1U0SY

Chemotaxis kinase chea p2 domain in complex with response regulator chey from the thermophile thermotoga maritima
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In different organisms, the mode of interaction between two signaling proteins is not necessarily conserved
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 43
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u0sY00
4MS3A 1DP4A 1LBHA 2FN9A 2GBPA 3O1JC 3IPAA 3H1FA 3EULA 4Z4IA 1P6QA 4RKQA 3N53A 2ID7A 2JB9A 1KRXA 2FTKE 3K4HA 2NZVG 4NCAA 2ZWMA 3HCWA 1NTRA 3UKJA 3CHYA 4RWEA 3F73A 1DCMA 3QLTA 1DJMA 2DRIA 1Z26A 5IUKC 2PE5A 4LE2A 3FMVA 4RV5A 2PUFA 5DTEA 1NXXA 3MIZA 2P9HA 2M98A 3SM9A 1RZRA 1ZH2A 3TB6A 4F11A 3O1IC 4LDZA 3QLVA 3OM0A 3M9XA 5KC9A 1DBWA 2FQWA 3LUAA 4PZ0A 1ZHHA 2PAFA 3KYIB 3O75A 1K68A 3FFWA 5EWJA 1EHCA 5HQJA 1JYFA 1KMIY 3MYYA 5IC5A 2F8TA 3TMYA 1SXIA 4TLMB 3BBLA 3D02A 3QEKA 4RK6A 1OXBB 2MYPA 4JB2A 5CNMA 4E7OA 2L18A 2P4UA 3C3WA 4MLCA 4MS4B 3OLYA 5JS1A 1ABEA 2QW1A 1MAVA 1ISSA 4YS6A 1JFSA 4PE5B 1ZGGA 4Z9AA 5JNWA 5KQGA 1AB5A 2B1JA 4FE4A 1Z17A 3N6VA 4KNYA 2E4VA 1ZY2A 1MB0A 3BILA 2FMKA 3FDFA 3MF4A 1ZVVA 1NXVA 4LDAA 5GQSA 1NXTA 3MMNA 1C4WA 2E4ZA 2LBPA 2R47A 3Q15C 2JVIA 3LUDA 2FEWB 3NBMA 4JASB 4KVFA 5DGCA 5EWLB 4KQCA 2HQBA 5DLEA 2MYUA 3QEMA 4EY3A 3TX6A 5CNKA 2ZAYA 3GWGA 3N75A 1NATA 2QXYA 5KQPA 2MSLA 4GPAA 1QQBA 3H5TA 3KYJB 3H6GA 2E4YA 3F6CA 4RSMA 4Z4GA 1Z15A 5TQ2B 1DBPA 3ROTA 3RVPA 3HM9A 3UUGA 4Z4EA 3JS5A 1PEAA 4ZMRA 3EODA 3EGCA 2FW0A 3SY8A 3JY6A 4G0PA 4JA2A 5KQLA 4M88A 4RY0A 3N0XA 4W5NA 5EWLA 2LPMA 5JNSA 1USKA 1Z12A 3DZDA 5D2CA 3RVOA 2GX6A 1E6KA 4RXMA 3H5OA 3OLVA 2L19A 3R0JA 3VNAA 3TO5A 3H1GA 3HSYA 2RDMA 3Q7TA 3QLUC 2V0NA 4XARA 3VNBA 1SD5A 2FLWA 3QX9A 5I4CA 1ZDMA 5T3YA 3CG0A 4IF4A 1F51E 2GI4A 3GRCA 3LUCA 4KZKA 3HV2A 4F8JA 2O20A 3G85A 3CTPA 1LBIA 1T34A 3OLXA 4XFKA 2RJNA 3CFYA 1BA2A 4KK4A 4EYQA 2MSKA 3K9CA 4O1HA 4EVSA 2JVJA 3O74A 4KPYA 2Q5CA 3NHZA 2PMCA 2A9RA 2A9OA 3I42A 4MAAA 4HYEA 2R25B 3QX8A 3KS9A 2FN8A 1Z2DA 3IPCA 4RKRA 4MR7B 4D6XA 4G0XA 4KV7A 3JPYA 2IPMA 4RK7A 3KKEA 3H5WA 2AYXA 1ZGZA 2JK1A 1JF8A 1JFVA 3N0RA 2PLNA 5FWYA 3L6UA 1JDNA 4EUKA 3FFXA 3O2QB 1B00A 4G0MA 2I6FA 4KMRA 1PNTA 2E4UA 2VUHB 4MR8B 4LRQA 4DN6A 1DCFA 3A0RB 4G97A 5BQ3A 1IIBA 4HNSA 3ILHA 2PUCA 3LUJA 2XDYA 5IEJA 2JRLA 4LX8A 4S05A 1SXGA 4TMYA 4Z99A 3A3KA 3OO1A 4ML3A 4OLBA 4MQFB 3CZCA 1DZ3A 2R4QA 4QPJC 5FBHA 1BDJA 2B4AA 3KCNA 5F64A 3T38A 5C5EA 5KQMA 5DCLA 3NNDA 3S99A 4D6YA 3Q7RA 3GYBA 2E4WA 3O2JA 3IP9A 3C3MA 3QK7A 5IULC 3KG2A 3QLVC 1APBA 1YS6A 1TM2A 2CHEA 3G1WA 1EAYA 2OQRA 1GLGA 3LUKA 3I5AA 4RS3A 2QVCA 3H5VA 3H5LA 3NHMA 5JNVA 2HPHA 4EVQA 3M9WA 1EWTA 3FFTA 4G0QA 4XLTA 1DCKA 2VK2A 3Q9SA 4KK3A 3NNNA 1LJLA 2LIVA 3HEBA 3RVRA 4G0OA 1H9CA 4WXMA 1I3CA 3KJXA 3A0UA 1GUBA 1VKRA 8ABPA 4HNQA 2IPNA 4FE7A 3ROFA 1YMUA 2MYNA 1ZITA 2IKSA 3HJFA 4RK4A 4YRZA 2PUAA 3SNKA 4N76A 1ZN2A 2WJWA 3A10A 2R48A 3DLHA 1U0SY 1FFSA 1PHRA 1GCGA 2FLKA 1BDIA 3L49A 1DRKA 1FFGA 4P1ZA 4KFCA 1GCAA 1A0OA 2FVYA 3HZHA 2CWDA 4YP9A 5EWJB 5BRAA 3QELA 1U8TA 2KYRA 1PNRA 2CD7A 2FMHA 4WZZA 3M6MD 4MS1B 3B2NA 5FBKA 4YV7A 3DLBA 3CZ5A 4G0YA 5IEBA 3H75A 4H3HB 1F4VA 1XWWA 4MQEA 4WUTA 1U2QA 3MQ4A 4Z0NA 2YHBA 5CNJA 4QYWA 5B3JC 3E3MA 2W42A 1YMVA 4F06A 5EWMB 1YK1A 4UHKA 1NXWA 4EYOA 5HKOA 2L17A 1KGSA 2PUDA 3CU5A 4WXEA 3QEMB 2WMYA 1QKKA 3BREA 1MIHA 2J48A 4Q6BA 2H3HA 3H1EA 3QLUA 4TLLB 3GBPA 1PEYA 3CNBA 4ETMA 2LP4Y 2WY2D 3OMWA 5ED4A 3RVJA 1YS7A 2VYCA 3NNSA 2IOYA 4ZMSA 1USIA 4FB4A 3HS3A 3RVSA 5IBQA 4XASA 2GWRA 5TQ0B 1DC8A 3OO0A 4MR8A 3LTEA 2FEKA 2H0AA 4CBVA 3O1HB 1QO0D 1QP4A 1RXEA 4DQDA 4N47A 3F7NA 3UK0A 1D2AA 1EWKA 2GKGA 2NT3A 3KHTA 2TMYA 3W9SA 4EGSA 4QYMA 4MRMA 1KRWA 4JOQA 4NV3A 1JLKA 1D1QA 4D74A 1E6LA 1YTUA 7ABPA 3HUTA 1LK0A 4ZJPA 1C0EA 3IP6A 1Z2EA 3KTOA 4MR9B 4EYGA 2PKXA 3E61A 4W5OA 1D4ZA 3LKBA 4RK5A 1P8AA 1TJYA 1WETA 1FQWA 2PUGA 1RPJA 3GA5A 3O21A 3KLNA 4YGXB 4JP1A 1TLFA 3LKVA 3JTEA 3N8IA 5TQ2A 5BRJA 1JH9A 4IMJB 5JNTA 1QP0A 4W5QA 4YR7A 1URPA 3FGZA 5C5CA 1USGA 2FQXA 4IILA 1RXIA 1M2EA 4F3TA 2VUIB 4WWHA 5TQJA 5IUJC 3I09A 5TPWA 3OMXA 1CYEA 2RJOA 3DBIA 1JDPA 4NCBA 1JFTA 1EWVA 5ABPA 3SAJA 5FWXB 2OENG 5KWSA 5IX8A 2IPAB 2E4XA 3H6HA 1QO0A 2FXIA 4MYRA 4O5AA 3CLKA 1NXPA 3MM4A 1NXSA 1ABFA 2L2QA 2WJAA 1JWLA 4O1IA 1SRRA 3OLWA 4PEVA 5HM6A 2PUEA 4KRFA 4OLAA 1QNLA 4KQ9A 4H60A 2FMIA 1J56A 3CS3A 1ZAYA 4N0QA 4H3KB 3BRQA 2PL9A 4MR7A 5JNUA 2JBAB 1JL3A 3KSMA 3F6PA 2MSWA 4YO7A 3SG0A 4WT7A 4YCSA 3OQMA 1P6UA 4YLEA 3RVLA 3RVKA 3HDVA 3TD9A 4RK1A 3OM1A 5TPZA 1RZRD 4YWHA 2JCGA 3EQZA 1Z25A 1BAPA 3OLZA 3HXMA 4MS4A 1A2OA 4GNRA 1SXHA 3CG4A 4N03A 4Z9BA 2WWVD 2AYZA 1L5YA 5TPZD 4NICA 3O2SB 2PJUA 2NUBA 2M1ZA 2HQRA 3IP5A 3LUGA 5KC8A 2A9QA 4G86A 1VPWA 1RNLA 1NY5A 1VRVA 3QELB 2N9UA 1JBEA 3C6QA 2X7XA 2JVKA 3GV0A 3LUFA 3JVDA 1E6MA 4MGEA 3CRNA 4Z4FA 1NXOA 1LJUA 2WB4A 1EFAA 1MB3A 1U04A 3MA0A 4PYRA 1BDHA 1ISRA 2IDMA 1S8NA 4DADA 1DC7A 4OG2A 1R8JA 2HSGA 2MYTA 3IDOA 4L85A 1DBQA 4MS3B 1YK0A 5CNIA 3D8UA 4LZLA 1UDRA 4N0PA 3GT7A 4RZSA 1JX6A 1PUXA 1DRJA 1OXKB 2FMFA 4RXUA 5GOTA 5B3JA 4EVRA 1CHNA 