1SQ0A

Crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
DFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor (vWF) [Contains: Von Willebrand antige
publication title Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 72
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1sq0A00
1N9ZA 3Q3GE 3TW0A 4CN9A 4XW2A 5E6UB 5E6SA 4WK2B 1LFAA 5BV8A 2NUTB 1ZOOA 1M2VB 3VI4B 4G1EB 1L5GB 2XWBF 1T0PA 1SHUX 3EG9A 1QCYA 3EH1A 5HDBB 1JEYB 2VDLB 3EFOA 4IGIA 5KYYB 2XGGA 4IXDA 3TCXB 2WW8A 2VDRB 3F74A 1RS0A 3BQMB 2VDKB 1JLMA 1M1XB 4UM9B 3V4VB 1ZONA 3EGXB 2X5NA 4NENB 3BQNB 3F78A 1N3YA 5KYWB 4UM9D 4C2BA 2NVOA 1MQAA 1M1UA 1M10A 1PD1A 2VC2B 1XUOA 4MMXB 1QC5B 4WJKB 5KYUA 4JDUA 3VI3B 3FCSB 5KYXB 3K6SB 4DMUB 4HQKA 1IJBA 1IJKA 3ZE1B 1AOXA 1FE8A 4UM8B 3V4PB 3ZDZB 3BN3A 2VDMB 5E6SB 4BJ3A 3K72B 2IUEA 3PPYA 3HXQA 1IDN1 4NEHB 4Z7NB 5HGJA 3EG9B 2NUPA 3EFOB 4HQNA 1AO3A 1BHO1 3IJEB 1CQPA 1PT6A 4WFQA 2XWJI 2VDPB 1IDOA 3EH2A 1UEXC 1PCXA 5HJ2A 4A0QA 3RAGA 1U8CB 1JV2B 2VDNB 1SHTX 2VDOB 2ODQA 3PPVA 1JEQA 3E2MA 3K71B 3HXOA 1M2OA 1Q0PA 1ZOPA 5E6RA 3EOAI 4O02B 1NA5A 5KYUB 2ODPA 4MMYB 1RRKA 3PPXA 5ES4B 2O7NA 3T3PB 1MHPA 1TYEB 3EGDA 1OAKA 1SQ0A 4CN8A 1MF7A 4F1KA 3T3MB 3HI6A 1XDDA 3NIFB 1DGQA 1YVRA 4NENA 3TVYA 2ADFA 3IBSA 1PD0A 4HQOA 4Z7QB 2WINI 4Z7OB 4IHKA 4WK0B 4CNBA 1U0NA 2NUPB 5E6UA 1V7PC 1DZIA 2NUTA 1BHQ1 1U0OC 3PPWA 1M2VA 1CK4A 1MQ9A 3NIDB 1MQ8B 5KYNA 3FCUB 3ZE2B 2M32A 4C29A 1JEYA 3ZDXB 3M6FA 5KYYA 3QA3E 1JEQB 2B2XA 4HQFA 4WK4B 5E6RB 3ZDYB 3GXBA 3N2NA 1T6BY 5LN1A 3EOBI 4HQLA 3EGXA 4MMZB 3EGDB 2I6SA 2VDQB 4C2AA 4FX5A 3NIGB 5KYWA 4PN7A 3TXAA 2QTVA 4F1JA 1XDGA 2I91A 1AUQA 1QC5A 1RD4A 2I6QA 1MJNA 4G1MB 4M76B 5KYXA 1ATZA 3K6SA 1YVPA 3ZQKA 1FNSA 2ICAA 1RTKA 3ZE0B
chains in the Genus database with same CATH superfamily
4P3OA 4FGKA 4QDXA 3PT9A 1F2VA 2ZBQA 3THXB 3GO4A 4ZVVA 3USES 4H1TA 1BKYA 4IJMA 3HR7A 4IJ5A 1R4ZA 4LYAA 1LRJA 2G07A 4MRNA 1JR6A 4CV1A 3FI9A 5DP1A 2GI4A 1GOTA 3U3XA 2ADOA 3ZCUA 4YUXA 1Y1TA 4IGIA 2D1SA 5ICEA 4H18A 2NADA 2PRJA 5FTMA 1U2DA 5LWHA 3KC2A 3J81k 1BE8A 2JKZA 4NDAA 3WO0A 4I8IA 1S1CA 3CF4A 2GPNA 3ZGZA 1Z39A 2YIMA 5LJIA 4YYZA 5EMJA 3CO0S 5A1TA 1MUUA 3VPDA 1PJQA 2KS6A 4A0GA 4CUZA 4MVXA 3GGJA 1NXOA 4JL8A 4AF6A 4EYGA 3R8FA 1GZ4A 1M8FA 2J9RA 1M8PA 4L5BA 5J4LA 3KEFA 1ZA2A 5BO5A 3HEMA 1AN9A 2G0NA 2RHMA 3EVFA 3OE7A 4KW7A 5CXQA 5GIPE 3HXQA 3TNFA 1K8QA 4UTRA 1TYAE 3COSA 3V42A 2ATVA 4EL0A 3UCXA 1ZHHA 1IZ7A 1PJCA 3R0XA 2WHRA 1ADCA 5E4FA 3PENA 4ALLA 4DLSA 3H9QA 1NI4B 3U3JA 3TE7A 5CVDA 4DAEA 3HNPA 3K1JA 4DNOA 3KAJA 4ZVTA 1P74A 1D4AA 3BIOA 2BAGA 2FOXA 1L9XA 2JJQA 5A5FA 2J7PD 2PWBA 4Z4QA 1DLIA 1FW8A 1XZAA 1F60A 4YRDA 4UHEA 3BJRA 3BH7A 3FN4A 2I4OA 1G6KA 3G2MA 4BNLA 3EXG1 1EVZA 2FDRA 2Z9CA 4MQBA 4PZ9A 5FB3A 1OF1A 4CETA 2A3RA 3RHSA 1DXOA 4EY4A 1YBFA 3AEKB 5FO1A 3H0KA 4OOEA 1YBMA 4YV1A 1NW8A 3KQMA 1ZD9A 2PZMA 4MYUA 2VT3A 1UEJA 2X0IA 3OEED 3B78A 4QARA 2ZIXB 3MRSA 5JD3A 5FOWA 3L06A 4G0UA 2OO5C 4UNPA 2GF2A 2GS9A 4MV4A 1GV0A 1TZJA 2UAGA 3H3FA 4RK4A 1WCIB 3DWFA 3KYDB 3EXHB 1JDZA 2J41A 3LGSA 3MB8A 5FBHA 2G6TA 2Z57A 4GMDA 3PXCX 3U31A 1Y4SA 1N33B 2OV3A 2PTHA 3P0EA 1MNAA 2FHSA 2FRXA 4U4AA 2GNAA 5JMWA 5EZQA 2P9BA 5KYNA 3SIPA 4LHWA 4M0EA 4EW2A 2D0IA 2XVMA 4COKA 2YJTD 5JFGA 4DCJA 3EPPA 2IELA 2VEOA 3WGVA 4OJNA 4Q4AB 1W581 5A4AA 1UFVA 3EXFA 4DEYA 5CCBA 2FWNA 1SCQA 4GWGA 4D46A 4XGRA 1S8OA 5K8CA 1KJWA 3I9OA 4WN9A 4G9GA 1XSEA 2XTMA 3RAJA 1YK1A 5FTJA 2X15A 1I0IA 1UWLA 1Z82A 4NXMB 1E4YA 2Y99A 3B6JA 3HB0A 2ZI9A 4LS3A 4PU0A 5F1YA 3THYA 1TFUA 2YRWA 3QEOA 4P4NA 1ZSVA 4QUHA 2CD7A 2E49A 4R8KA 5E6UB 3J7AC 4TRRA 2XUOA 3C70A 1JMKC 2AW5A 2HK9A 2V7WA 2DWCA 3LGXA 4MPTA 4PHCA 1H4SA 4ARZA 1DEXA 1K3TA 2OBFA 2XT0A 5FQOA 5TMDA 2WSLA 2H0AA 9MHTA 1HOTA 2WUGA 1HDXA 4K6FA 4UMFA 4DM4A 1X7XB 1GA4A 1RJ9A 1QIHA 2ZSJA 4HRYA 4LQ4A 1Z0DA 4KXFB 1AGPA 1WQ1R 3LPLA 3NGMA 2PT9A 3WFZA 1JJFA 2BEWA 3MC1A 1JSZA 4BQEA 3ZWQA 4D4LA 4TM7A 1ONOA 4HDNA 4DARA 4KQFA 1QNFA 4FZJA 2O1WA 5J23A 3JQPA 5GIOE 1KI3A 3G0DA 4BECA 3AKEA 2KX7A 5DEOA 5DT2A 1RCUA 3BK7A 1MIOB 2X4DA 4D9HA 4QTZA 3IBYA 1EVQA 1R0ZA 4GRAA 4HPXB 5AKEA 1IY8A 1TKRA 2OG1A 3M89A 1NI5A 2DPMA 3PKZA 1DRVA 4FDTA 3MINB 4FXOA 5DSXA 1DAMA 4BGDA 1NZJA 3MMZA 3FOFC 5HZHA 4ZJYA 3WKCA 1PYDA 2DQSA 1SQSA 4ND4A 3MBIA 5EI5A 3WLMA 3WLJA 4D4IA 2LBPA 2YC2C 3N0RA 4KXLA 2AI3A 3VBEA 3H5TA 1XAGA 3H9EO 3K0AB 4CM4A 4OQPA 1B0AA 3TEFA 1Q11A 2PVPA 4EELA 1AS2A 1NQXA 3HJHA 4EHNA 2W2PA 3LLUA 5ALMA 3H9CA 3UHAA 1LTQA 3HU1A 1O2DA 1K3FA 2WHXA 3K30A 5KQSA 1VSQA 1UKEA 1USUA 4AY2A 1UBEA 5K51A 2XCUA 2IDKA 2IQ5A 2VJQA 3A9CA 3HL0A 2V54A 4V39A 3TAUA 2FEAA 1E98A 3AB3A 3BTSA 4LV6A 1YCDA 2CLEB 1PEDA 2NOAA 1JQ5A 1W4ZA 4P53A 3UAVA 4P84A 4MUXA 2ZPTX 3PYLA 4DNXA 2XYRA 1SIUA 3PWTA 2DHRA 1ICEA 2I3ZA 2ZUCA 2E4UA 3AR9A 4KDEA 4AC9A 2PCJA 4X65B 1FC0A 1KZ7B 5ES4B 3ZWAA 3E7PA 4D4GA 4ZZ2A 1Z12A 5BMVF 3R5FA 1KFKB 2B2NA 2Z4RA 5LMUB 2CHGA 3AOGA 5EVJA 2NUAB 2D5BA 1Y8QB 4UBLA 1QE5A 4CMAA 3S8YA 4JI2B 5LQCA 4IKPA 1Y1KE 5KC9A 1MOSA 1VM6A 4LRYA 1GAWA 2QVXX 1NBAA 1A76A 3H1AA 4TLMB 4MVJH 2OBNA 4JT4A 1DXQA 5EQDA 