1U0SY

Chemotaxis kinase chea p2 domain in complex with response regulator chey from the thermophile thermotoga maritima
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title In different organisms, the mode of interaction between two signaling proteins is not necessarily conserved
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 43
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u0sY00
4MYRA 2WB4A 4RU1A 1QKKA 2HSGA 2FEWB 2MSKA 1ZVVA 2B1JA 2L18A 3Q41A 2FXIA 4MS1B 1RZRA 4KQ9A 4EVSA 3Q15C 4MR8B 3URMA 1RXIA 1VRVA 3A10A 2QVGA 1JFSA 4MS1A 5IC5A 1DJMA 1A0OA 1R8JA 4MR8A 3HSYA 5JS2A 2F8TA 4KFCA 3OQMA 1J56A 2PUEA 3JTEA 3EULA 1AB6A 5IEBA 3DZDA 4RSMA 1M5UA 2H3HA 2A9RA 5EWLB 4NCBA 3OLWA 4YRZA 4IMJB 4W5QA 2QU7A 5GQSA 1JHZA 4XXHA 3TX6A 3HM9A 4PEVA 5TQ2A 3H5TA 3SM9A 4PZ0A 4ZJPA 4RZSA 1I3CA 1RPJA 3O1HB 1NXOA 3QX9A 5IUJC 4S05A 2BGGA 3DLHA 2IPLA 3OM1A 5KQGA 1EWKA 1D1QA 5JNUA 1QP7A 1KRWA 2GWRA 3MM4A 3JVIA 4RXMA 4RV5A 3GV0A 3LUFA 2NT4A 1Y1LA 2FQWA 3H6HA 3KHTA 1IIBA 4MS3B 4RK6A 3ROFA 3ROTA 1JH9A 3D8UA 1LBIA 1P6UA 4OG2A 4MS3A 4Q7EA 4Z9AA 1U04A 4Z0NA 4TMYA 1TJYA 4KV7A 1FQWA 2HQBA 2IOYA 3M9WA 3BRQA 2J48A 2FN8A 1P2FA 3CLKA 1GCAA 3LUKA 3LUAA 4YO7A 2MSWA 2CD7A 3HUTA 1QO0A 1Z16A 2PJUA 3DBIA 5CNJA 1JFTA 4YLEA 1MVOA 1DP4A 5B3JA 1BDJA 1BDIA 1GUDA 2PL9A 3C3WA 1S8NA 3OLVA 3EQZA 4HNSA 4MQEB 3KJXA 5ED4A 1YS6A 5T3YA 3IP9A 4JB0A 5I4CA 4Z4IA 2E4VA 2WJAA 1RXEA 2PUBA 1QQBA 4MQEA 3MYYA 5GOTA 4F11A 3I45A 4XASA 3HUUA 2DRIA 1M5TA 1SRRA 5DTEA 3KTOA 2OENG 5BRJA 2FQXA 5CNIA 4P1ZA 6CHYA 3OQNA 1VPWA 3N8IA 3LOPA 3RVQA 2GX6A 4ETIA 4WXMA 5HKOA 1QQAA 5TQJA 1L5ZA 5DCLA 4ML3A 4JB2A 4Q6WA 3OMWA 3GWGA 4Z9BA 2WJWA 4MQFB 4EVQA 1YIOA 1ZGGA 5IEJA 1Z26A 1E2BA 1L5YA 3M6MD 4MQFA 1K68A 3MA0A 1WETA 4FE4A 1JYFA 3HVRA 2W42A 3CS3A 4O1HA 2R4QA 2WRZA 1BVHA 5DLEA 1KGSA 1ISSA 4XARA 2V0NA 4L85A 3CKMA 1JDNA 1VLZA 3SQNA 3KS9A 1ZGZA 3Q9SA 1GCGA 1PNTA 4OBBA 5IUNC 5BRAA 2CWDA 8ABPA 2FLKA 1K66A 1BDHA 1Z17A 3CZ5A 3QK7A 1Z13A 2M1ZA 4L4UA 3HCWA 1FFSA 1U2PA 4FE7A 5FWXB 2IPNA 4YCSA 1D4ZA 1YK0A 5JNVA 4D74A 2NZUG 2NZVG 3IPCA 5CNKA 4QYMA 3CZCA 4TLMB 3H6GA 5FWXA 2FEKA 2ID7A 3N0WA 3LKVA 3QELA 5EWMB 5C5EA 1NXXA 4LZLA 3QLVA 4UHKA 1Z25A 5EWMA 1D1PA 3KLOA 4W5OA 4YR7A 2QXYA 2FMIA 3KYJB 4H60A 1Z15A 4YGXB 4NV3A 2WWVD 2FVYA 3LUCA 4NQRA 4CBVA 1USIA 5TPWA 3HK2A 2HQRA 3EDCA 4KQCA 1VKRA 2HPHA 2M98A 5TPZD 4D6XA 4D6YA 4RK7A 5C5CA 1C0EA 3RQIA 3H1GA 3QX8A 1NTRA 1SXIA 3N75A 3O1JC 2GBPA 1KMIY 3CNBA 3B2NA 4KRFA 3N0RA 3LUJA 3RVSA 4EVRA 3N0XA 3TMYA 1LJUA 4RKQA 5TQ2B 5KC9A 2PE5A 4DN6A 1DC7A 5JNWA 4KPYA 1MIHA 1EWTA 4KK4A 5PNTA 3VNAA 1LK0A 5FWYB 1QMPA 3GL9A 4G0QA 2MYUA 3HDGA 1PHRA 3EODA 3O2QB 1YVUA 3OO0A 1DRKA 4ZMSA 4JOQA 5FWYA 1A04A 3N53A 3GA5A 4IRXA 1QP4A 4LDZA 3H75A 3A0UA 5KC8A 3H5WA 4W5RA 5IX8A 4YS6A 1ABEA 4O1IA 3S99A 3KLNA 2OQRA 2L17A 1T34A 4LX8A 1W25A 4KMRA 4HNRA 3G85A 3I5AA 3T8YA 2YHAA 3E61A 1SD5A 2PAFA 1ZITA 1P6QA 2PL1A 4KVFA 3OLYA 3DGFC 4JAVC 4KK3A 4ZYLA 1NXSA 3RVNA 4WT7A 3E3MA 4RK4A 4YV7A 3IPAA 3NHMA 3KSMA 1NY5A 3UKJA 4N76A 1ZY2A 1NATA 4E7OA 1E6LA 1NXTA 1MB3A 3LKBA 4F3TA 2JVJA 2RDMA 5FBKA 1JF8A 1TMYA 5DGCA 3I42A 2A9QA 5CHYA 5KWSA 3NNDA 3SAJA 2CHFA 3T38A 4EYQA 1MB0A 2NT3A 1E6KA 4RY0A 3MQ4A 2JBAA 4Z4HA 3CFYA 1CHNA 4N03A 1EHCA 1DCKA 3O21A 2PUAA 1YMVA 1EAYA 3ILHA 5HQJA 4E7PA 2GKGA 3C3KA 2PMCA 3CRNA 4ETMA 2QR3A 2IKSA 4HNQA 4RS3A 4OATA 3JY6A 1JYEA 1UDRA 3HS3A 4GNRA 1B00A 3Q7TA 3TB6A 1PUXA 4MRMB 4EGSA 4IILA 1P8AA 3UK0A 2A9PA 3T6KA 1YMUA 2IYNA 1EFAA 4MRMA 3R0JA 3O1IC 1YK1A 2HQOA 2CHEA 3I09A 2AYZA 3OMXA 4MGEA 5B3JC 3HJFA 5JNRA 4WUTA 4KREA 4EUKA 3F6PA 4GPAA 2GI4A 2RGYA 2ZAYA 4TN5A 1DC8A 1SXHA 2R25B 1JFVA 4JASB 1YS7A 4RK0A 3O74A 5E3JA 4F12A 4IGAA 2YHBA 3EGCA 2I6FA 1DBWA 1JBEA 7ABPA 4B09A 3GBPA 3O2JA 3C6QA 1ZN2A 4G0YA 4EYGA 2N9UA 4S04A 4PE5B 1NXWA 2PUDA 4Z4GA 3T95A 5KQPA 3HEBA 2RJNA 1FSPA 5EWJB 3QELB 2LIVA 4RXTA 3LMKA 2E4XA 2FW0A 4W5TA 1DCFA 4P98A 5EWJA 2AYXA 9ABPA 3CTPA 2QVCA 1NXPA 3OLXA 1ZAYA 3O2SB 3FFWA 2P4UA 4H3HB 3CG0A 1RZRD 3HZHA 6ABPA 3FFXA 3EQ2A 3LTEA 2FLWA 3QLUA 2FQYA 2MSLA 1FFWA 4NICA 5TPWB 4G0OA 1NXVA 3N6VA 2Q5CA 2ZWMA 4MPTA 1Z12A 2B4AA 2IDMA 1U0SY 4RK1A 4DADA 1XHEA 1ZH2A 2NUBA 2E4YA 3Q7RA 3TD9A 5KQLA 1MAVA 1DG9A 4PYRA 4Y9TA 4ETNA 5D2CA 4ZMRA 1AB5A 2FMFA 3HO1A 4LE0A 3SNKA 4MLDA 4ZPJA 5CNMA 2FTKE 1D2AA 1USKA 2WY2D 1U2QA 1APBA 2FEPA 1DBQA 3G1WA 5KQMA 1KRXA 3H1FA 2JCGA 4M88A 5F64A 4Q6BA 1TM2A 3Q7SA 1CYEA 5JNSA 3QLTA 1F4VA 2FMHA 4MR7B 4RDCA 3VNBA 4MLCA 3CU5A 3QLVC 4JA2A 2VUIB 3A3KA 2E4WA 2VUHB 4LE2A 3W9SA 5IUKC 3KG2A 4MR7A 5TQ0B 4MAAA 4EYOA 3LFTA 3QLUC 2JVKA 1DCMA 1D5WA 4Z4CA 2JRLA 1A2OA 2LPMA 5TQ0A 4RK5A 3QEKA 4QYWA 3FDFA 1XWWA 1GLGA 1ZH4A 1LJLA 1OXBB 2JVIA 5TPZA 4FB4A 3QEMB 1OXKB 3DGEC 4YP9A 2IPAB 3HXMA 4EYKA 1DZ3A 1Z2DA 4LRQA 5HSGA 3QEMA 5JS1A 3JPYA 3JS5A 1ISRA 3HV2A 2PUCA 5EWLA 5HM6A 3L6UA 3H5IA 2R48A 1QO0D 3CG4A 3KKEA 4IF4A 2WMYA 4N0QA 3RVJA 4IMIB 3RH0A 1ABFA 3DLBA 3OLZA 1M2FA 2KYRA 3BILA 4W5NA 5T7BA 3K4HA 4N41A 2PUFA 3LUHA 2VK2A 2ID9A 4O5AA 2LP4Y 4N47A 4KNYA 4WZZA 3H5VA 1USGA 4WWHA 4QICA 1XHFA 2JBAB 