3JVIA 1ZH4A 4P98A 3RVQA 4EYKA 1YVUA 2F8SA 1DG9A 4OATA 2ID9A 3OQNA 2QR3A 3H5IA 2HJ9A 4MQFA 3RH0A 4ZPJA 3HUUA 1QQAA 2YHAA 1U2PA 2IPLA 2NZUG 3I45A 4G0ZA 1M2FA 4Q7EA 4Z4HA 4IGAA 4LE1A 1BVHA 4Z4CA 1Z13A 3C3KA 4RY9A 4OBBA 2QU7A 3C97A 5E3JA 1QMPA 3RVMA 4LE0A 1XHFA 1Z16A 1VLZA 1K66A 4JB0A 1GUDA 5TQ0A 3RQIA 3T95A 3URMA 1D1PA 1MVOA 1QPZA 3ILYA 4PICA 5JS2A 6ABPA 1CEYA 4XAQA 4MR9A 1W9HA 2QZJA 3CKMA 1L5ZA 3HK2A 3EDCA 1M5UA 3Q7SA 5TE9A 9ABPA 3RVNA 5HSGA 4NQRA 2WRZA 4QICA 1Y1LA 4MRMB 3OQOA 3T6KA 2QSJA 4ETIA 3Q41A 4RDCA 4UHJA 1YIOA 2FEPA 5PNTA 1JHZA 4Q6WA 3JPWA 1FFWA 4IMIB 5FWYB 4MQEB 1P2FA 1TVMA 3P9YA 3LUHA 1QP7A 2A9PA 4KREA 3T8YA 4OTZA 4MLDA 1FSPA 3IP7A 3KLOA 1AB6A 3HDGA 1E2BA 3EJWA 4W5RA 1HEYA 2RGYA 4IRXA 4MS1A 3HO1A 1TMYA 5FWXA 4ETNA 4MPTA 2JBAA 4Y9TA 3EAFA 3SQNA 5TPWB 2NT4A 4B09A 4JAVC 3N0WA 3DGFC 5KI6A 3BRSA 3LFTA 3GL9A 5JNRA 3HVRA 1XHEA 5DKFA 1W25A 1A04A 4L4UA 2FQYA 3GBVA 4RXTA 3LMKA 4TN5A 1M5TA 1ZESA 2LUOA 2FKAA 4E7PA 4S04A 2QV0A 5T7BA 2CHFA 5CHYA 1Z18A 2HQOA 5EWMA 4F12A 6CHYA 5IUNC 4N41A 1D5WA 5BR1A 1JYEA 3EQ2A 4HNRA 4XXHA 4RK0A 3LOPA 2FSPA 3DGEC 2IYNA 4W5TA 2PUBA 2PL1A 4ZYLA 2QVGA 4RY8A 2BGGA 4RU1A
chains in the Genus database with same CATH superfamily
4IKOA 3IKTA 2FN9A 4JYAB 2O50A 1GPWB 1QHSA 2VWQA 3NRBA 3PVZA 3PUWA 1HTTA 3SHFA 2EJBA 2EZUA 4QVKA 1GZVA 3DE5X 3SBDA 2GH1A 3M70A 4L8LA 2PO5A 4PC6A 1QP8A 2B5OA 4J49A 2FA9A 2JGMA 3HJAA 2BJWA 4URFA 3V8NA 2FPGA 1QFXA 1U2RA 3ZDCA 1ISHA 2CXQA 3ZPXA 2NZVG 5J4YA 1SHZA 2IU0A 3RKUA 3I30X 3ON5A 5SYNA 3G6KA 3TMKA 3A4YA 2GN8A 4RTMA 1H4QA 1YR2A 5K8UA 3KNZA 4DLSA 1WPXA 2DHCA 3ORRA 5TT0A 1N92A 3OH8A 1AURA 3RR2A 2PV0A 2PKRA 3SM9A 5HRUA 1ZH2A 3UTCA 3VTKA 3NHFA 4G1CA 5FL7A 1HFKA 1HFEL 1AKVA 2BGIA 1EK6A 2GCNA 2P1DA 3MG9A 4I14A 2A5DA 3SDBA 2XB9A 4GGPA 2OO5C 1R4NB 2G36A 4U2FA 1DIBA 4MO2A 4I55A 821PA 1P4GA 1R9JA 2PD3A 4JR1A 1FNNA 4TLMB 3BXFA 2IE8A 4JYPA 1P1BA 1Z3IX 2MIIA 3L0BA 4Q1VA 4BCCA 5IANA 1TJ4A 2X19A 3GZTB 3NIFB 4P3OA 1Z8FA 2HV8A 2P65A 2JEYA 2YN4A 2ZSAA 3TI9A 5KSOA 3ESQA 4K6KA 1GZ3A 4JJGA 1A8UA 1F06A 3PF8A 1NL3A 1TQ8A 2IYFA 4XM1A 5JR3A 4WCVA 4I81A 3HVHA 2IY9A 3LBNA 2ZAMA 4C3UA 4K2AA 2Z6AA 4V0RA 4ZAZA 5LIPA 1DPGA 1WJGA 5AKJA 3Q98A 3TOVA 4B6FA 5AVZA 4H35A 4OUDB 4EEKA 4FBLA 3O5AA 1ZY2A 2GAFA 3K70C 3N2GB 4EBFA 2Q4OA 2Q5HA 2R6R1 3SIWA 3UJBA 4EY8A 2A1TR 4RTNA 2FEOA 4LW8A 1GGEA 3WG9A 4E30A 2O8CA 4X63A 2QQEA 3CLUC 3MMNA 2WTXA 4LQLA 2E4ZA 4HAUA 5C32A 4P0PB 2FEWB 1S9HA 4ALNA 3QPCA 2LXNA 1NVDA 3QEMA 3TX6A 2VJKA 1WUYA 3G2JA 2OXTA 3N75A 1KK2A 2YWDA 5EIOA 1ML4A 4EF6A 4F2DA 2QI9C 1BXKA 1LLQA 2H4WA 1S2GA 1SBHA 5LLDA 1R12A 1ZP6A 1VIVA 3QWIA 4MKZA 3QYJA 4LJ9A 4O59O 1CB0A 4KWIA 4WX2B 2WK1A 2VBGA 2W6JA 3CWQA 5E0OA 4UXHA 3WRYA 4D41A 1FX0B 4MWBA 5ES3A 1FRQA 2AKAB 2CBZA 2ET6A 3DDZX 2ZBEA 13PKA 5EWLA 2LPMA 3ROKA 2PX6A 1E77A 1MOZA 2H1VA 3L8EA 1E6KA 3A2KA 2CN1A 3EDMA 1LFDB 2VDLB 1E6EA 1JVNA 2Q3DA 2W83A 3CF0A 1SZCA 4IJMA 1GL6A 1YGPA 3VYSB 4ZDKA 4ZOQI 1WCIB 5FTMA 4WASA 1CS0A 2NN3C 2AQHA 2RAPA 3UJ9A 3VDXA 3S7ZA 3SSAA 1G59A 2EL9A 2Z9BA 4O6VA 4DQXA 3HYLA 4J43A 1BEEA 3DJFA 4IF4A 3GCZA 4XJSA 2FG7C 1AY0A 1PL6A 1LU9A 5JO0A 2G63A 5HRAA 2R84A 2A6PA 1V71A 3CTPA 3OKCA 3W8EA 1Z47A 2EAUA 2AXNA 3H9QA 3SFVA 4ZI7F 2AZMA 2ZJ7A 4EYQA 1USVA 4M0KA 2JL1A 3WQHA 4UHBA 3K9CA 3AZQA 3FZEA 1NP7A 4XWYA 3SQXA 1R50A 1K8ZB 4X61A 1IOLA 5EZ5A 3E7PA 1XDZA 3IC5A 3AO0B 5DRTA 4AJ2A 2NX2A 1KDZA 2HD4A 4I08A 4IKEA 2FE4A 3S70A 1PW7A 1P1RA 1R4MA 2OQVA 4F71A 5DRYA 1AC5A 3GYGA 3JPYA 4NEQA 4CM8A 4C7BA 1HF3A 1T9GS 1IMJA 3EWAA 3NWJA 2N1MA 1JF8A 2GYYA 4IQ0A 4CV1A 4YQZA 2DFTA 2OAEA 3M4XA 3R76A 2FGJA 2AB0A 2OL4A 4YT4A 4BZQA 2O2DA 5EMLA 1P7CA 1Z0JA 1VLQA 2RGEA 5D8DA 1WULS 3EK2A 2WFAA 3HTXA 1K5GA 3NC0C 1UBLS 1UBUS 3G5TA 2FR8A 4EF5A 1S2MA 4K9KA 4YBRA 4BIIA 4TRMA 2QTWB 4C29A 2J8ZA 4EA7A 5C81A 4TV9F 4JLKA 1AF4A 2EGHA 2EBFX 2AMVA 4D9JA 1O0CA 2BDTA 3DO5A 4ZV9A 4FSXA 3H8JA 1FE8A 2I5PO 2OHXA 3CZCA 3OCWA 4HH3C 3P1JA 4QPJC 4C7KA 3NI2A 1ZMRA 4WGFA 4KE6A 3MS4A 1CUCA 1NE2A 2FDCA 4RHXA 3ZHCA 3UUWA 2VP4A 2J0SA 4KR6A 3HN7A 2CHEA 3PK0A 4TKLA 2PWYA 2YMMA 4B9EA 3EQ8A 4E08A 3OZDA 3SQWA 1YIDA 2A1UA 2CB9A 1N7IA 2C3MA 3I5AA 4RYLA 3WKDA 4QPDA 5CTJA 4M1ZA 4OPMA 2JLWA 1FTGA 1ADYA 5E6RA 1SVUA 1V8DA 1LJLA 3U16A 1H9CA 1SOUA 4WJKB 3WICA 2I6QA 2ZYIA 3DKKA 1G5RA 4L5JA 1K9SA 4E12A 5IDWA 3I8SA 1M8GA 4G5SA 2O2SA 4FOPA 4K28A 2HA7A 4OM8A 4UHFA 4C05A 4KQMA 3JQ8B 1AS3A 1O95A 3OX1A 3KOMA 3AQ4A 3C24A 3Q2IA 2MYNA 4BC1A 1CUEA 4IHJF 4EFNA 1QLHA 1ZL0A 1LRJA 2QIPA 4X66B 1CYDA 1PWYE 1AV6A 2WJWA 3A10A 4NMHA 1W94A 3M49A 3OICA 4EG8A 3KSZO 2Z9DA 2HU8A 1H2ZA 5KYUB 1FF9A 3ZTYA 1UWVA 5EESA 2JFXA 1ZGCA 4TSFD 4ZVPA 4DV7B 4A0QA 3GARA 3WK5A 1CJUC 2GA9A 3CC8A 4HUTA 2F3PA 2Q1TA 3EOAI 4OM7A 1X1BA 2XCRB 3MUEA 1A0OA 1DXHA 4NG4A 1RAFA 4R8RA 2MWMA 1IVYA 3QE0A 1L5WA 2JJ1A 4FGJA 4JUIA 4KC0A 1TZJA 4FT4A 1SB9A 4NAUA 8ADHA 1GQSA 1KZ7B 3ZGNA 3KKZA 2M6SA 2PUVA 3GMSA 1RC1A 1M6EX 4G0YA 4M54A 2BOVA 2UDPA 3ZWMA 4YCNA 2BFCB 3PITA 4FLEA 5K1ZA 4KKVA 4RVGA 3MJEA 5F7ZA 3GNLA 1W4CA 2HF8A 2I62A 4RM3A 3D31A 4Z49A 3T4UA 4U39A 4D8XA 1SG0A 4CW7A 2VQFB 