3S7ZA 3AB7A 1CS0A 4Y2PA 2WJAA 2XXBA 2ORVA 1C4XA 1JJVA 1UR5A 2QM8A 2VF5X 2YJGA 3FM9A 3NHJA 4FKMA 4XIGS 5GJBA 4O4HF 1TIPA 2OTCA 1WLSA 4O4HA 1FRNA 2CJWB 2IP1A 4K9RA 5GJCA 4DADA 1PTJA 4OBWA 3HXKA 2C78A 3E70C 2O8VA 3PFWO 3WKDA 1P1KA 2O59A 2EFGA 3M0EA 3TI7A 3CR8A 2XA1A 3PTLA 1K6XA 1DC4A 3I1FA 3NIWA 1LH0A 1YK0A 5CH3A 2IZOA 5CDHA 2PWAA 1UXHA 4DIKA 3U3ZA 2XE8A 4LTMA 1G8MA 4B32A 3VKHA 4Q3EA 3DL0A 2O8BA 3RADC 1TM5E 1LLQA 1EK6A 3D4OA 2NZWA 4EKDA 3NDRA 1FP2A 3QLTA 2Y66A 5CG2A 2FTKE 3RRMA 4LQDA 2COKA 4X61A 2AUTA 3D2LA 2PXXA 5AK4A 2OZLB 3T4PA 5CB0A 3OWXA 4DN6A 5K0CA 2OHJA 1ZK1A 1OAOC 1CJKC 4GZMA 4EMSA 3LA8A 6ADHA 1RC0A 4MR7A 3BREA 2GZ3A 3KB2A 3K2QA 2DYKA 1X70A 4BYMA 3O8QA 3O74A 4HATA 3GZNB 1Z4JA 1Q5PA 2CF6A 3HYSA 3JVVA 3B2QA 3KBOA 3T95A 5ALVA 3ITNA 5U1PA 1R8XA 2ZUFA 1T0JB 2XBLA 2PWPA 1F1BA 4YCJA 9ABPA 1KYIA 1LZLA 1T8PA 1HETA 1NMSA 1UBLS 2QE7A 1UFKA 3A2NA 3LTEA 2IU0A 4E7PA 3ZHBA 1KYYA 2I7XA 4KLAA 1NUSA 5DK4A 1TTTA 1TAUA 3R1IA 2PL1A 1GGKA 3IAFA 1P91A 1JU9A 1O97C 3LW7A 4EF6A 3E2IA 5MF6A 1U0SY 2JBAA 2GFIA 5GOTA 3SQOA 1ISPA 5D51S 3MS2A 1BWPA 1WM1A 2NPIA 1JHOA 1PQYA 2BPOA 1XMPA 2NW6A 4U7HA 3RIEA 1CWUA 4CFYA 4H9GA 4BZXA 1VIMA 4DOMA 3I2FA 1Y6RA 3CSDA 5ITVA 3GLVA 4JYAB 3A8TA 3MQ4A 1I7QB 1MEOA 3AWDA 3KL2A 3LL7A 4A0QA 1U8AA 3MWJA 4LJ4A 2XHZA 2FXIA 5WRFA 3R9IA 3BHIA 3CUSA 5A4IS 3K0HA 4R1UA 4FEYA 1JEQA 2ZR0A 1YBHA 3LOQA 2XOKA 2H1IA 5LA6A 1JW9B 2R5WA 1NXWA 5AM4A 2R60A 4CM1A 1Q1QA 5E1BA 1YZFA 3VKVA 5FAXA 2ZREA 1MHPA 4MWOA 4NFSA 2GUGA 3AL2A 2R6HA 2ZBPA 3JQ7B 3QU7A 4MGZR 5HF6A 1HDZA 4F6RB 2ASVA 2ZZMA 2Q4OA 4LYGA 5I9BA 3E23A 2ORYA 4WOKA 1AGRA 2PMDA 1K75A 1DINA 1MR3F 3PFFA 4GLLA 4HFRA 1GZUA 3IO3A 3AI3A 3FOBA 1RACA 2LKCA 3IQEA 4WLFA 4F4JA 1N0UA 1U9CA 3H13A 4G5SA 5DGCA 1NPYA 2K5UA 3GJSA 2VAXA 3NFYA 1ODSA 3R09A 2A59A 4CKWA 1FVFA 3GWZA 1YDEA 1X3SA 1ZWLA 2FRDA 2PU7A 3H11A 1NSYA 3H04A 1KK2A 3K70D 2I33A 4XVHA 1D1SA 2QL7A 3B52X 1W4RA 2AG0A 3RPEA 4W9MC 4RY8A 1NVUQ 3W77A 4LQCA 1XZMA 1K63A 1QDEA 2RHCA 2VT2A 4BMPB 1RI4A 4P7GA 4WLEA 5CXSA 5HG0A 5FUYA 4EDFA 5AVYA 5D3ZA 1AKWA 2YC4C 4EMTA 2AR7A 1P0FA 2HHAA 3FYTA 1JEOA 5ALYA 1V4BA 1NZFA 3OZIA 3RUCA 1FUIA 3AUYA 5JVDA 1X6VA 2B4AA 1P72A 3MWEA 1PJTA 3CJRA 1H2BA 2FP4A 4F06A 1QIJA 2PRIA 4A1FA 2ZYUX 3CPEA 1KPIA 4LMBA 1A71A 3W3AH 2CLKB 2L17A 5AKJA 1V9LA 5F9HA 1UINA 2NVUB 2WQ6A 3RS4A 4U2EA 5AHRA 3E1SA 1WS6A 3PRYA 4MINA 3FGOA 4N6NA 3YASA 1EM8A 4JLOA 4CMCA 1JB9A 1SC6A 4QU5A 2P69A 3UT0A 1NFQA 2NXEA 3ICPA 5KDOA 1LSJA 1JFLA 2H00A 3KKKA 4YEDA 2HU8A 4D02A 3V2GA 3RDPA 1KY4A 1A9ZA 1WEHA 3NV7A 1HURA 4LYHA 4A1OA 4MO9A 3MWFA 3B1YA 4DLNA 4IHJB 3GGSA 3TGWA 4HLQB 4KIUA 2P40A 2F17A 4ZXFA 3KTFA 1VLJA 1WXGA 3JTMA 2JI8A 3GELA 1Y4UA 4PRLA 1SBNE 3I0MA 4QOSA 2HK7A 2CV2A 2IUTA 4BO4A 1ZIPA 5EHZA 1YR2A 1VIVA 5F2KA 2DGDA 3OQNA 3UXYA 5DOZA 1TEXA 2QJWA 1Q7TA 1W4CA 4GSKA 4R5HA 1M67A 1QH0A 1ZH8A 5LZ9A 1Z7BA 3GJYA 3CT6A 4ZOLF 3QPUA 4ZOLA 3CZAA 5IC6A 1AXGA 3IV7A 1EM6A 1QB8A 1QH1A 3BXEA 1V5GA 1VQ1A 2VYND 3H17A 3PDIB 5K3FA 2QPTA 3FCYA 1EPUA 2V4ZA 2E5LB 3MN1A 3NB0A 3HKDA 5BSFA 1EYZA 2W8BA 5ARBA 4JP5A 4LVCA 1ZVJA 1WB6A 4LZJA 1BDHA 1TJ5A 3PSHA 2RGDA 3FJYA 4B3RB 1H42A 2WFZA 4ZWNA 1JKJB 5EXXA 2AH5A 3VKWA 1JPUA 3PGLA 5B30A 1M8JA 1FTYA 3DBIA 1CV2A 3L4BC 4GGOA 4R1TA 2IEYA 4FE3A 4J7CA 2Q6LA 1GGEA 2F43A 2IY8A 3HJFA 4CXMA 1IB0A 1HA3A 2ZBEA 3IMKA 3LC7O 2X1LA 2PD6A 3C16C 2GAFA 4TV9F 1JR3E 4TV9A 4WA7A 4CQJA 4AURA 4NHOA 2BH9A 2OLJA 2YXEA 3IS3A 4PIPA 4ZQGA 1QSGA 1Z88A 4BTLA 1SA0B 1E69A 1Z5UA 2PPLA 1XLVA 2D1YA 3VJKA 1GZVA 1CB0A 1UJBA 1IM2A 3MIIA 2X7JA 3QX3A 3KSAC 3O75A 4EGAA 2WWRA 1GCGA 4UEQA 3TR0A 4JU9A 2JH9A 3BOSA 2EGGA 2Z2IA 2LW7A 3VMFA 4GE3A 4XKJA 1QHHA 3I12A 3MRXA 2X3YA 3BWVA 3QKTA 5E38A 1H65A 1U0OC 1VLMA 2WNHA 3K9NA 4LWZA 5G53C 4C6TA 4X97A 4IDGA 1QHIA 1QJCA 4PRZA 4DJJA 1MB2A 1EWTA 3MUNA 4MNTA 4CCSA 2DJ5A 2BMEA 3QG1A 1F51E 2BGTA 2OXFA 4JIGA 4RNCA 5CK4A 3V48A 2PR7A 4E09A 3I62A 1ABEA 2C7BA 3JQAD 3A06A 4FYIA 4EJSA 4C6HA 4EW1A 1ZKMA 4WADA 4EUKA 2Q8QA 4ZRDA 4UQLA 2AG1A 4RPJA 3F90A 2LXNA 2G67A 4L5AA 1R6UA 5D8DA 3FIUA 3N2YA 5D7NA 1WUJS 3RGWS 1OLXA 5DM70 2YMMA 4WKPA 2ZJ5A 5GPBA 4P0QB 1CZKA 1WKCA 1KIAA 2AXEA 1W2GA 1XA3A 3N8KA 1UEIA 3NBZC 1J00A 2X8AA 1QO0D 1VKZA 2FZVA 3H1FA 4HH4A 4J2OA 1I0ZA 3QFFA 5HF9A 2BE9A 2V59A 2QM3A 5FNVF 1SUCA 1UBGA 3I2HA 3WBKA 1CEYA 1YE8A 1ODCA 2NNWB 3NALA 4HGRA 3A6ZA 4OP2A 3AR5A 3SYTA 3H2HA 4HHEA 3OD5A 4RM2A 4DNPA 1PSWA 2CNKA 1GZ5A 5DBIA 3I2YX 3O1HB 5LP6B 5DULA 5A4KA 4IIHA 2VJAA 3JZIA 3MJRA 5DBGA 1U7UA 2Q4TA 4OQEA 4PFSA 5AVKA 3AY6A 3FJOA 1L5WA 1D9XA 2QB5A 1R5JA 4MA0A 3M4YA 2CK3D 2NO1A 4AWAA 4ARSA 3R6LA 3W7AA 3AI2A 5BURA 3N6RA 3QKSA 5PGMA 1W1UA 4MYHA 2P4QA 2WPDA 4Q4JA 4YMTA 1ILWA 2I3DA 1NOIA 3ISVA 4CM8A 3ZTTA 2Y77A 3C5CA 3JWHA 4ZGBA 1S8FA 2WVAA 3W9YA 1JIKA 4IS2A 1CRLA 1RJEA 2HLHA 3VISA 3RC3A 1F3LA 3ZDZB 4DDUA 1ZGZA 3GNSA 4KGVA 4EI2A 4JODA 3SS7X 4R84A 2MINB 4RESA 4YRPA 2ONCA 1KMIY 3DTVA 1L3CA 1C5KA 1XTBA 5AVZA 1V3QE 2XWQA 3LBYA 3WY9A 3TNJA 1VSUA 4JAVC 3UANA 1JHZA 5FL7D 3H6GA 1JTVA 3FPJA 3ONWA 1DRUA 2GEJA 4ADSG 3PUKA 2HA6A 2C2BA 3BHMA 1W9HA 