1SQ0A

Crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
DFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Von Willebrand factor (vWF) [Contains: Von Willebrand antige
publication title Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1sq0A00
2XWBF 2I6QA 1BHQ1 1XDGA 1MQ9A 3EH2A 4DMUB 2ADFA 5KYYB 1PD1A 3NIFB 1M2VB 4NENA 3ZDZB 3BQNB 4UM9D 3EFOB 3V4VB 4XW2A 2O7NA 2VDPB 4UM9B 3VI3B 3K72B 2VDLB 3FCUB 1RS0A 3EGXB 1V7PC 1IDN1 1SHTX 3RAGA 1AUQA 1JLMA 3EOAI 4IXDA 3TCXB 1AOXA 5HGJA 4A0QA 1JEYA 3HI6A 1QCYA 3V4PB 1U8CB 2NUPA 3K71B 1OAKA 1RRKA 1SHUX 1MJNA 3EGDA 4CN9A 3FCSB 4G1MB 4F1KA 3M6FA 5HJ2A 3ZE1B 2QTVA 2VDOB 3IBSA 1IJKA 1JEYB 3EGXA 1ZOOA 4HQLA 2NUPB 1M2OA 1JEQB 3EGDB 4MMZB 4MMXB 4C29A 4WFQA 1XUOA 4UM8B 1LFAA 3ZE0B 1BHO1 4Z7QB 3EH1A 4FX5A 3GXBA 3F74A 2M32A 2X5NA 1MQ8B 1AO3A 2XGGA 3E2MA 2ICAA 5E6RB 4Z7NB 3TW0A 5LN1A 3K6SA 5HDBB 5KYNA 3NIGB 4BJ3A 4PN7A 4C2AA 1YVPA 4HQKA 1YVRA 2WW8A 1JV2B 4Z7OB 1JEQA 1N3YA 4O02B 3Q3GE 4HQNA 1T0PA 3BN3A 3QA3E 5E6SB 3K6SB 1UEXC 2VDQB 1T6BY 1TYEB 1FE8A 3PPXA 3T3MB 2I91A 4NEHB 5E6UA 1RD4A 1QC5B 1NA5A 2ODPA 3IJEB 2IUEA 4WJKB 5E6RA 1IJBA 4JDUA 3EG9B 1ZOPA 5KYXB 1FNSA 2NVOA 5KYUB 4CN8A 2VDRB 2XWJI 1PCXA 1Q0PA 4WK4B 3PPWA 1U0OC 1SQ0A 2VDMB 4G1EB 3PPVA 1XDDA 3NIDB 5E6UB 4CNBA 5KYWB 3F78A 5E6SA 1M10A 4MMYB 5BV8A 3BQMB 4F1JA 3ZDYB 3TXAA 3EOBI 4M76B 3T3PB 1MF7A 2NUTB 1DZIA 1L5GB 1QC5A 3HXOA 3ZE2B 2VC2B 2B2XA 3EG9A 1PD0A 4IHKA 1CQPA 4WK2B 5KYXA 1N9ZA 3TVYA 4HQOA 1ATZA 1U0NA 5KYUA 2VDNB 3N2NA 1M1XB 1M1UA 4WK0B 1MHPA 2ODQA 4NENB 4IGIA 5KYWA 3PPYA 4HQFA 1CK4A 1RTKA 1IDOA 2VDKB 1PT6A 5KYYA 1DGQA 1ZONA 2WINI 2I6SA 4C2BA 3HXQA 1M2VA 2NUTA 3VI4B 3ZQKA 5ES4B 1MQAA 3EFOA 3ZDXB
chains in the Genus database with same CATH superfamily
