA 1IWOA 1XXHB 3ASZA 4BB5A 4PYQA 3HCEA 4O4HB 2PX3A 1DO0A 2RMKA 4O25A 3VO2A 1V1MB 1D0VA 2IZ5A 1YJXA 5C5IA 1YZGA 3UFBA 1RI5A 3I4CA 1L3BA 2CSXA 5DMXA 1HFWA 3SKYA 1PL6A 2DFDA 1I4DD 2NO6A 5DW3A 3NBAA 3LSTA 4F9EA 2GHTA 5KMGA 4TT3D 1SWWA 1UPAA 4LK2A 4BC1A 1I4LD 2Q62A 4X91A 4CF7A 1OLSB 3GGDA 3PRKE 5E1OA 2HT1A 3BZUA 4K40A 3AUSA 4RVDA 3EOZA 1ATIA 1NG9A 1X80A 1GVNB 1T2UA 1Q0LA 3PPIA 5SY6A 1OROA 1Y3HA 3LCMA 3DEJA 2Q50A 4M83A 4OFZA 1GV1A 1I13A 2ECKA 3OFJA 1H9AA 4OFXA 3UQYS 2JLYA 3DAPA 4R8RA 3RRFA 4A0QA 1ZM2A 2E48A 2GZAA 4N0EA 2X76A 5F98A 1FDIA 4TZ0A 1U9JA 1JDTA 2NYUA 2XAUA 3PDIB 5FYQA 3HXMA 1FPQA 1ZA2A 4QQKA 4NIMA 3LYAA 5FUYA 2C00A 1DUSA 1ENZA 3W77A 4DV2B 2OGUA 3GEMA 4DY6A 3L18A 4KQXA 1XMOB 1YR1A 1J8YF 4Q3AA 5CT9A 2HJVA 1M1YE 1ZGHA 1U8CB 2P2ZA 4D82A 2EQAA 4B85A 2IPLA 2O0HA 1L4BA 3H8SA 3KUKA 4NHEA 3VU3A 5K2MA 3EEBA 3N2ZB 3IR5A 4HL6A 1WUHS 3KR9A 2FSPA 2WZQA 4I50A 3TSYA 3NO4A 2C8VA 3KJZA 3L0BA 1OI7A 2WIJA 4F4FA 1Z7GA 1UMCB 1RKBA 3SQDA 3I1YA 4PRLA 2H06A 3A1WA 2BKVA 3IBFA 4KK4A 4ARZB 1DUVG 2KM1A 1KK1A 3RK0A 2Q3FA 3NNSA 1QG4A 1YR9A 3HO8A 2C98A 2IXFA 5EL0A 1Z6PA 4G6ZA 5EFOA 3WL5A 1BE6A 3O4HA 3N58A 4IV5A 4V0KA 3IV9A 4GZ6A 4WOJA 2C0QA 3PCTA 3WXBA 1J2TA 3KYJB 3U16A 1BH6A 3ANSA 3E2MA 3H5OA 4GRDA 4Q4DA 1AKNA 2I22A 3RFCA 2W37A 1TIKA 2BKLA 2GX6A 4P3PA 2OLJA 3GHYA 2FPGB 2YJ5A 2PZJA 3IHKA 3NEYA 4MVJH 5B1SA 4CF5A 1U0RA 2NPIA 4RD6A 4OKIA 1MQAA 3NETA 4W5JA 2OORC 1YCDA 1FFCA 2ZULA 3D1JA 1E2IA 3H5VA 1GWNA 1EX1A 1LLFA 1SZDA 5CRIA 4B7UA 1V2HE 1SRQA 2VC2B 4F60A 4MV9A 4XB6B 4GH5A 3DMYA 4GEKA 4BNKA 3I61A 2JIZD 2IZZA 3MOIA 1F17A 1XJ0A 3HB9A 5DM2A 4JJEA 5BN4B 2A30A 1D6JA 4X5OA 1TW3A 1GYPA 3ELUA 1IONA 4P4UA 5F5XA 2BTEA 4OH7A 1PJSA 2X4IA 4M1SA 3RVDA 5B7QA 4J7CA 1KQNA 3TZCA 5LM3A 3LIIA 1AQUA 1EXNA 2FTKE 1VRCA 5K4GA 4DL9A 1Y9JA 2J3LA 3KHSA 4G0QA 4L74A 3DD5A 1GRQA 3OE7A 5JPIA 4EPXA 1J7KA 2JFZA 1KEZA 1K7YA 1N7IA 1AQYA 1UDXA 3PJEA 4ZO9A 2NX2A 4ZMRA 4XWWA 1NASA 3I34X 5FNVA 5GJCA 3ZK9A 3O4RA 5KNDH 1AGXA 4IMRA 1S6YA 1MOZA 1P91A 3W4KA 1IUPA 1FQWA 3V3KA 5EOVA 3VYSB 1NFFA 4BEWA 3ZPXA 4DNXA 1GZ7A 1Z47A 5DBHX 3L01A 2EV9A 2OD2A 1YJQA 3PHJA 4RQUA 4G5SA 3RUFA 1M2FA 4GRIA 1VYUA 3E27A 4C7XA 4FYVA 4QKQA 1VI5A 2DHQA 5ALJA 1T24A 1X7DA 2MSDB 2ZVDA 3CZPA 4I1RA 1JR2A 1VDMA 3OVMA 1WB9A 3JQ9A 3PLAE 3ESRA 3CLRD 3N0RA 1VTKA 2JEZA 1N7HA 1E94E 2ZSAA 3N76A 1U1GA 5KNBD 3KZMA 1DQSA 1EH5A 4AB1A 2PKWA 3WGOA 3WBJA 2ADMA 2OCYC 3AKDA 3HKBA 1RHRA 3K8ZA 1RVDA 3PGJA 4IQFA 3U81A 2ACEA 4RA9A 3KUXA 5ECGC 3H2BA 3CINA 3G2PA 1WVMA 2Q0SA 2Q5IA 3P32A 3QPWA 3ST7A 2Z8YM 3KKPA 3O95A 2ORVA 1NWHA 3F7NA 3AR2A 1W47A 2HMUA 2PGAA 1I0LA 3QUTA 3OIDA 3E81A 1XQXA 2J7KA 2QY6A 5HMMA 3TQHA 4HDCA 1XQ9A 1F12A 1KZGB 4J0QA 1F2VA 3V42A 3P2YA 4LIPD 3OWHA 5LOVA 1XNRB 2BF7A 2ZTSA 3UWKA 5HK9A 3FWKA 5CDSA 3SK0A 1XEAA 3U3OA 2PR7A 2XUQA 3OF2A 3JQGA 1SPXA 4P4GA 3HA5A 1ZMXA 2Y9MB 4EJ6A 1RQPA 1WVIA 2BGLA 1NQOA 1V6CA 1YDMA 5DFAA 1FVXA 1G3IA 1SUIA 4ZQGA 3VR4D 4GMFA 3PQDA 1KL7A 3WQSB 1UM9B 4OAQA 2BM9A 1SCJA 1DXQA 5F21A 4BNTA 3I9OA 5KJFA 5DPMA 1T3HA 4LNUA 4N39A 3MJEA 4GUDA 5PNTA 2FWBA 1LVHA 2HSZA 3RSLA 3ONWA 4EKNB 1PEYA 1U1DA 4MKXA 5KTRA 3EPRA 5EIXA 3JQFA 4OYRA 1P2VA 4QX6A 4YMVA 4YJFB 4ZC1A 2Q99A 3FFWA 5TMEA 2XDQB 4X95A 2I8CA 2ZIEA 1VL2A 2D2FA 1AA9A 1Z8DA 2PWPA 2QTAA 5CNKA 4M8IA 4EKGA 5CLJA 1NN5A 3STXA 4BDSA 4FNAA 4B45A 2Q7DA 3CZCA 1HH4A 3Q7TA 3JYQA 3QA9A 3ZKAA 3DB2A 1L5VA 4RVSA 1FDSA 4J8PA 1K4YA 2XLCA 3T34A 2QRUA 1L7RA 2X14A 5K8LA 4K0KB 4MI3A 1N57A 3TXXA 3DC7A 1GUYA 5EWMB 4CEIB 2Y1GA 2QG6A 2XMBA 4U8GA 1JTFA 3JQAA 1BA3A 5C4MA 3WHKA 2AFHA 3HYNA 1SURA 1QE0A 3U4GA 2NADA 5ESWA 4B48A 4BRWA 5ULLA 3WNQA 3T99A 3HCCA 1N8SA 1T3ZA 1VYTA 3EWSA 3F98A 3T5AA 2DWQA 4H08A 4AYTA 4C7OA 1JA9A 4Q7EA 2OZPA 5F77A 3P4UA 2PR2A 4DM3A 2ZAMA 2E0IA 3VPCA 1J2UA 1H6DA 2JIPA 6Q21A 1Q44A 2O20A 3AEUA 4Q9LA 1J23A 1NC1A 3R7AA 3UJAA 2O2IA 2BTQB 3C7AA 3QVJA 4HH0A 4R31A 1ZXBA 2VK4A 4LCBA 3CG0A 2WI8A 5CEJA 4QULA 3Q3GE 2WSSD 2IOQA 4TV9B 4CTJA 2P69A 1DTWB 5GP1A 2H52A 1KEKA 2FDCA 221PA 2PJZA 2F1OA 1SXJC 4CTNA 1ZCFA 3L7IA 1JF8A 3G8DA 3FW1A 4M0MA 3RWMB 3BERA 1IEVA 2V7VA 3NR2A 2BI7A 4QYMA 4UQPA 3ZOKA 4X1OA 2WJPA 2D0IA 3R3HA 