4B4OA 3ZHTA 2FUG1 3LQ1A 4EUNA 4ZHQB 5FD8A 2WMYA 3RLFA 1PQUA 1EUDA 1H5UA 2VUSA 4H6WA 3K5PA 5T8KA 2W2XA 2Y4OA 5H59A 3UMRA 1E9AA 4EUFA 1KC1A 3EVEA 1I4DD 1G66A 1K98A 3K1AB 4JROA 5HM8A 1I7QB 1V37A 1EB9A 3A9WA 3HS3A 3PEEA 2BKEA 3QFFA 4B31A 4UUQA 1JFFB 1K7YA 3KAQA 1KE2A 4HZUA 2MCFA 3AWDA 5DBHX 5K20A 1ZSNA 1YFKA 3FRIA 4P7BA 4BZZA 4QREA 2EFDB 3ICEA 1W1WA 3M2TA 4JVLA 3SJBA 1Q1GA 3DMFA 4F5WA 5I5GA 2XCTB 4BJ5A 4U9IS 5IYZB 1JEAA 1KRHA 2GN0A 3VOSA 2BRUA 4G1FA 5E6UB 2Y1EA 1XTJA 3AJAA 4HQRA 1TNDA 1A8SA 3KYDB 2ZP1A 3U1TA 2YN0A 5A5EA 1HC7A 1OWNA 4LXHA 4MLZA 4PGHA 4BNZA 3E3OA 4MX8A 1GTRA 2GZ1A 1DQRA 1PNOA 4GX2A 3E82A 1FX1A 4YAUA 1G41A 1UWCA 2QNRA 4EYGA 3JRWA 1FXUA 4OHCA 3EGWA 1FXWF 4PO3X 2XA9A 3PKJA 5DHSA 5T41A 3NTXA 1SBYA 3AKEA 5KYGA 4P0QB 2HMSA 5ALEA 4PFQA 4L78A 1PJZA 2JGEA 5D84A 3UHPA 4H0FA 4J0HA 5JO9A 4INOA 2NXJA 3KYCB 5HIIA 3ZVLA 5AK0A 2RH9B 3SS9X 4BJHB 4ZIRB 4V1CB 3BMQB 3CJRA 3R74A 3K0HA 1J1ZA 1CF4A 3EDQA 2FPPA 4OK3A 4Z3DA 4IUCS 5ERGB 1VJ1A 1CNMA 1JHOA 3GT3A 5L7YA 3ZHQA 4ZN6A 1NKSA 3PICA 4NZNA 1JR4A 4D3XA 1EP1B 5KTPA 5AW8A 1CC1S 4MW5A 3M89A 2JHPA 3A8TA 5EIFA 1E79A 2RI1A 1L1FA 4R8MA 2XYHA 5FPHA 2F9MA 2YJ3A 5KOHB 3IVMA 1KY2A 1NC3A 5A4JA 1CF9A 3LZDA 4K6HA 3NG1A 5FA6A 1IATA 3MWDA 4E94A 1NRXA 1TIBA 4NZYA 5CITA 3A4LA 1GDDA 4G5OA 3CUTA 1U2ZA 5SZIA 4D9CA 2EGGA 4P82A 4CIAA 5EIAA 4DCGA 5FR2A 1B6RA 1LSJA 3QLEA 2H4YA 2Q5FA 4YRTA 2Y3IA 3WWZA 2Y6UA 3WK9A 5A6VA 4ZAXA 4YV1A 3PQFA 3PGLA 5GY7A 3LHIA 3KSMA 1Y9DA 4YO7A 4YP0A 4BUCA 4YCSA 3K1TA 3KJEA 5EMKA 3I5UA 1MPXA 3Q3VA 4KYIB 2AFRA 3STYA 4HDMA 1KIFA 3P8ZA 2Q4DA 4PRYA 2YY6A 2VOEA 1DS6A 2Z2KA 4P6VF 4TWZA 2HXYA 3MWYW 4WZ6A 1EU1A 4FMPA 5JARA 5JLJA 3QPUA 1K3FA 4XGNA 2C95A 2Y0BA 2QOEA 1THMA 3WL5A 4EHLA 2PX2A 5BVGA 3TOCA 1UBJS 1NWCA 2JKYA 3CG4A 3LX6A 1NAIA 1JHXA 4KCGA 3GHYA 2JGLA 2ODWA 2B1RA 3WYFA 5KYTA 4K9OA 3DXFA 3A4TA 4MVJM 2NUBA 1VCOA 2ZBRA 1C9KA 1X77A 2QF7A 3RAPR 1AZSC 3KQUA 1ZUIA 1VPWA 2REQB 4LUCA 4Q3NA 5C0OE 4AKGA 1QYRA 3A3YA 5GJCA 2JLVA 3MT7A 4E15A 1JECA 2BFDB 1H1TA 4O2AA 2RHGB 1VSBA 4BNHA 1Z74A 4NBTA 2NTVA 4A91A 2HC9A 4YAEA 2Q9BA 3MOSA 3LSTA 1NXOA 4N8EA 1Q7CA 3TEJA 2ZDGA 3D4NA 1MB3A 4BAUA 2JIRA 5HK8A 1EEHA 5JBQA 1YZ3A 1R6DA 2UVQA 4OXRA 1XDGA 2CMGA 3WZLA 4QATA 4INAA 2YNMC 1LQ2A 1YHZA 1XD9A 2QY9A 5KNBD 3GCDA 1YHYA 2VP9A 3MJCA 3K1ZA 1NTOA 2X6QA 4YQFA 2VKQA 2G09A 5C4GB 4E5DA 3AVTA 5CM9C 3A11A 4CTNA 2R1TA 3R1IA 1D6NA 1CRQA 4ASUD 2BGUA 4OATA 2Q8PA 1RI2A 3RS4A 2WSLA 5EEGA 3H5IA 5HVNA 3I1JA 4NHOA 2QRUA 2CUTA 4DV3B 4BY9E 1DMSA 2EZ4A 3NOOA 2JANA 2L0XA 3OWXA 4PNEA 3MOIA 1L4HA 2HCTA 2PSFA 4CQNA 4LE1A 5CG1A 3V4OA 1V16A 3S2EA 4V0OA 3FOCA 4CU5A 2QVZX 1BHJA 2GEFA 4HXEB 4ND8A 1Q0UA 2HA0A 9LDBA 3Q0IA 1H0SA 3OTGA 3U61B 5A0VA 4U2KA 1KI7A 4DAEA 1QTQA 5F9FA 2OK7A 1GRNA 3FCEA 3BULA 3H7AA 2BMDA 4LRSB 2PKWA 5B3KA 4IGEA 1NVVQ 2WP0A 3NPMA 2H1LA 1SR8A 3GD5A 2UZIR 2PZBA 2EFGA 1ZMBA 3FNRA 3NAGA 4F3YA 1HSOA 4Q12A 1TQHA 3O26A 4IP0A 4LX0A 4NQRA 1XQXA 4DCPA 1Y1LA 2QN8A 4FHCA 1RYYA 3LX5A 1C9DB 3WYCA 4JNCA 1YIOA 2VJAA 4LNUA 4D99A 1JHZA 3ADCA 1Z4NA 2BJHA 2V7EA 2IHVA 3FDJA 1AIPA 1Y6RA 2X5NA 3LOUA 2FU5C 3LOQA 1V8FA 1V4NA 4IDNA 2D2EA 3IP7A 4MB0A 4R2KA 4DF3A 4DIUA 1JTFA 1HEYA 5LM3A 2XODA 5KHLB 3V4RA 1OA0A 1FFYA 1Q91A 3LHDA 3P9PA 4EW6A 2FN3A 2C1XA 1L4FA 2JLQA 3D5QA 4X6LA 2ZT7A 2PL5A 2WWYA 1Z0IA 3DOJA 1Y6FA 1TYDE 1LLFA 1DOHA 4KO1S 3LMKA 1E2LA 1NA5A 2C2MA 2IDKA 2WJ6A 5A5FA 4HLCA 3UAGA 1SZPA 4NNOA 5J2UA 4P2BA 1Z18A 4ZTUB 1I2ZA 3ADPA 5KIAA 3SM3A 1VG1A 2JBWA 2ZLBA 4GZ3A 4W5TA 1ZNXA 4GP7A 3LECA 4AF8A 2CLFB 3ECAA 4R1UA 5JS8A 4X6UA 3QNUA 4YROA 4WA7A 3IUMA 4BMVA 4EX7A 2GXAA 4GR9A 3PD7A 2WJ4A 4QXOA 1MX1A 1E0JA 1PR5A 4FI3F 3LF2A 5JZ9A 3GRYA 3IB6A 3C8HA 1T0BA 3MW8A 5ISMA 2GTIA 4HDNB 1ZR4A 4WFIA 3H19A 2I4TA 3GPDG 1LW7A 3HCWA 1EDZA 1WB6A 1Z75A 2PMWB 1NTRA 3L4EA 4FOLA 3AILA 1F3LA 1YB6A 2H57A 1LBTA 2C5SA 2JGJA 3C3CA 3BG5A 1D0VA 3ETDA 3P0HA 4JLAA 4ZVUA 5JWRA 1IUKA 5TS3A 3INNA 4P84A 4XYBA 4MWZA 3KIPA 1OHHA 3VV3A 1Q92A 2X7HA 5IG2A 1YI8A 2X4DA 5DTEA 4EYEA 1AK2A 5CIQA 3FOFC 3RS9A 4Q3LA 1PG0A 1TF5A 4FMBB 5BNWA 3GEBA 2O8NA 3ZJVA 3SYLA 3QLVA 3PYMA 2NTYC 4QRIA 2WPNA 1AQLA 3UO8B 3W2FA 3BRWD 2H52A 4LV6A 1G2OA 2PKQP 4QQRA 4PZ0A 1JJVA 1HNNA 2XQIA 4NULA 1HKHA 3AEYA 3LUPA 1WIWA 4HNAA 4X92A 4CDNA 1TAUA 1Z7EA 4JL5A 4DR7B 2KM1A 2YV1A 1LDNA 3PQDA 1YZFA 2AE2A 3HG7A 1QX3A 5AKHA 4OX9Y 3D0KA 3G8DA 1F0PA 5AI9A 4RZXA 3AKDA 5CNMA 5FO1A 3EA5A 4D0LB 4ZGWA 4MS4B 1LA2A 3RYIB 4LXTA 1XELA 1RVV1 1KJZA 4IDDA 2RB5A 1F60A 4C88A 1DXYA 1NX6A 4LMRA 2Y4NA 5KQGA 2NUPA 4ZQGA 2IEIA 3CCCA 1JLRA 4IY1A 3LA8A 2ES4A 4E32A 4FKZA 1QE5A 1JFFA 2QMUA 1PFGA 2G25A 2GD2A 3R3SA 1U0LA 4N6NA 4OXIA 2B82A 2HA2A 5EIBC 1R3UA 1KR5A 3FCYA 2QRPA 1JFLA 3ETNA 1GAQA 2O1EA 3UJHA 3OHPA 1DKOA 1KI6B 2GYVA 3TAHA 3ITEA 3NWBA 2P1ZA 1CQJB 2VYFA 2ZSFA 5ENZA 4EELA 2W6MA 5EWLB 4C0HA 2DPMA 2VJDA 4CMEC 4BQEA 3CMCO 1D8TA 4TQAA 2N75A 3WBJA 3VKHA 2BFAA 4EHJA 1RZRD 4K3VA 1NATA 3NYWA 4RMNA 1K63A 4AJ9A 1QZUA 1QYWA 2QMQA 3K8OE 4F86A 3KT8A 3FNIA 3PEYA 5KYWB 1DI0A 4Q3CA 4CLRA 5C53B 2KWIA 3ODPA 4HWPA 4PFJA 2EW1A 1NJSA 4TXJA 1IVNA 4EZBA 