5FYDA 2PUCA 3AFHA 4HKTA 5BPHA 1PGQA 3OFND 1FDWA 3F6RA 3EVDA 3N8IA 3HXOA 1QIEA 2FOIA 4E15A 2OGUA 3GQBB 1H0RA 1N2CA 2V0CA 1VCHA 5B1HA 5K2MA 5KIAA 1II8B 1HY3A 2JH8A 2P91A 3WLIA 3OTWA 5AW8A 5LYJF 1DCTA 5LYJA 3WLQA 2Z3ZA 1W88A 4Q9JA 3ROZA 4K87A 4XOIA 3PXAA 2YH2A 5IZCC 1YJ8A 2P3QA 3FPAA 3R9WA 5CIWA 3AF4A 5EKUA 4EG4A 5L3QA 4L85A 4HQOA 2P3OA 2ZBRA 4I5DA 2Q1UA 2YJ3A 2WU8A 3TTUA 2ISQA 3VR4D 4D4HA 1ZUD1 1SUWA 3ELYA 1YL6A 4BU1A 5EIOA 1T34A 2PT6A 5T67A 4Q16A 4K6HA 1XNQB 1TTPB 2E18A 5IUJC 2X9QA 4KRYA 3DCJA 1IRXA 2CHQA 2O1SA 2W43A 3FCUB 4HGQA 4X93A 5CHEA 4CI9A 3GLSA 1V8FA 1DFGA 1OT3A 5CT6A 4U2KA 4V38A 4ZKEA 3PJDA 1II0A 5IKOA 1MB9A 4GI7A 3I37X 3GBVA 2EJCA 3OX3A 3R7AA 4DIMA 2VOJA 4IDQA 3G2OA 3BSYA 3F3KA 3W7BA 2P0YA 4R3WA 4J1NA 3KZOA 2YZMA 1QHSA 5J2UF 2QL5A 1SXQA 4KNYA 2JAUA 3C5WP 4Z3OA 4TTAA 4JOBA 1UDRA 1PWZA 4FFNA 2P11A 4DTIA 7YASA 3DAOA 4BFUA 5HSGA 2XVXA 1K4KA 2OHVA 3AP2A 4ESHA 3BMOB 4FHGA 3LH5A 4KZPA 3LCRA 1YIOA 2AFRA 1JQEA 3RLIA 1YS7A 4MUIA 4PO8A 4BVKA 3LF2A 4E07A 2AZ4A 3V8NA 3PWZA 5E4JA 4OA8A 2B35A 3HABA 4KQEA 4E46A 2R6JA 1LC0A 5LZ2A 1FSFA 5B58T 3DOFA 1OZHA 4MKIA 5EUBA 1E0JA 1N5RA 2VZ0A 4WUTA 4O8ZA 4QYIA 4XDZA 4CUKA 1Z35A 2W2NA 3WWYA 1KO7A 4C4AA 4EVSA 5AO9A 1I2AA 2I2BA 2RHRA 2V9CA 1OX5A 1BJKA 2X40A 4PLWA 1JXOA 3Q5EA 5B7PA 2LZ0A 3KK0A 3EXG2 3O73A 5GTDA 4TKUA 4DY6A 3VO8A 4EKNB 3TQFA 1DKRA 4BFLA 5EPEA 3SJ7A 1D6SA 4AWBA 4PAWA 1M7HA 2WTAA 1YR9A 3OD1A 1RWQA 4TXLA 4XOUA 3RRFA 3WKAA 5CFOA 5CLIA 4MWTA 5L6LB 3ZE1B 3IVCA 4FOTA 1AQLA 2B5WA 2BUAA 2QD5A 3F4BA 2DTDA 3F2IA 3U4HA 5M5BA 3CWCA 3ML1A 1GR1A 2ZB4A 1RLUA 2IPLA 4QEZA 4B6JA 2Q5HA 3S81A 2ERCA 2XV1A 2H1RA 3GFTA 2CBZA 4PNHA 3I4CA 3DR5A 5K3DA 3RC7A 1T3LA 4NU6A 1FSZA 4FZ5A 1CDZA 2QPOA 3LT5A 4MPDA 1EFVB 2QD4A 4FC7A 4P4TA 1GILA 4EWLA 1MVOA 1DJOA 2HIAA 2IIPA 4FIZA 4N0QA 2VTBB 4ZVUA 8GPBA 3G2IA 1NBME 4KQJA 3RBXA 4DSUA 3WAKA 1E99A 2VZLA 4GL4A 4OREX 1HYHA 2VCEA 3BA6A 3ZQ6A 1WV1A 1QM5A 2HQSA 2ZW9A 4IEEA 1YF3A 4HN9A 1J5EB 1RCTE 1Q0SA 1QFJA 3SGLA 2JCGA 4IH9A 4DRZA 2KJQA 3HWSA 1E1DA 4NOMA 1KS9A 4KIGA 3TLGA 2EYUA 2I55A 3SXUB 1MF7A 1Z3IX 1GPH1 3O84A 1KRWA 4XYEA 2QTAA 1T1IA 2BWJA 1BYIA 2VXOA 3WVNA 4H3SA 3ZX4A 1PVDA 2YW9A 2HCBA 2WQZA 4IV8A 5AK6A 3FR8A 2YJZA 2QZJA 1A8UA 2G0AA 3WQHA 2E4XA 4IYJA 1T4BA 2OC9A 4LWOA 2P7IA 1MXFA 5JTUA 2FRDC 4IR7A 2JCBA 5CLQA 5KTRA 2EQBA 5DWDA 1E2UA 3J80A 1K7FB 4K8OA 1KQGA 3LCUA 3Q72A 4MLZA 4PLCA 2Q5OA 4JSYA 2VHQA 4KJXA 4POAA 2XHEA 3LY9A 1I24A 1KEEB 2ZT7A 1X7HA 4AZVA 1B26A 2YHBA 3BL6A 4Y6PA 1G7SA 2FI1A 5J58A 1KERA 2ID8A 2ZRBA 5CT9A 2UZIR 4BQOA 1I9GA 4BVEA 1E0SA 3WL3A 5JANA 1FL9A 3N76A 2EKZA 4L9SA 3JYPA 3UK0A 2A9JA 2P79A 1O94D 2IIVA 4YAIA 1BHSA 3L0PA 2AI1A 1KSJA 3ZUPA 2F3SA 2CJPA 3A9UA 2JFXA 4OAPA 3FHTA 1XDGA 2BEUB 2D2IA 2DX7A 2OP1A 3JQ8B 4O8CA 3ZZ1A 5CCXA 4BLRA 1E94E 1BVYF 1NRXA 2J5BA 1IB6A 1JQKA 1QS0B 1V11B 2WM8A 3D3QA 4HWKA 3P1JA 4HZUB 1JTFA 3RRYA 2CNLA 3AESA 1P7CA 4QUDA 2YFHA 4ND1A 4B6RA 4OJQA 1DAHA 4HQRA 4ISCA 2I78A 4DLPA 1I7SB 3ZVMA 2P9JA 1UZNA 3AEZA 5EJGA 5KU1A 5FWXB 3LUPA 2C2ZA 2PX8A 5BOSB 2YOHA 2J3MA 2DY0A 2VKTA 4J43A 1A5BB 5AKYA 1TK3A 4CM6A 5KCZA 1RWXA 4GBJA 1HQCA 3GFGA 3MXTA 1VIDA 3DD5A 1KQPA 4U8HA 4ZQCB 1F0NA 3BZBA 3OZWA 5E2IA 4RU1A 4CKBA 3N7UA 4JBGA 4BWVA 3MWKA 3ZIUA 1Z7GA 5IH7A 1YRYE 5KVQA 1C8LA 1PJBA 2K2WA 1W0CA 2QIPA 4KXQA 3MMSA 5AM1A 2W6JA 4MMXB 1OZAA 5DISB 3KPJA 4WKBA 4KQXA 3U26A 3T7TA 1OASA 2V7PA 1F0YA 4DMMA 8ABPA 3SQWA 5F3RA 3H1PA 2JCVA 1FE8A 2H9AA 2H0RA 3L7NA 1CUGA 2Q9BA 1YFZA 3DZHA 1GTSA 4TMTA 1P1RA 5FUQA 4QREA 5J2TB 1DC7A 1GADO 1P3DA 1VDMA 2Y1OA 3OPNA 3PCRB 4LC9A 4N0MA 4PCLA 4EOGA 3F6SA 4FSHA 1MA3A 4L15A 1T4DA 1FY2A 2MDTA 1W0KA 1L8XA 1QAMA 2UUPA 2QN1A 3KCQA 3HRKA 1JBEA 1E63A 4J2HA 4NAVA 3GLGA 1DV1A 3F46A 1PE0A 2XYGA 4QGGA 3UW1A 4HNRA 4G4JA 1V8OA 5C8ZA 5JARA 2J6HA 2R8XA 1H3NA 4CTKA 1F12A 3MILA 4PWZA 2D7JA 4F9EA 2D0PB 2B61A 4NC9A 4EDHA 3CINA 3H6KA 2XNJA 1NATA 4MAFA 2B83A 3B5JA 2PD4A 2O23A 3PUJA 2PZKA 1KC3A 5DWQA 2PIDA 4C5CA 1X1BA 3B36A 1OLOA 2VYVA 3UMBA 2BFFB 1X80B 4KOAA 5DYIA 3PNSA 2R47A 2ALJA 1G5RA 2GK3A 4Z4GA 1N6LA 1Y4AE 5KVSA 2C8VA 2VH2A 1E2HA 1J8VA 3K4QA 3JVEA 1M6YA 2IGBA 4JUCA 4G5XA 2Z30A 3Q6MA 4JKOA 4LPKA 3U3OA 5DRYA 4Y6GB 2FW6A 4UUPA 1OQAA 3EUAA 3QLVC 4X84A 3WNCA 3HC7A 3KVYA 1KZ9A 2GPTA 4FFDA 3OJWA 1FQKA 1JMVA 2H4XA 3SFVA 3VX4A 3RU9A 3N58A 2J6BA 2XDWA 2BGKA 2I80A 3IIIA 5FQNA 3FF1A 2GPJA 5BW4A 1JEYA 1X86B 4TWRA 1P81A 4BFCA 1KVSA 2CNWD 2MCFA 1USWA 1OWOA 2HF2A 1HMPA 2NWQA 2XBUA 4H7FA 4KYUA 4YV7A 1OB2A 2ZJAA 1YA6A 1ECBA 2IEIA 3JCZA 4CNQA 2X0RA 2W93A 3DUWA 1N7IA 5MN4A 1DBPA 2X2FA 4M8LA 3TO5A 4MYRA 4F3KA 2OOSA 1TW2A 5DGXA 3D5EA 4I6GA 2G8LA 3PK0A 3HYNA 2BM8A 3GVIA 1XQVA 1ONSA 2XJ9A 3GV0A 3K8OE 4KIFA 5BN5B 1V37A 1TU0A 1DT3A 1U2PA 1ULHA 4P3PA 1XK6A 2YJ6A 4QPZA 4ARAA 2IHKA 2CB0A 2C07A 4KV7A 5FI0B 3IEMA 2PLFA 3KOMA 3GGOA 3ON5A 3H0EA 4ECEA 4URXR 2Q3FA 2Y9PB 3C6YA 1XEWX 4BTEA 3Q98A 3JR7A 4QECA 3MGGA 2HLDA 1K7CA 1X7ZA 3O93A 4ZVQA 2WK1A 1J07A 1LS6A 2H29A 2LP4Y 2Q1SA 3IP3A 3QVSA 4FZ3A 4B75A 4JLWA 3EA5A 1YJ5A 3TTTA 1PR4A 1XIVA 1T2NA 3A4TA 3L6DA 1Z2OX 