4NYJR 1GDHA 4ZQCB 5AW1A 5JS1A 3HBNA 5DLPA 2VCYA 2EX1A 3H5WA 1NATA 2IOYA 5HJ2A 2B5OA 2ENUA 3L8CA 4I5IA 1BWSA 2IEDA 5J2TB 4WFQA 4YIHA 1IRIA 3B9BA 5TQ2A 4EJSB 3NBUA 4LBYA 1KI8A 4GMKA 2FPOA 2R84A 3L8HA 1KYWA 1A5AB 3FDXA 4FVTA 4RKFA 3PYMA 4V0SA 4ZT7A 1E89A 3V7FA 3W7BA 2JC3A 4S2EA 2P27A 1QOPB 3D6HA 4HXEB 3O93A 3TECE 3ZE0B 2DHRA 2FUNB 4IXDA 4LE0A 1W0JD 2Q1XA 3RB8A 1GM5A 1KETA 1UFOA 2XQVA 1UXGA 2G82A 3KNZA 1XROA 5CNMA 1RQLA 2XGJA 1UZLA 2NU8A 2IYYA 4Y9DA 2CY0A 2WMDA 2H1HA 3L6BA 3R5KA 3R5HA 3RJ5A 4DSAA 5A7FA 4ZV9A 6AT1A 1LXCA 1P7PA 3D6AA 2B8NA 4JT2A 4N0QA 5BOSA 3GPLA 2YXPX 2I33A 3JQ6A 3CSDA 5COBA 2YRWA 2PHZA 3CF4G 1D2MA 5JRJA 3N70A 1U7WA 3OUUA 1LPNA 2FR0A 2PBZA 1YMQA 5B57C 1QHHB 1XAGA 3V7NA 2VPIA 3DLAA 3NHAA 3ETCA 1TD1A 4MYRA 5IT9A 4D6XA 3MINA 4JFRA 5JDCA 3I5XA 1KVSA 1C4KA 3ZU6A 2QT0A 4JB3A 1TA0A 2BLNA 3EQ2A 1NMQA 3GGOA 1YULA 5IN5A 4JBWA 3WOVA 1EP1B 3ZS8A 2FV8A 4DLNA 2ATXA 3PNVA 4FWBA 2CFOA 1J6UA 1A4UA 1NTRA 4BVGA 1LEHA 5D51S 2CN1A 5FP0A 4AKGA 4HSEA 1AQ6A 2YY6A 3UA3A 3TQSA 3DTVD 3QVWA 1QOZA 1WHSB 3HYLA 3TLGA 2Y67A 2CE2X 3IBCA 4C3OB 1N2ZA 2WPDD 1VE3A 2EP7A 4RVGA 5IZ4A 2EFGA 5F3WB 5CPFA 2P6OA 2ERXA 2XD9A 3M4ZA 4LDPA 2Y05A 3DLCA 3AKEA 4DQ0A 3WAGA 3JVIA 4HRXA 4P2GA 2PKQP 1NBME 5CVEA 2EX0A 2CFRA 4R51A 4FN4A 3JVEA 1NPYA 3DCYA 3WMFA 1M8GA 3ZXSA 4DREA 4LE2A 4E09A 3L6CA 1U3FA 1FP7A 2ZCUA 4MPTA 3S2YA 3DW1X 4K1XA 2IEBA 5AP9A 3QUAA 5T64A 1VG1A 2XIQA 4PGGA 2GLXA 3BHJA 3BB1A 3EUAA 2J7PD 4QOHA 1DTEA 1QZ3A 5AKLA 1ZWLA 2ONCA 2E55A 2VJDA 3CF6R 5DMHA 4XXHA 4WE3A 5K3FB 2RH8A 2ZOSA 3DT9A 4QTZA 4WLFA 3H7IA 1T8UA 3OJXA 4RYDA 1KFKB 2G67A 3SNHA 8AT1A 3JD1A 3RUCA 1IG3A 4J49A 5C7YA 3Q40A 2CJXA 1U1IA 2HQSA 1O08A 3GWGA 3W5UA 3UMRA 1AQNA 2H07A 5LVAA 1LFAA 5FPYA 3UK0A 4DA9A 5EJ8A 1NXWA 5JNVA 1NMYA 1JDPA 3RS9A 2C0PA 1I1OA 2WTXA 4R98A 1ZPDA 1U6KA 3ZQUA 2CHFA 1VKNA 3JZFA 3QPUA 3FKSD 5G0SA 4QM7A 4MUJA 4Z9FA 2BBWA 2XWBF 4M89A 4OI2A 1XMQB 1NF2A 2IHVA 3RC7A 4CM6A 2JKVA 3MLAA 2NPFA 3WYGA 1W4BA 2QE7A 2WU1A 3PXAA 4N18A 3SXPA 5KC8A 1U1EA 3F5FA 4CF3A 3JWEA 4BWGA 1P44A 4Y6OA 5A71A 3DDZX 1A76A 3FCCA 3FNRA 4LXUA 4TMVA 4QELA 1RSZA 3AFHA 3RK1A 4I46A 4QQNA 3H9JA 4S12A 4ENTA 3VNVA 4X6LA 3TNYA 5D3QA 4ZIRB 5I45A 5H02A 1PQPA 2GPTA 3AHDA 2BFOA 4L1KA 1ONPA 3L4EA 1E18A 3MTDA 2DPYA 2PVPA 2W2QA 2BR4A 1OPXA 4EARA 2PVCA 4QFCA 2P3OA 3G9QA 4RQBA 5DM70 1TFUA 1D5WA 2Z4SA 2AXPA 2G9ZA 2HT6A 4MPPA 1JH8A 2W70A 1RD4A 2WWVD 5DT9A 3RASA 4B09A 1R0RE 3RC9A 5JO9A 4EPYA 2W5UA 1JYFA 1MQ9A 2C2OA 3BJZA 2RSLA 3GUZA 3QBDA 4FGUA 4PTZA 4E5VA 4GDFA 3CEAA 3IUMA 4HHEA 1FXWA 3CY6A 4KSCA 3TJMA 4QZVA 4LBZA 3R75A 1YAJA 3JS5A 3WL8A 1DJNA 3A6HA 3TE6A 3VTZA 3PE3A 2ROQA 3U4QB 1AH2A 4S0XA 1WETA 3L8MA 4DF3A 4QU5A 4CMKA 4TM8A 4WEQA 4XGKA 4Q4HB 2ZI9A 3F2IA 3UENA 1QPGA 4AJEA 4KE7A 4EB0A 3PK0A 3OF5A 4K9OA 3QXHA 1E9VA 1NT4A 4KQKA 4KLCA 2VTVA 3LRXA 1P0CA 2COKA 4XDYA 2G9UA 5C8DA 5HIJA 3UAVA 1JHZA 3NTQA 4Q3OA 5FPHA 4EGJA 1K06A 5IWCA 3KAPA 3GEEA 2ZJ5A 1PGJA 4PANA 1I3CA 3NBMA 2IXDA 1C9EA 1C9YA 2VXBA 3T06B 2GKGA 1DOZA 4Q7KA 5LYJA 3FSGA 3VJKA 1C0KA 4PQRA 3EZXA 1PNRA 1G6Q1 1HG1A 3IRVA 6CHYA 4L5JA 5KYWB 6ABPA 1ORDA 1YQGA 2P77A 4MS1A 1W46A 4MRPA 2VCEA 4HNAA 3UT6A 4P83A 2UXBB 1YQ9A 1EE9A 4EEZA 8OHMA 3CUTA 2Q07A 4CQJA 4EHKA 3TAXA 4XEUA 4ZU6X 3KQHA 4XVUA 4N0PA 3UUGA 1W93A 4U7WA 3LDHA 4WZAA 4OATA 1NVMB 3PFKA 4I81A 4FYJA 4I4TA 4BTEA 3WRYC 2H7VA 4TLDA 5TPZD 5KTKA 4H7IA 4OUDB 3D6FA 1MO3A 3TPZA 1YR2A 1XRMA 1EESA 1HKHA 2EC5A 3LBNA 4GSLA 2Z09A 1DV2A 4LYEA 4RJJA 3NDJA 2AFRA 2DTXA 4LQCA 4ARSA 2IPAB 4Z2YA 3RUPA 4ZJPA 1S4MA 4LDRA 2QJTA 2BKEA 3EJWA 3QLJA 2XGGA 4XLTA 3WQRA 1FJXA 2ZEJA 3OAAD 5GONA 4J6FA 3LUDA 1Q15A 2X19A 1XF1A 2QP9X 1FTGA 2G9QA 3WTCA 2I1LA 1S02A 4TTQA 3B6JA 2EKPA 1OH6A 1FU7A 2H1CA 2XUFA 4HDKA 1O03A 4HX2A 2IXEA 2SECE 3JQ7A 3GVIA 5AM0A 1GL7A 4F46A 2OOKA 5I8WA 4X84A 5TQVA 1ISHA 4KDEA 1OKKA 3GBVA 1H2BA 1KVRA 1TQ6A 5T7BA 1A9XA 3ZU2A 1YKGA 4FC6A 1HMYA 1H1DA 1G21B 2OBMA 4II7A 4UE6A 4EG4A 4W5RA 2LNDA 3PNBA 1QO0D 1J5XA 1EMDA 3TNJA 2PIAA 4PHTA 4ROTA 2QTLA 2FLKA 3S28A 3BAFA 3QE3A 1XDGA 4EKDA 3KKOA 2ZPAA 1Z82A 5ALEA 4TXMA 4JDPA 3WMRA 3SE7A 1YDEA 2VZEA 1GLGA 2DETA 1E99A 4BV3A 2GRJA 1FLAA 