2NAPA 2X41A 5DHPA 2D0PB 4D3FA 3PF9A 2GVZC 1J0BA 2OHIA 4AIRA 1PO7A 5FYQA 4DLUA 1WDTA 1ZSVA 4OK6A 2BBSA 2PRSA 3W7AA 1CY2A 4GXTA 2FWBA 1L4YA 1F8UA 4MMZB 2H1HA 1BMTA 3HRKA 3VNAA 1RWKA 4UE3S 1FU8A 1P29A 4HVLA 5FOXA 4Q7MB 2YHIA 4XARA 1N0UA 2P1RA 4OHUA 4I19A 2WF5A 1X74A 1VA5A 1QRSA 2LWIA 2DUUA 3T9EA 3BZWA 4FGUA 1RJ9A 1O9GA 3CSUA 3PIDA 4PF1A 3AMVA 1DC4A 1ETHA 1TK2A 1XEWY 2QYTA 3L05A 3FTQA 5AM5A 1Z82A 1VG9B 1DWOA 2O20A 5KOHA 3FVQA 4BO1A 4F8YA 4N8SA 3EGDB 1NUAA 3AIKA 3CXUA 4KUHA 5F1YA 3RHFA 4OHYA 2MSKA 3LVQE 3KXDA 1G3RA 4C0KA 4F72A 3CNLA 2DHRA 3G1UA 4HLUC 4HUJA 1YQEA 4DR3B 1L7MA 5DNWA 1Z2OX 2NYAA 5E9WA 3R6GA 1U2GC 3TPZA 1GRQA 3GLHA 4IDPA 3JD4A 4A1OA 4MI6A 4D6XA 3KQQA 2O8FB 1L5KA 3NVAA 1YCFA 3SYKA 4YR9A 4GPEA 2EJVA 3IGFA 3KSBC 2ATXA 4JBWA 4IWXA 4YC7A 3RB8A 3SYRA 3N0RA 1VYUA 3IPXA 3WMEA 3UMFA 4DG5A 3W7BA 3PDWA 1OUMA 2JFBA 1YZTA 3T4EA 4N01A 3FF1A 4ZAVA 1JQ5A 1WSBA 3AJDA 4MQBA 1M54A 4IX1A 4XGQA 3JYLA 2X8JA 2ZRPA 2AOTA 1TMKA 2QU8A 3MFQA 5KSPA 4HEJA 2QNIA 4IHAA 1UC8A 1YBHA 2VRCA 3ABOB 4MUYA 4S35A 1VCNA 3PXGA 2ZUVA 1A50B 1BEZA 1HDCA 1UFVA 1TUIA 3B38A 4PLWA 3EA4A 4ML3A 1V7ZA 2C9YA 3R7WB 5IC6A 4GVLA 3ZHXA 1QQ5A 1WG8A 3W77A 4GQAA 2R2AA 4X3CA 3NU1A 5EAIA 3PFIA 3SBEA 3TLCA 3HMKA 1N77A 4LA4A 3QI7A 4JUBA 1PEKE 4KAXA 4BLWA 3IVRA 2E0IA 1Q1AA 2Q2OA 3N58A 3QK7A 1N6NA 3ICPA 1E1YA 4FD2A 3ZIAD 1ZD4A 3C8DA 4O0LA 2XYRA 1IXSB 3DP7A 4CCYB 1WOMA 4RS3A 1R8XA 2VAVA 3U7EB 1VL0A 2I1VB 1HDRA 3JZMA 3KR2A 3H42B 3QJYA 3VZDA 5B37A 1I4WA 4FMDF 4HD8A 1TD1A 1X7ZA 3T3IA 2XT6A 2BGTA 4KLZA 3BB4A 3L9XA 4TQGA 2O3UA 3FN4A 1IWBB 4MIYA 5CYGA 2VO1A 5CFQA 1XNQB 3SI7A 3A9TA 4MV7A 1WDMA 2G1JA 3CGGA 2LE0A 4KPUA 2VJMA 3EZFA 5KTOA 2CNWA 3EWSA 3OUTA 4PYOA 1SCDA 1YR7A 2BE7A 5L6MB 5KNDH 4O4LB 5ALFA 1W5BA 5BUCA 2P2CA 2CF6A 1VA4A 3HB4X 1YMQA 1CERA 3FSGA 1FUUA 1WKBA 1ND6A 4MYDA 4NS1A 5ITWA 3G8YA 1DHTA 4M60A 4I5EA 4L28A 2AFHA 2OVFA 1Q7TA 1NGSA 2RFLA 5EGSA 4DDWA 3ZBPA 3NHKA 1NW3A 4AN0A 5JQWA 4AYWA 1G4UR 1HURA 3FR7A 4FMDB 3WGNA 4Q9AA 2XTZA 4TMXA 2F1RA 3DONA 1G2QA 4ZDJA 2RD2A 2OESA 4UCWA 1KSGA 2YVQA 5K8IA 4C4TA 5F4ZA 1I32A 2HO5A 1XF9A 2W6CX 2CYCA 2GAAA 3BFKA 1IE3A 1P0IA 1EFRD 1QYIA 2VEDA 2VA8A 4NARA 2D8AA 3D54D 4JA0A 4PHHA 3W90A 3BWBA 5JQGF 3DLBA 4I1RA 5CVUA 2DFLA 4L0QA 5JFGA 5B3AA 4MQEA 4L95C 4HTAA 3GLFA 3O82A 4E13A 2XDWA 1UIMA 3BHJA 2OFFA 4TT8A 3A14A 3ENNA 1MH1A 4HRYA 5FLYA 4QPPA 1TKRA 2XXAA 3COWA 3P4XA 5ERYA 4H6PA 3RU9A 2QG6A 4CDRA 3FPBA 2H1RA 2E1RA 3ZE2B 4Q24A 2HREA 3QJ5A 1QKKA 2IP4A 1I7PA 4FJ2A 1MBZA 2HBYA 4CUKA 2MDTA 3QLUA 4QUBA 2I8LA 5E2BA 4LY6A 3R9KA 3B3FA 3L8DA 3E8MA 1BN6A 2WY2D 4RVOA 2BSQA 4QUGA 5TRTA 1KQNA 3SIPA 4YXWD 1H65A 1KBOA 5EG5A 3IIJA 3PHCA 2BEWA 2COKA 3RJ5A 3T7KA 3WWDA 2RBEA 4V38A 2C9CA 3OO0A 1II8A 1JHYA 2AOUB 1GZDA 2H7XA 4MW7A 1UPFA 2AOVA 1RLMA 1OJLA 3G9QA 3KX2A 4O4IF 3INYA 4W8OA 5E7JA 3A32A 1K7FB 3CJQA 1WHSB 3DPSA 4HB2A 4B4DA 2WU4A 1KZ4A 1RRKA 2BFDA 2O52A 3NTRA 4YFVA 1D2AA 2CZCA 4PRLA 4JDUA 4J0FA 4EKGA 5JYDA 1NRIA 3L4JA 4PC1A 4ZC8A 3C2QA 4BWFB 4GYJA 5EC8A 4BV3A 4RKEA 4HXYA 4DS3A 3WGVA 2IL1A 8MHTA 2WA2A 3TKAA 1GZ5A 2B99A 2F59A 2GZ3A 3VV2A 1XJCA 1ATZA 2Z5LA 1B2LA 1DBVO 2HXGA 4WNIA 3UG6A 1ACLA 1FMCA 4F97A 1OKKD 1B3RA 3GEEA 3OEHD 2SCUA 4HRAA 5DFAA 5ED0A 5HMMA 3RT7A 3SZRA 4MDFA 5ECWA 2NVOA 3BWCA 3FLBA 1G5TA 1VYTA 1WU8A 1CKEA 3A1TA 2W2KA 1G20E 5JY6A 4ACAA 5HZKA 3WAKA 5I7EA 4WZAE 4QEZA 3TINA 4F4JA 4V24A 4EZIA 1EXWA 2H8KA 4UPEA 3GGOA 3HB9A 5FWNA 2G40A 2NPOA 4F5ZA 5I9NA 1AS0A 1RM5A 1NLMA 3MILA 3IESA 4E5UA 5FWAA 3VNSA 1RT9A 1L8XA 2VJBA 2X8LA 2EZ9A 1Z34A 3QWFA 2QTGA 3N7AA 3HJTA 1Z5ZA 2RSLA 3AVVA 1L3CA 1THTA 2XQVA 3HY4A 1RJGA 1NBME 5FYDA 1REQA 2PUJA 5IUJC 4AUKA 1YZVA 2C92A 2HMAA 2XOEA 4FNOA 4IEEA 5JD3A 4LY0A 2CNDA 3OMXA 2NTEA 2QLNA 4P4NA 3RFVA 4EFDA 4KHPB 4LYEA 4V03A 1CUZA 3GH3A 1OAKA 3F0TA 3SAJA 3S81A 2H16A 4R2HA 2FXIA 2CVQA 1QVAA 4JP2A 3O8CA 3G13A 1IN8A 3ZQ6A 3G1TA 3STVA 4FZ5A 4OJKA 1F8FA 1XK6A 1SRRA 2R00C 4M9QA 4Q9IA 2CNLA 5AVJA 3DFKA 1NG9A 1RWMA 3FPHA 4G9EA 2YCLA 4J7AA 4Q4HA 4YB8A 1HMYA 1J0CA 4TMZA 3E3NA 3WHIA 1PW5A 1PZEA 4F56A 2X9VA 2WUDA 1TXGA 5I4KA 4YJ2A 4DA0A 4F3CA 1VIAA 1A77A 2H17A 2R6GA 4NAHA 1KKUA 4GX0A 4NS4A 1YJXA 2OV2A 5EFZA 1JMYA 6GPBA 1EK5A 1F14A 1MENA 3G2HA 3T12A 5FT9A 1H3NA 2VDPB 3E15A 3QYAA 1IUNA 4OO3A 1EG7A 3TECE 1SXJB 1T9ZA 4L8YA 2H9AA 1ZBDA 4CWAA 4K03A 5FA8A 3LZ6A 2YWRA 3V9PA 1W85B 4HNVA 4M0FA 1RJ9B 2A8YA 5U9CA 2H29A 2I8CA 3GEIA 4JH0A 4YJKA 1YR1A 3N2EA 1UZMA 2V5VA 4FFLA 4ZTBA 1W73A 1DDIA 3JSAA 1LD3A 3RTAA 1KU0A 4MAFA 1J07A 3WGLA 2Q0XA 3FZYA 2R8YA 3L82B 5CGZA 4DEVA 5ALNA 3BE5A 3CRNA 2DHDA 4YJHA 2YKGA 2F7SA 4HTFA 2R86A 2XDQA 4IV8A 4HZUB 3AONB 4JMLA 5HCNA 2W37A 2IE0A 4B6PA 4E09A 1BVRA 1H5NA 1W96A 3PS9A 2H06A 1EA7A 2D7CA 3AW9A 3KZMA 3B5IA 4HYQA 1C8LA 1H42A 2YXPX 4IKPA 4C4XA 1OC2A 4AZ3A 4MS3B 1DBQA 1ZZEA 4ZO6A 5AM3A 2JJ8A 1GLVA 5CNIA 2WFMA 2RG7A 3F4BA 1OFTA 1UPAA 1B1AA 1UMCB 4MEJA 1TB4A 3TX2A 3ZWAA 3R9XA 1KO1A 4LGCA 5AI8A 3AOGA 3K9WA 3R20A 4J16C 4I3HA 1MJGM 4M36A 2Z6QA 3DE0X 2PKCA 4Q15A 5BSWA 2KLBA 2O48X 1JU3A 2YYSA 1GG8A 3I58A 3PVSA 5M04A 4R01A 4B8ZA 1XJQA 