3E9ZA 4DWWA 1QZTA 1ZRHA 1C9KA 4DA8A 3BB1A 3KWLA 4FU0A 3VR6D 3GDFA 3JY6A 4AY6A 4M21A 3T1VA 2B78A 1DXYA 1GXSA 5AJVB 4OH1A 3OY7A 4D79A 4EO9A 1XUOA 2LDXA 3B7GA 1DCFA 5BSKA 1I2DA 3FCSB 3EGWA 3OQPA 1WMEA 1SD2A 2QTLA 1E2EA 1SC3A 2CVQA 3AG6A 4U1RA 2OKCA 1KP9A 1MVLA 2JFFA 1NPDA 1MCZA 4LRTB 1II9A 1XKQA 4CT0A 2VYQA 1AUPA 1NU8A 1UOEA 2D54A 4X7PA 1L5QA 4TROA 3HCWA 1ST3A 4L74A 3W78A 3OP1A 5JH7F 4DZTA 1EFCA 2QN2A 4PC3A 5HTKA 2Q4RA 3STUA 3Q7RA 1RR6A 5K45A 1EESA 4C7OA 3IKVA 3ROXA 1FDOA 2ENUA 2VO1A 3JASA 2VTKA 4YB8A 5F1PA 4B40A 5JQGA 2JFHA 2WJZB 1HL3A 4ZXPA 2NZXA 3A7EA 3CG0A 1S2DA 4O5AA 4CF3A 5E6RA 4HSEA 1W5SA 1X1EA 2C0CA 2DBQA 5DDIP 2E48A 1K5PA 4EFMA 3JQQA 2LCIA 3BXPA 5FI3A 4ROTA 4AJ9A 2AD5A 2XXAB 1JHUA 4IXNA 2DLDA 1UQUA 5A62A 4DSOA 3CQ9A 3IAM6 1AMOA 5IJAA 4KWIA 4ZOQI 3RYIA 2HA3A 1EBBA 2QP3A 4REMA 3VU0A 1HUQA 4LI3X 1JAXA 1U7PA 2W83A 2W37A 4FWTA 2PX4A 5CYPA 3DVAA 2DWPA 2GXQA 3G0CA 5K4GA 4C4TA 4IMJB 3UENA 2GSDA 3IDZA 5JPIA 4KMMA 3DVQX 3VOSA 1ZN2A 2Q5EA 3DAHA 1J0XO 2JLYA 3HH8A 4BBZA 5JZ9A 1VI5A 3SYKA 1ISIA 2DY1A 3SJAA 4NCNA 4R01A 3FSEA 3A70A 1N9GA 2RKWA 3A3KA 2ZJ8A 4PLFA 4OMUA 5LL6P 2NT3A 4KV9A 3UK7A 1P45A 2Q3EA 5D3KA 5TJ9A 1R6BX 1ZESA 1F0PA 4IUCS 2PJUA 2V8BA 1UPAA 3MERA 4JSTA 4Q66C 1E5XA 3U1BA 1F0KA 2HSGA 2O6HA 3RUPA 4ER6A 4UUMA 3T9AA 1OH5A 3DHWC 3ADKA 4KB5A 2A30A 3AV3A 4UCQA 1AKQA 5DGIA 3B1JA 1C7RA 3WGNA 3R77A 2X14A 4RY9A 1HDGO 3QW4B 1K5GA 5I3CA 2QUIA 4O3FA 2HBRA 1SHUX 3JAKA 2J07A 4M53A 2PMWB 3FXAA 4OYYA 4B3FX 1UCFA 4A9AA 4BO5A 2Y1EA 3D8SA 3RF6A 3W3ZB 3ASYA 4GI1A 5DM1A 2F3UA 4Q6BA 2Y76A 4LFCB 4B4WA 4IQ4A 1P8JA 4FIDA 1GDDA 3H1EA 4G0OA 4G67A 1UDAA 2YFKA 4A2CA 1G0NA 2WT8A 3EF0A 2AMFA 3OG9A 3GRCA 4QELA 3MMNA 4CV3A 2H2GA 2IPAB 4MW0A 2WSIA 2Z2KA 1VJCA 1IAVA 1OFTA 2IYUA 3ID6C 3N5KA 3OZFA 4WJLA 2JHAA 2A2ZA 4LJ9A 2VVTA 1M2WA 5K7SA 1X3LA 2I5PO 4TL6A 2A1TR 3B1FA 3R0IA 1JIIA 3T8YA 4BKUA 1L5MA 3S2YA 1RM3A 2N1BA 3CZPA 2WHYA 3U6KA 4GR9A 1UF9A 3IELA 1W5EA 3BGOS 3AJRA 2ZB3A 4O08A 5MDHA 1WCYA 1PCXA 1Z6GA 1CPYA 3ZBUA 3K9FC 1SHTX 4I9HA 3KQKA 1LFDB 2W2KB 3K09A 4R8LA 2QLBA 3DKRA 1CQJA 3UMCA 3GLIA 3IT3A 2I03A 3LP8A 1P4GA 3FNHA 1SXIA 4KO4S 1Q0PA 1WUTA 1V1MA 1TT5A 2X4GA 3HG7A 3TXXA 3WK5A 3RSLA 3D7MA 1QP8A 2B4YA 1YOBA 5FTWA 1KJ8A 2JLZA 4R6WA 3PQ5A 3FH0A 4EKGA 5AI4A 4CQLA 1XEAA 3VKFA 3GRRA 1QG4A 4OSPA 3FJ1A 5AOAA 3WDSA 4XWKA 2AKEA 1JHXA 3ZU3A 3CZ5A 3JSAA 4MV6A 2YHSA 5LQSA 3BBPA 3UWKA 5TMEA 5ESRA 1GPAA 1K7XB 3ZQJA 1MO2A 1U0NA 1ZW1A 3RK0A 1QOZA 1A5SB 1IEXA 3LFUA 1UFRA 3TRDA 5G1PA 4E1AA 3C3XA 3LNCA 5AJZA 4JI1B 5IK2D 4QVKA 3ZJTA 1FNMA 5AD1A 4RTSA 2YJ4A 4EK9A 1H0KA 3QI2A 1YHYA 2OK8A 3I6QA 4JASB 3I8SA 4C88A 4N48A 2RKOA 5I01A 4US1R 1W7AA 3WS7A 3RS0A 4BE7B 5LM3A 3L40A 3AUUA 1KNQA 1LPSA 4YBZA 5CHYA 3ZY2A 1ODJA 4C2AA 2OSVA 3Q7PA 1RQ2A 3LUAA 5EZYF 1DKLA 2J7PA 4BQQA 5DHUA 4ILKA 1G63A 1QYVA 1AB5A 1I2ZA 1GGMA 4MAMA 2CY0A 4X41A 3ZKWB 3PLNA 4NRDA 3OHMA 2N3ZA 3NWEA 1HT3A 3LMKA 5CVTA 4NZMA 1CLUA 4UU7A 2WM3A 2HCTA 3CW8X 3TX2A 4CHGA 4E5VA 1O9BA 2NVWA 4DVGA 2OWEA 1XXHB 2Q5JA 2G83A 4NE7A 1YZNA 1PX2A 1ZGGA 5DNDA 3H9JA 4AVYA 3RTCA 2A9QA 4FONA 4EYKA 2A3NA 3HZOA 3C98A 5K6TA 5AVXA 3VSCA 1M5RA 3I0ZA 3BZWA 4GDMA 4RWZA 1K5DA 3QEKA 4QYXA 2WKQA 3FHLA 1TCBA 4H4CA 1BGWA 3AF0A 5G41A 3L7AA 1WSAA 2PKRA 2QRMA 2ZR9A 4HB3A 3UYKA 3B3QA 3K0BA 3OCXA 1EP3B 4LRUA 4GBMA 1TYCA 2J09A 2RBGA 2IK8A 1G4UR 2ZRHA 3SFZA 1Q20A 4F56A 5ALHA 5AIBA 1GFIA 1T9GS 1UBFA 5IEBA 4W63A 2Q7DA 2JI6A 1GFWA 1BG6A 3SOPA 1V5EA 1HE8B 3SQNA 2I22A 2EKDA 1HNXB 4O3MA 2I54A 4UNIA 3UKDA 4DBZA 3IVRA 1PFKA 2BZ0A 5DTEA 3AHGA 1NFRA 2EZ9A 5ECDA 5GM2A 2JAOA 1IEWA 1ISMA 1O7JA 3ADPA 3AHEA 3QX7A 4FNAA 3NP7A 4G86A 1R0SA 4JN6B 2C31A 3K72B 3L1HA 2VWGA 5F2OA 3TN7A 2AEJA 3AEUB 4KQWA 5ALUA 4D81A 4PQGA 3N07A 4QEDA 2IHUA 4JP8A 1EG2A 1E1CB 4YRGA 3GF4A 2B8TA 3PDCA 1JF8A 4MV0A 1K2WA 2IHNA 3B9BA 4R83A 2FDXA 4KR2A 2QUJA 4PINA 1L5FA 2O20A 3BK1A 1TKBA 2VA9A 2FSFA 2IXDA 1KH3A 1UOQA 2Q49A 3O82A 2IVZA 4CLRB 4DJEC 5GONA 3OLYA 3FTQA 1Z5GA 2C3OA 3IQHX 3SX0A 2XEXA 3NWOA 4CEJB 3LUJA 3GOHA 3I92A 4URFA 2RGCA 3FRHA 1XX6A 4DA9A 3ORQA 4AS3A 4QNNA 2FPGA 1GGHA 4Z54A 5CDSA 3GFOA 5D1HA 1NXTA 5FOSA 4LXYA 3PR3A 4F4CA 1PR2A 2O8FB 2Q62A 1REQA 4QYSA 1MD9A 1PW7A 2X3FA 3H87A 2ZSAA 3OUTA 1H93A 1JHMA 1U0GA 4WBNB 4M37A 1A7AA 2X41A 4QHTA 3I9MA 2YN2A 3UB3A 2HDWA 4HWPA 1JH8A 1U3WA 3NS7A 4AMUA 1A7KA 3BERA 1XXHE 2OO7A 3L8ZA 3TLEA 5IJWA 2TRSB 3WIEA 1Y89A 1BS1A 2WIGA 1JG7A 3BWCA 3EMKA 1M8KA 3L3BA 2V96A 5LUAA 4LF9B 1MMFB 1NURA 5IS2A 1GT91 1K8ZB 1RXCA 3SSNA 2GN1A 1V4VA 4EHBA 5JAZA 3W04A 2OHOA 3F5SA 2X1HA 2M32A 1B8PA 3IA7A 5BN4A 1LPOA 4ZT4A 1U1EA 4OIMA 4QUGA 3KTAA 3R5SA 4OJTA 1U11A 4MV3A 3SC2B 4TLBA 2DQYA 1FQOA 3ZYCA 1GKIA 3Q85A 3FY4A 3B6EA 3BF8A 1FYVA 2B9EA 3LTNC 1RM0A 4C4XA 3HE3A 1MVNA 4TZTA 1SXPA 2VYFA 1AQNA 3GPBA 2EF1A 2H2DA 3G17A 3NRJA 2UXDB 4ON9A 2I91A 2P9ZA 3L7YA 5LQAA 1PHRA 3FI0A 3RT9A 1SB8A 2I6QA 1IULA 1G6OA 2OLEA 4GEKA 3WICA 2B3DA 1N5OX 3AUTA 3C6XA 1D1TA 4EHAA 1YCFA 1ZXBA 3DZ8A 5TSDA 3D0KA 2F55A 3DF7A 1N7GA 4JI4B 4ZALA 2G9UA 3TOZA 5BVHB 1ZVVA 1FCJA 2ETXA 4IJKA 1SU4A 5DJ5A 