1CQIB 3U0BA 4X1KA 1T8PA 2IQ5A 3GLTA 4M55A 2JBHA 3U1BA 3PDJA 4LPSA 4GI7A 3ANSA 2RB4A 3ZVRA 1A5AB 4DV3B 1K2VN 4QO7A 1COWD 2PKEA 3RFFA 2QRHA 3TRJA 3EEBA 2PUJA 1P7YA 5JPDA 2Q5OA 3B9BA 3GFPA 1QYWA 1N5RA 2HDOA 2FPPB 4UTRA 1U2RA 3R6GA 3F97A 4DIMA 4QVKA 3TMYA 2R6ZA 3S2IA 3IKJA 3O4GA 4WOPA 3TB4A 1PWXA 3DH0A 4EKYA 1SXGA 1DO0A 1QHNA 3PR2B 3QM1A 4YHBA 4CR7A 3ZV7A 2I2WA 4GDMA 1WB6A 3FSGD 1QTRA 2R9VA 3LO8A 3IXLA 4QOSA 1ZAYA 1BD4A 1W5AA 1G6HA 1UP4A 4F6RA 3PNOA 2A35A 1GTRA 2GBGA 1QH1B 4WFKA 1QGED 3RIGA 5BT8A 4R1TA 5TQ0B 3ITKA 2Q28A 4G5YA 4DF3A 1YJAA 3E6AA 4EL0A 1YS1X 4KGVA 4M9ZA 4PV7A 2VPIA 3UMRA 3IV6A 4K9SA 3ICEA 4AECA 1DMSA 3MXTA 3PUJA 4C5BA 5E1MA 1ESNA 3QV1A 3G8BA 3SEAA 1FYXA 1XD8A 5A2QA 3TEMA 3QPCA 5I9MA 4WFQA 3BTOA 1TZMA 1DBWA 2DKNA 3HCWA 3IDZA 1XVTA 4QATA 1VJGA 1ZH0A 2WABA 2XNKA 1YR7A 4M1EA 4AKTA 3RYIB 5BWMA 4NS1A 5I4CA 3N8HA 2VL7A 2WZBA 2X4LA 3QTLA 3PEUA 3ESBA 1MRSA 1ZEJA 4EMUA 1EHIA 1K63A 3FSRA 4NECA 1F14A 1JHVA 2ZQZA 3TPCA 3UCEA 3HJUA 4HGZA 1U28A 4LMRA 3AHEA 1QGYA 1DXHA 3NV7A 4PSDA 5D6NA 3A3NA 1YB2A 1ZD4A 3FHLA 3GZNB 2P6OA 1MEEA 2WUVA 4YDSA 4PYKA 1M2HA 4YAWA 2WVJA 4YJ2F 4E46A 4FIZA 5LQKA 3EXHA 4NOMA 3F8TA 1TLLA 4DWWA 3F3YA 3JWGA 2JGMA 4I55F 3T3MB 1CF4A 2XHZA 2K7ZA 4QU8A 4NYMR 4P3NA 5IDYA 3A0UA 2XQJA 4FVTA 1JPNA 3P2YA 5CH3A 3SBOA 2OCBA 3I01A 4KO1S 1Y98A 4UCQA 1BS2A 4YAUA 1VPLA 3G0BA 2DTDA 2ZTSA 4OLHA 3IODA 3OHSX 1Q0PA 2P91A 5CEFA 4ILEA 1SIOA 1KZ9A 1WDTA 2NT3A 3IJ5A 4KAXA 5FIUA 4D4KA 1CWUA 3A1NA 1TIKA 1AKQA 1QAQA 3BILA 3F8SA 3NIDB 2R1VA 3EIQA 4Q02A 4V2IA 5CB8A 5ARDA 2ZWOA 2BGKA 3ENQA 1P39A 1RKQA 3P2OA 4CFZA 4MJ3A 3BJEA 4NBTA 2FN3A 3BTVA 3AZQA 3C4VA 4PHHA 1T4BA 4GOOD 4HFNA 2CMDA 2OP1A 3ZHZA 2R8XA 5JSZA 1NW4A 1P3JA 1CUEA 3N2EA 2R96A 3R24A 3K0HA 4U2BA 3HA5A 5C3MA 4WE3A 3QNMA 4C5AA 2BFDA 4HGPA 3THWA 1JA1A 3ZTTA 3K9QO 3ABIA 2HK7A 5TVGA 4EG5A 2WYVA 4KC0A 3EEIA 3AV3A 2ZT8A 3CGGA 