1ZHHA 3F73A 3MF4A 4EY3A 3NHZA 2PKXA 1JX6A 2L2QA 3BRSA 4JP1A 2JK1A 3BREA 3C3MA 3JPWA 2F8SA 3LUDA 1QNLA 1DBPA 1FFGA 3M9XA 4H3KB 2MYPA 3RVLA 4UHJA 5IULC 1QPZA 4Z4EA 3IP7A 2E4ZA 3FFTA 3UUGA 3K9CA 2MYNA 1GUBA 2HJ9A 3GRCA 3NBMA 3F7NA 1PNRA 3FMVA 4MS4B 1PEAA 3D02A 3FGZA 5KI6A 1SXGA 3HDVA 3OO1A 2X7XA 1ZDMA 4G0ZA 4N0PA 3H5OA 4MS4A 4XAQA 1C4WA 2P9HA 4LE1A 3EAFA 2O20A 2PLNA 3O75A 2H0AA 4QPJC 3RVOA 5TE9A 4YWHA 1EWVA 2IPMA 2MYTA 4XFKA 3MIZA 4NCAA 3GYBA 1F51E 1TVMA 5FBHA 3LUGA 1TLFA 2FSPA 3ILYA 3A0RB 4RWEA 1M2EA 3KCNA 2FMKA 4Z99A 1W9HA 5JNTA 4PICA 4G0PA 3H5LA 4RXUA 3IDOA 4OLAA 2PUGA 3C97A 3KYIB 3L49A 3SY8A 1BA2A 3TO5A 4G0XA 1DRJA 4OLBA 4MR9B 1RNLA 2FKAA 4DQDA 3JVDA 3RVMA 3OQOA 4G0MA 3CHYA 1HEYA 4MR9A 3RVPA 3RVKA 3H1EA 4RY9A 1U8TA 1ZESA 4HYEA 4LDAA 2XDYA 4RY8A 2R47A 2LUOA 2A9OA 3RVRA 1JLKA 1PEYA 3GT7A 1LBHA 2RJOA 1YTUA 1E6MA 3IP6A 3NNSA 5BR1A 1H9CA 1CEYA 3NNNA 4RKRA 3P9YA 4KZKA 4F8JA 3OM0A 3MMNA 5ABPA 1Z18A 3IP5A 4TLLB 1BAPA 4F06A 3EJWA 2JB9A 2FN9A 4G97A 4G86A 3SG0A 4OTZA 3GBVA 1URPA 4XLTA 1JDPA 2TMYA 1Z2EA 3F6CA 2E4UA 1JWLA 4Z4FA 2LBPA 2QSJA 1QP0A 1JL3A 5DKFA 5BQ3A 2QZJA 5IBQA 2QW1A 2VYCA 4WXEA 2L19A 3BBLA 2QV0A
chains in the Genus database with same CATH superfamily
1ADJA 3L7JA 1K0FA 2J31A 3ACCA 4DDVA 4CKZA 2MSKA 2ZTUA 1A2BA 1HYEA 3GRRA 1WSDA 5FUMA 4KQ9A 2ZRCA 2IS2A 3OFND 2A7QA 3ACDA 1CR0A 5KSWB 2A1TS 2WWXA 2QWXA 1U3VA 1F4PA 4GBMA 3MHTA 3F5FA 5IC5A 4CHTA 1I7PA 3RAGA 4J4BA 2PJRA 5ESXA 4BE9A 1I3KA 1VMEA 3IIKA 3PEVA 2ACEA 3Q40A 2EFGA 2I34A 3T7SA 2DFTA 3OKFA 4JBHA 3VRHA 3FETA 1P5FA 3D6FA 4IDDA 3WHKA 5LQMA 2BC9A 2FW1A 3H13A 1FMFA 4W5QA 5KS2A 2AOTB 3H2YA 3D81A 1TQHA 1JHZA 1H42A 3EQ7A 4Z8YA 2C31A 4YEDA 1EJ0A 2HCJB 3P26A 4WERA 4X65B 2XA1A 1MQ9A 1A88A 1D0SA 2BGUA 3TBHA 2F3QA 1LDBA 1UODA 2W6ID 2FDRA 2OHOA 3O1HB 1V1JA 3B5JA 3UJ8A 4CF3A 3DLHA 5KQGA 3NMUF 1H0KA 4J16A 2R85A 5BN5A 2P2CA 3RIGA 1R4MA 2KE5A 1BE6A 2HLDD 2X8JB 2VYFA 4JWKA 4K9LA 5ES4B 4MVWA 3RK1A 1T9ZA 1N57A 1VJCA 2FQWA 2PEZA 1NVEA 2Y92A 3C74A 4GKVA 4UZFA 5CUQA 5MN6A 1R0LA 3X3HA 4ALMA 4MPPA 4U6QA 2Q4EA 1WR8A 2DG2A 4BO3A 1Y1RA 2CFCA 3K1YA 5BNIA 3CR3C 1ZA1A 1U04A 3ENZA 4N7RA 1A7AA 2BFBB 1UDCA 5DK4A 1IZ8A 2I29A 3TW4A 4B3GA 3V1MA 2IX3A 2DZDA 3FSGD 3BRQA 1UKEA 2CLLB 4MINA 2PUWA 2R8ZA 4LXHA 4TS4A 1Z5NA 1MORA 3HE3A 4MWSA 4V0QA 3SE7A 3ZWPA 4Y9UA 1J7JA 3LH5A 4MV7A 2MSWA 5K8UA 2Q2VA 5KU1A 2WTUA 3R4VA 2ISSD 3HUTA 1EK5A 5ICCA 1TA0A 5KCZA 4CEIB 1BCSB 3L9WA 4GMFA 4KO3S 5EHQA 1DAFA 3HWSA 4CI9A 1G21B 3HKDA 2RGDA 3LCUA 5CG1A 1XUOA 4DT1A 1G8MA 1ENYA 5HZGA 2GEVA 4HXGA 3QKUA 1UJ2A 2VJLA 5H4HA 2C9CA 3L8ZA 3Q4GA 5KKNB 1VKZA 3PD0A 4MQEB 3E9ZA 4GGMX 1UBNA 4CMEA 1SWVA 4B5KA 4WQMA 3COSA 4WOBA 1RM3A 3WGQA 2XCRB 2BZ1A 1RYBA 4MKHA 5AH0A 1C3OB 4BNGA 2R62A 4IQ4A 2HIAA 3HKBB 3A6LA 1GGKA 3EC1A 3BDAA 3PBKA 1DXYA 3SZRA 4EJMA 4HDKA 3LRTA 1S3IA 3H0KA 4ZOEA 4RJJA 3UH1A 2H5EA 4DHWA 1NI5A 2BCJQ 3CEAA 1F2UA 3LNTA 5BN3B 2AQKA 2Z2JA 2C3MA 2GB4A 3NC0C 3RVQA 4DDMA 3H87A 1ENOA 3TGWA 3QW4B 4ND3A 4BZPA 1FEZA 5E7QA 5DCLA 4FN5A 3K8QA 4WY8A 1GL9B 4K9DA 3W6UA 4CNQA 3KUXA 1MV5A 2JGAA 2HQ1A 1KMHB 3LDFA 2P3SA 4OXYA 1U4SA 1ZUIA 3QXSA 2H1FA 4RIIA 3W8RA 1HV8A 1V16A 1AKEA 3A6HA 1QK5A 1JYFA 1Z4LA 1T6BY 1L7NA 3KFXA 2HF2A 2VCEA 2VPWA 3BWEA 2VWQA 4PO1A 5JTUA 1VMIA 4L85A 3L1JA 1ZK4A 3RC3A 4A1FA 5LWHA 1QQ7A 3VR6H 2OCGA 4HYQA 4FFBB 4B2IA 4WNCA 2FE4A 1KH3A 4B6JA 4ZJZA 2XODA 3TAUA 4OQPA 4F9FA 4YHBA 5JSUA 2DWOA 2GQ0A 4NBKA 2IPNA 3O8OA 3SBOA 5FWXB 1YFLA 1XNRB 4JHXA 5AI9A 4LGVA 4A82A 2OO7A 3QLJA 3R0XA 4UXHA 1KJQA 4QOSA 4I4NA 4PZAA 2PRZA 2R8EA 5EGSA 1P17A 3LKVA 5AW8A 5JJKA 2D0OB 4DQLA 5C7LO 4ICIA 5TNXA 1R4NA 1VI5A 4P7FA 1RWXA 4RZ2A 5HBRA 2NP6A 2VDPB 3R8XA 1Y37A 5AJUA 4PZUA 2A57A 1R3DA 1OFVA 2DH6A 5HTKA 2FMIA 1M1UA 3P4XA 1V37A 4IP0A 2QQGA 1Q1ZA 1ZMRA 2X5KO 1PQ4A 2PCLA 2C7BA 2X1HA 1K98A 3C3CA 4DABA 4K9SA 1CRLA 3CPJB 1J2TA 2FH5B 2E6KA 3IOBA 2I6UA 3QX8A 1XA4A 4F5EA 2NIPA 3BWDD 5FKJA 4PF1A 5KTKA 4TMTA 3QKIA 4TGLA 1E59A 3M5WA 2OCXA 1IHYA 4JI7B 3H9UA 4J7AA 4P0PB 4TS9A 5JQGF 4FKMA 1BVRA 1NBAA 2YWEA 2WYHA 3TTSA 5KJCA 3G17A 4RQTA 4EABA 1UKVY 5KSOA 2HQSA 1Y4UA 1MF7A 3P71T 5DTIA 5AM1A 3PHJA 4MVJI 3TQQA 4KXNA 2EKZA 1G2OA 1TA9A 3HDGA 3KC2A 1N77A 3OA0A 3TNFA 4D96A 3WLPA 4U9IS 3OO0A 4YRGA 1LXCA 4EA8A 3PITA 1YBVA 5A62A 2CDNA 1YV9A 2HUNA 2HSDA 1J9ZA 3QVGB 1KE1A 5KC8A 3HU3A 3WWOA 3ZCUA 4QOHA 1X7YA 4B6PA 1T0UA 5CFRA 1G38A 1YQDA 1GRNA 1R5JA 1YRQA 3BJRA 3RAPR 3OBIA 3QBEA 4OH1A 5AXCA 5T4FA 1XJQA 3RUPA 3ZBUA 3RKSA 1WMEA 3ZHQA 3OLYA 1G8KA 4MYTA 2H06A 1JHVA 2ZYSA 3RVNA 1X42A 3W1EA 3ZZMA 1YB4A 5IM4F 5L3SA 3E8SA 1FU4A 1XEXB 3W6ZA 3R9KA 3WLSA 4D5EA 5LR6A 2C59A 4V1CB 2B83A 4ZVTA 2RI6A 3GVPA 1VSBA 2ZATA 3AESB 4Q9DA 4R69A 1JHDA 1FP4A 3LPNA 3IV7A 4ZIRB 2IT1A 4LJAA 4LJ5A 3LLVA 4QQKA 1UWVA 2GEBA 3TS1A 5CB4A 3GNLA 5FNVB 4D9JA 1ZVKA 1T5BA 3T38A 2WD8A 2Z5VA 3BL8A 3IMEA 4FW8A 2OO3A 2NT3A 2NTVA 2VDRB 4F2WA 2IV2X 1MHPA 1VCHA 2ONZA 2XUGA 4FCVA 3ZGXA 3C5CA 1THZA 4KAJA 4Y8VA 4DWVA 4F0JA 4JXZA 2ODEA 2WF9A 5FLYA 1ND5A 2VTKA 1EM6A 3DT9A 4E4YA 4O2BB 3QX7A 4AXXA 1JKFA 3MNFA 3PU6A 4GSKA 1VJ0A 4UU7A 