1U0SY

Chemotaxis kinase chea p2 domain in complex with response regulator chey from the thermophile thermotoga maritima
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title In different organisms, the mode of interaction between two signaling proteins is not necessarily conserved
pubmed doi rcsb
source organism Thermotoga maritima
total genus 43
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u0sY00
1PEAA 3MIZA 1A04A 2R47A 2JVIA 3BRSA 2QSJA 5DCLA 3FDFA 2L18A 3NNDA 5CNIA 2WJAA 3KLOA 3HV2A 1EWKA 2CHEA 2MSLA 3MF4A 3QK7A 4N0PA 3JS5A 4ETMA 3FFWA 4G0MA 5JNTA 1ZY2A 3CTPA 3N0XA 3MM4A 3OO0A 4KQCA 5HM6A 1CYEA 5EWMB 4XFKA 5IBQA 4N76A 2OENG 3HO1A 4MS1A 4ZMSA 4MS4B 1DRJA 1DG9A 4G0YA 3CZCA 1NTRA 1XHFA 1JF8A 4G0QA 4RS3A 3KYJB 2QR3A 1VKRA 4MQFA 1JYFA 3OQMA 1QP7A 4NCAA 3JVIA 5EWMA 3H6GA 5IUNC 4MRMB 1KGSA 5TQJA 3QEMA 4KK4A 3C3WA 3OM1A 4TLLB 5IEJA 1M2EA 3RVNA 5IX8A 3OLXA 3UUGA 2GI4A 1M5UA 4IGAA 1JHZA 2JBAB 4MS4A 4YV7A 1EAYA 1FSPA 2E4ZA 4YRZA 1LJUA 3GBVA 3RVPA 1TVMA 1RNLA 1TJYA 3D8UA 4Z4FA 3TD9A 1D2AA 3HDGA 5IEBA 4MRMA 3A3KA 2RDMA 1L5ZA 1ZH4A 1IIBA 2L19A 1ABEA 3IP6A 4Z9AA 5KQPA 1P8AA 1GCGA 2FSPA 1H9CA 1XWWA 2QVGA 4KFCA 2HPHA 2PUDA 4EYOA 4Z9BA 4ZJPA 5GQSA 2FW0A 2MYTA 3MQ4A 4YR7A 1FFGA 2ZWMA 5CNJA 2HJ9A 4YWHA 3TB6A 5TPZD 1DZ3A 2CD7A 5D2CA 3IP5A 5BRAA 4RKRA 5IULC 3A10A 3CLKA 2NT4A 3Q15C 3OLWA 2PMCA 1DCKA 3URMA 2R25B 1U2QA 2RGYA 4MS3B 1A2OA 1ZAYA 1U0SY 1NATA 2L2QA 4G86A 4Z0NA 4TN5A 4N0QA 2A9PA 3MA0A 2M98A 5JNWA 5EWLB 4D6YA 1DBPA 4LX8A 3OMXA 2JCGA 3LKBA 4WUTA 1F51E 4RU1A 4LDAA 2QW1A 1URPA 1Y1LA 3QELB 3UKJA 4MS3A 2MYNA 4TMYA 1USGA 1Z16A 4W5OA 1E6KA 2P9HA 1PEYA 4H3HB 5B3JA 2MYPA 2WRZA 1MB0A 3N75A 1ZESA 3L49A 1MB3A 3FGZA 3O75A 3F73A 5TPZA 3OO1A 2OQRA 5EWLA 3ROTA 4Z4GA 4DQDA 3EAFA 3IDOA 1DC8A 4PE5B 2PUGA 1U8TA 4EVRA 3W9SA 2FMHA 3QELA 4HNQA 4EYKA 2PUBA 1ZGGA 4N41A 2ID7A 4ZPJA 8ABPA 1CHNA 4Q7EA 3C3MA 3OQNA 4MR9B 5EWJB 1BDHA 5KQMA 3CFYA 3M9XA 3JPYA 3RVJA 4KZKA 3LUJA 6ABPA 2NT3A 4N47A 2FEPA 5FBHA 4CBVA 4JA2A 1QP0A 4FB4A 5GOTA 3KHTA 1APBA 1YMUA 1YTUA 3OQOA 2LIVA 1SXGA 5IUKC 4ETNA 4ETIA 4MR9A 1JL3A 1QPZA 2FLKA 4Z4EA 4WWHA 5HKOA 4IMIB 2PUEA 4W5RA 2MYUA 3H1FA 1VPWA 1NXVA 2FN9A 2JB9A 2QZJA 2E4WA 3H1GA 3LTEA 1U04A 4XASA 4O5AA 3EODA 3EQ2A 3LUCA 2FQXA 2PUFA 2ID9A 4MS1B 3TO5A 1JDPA 3GL9A 1E2BA 1SXHA 3E3MA 4NV3A 2JK1A 3CRNA 3KJXA 3HUTA 3T8YA 1YMVA 3OLYA 4YO7A 1RPJA 3LOPA 3I5AA 4MQEA 4MQFB 5F64A 1YIOA 3Q9SA 1BVHA 4G97A 1UDRA 3FFTA 3F7NA 3H75A 3HK2A 3QEMB 1EHCA 3FFXA 2WWVD 4D74A 1F4VA 3C97A 5DGCA 1JDNA 4MLDA 1KRXA 3LUFA 1ZH2A 3RVMA 3CS3A 4Q6BA 3TMYA 5IC5A 1ZGZA 3IPAA 4EVQA 1RXIA 4RY8A 4PZ0A 1DBQA 1PNRA 1P2FA 1LK0A 3G85A 3KS9A 1ZVVA 1MIHA 1Z15A 1JLKA 2HQOA 2F8TA 2PUAA 3QLVA 4IF4A 4NCBA 1BDIA 1ZITA 2R4QA 4FE4A 4QYMA 7ABPA 4G0XA 2FMKA 3LMKA 5BRJA 3F6CA 3N6VA 4F12A 2TMYA 3LUHA 4W5TA 2M1ZA 3O2QB 1M5TA 1GUBA 1Z12A 2IOYA 2QV0A 4KMRA 4M88A 3RVOA 1Z13A 5KI6A 4ZYLA 2CWDA 3K4HA 3O2SB 2FMIA 3N0RA 4YP9A 3RVRA 1JFSA 1D1PA 3LUGA 1EWTA 1C4WA 2O20A 4S05A 3NHMA 2PLNA 2LP4Y 1USKA 3GA5A 3HCWA 4RK1A 4LDZA 3RVSA 2PAFA 3SM9A 5FBKA 2E4YA 4RZSA 1QNLA 3NBMA 4KVFA 3CG0A 2DRIA 3Q7SA 5TQ2A 2VYCA 3IPCA 4QICA 3QLVC 4JB2A 1NXSA 1JH9A 2KYRA 4EGSA 1YS7A 3DBIA 4RK6A 3OMWA 1MVOA 2GX6A 2N9UA 1PNTA 3H5LA 4OATA 3Q41A 1RZRD 3GWGA 1QO0D 3JY6A 4RY0A 1Z26A 1KMIY 3VNAA 3FMVA 4OLAA 4PEVA 5DKFA 4EUKA 4GNRA 3H5WA 4WXEA 1T34A 4ML3A 3ILYA 4LE1A 4YLEA 1QMPA 2FQYA 1W9HA 2IPAB 2PKXA 1JYEA 4Z4IA 2I6FA 1JBEA 2W42A 3HZHA 3SNKA 2RJOA 2NZUG 1MAVA 2PL1A 5ABPA 3CG4A 2RJNA 3HS3A 4EY3A 4KNYA 3H1EA 4F8JA 3OLZA 2HQBA 1GUDA 4YCSA 3Q7RA 4G0OA 3RQIA 3KYIB 1NXWA 5DLEA 1DJMA 3KTOA 1YK0A 2LPMA 4EVSA 4WT7A 3CZ5A 6CHYA 1NXPA 2B1JA 5T7BA 2FVYA 3N0WA 1RZRA 3DLHA 4B09A 1QO0A 2YHBA 3GYBA 3LKVA 3N53A 3KCNA 2WY2D 2FLWA 2P4UA 3RVKA 4XARA 4JP1A 3HSYA 2PE5A 5TPWB 3N8IA 1QQAA 2IYNA 2WB4A 3BRQA 3I45A 4JAVC 5BR1A 1K68A 2AYXA 3EGCA 4RV5A 1ZN2A 4RK7A 5CHYA 2J48A 4XXHA 5B3JC 4NQRA 4WZZA 3MMNA 5JNVA 5FWYB 3ILHA 5TPWA 1E6LA 3GV0A 3H5VA 2LBPA 3DGEC 1SRRA 1LJLA 2FXIA 2PJUA 3M9WA 3EULA 1EFAA 2GWRA 3IP9A 4RXTA 2E4XA 1DCMA 4DN6A 2FN8A 4MQEB 1TLFA 2FQWA 5HQJA 3IP7A 4D6XA 1EWVA 1C0EA 1JWLA 4KPYA 2F8SA 2IPMA 1DP4A 2VUIB 4MR7B 5FWYA 4W5QA 4Z99A 4E7PA 4HNSA 4G0ZA 5TQ0B 3QX8A 4MGEA 3GT7A 5JS1A 4MLCA 1PHRA 1QQBA 4QPJC 4RKQA 2JVKA 3LUKA 4QYWA 5JNSA 2IPNA 2MSKA 4H3KB 1PUXA 4RSMA 4HYEA 3HEBA 4MR7A 4EYGA 3HXMA 3RH0A 1FQWA 1J56A 2AYZA 1ZDMA 2FEWB 1NXXA 3O2JA 1B00A 3Q7TA 4JOQA 1USIA 4XAQA 2XDYA 4IILA 3I42A 1DRKA 4P98A 5TQ0A 5C5CA 2JVJA 3KG2A 4MAAA 2QXYA 4OTZA 4MR8A 1OXBB 2CHFA 5E3JA 4EYQA 4ZMRA 2GBPA 4Z4CA 2BGGA 2IDMA 4H60A 1BDJA 1FFSA 5PNTA 1ZHHA 3I09A 2IKSA 2FKAA 1E6MA 3A0UA 1JFVA 2VUHB 3TX6A 4F06A 3SY8A 3QEKA 2X7XA 3HVRA 4HNRA 5HSGA 5TQ2B 1YK1A 2HSGA 4UHKA 4N03A 5I4CA 1VRVA 1D5WA 1P6QA 3KKEA 3S99A 2QU7A 5KQGA 4LE0A 5FWXB 3T95A 4OBBA 1ABFA 2FEKA 5ED4A 3K9CA 4WXMA 2JRLA 5CNMA 4RDCA 4F11A 1I3CA 1NXOA 2R48A 2FMFA 3EDCA 3QLUA 2A9QA 1U2PA 2QVCA 5TE9A 1JFTA 1Z17A 2LUOA 1TMYA 1VLZA 3L6UA 3D02A 5FWXA 1SXIA 2E4VA 4RXUA 1WETA 4RK4A 4RY9A 2A9RA 1OXKB 1LBHA 