2VUIB 2CDCA 5FQOA 1V5EA 3WP0A 1GUBA 2X8JA 3BE5A 4CUZA 1ZVVA 3OP1A 4JP5A 4KXQA 3ER6A 3R5SA 4ABYA 3U7RA 3NTXA 3GNSA 1GSOA 1UKAA 2BFEB 4N9QA 3HY3A 3OKCA 2UVPA 1LBSA 3EPPA 4OXXA 4YPOA 1YQWA 5CA1F 2W83A 1S2IA 1S4QA 1P2TA 2CSXA 1KBQA 1CEEA 1FYVA 4PX2A 1RHJA 1TM7E 1G9SA 3AKYA 4L9AA 1L3BA 4AG6A 2P4EA 2GVZC 1VYTA 3FCUB 1BFDA 4P8RA 5AI9A 5LQSA 3U4AA 4MPDA 1KOLA 5LM3A 3J7AC 4IXDA 4IIYA 3K6JA 3KL4A 3THRA 4XB2A 1PJAA 1A4UA 2RAVA 3FIJA 3UXMA 4C1BA 1GN9A 5GP1A 5F77A 2W2KB 4AN4A 4IDQA 4AX4A 5HMMA 1W581 1QAMA 1ZA1A 3PITA 4O25A 1P0QA 1RAHA 5EXSA 2KYRA 4PNPA 5DWVA 1PWYE 1OLSA 1YCGA 5BSTA 1CNEA 5BMOA 3TTVA 2Z43A 2OHIA 4CL0A 2X9VA 3M6FA 3DMDA 1RAFA 4ETNA 5KSZA 4RSRA 3ZZ1A 2ZRIA 1KTVA 5IEBA 4EMBA 3ZC3A 2YBDA 5A3QA 2ANBA 3OZWA 3NBYC 1WCXA 2IBSA 1GUFA 3HDHA 1N5OX 3ZGOA 3REOA 4P83A 1WY7A 3SZUA 4IIJF 2R8ZA 3ROXA 5ITZB 3JQAA 1UR5A 1E5TA 3B2NA 2VPZA 4HQ6A 4QBIA 2H9IA 1F51E 2BFCA 3FFWA 3OSZA 5ALKA 3ZJ4A 1DTWA 4MINA 4OH7A 3AVVA 4E94A 1L7PA 3HB5X 4PG8A 1IHDA 3L7JA 2DERA 4BE4A 1NN0A 2HZBA 3E0QA 4G24A 1AU9A 1IHOA 5ICCA 1II0A 3AESA 1KBOA 3V8MA 1SR8A 1DJPA 3LP6A 1DARA 1TQ6A 4YJ2B 3DXFA 1RWOA 2C58A 3CT6A 1S8NA 4I5FA 1BHSA 3TS1A 1N3YA 2GD0A 1CRWG 2GRJA 3H2IA 4BO4A 3N6XA 3JQPA 1HY3A 4KKVA 4D56A 2FOXA 3LX5A 4HUTA 3W3ZB 3BIOA 1VE9A 5AW4A 1PEYA 4KXWA 2PJUA 2FRXA 2IBMA 3WRXA 2Q4DA 4DR7B 1M2GA 2Q62A 1EI9A 4FUQA 3OY7A 5T41A 4HB4A 1H1TA 1DEOA 1HDXA 4LW8A 5CDSA 4RJJA 3QKWA 3SJUA 1L3IA 1HYQA 2BM9A 4GRDA 1ZCZA 3EA4A 1AXGA 5CM2Z 5JBNA 1XXHE 3PUIA 4GZ5A 4JJFA 2YIVX 4DTCA 2PY6A 3GLIE 1XP5A 4QDTA 3TPZA 2ZE7A 2CXHA 2AYXA 2JD1A 3FKQA 3NVMB 2D2EA 1LU9A 3EY4A 1RIIA 2Z6QA 4XTRA 5SICE 2HA6A 3CNBA 3FMIA 3WLEA 4HGQA 1KO5A 3EVAA 4W7SA 3STHA 2AFHE 1TM1E 3ZIAD 3GJ0A 1YOVA 4NXNB 2BHRA 3A14A 3A26A 3H2HA 3TRIA 5KVVA 5LQJA 4PXAA 2GCPA 1ZM9A 3HDYA 4TPKA 2AFIE 4YDHB 