1C3LA 1XV5A 3GN1A 4JGGA 4MS1B 2C4HA 4BNDA 2O5EA 1QDLB 5KOYA 3BMCA 1IMOA 4IGEA 3OQJA 4DY4A 4OL9A 4E30A 5CCEA 2R5FA 1ICIA 4KFSA 3WGGA 3MT0A 2OM6A 2QRVA 3KM0A 1GGNA 4KN5A 4OQDA 3VDMA 1YONA 4Z49A 3C4QA 4RSGA 4AJKA 1VBMA 1EWRA 1M1YB 1NQTA 1OI3A 2Q8PA 3FNGA 2BFBA 4KX5A 4M87A 4UEOA 3S2SA 4A0FA 4UM9B 1BHJA 5I7RA 2F64A 4MHTA 4RZQA 4K88A 3O03A 1DADA 3UK6A 1QHFA 1VL0A 2AMVA 3AHFA 4G2NA 4J6EA 4EPWA 1K68A 5CH5A 5A4DA 2JGMA 3DDOA 2JK1A 2Z58A 4MPJA 2QLMA 4OU5A 3WIDA 3BFXA 3TZCA 4G23A 3FMIA 4TV8F 2BSXA 4TV8A 3WHIA 4QTTB 3RTGA 1YQUA 1KVQA 5FOQA 6REQB 2YW2A 1Z36A 3QXSA 3TDNA 5ADUS 3K9WA 3QA9A 3II6X 5TC4A 4OM7A 4ZZ1A 3UGTA 1IDN1 4RA9B 2GD6A 4FP9A 4BQIA 1U94A 3GMDA 4IUDS 2GYWA 4TXJA 2W2TA 1QTNA 3B89A 3H2IA 1ZI9A 3CF6R 2O2IA 2NU9B 3TMAA 2Z5GA 3ABSB 4B46A 4Q3CA 5BNFA 4ONEA 4OHBA 3UO8B 5C53B 1N2JA 2QT0A 4IDPA 2ILVA 2ES4A 1A04A 2FGJA 2Y1XA 3LT1A 4CBVA 2V7QD 4LXUA 5JI2E 4KK4A 3JWIA 3N74A 4UZSA 2BGLA 4C01A 3A1CA 1EFRD 4OJMX 2DCUA 5J4YA 2Z0MA 1WIWA 1XK7A 4MGEA 2YWRA 3QVJA 5LQKA 2NO9A 4EHKA 4Z3DA 3KDAA 3PHGA 1VB3A 1N2GA 3PPXA 4UW9A 2I1WA 4EGQA 5A03A 4DR7B 3WTBA 2YMQA 1SN7A 1EG7A 4XGKA 3KQOA 4NNPA 1YB5A 3Q2OA 3TL6A 2Y1CA 1PRYA 3PNKA 3OJFA 4YUAA 2PSHA 2FW7A 2O2HA 1A8SA 3AR3A 4NVRA 4DCMA 3NHPA 4OI2A 3TDKA 4BPRA 3DBRB 4WWHA 2AEMA 4JUAA 5IDQA 3RFXA 2A57A 4RJ2A 3M83A 4CW7A 621PA 1OB5A 1EEXB 2J3EA 3DBLA 2PRKA 1JR4A 4LYDA 2VI5A 3TX6A 5A7FA 5JWOA 1X7DA 3EBPA 2AUNA 3A3PA 1GZHB 5ALJA 4EGFA 4LV5B 4RMJA 4RK0A 1OU4A 4LOHA 2AFHA 5K0SA 1BW9B 3TGPA 3M6FA 2H2FA 1CCWA 1ZMOA 5EIXA 1NNSA 4EYSA 2CL6X 2NO4A 4DRYA 1K7SN 3DYBA 3K20A 4IMPA 5KNBH 3EOBI 4HDKA 2I6GA 3CBGA 2AHOA 4Q12A 1I0LA 3T7KA 3ZX5A 3JS5A 5ECYA 4X6UA 4MOWA 4MVJA 2JLVA 2Y8EA 3SU8A 4NI5A 4O33A 4BLUA 3FDFA 4NCIA 5JNLA 2Q41A 4FFSA 3MF4A 2XZDA 1FQWA 4IILA 2CJXA 2QW1A 1L7XA 4X63A 4CF6A 2C99A 1NN5A 4ZOAA 1DAKA 3DBHB 1Q95A 3GDHA 4HX5A 1E3WB 3E9DA 4XI9A 1TYBE 2AT1A 1OBFO 4ZP1A 2R1VA 4ZAZA 2IWHA 1YTUA 1OFIA 2ZTMA 3ZLTA 3PGVA 4HG2A 2OAGA 1HTWA 1U9ZA 2QN9A 3DEZA 1J42A 4XAQA 1BE6A 2HRCA 4LKOA 4N47A 3ZDQA 1QU3A 2YMPA 5BSRA 1JHPA 2JGRA 1Q6ZA 3AP3A 3FPFA 1A9RA 2MHCA 3LDAA 4RLFA 1T6XA 3EH1A 4W9RA 4BBAA 3F2VA 1PWHA 1A5TA 3EVTA 4NJEA 4YJ2B 4W99A 3KXIA 1RHRA 3UJ8A 3ACDA 1D2RA 4NKRA 4Q3BA 3A3OA 3BQMB 4JMPA 4R3NA 4B5KA 3HN6A 4O2AF 1CJMA 1GWNA 3IUEA 4C0BA 3CLVA 3VPBA 3R6WA 3NASA 3LRTA 2IXBA 4CDRA 5C5CA 3GI1A 3LP6A 3T3OA 4AMGA 2LIVA 3DV0A 4RZUA 1E0DA 4Z1MA 1XQ9A 3DDSA 4JNKA 1Z0ZA 3V7UA 3WQQA 1XVVA 5KYUA 2PS3A 5HKLA 2D2VA 1FRQA 3X2EA 4AJJA 4MITA 4DDKA 4DEVA 4BFWA 3ZR4B 1R16A 1G8AA 4B2PA 3DOIA 4E22A 4BY9E 3EGEA 4RPIA 4Y2RA 3D6AA 1AZTA 2GK6A 4FD3A 1C8VB 1S2GA 3GG9A 1BA2A 3CV3A 3P9IA 4JOCA 1COZA 1XL1A 2EWWA 3I2JA 2FFRA 4MI3A 1FUUA 1E4EA 3DVLA 3PS9A 1R6XA 4XJTA 4ENWA 2QUKA 4G01B 4H1HA 2DZDA 3FBGA 9LDTA 1RI2A 1GPMA 4OKNA 3T5PA 4EG7A 4OGGA 3X1XA 5COAA 1C3OB 1EINA 3EVAA 4LE2A 3WB9A 4RZ2A 4XARA 2DBZA 2FW9A 3RV4A 1J2TA 1FJHA 1KI7A 1ML3A 1XYGA 1NPTO 3L7CA 3URKA 3K1ZA 1Y5IA 3IP7A 1W19A 2IX3A 5EP3A 2CJFA 5D2CA 1LU9A 1U9IA 3I52A 3QMMA 5F1KA 2XKBA 3CH5A 1XZBA 2QRUA 4D6YA 1UDCA 1T2AA 2Z8XA 2NZ8A 3I3SR 1H8ED 1PKXA 3MAAC 1F20A 2P2YA 1C3XA 5FI5A 5JROA 2IBTA 2IUSA 2C4WA 1MB0A 2DSTA 2WUEA 4F71A 4XD7D 1GCAA 1CUBA 1E1KA 3LYHA 4MYDA 5BN1A 1H1LB 3ZU4A 3CUEF 3KHTA 1EZ1A 2ZE8A 4LJ5A 4B34A 4JFRA 2JGLA 1F2TB 1NVBA 5CYGA 1AE1A 1IN6A 4PLYA 3MJHA 1A96A 5HZGA 3ERCA 2C00A 4XRGA 2BV3A 1HT1E 1JWBB 1Q2XA 2IW3A 5FTKA 3STYA 3PUVA 3HMKA 3KLNA 1CTQA 3EVEA 1E20A 1MQ9A 4X3PA 5KQMA 2H65A 2VYNA 3BL8A 1MAVA 3QY9A 4QFDA 5THQA 2VRCA 2G1KA 4HDQB 3IA2A 5AQEA 5I7VA 4UHBA 3IUSA 5HP4A 3KB8A 3OA0A 4ZT2A 2HO5A 4L78A 3L1JA 3RC2A 4ZAXA 4M2LA 2CMFA 2CWWA 3O9MA 4OXXA 1Q3HA 3K2EA 5FWYB 2UVPB 4RGQA 2ZIGA 2PK3A 1A97A 1OV6A 1KTIA 1D6MA 2ZAIA 1NQOA 2QS9A 4L0CA 4WMLA 1JAIA 3WV4A 5KKNB 3VSEA 2MTBA 2REQA 4NAHA 1XHEA 4YRZA 5F23A 1SVMA 1AQ6A 3V4FA 4QVGA 2R8RA 4HGZA 1CU1A 4GXRA 3L7IA 4PZEA 5SICE 2HU5A 3TSZA 3QEAZ 1DCMA 1TQDA 2GBIA 2VP6A 1YR3A 2JIRA 4N5IX 5DU2A 5BW6B 1H69A 2BDUA 3KPVA 2Z3VA 1ZSNA 2H7XA 1FRFS 3LLSA 3QLUA 2O6LA 5FULA 2IBMA 2UZ0A 2NPFA 5A9RA 1LWNA 2G5PA 1EGMB 2VP9A 2ZAOA 1W5BA 3HV2A 3MGKA 2HRQA 4JENA 2Y0EA 2Y92A 3HPQA 4N03A 5E7JA 5LQRA 2WVHA 8LDHA 1FFHA 2WNIA 2PGDA 1FYXA 1O4VA 1UBCA 4P9NA 3LHFA 4MI1A 1U1IA 3S0JA 3W3AA 5FTNA 2J9ZB 3ZDAA 1RHJA 2MMCA 3OMXA 4ZAWA 1E79D 1HH4A 3CB2A 3DE2X 2X5NA 5TV2A 1Z75A 3E82A 4AI6A 1LDGA 3W79A 4NH0A 1HTTA 2YVQA 5LFAA 1XPUA 3H2KA 1PT9A 1C9EA 4YBRA 1MQAA 2EYQA 3V7YA 4LBWA 1M0SA 1CUDA 4J0KA 2PR2A 1GNLA 1KO5A 4WX2B 3D3NA 5JSUA 2QRQA 2UV8A 1FMTA 4U9HS 4KG7A 2JHFA 1V0JA 4JGIA 4L4YA 1ZGHA 2OCKA 3I5AA 4JT2A 4L8YA 3T54A 4BBPA 2WIBA 1OI2A 1WUKS 3C7TA 4FDLA 2I6TA 3OAAD 4B3DA 4ZI3A 1Z63A 3ZHSA 2GEVA 2PA3A 4FT2A 4MULA 5ALOA 3RSFA 3ZVRA 1EK0A 2JVKA 2BFDA 3M1LA 3AM5A 3UV6A 1Z73A 4QASA 3ASZA 4E5DA 4LZOA 1GRRA 3ZWXA 1WRBA 1CP3A 2DHEA 2IQIA 4HAOA 2QG9A 3J81A 4MW6A 5AM2A 4ME6A 3ND9A 4LTNA 1FP7A 4OB7A 5KTYA 2AN1A 5CVCA 4DRXB 3NM5A 1R4NA 2JFUA 2OLKA 3HO8A 1ZJ5A 2A0FA 3T4UA 4F5DA 3BJIC 2H7CA 5BT8A 1M54A 5G1NA 3PC7A 1H9CA 2G80A 3C6MA 1MIHA 4OUDA 4E12A 1KEPA 