3A2NA 3HVJA 4KYUA 3BE6A 3KFVA 2Y2VA 3NBKA 10MHA 3OQPA 1V43A 4KRYA 2IWRA 1V3UA 1I8TA 4HLNA 4CM7A 4NJOA 3JD0A 4H7DA 1H2YA 5JAQA 3WLHA 3N3BC 4NY1A 1CR6A 5EP3A 4DCTA 4AP5A 3HYNA 4RY9A 4V1CA 3GLIE 2D1FA 3BXPA 4CTKA 4B3RB 4M1EA 3DDUA 4O4JA 5T6MA 3OJWA 4JI6B 3IQWA 1C9NA 3HGTA 4R0NA 4QTUB 1SVLA 1UK8A 4HH1A 2B1GA 4ZQBA 1VYHA 1B8PA 2BEWB 1F3OA 1IBKB 1EH5A 1P6XA 4ZXFA 4IJWA 2DBQA 1KYIA 2CBGA 1OLUB 4PZCA 3U60B 5J59A 4DA4A 3AVUA 1GVNB 3RJZA 2Q3FA 3PG5A 1NDHA 4YRRA 5HSGA 5BSUA 5DBOA 3OQOA 2V6GA 2J5XA 3S8MA 4CCSA 5B1YA 1DDGA 1O8BA 3C45A 1J0DA 2A78A 4BNGA 2V6IA 4UVGA 5FCDA 1N4AA 3D8BA 2PXHA 3LY8A 5BSVA 4NNPA 5KYVA 4DMKA 3IVGA 1QP7A 2Z1DA 4WFQA 4N7JA 3JXEA 3KLOA 3OPYA 4QWWA 1WMEA 3EHEA 3ADBA 2WJHA 4NCHA 3DTTA 5ICGA 1W49A 1FCJA 4KUEA 1TMYA 4G8DA 4PX2A 4E14A 4LMBA 4MPTA 2J5BA 5EA2A 4HMPA 5AFSA 2DSNA 1WTAA 4GMHA 3RC2A 2CNOA 1C80A 3JR3A 3SICE 3FW1A 3TB4A 2ZJ4A 2WAOA 1W2GA 5JNRA 1XHEA 4D0NA 5MN5A 2CLHB 3W8FA 5AW9A 5A02A 4ER0A 3NC4A 5AVSA 3RIYA 2GK4A 1XBTA 2FCRA 2PMFA 1GSHA 4IIJA 5JANA 1KEKA 1O5OA 3W5AA 1MOSA 2HB6A 2FZVA 2OVBA 1NNLA 1R0RE 2PZGA 2DWUA 2Y0DA 4LVOA 1F9AA 4YJ3F 4BFZA 1TEZA 3GVHA 2B8EA 4TQ9A 4H6XA 4KXWA 4DKJA 1IEWA 4RY8A 1V95A 1XTIA 4U7JA 3WNQA 1I3MA 1IJFA 1XQVA 1X9GA 3VZCA 4MS3A 3NEAA 2UYHA 3PWZA 4Y8VA 1LBSA 3HN6A 1Y9AA 1UBKS 3ZE1B 3LDHA 4BDTA 2WYWA 5IF9A 4BVKA 3PDUA 5JS6A 4YDSA 2C29D 2R60A 1D6JA 1Q7EA 1DO2A 2H8GA 4MB6A 5ENDA 5FBLB 1Z83A 1RI4A 1FXWA 1ZGHA 2XUDA 3P4UA 2DSTA 1UBCA 1LNSA 1G9TA 1YGYA 3LVBA 3AF2A 4MGZR 1DJQA 1NMEA 4X1KB 2O2JA 4F0JA 4ZVTA 2QVBA 4DDTA 3D59A 3D7NA 4KXFB 3QVSA 2PGIA 3IQGX 1I1NA 1NLFA 1DTWA 3A6HA 3X44A 3K05A 1H05A 3AI3A 3SJZA 1X38A 4RJ2A 3KU1A 3WDSA 1EXDA 5HUQA 1UOPA 1U2TA 2BM9A 2OSBA 3DQPA 4LDZA 1Y81A 3Q5EA 4BJ1A 2PR2A 5AUPB 1GNSA 1H3EA 1HQKA 5J5VA 1F4LA 5CCBA 4B9AA 1RRPA 1SVOA 3KSUA 3QKRA 4J4BA 2P30A 4Y2HA 2Q5OA 3M83A 4FR0A 1JYFA 4U7GA 2NPFA 5KCZA 3DZBA 4RCZA 3TMYA 1XRJA 5A9RA 3V33A 5AVTA 4Z86A 5CA1F 1P2UA 3OHMA 3TJMA 1SUSA 5AP9A 2H00A 2Y93A 3FG9A 2L18A 1KL7A 2ZJ0A 3VR5D 3HBJA 1GG5A 1AA9A 1TO1E 2C00A 1TQ4A 4KLCA 4YIHA 1R4AA 3FMIA 4KIJA 4PLTA 2JFHA 5A0FA 1VB3A 3DUWA 3Q8LA 2V4UA 2PJRA 2YY5A 1MOPA 3MF4A 1BD4A 4KACA 2P35A 2GEUA 5BQXA 4N48A 5AW3A 4Z7NB 3J81k 5GQSA 2WV7A 1Z4JA 5LZ4A 1E7SA 2I3ZA 4Q9NA 2WFLA 3IAHA 3W5DA 4Q16A 1KEPA 1Q1BA 1EE2A 1PBNA 5LP6A 1P4AA 3EOZA 1IULA 3UWSA 4D44A 1UAYA 4TM8A 4EY3A 4J0CA 2CXRA 3A6DA 3GLSA 4HFMA 2CLEB 2G7MC 2UUAB 3H5TA 5EUQB 4EEXA 1GA1A 1SC9A 2F1KA 4PAQA 3RG2A 1JEDA 4HO1X 2DPYA 5LQNA 5A62A 4ZO8A 3MGCA 1IEVA 3K0AB 3UICA 3UUGA 2XR1A 1KJYA 3DBHA 3TW8A 3U4GA 3T3MB 4EG3A 3ONNA 1FDVA 5IMBA 4BX8A 2IX3A 5ADUS 3FWYA 2VQ6A 5AH0A 5EINA 1TT5B 4W5NA 1PYOA 1X15A 1CRZA 2C8VA 2QYHA 5AJWA 3U3MA 5I7AA 4KQJA 5KNLA 3S2SA 1W7AA 3T5CA 2BZ0A 2JGDA 4B3JA 4RTQA 4EQZA 1Q0ZA 2GPAA 3FH0A 2EX4A 2YY7A 3HXLA 3H4IA 4N7MA 3SEZA 3GUYA 2P9TA 3CURA 5DN9A 1AMNA 4LJYA 3QHQA 1D4AA 3FSJX 1B14A 2REQA 5CG2A 2W0SA 2ZS9A 1Y8CA 3Q0EA 4HQNA 4DPLA 2FNAA 2WV9A 3V8PA 4IO1A 1T34A 2IDJA 2PFKA 1XNRB 2ZR0A 4QLBA 3KVOA 1PP4A 5ALVA 1QU2A 2GZSA 3U80A 1U28A 3U9LA 6YASA 2RONA 1IG0A 2A67A 5D5PA 4C6SA 1T8RA 4NI5A 1UDAA 3NIDB 1F7VA 2H1OA 4KNWA 3WWOA 2JHFA 4QLAA 4M1KA 4H3SA 1JZQA 2VPTA 5LDDC 4BS9A 1L5OA 1OVGA 3TUJC 4HC4A 1T5OA 1UR5A 3ZN2A 2V7XA 3IQDB 4QYXA 1T5HX 1JAIA 2P5TB 1V1JA 2ZQ5A 5THKA 2JK1A 1ILEA 2ZTVA 4PG6A 4EB6B 1QIHA 1CXZA 4LPSA 1DWPA 3DMNA 3FFXA 4PIVA 3P20A 4KPFC 1CZLA 1NY6A 2OYRA 3O4FA 2LCIA 4R0VA 4ROTA 4Z9YA 2AG0A 4YHBA 5JRZA 2HZ7A 4C0LA 2NSDA 1NP3A 3FKSD 4DN6A 4ECEA 1TM3E 4XDYA 2YWBA 2J3JA 3A27A 2J4FA 1UDWA 3CNEA 4WY2A 1G3IA 4Y2JA 5IEJA 3DEAA 1PR2A 1GZSA 2QUKA 4XVQA 5DOVA 1VLVA 5GTDA 2HJRA 4QUDA 1K7XB 1B0ZA 3U4HA 5GGXA 2TYSB 1E3WA 4LI3X 4LSGA 2PBRA 5DNAA 1DARA 1U1GA 2VHVA 5IAJA 9LDTA 3KCNA 1FQOA 3CPEA 4GGOA 1DOZA 1NOIA 2PA0A 3P0FA 1QHNA 5D86A 5B55A 2IW1A 5ADVA 4URVR 1ZK4A 2ZU6A 4UTXA 3FMFA 1JV2B 3G1WA 1EAYA 1QJCA 1NFQA 2I55A 4TTTS 3GN1A 3RUPA 4V2UA 3OX4A 1Z4MA 1GQOA 1JRLA 1DCKA 3D8HA 4P8RA 1OLSB 2VTVA 5BWLA 1A9RA 2CXHA 5A3VA 3HEBA 4JLOA 5DHTA 1CZRA 3KEFA 2F43A 5B4UA 3E18A 2QN1A 1P4RA 1IZ8A 3Q6IA 5H3LA 5D6OA 5SICE 3TOZA 1YRWA 4IUBS 2ZR8A 4CFSA 2UKDA 2I7XA 2OQ2A 3P5BA 2FPSA 1T6BY 3ZE9A 3ROFA 2BN4A 1GJRA 1JZSA 1N3YA 4M49A 3AJ8A 1JSLA 1P1KA 2H7YA 2YWHA 1QG4A 3ZX5A 1ZAKA 2A88A 1E3IA 2BFFA 2R1VA 3SKVA 2BI8A 1KJQA 3JW8A 4BFLA 5KOJA 3KQVA 4CF5A 4Z9XA 4HN4B 3TUZC 2VP3A 4DEYA 4JT2A 3BYZA 1COZA 1PJSA 2B78A 2KPOA 2ONYA 1MO5A 1U94A 3HCPA 4MUEA 3F1LA 1UZUA 4PO8A 1PHRA 3M5WA 4YLGA 4ZVNA 3AVXA 1ANKA 1K1EA 4JSRA 3HY3A 1FBTA 2C0PA 2NO4A 4JXKA 3KP1A 4CG2A 2VFAA 4L51A 2QLTA 3QHAA 4NYJR 2WJYA 4F38A 5EJ6A 1S1CA 2A30A 1Y37A 1C2YA 2H5IA 3HSKA 4IH4A 3QELA 4LG1A 4P36A 4R5HA 1C2TA 3IL2A 1WHTB 3EXG1 3ZCTA 1MFZA 5HF8A 4HEA1 1NNEA 3B3GA 4TXLA 3A6FA 4Q00A 2NUTB 1N3LA 2W6PA 4Y9RA 2WHQA 5D5QA 3OETA 2XE8A 4EY6A 4BYMA 1W87A 3IPLA 3HJBA 3I2FA 1NX9A 1J2JA 2FOIA 1XCJA 3II6X 1U2QA 3YASA 1ULSA 2LCFA 2YHBA 3BK2A 4KPGA 3VDQA 1WXIA 1NVFA 4K6OA 2FWIA 3KUXA 4NV0A 4JI4B 2JIQA 3RROA 4X60A 2W42A 1G20A 5EWMB 2QN2A 3RE1A 3V4VB 2W43A 2NXWA 3CU5A 3KKPA 3AR6A 1JDBC 4RENA 