3KTOA 4WL0A 4BB6A 1KC1A 2Q6KA 2RHCA 2NIPA 3COPA 3GGPA 4E3ZA 4CLDA 1J1UA 3JALB 3VUFA 3EYWA 2X1MA 1XD2B 5C1BA 4ND2A 4AJNA 1UKZA 3A4VA 1UPBA 3K09C 3MWEA 5DCLA 3HO6A 3F0TA 1ZNYA 4BGVA 4FSXA 4DA6A 1E1DA 3FPFA 3G89A 4BQSA 1U8TA 5CFNA 4FGUA 4DMUB 1ZGAA 3FJYA 3HWWA 4KRXA 1TQ2A 3M9LA 2WA1A 4F4CA 3UNXA 4QDUA 5JS6A 2ZRHA 5G02A 1EK0A 2VZ0A 4Q7MB 4ABTA 1J07A 1SVLA 2XVXA 2Q7OE 2FG5A 1VLJA 3U4DA 3WL8A 3WIVA 5K4HA 2MSKA 2WE7A 3MHPA 1WXHA 3LUAA 3VSAA 1R0RE 2ZU6A 3L05A 3LPDA 1VJTA 4HYQA 2FETA 2R6JA 3JX9A 4JZKA 2OV8A 1V9LA 1YJ5A 3DS8A 3GA7A 1Y1KE 2B99A 2V4UA 3DKIA 1ZRHA 3ESRA 1QNLA 3WNBA 1A77A 3KWJA 1NW6A 4IJMA 4WY8A 4YMHA 3L0CA 1WXXA 1D6NA 2C7QA 5CLJA 1LS1A 1LWNA 4PLCA 4F1KA 3PK0A 3W1EA 3FSJX 1KJNA 3OPMA 3ZJYA 4L4RA 6REQB 1L8OA 1NW7A 1X7GA 1Z2PX 2I3AA 2QLBA 4Q7EA 2VZ8A 5DNDA 5KVCA 3KUDA 3G5AA 3GZTB 2YV2A 1Q0SA 1BKDR 4H59A 3OVMA 2OAGA 4UFNA 2ATVA 2C2GA 1J23A 5C1PA 3ADPA 1D8TA 1VB3A 3QLTA 1XZDA 1ZP6A 3FUTA 2PRSA 3VPXA 5LMNB 1FCJA 1MTZA 2RC6A 3X43A 4WBXC 1JNYA 1XLUA 2FLKA 2QHXA 3DBHA 2CLLB 1E9FA 1N2CB 1W0KD 2JFPA 4HRAA 4LEIA 4NE9A 4OUDA 3J81k 2WNIA 3L43A 1DBVO 4QJIA 5DASA 2BTOA 4WACA 4LX8A 3E53A 5FO0A 1U1CA 1SCUB 3DAOA 5HRCA 1VIVA 3J7TA 2HY7A 1O0SA 4WVLA 1B0UA 1RLOA 2JFQA 3I6BA 4UE6A 5AW3A 5CP8A 4NR0A 4X3CA 2PZEA 1JHMA 3JYNA 1W5BA 3DYVA 4I1UA 2W2LA 3KYDB 4K88A 1I7LA 5JAZA 5KTNA 1VM6A 4DMFA 5DISB 3JR7A 5F3RA 2OCAA 2QTHA 4NBUA 1W1WA 4DV2B 1ZOIA 1FNDA 4IL5A 4TLAA 1TK9A 4R54A 4C2UA 5DHPA 3K2IA 3EZ7A 2H65A 3O9VA 3NPAA 5JHGB 3K05A 1XWFA 1A7JA 2E4XA 1GKLA 2Q3LA 3GJ6A 3KQSA 4QEDA 2FPKA 4KH0A 2AJDA 3GRFA 4OFXA 3R8CA 3T54A 3URMA 2WIKA 5HF9A 3N70A 5KX5A 1DTSA 4Y3UA 1XLWA 1WRBA 3HB0A 4NOKA 4OO3A 3C41J 4EYSA 1XPUA 1NKTA 2H9YA 2B20A 2COEA 3CEPB 1T9ZA 3OZFA 2G4CA 3AM3A 4PQGA 4WRRA 3V8PA 3ZXXA 2PUEA 3U4IA 1JDSA 3K4QA 2WPDD 1Z8HA 4GYJA 1IAQA 