5TB5A 4CQMA 1IOZA 2XR1A 1T9DA 3CLUC 4G0XA 2ZJ6A 4FHFA 2CV1A 1W0JD 4JA2A 3OHPA 2QORA 4JQZA 4PONA 4OSOA 3EHDA 1DBRA 4CTOA 2EQAA 1QRDA 3EW9A 4PCVA 3KQSA 4JC5A 2AVDA 4JB8A 5HS6A 1SCNE 2AMYA 4WLNA 4CR8A 5FPSA 4DM3A 4ABTA 1DGQA 4MDFA 5CDFE 3BKWA 2FJ0A 2G63A 1Z25A 3QOXA 3UB2A 3UT5A 3PG5A 1GKLA 4P80A 2VBGA 1ZN8A 1GL7A 2QM0A 3DFMA 3CX6A 3D9QX 3ICCA 4JR1A 3RD5A 3VXKA 1SBHA 3LL4A 1J1ZA 2VBFA 2I2XB 3RREA 4MQFB 1WQ4A 3KUCA 4B7AA 4QQ8A 2CBXA 1ML4A 3P94A 4IL5A 6Q21A 2WC1A 5AI0A 1Z7WA 2R6R1 2P5UA 5LYYA 5G2OA 3W9SA 4YRQA 5FL7A 4NATA 2YWBA 5BR8B 2D13A 4YRJA 2IZ0A 4I7EA 2KB0A 5CD9A 3NYWA 1UFOA 1JWAB 3KOUA 4WECA 1E2PA 2FK7A 4I8XA 4C3VA 1T5IA 2H4ZA 4P4LA 3N59A 1Q1EA 2B0JA 1VCMA 2WICA 4WOJA 1SVSA 4UOEA 1JIXA 5CB6A 1Y81A 4A26A 4CM4B 3SKVA 1XA4A 1YZ3A 1Z2PX 3NTRA 4U0KA 4A03A 1T8TA 3BHJA 4GBED 3K8ZA 1M8GA 4ZC8A 1MJNA 2W4MA 2W9XA 5DGTA 3KX2A 5CCDA 2VJDA 3ZS9A 2QD1A 3DPIA 5HIJA 3B38A 4BKRA 3KYBA 4F21A 1UPBA 1YL7A 1TAHA 1J90A 3CBQA 1OXVA 2O52A 3HDTA 1X2EA 3LNTA 4Z8YA 3HO6A 4L6IA 2PH3A 2NU6B 3AUSA 1P1IA 1KQ3A 1WF3A 4U2CA 5I5EA 3LRXA 4IOMA 2VP4A 3H5VA 2WSBA 1X39A 2IT1A 5SV2A 4HB4A 3P97A 1ORRA 4H6XA 1BDMA 4YQFA 2VFAA 3P9NA 5CGQB 4EVQA 1TK9A 1FDVA 1ZEMA 2RG1A 2M6KA 2BMFA 4BMYA 1NVMB 3E4CA 1DJNA 3DZGA 1QIMA 5LDHA 1DJLA 3CVYA 3ESBA 3GHYA 3NGLA 2B7BA 1YB1A 4LJAA 4B3CA 3GIWA 1KZ4A 3JQFC 4ALKA 2H17A 5BMVB 1B2RA 3BEDA 1PT5A 3WLPA 1NVDA 1XRMA 3UV7A 1MABA 2ZLBA 3DDNA 4TS1A 3K53A 4ZU1X 121PA 2B8JA 5CMLA 3EZXA 4JITA 4RANA 3I4LA 1QQ6A 4RCYA 4X20A 2NSLA 4HC4A 5D00A 3N53A 4ZMSA 4G1VA 1J39A 1ND6A 5B1IA 2PUGA 3KDPA 4EAAA 1FK8A 1XWWA 1FYFA 4NQRA 2NP7A 1JT2A 3ZGNA 3CKLA 3EWNA 2XF8A 5EWMB 5B3LA 2X1MA 4D4MA 5JY6A 2HM7A 1D3AA 4A2PA 5D1NA 3IHLA 5DM2A 3ICQB 4J6FA 1P77A 4DV1B 2H1OA 3G6KA 5I7WA 5IULC 3M5WA 1AJEA 1ZITA 4HTFA 5F52A 1VKJA 1R6AA 3PRKE 3IAEA 2WF6A 1ACJA 3WGKA 4EATA 3WL5A 4I55F 4IZIA 4Z99A 4I55A 4KE9A 3A9SA 3PPVA 1TF7A 2WF8A 3O4RA 1Y37A 3ZNQA 3HO1A 4EEZA 3OBIA 3EOAI 3HUDA 2O8BB 3K94A 2Z3WA 1RBMA 4EZIA 4MYCA 3R7FA 4UEWA 2VSYA 4CPDA 1RTTA 1W46A 2I65A 3L6RA 3V1MA 1KE2A 4RUKA 3BSWA 1LUAA 1OYWA 3KT8A 4LE0A 1H66A 3WNZA 2EC5A 5ABPA 5HX7A 3RKSA 3RSHA 4C4RA 1HDCA 3HQ4O 4I8DA 3SVZA 4BUZA 4NFLA 3I39X 6YASA 2Q3BA 2ODEA 2QMQA 4YO8A 1WMAA 5IUKC 2IWRA 1DQRA 4G5OA 1NYLA 1LC3A 4LSGA 1QORA 1TAQA 2BGNA 4HPWA 1H3FA 1U02A 2ZJYA 4AX4A 4Y9DA 5K3AA 2J5XA 1HOXA 1B4DA 1B16A 2WAYA 3G6WA 4WXHA 2Q5LA 2G36A 2O7SA 4FHEA 5EQJB 4KHPB 4KX3A 4DT1A 5LPNA 1ILEA 3LQQA 5DNVA 4WZBA 2GXAA 1ZK4A 2PV7A 5A7GA 4CMEC 5DTRA 1C1XA 4JJZA 3ZH2A 3QVWA 5A4JA 1IHOA 4EHJA 5C80A 3BWBA 4NYJQ 2A84A 3SZGA 2HMUA 2R8YA 3W8NA 3DMDA 2W2XA 4Q93A 1NULA 2QAGC 4C06A 4AU1A 1P2TA 3VOTA 1LV7A 1FRZA 5U9CA 1V4NA 3NPMA 1T3TA 1BNCA 4G56A 3C41J 4ZEVA 3LKZA 3CNLA 3OWHA 1EX9A 1F9AA 1ZH4A 4DQUA 1XYYA 3CLSD 1GQFA 3KHKA 4RADA 1XPOA 1N9ZA 1HYBA 3Q3GE 1SXHA 4OGKA 3PPIA 3PZRA 5EE9A 3T15A 3U0VA 4D3YA 4G1EB 1WKBA 1DAFA 1RKBA 4GUAA 4L1KA 4B8ZA 2PMCA 2OORA 1Z15A 3RLFA 3AR7A 3QZUA 3DO8A 1OROA 1ZL0A 2JFBA 2PD3A 3HP4A 4EKEA 3IRVA 5JAHA 1O57A 3KJFA 4HB0A 3DE1X 4H77A 3VU1A 1JZTA 5J9FA 3JQEA 2FKNA 4TQUS 4E3WA 3TGLA 4G4SO 1KORA 4X1IA 1GAEO 2FPPB 1RXVA 1E2NA 3AERA 3DXYA 3F3SA 4U0JA 1N5DA 1B0ZA 4PSUA 1TVKA 4AJLA 2HMTA 5DYYA 5BR7A 3W2TA 3AOEA 4YMSA 4A0RA 1P9WA 2HTEA 2X8WA 3C1TA 3DOEA 1XQ1A 4NJMA 5C8XA 1W76A 1HE3A 4FFMA 3LA6A 5JJIA 2GZRA 1YQWA 2PANA 4FBGA 1Y8ZA 2VOEA 2C9DA 1MJGM 1MRNA 2X3UA 3WRVA 4FFLA 1QPBA 2BCGY 2ZYRA 1U5BA 3H11B 3TZKA 3PEWA 4DV3B 1O5TA 2C29D 2GN6A 3A26A 4KKXB 3TLXA 3KIPA 3A6JA 5IN5A 4OQLA 1Q0RA 2Q8NA 2H1CA 1Y9JA 1FNCA 2VT7A 3OJLA 5K8LA 4WXPA 1IWPB 5FA5A 1PW5A 1Z68A 1CUUA 1TYZA 1UK9A 3GEEA 2GQ0A 3NBXX 1YNOA 3KG2A 1E59A 2O5VA 1DUVG 3L6EA 3NBKA 3WQSB 4TYPA 4XDHA 1U9IC 2C8JA 1O5IA 3KAKA 5EMLA 5TGTA 1YHNA 2YBEA 5ITZA 2XUKA 1XMOB 1XMXA 2J7KA 1T3HA 1XF1A 1OHHA 2P8SA 1PNQA 2GN8A 2FP4B 3IULA 2NAPA 1YMVA 3BK2A 1QQAA 2QWXA 3B53X 4LZZA 2I4TA 3HA7A 5HE8A 1LBSA 2GJSA 4IHAA 5JSFA 5DXFA 3REOA 1E1QA 2NLOA 4XFKA 2C5FA 5AFSA 1O0SA 3H5RA 1U8FO 3T7SA 5C9ZA 3L8DA 4FFBB 1W73A 1R2QA 1RHKA 3AP1A 3PIIA 4QSHA 2A1IA 2FPWA 3P26A 1MNQA 1GUDA 2WINI 2Y0PA 4J49A 4PHGA 4P32A 1CC1S 3VJRA 2G6BA 1SVIA 4DBLE 2QTTA 2NUTA 1BXRA 1E5LA 1YZKA 4K26A 1MGPA 5E3IA 2CZCA 3BB4A 4CGYA 3E2PA 2ZYHA 1OIVA 1SULA 4R8SA 1CETA 2PUDA 4KREA 1Y8AA 4G0QA 1I3LA 1WSBA 3FLAA 3PFNA 4TWIA 5CA0F 4I4CA 3EDRA 1H8HD 3IXLA 1Z0KA 3QMPA 4Y7CA 4JB3A 3LLVA 3BFKA 3AM3A 2A9FA 3NRBA 4TSFA 4KYTA 4NS4A 1CX9B 5TF0A 2R8BA 3VH4A 2FMHA 1VHLA 3ZE9A 4AB1A 4F4UA 2JHPA 2R2AA 2HNAA 2ZRGA 5F7ZA 4C20A 1RWBA 4U2DA 3ZHYA 3THOA 1T8YA 2FEWB 1KVUA 2FYTA 5TGDA 3HEAA 5D01A 4C05A 4RTOA 1P7WA 5I6DA 4UNQA 4FS8A 1K4YA 5D6NA 3HKDB 2FMTA 1WJGA 4JUIA 1ID1A 1L5NA 4UTOA 1ZCAA 2CXTA 1CFZA 1E9SA 2C98A 1XZIA 3BXGA 3O8LA 4D9EA 2FF7A 5JWHA 3GLKA 2MSDB 4E5MA 4I5IA 3KKPA 4LY0A 5JAPA 3CZMA 2ZTSA 4Q9DA 4ESOA 2L69A 2R86A 1SQFA 4FFVA 1L7DA 3Q0IA 5HM8A 2AS0A 1W25A 4U7WA 3IIJA 2BM0A 1I7PA 4M9QA 3A58B 1KJQA 3ROKA 4NMMA 4S2UA 3JZFA 3EF1A 3HB9A 4E6PA 2VTEA 1HKUA 4P5DA 4QXMA 5KOIA 4YLGA 1T5LA 2AJLI 2WP8J 5HK8A 2AQHA 3HUEA 4IXTA 1XELA 4A92A 