4Q6BA 4X64B 3FYTA 3ZKAA 3VHXA 1JG3A 3KSDO 4LBZA 4FYJA 1H4SA 5JROA 2FF5A 1X1TA 4ZTZB 4MCIA 4E5NA 3HWSA 1S8AA 3IURA 1KZGB 1N6RA 4L0DA 1V7PC 3IJEB 4IIXA 1AHNA 4LHWA 3A31A 4RHEA 3L7BA 2VJYA 3PDCA 5DDIP 2H11A 3B3QA 4X20A 2BCEA 4WKBA 3ZNNA 2WNHA 2OD9A 4E4RA 4JBLA 4XB1A 1E2PA 2HJGA 3UGQA 1Z0UA 4C0BA 3I9LA 4WE3A 2GESA 5HJEA 1VXOA 2WUEA 1LPPA 2EU8A 1B41A 2XA1A 3CXRA 2NO1A 3P2JA 4NC9A 4P58A 4FQ8A 4UNIA 4G8JA 3B1VA 4Y9UA 4MPJA 1OB2A 2ZXEA 5MFZA 5CDTA 4NXMB 3EHDA 2X5XA 4JEMA 4ZYWA 4X62B 1VL2A 3PP8A 3EXG2 2VPPA 3EZ7A 5BV8A 3F90A 5MHTA 2GCPA 4H0NA 2NSJA 1IEQA 4COKA 4WZBA 4AX8A 5ALGA 3LL4A 4JV5B 3DVAB 2X8BA 5GVSA 1USWA 1XPOA 3ESZA 3LT2A 5F1PA 5KYYA 1MW8X 4R51A 3S8YA 1P0CA 3OJCA 5CX1A 4E5MA 1WETA 1VE7A 3EZNA 1SPBS 3GA5A 3GJ6A 4CR8A 3OY7A 3U3RA 2W93A 2IVZA 4D9KA 2BGRA 4EKIA 4IVNA 2Q8QA 3PVCA 1UPTA 1KO4A 3DB1A 3DF9A 221PA 3GGPA 3VISA 4W5QA 621PA 3ZDBA 1TCVA 4NECA 1LF5A 1URPA 1KDRA 1M2WA 3OM9A 2YQ5A 4U8HA 2Z1MA 4LF5B 1FNDA 3C3PA 3B52X 4F84A 5EMMA 3FMOB 5CJPA 1KEEB 4Y2YA 3ZCSA 4YCAA 5JI2E 3AHHA 4DLBA 3FWKA 1RLJA 1ESCA 2X5JO 5CIYA 3WZ2A 4DM3A 1B2RA 1IU9A 2YXLA 3DBIA 1L5LA 3WR5A 1N6HA 4BAGA 4R1LA 2NVUA 4BNJA 5J2UF 2FR1A 1KVUA 1FTWA 2NUTA 1FFAA 4ZAFA 2OB2A 3MM4A 4N12A 2OBMA 3IMKA 1ZJJA 1B8OA 2GLXA 1Q77A 4PEVA 1E2MA 4C5BA 4FYWA 2AXPA 2ZBUA 4NCIA 1A7UA 1CEXA 1K89A 4LJLA 1A2KC 1ZN7A 3MFYA 2LVBA 4A6DA 4I50B 3BT7A 4JBGA 1J56A 3CS3A 1N78A 1U0RA 3T3HA 4D8TA 3N8NA 4UVHA 4H3KB 4MKXA 3TRDA 5EQTA 1P5HA 2ZYRA 3RFFA 3WBBA 3TRHA 4KXVA 2B4KA 1BNCA 2MSWA 1NLZA 1PJBA 2X15A 5FB3A 3PHGA 5BSRA 5JXJA 2QDKA 4GI5A 1PUIA 3A1CA 5B7GA 3B8HA 1RHMA 4OOFA 3FTDA 4DJFC 5A5DA 5INTA 1IXZA 2J7PA 1FP7A 1QX4A 3GMTA 1XQ6A 3AB3A 1T43A 4GLBA 4CL8A 1W47A 3AV0B 3P2IA 1JPVA 2V4ZA 4NICA 5LXTA 5GIPE 3HYTA 3OBBA 3H2ZA 3G82C 3QRWA 5FH9A 4IOJA 4OX9B 1IN4A 4KLRA 2A9QA 4HYTA 3TCNA 2G4CA 3O4VA 3RQSA 5C51B 1GYRA 3K2BA 2D6FA 3OZWA 4I7EA 1W5AA 3PDIB 3OZ7A 4XIYA 5I5EA 5JZVA 2QSUA 4ARVA 3KEGA 1A9YA 3WMRA 1HLPA 3O9VA 4AS2A 5DM0A 3RUHA 4MVWA 5EXPA 2CLLB 4B4UA 1RZVA 2E5WA 1J6UA 2V98A 4D4JA 3K16A 3QBVA 1S8NA 1IAVA 1Z4LA 4BDSA 2QUBA 1UM9B 1I4TD 2B2NA 1QGUA 2W98A 4JJ8A 4L85A 3I9NA 3ML1A 3THRA 4AJLA 2PMKA 1E3WB 4LZLA 5IBRA 5KNBH 1QYXA 1PS8A 1ZN8A 5ITSA 2H1FA 3K9BA 1SO8A 4EYKA 4O02B 3UAXA 1STOA 2V3VA 4GEKA 5B1SA 3UAYA 4AP9A 3FGNA 3QXCA 4I3FA 4NZPA 3VKVA 2IS6A 5T8KC 4UDNA 1DWQA 4YUYA 4X3PA 4C7JA 3MT0A 4EG5A 2NSLA 4FFBB 3SMVA 1RXCA 4NYMR 2EF0A 2BM8A 5FI5A 1H9AA 1QU3A 1LLCA 5JSZA 2H2HA 3E9DA 3G0GA 5CXXA 3LZCA 1GCIA 1P80A 3C3KA 4KQGA 1EUZA 5MDHA 4BECA 1NJFA 5CT4A 1G1MA 1NYRA 2KX7A 5T3UA 3RYHB 1MA0A 3NJ4A 2BGLA 3TIGA 3ENQA 1A4RA 5BSKA 3RQIA 5AOBA 1U0HC 4BE4A 4ID3A 4C01A 4UBKA 1MVOA 3O4IA 4IX9A 4D9GA 3G6WA 2IC5A 2DPGA 1OI7A 5IJAA 3UC5A 4B33A 1TI7A 2ZJFA 5H83A 5JS2A 1Z88A 2C8LA 5CGQB 5F2OA 3ZBTA 3IEMA 2I2XB 3KPWA 3EDCA 3GLGE 4G5GA 1GGVA 2ZSHA 4FVTA 4MARA 5JJ5A 1U8AA 1LW6E 1ZS9A 1SUCA 9ABPA 3VVMA 3C98A 3HUFA 2QN3A 5AM1A 3U56A 2CV1A 4GR5A 1O6BA 3KAJA 1ZUNB 2A1TS 2H07A 2Y0PA 3T7CA 1BCSA 1B0UA 2XQGA 4X54A 5FWYB 4I36A 2BFCA 3GJZA 4CMJA 1CEEA 4JLPA 1PSDA 1ZMTA 2A9PA 2W6OA 3P52A 3AHIA 4ITVA 4RQTA 4B4WA 4Z9FA 4XLZA 1OH7A 4W5RA 2JI6A 4TKMA 4LYDA 3PQ3A 2R87A 1EFPA 1G8YA 2WJZB 2X6RA 1GT91 2PT5A 1IC6A 1V3TA 4QBGB 5FBWB 5TPWB 2NT4A 3T5GA 3NHUA 5K4GA 2F8LA 1XXHA 2HIGA 5IXYA 1E1KA 3NT4A 1KO5A 4C0QC 4E7PA 2WJPA 3MTGA 2YCBA 2NV6A 2HF2A 1L8AA 3EPHA 6CHYA 4D4LA 1PZXA 1F4PA 2ICAA 3GMDA 5F9HA 1O5IA 2AW3A 1KYXA 2DULA 1I10A 4NBRA 3KBOA 4ER6A 4BMYA 2R7KA 2NO5A 1IPFA 2ZU0C 2HK7A 2IZOA 3K8QA 4ZYLA 4NBNA 4BBAA 2GVNA 1O6GA 1NJ8A 1ODCA 1RHQA 4QHYA 3AHGA 4MKGA 1C0LA 1F7UA 1SUBA 2GRUA 5IAAA 3TZ6A 4WLVA 3IOBA 1DTSA 1GL3A 4J2TA 4AS1A 2GK6A 3A4VA 3IP3A 1ADFA 2GM5A 4L75A 4N54A 5JZBA 2E89A 3LHKA 1OA1A 4CF6A 5I7VA 3CX7A 4C7MA 4I50A 3L7DA 1RAIA 2E2WA 3HFGA 4H18A 1BIFA 4XW2A 3UHAA 4UM9B 4RWEA 2C04A 2DT5A 2WHRA 3BEOA 2NSHA 3FPJA 4LZJA 4NF2A 4O2BB 3LK7A 2VHXA 4GE3A 3PEFA 1UJMA 1L8LA 5AICA 1NI4B 1OAAA 2B2XA 2FP3A 2EP8A 1XPRA 2ZIWB 1V6CA 4J1NA 2B34A 4XKJA 3D6NB 4OXKA 3BMNA 2NP6A 3TB6A 3WK4A 2G9RA 4BQSA 5JWOA 1AE1A 1ZCAA 3BQ9A 3RVDA 4EMBA 2XVAA 1ESEA 1RFGE 4I9NA 4BNUA 3HU2A 3T3PB 2FI1A 4EZEA 5BWBA 3CH6A 3KVVA 3UOAB 3R2JA 4QVIA 2XOKD 3V3TA 2COUA 1NPDA 4Q4HB 1P5JA 4PLGA 2FWPA 3P2EA 2ZYTX 1G8FA 5E7MA 2O2ZA 5LZ7A 2DVMA 1HNZB 1MPTA 1UBSB 1YUMA 4GRIA 3WLJA 3G7SA 5KOYA 1NDQA 3C4QA 3ETEA 3EXHB 1L5QA 3LG2A 4DCMA 1E64A 2V1XA 4FE4A 1T3LA 4JMPA 2XI4A 1J20A 3I5YA 1EK2A 4R1QA 5KTKA 3GC6A 2P91A 1W0JD 2BHRA 5DBFA 4TYPA 3RF7A 2X5KO 3TFOA 4XVHA 2FFQA 3ZGLA 3UK7A 2WQ6A 1RS0A 5ECYA 2P9GA 3RT1A 3ZLUA 1OOEA 2AV6A 1U3DA 5ITZB 4GRDA 3A1DA 1Y6JA 5IYZF 2R47A 4IGFA 2ZI5A 4Q66C 4QJ5A 2JVIA 4PYNA 5D5HA 5E4YA 3U31A 3ZV4A 4ZYXA 4UASA 2J0UA 1A2BA 5DLEA 1G8PA 3ZGXA 2G1UA 3NHJA 4QPNA 1UQTA 5AXBA 1V41E 4BMDA 2Z5FA 1GR0A 5MGBA 5EJ7A 1JR3A 3H6GA 1SEPA 3P71T 1BN7A 5D51S 3IQEA 4RSMA 4Y1GA 3LHFA 4ARSA 4AYXA 1SK8A 3DHYA 3UKDA 3KYCA 4GR4A 4B81A 3RV4A 1FJGB 1BYIA 4KGDA 3IAUA 1H8HD 3CUEF 2QB5A 3T9CA 3RI3A 2XZOA 4ZMRA 2QORA 1P4HA 2VRWA 3ILXA 5I7SA 3TOXA 5KQLA 4HB3A 4FMCB 4ZHQF 2SKCA 1VCHA 