5CB0A 3TBFA 4HZIA 3EISA 5KYGA 3OO0A 1R16A 4HRXA 4KGDA 2C9DA 1NVVR 1ZG3A 2BPOA 1U28C 2QN9A 3G9QA 5E1OA 3UXEA 5EEHA 1GFWA 5ESXA 4BMZA 1SQFA 1N0IA 2PSEA 2PGOA 5TPZD 5YASA 3AL0C 4ZDWA 4EJMA 4KQ9A 2CHFA 3AVQA 2AUTA 4ZAZA 3EXHC 1C9KA 1UBNA 2IP1A 1LQUA 2GH1A 2EF0A 2RG7A 3BMQB 4M36A 2P9FA 4A8JB 4DIEA 4YAKA 1I30A 3QOWA 1BH6A 1USUA 3AEYA 2QM3A 2A1UA 4E1AA 2BV3A 4EELA 5FO1A 1FFWA 3SWWA 1RJ9A 4LVOA 2J45A 4OEHA 4GMFA 5MGNA 2BEKA 3EPRA 1E9RA 2FZKA 4G2NA 1OE0A 2FXVA 3MRTA 4OL0A 4HVLA 1T1IA 1MJFA 1B2RA 2VJYA 3K9WA 1NVWQ 1PGPA 4ARZA 1OT5A 2AFHA 4YRJA 4BB5A 1FXUA 5IP5A 1NZJA 5SZJA 3VR5D 2ZG6A 2AFIA 3SHTA 1UBEA 1UMKA 4Q4LA 1IK6A 1ODCA 1OKKD 1EFPB 3H16A 3MTAA 2R8RA 2BFOA 1GN8A 2QD1A 3TIFA 5J47A 3R75A 5EL0A 4TS3A 4YP6A 1KNQA 2R66A 3VR1A 3ZWQA 3NHRA 1HMYA 3RARA 3IUYA 2M6LA 2A5GA 4LY0A 4QQFA 3TIXB 4HH4A 5FI0B 3PYXA 4MLPA 3I8XA 4NULA 1H2BA 3VYSB 2PM8A 1E2DA 4FC7A 3GUCA 5DEOA 4AQDA 3UXYA 4EHFA 4PHTA 5KHLB 1SIWA 2FPOA 3SQXA 1U5BA 3W4JA 1MMFB 4HUQA 4UM5A 2UXBB 5B2FA 3N3AC 2BR4A 3AF1A 1T1JA 3AX6A 3PUWA 3QLEA 5ER6A 4FGSA 3H13A 5DTEA 3FTCA 2WB2A 3G0IA 2JIDA 2AW3A 3QUBA 2J5BA 1IUKA 2IXBA 3V8RA 3B53X 3LDHA 4HKTA 3C7AA 1W0KA 5A0VA 4HB0A 4AZWA 2ZQYA 5EJIA 3UA4A 4NX2A 3LX6A 5DNAA 1P2GA 2HF2A 3S7TA 1RHQA 2C3OA 5I7HA 4JY7A 3FRJA 1SC3A 3G2PA 1BMTA 2X8AA 4NG4A 1WB5A 4NZNA 4XA8A 4YO8A 4C0WA 2EJVA 2W8BA 1KI1A 1LDNA 2IH5A 2I7VA 1F8UA 2MSEB 4HQKA 3T4UA 1F20A 4JXXA 5I8PA 3IL2A 1XKXA 5JFTA 1DKMA 3U7HB 1G1AA 1A9TA 1Y33E 3UVEA 4DV1B 2VYVA 1TK2A 2XX3A 3F7OA 3NOQA 1CUHA 5FA8A 5JO9A 1K8YB 1OWNA 1UKBA 2CKDA 4RA6B 4X7MA 3HFJA 1KORA 3HXPA 4XJTA 1EINA 3KSBC 3P8ZA 4MICA 3LUBA 5LP6A 1NVDA 1T3LA 1X7YA 4XB1A 3WMGA 4DLTA 4J2OA 2YHIA 1D9XA 3CUUA 2AEEA 2XCRB 3OOWA 4PGAA 3GFTA 5CJPA 3W5IA 2AOUB 3OZSA 4QO8A 4HDRB 4IGKA 2D74A 1FFXB 2OHVA 3GJ5A 2ROQA 4CM8B 2ODWA 3WG9A 