3AJ9A 3UG7A 1SIWA 2WG2A 3TZLA 1FK8A 1YRQA 4ZN6A 1X7ZA 3O4FA 2FXIA 1P5JA 1YQDA 4X1KA 5J40A 1EM8A 1RC1A 1LS6A 3D2LA 4M36A 3UKDA 3G85A 3EFEA 1AMOA 4B80A 2FOXA 2QYSA 2RHOA 3JD3A 3KLBA 3FUXA 3NIWA 1E1KA 3CVVA 4L9WA 3PWTA 4LJSA 3Q8KA 2CMKA 1NBMD 1WD7A 1F2DA 2A5GA 1AX9A 1K8XB 3BFPA 5ICGA 2MOKA 3K70D 1BDJA 3BRWA 4JLJA 3IMFA 4CLRB 5MF6A 4FMCB 1N2OA 1ZJ5A 4ME6A 3W1WA 2PK3A 3B6EA 4X8LA 4TRMA 4D1YA 2JLRA 2G1JA 5UKDA 3AC0A 3B1JA 4MMYB 2VHEA 4JSYA 3OQBA 2GPBA 2XEDA 3RIGA 1ZOLA 4L7VA 4C2AA 1KORA 5J9FA 1VRVA 1LPBB 1ZM4A 3C3AA 2IHTA 4R2HA 4NYMQ 4LOKA 4X00A 2GFIA 3H9GA 5LMZA 1T6XA 1D6MA 4E5MA 2QMEA 3ZI0A 2O7NA 4RHEA 3RUEA 1P0IA 3VR4H 3LYLA 3ORQA 1CEYA 3U44A 4D9FA 3EIUA 3MWGA 1ZNQO 4OJMX 4AJLA 2Y0CA 4YLYA 1C9KA 2UYQA 3FA2A 5CDHA 2I4LA 2FG7C 3R0ZA 2YXBA 2GCOB 3FTQA 4R1MA 4C1NA 4IO1A 4J0CA 4TWRA 2PGNA 2O6LA 3U13A 1B7GO 3OIGA 1SG0A 3V4LA 2A33A 1QBGA 2XPCA 3P9CA 3DFKA 4HR7A 4ER0A 5C8VA 1RXWA 4ZV7A 5FTKA 1BVHA 3U3ZA 4BKMA 4BNUA 4GPIB 4NBNA 2CEKA 2FPWA 3W3AD 1OF1A 1V2GA 1VB5A 1WCIA 2QDKA 2RGNA 2X5KO 2AUTA 2XQJA 3AR4A 4XVCA 1QQAA 4KC0A 1ACMA 3C6KA 4QGBA 1ULHA 3P97A 3GT7A 4OSEA 1ZITA 3SS7X 4E08A 2VZ0A 4HDOB 3ZVMA 3OT5A 1HEIA 2CT8A 2PV7A 3G1TA 5JNTA 4MWZA 4DA4A 1POXA 2OUIA 2DC1A 3F74A 3TZ6A 3U1VA 1FTNA 3U7FB 2B2NA 1EDEA 5AKGA 1HLDA 2FX5A 2RAPA 3OZXA 5T67A 3RYIA 4JI4B 2ZYAA 1UMKA 2RC6A 3F3KA 1QFMA 2BFCA 4CR8A 1QVZA 1LJUA 4ZJUA 1CDZA 4C5CA 3M1AA 1S7GA 2ZTUA 1JFFB 4RY0A 2WTMA 2D5IA 4U7PB 2A3NA 2NO5A 4Y2YA 1FDWA 1SKUA 1PJ3A 1RHJA 2DE0X 1OE0A 1HE2A 1RDFA 2H59A 4IJUA 4YJDA 5EESA 3DV0B 2O23A 3ONDA 2I76A 3F4KA 3RWBA 4R6WA 1EFUA 4GOXA 1GKLA 1K8RA 1S8OA 4KACA 2VJMB 1UJBA 1UC5B 3CEJA 5L3ZA 4IXMA 3RC3A 1XALA 2UYYA 1RKVA 1TF7A 5KWIA 2YVQA 3HXTA 5BQ5A 4ENPA 1NJFA 3JQCA 3AU9A 3BXHA 3K8OE 4LHYA 4DJJA 4DRXB 6ADHA 5LMUB 1PK7A 1EZ1A 3EXIA 4IUBS 1TJPB 5TVKA 3EA4A 2C04A 4G0NA 1R8QA 3FUVA 1JPNA 1NV9A 5FIUA 2WB4A 4RIIA 2EX4A 3QMVA 3FGPA 4OHOA 2H2FA 4CMGA 1YBAA 1NONA 4LHXA 5EGNA 5LBIA 2ZCJA 3IYLW 1HDEA 1MVNA 3AJEA 4G5YA 5TRTA 1M2JA 1YK1A 2H54A 2QGFA 3OEYA 2FFAA 1OI3A 1QGUB 2RBKA 2X0EA 1FX0B 3V48A 3WA6A 1QBKC 3E8XA 3AJRA 1KU6A 1OX6A 3R5XA 4NH0A 3TOCA 4AM8A 2GNAA 1CP3A 3DEIA 2PUWA 3F90A 3PPYA 1U9YA 5F35A 5TF0A 2BIFA 5IAAA 1V8BA 3TJZA 3A1UA 3IAUA 3ADKA 2G5PA 4QSMA 3PR1A 3OPQA 4ZQBA 5JCJD 2YUIA 3C7KA 3LT5A 3WWCA 3W5SA 3AXTA 2DWOA 1SOWA 3PVCA 4EWLA 4Z7JA 1FYWA 2H65A 1I24A 2FOIA 1K8QA 2NO9A 1LDBA 5REQB 2O07A 1W5FA 2W6NA 1Y8AA 2YMPA 5TS3A 1HE3A 3G6WA 3PDHA 2A0UA 4KNVA 3EAGA 1EWTA 2NQTA 4KAFA 2GN6A 5EINA 4F96A 5K8TA 3DMGA 5AHOA 2AN1A 2JKZA 2EFCB 4CPDA 1NW5A 4QJ5A 3X3HA 4BQNA 2HPZA 4TMWA 4LGVA 1BGVA 4PGAA 1D3AA 4DCPA 4CEHB 1OR8A 1BMTA 1XEWY 5TIIA 3ND8A 1DCMA 3ZR4B 1DKUA 1DBRA 4CLHA 3NU1A 2W6OA 1MO6A 3RYFB 5IJ9A 1CLEA 1KDRA 2OV3A 2A5JA 1U28A 3HMKA 5FWAA 1KOFA 3EZFA 1Z2NX 2EDCA 2GAOA 1RZRD 3PGKA 5JVDA 4RPIA 2JAWA 1ZQ1A 4I66A 4IEEA 2B6HA 1Y82A 1HDIA 1N2XA 2XWPA 3KJGA 4NEHB 4ZWNA 1K66A 3NAMA 2ZETA 4JASB 4PZEA 1SBZA 4BQOA 1I4TD 2QB5A 3FNIA 1QV6A 1YCFA 1W4CA 3G5TA 1PG5A 4ND5A 1VGRA 4RMGA 1U5BA 2I5PO 3A1FA 2GZ1A 1DKQA 2FPPA 1NVBA 3CNNA 3M3HA 2VWHA 4YEDA 5LD2C 4C2UA 1ZUNA 1O8BA 1QC5B 3HSSA 4GP7A 2GKSA 1ADCA 1D2AA 3IH5A 3ACDA 2WZDA 2LRHA 1UXIA 3JATA 1CEQA 1VP9A 1WUYA 2PBRA 3GP5A 4IDEA 1P3DA 4BRSA 1W4AA 5EQJB 5GGXA 1YQXA 3VU8A 3Q8WA 1RI3A 2FSVC 3NNNA 4BLVA 4KRGA 3TLJA 4ENVA 4RV5A 4Z54A 2X2OA 1AQJA 3GBPA 3FIJA 4GX5A 5JG7A 4CYMA 4LN1A 1LLDA 5HIAA 4FQ5A 2Y1EA 1Z5NA 1ZCZA 3NWPA 3WWEA 1IZ8A 2ORWA 1XVLA 4D9KA 1RYYA 3U17A 4DLPA 2F9LA 3EY9A 3WGQA 1PNTA 3MAGA 1EIZA 4PC1A 1E4YA 4FHZA 5IVPA 1L4FA 5KREA 2DG2A 3Q0IA 4KQCA 5DW0A 1S01A 4CKCB 3O83A 3IELA 1EJBA 5C2JB 3QPAA 3CMCO 1DQNA 3UC5A 3PGA1 4F3YA 1LLQA 1COWD 2AWNA 1NA5A 3BIOA 3LPNA 4M37A 3SYNA 1PLJA 1OZFA 4KUEA 2ZR8A 4N7JA 4WN9A 3W4JA 3UAXA 5JAMA 3URKA 3W2GA 3HEBA 1R8YA 3G9ZA 1NHWA 2HTEA 5AQEA 2J33A 1E4EB 2QE7D 1NV8A 2O7SA 3JZMA 1VPEA 5GOZA 5DGHA 1RWVA 2CXOA 2QVCA 2WKRA 1R2QA 3L43A 4FMDB 3IPRA 3U4IA 1VJ0A 1B6GA 3DE2X 2FMKA 3MF4A 4G85A 5CA0F 3WMGA 2VR1A 2FZVA 5E9QA 2WHRA 1DQRA 1NOIA 1U5CA 2AC7A 1GU0A 5A0TA 1PK8A 4A8JA 4V38A 1FU4A 2C5SA 4H4CA 3ESCA 3NC4A 1KZHA 5JUWA 1T3TA 1ITZA 2J4DA 