4JB0A 4PYRA 4OG2A 5JS2A 4LRQA 1L5YA 4DADA 2WMYA 3UK0A 2JBAA 3O1JC 2MSWA 3SQNA 2GKGA 2Q5CA 5C5EA 4MYRA 2ZAYA 2IPLA 3T6KA 3DZDA 3SG0A 5T3YA 5IUJC 3M6MD 1S8NA 2B4AA 3NHZA 4LZLA 1Z25A 3P9YA 3CKMA 4KK3A 4OLBA 1JX6A 3F6PA 1Z2DA 1NY5A 3QLUC 4Y9TA 3A0RB 1BA2A 1ISSA 4L85A 3RVQA 3KLNA 3H5IA 4O1HA 4YS6A 3ROFA 1BAPA 4JASB 5KWSA 3CNBA 4XLTA 1GLGA 1YVUA 1AB6A 3KSMA 1RXEA 1ISRA 3QLTA 4O1IA 3HM9A 4GPAA 2VK2A 4YGXB 1Z18A 3VNBA 1K66A 5JNRA 3C3KA 2HQRA 4KREA 3O21A 3HJFA 4RK0A 3OLVA 3QX9A 3O1HB 1DBWA 2V0NA 4Z4HA 1D1QA 3LUAA 3JTEA 1CEYA 4P1ZA 4Q6WA 1QKKA 2H3HA 2H0AA 5BQ3A 2PL9A 5KQLA 3LFTA 1P6UA 3BILA 5CNKA 5JNUA 3NNSA 3GRCA 3HDVA 3MYYA 3RVLA 4E7OA 2NZVG 3CU5A 4TLMB 4FE7A 3H5OA 3O74A 3H5TA 4RWEA 4S04A 2WJWA 1KRWA 1GCAA 3NNNA 4LE2A 4G0PA 4RXMA 4KQ9A 1HEYA 1NXTA 4NICA 1FFWA 4PICA 1LBIA 1DCFA 1R8JA 2PUCA 3H6HA 4F3TA 4KV7A 1XHEA 3JPWA 1DC7A 3E61A 1QP4A 3C6QA 1AB5A 5DTEA 3EJWA 5KC8A 3GBPA 4KRFA 4IMJB 2E4UA 3EQZA 3T38A 4W5NA 3BREA 1A0OA 2YHAA 3OM0A 3B2NA 1TM2A 1W25A 2FTKE 3R0JA 4UHJA 4MPTA 4IRXA 3SAJA 1M2FA 3DGFC 3LUDA 3BBLA 3JVDA 4L4UA 2A9OA 1SD5A 5EWJA 1YS6A 2NUBA 1D4ZA 4MR8B 3O1IC 4RK5A 5KC9A 2L17A 3G1WA 3HUUA 3DLBA 3CHYA 9ABPA 1Z2EA
chains in the Genus database with same CATH superfamily
4XW2A 1IJKA 1II8A 3EIXA 4URHA 5KKAA 5AW5A 3FDFA 5CB8A 3VKHA 2OKCA 2VDUE 1P2DA 5EI5A 4EDFA 3HRHA 4C2BA 4EITA 2JGAA 2ZIGA 5I4IA 1M1YE 3L41A 3VHXA 2WYUA 1E1YA 3LCMA 2H1SA 3ZI0A 3OOJA 4KTTE 5C9ZA 3AUSA 2XLCA 3HO6A 4C01A 4X7PA 4LFBB 1CYEA 4NIMA 5JUWA 4N7BA 4N76A 2ZWPA 3KZKA 4D41A 4HAUA 4D25A 1R0LA 2ZETA 2IDZA 1L7VC 1JJVA 3E22A 5JZVA 1H69A 2IW1A 5DNAA 3GZJA 3QEOA 4O4HB 2NUTB 2WEKA 4Q03A 2HA5A 4C43A 4UMVA 4QDKA 2EP8A 2QR3A 3CMMA 2BMDA 2C96A 1E2FA 2XTNA 3P52A 3L6CA 4Q3CA 4JXXA 2C7PA 2OBXA 3C3WA 1BE6A 1PG2A 1YZUA 2WK1A 4M0KA 3BJMA 4KQ6A 4IQ4A 1E62A 4FFBB 4LY6A 4KYTA 3RVNA 3TN7A 3UUGA 5K7SA 3I8XA 3NBZC 1GEGA 2UYCA 3I64A 2NSYA 1RM5A 3G3EA 5HRUA 4X1YA 2NAPA 3PUKA 1P6XA 1TVMA 2D2EA 1DHTA 1PWYE 3KPVA 3GFOA 3AHCA 4HN4B 5AKXA 3MD0A 1GRQA 3LLMA 3LXMA 4YCNA 1NBIA 4PSUA 1WB6A 4M8NE 1TJ5A 1ZH4A 3H65A 1KH1A 1QYDA 3NORA 1NBOA 1SA0A 5D7NA 5JDCA 6LDHA 2ZBQA 2MCFA 4GM1A 4CKBB 4J3FA 4DLZA 1F6WA 4X3PA 4Y2PA 5FLYA 3VJRA 2OBLA 3F2IA 1VJCA 1R8SA 1REQA 3EGDA 3WSVA 3QEBZ 5CIQA 4DILA 5GQSA 1G0OA 2OUIA 5MFPA 2FW0A 4FHGA 5IT5A 4QOFA 4RVHA 2O8BB 3ESAA 1T36A 3FOCA 1E79D 1TKCA 2W4IA 1EFTA 2B7LA 2BE7A 1IOVA 2M6LA 1E6UA 1GDDA 1U5BB 2K7FA 1K98A 1VJGA 3R3ZA 1RS0A 1L5OA 3GFGA 4JKYA 4M1YA 1HDOA 4CF4A 5AESA 1ZR4A 2CUKA 1S2GA 4MV0A 2XMPA 4LBZA 3G79A 4ZAXA 5JLAA 1KY5A 1H42A 4I14A 5FXMA 5IF3A 4PLYA 3Q15C 4U7PB 3AT1A 3U3DA 2QTNA 2BCGY 2FUEA 4NH0A 2AJBA 4CTKA 4ERXA 5DB4A 1EJ0A 5LZ5A 1U2QA 1GAXA 3ETJA 3PKIA 4J0QA 4RTLA 1UZAA 1XMOB 4F7DA 1A2OA 2Z2KA 5GV7A 2C59A 3T7DA 1U81A 2W00A 3TDMA 2ZVQX 5AXCA 2P35A 4QT0A 1ESZA 4BUJA 4GM0A 1V8FA 4IV5A 4ZEOA 4EB3A 1FVOA 4YGYA 3QWHA 3D0QA 3L0CA 1NW6A 3FCAA 1RCTE 2J3KA 1RMQA 3I72A 3K0FB 3LGXA 1R4NB 4IQGA 4KEAA 5JADA 1NRJB 4MP8A 1VI2A 3LT4A 3W90A 1Q17A 3QLEA 3EJ6A 1CR4A 1MB0A 2Z8YM 4RVSA 2HBYA 4FYPA 4DJAA 1RP1A 6PFKA 3GLSA 3KXKA 5CIYA 4AZVA 4JP8A 1K7EB 2PD4A 4J2TA 4Q9LA 5AI0A 1JAHA 4FU0A 3TSWA 3WGVA 4MW2A 1DUSA 1UFRA 2EHJA 2W2KB 4QXQA 4B3JA 3NS7A 3RRNA 1KDZA 1I2DA 3DD5A 4GM4A 2F67A 4DLRA 1P91A 3NM6B 3CJTA 1N2ZA 1NN5A 3VU0A 4CQLB 5AOBA 4C6TA 3DTYA 1AZLA 1VYVA 2V7EA 3AVQA 4MW1A 5JXJA 3K70D 4YRKA 3FNIA 5C1OA 4W63A 3X1DA 4ALJA 1TX4B 5JARA 1Q16A 4OHXA 4FLFA 2VUUA 1DBVO 3LUJA 6ABPA 2IV3A 4DZTA 1U7XA 5FBHA 2BMFA 2XB6A 2H11A 3BJZA 1GNRA 2P9TA 1V41E 3W8RA 2FW8A 3PLRA 5JSQA 3GPIA 1QIDA 2HJGA 5JANA 4V03A 4W5WA 2X58A 2Z2XA 4ETNA 2YYZA 1JL3A 4JSTA 5EJ2A 3S55A 1QPZA 3SC4A 4ENPA 2DJIA 4NBNA 3WSTA 4OU4A 2G07A 3K70B 1II0A 5DLYA 1VPWA 1NF9A 1OBFO 3OJCA 4U2EA 1PCXA 3LTEA 1U04A 5DEIA 3EODA 3Q12A 1ODCA 2Q5FA 1JIVA 3EQ2A 4OB6A 4MVJG 1Q0HA 2QN6A 1B8VA 1UPAA 1UK6A 1B93A 3N7UA 5LDHA 4RZQA 2D0PB 2ENWA 4OXKA 1FYVA 1Q83A 4MPRA 2X8AA 3TI9A 1W8DA 3QMWA 3GZTB 1A9ZA 3HYTA 1K3UB 1Z6PA 3FKJA 4CJXA 1E9EA 4MQFB 4MV8A 2RGDA 4IIJB 1E3WA 1N2SA 1Q0RA 2EARA 4UAJA 3ADPA 1YUNA 3R3JA 3TKAA 2I3BA 1U02A 2XQVA 4BRZA 3GWZA 3C4VA 4FMBB 2G06A 3BTVA 1WMFA 4ID3A 4DPMA 3EPKA 1KI9A 4AZ0B 4N54A 1YB2A 3BMCA 3DV2A 2PCJA 2DG2A 5IABA 4ZVMA 2ZBRA 2PUWA 3IQDB 5KTOA 4MPDA 4RC9A 4E31A 3IMGA 2VK4A 3CWQA 4KQGA 3LVFO 5DHQA 1RQXA 2H54A 2M1ZA 4WERA 4CN8A 3JQGA 1L5QA 4TVBA 4W7SA 1NNEA 1ZQ9A 1W4RA 2EFEB 2WVAA 2XAAA 4LECA 5B12A 3AR3A 3TH5A 4KXNA 1AO0A 1R6XA 4J4HA 2I8AA 1QU2A 4LIPD 2O2CA 4CEHB 1EWTA 3A31A 2ZXFA 1WZUA 2LP4Y 1XA3A 4KXXA 3OCWA 1ZWKA 5JH7B 3NMUF 4XIIA 5C53B 4WDRA 3WJ2A 1O7JA 2GN1A 3L77A 3F46A 1EU1A 3PE4A 3WC4A 3CG0A 3OFKA 5FKJA 3II6X 3KJFA 2FOIA 2R11A 9LDTA 3ER6A 4PHFA 4B74A 5I7HA 1JHOA 2GK7A 3A2MA 4HEJA 3IE2A 2KYRA 4Z7QB 3A06A 4OSOA 2ZSKA 4MULA 3OZTA 2JFWA 5EKXA 3QSYA 2X2FA 5NULA 5L8VA 4WLVA 2C03A 1EM8A 5DBFA 1VL0A 3BGIA 3HBLA 3KXPA 3F4BA 3N8HA 5CITA 3CT4A 4WMLA 5L7YA 1CX9B 5U4XA 3WLIA 1QHHB 1ZJ4A 5T6BA 3DBVO 4F71A 1P4JA 5DKFA 4L73A 4MUJA 1UDWA 4XRRA 1P62B 2PQ0A 1XTZA 3EXIA 5I7AA 3HO8A 1GD1O 3KZCA 3NOQA 5GONF 2OP0A 4CQMB 3HJCA 3ILYA 