3SF0A 4BB9A 3GJ7A 5IH3A 1E1KA 3MB5A 2CHGA 1V6CA 4GNRA 1CZHA 1P1HA 4B4UA 3MUFA 2JDIA 4IILA 5T8KC 4D4GA 4ESOA 1KDOA 5FF9A 4CKWB 1R3UA 3EXIB 3HN2A 2QZZA 4FSXA 4H7HA 4BWGA 4YT4A 3NV7A 1U8EA 3FZYA 4C2TA 2HOQA 3DP9A 1ZH6A 1KSGA 3O8RA 4RHFA 2LKCA 4C1BA 2X13A 3EXAA 5DT9A 5HZMA 2GN1A 2W2LD 3CCCA 3PJFA 4L78A 1Z0JA 1D4OA 4B0OA 1V2GA 3G9QA 1US8A 1JU4A 3MWYW 4KRXA 4MAMA 5ILQA 1RWPA 4MHOA 4ND4A 5AVTA 3OEEA 4TMVA 3JXEA 5DWVA 1OT3A 4QYXA 1R0XA 1TW2A 2C2ZA 3KR9A 3ETLA 1O7JA 1JBEA 1R8QA 4GXRA 1O94C 2Y1LA 2Z2KA 5G0WA 1OB2A 2GXQA 4FOLA 1L8LA 3I2GA 3ZD6A 1V45E 4MVJM 4B1FA 1EMDA 5CRIA 3UK2A 2EIHA 1LTKA 4HWOA 4BLUA 2RJNA 2CL0X 2GN2A 2VZEA 3PSAA 5B2FA 2HV9A 4EPYA 2FW9A 4L76A 4NS4A 1YR6A 5FLEX 1EJ6A 4EF5A 4YBRA 4EHIA 5J4KA 4D4MA 1K9SA 4BQRA 1TPZA 2YIDA 4H3HB 1YDGA 1PKXA 1SVSA 1N5LA 4CV1A 3WKEA 1KPGA 3H9JA 2XUDA 1UKAA 2FQYA 1B8OA 2W6ZA 4IEIA 3GP3A 1VBMA 4G0OA 3SLGA 3E70C 2D5CA 1N9GA 4L9SA 4P5PA 5F4ZA 5TLSA 1WBDA 2W71A 1SD1A 1U6JA 1LDEA 4KC0A 1X1RA 1N1GA 4DRZA 1NKSA 4DLPA 4K6MA 2QJWA 1Z4KA 3KTDA 4IH4A 1ZC3A 2CLFB 3MTIA 4IFTA 1CRZA 2APJA 2W2MA 4V0NA 3ZS9A 3ZUGA 1LLCA 2LCIA 4MWZA 1FF9A 5JC8A 3KXKA 1DAGA 4N5HX 1QGZA 4BNZA 1Y6GA 1DTSA 4UMVA 4NU6A 4UBNA 2NVUB 1QF7A 5AKYA 5FUWA 5J59A 2FG5A 2I3BA 3IAM1 1F4VA 2EZUA 3LYLA 3FTEA 4CF5A 4EHHA 3FWYA 4OXNA 3L0PA 1FXWA 1BFKA 3SFVA 4PQFA 1JIIA 3U62A 3GJZA 3JQCA 3KG2A 2ZUTA 5LVAA 4F4JA 1C30A 1J0EA 3IUNA 2JVKA 5K3AA 4YROA 3KVYA 2A0KA 1V71A 3GVCA 4ZWNA 1H65A 1JFRA 3IBSA 1XWWA 4JU8A 3E9EA 4WFKA 2A86A 3UTDA 3VM6A 3UMYA 3QV1A 4EUSA 3RE1A 3NTQA 4QXRA 3ZWYA 3OUZA 1D8AA 4HN2A 4QOJA 5SZIA 1QNFA 4FT2A 3WDLA 1P0FA 2NPOA 4P36A 5I9MA 5JS1A 1KK1A 2BI4A 1YS4A 1RKVA 2C9YA 4J6FA 3L6UA 5FUVA 3W9UA 1WBBA 3O3MB 2PXCA 4JH0A 1YOVB 2JATA 4GLBA 3UJCA 3TXYA 5FA5A 1QIFA 2W2VA 3GMSA 5GJCA 2ZWVA 1IY2A 2YFQA 3COZA 1T3TA 2GN0A 3E9RA 3FN4A 7AT1A 4P86A 1GQRA 2X9GA 4EFDA 1HFWA 1UMDB 2BY4A 2FOLA 2I4LA 2NU7B 1IAQA 1QMGA 2EJTA 4PSAA 2FMTA 1NG9A 4DB2A 4QRIA 5LIPA 3W9BA 1SXJE 2IHKA 3OY7A 3HJNA 2R2GA 3KD3A 2R4UA 1USGA 1Y3AA 1ZN7A 4QICA 1XHFA 2CJPA 3OIWA 4IX1A 4ESEA 4YRDA 2GPJA 1L5NA 3ZWDA 4B3BA 1CQWA 2ZEJA 4PPQA 3NGMA 3KJHA 2TSYB 1YR2A 1E2UA 3LXXA 3BRSA 4JP1A 3RHTA 3WGGA 3EARA 4PNZA 1QGYA 2HA7A 3O0DA 1DBPA 4B6FA 5IULC 3L5KA 2UUCB 1MG0A 4RV4A 4GMHA 4PZLA 3QU2A 5G2OA 3FFTA 4ARIA 4F92B 1NYTA 4KSCA 2IY9A 2MYNA 3ORRA 3K70B 2D0DA 2IEDA 5K6RA 3M7IA 5JFOA 4HKTA 3GLHA 3WI7A 5JAOA 3NYIA 3BE4A 2JRCA 3A37A 3ZHCA 2QU8A 4U02A 1DIHA 3TLZA 3CLSC 1QYDA 5EIWA 1Q2XA 1QE5A 1X7DA 2HDOA 1MP0A 2F67A 3P96A 1HT1E 3C3EA 2XEDA 1FVXA 2MSNA 4LSWA 2K87A 3OQPA 2H7YA 3CVOA 3GPDG 3DEZA 2D00A 3WO0A 5ESWA 4NABA 4RMIA 1L7AA 3GJ6A 3U3MA 1WEHA 4XX0A 4HATA 1GTVA 2HSJA 3RYIA 3ECCA 3VZBA 4X44A 4Z99A 3WGJA 4WK0B 1ZOLA 2WM8A 3ZQ4A 1FFBA 2JI6A 4EHJA 3JZIA 3LGSA 2E55A 3RFXA 1YJQA 5FTKA 3RGGA 1U7TA 4DQDA 4RELA 1VGRA 2IYQA 3PHLA 3PC7A 2QM8A 4CM6A 3TZKA 5EGNA 1CQIB 4U1RA 1M7GA 3DZFA 1IOWA 3P9CA 2OCIA 3RVPA 4H0NA 4EHDA 3H1EA 2BRUA 4MW4A 1HY3A 4PVCA 1Z0ZA 2I67A 4XUCA 3N0TA 3U44B 1Q6ZA 4NIMA 1ZUD1 4RO0A 1PDOA 3ZJ5A 4U39A 1T8PA 4TL9A 2OUIA 4H27A 5CFNA 3HJAA 4W8OA 1GPKA 4RM2A 4BE7B 1SCAA 1QC5B 2LXNA 4GZ6A 5FTNA 1P73A 1B23P 3IA7A 2HREA 3B3AA 1PUIA 4ACAA 1H9CA 3N5CA 2G9VA 2Z6UA 3HEMA 1MJNA 2AC2A 4UFNA 5C3UA 3RF7A 3B6EA 1VL1A 1M7BA 3PE3A 1RI4A 3ORSA 3UOWA 3UWMA 3EJWA 2NO7A 3HI4A 3RM3A 3OOSA 1GRQA 4G4SP 2GT1A 1QV7A 5DN6A 1OWMA 4FFPA 2VHXA 3LPAA 2NNWB 1ZMXA 3M2PA 5JANA 3M81A 3MT0A 4BVJA 2W93A 4O4LA 2BFEB 1CYDA 1M73E 4OSEA 3EA5A 3R8FA 3CZAA 3CUTA 5FTMA 3P9KA 1F20A 1NVGA 3O93A 2ASVA 1GZ3A 1RPTA 1TAGA 1BW9A 4QBHA 3VBCA 2A58A 2BR5A 1D2GA 1WSWA 1RKUA 3GUUA 1DJMA 4Q02A 1DAPA 1R8JA 1JIUA 1FJHA 3NHAA 1QGUA 2GUWA 4AJKA 4F46A 3A7DA 3UWDA 1TZCA 5ETJA 2FDXA 1N0WA 4E5NA 3DKPA 2QUZA 2RKBA 1U94A 2NPFA 1NJSA 2YTZA 3P9XA 1NR1A 5JAIA 1X1QA 3IVCA 1CIVA 1H5UA 1WUHS 1C41A 3AHEA 2J5QA 2UUOA 2B8JA 1IEXA 2VBCA 1YU9A 2XCOA 2VTEA 3QBVA 4YCJA 2Q46A 4DUZB 2VJYA 4YNBA 1UFKA 1WPXA 5LQRA 2O50A 3X43A 4LQDA 4S05A 1YTLA 1M2GA 2H52A 3DOEA 3MCZA 4FGLA 2A8YA 4OQNA 2CK3A 5KVSA 4OJYA 2AUTA 1CZOA 2XXJA 2RKWA 4LJ4A 2CXQA 4HG2A 3W4IA 4FMCB 2NVWA 4GFDA 3AUUA 5TVKA 1IONA 1YL7A 2JL1A 1KFEB 1SWWA 2IIPA 3B13B 4JR0A 4RORA 2PSDA 1WKVA 4FM9A 4XD7A 3I52A 1OZ0A 4MKRA 3DKKA 3H9GA 3PQDA 4WNIA 2D5LA 2V6GA 3PC2A 1W5BA 4MWTA 2W6OA 4XA8A 4Q47A 3E3OA 2FE1A 2GZDA 2QMHA 2PYIA 2CJFA 2R7AA 3QGMA 4XDHA 1SQ0A 3E1KA 2E5WA 4UEKA 4X9XA 1Y3FE 3C3DA 1WJGA 1Y81A 3ICWA 1Q19A 5T8KA 5K7SA 2A78A 1JZTA 3PXGA 3KQKA 3GCDA 1Z16A 3JAMA 4A8JB 2O2YA 5A1TA 1JFTA 1QFXA 3LBYA 1N3LA 3T0FA 2IW1A 1UJ4A 4I99A 4JITA 2UZ0A 2XT0A 3KPYA 5LA6A 3CN9A 1XIVA 2O7NA 4NU5A 5JCPA 2J07A 2BGNA 2PS9A 4DCGA 3L7NA 3GR6A 4JSYA 4ZU3A 2I6GA 4JYCA 5LZ4A 2QOEA 4MUKA 4OM8A 3AILA 2HI0A 4RBNA 5ALYA 3ZDDA 4P58A 1ECFA 1WXXA 1WKCA 1WUJS 3GGOA 3WKDA 3O4HA 4Z4IA 2PUBA 4G0NA 2O5EA 1PFGA 1OYOA 1X80A 2H1IA 4R2IA 1U2SA 3S2EA 3E1GA 5D1HA 4XASA 4P3YA 3TSWA 2GTIA 1V7CA 2AK3A 1V7PC 2FSHA 1RLIA 4PG4A 5GAJA 2YH2A 3SQMA 5CCBA 1ZK0A 3EVAA 4C5AA 1K8XB 1WQ1R 2J5BA 1CP2A 1GTJ1 1Y5LA 3PNMA 3PG5A 1ZGBA 4ZOLA 3ROGA 4ZI2A 3LOPA 1JHYA 3QE3A 