2EIXA 3A06A 3S99A 3T35A 1Y63A 3C24A 5AVUA 5AKIA 3LLVA 1RE0A 4AYWA 2DFKB 4ZPJA 1Z0DA 5C5DA 2MYNA 3UAOA 3KOWA 4E70A 2AS0A 3PFIA 5DH9A 3GOQA 3BGIA 3KPYA 4BNJA 1R5OA 2YFQA 1FNSA 4Q21A 3VAZA 1X87A 4BIMA 3HWWA 4PV7A 4F3RA 1HZZA 1N32B 3PVSA 4FN5A 5JYBA 3F6EX 3QENA 1XEWX 4WK6A 1LS1A 3AUAA 2P2LA 2QWXA 2XF2A 3ZQJA 2QNBA 1JEYA 3MS7A 4E31A 5ITZA 4MV1A 3DFFA 1BQ3A 4JX8A 5AVSA 1DO2A 1YTLA 1IQPA 5GGYA 4C4TA 1II0A 4KR2A 1U4NA 1P4AA 4KLAA 3IKLA 4JT9A 5FOVA 1CSEE 1EE1A 1LQ2A 5I7OA 5GVSA 4LQ4A 2FAXA 2OD7A 3F7MA 4DG5A 1SHTX 1U0BB 3IDQA 3TG8A 5HIMA 4ILKA 2PLRA 4RFVA 3RT9A 3MUFA 3O4JA 4ZEWA 1HYBA 2JF0A 3EW7A 3I2HA 4TGLA 4ZOLF 1DQZA 2O5VA 4NQRA 4LZAA 3KKNA 3FHCB 5BWLA 3VC7A 1KOGA 2IF0A 3EG5A 3M6IA 3QUBA 4KGVA 5BRJA 2V6BA 4IHAA 4J07A 4KRYA 5CIYA 2AZMA 4JI8B 3K9HA 1CDOA 4OGLA 2PKYX 3FUTA 1UBJS 2KSQA 1LTKA 2QR5A 3K4QA 2PGIA 2H29A 4KMSA 3UUFA 3FWHA 1MX1A 3BXPA 1XP5A 1U2DA 2C58A 3DDUA 4D0LB 1J8QA 1JLHA 5A4JA 3OIYA 4U7TB 2H7CA 4MR7A 2RIPA 4H4DA 3E9QA 3IUYA 2IIQA 2Y76A 1MOQA 2O8BB 2FZ4A 1YE8A 4NTZA 4D7AA 5HF8A 1QZZA 2H2GA 4DIMA 4EMSA 2ZRCA 4IUYA 4TXHA 3EH1A 1C4XA 1GA6A 3LBAA 1MRSA 2V8BA 3OIWA 3STYA 4DEYA 3PNSA 2H4HA 4KJXA 3AU8A 3BJIC 1HNXB 1QE3A 1CXZA 1KTVA 3K35A 5K0NA 5ICCA 4UE3S 1CRPA 2W2LD 2GPSA 1WXQA 3D3JA 3MCTA 3PA6A 5KWVA 3ACCA 4YDRA 2YZNA 3OQOA 1LRKA 1ZISA 4LYAA 3DE7X 1QLJA 4NAVA 2MHCA 1T5IA 1MW8X 4PCLA 4NECA 5BQFA 4PF1A 3S5JA 4YT2A 2W8BB 5JS2A 3JQ9C 3HP7A 1TKAA 3A58B 1ZD8A 1MB0A 2GASA 2OILA 3PEEA 3PXDA 1UXKA 1SCBA 1G41A 2QLLA 1BCRB 1KMNA 4PZCA 3CC8A 1SOVA 1N33B 1UBMS 2PTHA 4QGGA 4LWQA 4N82A 4Y3UA 1C0LA 1FNCA 4Q3EA 3L46A 3EBLA 4QO7A 3REFA 5GJVC 4B2IA 3OQVA 4Q9IA 3ETDA 3ZBPA 4EL0A 1TGVA 3TRJA 4BVEA 2I3DA 3NASA 2HGZA 4MUBA 5ENVA 2Z04A 5K4HA 3C8HA 5LFAA 2WKPA 1EVYA 1IK4A 1RLJA 2P62A 3L93A 2X23A 1K6EA 3WJ7A 2VPWA 1KZYC 4PHGA 4HS4A 3BMNA 3FX2A 1XEXA 4M0UA 4QBFA 4QWWA 5DI3A 4LECA 1JWAB 2P2SA 2XUIA 2COUA 4M1EA 4DLZA 4ZZ2A 3EJ6A 1L7MA 4Y6RA 2WHPA 5CB4F 1SVSA 2X2FA 1CZNA 4R9UC 3QPCA 3RGWS 3ROMA 2ONZA 1L5RA 3QKSA 3TNDA 5AM4A 4JVNA 5FBVB 1J8FA 5A5VA 2C78A 1HUQA 2OKGA 3S5UA 1WR8A 2II6A 2VXCA 2ACWA 2FMFA 1L1RA 1SBNE 3DTVB 4G5OA 1NYRA 4P82A 4J2TA 3ZEAA 5LUAA 4JENA 5DRYA 2Q8NA 3WYCA 1WOMA 1FU8A 1JLLB 3WHIA 4EQZA 3H1BA 3VDXA 4ESOA 3A0UA 2O0MA 2ZSIA 2ID8A 2FQ1A 1IBRA 4CIDA 4JUFA 2AK2A 5IG2A 1MC5A 2XZTA 4QLOA 4MA5A 3DE0X 3IQHX 3JQFC 3TEJA 5AJYA 2K4MA 3CF4A 1K8YB 3PNOA 4D92A 3M9XA 2RB5A 1QYDA 3H18A 4E22A 3LO8A 1QUEA 3IP6A 3OZWA 2X1VA 1GEEA 3COWA 2C54A 1E4OA 2H16A 2OG2A 5E6UB 1Z2CA 4P4SB 3W8NA 1KEUA 2JGLA 3THSA 3HJBA 3PD7A 2WQ7A 2P0AA 3WK7A 1JG6A 2WC1A 3D3WA 4FYMA 2YWFA 2Q3MA 3IILA 2PWAA 2QJRA 3GZ4A 3VR6D 4ZVPA 3I5AA 1HURA 3HGQA 3NHJA 2QRVB 621PA 1V9LA 2PGLA 2UXCB 1C80A 1D2CA 1KMHA 3B38A 3FPHA 3MW8A 4UMDA 1E3WB 3FHOA 5EI5A 1HT1E 4XSGA 2VNJA 3VH3A 1OYVA 4Y6PA 1WUIS 1H1TA 2ZBQA 1U8UA 4AW9A 2GF0A 5KS2A 1H6AA 1O3YA 1JU4A 2BGNA 4LUCA 2LCQA 2OYSA 2CMGA 5FWYA 1BE0A 2Z56A 4PYRA 1CHDA 5JNRA 1T5HX 1RM5A 3PITA 4KMRA 4FHGA 4BX9A 5EIBC 3PSAA 4WHMA 5KMGB 1F20A 2AKAB 1YCHA 1PTJC 1SUFA 3MRSA 3GFBA 5EY5B 1T9AA 5I8ZA 3W3AH 2GHQA 3HVIA 1F3OA 4MITA 1W7AA 2AYYA 3MD0A 3R77A 4ZVUA 2M6KA 2X7XA 1R6TA 3K9BA 2X42A 1KZ7B 1X80B 4OHBA 4EI9A 2VUTA 1WMAA 1ZGGA 1Q1AA 5F51A 5CT5A 1TUGA 4BBPA 4FGZA 2GYYA 1O58A 1NNSA 2P91A 3GJSA 2OHFA 1ZXXA 2BY4A 2JS7A 5DYWA 3RRYA 2XMGA 2WJ6A 1X7WA 4MRMB 3COYA 4Y18A 1Q0TA 3U3JA 2P0EA 4Q66C 2IELA 5TVGA 2E49A 3MERA 5ISMA 4ALLA 1USGA 3GHHA 3LXRA 1TLFA 3V97A 4RJLA 3UKOA 4BN4A 1Z5OA 1HFJA 2ADFA 2DFPA 2VH1A 3ZHUA 3CZQA 1ILEA 3ODPA 4YAWA 3RU2A 3OTIA 1NR5A 2XE4A 3P4XA 4I50B 3KP1A 4DTCA 4ISCA 4IJQA 3PU6A 5JC8A 4U9UA 3T52A 1N9GB 1JMKC 2I99A 4UVEA 3K05A 4BFUA 1G5TA 4JP8A 4YLGA 3NHWA 2DR3A 3M6XA 1PJQA 4PZAA 3LHSA 2XT0A 3CRZA 4I6GA 4M46A 1UWVA 3TW8A 4EATA 2IUUA 2YY7A 4DZRA 1PR5A 4JYAB 1VB3A 2TYSB 3KJXA 3N05A 3PL5A 1WUJS 4BVKA 2YHAA 3QHPA 2O3JA 2YV4A 1KKUA 2E6UX 4C7KA 3QEKA 1MJGA 4CE6A 1FFSA 4YCJA 3QM1A 2QSYA 4N7MA 1B2LA 1TEHA 3ILYA 4W1QA 4C6RA 3JQPA 2GZDA 4S35A 1D8TA 2XZDA 3R8XA 3V8RA 3GLIE 2O2JA 3D0KA 2W48A 2JGDA 3KEMA 3GCXA 2FDRA 4Y2QA 3FF4A 3G2IA 3PUYA 4IO0A 3KSMA 2HHLA 3I37X 5JDCC 3UV3A 1WY5A 2FU5C 3HJGA 3R5JA 