2V74B 1PFYA 4CM1A 3GWZA 1Z12A 3ETHA 4O2LA 3R8XA 1RLTA 1E96A 2VHYA 4BAZA 2RE8A 2I03A 3H5OA 5JC1A 1Z5PA 1UKCA 2FX2A 2JFOA 2OC9A 2YDXA 4R2MA 1X1EA 4ARUA 5AHOA 4ZI5A 4MIEA 5JAPA 1FUYB 1ZEJA 3WL8A 4XJVA 3OMLA 3KHSA 4YX9A 1Q57A 3PNBA 5SY6A 2A4MA 3CG0A 1F51E 1I5OA 4PW0A 1IMOA 5TGZA 4GMGA 2XKJE 4PSUA 5G41A 3STXA 3WL7A 1OZGA 2VNAA 4H77A 1IBLB 1LVHA 2E5LB 1NI4A 3GO4A 3MUOA 1OXTA 3JALA 3NTOA 4YRKA 1QTNA 2DERA 3MAGA 4MRPA 2VYNA 4X7BA 1K9VF 1T13A 3TQHA 3VR1A 1GNPA 2IHTA 4OBWA 4U0JA 2B6NA 3U4QB 1TTTA 4HDMB 1PT8A 2MU1A 1REQB 5CB0A 1MJFA 3BICA 3GLIA 3F5DA 5E38A 1VGQA 1ZD8A 5K3FA 4DE5A 3R3YA 2LGJA 1RTTA 1NRJB 3PUIA 4NJMB 5GV7A 1Z7YA 1ZH8A 2XXAB 3ZCUA 4GT1A 1Y3BE 4LBWA 4M1YA 4ARIA 3IPCA 1LI5A 5CVCA 5AJUA 5K3AA 3HCFA 4PLVA 1MEOA 2IOFA 3QVTA 3PJGA 4LY3A 3SX4A 3VJLA 1Z4QA 2Z98A 4F2PA 2P2SA 4BQRA 1O97D 3SWWA 3VR3A 3IRVA 5D3KA 2H4FA 2X2FA 2I87A 2DPHA 2REXB 3L6UA 4GU5A 5KKNB 1WUTA 1HUQA 2XCUA 2GT1A 3DFFA 3C41J 2SCUB 3UHJA 1UDCA 3RAEC 4W7IA 3KR0A 2E4UA 2GM9A 2VNKA 3DE6X 4HAVA 4P5DA 3UN1A 5GINE 5KYNA 4ITRC 3Q8WA 3FNFA 1E1CA 3EARA 2A14A 2H2IA 3N1UA 4JN6B 4ZZ2A 4UOEA 1SQFA 3ILHA 5TMBA 2NZXA 3LD9A 4H7HA 4BN0A 3CRRA 1SC6A 4KX3A 2ZYDA 1XQ9A 5TMEA 3THXB 1FMJA 4ZI2A 4I55F 1VE1A 4K9NA 1BX3A 4UUBA 4H0CA 4YEDA 4WPGA 1IY1A 2HCBA 2UZ0A 3MJRA 5JCZA 1OZAA 5FUWA 1KK0A 1YZYA 3SYNA 4JOSA 4OGWA 3AU8A 1M1ZA 2AN1A 4HDKA 4J9VA 2CHQA 4Q37A 4UC0A 1PR6A 2D7JA 4KQ2A 3W9BA 3QLVC 4IUYA 1SVIA 3ME5A 1K0FA 2IHBA 1GLGA 2RGGA 3L92A 4B84A 1NXQA 3I92A 4IFEA 2YS6A 4CUJA 1EDEA 4XLTA 4G0QA 2DM6A 2ZRGA 1B0PA 1PJ3A 1PX2A 4KK3A 4REOA 1C3LA 4OQXA 3TE6A 3KQNA 3ACDA 1OXVA 4II2A 3TLMA 4DSTA 3T9AA 3I2KA 4H1HA 3TZLA 3ICWA 4BLRA 2BFBA 1W2HA 2I54A 1UH5A 2IPXA 2WIJA 3OT1A 4I0WB 4OOEA 2PM8A 2XCLA 2UXBB 5MF6A 1GUBA 4G6ZA 2O3JA 2C0CA 3IPYA 1EBUA 2O57A 2ZE5A 2VDMB 3KD3A 1A2QA 4AJHA 4E5VA 1U0BB 1HDYA 2GPWA 2JI9A 3UM9A 1K2WA 1L7RA 3C6XA 4KXMA 3ZDRA 4CCYA 1W5SA 1X7GA 3OKAA 4RH1A 2IKSA 3ONFA 5JCXA 3TZKA 4N76A 1QH1B 1POWA 2YZMA 3H11B 2QN9A 2OXIA 1L7EA 2J59A 2P11A 3SP1A 2YZKA 3PCXA 1RPZA 4MW4A 4PSVA 1I80A 1CJSA 3BA1A 3ZWQA 5BSEA 1KZ1A 2BH9A 1U0SY 2VPWA 3IALA 4YJ2B 3OC0A 2G9UA 2YIDA 5E3HA 4CN8A 2VJNA 3SXUA 2IIPA 1OVMA 4MROA 5DK4A 4MWDA 1TJNA 3H9CA 4EFKA 4PAWA 2ACEA 1LKZA 2FVYA 1SHTX 3PFWO 4CMEA 4JYZA 3F5SA 1B8UA 4AWAA 1JQDA 3AY6A 3L02A 3NDBB 1UZAA 3AIMA 2CD7A 1V3QE 2V9PA 2W6NA 1U2EA 2HSZA 4PYMA 3KD2A 4RLSA 4URXR 2VJCA 1JAZA 1XWFA 1NUPA 1X80B 4PSCA 3DDSA 3NT2A 1F4VA 4GKAA 1XRRA 5IWCA 4J0DA 1P9OA 3MQ4A 2JLUA 5LYJB 2J1LA 1NW7A 1J06A 5FO0A 3RRXA 4QYWA 1XMSA 4ZOLB 1O6ZA 1PNQA 2J85A 3I9V6 4GBMA 4XRGA 4F06A 1YK1A 5JXIA 2XUZA 3NIGB 3S29A 3L06A 1PSWA 4BP8A 4WXEA 1HLDA 2X9QA 5GGYA 1QOQB 4V0QA 2QHXA 2H3HA 4Q3EA 2V96A 2IHKA 2QN6A 2AQKA 3D2BA 4ND5A 4NL4H 4CCWA 5FFMA 5EP4A 4OQFA 2NQTA 3UTDA 1DKQA 3UMMA 1ZJYA 3NBAA 5BWOA 4L4YA 4BB0A 2P6RA 5BUQA 1Z73A 5F51A 3PL1A 3OEWA 4BBZA 5KPDA 2NLOA 2P0EA 3K0EA 2OO3A 4MKIA 2FFAA 5FI3A 3V1TC 4CYMA 2NT3A 4GZMA 4LK3A 4TV9A 4HLUA 5C18A 1SHJA 1ECGA 1FLNA 4HZGA 2P9ZA 2HA5A 3SXJA 3ESCA 4E3WA 4ZQCB 1JDBB 2P0YA 2FDRA 1JR3E 3H16A 5JNLA 4ENUA 3GGJA 3SXUB 3OQ6A 4NDZA 4C87A 3L93A 1HA3A 3BHMA 5F3WB 1F2TA 3C85A 4ND3A 5AW1A 4P4UA 3D8RA 4ZODA 4I8DA 1L3BA 2C20A 5TXGA 4FR2A 1WLSA 4JXZA 2BFPA 1ZUD1 4MMXB 2ID4A 2GBLA 2VWGA 4ZJYA 5L40A 4KQEA 1WXQA 3ELUA 3JASA 1L4UA 1T8UA 5IAEA 3LLCA 1QBKC 4WUVA 4ATNA 1EX7A 2Z6UA 3HYCA 2DWPA 1NQVA 5EL0A 1Y3FE 3TXAA 4BKOA 5F2NA 3L0YA 4G56A 2P9BA 1BXGB 2FZWA 4MWGA 3WKBA 3U3KA 4Y1EA 1HQCA 5BOSB 4KN8A 2CXPA 1OAOA 5JATA 4XUCA 1YI1A 3E84A 3S7TA 4TM7A 2VPYA 1KP3A 1N0HA 3QVWA 5F3RA 5JAUA 1BW9B 4ZCMA 3V2IA 2HSEA 1HX7A 3CR3C 4BVLA 1R64A 1JFTA 3MUFA 4LHVA 3X2FA 2VDWA 3RU7A 3EGEA 3W0LB 1NXSA 3EISA 1RYFA 3LY9A 4H6VA 1Q0HA 2L2QA 2WJAA 3RTCA 1LI7A 4FYPA 3WGUA 2HSJA 4DDMA 2O59A 2QP9X 1EMDA 3HEAA 3JTMA 3W4JA 4M7PA 4WBXC 1N32B 2HGSA 4URYR 4E88A 1Z0DA 2XRFA 3EXEA 4GKVA 3H9UA 2GERA 4FDLA 2VQDA 2QXTA 2IOQA 3PPXA 4FK8A 3V4ZA 1XTPA 1ZSYA 2AHRA 4LNHA 3VPSA 3ET5A 1AKNA 1BGXT 4UOQA 4QO7A 5G40A 4WCDA 3Q72A 5K0EA 3IV7A 3ZXYA 1ZM7A 4QHTA 5ALIA 4X65B 1XVIA 5FNVA 1GITA 2ZB7A 1PD1A 1WB4A 3O9MA 1RQ7A 5AW7A 1U90A 3F47A 5SYAA 1ISMA 1MAHA 2AOUA 2BW0A 2J7PD 3PEVA 4HAYA 1JT9A 2HQRA 2ODPA 1IQRA 3BTOA 4MQLA 3UWPA 2GCIA 4DY4A 4QUJA 2C4HA 4B3MB 2RCNA 3KFLA 1ZH0A 1JBEA 1IK4A 2Z57A 3GZ4A 3GAZA 3JQBA 3O8LA 4GO1A 4QM7A 3AM1A 4QXPA 1H0HA 2CFIA 5FUBA 3D4OA 4ONEA 2I9PA 4HUQB 2PSJA 2ECQA 2J9GA 1UMKA 1FDUA 3F3YA 5JSYA 5HKBA 5KUTA 3ZBUA 1AKQA 2IZ7A 3H87A 4MQMA 1QF9A 3QUSA 3EVCA 1AUOA 4JJZA 2QTTA 3IILA 2I33A 3TQOA 1SXJD 2JD1A 1JA1A 3MXOA 1PR1A 1YR6A 5AQEA 5C35A 1WR8A 4N0PA 3VTAA 1C9JA 1ZN9A 2AWOA 4D46A 4CKXA 4HNTA 3A6EA 3GF4A 3U3OA 3FY4A 3PGVA 2R44A 5BR4A 1KQFA 2B0JA 2ISCA 1YXMA 3PC7A 3ZDQA 5LQAA 2GN1A 2OC4A 4KV9A 1TYAE 1GYPA 3KK0A 5DM70 4I5IA 1ZKMA 4A5OA 1E1NA 2V3WA 1GVHA 3ND7A 2QQFA 4ZVKA 4C7XA 4CR6A 2YOFA 3EGVA 4LK2A 4QUIA 5HDBB 3X1ZA 4B7AA 3VC3A 2P78A 5J4KA 3DAFA 5FTLA 3U5ZB 4XVUA 5FTJA 1T5BA 1SWVA 1UMDA 3QVMA 3X1MA 3FI0A 3MINA 3R7LA 3RC3A 3CF2A 1F20A 4AY5A 2OCGA 2IDZA 2GPJA 1UOEA 1GZ4A 3JRXA 1QB7A 2XGOA 3QV1A 