3BFJA 3H5IA 3TFOA 3UFBA 4ETWA 4F9GA 2UYYA 3UJDA 1P2UA 3M5DA 2AJBA 3K92A 3SF8B 1EVYA 3G1UA 1AKEA 1OXXK 2IV3A 1U2EA 3D2CA 1JXAA 5LDGA 1ZRMA 2MYUA 3C8DA 2HGZA 3MB5A 4CEHB 1NYQA 1V8ZA 3HCRA 4ZC1A 4EF4A 3FMGA 3IDQA 1Z2DA 1LPNA 1ZHOA 3FGPA 1UPXA 2IXGA 2MSCB 4Q3KA 1U7DA 4URUR 2AZXA 5JDIA 2VPXA 4HUQA 1EAMA 4KXMA 3V3TA 4EJSB 3CU5A 4ZOEA 2FUNB 4PZ0A 2J9FA 4BLSA 4RFLA 6LDHA 1E3JA 1ZQ1A 2EFDB 1JLSA 2Q6KA 2WFLA 1ISSA 4JT9A 2HBQA 3VHXB 5EIWA 3VU3A 5AR1A 2XNDA 1ADGA 1YOVA 2VBIA 2ZYVX 5C8DA 3LDUA 4NE2A 821PA 4HNUA 1R15A 2ZM6B 4RPLA 5KNCH 1D4OA 1QHYA 2DECA 4RHTA 4RTRA 3KQLA 1FX1A 2I2AA 5DKFA 1RRKA 1ORVA 4LXGA 5FNVB 1KQNA 1E9FA 5CFRA 1GD1O 5K0TA 4MUMA 1Y3AA 1GPYA 3OPMA 1XZGA 3T3MB 1UJ6A 5A9TA 4M0LA 2Z43A 4E5UA 2E5WA 3LQ4A 1ZVKA 2OOKA 1OSNA 2PQ2A 4A82A 2HX1A 1PQPA 2OBLA 3IAXA 3GX1A 4R2IA 1P3JA 4UARA 3TEJA 3FFTA 1MOPA 5FORA 4EP1A 2C4KA 2V8OA 4QLBA 5KHLB 3S5JA 4RLHA 1JHYA 4OHFA 2GR9A 3QEBZ 3U2QA 3UWSA 2QT9A 1PVOA 4C4YA 3ZV7A 2B69A 3SZUA 4AKGA 2YY7A 2EZ8A 1MEJA 1QQTA 1WPQA 3T3HA 3ZWMA 3I1IA 4OM8A 3QKSB 2EDAA 1NDQA 3AVPA 3CVWA 4MTLA 3SC3A 1L4GA 4FNMA 5EJIA 2DJIA 4DR2B 2CLLB 4BWFB 4FEGA 1PNRA 2OZEA 2H8KA 4GRIA 2C4TA 1N7JA 1Q19A 1T6BY 2VDWA 4B73A 3EA4A 3MUEA 5LIPA 1PZMA 4XEUA 4I1VA 2H57A 5AUOB 4DTCA 1G38A 1Q3TA 1E3TA 4LJRA 4N76A 1G9XA 1U5CA 4F1JA 3CR7A 2FUEA 3IALA 3K0FB 4PTLA 3W0LB 2QR2A 4L50A 3GGCA 4X71A 4JC8A 1E64A 3R9XB 1CE8B 2R66A 3TMYA 4P3NA 1BJTA 3UNXA 3FYHA 4IMRA 1DWPA 3NXKA 3FF4A 1EH5A 4KSCA 2JIZD 4YP0A 1F8YA 2QN6A 1TEVA 4M46A 2RGWA 1SUDA 2UYGA 5BV8A 4CLXA 1ZOOA 3OZSA 2BFEB 3CC8A 3PFCA 4PPQA 3UJHA 1UXIA 1X9IA 1ODIA 1SCAA 4QAQA 2YXLA 1N0VC 4G07A 3PJRA 2XB4A 1KYZA 3ILHA 3EFOA 1ZJ6A 4MR8A 4CDNA 1R5OA 2RGYA 3AFNA 3ISJA 4MA4A 2ZJFA 3UKJA 4V1CB 4U7PB 1TB4A 2QLTA 3DAGA 3DYVA 4TLDA 2H51A 5AVTA 1D6NA 4LJLA 4DYDA 1OFHA 3OHSX 3QYAA 4XQ9A 3RC9A 5F98A 4Y2SA 3Q5DA 1DVRA 4ZDKA 2PTGA 2Q29A 3GY0A 4JBWA 3PHLA 4NG4A 3UFXA 2P4EA 1OKKD 5L3QB 4W5QA 2I99A 2XZTA 1L0BA 4G0NA 4H7KA 4K40A 2DMRA 2WWIA 3GH3A 1ZUNA 2RH5A 4EPVA 2RB5A 5C4MA 5TIIA 4NF2A 4Z0HO 1TQ6A 4F8EA 4OKSA 2QD2A 5KNCD 4BMOB 1IVYA 3KWJA 4LAFA 4OOFA 3CKYA 4XWOA 1FJGB 5FV7A 1Q1GA 3C7KA 5JCOC 4GSYA 1UIMA 2PWYA 2B20A 2W0SA 1OTHA 3VR2D 3EIQA 1QGUA 1N57A 4D80A 4QTYA 1OWPA 2W6IA 5F9MA 5EJ4A 2XUDA 4NXNB 5TPZA 5J2UB 3NTVA 2AR0A 1JV2B 1ZOLA 2B30A 2JJ8A 2UDPA 2VDNB 3FHJA 3LLMA 5JIBA 1P9OA 2PRSA 2Q1XA 2RH8A 4IIJF 3L8GA 5JU6A 3F7NA 2GB4A 1M1NB 3CVOA 4IIJA 4GG1A 2ZSHA 4UM5A 2Q27A 2JW5A 3LBHA 4AZ3A 2V5UA 1VC2A 1MP0A 1N8KA 2WHEA 1QTRA 2H1FA 3OFKA 1M33A 4S3MA 2ABWA 1IZZA 3CNBA 2A1UA 3GGGA 2CFSA 3SLRA 3K0SA 2ACWA 4DSAA 3H42B 2GEUA 2VHEA 4M0DA 4YGYA 1BX0A 3K5WA 2CN1A 4QU8A 4TKZA 3PTZA 4QYIB 3AMVA 1BWRA 3A9RA 4YT8A 3AO0B 1ULAA 3DBOB 4HAWA 3MG9A 4ENUA 4UVDA 1GUFA 4DXDA 2QV0A 1TU3A 5IHXA 1N6HA 4CEIB 4LCEA 5ALSA 2D6FA 3L4EA 1ODFA 3NNSA 5DGHA 4W9NA 5FFNA 4X1YA 2C5GA 5B36A 1M66A 2FWPA 1SQ5A 1WOMA 1BEZA 4P36A 1JI0A 2H6EA 4D0LB 2YYYA 1XTVA 5F76A 2BM1A 4F12A 4G25A 2BFNA 1E66A 2BHSA 3L0OA 2YMLA 1HQYE 1HQKA 2P35A 3T5CA 2XT9A 4O1IA 4Y6LA 4BC1A 1SXJB 1BC5A 1YHZA 3TI9A 2UZ4A 2YHAA 3LDHA 4X8OA 4YT5A 4KODA 3C8HA 3TR6A 3G0GA 2FE1A 2TYSB 3KD2A 4TKVA 1V5IA 1J9GA 2COUA 2VPYA 4B81A 2AMLA 2HA5A 2O3TA 1Z6PA 3I01M 2OHHA 1BE1A 1USGA 1ARZA 1HFJA 4Y0AA 3PHIA 4GOXA 2DEUA 4L7VA 1SCUA 4F8JA 4MRRA 4US2R 2CYCA 4BOYA 4LRSB 5BWLA 3T0FA 1QQ5A 3KT6A 1DRJA 3KKMA 1DPFA 2GHRA 3C7DB 3W8FA 2EW2A 3EHEA 3T06B 3VR5D 4MI9A 3KUUA 3IOEA 4KH1A 2EJUA 3VNAA 3RHFA 5JS8A 4KPUA 3RVSA 3TPCA 3VPAA 2FJUA 5IK2A 5DM0A 3R7NA 1V47A 3EAQA 3E3LA 4G6ZA 3JVDA 1NYRA 3ZDRA 1GAXA 1O87A 2BKXA 1Y9ZA 1I1QB 1NC3A 2CLDX 3LY5A 3KHUA 3DMHA 4M7OA 4OHOA 3UF0A 4YMLA 1G59A 1WBJB 1RZUA 1GJRA 3AOEC 5SZIA 2PZFA 4MEJA 4YCAA 1LNZA 4XQEA 5CA1A 4QDKA 4YRKA 1HI9A 1LZKA 2BI7A 5BY2A 4AWXA 1YACA 1N0WA 1Z6AA 2BMDA 1V8BA 4TQGA 4KGDA 3CNEA 4PS1A 4QSMA 2FV8A 2QLLA 4D0GA 3ZE8A 3LK6A 1B76A 4ND2A 4ENTA 3QLEA 1XD2B 4TRNA 3RNLA 4BP1A 1LI4A 4PYOA 4PG6A 3ABOB 3MJ4A 3PHJA 1U63A 3G85A 4WZAB 3W05A 5AXCA 1WZCA 4LDJA 4GPZA 3TSCA 1Z28A 4KTTE 2AK2A 3R2JA 3LDFA 4LZNA 2P2GA 5TX7A 1OA1A 3PT5A 5H81A 1L7BA 2BKLA 4UBKA 4JLPA 1E1RD 2AJCA 1QUFA 2E37A 4KZKA 5TVKA 2A1TS 1P29A 3M49A 2BR3A 2WJYA 4PC6A 2G4CA 2FSUA 3DZBA 4PPGA 3CZRA 2BDTA 2CLHB 4RY2A 4XVRA 5CH8A 1LNSA 4CMIB 3ETLA 2GRJA 2YL2A 4CGZA 3K0CA 2F1OA 2BGJA 3VNUA 5EIBD 1B15A 2COEA 3FNQA 1SXJE 3C5EA 1MRZA 3I53A 3HCDA 3V7WA 1KNXA 3Q9UA 3GT0A 3AKYA 4OHZA 2W2QA 2KLBA 2GRAA 2I2FA 3ADOA 1PBNA 1YAJA 2FFQA 3WYDA 1KGSA 2PRYA 3DMGA 2DTEA 3H4TA 3JX9A 4NENA 1FUYB 1KHHA 3O8RA 2LCQA 1QBKC 3OIWA 3HKEB 4Z86A 4AAYA 1J20A 3LXRA 4DBVO 4UE3S 1P6UA 3PXXA 4RHEA 4DB4A 3U3KA 3GL9A 2D1RA 3GU3A 5B6PA 4C43A 1I3NA 2PLAA 1TM2A 1JFRA 2WBLC 4ID3A 1YRQA 1QRTA 4DHWA 1NJ2A 2YNMD 4IIYA 3UMVA 2VQFB 4MB0A 1QIDA 3SK0A 3DE4X 4HNAA 3RBVA 1CJUC 3L4SO 1FDRA 3FPHA 1Y4ZA 1KMHB 2OY0A 4IXMA 1Z37A 1Q7EA 4JJ8A 3IUYA 5D87A 1YI8A 3IJPA 2HSEA 1CT9A 5KYWA 3NO4A 1SC4A 1T4MA 4YJ3F 5D85A 4YJ3A 5CBPB 3EDMA 1BTOA 2YOGA 1ZJ4A 5FBKA 1XPRA 4Z9FA 2DM6A 3VPHA 3A3YA 1EXNA 3BHNA 4CFZA 4GL2A 1JRLA 4YXWD 4DR6B 3QBTA 4V0KA 