4PYLA 3S40A 1XMVA 3LU1A 5AW6A 4RZSA 2Q4OA 1XVTA 1E9AA 2BM0A 1JHVA 2F1HA 3K5PA 4MDYA 1R4AA 1HETA 2ODNA 1OVGA 1U7HA 1YQEA 4BWVA 3PD1A 2PH5A 1XL0A 3TCXB 3KEQA 4UM8B 2XB6A 5HQ3A 4LFAB 4B3FX 1A9YA 1WMDA 1HXHA 4G2TA 4PX2A 3R0IA 5CJPA 5AVOA 3MFYA 3PDUA 3LWNA 3VHLB 4EHNA 2C3PA 4Q82A 3RU7A 2V5UA 3P9IA 4XDZA 1PEDA 2OHHA 3PTZA 3G0OA 4S1OA 4QEDA 1D4OA 3RVBA 4KWIA 5CYPA 2HN9A 3HRKA 4FSDA 4Q3DA 4R1QA 4I9GA 4DMCA 5LJIA 2G0NA 1M1UA 2RHRA 2POQX 3GLRA 3GA5A 5ALWA 3AF3A 3PX3A 4INPA 1GQSA 3SVLA 2YWBA 1RMQA 1TJYA 5ES3A 4P36A 1UJ2A 4HPXB 4LC1A 2PA3A 1E2GA 4XGQA 1WXIA 2GWRA 3EVFA 2OHGA 2Y3IA 1E2HA 3O38A 2Z2XA 1JW9B 4D98A 1UP6A 1JJFA 4YYEA 4PN3A 3D7LA 1DQPA 3DW3X 3G0IA 3T7SA 3VTAA 3W2FA 4ZGGA 2O54A 3T5GA 5J59A 2PT6A 2ZREA 3DNFA 5LQNA 4IYJA 2R8BA 3ILVA 1PSDA 2D7CA 1CTQA 1Z26A 2XGMA 3HKBB 3KQMA 3KYCA 3UJ3X 2J6CA 4RA9B 3T7KA 5ER9A 3LKDA 3TF5A 2ZWPA 3EWAA 3FF1A 1TOAA 3H3XA 3L79A 4GECA 4DCVA 2PZGA 2IS4A 2LXNA 4RO0A 4DADA 2PXXA 4G0XA 4ARBA 4GC9A 4JR0A 2NAFA 5ECYA 1F6WA 2H6EA 1USVA 5EVJA 4AS1A 1U04A 3WWYA 4KSYA 4B3BA 1OYOA 1T9GS 3BWMA 3VO8A 1GTVA 4GIBA 4MP8A 1J8VA 2IF2A 4WK0B 4F5YA 2J5XA 1D0IA 5K4AA 4YAFA 1UJMA 4TTAA 4MMZB 3IE0A 3SYTA 4QPPA 1OH5A 4KQHA 1RBQA 3OECA 5C7IO 1P2BA 1JNYA 1ZCAA 3JQGB 4WXRA 4DNOA 3ZX5A 1BHSA 1C9MA 3T5MA 2XNCA 3C48A 3WLLA 2AG1A 3LGSA 3VZBA 1N6LA 1L7XA 2WFLB 1MNQA 3QE2A 5FCDA 3PUWA 3UNXA 4D8TA 1P75A 1VFPA 4YUWA 1PR4A 5LQCA 2ZQZA 1IZYA 2Z6VA 3M3DA 2AJCA 1W8DA 4JL6A 4EFLA 3AFIA 2BFEA 4AIIA 4C88A 4CQMA 2XXAA 2MT9A 4GR9A 2BD0A 2J46A 2CL7X 3TW0A 3O0TA 4IILA 5U4XA 3QY9A 2HBRA 3H97A 2JEYA 4OLAA 4HB4A 2BMEA 3C4JA 1TLTA 2XRMA 2C2ZA 2IHKA 2HF2A 4ZOBA 3GD5A 1RFGE 3OOHA 4DPMA 3BYZA 3AI1A 4JJ7A 5JASA 3OX2A 4GQAA 5IC6A 3UXEA 5K0SA 3CNOA 2ISQA 1JSXA 4MIEA 3PTLA 4R84A 4D25A 5AI9A 3O1LA 2XCRB 1N8TA 1UJCA 2WTUA 3BE4A 3FTFA 1XQ1A 1HL7A 1C7QA 2F64A 2ZAYA 3PXXA 3NVMB 4HUQA 3T9DA 2CV2A 1YASA 2PKQO 1GQFA 1M73E 3RUHA 1QFXA 2HLDA 3AWDA 3ZS9A 2A7XA 2Z4TA 2XQKA 2FWRA 1N9ZA 2C7BA 4LCEA 5BSMA 4N8EA 5K8IA 4DY4A 3ZD8A 5EHZA 1ZSVA 4BMNA 3B1KA 3W0LB 4GBED 5JQWA 4GVLA 1WKVA 2W4IA 2ADOA 4FR0A 4EMBA 2GETA 4GKAA 1DPGA 3MGAA 2AH5A 4B6JA 2XYRA 1Z63A 2BJVA 2Y1WA 3DGEC 2N75A 3D8HA 1YS2X 2YWGA 5BSTA 3WLJA 4YCLA 4UEWA 4YMLA 1T8SA 5DIZA 1GSOA 1RRVA 4YIKA 1Z13A 2ETXA 2EZTA 2FWNA 2GAFA 3DJYA 3NWOA 1DRVA 4Z8XA 3TGLA 3Q6MA 3C1UA 3NONA 5I7SA 1DAGA 4ER6A 3H16A 1BFDA 4WOKA 3AEUB 1R4MA 4ZRNA 4MW9A 5EJ5A 3FPGA 4UBKA 2DPXA 5ENZA 4U2CA 4QGSA 4BO3A 3INNA 3FCEA 3I0NA 3WB9A 4AJIA 1BN7A 3N7UA 2DM6A 2CSUA 4C4AA 3BPSA 3ADBA 2JGAA 3HN7A 4D81A 1X8KA 1Z0IA 3VHQA 4E2YA 4YJHA 1TB4A 4PAGA 4Z4EA 4YRDA 1MA0A 1LA2A 4OQDA 3WICA 5BSUA 2P4EA 1MRNA 3NHUA 4EKYA 3MWLA 1DKRA 4LWZA 4K1LA 1Z5UA 1KPGA 1MABB 3TIGA 2H4ZA 1KNQA 1X9HA 3K6KA 3BOSA 4JAVC 4KR0A 4WFIA 1E2JA 2CBGA 4X7BA 3V55A 3UCXA 2JD1A 2O4CA 3AQIA 3NOVA 5GMOA 1UKZA 3UMGA 8LDHA 1MAAA 2R65A 4KTVE 1T91A 3UUWA 3UWDA 4JQSA 2DQSA 5F1KA 4PZUA 3IB6A 3UHOA 5L8VA 3CB4A 3ENKA 3OETA 5TQ2B 4MI9A 4DDHA 4LWPA 4MCAA 1BCSA 1L4LA 1S2LA 2XA9A 4Z7QB 4EP1A 2IIBA 1MH9A 2QW8A 1TLLA 2GTPA 2IC5A 2J67A 5K3EA 3Q12A 3QFSA 1A4IA 2I2WA 2CWDA 3I6IA 1E3SA 3NAZA 3GVHA 4P35A 3IPCA 4LFCB 5KOJB 4UW9A 2CVPA 1KJYA 1EVZA 2XKKA 4MH0R 1QO7A 2VZLA 2WG0A 5G53C 5BOSB 4G5HA 4E5DA 2C5EA 2A7QA 1L1QA 3KQVA 4XLZA 4UTVA 5EXDA 1EAMA 1N5RA 3CTPA 4YLEA 2BMWA 3EASA 3KUCA 3HP1A 1HT0A 1C1YA 2Y8EA 5BW4A 5HZGA 4BLQA 4F5EA 5JD5A 4C20A 1V5IA 1I7QB 4X24A 2CUNA 5KSPA 4BMPB 4B17A 2X8JB 3OOEA 1A9TA 3UHPA 3RV3A 4BHTA 1A7UA 4DLWA 2W42A 1DAFA 3O9ZA 2VYVA 3OPMA 4HI0E 2IYXA 1SBIA 2BFBA 2Q5LA 3M1IA 4WI1A 4XUEA 1LKZA 1PYDA 1IH8A 1N2SA 2ZJ0A 4G9GA 3CWCA 3AZPA 3ZU5A 4KUHA 2GZ3A 3AEYA 3R3VA 2A0KA 3ETGA 1K63A 2FQXA 4KK3A 4L8YA 4WZBB 4M9SA 1DUIA 5D2CA 1R3DA 2FKAA 2CEAA 3CLSD 1OWNA 4LE1A 4TS1A 1PQUA 3PGVA 3VR5D 3TLGB 3VR2D 2X3UA 1P81A 5FWDA 4HV4A 4DCGA 5E4TA 4MUYA 3O94A 1HV8A 4M0CA 5DYTA 2NYRA 1W44A 1FRVA 3CURA 3MWEB 3QJ5A 3F97A 3TFWA 4AJJA 3LHDA 5IC5A 4F97A 5KJ1A 5KTOA 3KOZA 4E13A 2P40A 3UH1A 2AB0A 3C3CA 4GM4A 1G63A 4L51A 4CI0B 1YVEI 3RVSA 3DZ8A 3OLYA 3H1TA 3I04M 5G1OA 3H2GA 2VPQA 5HP4A 2DH5A 2BI4A 3OEED 4A5SA 1C4OA 4JSRA 3A2KA 3RVMA 3QY0A 4YWJA 1YJCA 