4CVNA 4NOMA 1YI8A 5A71A 2BGLA 4KKXB 1V25A 3EDOA 1U3FA 1AGNA 3PRHA 4BFTA 4C3OB 4YUXA 5C8XA 1W9HA 1IXYA 3JR7A 1ZMTA 4HDCA 4B6FA 1QF7A 4JEMA 3QKIA 5DI9A 3OFND 4YRGA 4HLNA 3WV4A 4WVFA 5BSEA 5HZKA 3WLPA 4R2WA 3ZJ5A 1ZK3A 2YIMA 4M9QA 3WWYA 4CLHA 3H1EA 4DUGA 4EY3A 2H08A 1G8AA 3Q7RA 2G1JA 2GBLA 1ZM2A 2BWJA 4KGVA 2LPMA 5JWRA 1TTQB 2B36A 3PIDA 3DA8A 4RJ2A 1SVMA 4JC5A 4LF7B 2R97A 2VUTA 1C5KA 4B09A 2H4XA 3STWA 3A6ZA 1PQUA 1SEPA 1SJ9A 1A9OA 4LYEA 4F85A 1RTKA 4XGNA 3G7SA 1XRRA 2XT6A 2QNIA 4IF6A 4AZ3A 5BWOA 1J2RA 4A8HA 4DJTA 5HCUA 4AMYA 4ZAGA 1RC1A 1EP9A 2QEQA 2X1LA 3SEZA 5EP4A 3U3MA 2AT1A 1GQ2A 3NTVA 1XZPA 4V24A 2ZYSA 2QLTA 4B87A 1OY1A 4A5SA 5L7TA 3UXEA 3VR5A 3KSBC 2PRIA 3DFFA 4O2BF 4BGDA 5KPDA 5CHYA 2IEYA 1R0WA 4DLWA 4C14A 2ZJ8A 1JXAA 4Y2YA 5P8WA 3ILVA 1G20A 3FYSA 5BSKA 5LQKA 1DAHA 5DSZA 1R1DA 1QZXA 4PXYA 1TUBB 3DPUA 5HZGA 2NO1A 3OY7A 1X0XA 2WT8A 4G4GA 2E4XA 3JATA 4Y2SA 5AVOA 2FN8A 3TR0A 5JRJA 1XTRA 3IX7A 1BYIA 2D00A 3F5QA 1EWVA 1Q3HA 1TRHA 4X44A 4F0JA 1P4AA 3PJRA 3FWNA 3EVZA 1U0JA 2ZJZA 3RABA 3EHEA 1Q0UA 2LNDA 1VSQA 3A9CA 3PDUA 1JHAA 1FVXA 2VTDA 3ZDZB 4Z9FA 5AM0A 1VCMA 2QN2A 3F90A 5FYQA 3QX8A 2BTQA 1GCUA 1SG0A 4LY0A 3VPSA 4I5EA 5CLFA 1UFVA 3ZCSA 2JVKA 2QGNA 1QQTA 5AYVA 2OORA 3GXBA 3RHFA 2BM1A 3HEBA 2W7TA 4LBYA 5FFMA 1FJ2A 2RHCA 2XE6A 5AVJA 1JPUA 4RPHA 4YB8A 1UOOA 1I9CA 2OECA 3GIWA 4XAQA 1E2HA 5IT4A 5FNVA 3M49A 1E0DA 1Y1KE 5LDGA 1VHJA 2PLFA 4LK3A 4OTZA 1XRPA 4NL4H 4P4UA 1DKMA 4IDCA 1ODTC 1ZSYA 4PONA 3I6YA 4AI6A 1CZOA 1JQAA 3IAM1 4I5DA 4B3GA 2H7YA 3ODPA 3O7WA 3ZWNA 4UHDA 1ECLA 1IBMB 2VWQA 1OREA 1CUBA 3LS2A 4N8SA 1FFCA 3PUIA 5M7EA 4Q00A 1UDXA 2D2FA 3C6MA 5C3UA 1G7CA 1HT3A 1RJEA 5J1TB 1JZSA 1W76A 4OQQA 2ECFA 4ZPXA 2WQZA 4HDAA 3E3OA 3RSQA 2JAHA 2Z04A 2C97A 2J4FA 2RD2A 2XUFA 4YLGA 2AQKA 3FB4A 4ENWA 5JQGA 1OC4A 5FPYA 3K9CA 3JD1A 4JJ7A 1D2MA 2FPKA 4N0DA 5CA1F 5TB5A 4D79A 5CB4A 3BHNA 3L01A 5F7ZA 3THXB 4K9DA 3F6BX 1LPPA 1U99A 3I3SR 2FDRA 3GX1A 5CHEA 2ZYAA 3A3OA 2J3EA 4EG4A 1AV6A 3ZWAA 4EIWA 2VA9A 2GOYA 3I30X 1PIWA 2J30A 4LS3A 1OFHA 4CM6A 5KTYA 4HDKA 1TT5B 4BQFA 4GPEA 2C78A 2BIFA 1V1MB 3L4KA 1LBHA 1YZHA 1TEZA 1Y42X 4V39A 5TARA 4LDPA 4ZVPA 3M81A 1FUKA 4RHFA 3QEAZ 4FFVA 1ZKDA 4Z1MD 2CYBA 1EUCA 4LRUA 3OWHA 1YDEA 1H2RS 5DHPA 4KXQA 5LC1A 3ZWKA 5T3YA 4F2PA 7ADHA 1H6DA 2EJCA 5CPBA 5LMNB 3GDGA 1QK5A 4JLBA 3W9YA 4C1NA 3FZQA 4FJ2A 4U63A 4BO0A 2FYTA 3Q72A 4BQIA 4MVJA 1LK7A 4YP5A 1AK1A 1M2WA 1ZGJA 1ISSA 1NVKA 5G0VA 3QBVA 1N2CB 2VJDA 3F3MA 3GAAA 3KLNA 4HTFA 1NPDA 1K92A 3FPSA 3M4ZA 2Y1CA 3NM4A 4QE3A 1G9XA 2AOUA 3B52X 1PZXA 1NTOA 3MZ0A 1Q6ZA 2HF7A 3MTJA 4GPAA 3OC6A 3BL5A 4K9QA 5A06A 3NWOA 2OBMA 2NYRA 1O95D 1CJUC 4YI5A 4AIRA 4DR3B 2Q2QA 3AFGA 2QGFA 3TRJA 1G5FA 1QQ6A 3FHTA 4H9GA 1Z7BA 5K3AA 2WUEA 2AKEA 3SIPA 2ZWAA 4FCTA 3FPHA 3BXEA 1VYHA 1QC5B 4HEQA 1XFDA 3IGFA 4CLOA 4BNTA 4V1CI 3OIWA 3Q3CA 3GH1A 3OJXA 5JHHB 3AHFA 1U7OA 1IOLA 4FT2A 4P1ZA 2AF3C 3SMVA 3NBAA 5AI5A 1E6EA 2PX2A 1T6NA 2NUAB 3RUEA 5LIPA 1YRLA 1H94A 3QKRB 1UBHS 5AVQA 3RRZA 3BILA 5CNKA 3VR3D 4EI8A 2CZQA 4KR6A 2GLXA 2WAAA 3RS0A 3AP2A 3DDSA 1N6LA 1QIIA 2Z83A 1RLTA 5DYYA 3NWJA 4MUKA 4Q1BA 4R1TA 3VR0A 3CCCA 4D98A 3RSZA 4LF8B 1I4WA 2CGEA 5K3EA 3FMIA 3W2TA 2ZBEA 1L5WA 3W8NA 3IUQA 2O5CA 1NXTA 2ATIA 4I3GA 2ZDQA 4B3XA 1LBIA 1R8JA 3ENZA 3EEOA 4DXAA 1A27A 2DTDA 2PLRA 3NHPA 3GLIA 2VPQA 2MSNA 3JAWB 1XZLA 4L6AA 4FC7A 1QVZA 3GBPA 2Z2YA 4IMJB 5JRDS 1OLOA 2I33A 5FA6A 3FVRA 2JLCA 3ORRA 4P7KA 5LXTB 3PPXA 1J2EA 1KMMA 1KSHA 1N5LA 3JSXA 5AM1A 1X7YB 2V7BA 2WJVA 4CLXA 3BEOA 4RVCA 1V2HE 4TMFA 4D3SA 2ENUA 2HR1A 1V11A 1GZ7A 1ZGAA 3A4MA 4WCVA 2ZUCA 2D59A 1SKBA 4I55B 3F47A 3DV0B 3WKAA 1Q22A 4FONA 1KQPA 5CLHA 3S28A 4FEYA 5G4KA 5KYXA 1DMRA 2BMJA 5AJUA 4Y1RA 2DQ4A 2ZGVA 1TEHA 1Q1AA 4G4SP 4P34A 2O7NA 2QSJA 2R65A 4IMRA 5DOZA 3ADKA 4XM2A 2OCIA 2XB8A 4YWJA 4DM7A 2CE2X 1O9GA 2ZITA 4QBGB 4C06A 2V6FA 1HZZC 1QOPB 4GPD1 3MBOA 1FP2A 1E1CA 3RYIB 4LYYA 1WY7A 2BFDB 2E0IA 2APJA 4N5IX 2JDIA 10MHA 1SK9A 2RGNC 3RSOA 4F38A 1RCUA 5K3OA 1AHNA 4UVIA 2P91A 4PFKA 2EFYA 1ZJZA 3OO0A 4P6VF 3KYCA 1VMIA 1LRLA 3OKFA 3UKOA 3QGMA 3UC9A 4QBHA 2FQQA 1KPIA 3FGNA 3QVGB 1SBNE 4AW9A 1NKSA 2HLHA 4QLBA 5TMDA 5AM2A 4R84A 3I04A 2J41A 3BCRA 2XA2A 1GCIA 1XMQB 5CDFA 1H9BA 3JAKB 4G0YA 3W5VA 3P2MA 2YJ6A 2D2VA 3N8DA 4G5RA 1VKJA 1R4MA 2JFOA 4RS3A 3E53A 3NAMA 3PQ4A 4TS9A 3IKVA 4Y6PA 2AJCA 4UD2A 2VP6A 5F77A 3L4BC 5AFSA 3FZGA 2W9XA 4L1KA 3CEPB 1QHXA 2WJZB 5IUNC 5TQJA 2VN8A 1N7IA 1QRDA 2H5LA 3HUEA 4MAMA 2I7TA 3ROZA 1PI3A 3ZEIA 1M5UA 2HU5A 3AIOA 2P4QA 2ZI7A 2OD2A 5JFOA 5J9FA 3A9RA 3RVPA 1CY6A 4UXJA 1RNLA 5FBZA 4KR2A 1XBTA 3PHJA 2W6MA 4G1VA 4RLHA 2J7KA 3TD9A 2G70A 4R2JA 3VNQA 3UAGA 5BRNA 3ZCPA 4IKOA 4RS4A 5KMGA 1M7HA 3IB6A 1T5TA 4TQUS 2Q5QA 5C7LO 4GGMX 1GCGA 3ZNNA 3S81A 3VVLA 1V8ZA 3FKSD 3OE7A 4I50F 121PA 3RSGA 1L5RA 5JROA 2CXSA 3UHAA 4ZT6A 2R8BA 1U94A 3T0IA 5JSYA 2HWXA 5IFLA 1HMPA 4ZIRB 4AMUA 4I9GA 2IDJA 2EERA 3CZ9A 1EE1A 3F8WA 2O6HA 2P3LA 4J7CA 4KODA 1Q2XA 3ZVLA 1Z0IA 2ZI4A 1TYCA 3CR3C 4D42A 4YXFA 5ADWA 5JR3A 4XGIA 3RFCA 4TLDA 5A6SB 3C0KA 5IULC 3PR1A 4YUVA 2ZCJA 1Y1QA 4R2XA 