4EA7A 3EEBA 1Q6YA 1Z5OA 2A5GA 2BEVA 5ENZA 1NG9A 1HKHA 3G89A 5H70A 1QH8B 1C1DB 2G76A 2X58A 1ZN9A 1MFPA 2TMYA 3H9UA 4CR7A 3GB9A 1S89A 3CUTA 2B1IA 4MIEA 2A88A 4UCFA 3GG2A 1DC3A 1VIYA 1ZSYA 4UHDA 1EFKA 3CLHA 3KTDA 1QIGA 3L0IB 1WZIA 4KDFA 5AKHA 3QVOA 1LVUA 4PG5A 5EMHA 5K1ZA 5TR9A 3JAMA 1Q1ZA 1VXOA 2Y9MB 4KUEA 4DABA 1E6LA 4C22A 1YQEA 4ZQHA 2FOLA 3IPLA 1GSAA 2XUAA 4I66A 1K8RA 4F4HA 1KAQA 1O03A 3FCEA 4HQ6A 1N3YA 1SG9A 1PFWA 1NI3A 2RB4A 4H0CA 4QL3A 4PG8A 1XTQA 4MUJA 4RFSA 1IAQA 1W30A 2BVNA 3AV0B 4TSKA 4QNRA 5LQJA 5TQ0B 3I5UA 1GNQA 4Q4HB 1EQ2A 1FNNA 5KMGA 1XMSA 1Y34E 1TOAA 5KYGA 4M54A 1G41A 3BMQB 3C2QA 3JATA 3RNOA 1JDSA 3UQYS 3GLHA 1E3EA 5B4VA 1V1RA 2J0UB 1Q0ZA 4ESEA 2HUNA 1KZHA 1VHTA 2B37A 3B8HA 5HQTA 5C5EA 4I5FA 1U2ZA 1YCHA 2XCQA 3IQGX 1MO5A 3W8RA 3CUKA 3WL4A 1RFLA 4IX9A 4CMGA 1R6DA 3U56A 4RZXA 3JQ9A 1IZ8A 4CV2A 3USCS 1ZM4A 3QVTA 4P35A 4K05A 1FF9A 4CU5A 1GQOA 3AIIA 1ISGA 5I4CA 1MJ5A 4CWAA 3PNPA 4BAGA 3HRHA 5KEIA 5DNYB 3EFBA 1XWFA 4AKSA 1M2OA 3R20A 4V2UA 4WH0A 3ROTA 4MRSA 2AE2A 4R2KA 2JEOA 3SYRA 1FZTA 4BCDA 2KW5A 3HN7A 5I4IA 2XUZA 1MC5A 3LIIA 3DFZA 1ZDMA 2VXBA 1L4KA 3S55A 5HYVA 2IYWA 3FWNA 5C31A 1DIHA 2GEBA 3S3TA 3ZU2A 1KE1A 3CA8A 4UHCA 2P75A 2ACKA 2F3TA 3OTIA 3QTLA 4YIKA 3UUWA 5IXYA 4RX1A 1AHPA 3GLGE 2ORIA 1GTZA 3AIMA 1JLLA 1PD0A 4UD6A 5CXUA 2K6GA 5HF8A 3H4IA 1GPDG 2HI0A 4BNZA 3NP9A 3OE7D 3ZWVA 2Y0DA 2KWIA 2QNIA 2VPPA 5DLPA 2X9NA 2IXFA 3LY7A 4F45A 1OXSC 2IEZA 2JA1A 2PSDA 2GBFA 2HXYA 3B3FA 4DV0B 5JUWA 1XTJA 4B33A 1L4YA 5H3LA 3IQFA 2EX0A 5DWVA 4CL2A 4QM6A 1TO1E 3WRXA 4RD0A 1SXJC 4FJ1A 3PC4A 4B6FA 3HWRA 1P60A 1R50A 2A67A 1CYDA 4PPFA 1Z0FA 5FFFA 2V7QA 2BZGA 3GNTA 4CG2A 2BSAA 1YA8A 2FNAA 2K2QB 5JSKA 4EX6A 1RBQA 1LA2A 2J5QA 3FVQA 1JT9A 4H7EA 5DMHA 4F4FA 3CH4B 3OCCA 1N8TA 2FPOA 3IRUA 2C1EA 4FMPA 2ANBA 3FDZB 3UJAA 3TXYA 1M0EA 1Y42X 1U0LA 5JH7B 1XCMA 3PZBA 3CRVA 1EFUA 4ZO4A 4EVIA 4ZZIA 1EI9A 4XB2A 5G0VA 2VH5R 1SUBA 3F8SA 4FMDF 4U2GA 3TSYA 2QTFA 5HVNA 2OBMA 1VB5A 3NVDA 4HLUC 3PUWA 4XM0A 3LU1A 1GKUB 2G28A 2IKSA 4JLDA 5IAAA 1NLFA 4E7OA 4L3OA 3O3NB 3VSBA 4V1CI 2VH1A 4JJ7A 2E1RA 1XHLA 3BH6A 1OFUA 2PFSA 3KXDA 3B1VA 1IHYA 3P0JA 2AZMA 4QFBA 5GJWC 1VKOA 5CYOA 1RPAA 5IDWA 2QTNA 5M3BA 1A72A 2A9KA 3NNDA 5TNXA 3S1LA 3ZDDA 3DO5A 1J56A 1KH1A 4DMCA 4Q47A 1BOOA 3SBXA 1CZLA 1QONA 3SZOA 4AX8A 1ZIXA 1VJGA 4P1ZA 1VPWA 1PD1A 2I3AA 4IZHA 4B8WA 3S8MA 5JAMA 1GNSA 1GRQA 2IPXA 5T7BA 4MDEA 1WL8A 2AHRA 2HFKA 3G7SA 4IF6A 3NBMA 4TN5A 5IWAB 2IE8A 1U28A 2FEPA 3LPNA 4ETIA 2YVAA 3RT7A 5LQNA 3SYMA 1H6AA 2DUWA 2QZ9A 1FLDA 1Y8RB 1UBUS 1YXMA 2L42A 3DWIA 2NV2B 1JS1X 1N9GB 1Z34A 2YVLA 1CF2O 2LIPA 3SEZA 5CEEA 5EJFA 3TK1A 2HHJA 3IVGA 2B36A 3D59A 2FWMX 1B8UA 2GXSA 1SRQA 1TUGA 1IDOA 2XWJI 3FUCA 3G5TA 1BXZA 1FFEA 3GLRA 3H1GA 3WLFA 3ZZNA 1XLTA 1H3EA 4KRXA 1OREA 2FEOA 3TLCA 4REQB 5ALLA 2KBFA 3GK3A 1EXWA 3LM8A 4M1EA 3KE8A 2EBWA 1V41E 1YU6A 4HVAA 4OAQA 4C5AA 1BRTA 2GYYA 3HP1A 4PG4A 3WOHA 1A4IA 2OQRA 2IZZA 4TMFA 2XVAA 1YD7A 5JMTA 2G06A 3MJFA 4OO3A 2VWHA 3Q0EA 3PQ6A 5JS2A 4XB6B 3SG0A 4G24A 2D2FA 2FF5A 1J24A 2ZATA 3WADA 5F12A 1U0RA 4E70A 1NL3A 3DL4A 1CVLA 4DDVA 4N5NA 1BHQ1 4C89A 1HG1A 2BF7A 3R6DA 4IDAA 4MQLA 3LLCA 4PPNA 5ALQA 1VFPA 5TPWA 2GJ8A 2P78A 3OA2A 3N7AA 2JGAA 2C58A 3IKJA 2X7HA 5JC1A 1T36B 2B2XA 2WMOB 1QCDA 4LNUA 3QXGA 3WSVA 3GEIA 3B5EA 4Y67A 1Y4DE 2GK7A 2JHGA 2OESA 3IKMB 3U49A 2CXRA 2I7TA 4XZ3A 5ITWA 2J9XB 3EGDB 5B4UA 2ZB2A 4EPXA 2XUFA 1ESNA 1CJCA 1N6RA 2ZJZA 3L9WA 4N6GA 2Z83A 1UQTA 4X60A 4DS3A 4EHDA 1MPTA 2P1DA 7ADHA 2QMYA 2QY9A 1YE5A 4YCLA 4M86A 2V58A 2LGJA 1Y82A 1L7VC 2VUSA 3AF5A 3CMMA 3GRYA 3QQ5A 4AJ1A 4D99A 3DLHA 3M6AA 1D5WA 3MYRA 4PSDA 5E9JA 3ZQKA 4H3KB 2RCYA 4MZDA 5KC8A 3PHCA 5EKTA 1D0SA 1SD5A 2QSYA 4KIJA 3MSCA 4MP6A 5KNBA 1DFIA 1N4DA 2A5DA 2G25A 2RI6A 3TZBA 4C08A 3AF6A 4PTYA 3ONNA 4KVZA 3VDXA 4PSAA 4ZCTA 1LJLA 3EXIA 3BMNA 3OTGA 4R81A 3EUWA 1C3VA 5JECA 3GLIB 1HDOA 2P0AA 1V1MB 2RC6A 2WYWA 3TD6A 2WHPB 2YWJA 3A2MA 3V97A 1RC8A 3CPSA 4B3TB 2WLTA 4JLNA 3VR3D 1S4QA 1C1HA 5AICA 3H9BA 3USZA 2ZYGA 4C7MA 2IYFA 2QSUA 3IKLA 5AKXA 4CQLB 1J9EA 1L5LA 2D5LA 4RHFA 2PLNA 2Q5CA 1I01A 4LOLA 5ADHA 4JY7A 4JJGA 1AQJA 3Q3EA 4UBIA 4BGVA 5B53A 3EEYA 1W1WA 3GUYA 1KOJA 1YZGA 3ND5A 1V2GA 2CXPA 3QU9A 4OIFA 5G4KB 4O4JA 4G5QA 4LDNA 2JAQA 1F48A 5DB4A 3ZW9A 4AYWA 2HKIA 3A1FA 3W5AA 4I50F 4I50A 3JARB 3E5NA 1FMCA 4C6RA 2H16A 2OR3A 3QXCA 2CHFA 3EC2A 4Q00A 2O8DA 2I71A 3PUYA 1XZCA 2Q6TA 4UTNA 3LG2A 2Z1MA 1B3BA 2ZT5A 2DBRA 5EINA 4Z7NB 1T8UA 1Y3DE 2FMIA 1T6ZA 1J70A 2ASEA 2CNDA 4OBBA 1I7DA 5LUBA 4CL3A 1WVMA 2FMKA 2SNIE 2AOTB 1GA6A 3EZ6A 5DX0A 4B9EA 2IV7A 1E3SA 1D2HA 2HZ7A 3E9MA 3T3GA 4D42A 2PUVA 5AK3A 3AF1A 1PLJA 5JAOA 2G04A 1XZHA 2HPZA 2P6PA 4M1QA 5HF5A 4BCBA 2WTEA 4AROA 4ZI2A 1QTQA 3R5HA 4WKOA 2VNSA 3LWZA 5IMSA 3MK31 3NC4A 1NBHA 2QE7D 3UTDA 4NBRA 2DFNA 1BRMA 1N7HA 1J2EA 4YWJA 5IAGA 2VRNA 3QXHA 4QBIA 3WXMA 4G8JA 1CNEA 1YQDA 3TE6A 2XUJA 2YZ7A 5KWVA 1T2DA 2QQFA 2XAUA 3E61A 3LRPA 3NHZA 4BRWA 2J6CA 3TUZC 1ORTA 4O4LA 4AJ4A 4UTZA 3GLIE 2O3JA 1F3OA 4L8GA 4BKMA 5JXHA 2IYTA 3ZHCA 3T5AA 3OIDA 1D2MA 4XJSA