4PGFA 2IVZA 2CZQA 3VAAA 5AK3A 4E14A 1YL6A 4UE6A 5KZMB 1DAOA 2GD0A 1IRIA 5IJZA 1M2HA 1EDBA 3F8WA 1X8JA 4IIXA 3S6JA 1D1SA 3W5HA 4I4TB 1RRGA 2PRIA 2P4QA 3PFHA 4GOND 3G5UA 2C9DA 1JA1A 1XNHA 1ZA2A 3OZUA 2GN8A 3PPWA 3ZU5A 1L7VC 3DF9A 3M6MD 1ZX1A 4MQFA 1NN3A 3JQ6A 2LZ0A 4FE4A 1WETA 3RUEA 1OOEA 2A88A 1DAHA 3DYBA 2PR2A 1ONSA 1QIMA 4DIFA 2R751 4B83A 3V4PB 2WPDD 2I4RA 2WMDA 2KMLA 3Q9LA 1T3LA 3W5CA 2MWMA 3OJ0A 2I0FA 2DBRA 4XQ9A 3MN1A 4PGGA 2J08A 3PWKA 2RHLA 3HGMA 1P0IA 3DS8A 1NM5C 1NSTA 1XKXA 1B6SA 3CLRD 4R8RA 3WRXC 1FJ2A 4CR6A 5AVRA 2IBTA 4NXMB 4MI9A 1GADO 4DSZA 1YQGA 1BWPA 4OHWA 1VB5A 3ND5A 4YJFB 4HRVA 5T4BA 3SHQA 4D74A 3ME5A 4QPZA 1E1RA 4ZRNA 3KFLA 3L8GA 4Q34A 1Y5NA 1QYXA 1VHDA 2JCBA 4LOAA 3O03A 4BKRA 3P9IA 3VOSA 2NSJA 4JCOA 2GPYA 4UPDA 3O38A 4TKUA 3QKRB 1AK2A 1XD9A 2DULA 4QAJA 2QMOA 3KQQA 3BMXA 4UPVA 3NHLA 4YN3A 3D54D 3IB6A 3N2KA 4H7PA 3LX8A 1PL6A 1T2FA 4JVMA 2JJ1D 2ZB7A 2HDWA 2FR0A 1NDUA 2V6BA 3NXKA 1Y8CA 2WWVD 4EUNA 5CB0A 2DEUA 3UW1A 3T7AA 3PQ7A 4FYIA 3WDKA 3BFVA 2YCLA 4D6XA 2ES4A 1Z34A 1JLLB 4BX3A 1C0EA 2G25A 2P2ZA 3VH3A 3BF8A 4KR0A 2WOOA 2SHKA 2WV9A 3ZBQA 5KWVA 3O3CA 3KVOA 4LJ6A 2R8YA 2PT7A 1H2ZA 3RS3A 2VOJA 4U0KA 2VNHA 4BEWA 2JF0A 4NLLA 5M7EA 3N0XA 3BSYA 4V2UA 3WLKX 3H83A 4X3PA 5KYUA 3R7SA 1F1BA 2L69A 2DHCA 3EHDA 5JRZA 4AMBA 2P1RA 1Q7EA 2PSSA 1P3Y1 4XFDA 4CKXA 3EN0A 1IJEA 2ATVA 1A5TA 1HTWA 3WYDA 5BN1A 4FC7A 2VQFB 4Z0TA 4MKZA 1WNFA 2IPXA 1T6ZA 3GXBA 3OFSA 3GGPA 1K63A 4JT2A 2AJ8A 4NMHA 4PQEA 4XIIA 4DG5A 2HLHA 1TOAA 1YR3A 1ZRSA 3V32A 3Q2IA 1DMRA 5F7XA 3LL4A 3I72A 2BIFA 4O1IA 3S99A 3EUFA 1SBQA 1ZH8A 5JFGA 1OB5A 1JKIA 4Y0VA 3HCCA 1SOAA 5JBQA 2O6LA 5JALA 4DR2B 1D4AA 2AMYA 1BQ4A 3ENQA 1F7UA 2GLXA 4JI5B 1KI9A 2ZB8A 1T2VA 5D3MA 1DOHA 1P91A 4PYOA 3QM1A 2ZBRA 3L7MA 4Y2HA 1W19A 3AM3A 4CCWA 3TJZA 4J3NA 3GY0A 3AL2A 1A9TA 2XTJA 2HJVA 3H2IA 4R1OA 3QQPA 4PG5A 4UCQA 2D2EA 3Q7QA 1G3RA 2B4RO 4MI3A 2WM3A 1RM4A 2FFQA 3WHLA 2PKCA 1ZJZA 4R1UA 4AS3A 4C03A 4N76A 3NM5A 4EEKA 5BWLA 5ENZA 3HN7A 5IC6A 2QMQA 3FF1A 4F3TA 2ZULA 1ODSA 2C2GA 2IOFA 1GEEA 4NONA 1KMQA 4D2IA 3T3NA 3VU1A 1EFKA 1BMDA 1FBNA 3V1YA 2WIDA 4DREA 2X42A 3W7AA 1CR1A 4C08A 5JXIA 1JR3D 1IH8A 4TROA 3T61A 1HH4A 2I54A 5F3WB 4M99A 2X0NA 3QUQA 5EUMA 1O4WA 1DCKA 4YMLA 5JLJA 1O95A 4YP6A 2ILVA 4RGBA 5GADl 3DZKA 3Q85A 1E4EB 2PH7A 4ETMA 1ZR2A 2GAOA 1AU9A 4JP5A 2PMDA 2VDOB 4WASA 2POCA 4OATA 1UDRA 3IKJA 3Q7TA 2FWRA 3EXEA 4HDOB 4ZKDA 4AKTA 4F5ZA 2FZ4A 2Q4OA 4DDUA 1QHFA 1J00A 3C45A 3MTGA 2ZI6A 3HYCA 3M70A 2POQX 1QBKC 1YMUA 3LOUA 3QKWA 4KDCA 4MYDA 3SS9X 5F9MA 3FNBA 4K2HA 2ZIEA 5JSYA 4FYPA 2CNWA 4C3OB 1WCYA 2XEXA 3IURA 2EDCA 4XWOA 2UYGA 4IGEA 4YDSA 1Y8RB 4UDOA 2GCOA 3KTFA 1I7SB 3NAZA 2WAYA 1JS1X 1Y1PA 5K4AA 4AJ4A 4WBXC 2RD2A 1J1UA 1H0RA 1WS6A 2FR8C 5CCDA 4IJUA 1IM5A 4F96A 4TS3A 3K4QA 3VUEA 3O74A 2NZWA 5FEMA 3QY9A 1GAWA 3N2LA 1ZI9A 1A9PA 3QMPA 4XWYA 4CLXA 1WMFA 3WSWA 1CY1A 1DBWA 3T1TA 5AUNB 1FDOA 3A9SA 3DMPA 2YHUA 1ZD1A 4WEQA 5BV7A 1G1MA 4YQZA 3RRNA 1WP9A 1RHUA 4NYMR 4UCXA 4YDRA 5IXSA 4KBYA 4LTDA 4NFHA 2GBCA 4I6GA 2FW0A 3NDJA 5JD4A 2F00A 2ZIFA 2WB2A 2YFYA 3ASZA 3SMVA 4Q93A 3T4XA 4JQYA 4E51A 2QVCA 4O4HB 1RABA 1L0BA 1N3YA 5I7EA 4R6WA 3E35A 1ZAYA 5LD2C 1XDGA 4LNUB 3DV9A 3U61B 1TM1E 1XVIA 1E9AA 1IB0A 3KK0A 4IVQA 2Y1EA 4YQFA 1DUIA 2VSFA 3I30X 4Y9SA 1P1JA 3HSSA 1IOVA 1W1IA 3EIUA 4G4SO 4UVEA 5CM8B 4YAUA 1H2BA 4CV3A 5TPWB 1WHSB 5LM3A 2BFWA 3LI2A 5K3BA 3DL0A 1E6EA 3BYZA 2D13A 2B4AA 5JYDA 3DUWA 1XHEA 2AG8A 1HYGA 3T5GA 3G2HA 3UJ3X 3WY9A 2J3MA 1O0BA 3VTFA 1T5SA 5DOVA 1BSVA 4JJFA 2GK6A 3HKEA 5DHQA 4ZPJA 4QC2A 2FMXA 1CV2A 2Q1TA 3G2LA 1FRQA 2WY2D 5FAXA 4KPFC 4CMJA 4IINA 4R9UC 2O2HA 3G1WA 4QBFA 2C4KA 1J2JA 5GZ3A 5IBCA 3KOMA 3SIPA 1CJKC 1GQQA 2BKAA 5A1JA 4WBSA 2QA5A 4QUAA 1KYWA 4GRIA 3T7CA 1SZPA 3GLUA 1W49A 3CU5A 3IBCA 4RACA 3WGMA 4FR0A 4PRZA 4EA7A 4RYDA 1Y1KE 4EX6A 1YVPA 3KIPA 1WB9A 3IUEA 3WLIA 1UK9A 2B36A 2WF5A 4Z4CA 1JALA 2ZBPA 4HDSB 3CVUA 3LAWA 2VAXA 4C0KA 3SLKA 1GLGA 2GNPA 1ZWKA 2XMRA 1WCWA 3Q3JB 4BJ1A 3EUEA 4HN9A 5AIAA 5TPZA 5IVKA 2XHEA 5AW2A 3C41J 4PG7A 2P9JA 2VCYA 2EDAA 3HB9A 3KJZA 4J0IA 3UFBA 1C7IA 2FRXA 4JN6B 1CSEE 4Q66C 2FEMA 2IKQA 2QP9X 2VJBA 4LBZA 4MZXA 4U7TB 5E1MA 4BXOB 4LMRA 1YVRA 5J2TA 1MVLA 1Q77A 1ENPA 1OASA 4PPFA 1I30A 1DXHA 4OHXA 3NB0A 5K3DA 4ZZ3A 1SBIA 4GQAA 4IXNA 5HQ3A 1FQJA 1UP7A 2ATEA 3FM9A 4BFLA 2EEPA 2QD2A 3WK5A 4RVHA 2VZ9A 4NBSA 4P82A 4BY9E 2VJKA 3GLGE 1E9VA 2HA5A 4LWOA 3EF1A 4XI9A 2V4MA 3VYRB 2NYVA 4Z53A 3AINA 1EGHA 2PZLA 3ER9A 1MIOB 4EW3A 5G53C 4MW0A 4BE4A 3KV3O 4NCHA 4FGUA 4AZ3A 2P91A 1Z5GA 3LC1O 4HN4B 1X38A 4O2AF 3PFCA 4A5OA 3KE9A 3BJIC 4S0XA 2XWBF 3CNLA 1JX6A 1AS0A 1GFIA 2Q41A 1ADGA 1T0HB 2I7VA 2IZ0A 1ZNYA 2QIPA 3CB2A 3K6KA 1PJLA 3C3MA 3ZZ1A 4J2TA 1E9SA 1YIAA 1U9CA 1A4RA 1QPZA 1C9EA 4JL5A 4BVGA 2GXUA 4AS2A 1G1AA 1GNSA 1VE5A 2E4ZA 5I7VA 5A6SB 3D0RA 5HP4A 2QTAA 4DQVA 3CIOA 1GGNA 1SUPA 3ZEAA 1JHRA 3N8NA 5B1DA 5JY1A 2B30A 4LYYA 1V5IA 4P92A 5CD9A 3JYHA 1R0CA 4Y6RA 2C7QA 1S8FA 3D02A 4B31A 3DYVA 1IBKB 3HDVA 1D6JA 1SOVA 3HJCA 1GSOA 2X5JO 3SJZA 5C7IO 1DBVO 1P4AA 2Y4OA 1P2SA 4XDZA 4L5BA 3KKNA 