3DOUA 5SY4A 621PA 4WOPA 1Z06A 3UN1A 5CA0A 1QVVA 1N6KA 5J2TB 2CB0A 3LT1A 2GGSA 3PRJA 1ECJA 2FPGB 3MTEA 5EEHA 3L7LA 2G77B 3M33A 4NJOA 3ROGA 3EQ6A 2X9GA 4DMRA 4EJSA 4O4LA 2NP6A 5KNCH 1QHGA 1SOWA 4MPPA 1UMBB 4I4CA 5H4HA 1JXMA 1AKRA 5DM60 1KTIA 1FDOA 3A25A 3DE2X 1IZ8A 3CWZA 3LKBA 2ZRJA 3CN7A 1L4HA 2RARA 4LHWA 4HYTA 3RTBA 4DARA 5JZ9A 1Y8RA 3LD9A 1Y1LA 2GEFA 4KJXA 2NTNA 4BO5A 2FZEA 4ISCA 4TMYA 5E7IA 1M2OB 2HU2A 4A6XA 4JMPA 3LKZA 2GJSA 2REOA 1H2XA 2O7SA 1WHTB 2PT6A 3QVVA 4O8ZA 2WIJA 4UZFA 1ELOA 2J1LA 1JFFA 4J3JA 2FY8A 2VUSA 4QT4A 3VA7A 3FGZA 3C1UA 3W1WA 3SVLA 5CGQB 1TK2A 1EVIA 2P41A 3FLEA 3DFIA 4PPNA 1JKIA 2GERA 1VIVA 2F3PA 2BR4A 2HI0A 2BEUA 2M6SA 2PH3A 2PKEA 3TSOA 2NSDA 3W9SA 4AF8A 4EYKA 5EHZA 4R01A 2Z6QA 1DRVA 4ZYYA 1C14A 4JXJA 2V7QD 4LOAA 4TWRA 5IKEA 1OFIA 5FYDA 1RBQA 1C1XB 4Q7EA 3ZUPA 2CNDA 1SB9A 3RYTC 5EWJB 2PZBA 2NSLA 4D4JA 5I47A 5HX7A 1MNAA 3FAKA 1Y9EA 3MS4A 4BN5A 1Y9DA 3SICE 2N47A 1JKFA 2Y1XA 2ZZKA 4IEEA 2OV1A 4IV0A 3J80A 1JDSA 3LE8A 1L7DA 1MC1A 4NONA 2C88A 2HD4A 3GARA 1WUKS 3HPRA 3QPUA 1PEKE 5KOIA 4Q3DA 3AW9A 1DPGA 3UG7A 4WBNA 2ZCUA 2PUEA 2MWMA 1E59A 1RJGA 3R6WA 1CY0A 2B8WA 2O19A 3L7OA 3WRYA 2YS7A 4E5KA 4LBWA 2G5PA 4KN8A 4Q7KA 1CUIA 2X14A 4RNCA 5CW2A 5JI3E 1XQWA 3FDZB 4L08A 4RL6A 3N5CA 3TW4A 4G67A 4AKGA 1JDPA 4A0HA 1E2MA 1LBTA 3GL9A 4K9NA 4EW2A 4X66B 3S68A 1CUYA 1JEAA 1FS4A 4ZYUA 1E1RD 1T10A 1TYAE 1PX2A 1VJTA 3OECA 4K0RA 3SXUB 4OFWA 3UENA 4KDCA 1X8LA 4MQEA 4CTOA 3C1OA 1IQ0A 1FXUA 1X1QA 3CLTC 1E0SA 5HGXA 5CLLA 1E2QA 1O94C 4BLPA 2V6IA 3DOHA 2DHEA 3EGXB 1NZFA 2R1ZA 1X7ZB 2YOHA 1E96A 4BMSA 2R4TA 2JJ1D 1B0UA 4CMEA 1FPMA 2OY0A 2ZQYA 2QRQA 1PJCA 3AHEA 1U9CA 1TJPB 2BW0A 2O2XA 1VE3A 3AB3A 2B4TO 3GCXA 2CHGA 4PZ0A 3WLEA 2PZAA 3U09A 4LVOA 1JG1A 2A67A 1JLKA 3KUCA 1WZNA 3FNRA 1Z5WA 2R6AA 2C98A 1GZDA 2BISA 5JD3A 1EE2A 3PQ8A 2R79A 1ODLA 4FE4A 1XCPA 5CLQA 1X1DA 4MP6A 4QDTA 1VL2A 1KAQA 1BO6A 3MERA 1M3SA 3GAFA 2H7CA 4NOLA 2AMFA 1ZU4A 2I2BA 3RVOA 1JIJA 3CRZA 2EGUA 3QNWA 4S1PA 4KQXA 4ZQFA 3AI2A 3O2SB 4D4MA 4YIKA 4CMJA 3OY2A 3U26A 1J22A 2XQJA 1C3OB 3AILA 3GA5A 3NI2A 4QGSA 1WDWB 2HK6A 4KWIA 1NT4A 2HIGA 3EQ8A 4ESOA 3PPIA 1GSHA 4RE5A 3ZPXA 2O23A 3OX1A 1OHHD 3D4IA 4P81A 3G5UA 1G1AA 4LFCB 5TF4A 4BMZA 3KL4A 4LXTA 2QA5A 2GPSA 1NLZA 3GEMA 2H18A 2HCRA 3ZU2A 3NDBB 1T5HX 1W1UA 1Y3BE 5CX4A 5BNTA 2VEDA 3A6HA 3IIMA 5A05A 3WK5A 4CDRA 3N76A 4I55F 4CIXA 2WU4A 2P4HX 2ZT6A 7AT1A 2JG3A 5KCZA 2CBGA 4WKGA 3Q41A 4ARZB 4MVJH 1TYBE 5EIEA 4BE9A 2OYCA 2ZPUA 4NH4A 1DTWA 4XFJA 3WMFA 4UM9B 1CQPA 3CNEA 2I9KA 2L0XA 2VTEA 2O8NA 3ROKA 3K31A 2Q5JA 1IQUA 3U7EB 4ZYWA 2J6BA 1F1JA 3S8EA 4ESHA 5FUMA 5KNBH 3O3CA 4Z0HO 2WA1A 3FI0A 4O4IB 4KXFB 1F8XA 1M2KA 1EG2A 1TVKB 4HDMB 2EW2A 2FQYA 2Q4EA 2B35A 1QUFA 1EIZA 2R87A 2IYVA 2I4MA 3EMVA 4OQMA 3ZNQA 5IHPA 1P31A 3IEXA 1FMLA 4HH3C 2UXDB 1XZBA 1VJ1A 2YOFA 1PV1A 2WF9A 5HJEA 2QD4A 3VV3A 4EYEA 3ETHA 4NAUA 4B73A 1N8SA 1M74A 4KNVA 1NYTA 1IH8A 4P9NA 1PS9A 2VK1A 5DBHX 4ZYXA 4RDHA 3GHHA 4JSRA 4WT7A 2VDWB 3AONB 3CZ5A 1Q0LA 2R1TA 3BRCA 4OXNA 4XPIA 5E6SA 2GXAA 3O03A 2IOHA 2JH8A 2A92A 4CW7A 1OH6A 4LEIA 2VPIA 1RPZA 2V5UA 3ORHA 4MA0A 4OB8A 4R9VA 1GNQA 4HV4A 1TFUA 3LW7A 1XGKA 4D0LB 3AY7A 3NBFA 1RJ9A 3QF7A 4Z5XA 1QQAA 3FOBA 5B1SA 4EMUA 4RTJA 2IYNA 4MCAA 3WMWA 4FT4A 2AFHA 1XTJA 1NQUA 1WSAA 4DVJA 5JMWA 5KIAA 2WR8A 1ULBA 5NLLA 1DXOA 3NLLA 5MGBA 4TMWA 2D2XA 2GPAA 5TV2A 4ENRA 1YBMA 1ZIDA 2YFHA 3MMNA 4AUKA 4EPTA 3WB0A 4EG1A 3MJSA 1WTCA 5HYVA 3C3DA 1QF6A 4INOA 3HCFA 4D4HA 1ZUIA 1HDIA 4E3ZA 1UK9A 1G16A 1P0FA 2H1VA 1HZZA 1N5RA 3LYLA 1US8B 4H7IA 3IP9A 4L7QA 4PYIA 4RV9A 5IK2A 1XQVA 4OQXA 3DDOA 4RH0A 2OPBA 3C4QA 4MW0A 4A0FA 3S1SA 1AX9A 3QIAA 5GJWC 4BNZA 5ILOA 4KYVA 4GPTA 4GYYA 4U3JA 1OYWA 4S1NA 5CK5A 3K7EA 3VR6D 5AKJA 5LZ8A 5EIXA 1EDEA 4OXYA 3LVBA 4KL8S 1QX4A 4Y2QA 5AIAA 4ZRMA 4E7PA 4DANA 4MLCA 3L8CA 1MT3A 5JQWA 1KEVA 1T9AA 2CF5A 4RKQA 1HA3A 3HA5A 1NWHA 2IRWA 3HG7A 2IEAA 3K1YA 1T4BA 3IULA 1RI1A 3R3VA 3VOAA 2Q9UA 1X92A 4QATA 2Q7DA 2OHHA 3D8SA 4HWOA 1CDZA 3S29A 4QTTB 4A0GA 3DOJA 2O0HA 5IJXA 5FTKA 3FD8A 1ZSVA 3IOYA 1B00A 3U9LA 3QPDA 4GX0A 4PLCA 2C4KA 2CE7A 1ISPA 5A4KA 2OEPA 5C5CA 2JVJA 4INJA 3U1BA 1VJ0A 2XMDA 1V7ZA 1NUSA 1MJ5A 1R6AA 4RZIA 3BF8A 2VPZA 3SC2A 1NFFA 4ZGGA 1RIFA 3RC8A 3EA4A 3IIJA 3ZHYA 3OTIA 2HADA 2PSEA 1B6RA 2I7VA 2XGJA 4HB3A 3R41A 2K6GA 4PU0A 4N9WA 1QRRA 4TTRA 3C5EA 3TW6A 3QWFA 3LUPA 3UFXB 3ZC3A 4A7PA 2XODA 3GZ4A 2QU7A 1Z74A 2NO9A 4K2HA 4NYJR 4EB0A 4EZIA 3KTDA 1EI9A 4G8CA 3CRQA 3T9BA 1DAOA 2XNCA 3HNRA 4CNQA 4JJAA 3EDCA 1JBQA 3J7AC 3QLUA 1GG2A 2HREA 4RVUA 3BCUA 1ETUA 4QSHA 4BMCA 3IQXA 1NOIA 1L5MA 1WZEA 4H15A 4ECEA 5ES4B 3ADCA 3HYSA 3DS8A 1WZ2A 3IEVA 1QH1A 3L6UA 2DR0A 4OQLA 3AF1A 1WETA 4NYIQ 3X1ZA 5H9WA 4BZQA 4QNRA 1DU4A 1E2UA 1J90A 1YH3A 2VYQA 1C41A 5TS2A 3WDKA 4Q24A 3WQRA 2ZOSA 1ZKMA 3RF7A 1K7SN 4B47A 3GJYA 2XPCA 2XNDA 4RHCA 2W58A 3SQNA 2WTNA 2FGKA 5DX8A 4LXUA 2WHQA 2C9ZA 4MYRA 4E13A 2GK3A 1DHRA 1R6BX 3BWMA 3DBLB 5JZOA 4AAYA 2IBTA 2B4AA 2B9EA 5K99A 2C54A 2II6A 1VHWA 3EWAA 1YBAA 4LZLA 2CLSA 3AUAA 3W8DA 4EKIA 3CUUA 3PGA1 4OQPA 4CMIB 1DKLA 2Q1TA 4M89A 1KDYA 