3TKAA 3WJ1A 5HNKA 2NUBA 1ORVA 1G3MA 2ZYGA 1H2HA 2RGNC 3QNWA 1F8YA 1CRZA 3L7YA 1IOZA 1X3LA 4RABA 1PGOA 5TY0A 1YJ8A 3FOEC 1Y1KE 2O52A 4H7EA 2XTMA 5CCDA 3HZOA 4I55F 3RAEC 1E0SA 4RVFA 4EA9A 5DV9A 2JHFA 4M55A 4RTPA 3GLHE 1BRTA 4KXMA 1M8KA 1OYYA 4G1MB 5CNJA 3T7EA 2ZIAA 1GGFA 1NQTA 3VR6H 3L9XA 1KO4A 3EDCA 5KDDA 2ZUUA 4QTXA 2RHMA 1TJ3A 4LI3X 3DPUA 3DZIA 1J2JA 4YX9A 1ECBA 2C88A 2GEBA 2PH7A 4FIDA 5IK2A 5C4GB 3PXCX 4A6PA 1PFVA 3HS3A 2F3PA 4H1UA 2C4TA 4X6YA 1GG8A 2AEMA 3DKRA 3T9BA 4DM4A 3CEHA 1UC9A 1EUZA 3MGCA 4RDXA 5K6TA 4PBTA 1MG5A 2YJ6A 2IA5A 1R4NA 3TKLA 5A7HA 2D7DA 3ZJVA 4JELA 4EUEA 3UJ7A 3H11A 3P0IA 2Q4TA 4M1MA 2IHZA 4Q15A 2X22A 3WRXA 1MJHA 5L4LA 4II3A 3B48A 4TS9A 3Q85A 4R3WA 3O1IC 4HVAA 2Y1CA 1EVJA 2GR9A 4X8HA 3N2YA 4FZVA 3ESDA 3OFND 1F7UA 4CKEA 1XBTA 4PO9A 3T5TA 1BW9A 1I2ZA 5ADVA 1I10A 4HQOA 2K5UA 5F3RA 3NMUF 2GZ2A 3AHGA 2IITA 5SZKB 4X1IA 4PRYA 3WL3A 4AMGA 3L6OO 4ZK2A 4WJLA 1EK1A 1RLUA 3KTOA 3BCSA 4JBXA 4JJ6A 3WTBA 2QLBA 4CLOB 1D5CA 1IM5A 2D5BA 3DZGA 2UYOA 2OECA 5EHIA 1V7PC 2W4QA 4FHFA 1F1BA 4DR7B 1SH7A 3LVBA 2WYIA 3MA0A 4B3GA 4G4GA 1AQIA 1P3JA 3MELA 4PAMA 2NUTA 3VYWA 1ZHOA 3L4SO 4WBNA 2GHRA 3RSFA 3A1NA 5JAQA 1DFHA 1Y6QA 3ADCA 821PA 3ANYB 4BO2A 1J22A 2KJQA 1ESEA 3NYQA 3LBIA 2NVWA 2W11A 4MA4A 4QFDA 1P5RA 1XRSB 2L0XA 4C4YA 1U6JA 5LQKA 3OTGA 4EDFA 4QUAA 1JIXA 5GIOE 4BFXA 4V3CA 2Z3VA 3FFXA 4FKMA 1KVUA 3ORYA 4TUYA 1JG4A 1V9SA 1SXPA 2GXAA 1MEOA 4XWOA 3RSGA 4IOJA 1W30A 2P67A 3L1HA 1ADFA 2YINC 5FI3A 1RHKA 2PYDA 1CY0A 3K32A 4IVPA 3WLKX 3UTDA 1AKVA 2BHRA 2LR0A 4Q12A 4EMUA 4ZEVA 1D7OA 5CVVA 3L7AA 4YYZA 4D0SA 5HZKA 3ONEA 4UDOA 4C0JA 5IAEA 4HDAA 2UZ0A 3PHBE 4ENRA 1U28C 2NVUA 2Y6UA 3FCXA 3H2IA 1E7WA 1GTG1 3JASA 5JT1A 1A2KC 4IDGA 1FP4B 2UKDA 5C35A 1CNFA 4AJ9A 2IS2A 1DRKA 4IUDS 1KS9A 1TCUA 3KFVA 1RXEA 4I4TB 3WGJA 4BOYA 1WPQA 1WP4A 2YIVX 3BMCA 1KJ9A 4I4CA 5ALHA 2IPNA 3RV4A 1QF6A 3DTYA 3FGZA 3W9UA 4ZAVA 2CE7A 5CA0A 1MO5A 4C6HA 4OHUA 4PE5B 2FJ0A 3KEFA 1WP9A 1P1RA 3R0QA 3PD0A 3ZHOA 3GGPA 4FOLA 3UYKA 3HZZA 5GONB 4NDZA 4D0RA 3ILSA 2BGTA 3LQ1A 5SZHB 1A7KA 3MK31 1XWIA 4FMBB 4EFMA 2QJWA 5JXGA 1ZM3A 3BK2A 1RWNA 3HDYA 4EY4A 5CP8A 3N1UA 2H5EA 4WUTA 1FF9A 3LUPA 1L4NA 1QIJA 3OJFA 4IDNA 4CWAA 5JALA 4M0FA 1WBJB 3JQ7B 1EXMA 2NZVG 4Z8YA 4WTOA 3F67A 4JLKA 4PC7A 3LDUA 5JAOA 1GRVA 3L0SA 1QFJA 3JWHA 4F6RB 5JYEA 1A9XB 1CJBA 2IYFA 3QV1A 4DE5A 5KQLA 3TH5A 2J3IA 2Q5EA 1TAQA 4MVJP 3THOA 2YNMA 4Z49A 1FFYA 1YC2A 2GA9A 2GN9A 4EIWA 4IIFA 4G4SP 1Y1TA 4O4LF 1U0HC 2FW7A 2QVZX 2E4ZA 3GUYA 3PIDA 4QPDA 4U5QA 1IQUA 3WYFA 4KHPB 3CA8A 3TGWA 5CVDA 1YHNA 4KVAA 3USCS 2CXXA 2CCGA 1OIVA 2RH5A 1A77A 2J32A 1UIRA 2WNIA 2WUGA 3AEXA 3BD6A 1NDUA 3IKVA 3OZAA 1MCZA 3PHHA 4WL0A 2B8JA 3QEAZ 4NCIA 2BBSA 3VGPA 5JY6A 4HGRA 4TRNA 3RU9A 2C7GA 2DMRA 3K73O 8MHTA 2V7XA 5HZHA 4R1OA 2BEJA 4JHLA 3WLFA 5KYKA 3CPHA 4L0CA 2YVLA 1OPRA 5J2UF 3KLOA 3LWZA 3OZRA 1GUBA 3NDPA 1TGYA 1B8PA 2JIDA 4H60A 3G23A 4XPIB 2BFDA 3WLEA 3KT3A 1R0KA 4A8JC 4LVOA 5LDHA 3EE6A 1Y7PA 5SV2A 1G5IA 1T8TA 3GAZA 3TB4A 3ZE9A 1IBLB 2GEJA 2JJQA 3GEHA 4BWYA 1WB4A 3UB3A 3PBKA 1WF3A 2G6BA 2Q3JA 4RY2A 1WSBA 4UVGA 4BYMA 2AKYA 4JLBA 3SVZA 4RTJA 4D43A 2O8EB 1N1GA 3DDWA 1NVFA 4KXNA 2JCSA 4IFBA 1TF5A 4DV1B 1VCMA 4REQB 3L41A 4X9XA 1E2UA 4Y9UA 4RTQA 4MQUA 2OA0A 5BVHA 1HZZC 2CHVA 2P5SA 3L0DA 4WX2B 4YP1A 5JSUA 1RI4A 1SUDA 2NSHA 4W82A 4B3HA 4ZI2A 2VG8A 1AGNA 1DRWA 3DZHA 3GZNB 4B3SB 1SAYA 3M6WA 5DYNA 3FRJA 2QJOA 1SOUA 2PNFA 3B20A 4Z3DA 2P9EA 2XMRA 1RP7A 5FPQA 3WS7A 3CZ9A 1SJ9A 1GGNA 1I9GA 3AR5A 3OZIA 2V6JA 3Q8LA 4M0KA 1ZZGA 3BIXA 2C31A 1SBCA 2LGJA 3GGSA 3LNTA 2WQZA 3EAFA 4GEGA 2BUAA 1WCIB 5DHUA 1DADA 1JDJA 1IE3A 1J56A 1MFZA 2K6GA 1N8NA 2KW5A 2QZ9A 2Z43A 3QKTA 5EMKA 4PC3A 1UKEA 2QLTA 4M0PA 2FPMA 4JC5A 4UUBA 5T3UA 1QAMA 1NVTA 1ND6A 4EM6A 4MUKA 3PC4A 1AURA 3IIMA 1J9EA 4H31A 2VJYA 5AJWA 1ZD3A 3U40A 1XTSA 5DEIA 1JKIA 5JHGB 5IXYA 5AM2A 3QYFA 4NU5A 1L5YA 1DHRA 1R0CA 3O26A 2X6RA 3EN0A 5F73A 3ZWMA 4Y0AA 3SXUA 1Q21A 1Z4QA 4ND8A 4H7KA 1OX4B 4U2GA 3EPJA 1YBVA 3MOGA 2PRJA 3D43A 2P3LA 3GEPA 2D2VA 5FPTA 2KBEA 1P0MA 1REQA 1U2DC 1U7DA 5A9SA 3BWCA 5H3LA 4IJ5A 3VR3A 1IOLA 4JVLA 3TD9A 3ZK7A 2O1EA 3QKUA 2A4KA 3ZIAD 