4QEKA 4UMFA 5IAGA 1U4NA 5F2KA 2G6BA 3DUFB 4TV8A 4L5IA 4RVSA 4ZHSA 4C5CA 5DP2A 1YAHA 2JFZA 2V8OA 3ZZUA 4FYKA 1W9HA 3U6BA 3GFSA 4ZZ3A 2LV8A 1B42A 4GLOA 2GK7A 3DVLA 3CH7A 4LQCA 1RXUA 1NJ6A 1ULZA 2JJQA 3Q7SA 3U17A 1O8CA 1OGYA 4OH7A 2F00A 1DRUA 1O95D 1G19A 2EW2A 3RSCA 3SR4A 2YWEA 5JZMA 4DV6B 3QITA 2VT6A 3ZHRA 2O5EA 2PGAA 3ROPA 5IT9A 4OJQA 3N2ZB 1VI5A 3INRA 2QRLA 4Q6WA 2XUFA 5AXCA 4AWXA 3COYA 2PY6A 4KTTE 4F9TA 2HA6A 4HOYA 3SKYA 3GQBA 3PXXA 3PLAE 5I3ZA 3IOYA 5BV0A 2JG3A 4FHFA 1EQUA 4UEOA 1E0SA 3ELDA 4MW9A 3K5WA 4NKRA 4UM9D 3RC8A 1Z4OA 1UPBA 2V6FA 4FFWA 1RKXA 1PDOA 2FOLA 1JG1A 4NJMA 4DCCA 4JAVC 2RHHA 4G1MB 3KJFA 3F46A 3H5NA 1IM8A 4MV1A 1V5FA 1CIPA 2F6RA 3DZCA 3QEAZ 2FSUA 4BQFA 1I2CA 1Z8NA 2ANBA 2FKAA 2RK3A 4MNTA 1P77A 3FDIA 2LKDA 3SYTA 4Y18A 3OSZA 3EAGA 4NFSA 4Q4CA 2BFBB 4JCOA 5E0KB 2GFHA 1XTVA 3HN2A 4JYMA 4XXHA 3O8RA 4I1PA 1DIOB 2AN9A 4RK0A 4F7WA 5IS2A 2CXUA 3PC8C 2ZE8A 2BR3A 2RI0A 3Q7IA 1WU7A 2BEUB 2ZYUX 4PRZA 4OGFA 5BN5B 4F4DA 1P18A 2R00A 2DJIA 4N65A 1P2VA 4OH1A 3V3KA 1NU6A 3FOAA 4WNCA 1LTQA 5CXUA 5FUMA 1JN0A 1XVAA 2ENUA 5DLQC 2XJ4A 3FNQA 4M0CA 3IPAA 3I6ZA 4CMIB 3P9RA 3QVGB 1DEAA 3M81A 1U8CB 2J33A 4OXXA 3Q7PA 1R00A 4JVOA 1OKKA 4KQKA 3FDZB 1XCPA 1XVUA 3C1AA 3TF5A 1S3IA 5E95A 1PJQA 3OJEA 3A6KA 4PINA 4ZAGA 2ROQA 2F1JA 2FWNA 2XYVA 4HPXB 4X7MA 3W3AH 5EP2A 2EQ5A 1QRAA 2HNBA 2AUTA 3OFND 5IC4A 5T5QA 1A4UA 3AUSA 1BS2A 1CDZA 1OX4B 5IFKA 4TZ0A 4ZYUA 2YOHA 3L6BA 4RA9A 2WJIA 3L8CA 2HRQA 3KT3A 4I1VA 2D59A 1P7WA 3THWA 1CZOA 3FHOA 3DZFA 5T4EA 1TJ3A 3REQB 3V8BA 3KKQA 5CA0B 2O8DA 3FFWA 3NATA 3NVMB 4JNKA 4F91B 1FFDA 721PA 4MWEA 5AHKA 5HZHA 1N9KA 2DOKA 4M9ZA 4OHFA 4L8FA 1UDBA 2ERXA 3ND5A 3ZQKA 5FAXA 5DX8A 1UADA 2VK4A 3C7DB 4M3NA 4XPZA 4BKMA 4CVNA 3UW3A 1S7GA 1IY9A 3DTVA 2PT9A 2HO4A 1X7DA 2ZXUA 2C7QA 2WT9A 4BV8A 1FW6A 3CVYA 4JI2B 3LLVA 3WK6A 1W85A 5D87A 5HOEA 5L3QB 2CLIB 1OXUA 1X80A 2D5IA 2BGWA 3M6XA 4J16A 1G0OA 1ZCBA 2XVZA 2XYQA 3FDFA 2GDZA 2JRCA 3MCZA 4RHFA 2HCRA 4BBJA 3KJIA 3WNBA 5TF0A 4YHHB 3VU3A 4FN4A 3S2YA 1YL6A 2C5FA 1Z5NA 4XR9A 3WDMA 3LKZA 4LYJA 5EY5B 1JAHA 4AJJA 3TDNA 2LBPA 1FTQA 1R6XA 1A76A 2H54A 4GSLA 4UUPA 5TGTA 1NW8A 5ADWA 3DEIA 3H2JA 3L7JA 1QWOA 3EXIB 3V1YA 4Y0NA 2BFNA 2C4WA 1EK0A 3KYJB 3I76A 1XEFA 2ZQZA 2ZUUA 2PHZA 4NE2A 2P2DA 2IA5A 1JWAB 1KVTA 2IEGA 3UWOA 4E5KA 3KVYA 3RVPA 2FPOA 4XPIB 3VPHA 4LC9A 4TWJA 3W7VA 1C1HA 3O91A 2BAGA 1WA5A 5FI0B 1MAAA 2H1SA 2BEUA 2VQSA 1L1QA 4PVCA 2ISSD 1T9HA 2HRDA 4JA2A 2O7VA 4UU8A 1JSCA 4YRCA 4L08A 2XIJA 3ZGOA 2HHJA 3DPIA 3ZZ1A 4OP1A 4BO9A 3DZDA 3FYUC 3O8BA 1K8XB 1MV8A 5I8PA 3ZW8A 1ODJA 2BHLA 3HM2A 5DNEA 4M0EA 1C50A 3U7FB 3EH2A 3QY0A 4J90A 1GRRA 1T2UA 3QV2A 3B1ZA 5LYJF 4KE8A 2XCQA 4YJGB 1YE3A 3DMHA 1JB9A 3K5IA 2FP4B 3MWEB 4YJFA 3EIFA 3B82A 3I9MA 3GLFE 1Y8ZA 1E3JA 1YDFA 3PXEA 1YDEA 1M74A 1RLIA 4MULA 4XR4A 5JMOA 4QTXA 5T3YA 3D2AA 4KZKA 4NEGA 4JLDA 4HGQA 3EMDA 4Q0MA 4RPCA 3H8WA 4ZT4A 2DMRA 1D6MA 5DX1A 4O4JB 1MT0A 2I4OA 3L8MA 4JQOA 4QXRA 4OJMX 3ZEAA 2NNLD 4REMA 2RJNA 4I46A 5FOWA 3CNOA 2EDCA 1N2GA 1PQWA 4O1HA 2WHPB 4FNAA 1LFAA 3L18A 1Y4AE 5LLTA 2VF7A 4G3XA 5BMVA 1RW4A 3GCGA 4NEHB 4EFLA 3NHZA 4IHJA 2CXNA 3MWGA 2BI7A 4YJ3A 5C5IA 1QDUA 4WSOA 3E6AA 1BVYF 3E3AA 1XJ5A 2V8BA 4KV7A 3S27A 1RYHA 3NGMA 4RK7A 2WPDA 3KSRA 4NU6A 1FTYA 1V47A 3WXMA 5K5EA 1DFIA 2GF0A 1V16B 3ITKA 1JR3D 3BMOA 3NCTA 2CYAA 2FW6A 4G85A 1JDNA 3NV7A 3FJ1A 1B00A 4FEAA 4M83A 3MTDA 1VGRA 2PMBA 4NU5A 4LYGA 2QT0A 1K4YA 4DGQA 2ZGVA 3KYBA 4KXLA 4TWBA 5JMTA 2OV6A 5KTRA 1RYBA 3FHCB 4ZKDA 3RBXA 2R6HA 4CI9A 3OIDA 3AKZA 2EX1A 4S1OA 4DIKA 5GIOE 4LX8A 4IMPA 4S1PA 1RAHA 5CB4F 1AXRA 4Q3DA 4KSCA 1HSZA 4LNAA 2D1YA 3OZEA 4ZEOA 2WZBA 4EG1A 2QT1A 4OYYA 1QV9A 3HRIA 1RWOA 2SECE 1YFLA 1PGJA 4MRAA 3ER6A 5F64A 1Q0SA 3GRUA 1ODLA 3ND9A 4CLEA 5KQMA 2IXAA 2QTNA 3EYWA 1JP7A 2C2BA 4PCVA 4TV8F 4PR0A 4Y2RA 1E3TA 4FFNA 1XRQA 2AG5A 2C0QA 5JD5A 1YA6A 3TSOA 4JX8A 1GAJA 3INTA 1ETUA 3TL3A 2BBWA 3JYQA 1N3BA 1XAIA 3RABA 1LTKA 1GL9B 4KI7A 3M3DA 5EJEA 1XE3A 2O3TA 2O0HA 2WD7A 1F12A 1RIIA 3AUXA 2RGDA 3IQIX 1P2DA 4R05A 3FUTA 2P9EA 4X90A 5TMDA 1O77A 1C3OB 1NU8A 1TC1A 3NV9A 4RX1A 1COWA 2G8NA 2PS3A 4YRGA 5JYEA 1TK9A 1I2AA 3WE7A 1QF6A 1VKRA 4OJNA 4G41A 4KITB 2K2QB 3NHLA 4PS1A 2HLDD 3WJ1A 5B5SA 2W2OA 3EVZA 2V4MA 3B3JA 1UF9A 3C3AA 4NR0A 1FP1D 3W2TA 4F1JA 3R8FA 5IN4A 4WXYB 2DCMA 3GPIA 3SD7A 4LHEA 3VMMA 5AIBA 1WPRA 1HK7A 4ZQIA 1PFVA 1RQPA 2FWAA 3K6KA 2JHGA 2PLWA 3STUA 1CT9A 3P97A 3VC1A 1RC0A 2YWGA 2AI2A 2Q3MA 3EG5A 3EG9A 3P2MA 4LOIA 1XCOA 2FPUA 4DR6B 4GGMX 3EUFA 3ZCXA 4YJDA 4HGRA 4KN5A 1E1RD 1E1QA 2VF8A 1GPMA 4B80A 5IBPA 4Y6PA 4NENA 3BDIA 3DBLB 1IN7A 5JUWA 1U8TA 3RS5A 4MDEA 3QUCA 1BE1A 4QPCA 1XG5A 5KJFA 3LLUA 2BP7B 5IJ0B 1NF9A 1WKCA 1GGJA 4UATA 1PGQA 1J24A 3AVOA 1MFPA 1V1RB 4XM0A 2OORC 1T4BA 3CUUA 1TPYA 2K7FA 3WFIA 4HG2A 1FNMA 1HG1A 1OX4A 3GQBB 3CINA 3IO3A 3Q1LA 4GMXA 1GPDG 3PB3A 4F93B 4HMOA 1Y8RA 2HLPA 3DYIA 4DIMA 3HCAA 2I99A 5K3EA 5K0BA 5K4HA 4GKKB 1NXWA 3SU8A 4YP6A 2L17A 5TEWA 3RM3A 3OE4A 4MVJG 4PIPA 4BN5A 4A23A 4HEA6 2PTHA 1VKZA 5AYVA 3VR5A 4BBPA 4D8YA 4OFWA 3OCZA 3STHA 4Y6SA 1F8XA 1EI9A 2FEAA