1R2QA 1ZCZA 1BA2A 3LKDA 4BVLA 3SFTA 1TQ4A 4X0EA 3EXHB 4AC9A 3ICPA 3WQQA 3H5IA 4QGBA 1XELA 2QN3A 4OI0A 3D6UA 1SU8A 2Y99A 1YKFA 1YQEA 4H0CA 4O1IA 3EOZA 4YGXB 3SJ7A 4B9AA 4EH1A 4I1SA 2JJMA 2WWFA 4JUDX 1N3YA 2F1IA 3K4PA 3UUEA 1XLUA 3ILSA 3SK0A 5A04A 2PPVA 1A7AA 3S2IA 1LI7A 1KA9H 4B4KA 1NG9A 3F78A 4KO8A 2GN4A 4LZWA 1VPDA 1L7MA 3LY8A 5CTAA 3B6JA 2Z58A 1DBWA 1E4EB 2CJYA 1A50B 3Q7IA 2VS1A 4TS3A 4QARA 5DM0A 4U02A 4QTUB 3TB4A 4LKOA 4YRAA 1FQJA 2IYUA 2Q9BA 3E8XA 5F7XA 4B7CA 5K3BA 1UXHA 3JRNA 3FMPB 4EY4A 4C4ZA 4QEZA 3H2KA 4XJSA 4MVJF 3TTTA 1Y1RA 3G2JA 4GXTA 4TT3A 2J3QA 4IXTA 4BO9A 2O8FB 5IVPA 1L4EA 3MJFA 1M6VB 4CIAA 4FCCA 1XMXA 2BMWA 2DBVO 1RAFA 1YZYA 1ATZA 3LQ1A 3HJNA 4Y9SA 4PICA 3FPBA 4U7JA 5CFPA 1DCFA 2RE8A 1QFMA 3USES 4BFYA 3QVMA 3VU3A 4ZCQA 3N70A 1XRMA 3JPWA 4RZUA 5E3HA 5K3CA 1A8UA 5AKEA 3PHBE 4XDYA 2WTAA 1CIPA 3EJWA 1BC5A 3W3AD 1XCBA 5JZMA 1W93A 5D1HA 2R60A 1H2WA 2WTXA 3AUYA 4W5NA 1JR2A 3GEPA 5FOQA 1U4NA 3QJ5A 5ELMA 1QIHA 2OGSA 3HL4A 2X8BA 4IRXA 3OU2A 4MPTA 1M2FA 4QBTA 1ZIPA 5CCDA 4OQZA 1EK0A 1PSDA 2CMDA 5CLIA 4B2IA 1QZUA 2NUBA 2YHIB 2ZU6A 3O8OA 4GR5A 4HWPA 3R6LA 2FSIA 2KHZA 3CHYA 3QKSB 2D7JA 1ISHA 3JQ7A 1IHUA 3ASVA 3QE3A 4R1UA 2J31A 2R47A 4QUAA 3NHRA 2ISSD 4WGFA 2F4NA 4QQFA 2K2QB 1V1RB 2L18A 3GN1A 5H9VA 2JLVA 1RHKA 2A1UA 4XX1A 1HKUA 3V80A 4R4JA 4X63A 2AOWA 1G6Q1 2CHEA 3F0TA 3TTXA 4D8VA 1TQDA 2HMWA 3P9KA 3ZW9A 1I4OA 2CHVA 4N0PA 1M8JA 1H9AA 1NF3A 1X8KA 3FFWA 3FVVA 1SURA 3K1AA 3I53A 3QE4A 2P3QA 4XSGA 1UWVA 3H9GA 3LFUA 5BQOA 5DNDA 3S2SA 4DR2B 4A2WA 3PDJA 5A9TA 4OFZA 5LCXA 3R9KA 3MYRA 5C3MA 1N0VC 5CFQA 3EXEB 3PQDA 1AIPA 5SZIA 5AP9A 3U2QA 4D1YA 3CLRC 5DPMA 4B32A 4IWYA 2Y6VA 1XHFA 1ZK0A 1BHO1 3KU4A 4D9BA 3EBOA 4LZZA 4XTCS 1JAYA 1PTJA 3AESB 2Y68A 1VKRA 2FW7A 4MVJI 3L07A 4BWGA 1W94A 5DN9A 5JNLA 4YJHB 3ZHRA 2I71A 1F4LA 1M2EA 3BZWA 3V55A 1NL3A 4X91A 3Q3HA 1E4YA 1JHZA 1NVUQ 2EF0A 1W96A 3L9XA 3SX0A 3ZTYA 4FGZA 2ZYWX 3R09A 1FSPA 2JIBA 2Z08A 5G53C 2FNAA 5IVHA 4R5HA 5JYEA 4DQXA 4BQNA 2AE2A 1W4BA 2H9AA 3FE2A 3TQQA 1X8XA 1X1BA 1O6GA 2IDKA 4ZVNA 3LT2A 5CEEA 1K3FA 2RDMA 5DF1A 2H5IA 2NUAA 1UKAA 3CLSD 2P9FA 4FGSA 5I4KA 1X9GA 2WYHA 5ICMA 2GSWA 5DBGA 1QF9A 2R6DA 1LW6E 4WFKA 2C1ZA 1P8AA 5DSTA 3ZJ4A 1VE5A 2HPHA 2PO7A 4QTYA 2PUDA 4ZU6X 2N1MA 4JJZA 3EA5A 2BV3A 3WYBA 1BJRE 3QOFA 2ZJ5A 2GZ2A 2XMQA 3K0AB 5L4NA 4Y2GA 1E98A 3T7SA 2QJOA 4GX1A 4DKJA 3PFGA 4L95C 2RJ3A 1SG9A 2X1MA 3QPWA 1C4XA 5CNJA 5AHXA 3S40A 1CQIA 4PVDA 4PG5A 3ZQ4A 3G9TA 3W3ZB 4CKBA 3CUVA 4XQEA 1FRZA 3ZVRA 3DUFB 3PWKA 4PC1A 3ZIAD 4RKRA 5K0FA 1CY1A 1G8PA 4WKOA 2R62A 4L8GA 3OLWA 1QBKC 2VZ9A 3AW8A 1M0TA 4FXPA 4Q66C 3T3EA 1P44A 1U5BA 2QX6A 2RGYA 1KDTA 1UC9A 3C3CA 4MS3B 3BQ9A 4FNGA 4RVNA 1F0PA 2WD8A 2AV6A 4TN5A 4TS4A 5D3KA 1U8FO 3B3GA 1J07A 2PD6A 4GW3A 2HK8A 1J42A 3UO8B 5C81A 2JFGA 2KPOA 3A2LA 4ZI7B 2ATVA 3QUAA 2OO3A 2X5NA 4EA6A 2FF7A 3AR6A 4LRTB 1ULTA 2Z8YA 4N0MA 4W5OA 2DY0A 2QNBA 3OCYA 2G88A 3RK0A 3ZI4A 1QTRA 4Y9DA 5HZHA 2OV3A 1KS9A 5M2QA 3LTNC 3O75A 3GUVA 3JV7A 3P26A 2OQRA 4Z4GA 1CFJA 4LCJA 4JJFA 3IDOA 2LZ0A 3ZGXA 4PE5B 3MQ2A 1J70A 2J8ZA 4PS1A 4S1WA 4QX6A 3JTMA 3K0FA 5G1OA 1L4FA 1R4NA 1U8YA 3JQBA 2QVBA 3NHFA 1G60A 2PMBA 3OZAA 4PLVA 4RJKA 2KM1A 5DIZA 3TQHA 1LI4A 4C88A 8ABPA 5L40A 1Q0TA 4U7GA 5KQRA 3BTUA 3ZCVA 2NX2A 3OTQA 2RHBA 4AIIA 5ENVA 4BLSA 1C3JA 2BBSA 2W2KA 3PGXA 4EW6A 1G5TA 2NXEA 3OZGA 4CU5A 2ET6A 2WILA 4HB2A 3RHTA 4UTZA 3WR5A 2BKUA 2HBZA 4CQLA 4H4EA 3RJ5A 2BGRA 2QPOA 3FB1A 3PC8A 1JUDA 3E27A 1YMQA 1MJNA 3WYCA 2OV2A 2OXRA 1OI4A 3VC2A 3VH4A 2AZDA 3HB5X 5GGXA 1TMKA 3H1FA 1OB2A 1BGXT 2JGMA 5ALNA 4ZCRA 4D0GA 3HDJA 1EG7A 1P9NA 3H1GA 4HH0A 1T29A 1XCOA 1Q2UA 2LDBA 2PKYX 4U7WA 1XQ9A 2I6TA 4B6PA 4LWOA 1VPLA 1O95C 4ZI5A 5IT9A 3HPQA 1FDWA 4PNPA 4UBLA 3T9EA 1N2EA 1Q11A 2H0RA 1UZMA 3DMNA 4ZAYA 1JR4A 4WCFA 1RLIA 2JA1A 2D13A 1AOXA 1NLYA 1GU7A 3AEYA 4U00A 1ICIA 3S7TA 1BVHA 1WCIA 1Q7EA 4MKGA 3T3HA 4WJZA 5BQXA 4PC7A 2XUKA 2A9JA 3EDQA 5AHKA 1H3FA 2I4TA 1F4VA 4FDTA 1ZMXA 1R0CA 2O2JA 3I8OA 4QU8A 2DPHA 4QQRA 2QD3A 4M0FA 3OIUA 3TYXA 1U1EA 5EXDA 1ZH2A 1OV4A 4Q6BA 1EZ4A 5DT9A 4MI1A 2JL1A 2WD9A 3HSKA 4UUAA 3JAMA 4GI2A 1X1TA 3BTOA 5IAEA 2QGZA 1SKMA 4IIJA 1LXCA 3VPHA 3GGOA 1Z15A 1KVRA 1WXHA 4M87A 2OCAA 3HA3A 3NTUA 4KX5A 1RACA 4LTMA 1FP1D 4WZ6A 3WNBA 3MT0A 3NGLA 1XTKA 1YRWA 4W1QA 2J87A 2ORVA 3E3AA 1FS6A 1RAHA 4QXOA 3RCBA 2OE2A 1OD6A 4Y2XA 2V03A 5WRFA 5D84A 5DWDA 3L6BA 4M7WA 4AZ0A 4US0R 2IZOA 4UMFA 5ALUA 1C9JA 1VYTA 2FW1A 3ANYB 1LWNA 3O4RA 2R44A 1CLEA 2X9QA 2G9ZA 5ALQA 4O8CA 4EPWA 1TADA 4Q1EA 2JANA 3IOCA 3F9IA 1FMTA 1LSUA 1DXQA 4B85A 2CVPA 2QQGA 3WTBA 1G38A 3SM9A 3VC1A 2P6PA 4GLBA 1I9GA 2J9YB 3ETCA 5GPBA 4KPEC 1GDTA 1FBNA 2R5FA 1TA9A 1BKDR 4N5DA 5T8KC 2F1OA 1D3AA 3RYCB 4KDFA 4PAWA 3MXOA 4YUWA 4M54A 4MEBA 3VUFA 4CT5A 1FUEA 2F1JA 5A1JA 4GDFA 2BT4A 1QYVA 1Q7RA 5DNVA 1K06A 1VPEA 2ZIAA 3OCVA 3PGKA 4WW0A 1V1JA 3H4TA 4CUZA 4EOGA 2CV1A 1RKUA 2WJ4A 3ZGYA 2JA2A 2AFIE 3I4FA 4O08A 3PNYA 5AI9A 3GO4A 3FZEA 3NIDB 1I7LA 2K7ZA 3RAGA 2CN1A 2GCOB 2RH4A 2ZYUX 1JSLA 3GNLA 5JCXA 3M0EA 4X24A 5EJ8A 1RR6A 3DE4X 4PEVA 2QTWB 1CUUA 1I0ZA 1LBQA 