5JSHA 2DHDA 2YMQA 1JLKA 1TJ4A 3L8DA 2C9OA 4KO1S 3GRVA 2I78A 3OU7A 4CM8B 5CB4A 3FWPA 2YN2A 3OQJA 2J0UA 5KWJA 1JIQA 2LCIA 1CIPA 4FBGA 4HQ0A 3RR2A 3ZWXA 2QRZA 1NT2A 1JQEA 5IAKA 3WGLA 4OQ4A 3U2QA 2PZBA 2O7VA 3GA0A 4NFYA 1N34B 3C0KA 3EZ6A 1RBMA 1KI2A 1DKLA 1Z7BA 2XT9A 3NCTA 1PU2A 5FBLB 3AHEA 2P2NA 2QDXA 4QUEA 1I36A 1YD7A 3X1WA 4WERA 1E1CA 2RC5A 3WBKA 1AXEA 1XB2A 1VE9A 3FYTA 3P9ZA 4FOOA 1GFZA 4MEAA 5D86A 5BO5A 2GEDA 1Q0UA 3WGNA 5JFGA 1PR1A 3H9CA 1T6ZA 3OX4A 3GQBA 3KQPA 4RWEA 1D9XA 4NZOA 1TCBA 4KXWA 1NXPA 1JQ5A 1NN1A 2E1RA 2I4OA 4KPYA 1N5OX 5AW5A 1WAMA 4YI3A 1KRHA 2I9PA 1WLSA 4ND2A 4CR6A 5LR6A 4AKHA 4CNBA 5L45A 3K4PA 4B0PA 5CT4A 1QIGA 1TO2E 4K9KA 2IPXA 2JZNA 1KJIA 4OHKA 5KVSA 5LLTA 3KETA 3V9PA 1Z6ZA 3VVLA 5I7HA 4LZWA 4PG5A 1JEAA 2ZPUA 5CPBA 3F96A 5HRUA 3EVNA 1G8PA 3PXBA 4OHZA 4LS3A 5KINB 5LQRA 2AW3A 1ZGJA 2Z1DA 2PJRA 1VKHA 3FVTA 2VYVD 4BMCA 3VNUA 2GFQA 2EIHA 2WD8A 3FMVA 1KE1A 1Q0SA 5BXQC 2PH3A 2PMBA 4HQLA 1ZIXA 1N4AA 4II2A 2AI1A 3JPYA 1AM4D 2X0JA 2ZUTA 5JD4A 5KB3A 4JFAA 3GLFA 3RAGA 3RPEA 2I8LA 4YUZA 4DN6A 2B36A 4BMYA 3GP3A 3FTNA 4BQQA 1YJBA 2P4SA 3G1WA 4HYTA 1KU0A 4YACA 3HEAA 1WPXA 1YA8A 1AG9A 1T0PA 3WIEA 2XMCA 5AH0A 1R0LA 3LGAA 1BS2A 1QKIA 4JX9A 4Q9DA 1MTZA 3UICA 4EB6B 4F4DA 3G0HA 1U2QA 4GGMX 3CLVA 3LBFA 1HDYA 4M8LA 1O4WA 4C6SA 1KJQA 2XBMA 1Z0AA 2AI2A 5EMNA 3H5LA 2YDXA 4L0DA 4CKBB 2KWIA 3DL2A 4AY4A 3ZNPA 4GZMA 3QNMA 1K2VN 3PT5A 5TLSA 4RACA 4BNDB 2JH8A 5KWEA 1QTQA 4IDHA 1ZONA 4OCZA 5EIAA 3E8SA 2HCJB 2AG5A 3ZWPA 1OY1A 2H2AA 4RLSA 2QD2A 1JDNA 1VJDA 4KZKA 5FUBA 4CCAA 4AZ0A 3JATB 4DMGA 5CDUA 4RTKA 1E2DA 5CM2Z 2AUNA 3N6RA 4HAIA 2P2GA 1N7JA 4AWBA 3PNMA 2Q0XA 2XUOA 3PDCA 2WNHA 2JCYA 3R9KA 4EG0A 2JJ2D 4MR8A 2PMWB 3W5HA 3LLUA 5B4VA 2B7BA 4MJ3A 3OEWA 5L7TA 4QG3A 2JGNA 4F91B 3D5QA 5FJJA 5FR2A 1E0KA 1X8JA 1RM4A 2G5GX 3BORA 1E3DA 4DBLC 4IRXA 4WA8A 2GT1A 4IICA 4HFNA 3ZGYA 1X0XA 2WJGA 3ZWYA 4RDCA 4MHSA 4QOEA 5FORA 1SD1A 5J4LA 2BJWA 2AQHA 2WJJA 5FBKA 3JVVA 1IDN1 1OOEA 5ERYA 1XTUA 4FZ3A 4WSOA 4OJQA 5D87A 4ALNA 5C37A 1B16A 1JA0A 3ZVLA 1NPDA 1NBEA 1X86B 2NTYC 2Q4EA 3FPCA 3EIFA 1PR2A 1QRDA 1SEPA 3QKRB 4H7DA 4JKOA 4B5KA 4RHTA 5JOQA 5KNLA 3TMKA 1KQGA 1UQTA 3KM0A 4RTNA 1GN9A 1U3GA 3DULA 3UXMA 4BNMA 2GBIA 3DFZA 3V46A 5KYXB 2JFNA 5CDFA 3O47A 4A8TA 3AVWA 5JJBA 1HFEL 2YCLA 1YCGA 4L3VA 3RS0A 1G7SA 4EYGA 1XCJA 5DBEX 5A3QA 4V24A 4R8VA 3RIXA 4RPGA 2BFWA 5BN5A 1N3LA 3UMFA 1SQFA 4GM0A 3ZHTA 5IXSA 3F6PA 1CU1A 2RFLA 2VXOA 3DNMA 3RHZA 3E3MA 3TEFA 4A8JB 4F2DA 3CT4A 3X1JA 1FYDA 3TLBA 3EZNA 3ZY5A 3L84A 2MDTA 3RK4A 3D2CA 3O31A 2H00A 1BNCA 4BECA 3D5TA 5DBFA 2CMFA 2AVNA 2CLIB 1Z25A 2PUDA 3DKIA 1DAHA 1I33A 2W6ZA 1ZEMA 3E9CA 5CFPA 1P8AA 4LOJA 1OSNA 2QA5A 4PTLA 3A0RB 5D00A 2JFOA 3LX8A 4I9NA 4LV8B 4F4UA 1JJVA 5A6SB 3TSWA 3KSAC 5KYTA 1PQWA 2VH2A 4G56A 4PS0A 5J4HA 2L2QA 1P6UA 4OF4A 3BC1A 2QNRA 3DEAA 2PSDA 1KAGA 3GPBA 3JQ8B 1AUQA 2CXQA 3GFPA 3SF8A 1JEYB 1AHHA 2O8DA 5IDVA 3HN6A 1HBJA 4CMJA 1FZTA 4BLTA 2CDAA 3T9CA 3U7QA 3H1GA 1IPFA 3GARA 5IAOA 1P33A 2DCMA 3A7EA 3DB1A 4FFVA 1CY4A 1Q83A 4ZP1A 2AOXA 3WIDA 4ZCPA 3R4CA 3THXA 4NOKA 2VF2A 3UO8B 2PX6A 3KT6A 1J21A 3BMXA 3T7AA 3ZWAA 4MEJA 3LOPA 3TAHA 1N9KA 4OX9Y 1N2CE 3WWOA 4URHA 1U0NA 1XZPA 2Q5CA 4FFNA 1KYYA 3O74A 2BDUA 2R751 1AVTA 4IZOA 1I5RA 2IYQA 3ECSA 3NOQA 1F0PA 4FYHA 4RMIA 3LLMA 1GPKA 2VBGA 3N74A 4MNTA 3SCZA 3HBLA 4B7XA 3UIEA 4DMRA 5L40A 2O3TA 3QBTA 1OXKB 3QWHA 5FBHA 4YK7A 5L4NA 3V8BA 1DBIA 1IVYA 2NW6A 3DPSA 2ZUSA 2C3UA 4IP0A 2W6MA 3X44A 3CG4A 5TMBA 3WGUA 4ZK6A 3H19A 3V80A 3KR1A 4E6PA 4PIPA 3DDNA 5DEOA 1BGXT 4C2BA 1YQUA 4NONA 3AW9A 4B3XA 4F2PA 5KJ6A 3V7UA 1M0SA 1SQ5A 2JANA 2OPBA 3KWMA 3R6GA 5I9LA 4BGUA 2JLUA 3H4TA 4JI3B 1F06A 3C7TA 4A82A 2JCXA 4UHDA 1FRZA 1NVEA 4HYEA 4Y6QA 5ILGA 1P17A 5HUHA 5JTUA 3OJEA 4PO3X 3A9WA 1IUKA 3JRXA 4HDMA 5FUWA 2A35A 1UWLA 5DSZA 3OBIA 3GNTA 3A26A 2ILVA 1GQOA 3KLPX 4CG3A 16PKA 3EFHA 4KQFA 4EW3A 2CW5A 2GEFA 2RGGA 3E4CA 1EFVB 2CKMA 2J45A 4M1WA 1UP7A 1AKRA 4I08A 3UPDA 3OCJA 3NHLA 4BNYA 4IVRA 5IUKC 2QE6A 3GLIB 4MQEB 4HFMA 4A1FA 2JIRA 1Z5GA 1WMEA 2FEAA 3O8OB 4BFYA 2OGZA 3ANXA 4K0RA 4ZMBA 1M5UA 2CL0X 1ZUIA 3B6ZA 3PENA 4HBZA 2F1RA 4HDSA 4NE9A 