2ZU0C 3P9PA 3R3XA 1TK9A 4RTPA 2JHGA 3E7WA 3H8JA 4M1QA 4CJXA 1GG8A 1SN7A 1XLTC 2O0KA 4BVFA 1A9XB 1ITZA 3NHFA 2IH2A 3R1IA 4YWHA 4CM7A 1MEEA 3GAZA 1E32A 5UKDA 4LFCB 2CYCA 1NM5A 3NG1A 3OT4A 5FBHA 3WRXA 4QO8A 3AU8A 2UU9B 1IUPA 1YR7A 1P3JA 2A5JA 2FMKA 2C07A 3H7IA 3I1JA 1COWA 2Z1MA 3FMGA 3JQ9C 3LO5A 1GPWB 2IXEA 3O8DA 2GF9A 3IDOA 5E6RB 4BCCA 4F60A 4WBNA 4LHWA 3AR3A 3BSWA 5EHZA 1OGIA 4Z0PA 1ZFNA 5KNDA 4G0XA 2WNIA 2HZBA 2O8VA 4PLTA 2Q62A 3CTMA 4REOA 4AJPA 1H6AA 3F3SA 1DO8A 3V7WA 1XNQB 3DOCA 4A8HA 1OT5A 1RADA 1YNOA 3JQGB 3KB1A 3N05A 4DR7B 4F2HA 1UXGA 4R98A 1ZYUA 4JUDX 5KOHB 4I9FA 4TL6A 3FX2A 4GYKA 3ZTTA 1L5FA 3MAGA 2M6RA 4LRYA 2HWXA 4IIHA 3FB4A 1CUBA 3RVRA 2O3QA 2Z8YM 2VRCD 2YJ4A 3AQ4A 4RZUA 3V7FA 5IXYA 2KS6A 3AMVA 1E2NA 4B3FX 3M6XA 1HYHA 1JGTA 2IY7A 3C15C 2NOAA 5EE0A 2PUJA 3NASA 1WUTA 1I1OA 4KZKA 4LJ9A 2ONYA 4G89A 5ABPA 1CRQA 1Z18A 1O4VA 1NOIA 1T2NA 4UNRA 4II7A 2ZRMA 2J3EA 4IR7A 4KMMA 3GDWA 1KEUA 3L18A 2GS9A 4E94A 2VJMA 2JLZA 3LLUA 1SUIA 3KKQA 1EX9A 5IBQA 3RUIA 1SRQA 5T5QA 1KQFA 1T4BA 2Y0DA 3BBLA 2RIPA 3T94A 4UOQA 4FXPA 1P4RA 3SX4A 5I5GA 3KCQA 2PQMA 1KFKB 3Q41A 1TJ4A 3EMBA 4LAFA 1N2GA 1YJ8A 3WYAA 5KREA 4RTJA 5EJ4A 4HEJA 3URMA 2B25A 1E3SA 5BNZA 5HE9A 1Q0QA 5AMXA 4KITB 4RNCA 2GEFA 4HADA 4RVCA 2JFYA 3HSYA 4IICA 1VSQA 2GO1A 1JIKA 2H57A 4QYIB 4CFYA 1EX6A 4TSFA 3S2ZA 2BKEA 3OZEA 5LZ5A 1VYHA 3OCZA 5FWNA 1V41E 2VT7A 4A10A 3T1HB 2Z6AA 1D2MA 3ASUA 3E84A 4EKNB 3R7AA 3CT6A 2BGIA 2P68A 2BFCA 1MQAA 2JIOA 3A4LA 3QKSA 4FGWA 4U3JB 3SS8A 1XYVA 2W6NA 2HCRA 4NPCA 2RGNC 3IRUA 3TEFA 2AZTA 2RCYA 1AUVA 2QRPA 3P1JA 3WLOA 3X1YA 4E5PA 1JT9A 2YJ6A 1FX1A 2QTBA 5JDCC 2CMGA 3VAZA 3P2MA 3QX9A 1NQVA 4GWKA 3OF2A 5DW3A 4QX6A 3U7RA 5JSQA 4JI4B 4ZOBA 4QUIA 3IUPA 3VTAA 1Q20A 1PT9A 3TKAA 3NAQA 5K6AC 3T9FA 3GA0A 3A27A 4K9PA 1ZQ9A 3AIKA 2WDPA 3NUQA 3JALB 3IDZA 4J76A 3RT1A 1LBIA 1XJCA 1K7EB 2OORC 3R6TA 3OQ6A 4H7KA 4OHBA 3OU7A 2B5WA 2YUTA 1L5KA 1HR0B 2I5PO 3RBZA 2RH9B 5T41A 4IIEA 2VAPA 5D7BA 2XRFA 1RQPA 2BHRA 2X8WA 5ALTA 1EH5A 3K9QO 4X5OA 1P2FA 1EX1A 3LUAA 1NQUA 1XE3A 3CH4B 5TGTA 2VK4A 4QGBA 1E99A 1WDKA 2PJUA 1AG9A 3E9YA 1ORDA 4FIZA 3NWEA 1A8IA 2PD6A 5ITZA 2ZK7A 3CJTA 1HDOA 4WLFA 2CXSA 4E32A 1MRZA 3SZOA 1U7PA 4NBNA 4OU4A 1WW8A 1T3GA 3Q1LA 5JPIA 1AVTA 1NOJA 4EGCB 1AMNA 2BONA 3E9QA 4RTOA 3OQVA 2VA9A 4LDQA 3A6FA 1CQJB 3FNIA 5JVDF 3ICQB 3ESXA 3R7WB 2FR8A 2C29D 4HUQA 3CVYA 2QVLA 1H2YA 2WJ6A 1XK7A 5SY9A 3OEED 1Z4MA 3QA3E 3MWKA 2ZYUX 4X92A 1E7RA 1G17A 1W46A 3NKVA 1U8YA 3DE7X 3Q87B 4Y2XA 2NUPB 3I45A 1U80A 3ZHYA 3ZY3A 4YRSA 2IFTA 4GXTA 1PR3A 5BRJA 1I1HA 2RARA 2FG6C 1TU4A 4GZ3A 3Q1KA 2M6KA 3ZK8A 1LDGA 2Z3VA 4Z1MD 2NU6A 5FPTA 2Z95A 3IE2A 3N6RA 4ITVA 4BJHB 4ETIA 1NQAO 3QUTA 4URHA 1KJIA 2IYSA 1PJQA 4WN3A 3TDNA 3SNHA 3LVQE 2VNIA 2V8OA 3UCFA 4ALIA 2ZUWA 1C81A 1ELOA 2AG6A 1L8QA 2V7EA 4M76B 1LZKA 1PZHA 4M9CA 1C7QA 2Z43A 5ALPA 5EERA 3T9EA 1M2WA 1Z26A 2FKNA 2Y1CA 1YXMA 5JQGA 2Q9UA 4K9MA 4KXXA 3RIHA 4FGZA 5BQOA 2F8LA 3PV0A 4KN5A 5LNK6 1KZ6A 4C2AA 2YV5A 3D2AA 4EWLA 1DS6A 2R84A 1RI5A 2R11A 4I1RA 3SXUB 3VC2A 1KGSA 1OLUB 3OJLA 4TKLA 3D8RA 1VLZA 5FPYA 3RS7A 4X95A 4JI3B 1QH0A 1JHMA 4D7AA 2CN1A 3H0CA 2XNDD 1YKGA 4IUYA 3OI7A 4GU5A 4DCMA 1KY3A 2R1TA 2FEAA 5CDGA 4DCVA 2OC9A 2QYSA 1C9MA 1H85A 4J0FA 3V1LA 1VP9A 4CF6A 4X6XA 5LB2A 2NZUG 2ZRHA 5DASA 1RC1A 4CIVA 4GMGA 4INAA 2H11A 4TV8B 1V11B 4MB6A 3UXEA 1BJRE 3H11A 3KQLA 2V59A 1G6OA 3UJ7A 1U2TA 1D1PA 1J8VA 4V0RA 3DR5A 3S1AA 2WZQA 2CNOA 3T4UA 1AZSC 2ZUSA 3OE5A 4MX8A 4J4HA 4F91B 4LHYA 1IULA 1J1ZA 4M0DA 3KOXA 5FYQA 5HCNA 2H2AA 3J7AC 4RFSA 4WECA 3S0JA 1RQXA 1EA5A 2FVYA 4NQRA 3TE6A 1VXRA 2H63A 2AFHA 3OTOB 4OHYA 4ENRA 2W58A 1NAIA 1W8DA 1PWZA 4IPTA 4TYMA 4DWOA 2X86A 3D8TA 2AG0A 1Y6ZA 3CRZA 4JB8A 4DE5A 4YK7A 4DUYB 1OFGA 3HN6A 3GP8A 1LA2A 2JZCA 4MUMA 2C0CA 2IU3A 3RJMA 3JAKB 4Q7JB 3AVXA 2IVFA 4HQKA 1GZHB 4YXWA 3F4KA 4RE6A 4UW9A 3UHFA 5KC9A 3Q8MA 1TA4A 1LLQA 1T4CA 1LDMA 3W4JA 3A2KA 2V65A 3EVDA 2O59A 2O3TA 4RMJA 5IAAA 1ZVJA 5FOUA 1UP6A 3JSAA 1QMPA 1U3CA 5CU7A 5D00A 1YZYA 1W2WB 4LFAB 4OYLA 3EASA 1DAIA 1X7GA 1Z0UA 3Q3GE 3QV2A 4R2LA 4RVUA 1ZRMA 1DRKA 3JWIA 1TTTA 5FWYA 2UVPA 1QCZA 2V7XA 1T26A 2QRZA 4IRXA 3EZ9A 1F0NA 1NJGA 3A1UA 3HXPA 4WI1A 4C0SA 2W6QA 4FC6A 1H23A 2GAAA 1DKMA 3WB1A 3BXGA 5CGZA 4B80A 4FDTA 1MXFA 2WWRA 3IHKA 5ALNA 1SB8A 5D3KA 4YRBA 4DV2B 1UK7A 3VU3A 3C4QA 5WRFA 1IN8A 2JH8A 4RZXA 3UIEA 2C2YA 4XIYA 2YHAA 4HP8A 4N3CA 2PAFA 1NBMA 4TKVA 4REQB 2XWSA 3TOSA 4RTQA 4C4RA 2VDLB 1K6IA 1RAIA 1UWLA 1YBAA 3ZGVA 5BMVF 3ZDBA 2DFKB 3SICE 3LDHA 3QJGA 3DMYA 2HC9A 1ADBA 3UKJA 3ZJUA 3K73O 1FSSA 1E2GA 1L5HB 1NATA 1E6LA 2OL4A 4V39A 2FNAA 4ZAGA 2J9FB 4E7OA 5KKCA 3ZUPA 5FBKA 3WNZA 1XLTA 3ITKA 3PYXA 5KWSA 4J4TA 3NNDA 1QSGA 4A8TA 1U5BA 3DL7A 1HZZC 1L4GA 1QHIA 2EEZA 2Y1KA 4CE6A 3GMTA 3PT5A 3AONB 1AO3A 1FP7A 3A05A 5KNDH 1MJHA 4LX0A 1K97A 4JX8A 5F21A 1M1NB 3QFFA 2WUWE 2AI1A 2NO5A 3ILHA 4KN9S 1KFBB 1PNOA 2J46A 3P0EA 5BWNA 4R16A 3QF4A 1NKVA 2DWQA 1KKUA 3GDOA 4BQSA 4H2DA 3GYGA 2OKCA 1ZIPA 3U4AA 2WJGA 1KYXA 1NN0A 1E7QA 4JEUA 1P62B 4OL0A 4HZIA 5H81A 3O47A 4B8ZA 4W1RA 5DSZA 4AJEA 1G20A 