2EZTA 1S1MA 5CK4A 1KTVA 3JQ9C 3R5SA 4FYXA 4J2HA 1ZM3A 4U0JA 1IXZA 1I01A 1XZFA 1D1SA 4XWGA 1EK5A 1MAUA 1QO9A 3A4NA 3A4VA 4MJ7A 3PCRB 1EWQA 4UKDA 1JYEA 1WF6A 1NM5A 3NT2A 2JCXA 3OJWA 1BSVA 2VA8A 5JG7A 3SF0A 4EECA 2W42A 5ABPA 1YA8A 1HFKA 2IFTA 3CG4A 4Z7NB 2QK4A 5F4BA 4D5EA 2BJWA 2QP9X 4KGZA 1L7AA 1JR3A 1PL0A 3AI7A 1XYGA 4XVRA 4JMLA 3FF4A 4E5MA 1Z4LA 3UOGA 2VXCA 3SQMA 5IMBA 4B4DA 5GP1A 5LD2C 4E1VA 2ZS9A 1BD4A 3OPYI 1G4AE 3P2JA 4LJ9A 1E5TA 4TXHA 5FEUA 4BZWA 3HB7A 3H16A 3PNSA 3ZNOA 5C1IA 3T5PA 4GBMA 4QGHA 4OHMA 4JU9A 3SR4A 4HJXA 4BNHA 1TM1E 1U3TA 1WY5A 4EFMA 1PYOA 5IH7A 1P5RA 4LF9B 3C8MA 2ZR9A 4OD0A 1HORA 3RREA 3G2QA 5LZ2A 1BG6A 4FS3A 4Q4HB 2V7PA 3SLKA 1NU8A 4AJ1A 1U28A 2GHRA 3INNA 2C4VA 2YWCA 1T2CA 3EW9A 3IV6A 1HNXB 1SXJB 3U6KA 4IDQA 3AUXA 4GPZA 4IRUB 1GTMA 4FP9A 4LJ4A 3V6MA 4UU0A 3JYHA 3OFNA 5E2IA 2FW9A 4MIEA 3UMMA 1ADBA 2J6CA 4ZTZB 3F7TA 6GPBA 1EA5A 3GVXA 3RU2A 4DV2B 1F38A 2EGHA 2I54A 1KNXA 3MGBA 1DWUA 5JS8A 2GWRA 3TGLA 1U2EA 5J4KA 2ZQZA 1DCMA 1VL5A 1QDUA 3IAHA 2CLHB 3WIBA 1ZUD1 2J4CA 1SOAA 2YZGA 4K28A 5ECWA 3IP7A 5H02A 2C2HA 5HS4A 4YDRA 2YXDA 1YZNA 4QIHA 3FNBA 4D7AA 2EBWA 4RSRA 4EUHA 2IY7A 3FIJA 2NMVA 1N5JA 2ZR8A 1KKLA 3GHYA 4NFLA 4OGWA 2FZVA 5EKTA 4QRIA 1HDYA 1T6XA 4FEGA 5ALYA 1EDOA 3SFVA 4JVNA 1L8AA 3FOAA 2MU1A 4UDXX 3O3NB 1NLMA 2OOSA 3VZSA 2ZBVA 2Y93A 5KB3A 3JSAA 4GL2A 1K8RA 3W8FA 4B76A 5FBRB 2ZM6B 4GC5A 3TTYA 1I4EB 3AV3A 2X22A 5EHXA 3P45A 1L5SA 2CJFA 2X19A 3MN1A 5JBIA 4ZMRA 1B0PA 1RWWA 2YVQA 4A4DA 2GD6A 2IL1A 1GNPA 3MHTA 1LX6A 3ZU5A 1BDJA 1FFSA 1LF5A 2WE7A 2X6TA 3UFBA 4LAFA 3KKQA 4LC9A 1DKPA 4JI4B 2VCEA 3MUFA 1SVOA 3NHUA 4IQ0A 3ZG6A 2YJ3A 1WXIA 4M1QA 3S2FA 4X7RA 3TQCA 3SBXA 5DGXA 5FOVA 4BCDA 5GJCA 1YQUA 4BHTA 3U31A 2E82A 2IIBA 4X1KB 4Q19A 2G25A 2D8AA 3H5NA 4O4JF 4D2IA 2G7ZA 3N05A 1BH2A 2ZIXA 2JD2A 2C9YA 1KY3A 1QWSA 2OP1A 5AKKA 3UGKA 2EZUA 2ZTVA 4EI7A 5ED4A 1FUYB 2K4MA 3SR0A 3DT9A 1HDRA 5F9MA 1TUGA 4Z86A 2GESA 1QGDA 4C9BA 5EJ7A 2FPUA 5DVZA 4KAAA 3VYRB 3AHGA 3D6TB 3LBFA 2HJWA 4AL4A 1P60A 2GBGA 2PSDA 1LNZA 4Y6LA 3VFDA 1A9QA 1IG0A 1TTTA 1XXHB 4KUGA 1KJ9A 4OHYA 1OAOC 2W83A 1QH0A 4DBLC 3HZRA 3RFFA 2CDRA 1BGWA 1UWLA 3DE5X 4MRVA 4IDPA 4YMIA 5K6AC 2YXBA 4K3UA 2A5DA 4M55A 3THXA 1T3ZA 1GZ3A 3UK0A 5F2NA 4FBLA 4G6ZA 3AKZA 1NY6A 1J97A 1E4VA 1K9SA 2EJWA 4KYIB 2H63A 1KQGA 2GKGA 1YSCA 2Q5CA 5C5EA 5EMHA 5J5AA 4ONEA 4BFUA 3HN2A 3ETNA 4LSWA 4WQMA 3VZBA 3WWDA 4BTEA 4CUKA 1TT5A 1S2LA 4R7ZA 2XJ9A 3JARB 4KDEA 3IMKA 2REXB 1Y8CA 4IS3A 4OK5A 1R7RA 4CKXA 1FY2A 1Z35A 5TGDA 2WW8A 4RL4A 3SJCA 4OKIA 1OX4B 5EJIA 3SQWA 3FMFA 4EFNA 1ZMBA 3MIIA 3B1KA 4EPRA 4KVZA 3TZCA 1YONA 1AUPA 1NX9A 1W2WB 3LV8A 3C3EA 1ISRA 3E35A 4J3NA 1JZQA 2GTIA 4WL0A 4C89A 4ON9A 4AP5A 3VC3A 2B25A 1VHTA 1E7YA 3BD8A 2FA9A 4M0CA 4MQBA 1LUAA 3GJQA 5SYMA 4Q02A 3TCNA 1KI4A 1P18A 1GFWA 2C94A 3UMRA 4Z51A 5JIBA 5LQJA 4RK4A 1VMAA 3LLVA 3GLHB 3BMQA 3LX8A 2GO7A 1W0CA 3QX9A 4NHOA 3RB8A 2COKA 4B0OA 5IHXA 5LR6A 5E0KB 4Z1MA 2R66A 2JKYA 3H2YA 4J8PA 2H0AA 5IDVA 3ZE0B 3A4TA 5AHRA 1K8QA 3ND6A 4ANFA 4EO4A 4KFTA 4BNLA 1QYCA 1ANKA 1UBJS 2FWJA 3AYXB 4EBFA 3IQEA 4GOKA 1XMVA 1YHZA 3PC2A 4I6EA 4IVRA 4J1TA 1MEJA 1RI2A 2HA6A 3K9QO 1GA4A 2AR0A 3L8DA 1UMKA 3P4XA 4KE8A 3VU9B 2QTGA 3A3YA 2MOKA 1A5SB 1B16A 1H6BA 2LWIA 2C7VA 1XZCA 4KQ9A 2NAFA 4LDRA 4Q7MB 3QKRA 3SYRA 4HS9A 4WFIA 2C3UA 1FFWA 1XPOA 3PLAE 3MD9A 3FWYA 3M89A 3OT4A 4FZRA 4OI1A 4KV7A 2EFHB 2K5UA 1OR8A 5ESDA 3FXAA 3HSSA 1R6UA 2GCGA 4MTCA 2VPXA 1JLRA 1RHJA 2ZSUA 4C29A 3PS9A 2BEVB 5GINE 2E4UA 4XJXA 5K03A 5DBIA 1TI7A 4AROA 3EZ9A 3BREA 3GLQA 3MWGA 4HMQA 3ZHQA 3E2PA 3NJRA 4P4SB 2DETA 2I91A 1PGOA 1CJSA 5CVDA 4LCEA 2MDTA 2MTBA 2GD0A 2FZ5A 3Q5DA 2XCOA 5JMPA 2VQ6A 4F9FA 3ROPA 4HFNA 3H9CA 2QDXA 5BW6B 3VR3A 2WJPA 3JZMA 3THSA 3WLOA 1I6KA 1KQOA 2P2ZA 2ZYGA 1ML4A 1TLLA 2EKZA 5KVAA 1X7YA 3WOHA 4O2RA 4EJMA 1ZBQA 1WNTA 1EZ1A 1YWGO 4N01A 1SB8A 1EWKA 3ULKA 3MF4A 4QFDA 1H2FA 2J08A 1X8JA 4P32A 5JAQA 3EFHA 9GPBA 1ZHFA 3GA0A 3U4AA 2M6RA 2QL7A 1N0WA 3K0CC 5BYAA 4DNFA 1YJ5A 4WE3A 5EWMB 1P7VA 1KAHA 3RHZA 1ZONA 3W8EA 1JECA 5M5BA 1R9NA 2IELA 2RAVA 3DW3X 3ESRA 1TC2A 1XU7A 4K26A 3COWA 1GRVA 3BWEA 4MS1A 2HRCA 4OYLA 1Z6AA 2DMRA 3DT8A 1GPNA 4KXWA 2OBYA 4EG6A 4UHEA 3NTLA 4BV3A 2B5VA 1N8NA 1C2YA 2Z2IA 4KQ2A 1RHQA 2QRNA 4R1NA 1KZ6A 4RDIA 4BIMA 1ORWA 4Q39A 4X6LA 4L3WA 5AQEA 1PZEA 4DV7B 2Y1OA 3OM1A 3QVGA 1GSAA 2FB9A 2GI4A 5DHFA 4OJNA 2XXJA 3DCYA 3CUTA 2Q1YA 1JNYA 3DAPA 3JAKA 2QRGA 2I8CA 4CTMA 1LVUA 1Q0ZA 4TTPA 1TZKA 1VG1A 1WUHS 3QBJA 2HMSA 4NQZA 2JEOA 3PYMA 5KAMA 2Q41A 4MO2A 1JFRA 2ES4A 3N2ZB 5IEBA 4MW6A 3IA7A 4XLZA 1UR5A 4WCDA 2IVZA 4GE3A 4ZD6A 3M3DA 3U62A 5BR4A 1AK2A 4DSAA 1NR7A 4TROA 5IVDA 2G3YA 3TK1A 4DEXA 1XWWA 2VP3A 2BUAA 4P7FA 2DR3A 2YIJA 1AMUA 3MGCA 4HLCA 2HZ7A 3AKEA 2FAXA 3HP7A 4B7XA 4I4IA 1JN0A 1S4MA 5KNCA 1C81A 1EVEA 5LUAA 2RIPA 3PYLA 5FAXA 2HJ9A 1AG9A 3TNJA 2NVBA 4HNGA 3ACBA 1O4WA 2VDVE 2GO1A 4HK4A 5EAIA 4Q4AB 3KT8A 4UNQA 3TDKA 3E2MA 1M2NA 3O94A 1F2TA 2QPTA 2XIQA 3SC3A 3OG9A 1RFLA 2QW8A 3RVBA 4RDXA 3CLHA 3KSAC 5LLTA 1KVQA 3ZE6A 3VSCA 2H3EA 4YRSA 5JSFA 3URMA 1YAJA 221PA 3OX2A 