4B7CA 1LD3A 3D4OA 2F6RA 3L04A 4ZXFA 4EHFA 2A9PA 3MBOA 4IXTA 2CFSA 5IT5A 4AT1A 2FX3A 4NK4A 3DLIA 1B8OA 1M2EA 4QUKA 3W1VA 4JLWA 4QVIA 1UAAA 2UUBB 3DOEA 3VNRA 2XDYA 5DRTA 1DIAA 2V4ZA 1RRKA 3GJ4A 4Z1MD 3CISA 2A14A 3D4PA 4LJ5A 3NTOA 4V1CA 4Z4QA 1UMDA 3R3JA 4C4OA 1SM4A 1Z4NA 2ZUCA 1E79A 1XEXB 4EJMA 3QOYA 4IJMA 2LV8A 3LBHA 1T25A 4M7PA 4UBNA 3BSYA 3DC2A 4MVWA 3TB6A 1OAOA 2WHPB 1NE7A 1PJLA 3NEPX 2W6JD 3PGMA 1NKVA 2IYTA 2V5AA 1JVSA 4UZSA 4P7KA 3LX4A 2QMUA 4GPBA 3O3MB 3IDSA 4R81A 1HSZA 1J9GA 2HDWA 4PSVA 1NR1A 1IXRC 1CUSA 2DLCX 5HBGA 4RMNA 2WZBA 5I5GA 1YQTA 2D4HA 4YCDA 5AI6A 1MORA 5K3CA 3SWWA 2VAXA 3QELA 4MV4A 3T5DA 4B82A 5CB8A 1PX2A 5CA1F 2I66A 2D2IA 5LMNB 1SY7A 1QE5A 4MQFB 2XSZA 1Q2XA 3ZHQA 4HO1X 1Z68A 3I52A 4ENUA 2Q8PA 2NU7A 3PSHA 2EP8A 5CX4A 4B6GA 3LD9A 2GPJA 1VM6A 2YXDA 1E5XA 2HRRA 2ZSUA 1IOWA 3AIIA 4UC0A 5EZ6B 3H2HA 4YTEA 4MAMA 1GJRA 4A10A 1RWWA 2JI4A 3P4YA 3D54D 1EP3B 4IW3B 1FFXB 1EPUA 1RNLA 5H3HA 1YKFA 3LKBA 4CRWB 1LWOA 4Z3KA 4I99A 2OVBA 3D3WB 1AZLA 1C8KA 3RVOA 4P34A 2CLHB 4LYFA 4J7AA 2AOUA 1Z36A 2HA2A 4E5YA 4JLPA 1WPRA 3BN3A 3JZAA 1AB6A 1Z06A 5HQJA 2QMYA 3WLPA 1F3LA 1OC2A 4GSYA 5T3YA 3RG8A 3TLKA 2V9ZA 4KIFA 2XOKD 5F4BA 3UB2A 2YKGA 4LMAA 2YFKA 4BFVA 1L3IA 4OA5A 5FWYB 4D6YA 2XH8A 4BKQA 3GFQA 1JPVA 1RHUA 2CLLB 1ODTC 1JA1A 3VHRA 3JWPA 4RAQA 2JG3A 2XIJA 4FW9A 2X6QA 4KIUA 3WL6A 1SCUA 3HFRA 3IMGA 3D1VA 2H1OA 3TR6A 4AP5A 3TUZC 4BO5A 3HJTA 4G8DA 3USZA 1BD4A 4HQKA 4KPFC 1P9WA 1QU2A 1EBFA 5HG0A 2I4IA 3OC0A 2IY7A 3MTIA 4BXOB 2WYHA 2VHXA 2VF4X 1NXOA 2R2AA 1T6BY 4MRNA 2VKTA 3FVWA 1G8MA 3SX2A 3IEKA 3LXMA 4AFNA 2DUWA 1Q2UA 1P9NA 3DL4A 3LQFA 5CGQB 3LPCA 2CB9A 3WLMA 3WFIA 3ZGZA 4MK4A 2D3WA 2WM2A 4IFIA 2MSCB 4I2NA 3Q2KA 5F7OA 1HDRA 1Q0HA 2RI1A 3VZQA 4CMIA 4GKKB 4YJ3F 3O1HB 4L4YA 3GCWA 3G0GA 2HEGA 4R9RA 5K8UA 1SNYA 4CG0A 1M6YA 4PSCA 5HEKA 4E7PA 2ODPA 3G5UA 4HN4B 1A69A 4K9RA 3VH2A 1H8ED 1TIBA 1LDEA 2RI6A 3SY8A 2G08A 1GLVA 2XE6A 2PCLA 3PR2B 5AUPB 1ZUWA 4R1UA 1HYGA 2VDVE 4YCBA 1OZ0A 2DUUA 3V2GA 3A1SA 1NVVR 4F3KA 2R6CA 4WCFA 1UBLS 4DT1A 5BYKA 2OM2A 3HXQA 4MV8A 1OILA 2M98A 1LB1B 4Q9JA 4ICIA 2QAJA 3PQ5A 2HJGA 4IKPA 4YAOA 4F92B 4HN9A 2AMYA 1SHJA 5ESXA 3CKMA 3UATA 2Q4BA 3Q7QA 4UBIA 4N03A 1NVWQ 1JX6A 4OAOA 1TXGA 2FW8A 1M6HA 4O6VA 4TQUS 2PO5A 3DGFC 3A2NA 2D2EA 3NZEA 1G66A 1C9DB 1IXSB 2JGDB 1AB5A 3PT9A 4J9VA 5EZYF 2O8NA 2XQGA 4HWRA 5JRDS 4BJ3A 5K8CA 1DRUA 5FBWB 2ZWIA 2Z6QA 2W0SA 3Q2IA 3CV3A 2UYCA 3HCAA 5K05A 1KDOA 1W0KD 2DTEA 4EJ0A 2X5JO 2ANCA 4EA6A 3NAGA 4QDUA 4KQ1A 5A0FA 4UNPA 1ZK3A 1RS0A 2GZHA 4IHJA 3ZDXB 2OAP1 1ZGBA 4I4NA 2HWUA 1YMUA 2YCBA 4DIDA 1Y4SA 3AB8A 1L9XA 3AB3A 1LDGA 3AHIA 4HZIA 1E2NA 3ZD7A 1FA9A 2R96A 1CLUA 5FOSA 2HSEA 3LS2A 1E2PA 1V1RA 2HR1A 1KAMA 1ZGCA 5B37A 1LSJA 2P4QA 1T34A 3D02A 3U39A 2ZJYA 3K30A 3IR6A 3OOYA 2EKDA 4H4EA 4BX3A 4DGSA 1D4AA 1GPDG 2HWKA 1ZJJA 4HAXA 4B84A 2A0YA 3K5WA 1PE0A 4WD3A 2CXPA 3KSRA 4B6SA 4U7JA 2R0QC 1JHQA 5H16A 4UQLA 5DBIA 1P5ZB 3WMEA 1K4KA 5BOVA 3HDTA 3A6GA 5KYUA 3TSAA 2XYGA 1VLQA 1P7VA 1UK7A 3DYVA 3QQPA 4UFNA 1YBMA 4GNKA 4IXWA 2VSQA 5CIWA 4U2FA 5G0UA 3WSVA 4KLNA 2FEOA 2R6GA 3FYSA 4ZODA 5IYZA 3BGDA 4UU8A 1Z22A 4JUAA 1P4JA 3T61A 2D13A 1RM3A 3EA5A 3GLVA 3TDNA 3I92A 5NLLA 4A9AA 1J8DA 4AXXA 3L8FA 1E6UA 4Q00A 3RJZA 5AW7A 5JNWA 3TVDA 1TPZA 1SCDA 1ZOPA 1NR7A 2OV6A 4H6VA 4TYQA 3AFOA 1PBTA 3OQPA 1IY0A 1RWXA 4CFYA 1W52X 3UHFA 5LMCA 1VCHA 2OGSA 3M2TA 1TTPB 4CM4A 1OZGA 3LZCA 5A4DA 4GLJA 1CP2A 1Z75A 2A9OA 4CHTA 1Z74A 1U4OA 3NQ41 5CHEA 1BE1A 2VBFA 3NUGA 4XYEA 1EUCA 3ZXYA 1T4MA 3ONNA 4FJ2A 2VNAA 4Z9BA 2IZOA 5BMVA 3FYDA 3OCUA 3ICEA 4IVNA 4YO8A 3TQTA 4LQDA 2A84A 4JEIA 4ZCMA 5C18A 1KK0A 1ZGZA 1GPJA 1N6OA 4I8IA 1YS1X 4JEUA 5CAEB 3M83A 3RS4A 3ZQ4A 5KSZA 2UUCB 2FSIA 3O75A 4RH0A 1LNZA 3GJ7A 4XJXA 2XB2A 1VGVA 1O9HA 1UPTA 2QOEA 1GD1O 3B7WA 3GYGA 4S3MA 5KX5F 2N42A 1XPJA 4W5WA 2RAVA 5ALPA 5DXFA 2I87A 4BN0A 4LHSA 2H8KA 3UJDA 3WRXC 4JLDA 5AUNB 2ZB7A 3OF3A 4RTSA 4F3TA 1SCKA 1XYYA 4B47A 1OFUA 3CR8A 1EHIA 1ST2A 5BW8A 2XA1A 3NYWA 4BFCA 3GNQA 1RXCA 4LG1A 1DO8A 2QORA 3MWDB 3DAGA 1ORWA 2C5LA 2XUKA 4Z0TA 3SZRA 4IIJF 2B0CA 3BGVA 3Q5GA 2VWPA 4ZTBA 1WZNA 2D0OB 2R6HA 2HQBA 2ZRPA 3EEQA 3HVHA