2H7VA 5EYPA 3U3RA 5TC4A 3DHVA 3STUA 1Z4PX 3QXXA 1ESZA 1PO7A 3OMXA 3TI7A 5B3JC 1OAAA 1FB5A 1X7XB 1A82A 3K1JA 2V9CA 1Z08A 4BMCA 5A0TA 5BV8A 1Z7EA 1GAEO 3SR4A 3DTYA 3UMRA 1JFVA 1JNYA 5E7IA 4CT5A 3C7KA 4FMPA 5KAMA 3EZ7A 1JTEA 2DTXA 2HMVA 2WAOA 4GD3Q 4KO8A 5EIXA 5KYXB 2C9ZA 1QV6A 3DONA 1C5KA 3PC8C 2OYCA 4F12A 5I7FA 1PJCA 1JILA 2QLTA 4WKCA 3HMKA 3AHIA 1TUGA 4YO8A 3HB5X 3QHPA 4QYTA 1EZZA 4ARZB 1Y80A 2M1XA 2XWQA 4EYGA 4W9MC 5G3ZA 4PE5B 1KOGA 1ZL2A 4WCFC 4BV8A 6YASA 2TYSB 2JASA 4BQNA 2DM6A 3IQWA 3AIIA 2B2CA 4J0DA 5B58C 2Q8QA 4ZAXA 3VYSB 2BCGY 2Y0PA 3CLHA 3F1LA 1HUQA 2Y1FA 3PGKA 1YO6A 5DFAA 3RD5A 4JJGA 1M2VA 2R7MA 2Y99A 4PAWA 2CD9A 1NONA 4JVOA 3GI1A 4PTLA 2H1LA 4X71A 5AHKA 1DQSA 1WA5A 5JS8A 1CK4A 3HZHA 3NYWA 4FUQA 4BFYA 1AV6A 1XXHE 1LBEA 3ABSB 3N7TA 4WLEA 1WCXA 1CKEA 2NYAA 2ZJ2A 3B8HA 4QXOA 4TQUS 1G9XA 1R0KA 4NBLA 4AUMA 1VJTA 1Z3IX 2C03A 1RWQA 3ZV5A 4ZHSA 1KZ1A 3UVEA 3D8BA 3O8LA 3PNSA 2OC4A 1N33B 4QJIA 3NIGB 1QIIA 4ZCTA 3EVNA 3PQCA 2RMKA 2CVZA 1DG9A 1GPDG 1ZUWA 5AQEA 1B1CA 4ETNA 1AB5A 2FMFA 3FOBA 3OIDA 1UZMA 3G88A 1ZOIA 2Y71A 3IJRA 3NH9A 5CNMA 4EW6A 1BKYA 4EY8A 2B1QA 2C5HA 2Y67A 3EAQA 4I9HA 1XX6A 2VJDA 1T4GA 3GZTB 4MQ6A 4R1TA 5EC8A 5LXTF 4P33A 2IDZA 5JZSA 2ZKIA 4WN9A 3NHPA 3PI7A 4KUHA 3ZR4B 1G42A 1H2WA 4PG6A 1PQYA 5JDCA 1U9JA 3DUFB 2GETA 1SQGA 3USES 1XZPA 2IUEA 4LGYA 1PG0A 4MLCA 2IIBA 1SBTA 3CYFA 3INYA 4LHVA 1IY0A 3CRMA 4U9HS 4BEJA 5K6AA 4NMXB 3THXB 1C1DB 3B20A 5B55A 1F12A 2WOJA 1DCMA 1D5WA 4B6OA 4JUIA 5EVCA 1O8BA 2QTZA 2XQFA 2ZJ8A 3AY7A 4N65A 2OORA 1E0KA 1OSNA 4PSKA 1ZH4A 5FPSA 2WSSA 3FMIA 3E53A 3CGGA 2H5JA 1I2MA 1YOBA 1YRLA 5LDGA 1W4LA 4GKJB 2ZWIA 4OGFA 3NTVA 2NXWA 1DZ3A 3D6JA 4P3XA 5BQPA 3TKYA 1XKTA 3AEKA 3L40A 1MHTA 2XBUA 5FXMA 4ZI3A 2IODA 5DNEA 5F5LA 4PWYA 2VDKB 3MCTA 2OOSA 4QUGA 2UZ1B 3O5AA 4RA9A 4MDHA 3JZAA 1OXVA 3RVJA 1LFDB 3V42A 2QLLA 2EVWX 5JAZA 3GRPA 3C4VA 2B4YA 1I4TD 4J1NA 1JDTA 3GP5A 5FR1A 3DLBA 3AG6A 4ENVA 1YQXA 1G59A 2ID9A 2GMWA 4KNYA 2QZ4A 5JOQA 1G4HA 4G5SA 3B6KA 2CCGA 3TGLA 1W87A 3DO6A 4C22A 3SFTA 4BIIA 4C7OA 1QM5A 3C1AA 1O94D 4OXIA 5AKLA 2HU8A 4RHYA 1JP7A 3PUIA 4IFEA 3OT1B 2BGKA 1E4YA 1X6VA 2GRUA 5K2OA 2QL9A 1XV5A 1A9ZA 1P9LA 2MYPA 3I3SR 5DWQA 1VE1A 4RH1A 4R83A 2ZYVX 2BJVA 1MEOA 2AFIA 2H8GA 1DFIA 1W9MA 1YC2A 3K9LA 4Q12A 4BRWA 5I4KA 4LZZA 1INLA 3UV3A 1JXAA 2VVTA 1JT2A 3G49A 4P53A 1SEPA 3MTAA 3FMVA 1YKSA 5FAKA 4PINA 3FTQA 1QANA 5ALXA 3VR1A 1U9ZA 3C1UA 3HJBA 2AC4A 4HRYA 3A58B 3H6KA 2RHWA 5DMXA 2IEBA 3U4QB 4RTLA 4KNVA 1JMKC 1N5JA 1SBNE 1WMDA 1XJWA 2P8JA 2X2EA 4G5XA 3R7DA 3F6BX 4BPRA 5A9SB 5D86A 3WP0A 4IIJF 1I6LA 3EFOA 5AQ1A 4EUEA 4RCYA 3OOYA 3UJAA 4DKJA 4EMBA 1YA4A 4XYMA 4XGQA 2VOEA 1F7VA 3T5AA 2G5CA 4BO2A 3EGXB 1C0LA 3ILYA 3NJRA 2ONKA 3EQ9A 3W6PA 5B6IA 1DTWA 5HRCA 4CIDA 2I7XA 3IEXA 1E5LA 1C8BA 1XEWY 5GJBA 3SQLA 1U8FO 2WA1A 1NC3A 1U7ZA 1A97A 3G0CA 1NRWA 2IYOA 4CQLB 3FWZA 1N78A 4PIVA 4KWCA 1L5SA 4RFVA 2B9VA 3TZHA 5KTRA 2WAMA 3OQOA 1MDFA 3I62A 2H2HA 2J3JA 4ZDKA 1VKNA 4DA6A 1KGDA 3ANMA 3A4NA 4J49A 4X1KB 3TK1A 3SHVA 3A06A 4FFVA 4W9NC 5AJHA 2ZRPA 5CD1A 3FPBA 3WB2A 2FPGB 1EDEA 2R47A 4NAVA 1I2DA 3IPLA 1AGYA 4LBWA 3GOQA 4DJ5X 1NLMA 4CQNA 2P9BA 4ME6A 4L4ZA 2JGIA 5KNLA 2RJOA 2P27A 2YV4A 5B1HA 1PQPA 3D5EA 4EHBA 1JEOA 1KJWA 1VIAA 2OAQ1 1BHQ1 3SQOA 2DBYA 1PV4A 2HZ7A 5LZ2A 2FPRA 4UUBA 3RS9A 2QQFA 5FI1B 4BFXA 3AK4A 3OM0A 4KFRA 3RABA 5A6VA 2Y6UA 5LJIA 2GGSA 2A1UB 1J90A 3ETJA 3KYCB 3SC2A 3MXTA 3L4SO 4PHFA 1ZK1A 4TQAA 3ZQKA 1TVKA 4PIMA 5JWRA 2RBEA 2XSZA 3VZCA 4BLRA 2EWMA 3EJ6A 2QSJA 5DKFA 2Q5QA 3BQ9A 1E7WA 3H0EA 2BHTA 1SG6A 1JHXA 2WU0A 2XQIA 3UM9A 5DVZA 4MYRA 3CSDA 1E20A 5L95A 3TZCA 5CDYA 4MS1B 4BNJA 4L8FA 3FOFC 3KL2A 1VE3A 3ZCQA 9LDTA 3ZDRA 1WV1A 4XYEA 1LVHA 4L50A 3ZCRA 1G5PA 5JXGA 3CR8A 4D41A 4LSGA 2F8TA 4RDXA 1CETA 2GWHA 5EZ5A 4ZYWA 4IKPA 1BE1A 4MRNA 1AB6A 3IBFA 4EG1A 1SR8A 1DINA 4US0R 3SKYA 5IYZB 4KMOA 3ELWA 1R4ZA 3W8DA 2YVUA 3RBVA 4S24A 2QU7A 1R64A 5ALWA 4KIGA 1EUDA 4RF5A 1K5HA 5AHXA 1Q1EA 1FVOA 2I99A 3MB8A 3TX6A 4RIFA 3UJ6A 4BLQA 2QT9A 3K6SB 1N32B 5B12A 1VGVA 2JFZA 2R7NA 5TQ2A 3WX0A 3HM9A 1XFDA 3OWHA 3LQ1A 1NXOA 3CLSD 4HH1A 3B12A 1L7DA 1I5EA 1Z28A 1EWKA 3CMMA 1Q3KA 4UEOA 5JJCA 2GWRA 4OYHA 5DBFA 4BYMA 4X93A 1HZZA 2H4FA 1OFIA 2ODPA 2HLNA 3QXHA 4NX2A 3H6HA 5BVHB 3PHIA 3IEMA 2OKGA 2OY0A 2W8BA 1T3ZA 1UJCA 3D8UA 4DIUA 3FTDA 4GDFA 4N3AA 4UE3S 3OQBA 1Y89A 3O9VA 3PHBE 3PD7A 2ZRDA 2GO7A 4ZHQB 1SH7A 3E0QA 1NRXA 2GH1A 2DSNA 4UAUA 5KX5F 1TJYA 2ESRA 3MWFA 3BCHA 2QL6A 1Z6AA 4JQZA 3ZGNA 1V3QE 3GEHA 4IRUB 1KETA 1H93A 4IJMA 3V7NA 1B3RA 2ZYWX 3FOWA 4EY6A 5AW3A 1A1VA 3DH0A 3UT0A 4AO8A 2UZIR 3GLIE 5B3JA 1BDJA 2QYHA 3GGJA 4Q3NA 5IFKA 3OX3A 3OOEA 2X2FA 2XZPA 4RVSA 1QF6A 3EEOA 2HNBA 4R2KA 4TKZA 3HCRA 3L1KA 4GLLA 4X45A 1EG2A 1D07A 2ECOA 2EBFX 2JS7A 2M6SA 3CX8A 5C5IA 5HG0A 2IS4A 2QUBA 1ZRHA 4XWWA 3PNOA 5T3YA 2QTVA 1B6GA 2JW5A 4JB0A 5GGYA 3UKOA 4CIBA 4PX5A 1G7TA 3PC8A 4IIUA 2ZAOA 2Q7DA 1Q3TA 4XEUA 3IIIA 3AO0B 4KUGA 3Q8LA 5EFOA 3ENKA 2WJVA 4QARA 2BEWA 5B53A 3BJEA 4XYGA 5DM4A 2OENG 1SK9A 4WCFA 3E9NA 3TGPA 2Q07A 4GI3A 4M1WA 3VFDA 3H9QA 3KHKA 1X1SA 2VRWA 