2C9OA 1Z7EA 1K4YA 1WF3A 2C58A 1GPBA 1N92A 2DYKA 2FQ1A 5KNDD 1T8PA 2YJGA 4QBKA 3RC1A 4D6PA 4LJ7A 4GBJA 1Z0ZA 3BFJA 1EVKA 3HYNA 2SCUB 3GGDA 4Q47A 3L6EA 4TV9A 5A6SA 5I6DA 3DEZA 4P4TA 2VYVD 2C5GA 2BFFA 5E9JA 1UJCA 3RFXA 2WG1A 4GYWA 1X94A 3D7SA 3MGAA 4NBTA 3R8FA 2VHCA 4NCJA 2MYNA 3JWIA 4FX5A 5A9SA 2Z5FA 4PC6A 5JASA 2P9HA 3S5JA 1DEOA 1Y5LA 3C5CA 8OHMA 4M0MA 4JYMA 1F60A 4PSAA 5K0JA 1GQOA 2O0LA 2ASVA 4RFLA 4OA8A 1T2VA 1A4RA 4N41A 3FUUA 1RRPA 3LDFA 5BV7A 2F55A 1ODFA 1XDZA 2R3SA 2V98A 4AD8A 3PQCA 3AY6A 3V7FA 3JVVA 3I58A 3U1TA 1WMAA 1T1IA 4A2CA 5CDSA 3ORFA 1X19A 2OC9A 1HDCA 1A9TA 4LOKA 2BGKA 1POXA 2IHYA 3N2GB 4IEFB 4DRYA 1YNSA 2AJ8A 2FFHA 2YWHA 4MIOA 5EUQB 5GOTA 3T94A 1APBA 5IVKA 3KQMA 3RD5A 4D0SA 2XUQA 3OQOA 4F3CA 2LIVA 1C1XA 3OZBA 4E0BA 2Q6KA 2V65A 2ASEA 4FFDA 4QGFA 3BA1A 4EGFA 5ITVA 4Z4EA 5DHSA 4FQ8A 3OJFA 2ACKA 3HB0A 2I3AA 1KYIA 2XGOA 1PG0A 1KBOA 1NXVA 2BKEA 2QZJA 3UW1A 2WUWE 3TBHA 1BE8A 4CG2A 1NMEA 4UJ5A 1ZH8A 2PUFA 4RELA 4EBBA 1Y34E 1U2SA 3RBXA 4AMBA 3SJUA 5KHOC 3H0CA 1N9KA 2V7QA 2IYQA 1MB9A 1RWQA 3OOEA 2PKCA 1F14A 2Q0XA 3LYAA 4H0NA 4AKSA 4IV8A 1ENPA 2D1QA 3QPCA 1YMVA 3O8DA 4LV6A 4ND7A 1GZ4A 1PLLA 5EINA 2CV2A 3M1AA 2Z8XA 3WYNA 1T2AA 2N75A 4BJ5A 4AXBA 4K6KA 3ICEA 4AG5A 3NCHA 2O3QA 3MMXA 3EE6A 1RD4A 1XYVA 3AR9A 3FDZA 3K4QA 3HKEA 1AS2A 3ZBTA 1BQ4A 1WOYA 2J85A 2PT9A 5DGCA 4C0HA 3PZRA 1I2MA 1JDNA 1V9SA 2NPIA 4K9LA 4Y0NA 4L4RA 5DASA 4KOEC 3AFHA 3SXUA 4QDJA 4QYSA 1HE2A 3IAUA 4HDSB 5ALJA 1U6KA 5KOHB 1PT8A 4G5SA 3KLPX 3KS9A 3OQHA 1YTLA 3NOXA 4IOKA 4TL7A 5A5FA 3Q87B 3QV2A 1NURA 1N8KA 1X7ZA 1KXZA 3WYAA 3GLVA 4IFEA 1MTZA 4TTJA 3U48A 3H83A 1WSBA 5AJXA 5IKMA 2PK3A 2A1TS 3WYFA 1Z12A 3DAFA 3LZCA 3GBSA 2GRUA 3X2EA 2O48X 1W4CA 4JENA 5EIFA 1E1RA 1STOA 3JQ8A 4HQRA 2ZWOA 4HNAB 5FTNA 3CVUA 3ZVMA 2GM4A 1USKA 1E7SA 1DAMA 1IHPA 3RIEA 3HJAA 3INGA 1XALA 3KFXA 3P2OA 3M6VA 2BDTA 2CB9A 2XF2A 3T7KA 1PQPA 2ZAGA 4LDQA 4RZSA 1WM1A 4EELA 1B6SA 5ALHA 4XZ3A 5BN4B 4CMAA 3ADOA 3ZE8A 2C77A 4K8RB 3IPCA 1RXUA 1PK8A 2AVDA 3IKJA 2B20A 3PGVA 1C3OA 4MI6A 1RWKA 4FVTA 1L7NA 1X2BA 3K20A 3STXA 3RJ9A 7MHTA 1NA5A 3H5LA 2Z30A 3JYLA 4ARVA 4L27A 3WIOA 4UOEA 4KFSA 4EJ2A 1XZGA 4R54A 1JIKA 2DULA 3AHDA 1W2HA 2KI5A 3WAKA 2XUZA 2XTZA 5U4QA 4YECA 2O5EA 3ND7A 2R6GA 3COZA 1GPLA 5H0IA 4ZQGA 2GZRA 1UJ4A 4ARZA 1UH5A 4LQLA 4N6NA 2GN8A 4QAQA 2QVYX 3G2OA 1QRAA 3V9AA 6AT1A 4LHSA 4FS8A 1R15A 1CUHA 1OHHA 1VKNA 1YE5A 1NJ6A 2E87A 4A15A 2XB9A 3ICWA 1NAHA 2ZE8A 3RBAA 1V5FA 3I4CA 1U2RA 2HF9A 3O2NA 3WQHA 3K9HA 4E15A 3OUUA 3I9FA 1O6BA 2QN9A 1TVKA 1SH7A 1H8ED 1SCIA 4KVAA 1SHUX 3SZMA 4E12A 2ZRQA 3TVTA 4AYXA 2VHTA 3DMDA 4BNXA 5ULLA 1SKYE 2EGGA 2ZIWB 4Q05A 3DLHA 4MA4A 1YR6A 2WJ3A 1T0UA 3DKVA 3FAZA 4WK0B 2WSBA 4KE7A 4A8TA 4OF4A 1L9XA 2WY2D 3FHOA 3W5IA 1PZHA 3L04A 4D57A 1TF5A 2D5CA 4HXFB 4X8MA 4RQAA 2GJKA 1FNCA 3QFCA 4NJEB 3VU8A 5BQFA 2G76A 4M0DA 4E2WA 2XXAA 3RUFA 1QB8A 1WQ1R 1IVYA 4RWZA 4DQVA 3UT0A 1F17A 1RRGA 4BASA 1LPAB 1TZJA 1ZBDA 1LB1B 1JU9A 2J9RA 3AETB 4JJEA 3BE4A 1ZLYA 4BUCA 4DCOA 1C7JA 4KPUB 1VCHA 2FPRA 5B3JC 2DWPA 3OF3A 5L3VA 2CYCA 5BURA 2ZZMA 2V0CA 3PNMA 4H16A 5IAOA 1T2UA 2V96A 3GV0A 3H5VA 1IUKA 4O2AF 2PGDA 3DB2A 3MAGA 3ZTWA 4OFBA 4PN7A 1L3BA 3FNHA 1XF9A 1RSZA 3RUAA 3HZZA 4JL5A 2FSVA 3ITNA 2FQWA 3LUBA 5T4EA 1NWCA 4Q1VA 1WULS 1FQOA 4MCJA 1C0EA 3IAFA 3EYWA 1QGYA 4UBOA 1ORHA 4Z7JA 2IOQA 4HMOA 4ILKA 3RC3A 3L7BA 2CEKA 3AOEC 3K09C 3CEAA 4PR3A 3PSAA 4EF5A 4L4ZA 4N0EA 3UK7A 4I08A 2W2MA 5FLXA 3ZHVA 1P0PA 2R1VA 2J6HA 3LUKA 3PXUA 3V4FA 2VBCA 1PUXA 4D0RA 3L7YA 4DW8A 1IIRA 2AYZA 5J4HA 5E8JA 1ZD4A 2ORIA 2QMZA 4Q34A 3T7RA 1BXKA 1UPFA 5AOCA 1U2DA 4E32A 1HG1A 3IIIA 1IY2A 1HDEA 3HWRA 4NCNA 3L7JA 3U9SA 2XGMA 1U2ZA 3VSAA 1ZO8A 4JVSB 4TMTA 4B4VA 2FZLA 1OGJA 5DXJA 4EYQA 7GPBA 1UAAA 1G20E 1G19A 3H9EO 2R0QC 2GR9A 3P8ZA 4H7DA 3B51X 3ZXYA 1OYYA 3MCUA 1H1LA 4ND4A 4A2QA 2ZRGA 1GR0A 4DV4B 3I83A 3QEKA 3AF0A 4JI8B 3VR6A 1CUDA 2AKYA 2B6HA 2EHDA 2ZBDA 4HNRA 4PQGA 3W4JA 3QVWA 1JI0A 1XAJA 4TMZA 5AMXA 4N5HX 4N03A 4DWJA 2HMUA 3E6AA 3OCXA 4GWLA 2OM6A 2PRYA 4DB4A 1IPFA 1FJXA 4Y0AA 1XKTA 1MMFB 1LS1A 1N4DA 2VH1A 4FQ7A 3VC7A 5BWBA 4OGGA 2FEKA 1ACMA 1YAHA 1ENOA 2Q6VA 2OD7A 2Y8EA 4G25A 4MINA 5ES3A 4BB9A 3F74A 1E9DA 5LD2B 2POCA 2YCBA 2P90A 4BIIA 1KYVA 1DAKA 2QR2A 5FCDA 2OHFA 2BFOA 1TMYA 2HRQA 2SICE 2Y1FA 3H3JA 3HMQA 3LP6A 3QVUA 4JSYA 4DA6A 5LZ9A 2XLBA 1W34A 3X2SA 2B7CA 1PJ3A 1NIPA 1D03A 2IITA 3MWJA 1L4UA 4OPMA 5D5HA 4F3YA 2R6FA 5LP6B 1V48A 2BDEA 3E3NA 4LRQA 2HW8A 3GRPA 2FZWA 2QG4A 2GM3A 2YY5A 4M1KA 3MJHA 5BSTA 3VHQA 5JVDF 1Q3KA 1Z5UA 5JMTA 2FUG1 4QOSA 3IAXA 4PINA 4MUYA 2H2AA 3K9NA 4ARCA 1HGXA 4WHMA 2IPLA 4BNYA 1NU6A 3QMVA 2CUZA 1TMOA 4FX2A 1KRHA 1SUIA 2PQ2A 2CLOB 1AK9A 1CZUA 2FI1A 4LX0A 3CF4A 3WLNA 5DISB 4LC0A 4D8YA 3IILA 1P61B 3K0BA 3Q88A 4CM9D 1EUQA 1GG5A 4C1BA 1GPDG 3HVHA 1Z2AA 2WMNB 4BB0A 2PBZA 2UYHA 2LD4A 3GT4A 2LR0A 3G0HA 2O4UX 4HXEB 2EBFX 2PA0A 4M9XA 3SR3A 3DBLA 1OGIA 2ZUWA 3QVLA 4QAJA 4JYAB 3ZXXA 5I7SA 2ESRA 4RABA 1GZSA 1A7JA 5E2AA 2HMAA 5I9SA 2RAUA 4JLSA 2FPXA 2JLWA 5EHIA 1QS0B 4W9RA 2PKQO 3BK7A 3SDBA 1HE4A 2A0UA 3ZZMA 4CMIA 3WLAA 