2VZLA 3F78A 1YNSA 2M2IA 5KJ1A 1QQAA 1X9HA 1H6CA 3VO8A 3WWPA 3HYLA 3I58A 4UM9D 2CWWA 3E18A 1L4HA 2Q3JA 2WJWA 4OJNA 3SHFA 2IGBA 3QVLA 4ZI7B 4MA0A 3BC1A 1QYVA 4NRDA 2I4MA 3GX1A 3E9MA 3KL4A 4PONA 1H2EA 2RC6A 3JWHA 3PQFA 4X7BA 3AY3A 2YZ2A 4MIYA 2D1SA 2FEXA 1EFUA 2W0SA 3UUWA 4RIHA 1AHPA 1DFHA 4RW0A 3PDWA 5BXYA 3QNWA 2P7HA 4GX5A 1DOAA 3ICCA 5A5GA 1KR2A 2H5IA 3KB8A 3KS9A 3EZLA 3Q9SA 3RJZA 4V02A 1ZK3A 2XGMA 2A0YA 3I23A 3AHHA 3L84A 3GCWA 4QATA 1WMSA 1ND6A 4F1WA 4D9KA 3N87A 1NW8A 1KYYA 1PCXA 2FN7A 1LLUA 1BX3A 2WTAA 4TWIA 2BELA 5C1OA 1BU8A 3LBNA 4M60A 2WEKA 2ID7A 3BRCA 4NJEA 1E5QA 5EIBC 1ZLYA 4AN1A 4C01A 4ER6A 3BXEA 4KR2A 1VA5A 2AD5A 4Z3KA 5JNLA 3BGIA 5JIBA 3MEQA 1HL3A 3F90A 3FHCB 3QFRA 5ELLA 3PEFA 3EVTA 3NTLA 4MVJP 4BQPA 2XRYA 4QA9A 3ZIAA 2AW3A 4OSPA 2JLQA 5DT2A 4L6CA 4WCDA 4QGHA 3SX2A 5JXWA 2WYVA 2DQ4A 4NV3A 2OWEA 4UC0A 2YIMA 4CBVA 3QVKA 1AQLA 1RQGA 1MENA 1OWOA 4QSMA 5G0VA 4A3SA 2HNAA 2ODQA 1U0BB 3W2TA 4YJHB 5TPZD 3ZVNA 5C5CA 4EB6A 1JSZA 3N75A 2C1XA 2FZCA 3CA8A 1CR6A 5REQA 5TX7A 4EL0A 1PZMA 5JPDA 2VHTA 4YRFA 2GBPA 1DIAA 3CNBA 4WZBE 1YDHA 2O07A 2BP7A 4G23A 4OH7A 4B3IA 4EI2A 1OU4A 2CKDA 2R1UA 1JQKA 4EO9A 1OLXB 1UM8A 2RB5A 1XVLA 4ZVQA 2ZITA 3BRWD 4H4EA 2BW0A 1CLEA 1RYHA 2FY8A 2ZSDA 5D5HA 4IFIA 1C8LA 1UFQA 4FR2A 5K99A 1EPUA 4PBTA 3LM8A 5TGDA 5K8CA 1QDLB 3GAAA 3L0OA 3IQXA 5DNYB 1V5EA 1Y8QB 1YZTA 1FLAA 3TPCA 2K2WA 4BMOB 3D4NA 3SIWA 1QH1A 4YLYA 2GN4A 4JOQA 3FYTA 4KG7A 1CY6A 4NZNA 5HQTA 1XMOB 1WW3A 4DIMA 2W6CX 1XDZA 2HIMA 3ABQB 4W5RA 1A95A 3RK0A 4FMBB 4TKMA 3QLEA 2GZ3A 1VE6A 3HYSA 4FEAA 2OXTA 3RSGA 4BTEA 3T7KA 4X61A 1CQXA 4QFBA 1RYFA 1U6IA 3NKFA 5COQA 1I5OA 1KO8A 2IP1A 2IU6A 1AKNA 2N1BA 3RIMA 3AVTA 1I9CA 4BVAA 2CMDA 2JBWA 4ZGGA 4GW3A 1SXJC 1Z5PA 5LOVB 2PL1A 4QPCA 3BCRA 3FHJA 4FHZA 4QEDA 3W5IA 2O8EB 5D7NA 1MB4A 4G5RA 2ZRNA 1UZLA 4WD3A 4ZYLA 3ZHUA 3LQ4A 1EVLA 1KI6B 3HCNA 4RJTA 2Z6QA 2X6RA 1XRMA 2WWWA 5HDBB 3LBAA 3RIXA 4OK5A 2E0IA 2XX3A 3UTCA 4LGMA 3V7YA 2VQEB 2MSDB 2WKPA 3HI6A 2JVJA 2RDMA 1IY1A 5K8VA 2D3TA 1CUWA 1JE0A 3I42A 3KNZA 4WK4B 4RAOA 4DC0A 1JB9A 1YS9A 2O3JA 1ISIA 3QPDA 2FPPA 3RC2A 4CEHB 3BERA 1PZFA 3B9RA 1UMBB 3MQ4A 4HFJA 1K7YA 1CHNA 3NIDB 1T8RA 3T4EA 3BIWA 3EY4A 1CFJA 4FILA 2VSXA 4NBWA 4QDUA 2BMEA 4KXMA 1DXQA 1MX9A 4JIGA 4OX9Y 1LSJA 1T36A 2XB9A 4U8GA 5KTNA 4DCJA 1G5IA 1IHUA 1OW3B 5M29A 5ARBA 3GNSA 4LF4B 4BWFB 5CCEA 2RSLA 1PJRA 4KVZA 3FH0A 1CZLA 2VUTA 3OQHA 3BMOA 3TB6A 3WL6A 2F6RA 4DJAA 2TS1A 1TC1A 1L4FA 2WV7A 4J1TC 5HJEA 1ZCFA 3KX2A 2IA5A 1AKWA 5DHSA 4MRMA 3BXXA 3GNTA 1N2HA 4W9NA 4Z8XA 4BL5A 1A2QA 4AECA 1Z0FA 2FN3A 5L3VA 1U0FA 4MA4A 2BTQB 3VI3B 1WOYA 3X2EA 1RCUA 3S27A 1DX4A 1BN7A 4CLOB 5KNCA 3IMCA 4DLSA 2G67A 3EXHA 3KJEA 2XUHA 4KXUA 4BGUA 2V7WA 2GJ9A 1OBCA 2R25B 2FPUA 4HOYA 4Q3EA 5C2JB 3ROXA 5B4UA 3KP1A 1YS7A 1CUCA 2CFIA 2R5WA 3IAXA 3W2HA 3PDIA 1D2HA 3LHIA 3NXSA 2JIZD 2WVHA 2Y77A 3EGCA 5CLLA 4BIMA 3II6X 1IEVA 2FW8A 2JHPA 1PJSA 3GT4A 2PWPA 2DSTA 7ABPA 3QTBA 4KMSA 3ZD7A 3O2JA 2VK1A 3GFFA 4S04A 1KEEB 4NS1A 2SKDA 4PWZA 2ZJZA 2V4ZA 1SC1A 1GZVA 4OQQA 5DDIP 4B48A 1KTIA 5IT4A 1T5OA 4Q9NA 3WL5A 4LYFA 2LVBA 2QXTA 4KCGA 1TKCA 1OVGA 1YZQA 1NF9A 2WHYA 4DIEA 2V0GA 4E2ZA 3CV3A 1WZUA 3SN6A 2PZMA 3DBLA 4FCTA 1GQ2A 4M83A 5EVJA 5FNVF 5CGQB 5HA5A 1RI1A 3W4KA 3P19A 1TFRA 1G8PA 4LG1A 1YAHA 3LTEA 3QLUA 4NOMA 1FNBA 1X8LA 3IDQA 1I1NA 4KI0A 1OJLA 3O8QB 3VYUB 2N75A 4QU8A 4YTEA 1SUDA 3P52A 2D62A 2Q5CA 5K8LA 4KFUA 5AVXA 1M6WA 4O1MA 5I7UA 1ZW6A 1GU1A 1I36A 4TSFD 4WLOA 3W9YA 1X8KA 5CJJA 5DP1A 4MQ5A 4PYRA 3NC1C 2FPKA 3R24A 1G5TA 2ETXA 3H18A 1I7NA 2FTKE 1T43A 4ZDJA 1R6AA 3MRVA 3KO8A 2XGSA 4IUBS 1WQ3A 4V0OA 1U31A 4XPZA 5TR9A 4FWTA 1KAOA 3PUWA 3WMRA 1VL2A 1FDSA 3C24A 3HCOA 3V3TA 1DVRA 3EPJA 5TGZA 3ORYA 3GCGA 3PDUA 3TUIC 2JZNA 1JG1A 3S2IA 4J0HA 5IH7A 1BXRA 4MVJG 4RDCA 1Y5RA 3H65A 1Y1SA 4TLBA 2VXCA 1E1YA 3P9SA 1VL8A 2I2FA 2VNJA 3BMQA 3IEIA 1FMCA 1VTKA 5E1OA 2IWRA 4CN9A 1IUNA 1GEGA 2D54A 2I76A 1V0JA 2Q6OA 3D4OA 1VECA 1RZUA 2DX7A 2FJUA 2QB5A 3I6ZA 3LFTA 3K0HA 4FE3A 1A2OA 2D2VA 4KTVE 4P35A 1GOTA 3VVBA 1SK8A 3LZ6A 4YCBA 3L1IA 4XUGB 1OI7A 3NWOA 3L0ZA 4ZDWA 4MHTA 1XCPA 3KR2A 5AVQA 1B6RA 5FBLB 5KEIA 2ODNA 3PUKA 4EG6A 2JIDA 1PFYA 1XCBA 4JUAA 1BX0A 4Q4JB 4UARA 1H0HA 3HV2A 4DUGA 1TGYA 2EU8A 3LT5A 5HM6A 4B85A 4HVCA 3KVNA 2I4TA 2OZLA 2ZJ5A 1HFKA 3REOA 1RAAA 5DM70 4OI0A 3HH8A 5HJ2A 2CZGA 4EUFA 4N0QA 1OC2A 4O33A 3RTDA 2P65A 4MVJE 2I1LA 2V3VA 3ETDA 1NNLA 5A05A 4AUNA 4N5NA 3S68A 4B7AA 3GZNB 2R8XA 4LBVA 5EIAA 4Q4HB 1GLNA 5BVGB 4MRVA 1ZGAA 4KIUA 2XB6A 4W7HA 3OQ1A 4EW1A 3KYBA 3LUHA 1ODIA 4LDNA 4C76A 4H77A 4IRMA 1FBTA 2VHWA 3P5BA 4WWHA 4GI5A 4HFMA 2JBAB 3CNQS 2PZEA 4Q7LA 1L1RA 2ZWOA 3VGPA 2ZAGA 4MGZR 4D3SA 4EIWA 5DYYA 3PC3A 1HTTA 4ZAZA 1XC7A 4HUJA 1MABB 3ZYZA 4X6LA 2ZUVA 5IVDA 2GF0A 4XM0A 3N07A 5LYYA 2GTPA 2H1WA 3RADC 3OJCA 2F1HA 3NQ41 2SBTA 1UXJA 5DCWA 3R9XB 3AG5A 3QFSA 3NT2A 3UAOA 5EEHA 4JMPA 3CX3A 5LQNA 2PBZA 1ZRNA 4MEAA 3OCXA 4TV9A 1M0SA 2EFDB 3S2YA 4CU5A 4XWKA 4HO1X 2IU4A 4QUBA 1XWIA 2DY1A 3ZWNA 2XKKA 1I51A 1JU3A 2OV3A 1JAXA 1EXVA 4Y0NA 2WWTA 3ZHSA 3BGVA 1JQBA 3WK8A 1TEHA 3VDXA 2C4WA 3CCBA 1PT5A 1C0IA 4MYCA 5DHUA 5DO9A 2C82A 2FW7A 1FA9A 4EG0A 3EXG2 1WSAA 2RGEA 1N6OA 3A04A 1I7DA 2IPMA 4R2JA 4Y6QA 3NBYC 2J5XA 5DN9A 4YV2A 3WNDA 3WTBA 5E2IA 4FSHA 2NPIA 3QA9A 3FXAA 2YV2A 3QUCA 2ZAIA 4XGKA 3VKHA 3TTTA 3H2GA 4ZYYA 3REQA 1NTOA 3U19A 3PQEA 3VDRA 2VF8A 3HPQA 3SY8A 1BA2A 3TO5A 4NV1A 5BOVA 2NAPA 4ND1A 1OREA 5FOXA 1RNLA 1CF2O 1W88B 5CA0B 1EVQA 5JHGB 2PV7A 1SCJA 1TUEA 4RYLA 4QDOA 1G55A 4HCJA 4BO1A 4MW5A 3JARB 2R5NA 1S7GA 1VDMA 3ETCA 3RIEA 1KHTA 4F86A 3BAZA 4ZU1X 4MRPA 3GJTA 5B6JA 2QN2A 1S9HA 1OFHA 2A9OA 5LIRA 3QU9A 4C0WA 5AOBA 5IN5A 2QL7A 1QO7A 1PEYA 4ZVRA 3TNLA 1XRRA 4ASUA 3EIHA 4M55A 2G76A 3EDYA 2I78A 3C5HA 1S01A 4HZUB 2ERXA 1YWGO 2QD3A 1R6XA 4IO1A 1LSUA 5G1NA 3MRTA 1XVVA 5I9NA 3JQPA 2GKOA 3IFSA 1FRZA 4L8GA 4L9AA 4XVQA 2R1VA 4H6VA 4E07A 2WKWA 2O8BB 1EYZA 5IT5A 4YXWD 4M46A 2QUJA 5B37A 2YY6A 2JH3A 3M6UA 4YCDA 3SZGA 3CKLA 3WGYA 3DG9A 1B74A 2IEZA 3H4VA 6REQB 2QZJA 2YY7A 1U0JA 4IZHA 3CWZA 2HJWA 3KT3A 3ZBPA 4KQMA 1YI0A 3V97A 1E79A 1Q84A 3DOFA 4HH0A 3RCBA 1EFVB 2QM0A 3HFJA 1GGMA 1L5WA 4G36A 1ZCZA 2CHUA 5E9AA 1F9AA 2Z98A 3PUVA 3IOEA 1XKLA 4MR8B 4X1YA 2JLBA 2QBYA 1JB1A 4MQMA 4ZO6A 1U8UA 3ZNPA 3L8DA 1XROA 1FFHA 1Z75A 1KVRA 4OD0A 4DJFC 3JYOA 3N5KA 1E3WB 3MCAA 1OXXK 1MUUA 3NOQA 3PNVA 4IM7A 4F4HA 4ZYTA 5JVDA 4KFCA 1FFYA 3JTEA 1A72A 3EULA 2MDTA 1NI4B 2MHCA 1E0AA 1F0KA 1WDTA 2NACA 2GKSA 4IMJB 3QOXA 3RYCA 1WDMA 2O14A 2ZB2A 4KU4A 4NG4A 5JS7A 4JXXA 2PD4A 5FUQA 3E2IA 3W79A 4F4FA 1AHNA 2Q9AA 3G0DA 3SM9A 2X9VA 4OK3A 3TW0A 1CQPA 1LFAA 4BAZA 4JIMA 2I66A 2IPLA 3FVVA 3I8XA 4S1PA 5AW7A 2J0QA 2EHDA 4HAXA 1DQPA 1K6EA 1NU6A 1F4LA 1J22A 1NG1A 1JHOA 1XN1A 3AUFA 3O84A 2P8SA 2HB6A 1ZD8A 1YD7A 1ES9A 4MLPA 1IIBA 1V4NA 2LR0A 2WQ6A 2DUWA 2F1RA 2VRBA 3DVSX 4BZQA 2I2WA 3BAFA 4I50F 5CIQA 4IFBA 4ZEOA 1W36C 3E2PA 3GBSA 4EG4A 1CUHA 4KQXA 5F78A 3M49A 1N5MA 3UZUA 1K2WA 3MS7A 2VTBB 2IOYA 1L5RA 2IS6A 3GIWA 1ZQ1A 3BA1A 1VLHA 2OXRA 3C39A 3QIAA 3V4FA 1WPRA 4J1TA 5CT4A 5KNCH 3VBEA 2VN8A 3FNHA 8OHMA 5EMJA 4WOJA 5JBNA 2AT1A 3DDNA 3F3YA 1LC0A 5JD6A 1VG1A 2VG8A 2FUCA 3VNUA 3ZY2A 1RAEA 1AS3A 1D2CA 2CVQA 1T1JA 1S8NA 1LVGA 2G4CA 2QIOA 1SHJA 2YZ7A 3KJXA 4AP6A 2NG1A 4JC5A 2V7QD 1NQWA 5BPHA 1E8MA 1TM5E 2WWGA 4CLRB 5CBPB 2NO4A 4RX1A 2ZS8A 2XLBA 3EBOA 2WINI 5GOTA 4KWHA 4UNQA 1TK2A 4MVYA 1I10A 3HC7A 4KE7A 3DQQA 2B8EA 5DNDA 4DMGA 3TFWA 4IHJA 3X1JA 3HNOA 1Q1GA 5AIBA 5KVQA 2KB0A 2W2QA 4I7EA 4G9GA 2WC1A 3I2FA 2H1SA 5GZ1A 1J0XO 2DMRA 3L8YA 3L7CA 3RUFA 1XPUA 4WKOA 4UEQA 5EHNA 3BWMA 5B3AA 5LQUA 2IBSA 4HUTA 5EMHA 1B8PA 2WLTA 2DPHA 3L04A 2YVLA 2PT6A 1Z4IA 4EVQA 4FMCF 1Z8FA 2W2OA 3NATA 5CTAA 3CLTC 4FLFA 2X14A 5AHOA 1Y5MA 3CH7A 3NVKI 4RHUA 1HLGA 2PQ6A 3B7PA 4P80A 1FSFA 2VDWB 4CG3A 4AURA 3HVRA 2WRZA 1J4AA 3M83A 3RR2A 1ISSA 2Y0CA 2ZWAA 3GFPA 3M1AA 4HDMB 4K0RA 2Q0XA 3Q8KA 4OUKX 5ITVA 2WIBA 1F06A 1FNNA 3SF8A 2H9IA 3K2QA 2BZSA 3GQBB 1OX5A 2JFPA 2XYGA 4P4UA 5A7FA 3G2QA 3QK7A 3TYXA 1YZFA 2XH8A 3WLQA 1N2CB 3THOA 2WHXA 1VPDA 4OM7A 4RVGA 5JNVA 3QXGA 2PG3A 4PZDA 1FUKA 4PAOA 5GV7A 3L7IA 3PL1A 1OIXA 4HDAA 1G19A 2QNBA 1B41A 1UJBA 4L4XA 3PENA 2IH5A 5ALZA 5KYKA 3DSRA 2J6HA 5D8DA 3ZH9B 3UWKA 1P81A 1H69A 1K4MA 4KW7A 1P0MA 1Z15A 1BKDR 1C7JA 1OTHA 2V96A 1R74A 3A3OA 3C48A 3AF6A 4CMGA 3IH5A 1BVUA 1K3UB 1OZAA 4WOKA 4FSDA 2V6IA 3AVWA 4BS9A 2V5AA 3GG2A 4CUZA 4YIKA 2WNSA 3NPAA 4IG9A 2XVZA 4AC9A 1Z5OA 1W52X 5KAPA 1YE8A 1KE2A 4A73A 5FORA 2JNWA 3IXLA 4XB6B 1PGQA 4Z2YA 3QOYA 1FFXA 1ZKDA 3DB1A 2FPLA 3N0RA 4DC1A 2DVMA 1B0ZA 4HGOA 2PE5A 1DUVG 1AUOA 1AQ6A 1XRQA 3UJPA 2DY0A 4MWBA 4EBFA 2IX9A 4U4AA 4RLFA 4XSGA 2NUAB 4GGPA 1MIHA 3D3EA 4HAUA 5PNTA 3SYKA 1R8XA 2DLDA 5BN5B 3WL8A 3GRZA 4HQOA 1YVUA 2XB2A 2F1JA 4YJDA 3AQIA 4ZMSA 3IO3A 4J07A 4GVXA 3ADCA 3TDMA 3FAZA 2O7QA 4O4IA 1K4YA 4PCVA 2RGRA 1J8DA 3GZJA 3M34A 2AHRA 3QRWA 2WBLC 5LB4A 2XE8A 3SJCA 3QZUA 4ZZIA 2PJZA 4TQ9A 1T9HA 2GCGA 3PGMA 2XA9A 4PXYA 2OQRA 2R6ZA 5J63A 3M6AA 2PNJA 3AW9A 4NEGA 2WM2A 4XPIB 1OX4A 4Q3KA 1DUSA 5F76A 3X1WA 4EG5A 5A2QA 3HXQA 1TQ2A 3M5CA 1QTIA 1WCIA 3WB0A 1AUPA 1ULTA 1I94B 5LZ7A 4YA6A 3HB4X 2EATA 1CZKA 1ZHOA 3AT1A 4GDMA 3AUJB 3DMNA 3AR6A 4PZZA 4YWJA 2J0UB 1EQUA 3ZE2B 1Y33E 2XXAB 4E5DA 1U4OA 3OJXA 5SYAA 3SIRA 4DT1B 5JZOA 3AIMA 4G4GA 4EY5A 3BEDA 2FPOA 1GTL1 3EW9A 4S12A 4Z5XA 3F9IA 2IHJA 1BYIA 4NE7A 4BN4A 1JDBB 3CZPA 4M38A 4B6SA 1N5RA 3D6AA 4ER3A 4QQNA 4FNOA 4F3YA 5DX0A 3WKBA 2ZOSA 3NVAA 5HFNA 3GD7A 1IPHA 3PJGA 2VT3A 4XCXA 3M0EA 3MLEA 3OPVA 4YJ2B 4P5DA 2KLHA 5DW0A 3AUKA 5ENVA 2UUAB 4N03A 2OHJA 1JQEA 1XF9A 3BGWA 3HLKA 1MBZA 1C0KA 1F2UB 3K0FB 5F9FA 4IV0A 2WYOA 3AF2A 4MWOA 1C4KA 4RV9A 2ONJA 1JYEA 2BWJA 1FFAA 2QK4A 1YSCA 1GTZA 3A4TA 4ZXFA 3VV2A 3JQAA 3JATB 3TPZA 4PLPA 2R6CA 4MEJA 2BSQA 4K6GA 4TXMA 3R3WA 2HIGA 5B2ZA 3VPCA 2VP4A 3OMLA 4PU0A 4TZ6A 2W4IA 2H16A 5SICE 3SK0A 2IGTA 5I6DA 4BN0A 3DMTC 4ARUA 1V16B 3ORQA 4JFAA 3HJFA 2ZM5A 1R00A 1NMQA 1ZZGA 1Q0LA 4S0ZA 2V98A 1IRXA 1N3IA 1GG2A 1PR5A 3ELUA 3KYDA 1MVNA 2ZYHA 5DHTA 5F73A 4MW6A 3GUYA 1KEKA 1E9DA 3HCEA 1W1UA 4GRAA 5JJLA 3OAAA 4WOPA 5CHEA 5IAOA 4BATA 3C5EA 1EK6A 1WULS 3VVCA 1TPYA 3C0KA 1DU4A 3H2ZA