1K86A 3ZE9A 3U4GA 2HA3A 2IUEA 4ZGWA 3W04A 5EFZA 2RH5A 2P2CA 1XHLA 4EY7A 3FDXA 4BMDA 1FFHA 3VR1A 1AZSC 4X7BA 4E1AA 1E99A 1O08A 2JHFA 2O2EA 4MNTA 1T1JA 1IEXA 4G1UC 2H3HA 3T3IA 3ZXIA 5MN4A 1R0YA 4R16A 1TU3A 1YS4A 5H3HA 2ZS7A 2NO7A 2FPPB 1P4RA 1YL5A 4M49A 1TYEB 5LVAA 3SJZA 3GFBA 1G4UR 4F86A 4XD2A 5ALEA 1NQXA 3EXAA 4Y2JA 5JECA 2QI9C 1N3BA 2F9LA 2G67A 2O8DA 2H7VA 3NV9A 4HX2A 3ADBA 4MVJE 3FBGA 2J9FB 2TMKA 3BJIC 2Y0EA 3O4HA 2A3RA 3PZBA 4HUQB 4NICA 5BV8A 5J2UB 1U4OA 3SPXA 5L4SA 2J0EA 4FKZA 2A14A 1IM8A 4IJ5A 1Y37A 4GF5A 1G6KA 4RVOA 3IEMA 4ALLA 4F4FA 2ZI5A 1N1EA 3AJ8A 2O8FA 4G2NA 3OESA 1M6VA 1WABA 4PYOA 1HSOA 2JARA 3W9UA 2Z1MA 3B2NA 1MPTA 5FT9A 5C46F 4QHSA 4YH1A 4JQOA 1DJLA 4K9MA 1GXSB 2G4LA 5IXSA 4JUBA 3N2LA 3OPNA 1M75A 1J0CA 4WY8A 3VNRA 1MHTA 4FHDA 1G4HA 3TQRA 2A9OA 2RMKA 1V39A 1MKYA 1YKSA 3LI2A 4MR8B 2C4NA 2OWEA 2QY9A 1KYZA 3V2GA 4HSGA 1L5LA 1Z5OA 3W4IA 1WBBA 4XVCA 5G3YA 4MROA 4ALIA 4YCBA 1SKAA 1QG6A 1TZMA 3E48A 3GH3A 4HVAA 5CXSA 5DI3B 3NNDA 4Y6SA 2X86A 4DY4A 1W88B 1XCMA 3HB1A 3LY7A 3R6TA 2OLEA 5G2OA 2JI7A 2ZREA 4BKPA 3KTAB 3HRKA 3TOXA 2FPIA 4FZVA 4K0KB 1X7GA 2YHIA 4RGYA 4E6PA 1CR1A 3PX2A 3ENWA 2PUVA 2BHRA 3EB9A 5FHQA 4LZPA 1OV6A 3NBKA 2N3ZA 4KQCA 2F64A 4RGBA 4DEYA 1V1RA 4H6XA 5ALLA 3HE3A 3SIXA 2FMTA 1VIYA 3GLIE 3Q3JB 1HRDA 2A58A 4H7EA 1A5TA 2Q07A 4R1OA 2GK4A 2ONZA 3JD4A 5L53A 1BX3A 2V8OA 2P6NA 2CXUA 1QMGA 2YRFA 4KO4S 4CHTA 1L5NA 3FJ1A 4AS2A 3I37X 1DC4A 3QVOA 2YKGA 5BW8A 2KSQA 1O8CA 2W6PA 5JU6A 2FK7A 4TSFD 1LWOA 5JCZA 4MRMB 1VRCA 3QEMA 3ZE2B 1YS1X 3C3PA 3LDUA 4EHFA 4KH1A 4LHXA 3HDYA 2XZTA 4RPCA 2JBAB 1DAEA 1D7AA 2HNKA 5KBYA 2DPGA 2YFKA 1USUA 3OT1B 2C2XA 3RWMB 4D0NA 3UJ7A 2WBLC 4HHEA 3AESA 2PWZA 3U16A 2PQ6A 5EY5B 1QIEA 2VR1A 1T6YA 2OOKA 4NBUA 4RZXA 3U80A 1OFUA 2HYDA 1EXDA 3A3KA 4YJHA 1W46A 3D4NA 1ZM7A 5KPJA 2PWPA 4LOIA 4YROA 1MFZA 3CF2A 2O2YA 5TDHA 1ZEMA 4AULA 2QF7A 1E9AA 3SX2A 3VMFA 2CLEB 3LQFA 1EBFA 3ML1A 3O8BA 4LI0A 2XDQB 1MEOA 3UHJA 1VLLA 3VSDA 1IBCA 5KKNB 3E9NA 4M8IA 3KIPA 3L0DA 3I9JA 5J59A 3W9BA 2EBHX 2PXXA 1J2YA 1W4ZA 2XMZA 3FFAA 3HJRA 4LCBA 3AVXA 3IXLA 2AXEA 5CDFE 4H1HA 4JLMA 1JHRA 3TB6A 4MWOA 1R0RE 2HLDD 1PKEA 1FNBA 4G1BA 1GN9A 2PBFA 4CR8A 2HTEA 2JLSA 3M1LA 5BUZA 5IU6A 3WRVA 2X77A 4Q9HA 3TTUA 2C4WA 3M5DA 4IGFA 4M3NA 2BCJQ 4KBGA 2VHUA 2NT4A 1EMDA 4DSZA 1UQTA 1VDMA 2Q3HA 1VSBA 2WVGA 4XX0A 2WAYA 4JJ6A 4IIDA 1CIVA 1DQNA 1TM7E 4PRKA 4LMAA 5DHAA 4ZU1X 4BFLA 2CZCA 4N1AA 4WXYB 3GLGB 2G1UA 2GCIA 1U0SY 2YV1A 1ZAYA 1D09A 1JJFA 3U9TA 2JHPA 3IT1A 4AP6A 5JNWA 1Z7YA 3EIEA 2GMWA 3GFVA 1FVFA 1LS6A 2CFCA 2GNOA 2JCGA 3AOGA 4RU1A 3AXSA 1CLUA 1Q14A 3GLFB 2XZPA 1E2PA 3FSRA 4B4OA 4HVLA 5HF6A 4MS3A 2YZKA 3WICA 3BAZA 1Z16A 5EMNA 4F97A 1MGPA 1BS9A 1GGNA 2BAGA 2OK8A 4FFMA 4QPPA 5B3JA 4AMZA 1QHNA 4MGZR 2I4IA 2IHZA 1N9GB 3C3AA 5I9BA 4LQCA 2Z9BA 4LHEA 4IMPA 1GN8A 2F6RA 3EAFA 2AJTA 3TZBA 2CXTA 2W2LD 1MXHA 3ZIAA 4ZI7A 4JT9A 1I2CA 3O90A 4KTVE 1ZGCA 3BQMB 2W8BA 3N6RA 5H68A 4R8VA 4DR1B 2HHCA 1NUAA 4OOFA 2M6KA 5A5VA 1UODA 4PCAA 1BQEA 4GAEA 4RKEA 3PNPA 4ZPJA 4D3ZA 4L50A 1I13A 3GOHA 2EX0A 2VRCD 4GKKB 1EK1A 1YRYE 3D54D 2XKBA 4CHGA 2C2BA 3GD5A 1NZDA 4HKTA 3VHLB 4TV9F 4HYQA 3JPYA 2YHSA 4KZKA 1FCJA 2Q9CA 2WIKA 3GAMA 3KDAA 2A86A 2RGWA 1ZGBA 2B7BA 3KJNA 1UC8A 4UTOA 5AUQA 1X7XA 1RADA 3P97A 3PHLA 2NO6A 2OK7A 4RHUA 2I2WA 1TUEA 4QOIA 4ZZ1A 2W6QA 3VVCA 5HMMA 2NSHA 3V32A 1S3IA 3EEBA 1XKLA 3QG1A 3QPVA 1QK3A 4ZO9A 2OXIA 1N5DA 1ISGA 5BSUA 4YRJA 1ZIOA 2B98A 1JKXA 3DOOA 2H8KA 1I8TA 2VG8A 1HTBA 3AHHA 4HQNA 3NXSA 5FO1A 1QLJA 4Q1FA 4G85A 4WZBE 5B53A 3W5SA 4Z1OA 2TYSB 1NSYA 5CT8A 1KH3A 4XUDA 2QAIA 3E3MA 4P33A 3EN0A 5C51B 3INRA 1MAAA 5TJ9A 2VNIA 3HUTA 3RGGA 3ZWMA 1KOGA 4PLWA 2HQ1A 1NSFA 3KT6A 5FI0B 4P4NA 2X0IA 3HNOA 5AK6A 5F64A 3MLAA 1XZDA 1QLWA 1TM5E 3WXBA 3M6LA 1JR6A 2EX1A 3WK6A 3RS9A 4D74A 4F2DA 3M8KA 4J0EA 1SCKA 3A1WA 4HY3A 4E2ZA 2HJSA 2WG0A 1B1CA 3CNOA 4P82A 4QREA 4MICA 3VR6H 1ND5A 4G37A 2ZRLA 4TLEA 3RPEA 4ZANA 3HCBA 3V8BA 1XN1A 2Z9CA 3LDGA 5BN5B 3U4IA 3EF3A 1WW3A 2W22A 4UUNA 1OASA 3AUJB 3DAOA 4US2R 3PDIB 3C7CB 3SHWA 1XXLA 2QUAA 3PFKA 4FDLA 1GG8A 1M5TA 2Z5GA 5LQNA 3EOBI 1NNLA 1SO8A 4NATA 5ALVA 2C8VA 1BX0A 2PGJA 1ZJYA 3IVXA 3Q9UA 4GOND 4HFMA 4NY1A 4ZVKA 5IASA 3DEIA 1BXGB 2B2NA 3NHMA 5AKLA 2W8ZA 5IJ9B 3T52A 1JTFA 4N3BA 4YAJA 4AK9A 1VGQA 4V0NA 1D4FA 3G9ZA 3UK6A 1MBZA 1VCOA 3MC1A 1HE1C 1WP4A 1OZHA 3CO5A 3QW4B 3AVTA 4F1KA 2D0DA 3V2IA 4B46A 2DRIA 3MTDA 1PS8A 4BOYA 5JXIA 2BZ1A 3OUZA 4M6WB 1QE5A 3USZA 4B7AA 3QLVC 3AVPA 2XE4A 5KJ1A 2Z1NA 3KUKA 3NKFA 1YS7A 4JLUA 2RB5A 3A9SA 4X1IA 1KFJB 3AC0A 3BHMA 4BJHB 3CUKA 4DCJA 4BYMA 5L3RA 4CM5A 4DLNA 4HNUA 2R8EA 3JVUA 2CFIA 4BDTA 5DEOA 3DDWA 3FJYA 5KZMB 1KORA 3F97A 3KSUA 1UBTS 1IHDA 3ROXA 3RSFA 3RYCA 4MUEA 4A8JB 2X40A 3RS4A 2HL6A 1QB7A 1LLQA 3ON5A 3FGOA 1VE9A 1P2GA 1CQWA 3OTGA 2A9KA 4HBGA 4D9JA 4EI9A 1ADYA 1F2VA 1N1GA 3C5WP 4JZKA 2RK3A 3AEQB 1P0IA 2GCOA 3DXXA 3I34X 1ZLXA 1C1DB 4LNUB 1MOPA 4JOSA 3M1IA 5FPPA 3L8HA 3CH5A 3L84A 4UARA 3STHA 1VTKA 2NZWA 4C4OA 4DA9A 4POOA 4IL5A 4ZOCA 1MENA 1L5HA 4GP7A 4HGRA 4B84A 3P0RA 2V59A 4YT2A 4ZT5A 1NI3A 4IVPA