8LDHA 5HOEA 2G1JA 3T3NA 2J0SA 3L6RA 1DIOB 1PV2A 2H1LA 3DDCA 1P1BA 3KCQA 5DDIP 5ELLA 1YAHA 1CIJA 1N5JA 3H83A 2VBCA 3HJTA 1M7HA 5LLDA 1J1IA 1M1YB 3QA9A 5JCXA 2VJDA 1X14A 2GXUA 3GAFA 3UAVA 1E0JA 3L9XA 1VLQA 3N75A 4OQPA 2GHRA 4HMOA 2BBOA 1SKQA 2XKJE 3IVXA 3TVYA 4LY9A 1BJRE 3V7NA 4E2FA 4E32A 5HEKA 3PKZA 2JI9A 2QTBA 1U7PA 3AIIA 5TPZA 1OTXA 4W5OA 4HDNB 2KSQA 2QUKA 2Q4OA 2O1SA 3EWIA 5AI0A 1KMQA 4OQMA 4UPEA 4ZN6A 2AQHA 3L8MA 1ACLA 4UHDA 4A6DA 2GPAA 3KP1A 2NT4A 4RORA 2O8FA 1M2EA 4Z9BA 1KEZA 4DYHA 3EVDA 2BOVA 3K5WA 4UFPA 3H8SA 2A5JA 4M7OA 3RSLA 4TZ0A 3WRXC 1KK0A 4RKRA 2H2WA 1NE2A 3BZUA 2VN8A 1BA3A 3ZTWA 3CGWA 4X6XA 2HLPA 1MG5A 1L5WA 1YMUA 2G0TA 4PRKA 2FMKA 3ZVLA 1US8B 3EZ2A 4Y6RA 4LOJA 3VR5A 5JSQA 2O7NA 3LFUA 1OKKA 4Q4JB 2FPXA 1QRRA 2E4AA 1Q17A 2AQ8A 4HO1X 3RPEA 2DBQA 1ADCA 2EWWA 3I52A 1CJKC 1JBEA 3MJFA 2DAPA 4Y9UA 2GF9A 1U0EA 4YWJA 2VJKA 1M0SA 1UF9A 5H0IA 4Y2TA 4RE5A 1YR6A 3LY8A 4UCWA 4EYOA 3AFIA 3CRNA 3ST7A 4V0NA 4ZC1A 2A1TR 3HJFA 2CLOB 2C31A 2HIMA 4AYXA 4ZFNA 1X9GA 4B31A 4QAQA 4CU5A 3U5TA 3QPAA 3DL4A 2QTFA 1MC1A 4JLMA 3UB4A 2I3DA 1Y63A 3ODGA 3UFXB 4W7IA 2F62A 1RIFA 3W1VA 5M2QA 4YASA 3K8QA 4G81A 5EQJB 4ER5A 4I4IA 1O03A 1HUQA 3O4FA 1YE5A 4TKVA 3LFHA 3HBLA 4AKEA 1VSBA 4DQKA 3DKPA 4ZAWA 3IEMA 4TLMB 2G04A 2HU7A 2I2XB 3H8VA 1KAMA 4FNAA 4RD0A 5LWQA 4ARCA 5KAPA 1RBYA 1W4LA 2AXPA 1TQHA 1G3RA 1KY3A 1WULS 3T9DA 4Z0HO 4RTNA 2G4LA 2V59A 3IX7A 4FOOA 4X64B 2NM0A 2W11A 4KQMA 2YICA 3R0XA 4LOAA 2X4GA 1GA6A 3DAYA 3NRJA 1HT1E 4UQPA 1HLGA 2QDXA 4AY5A 1CY1A 1J9GA 1CJBA 1H8HD 4BVEA 3CPEA 3GFFA 3H75A 3MJSA 3ZYCA 5AM1A 4GBJA 3T7DA 1YBAA 5CIYA 2P4UA 3MGCA 1SVSA 3DO8A 2VA9A 3IEUA 4C7VA 3G0HA 5JATA 2X1VA 2QQ5A 3FOEC 1E2NA 3KXKA 1O77A 3PDWA 2R2AA 1QHEA 3PHLA 3GLRA 3H5NA 2AEMA 2WJAA 3ECSA 4NYIR 4Z86A 1PYDA 5P21A 5CDHA 1P17A 2PGJA 4I9UA 2RI6A 3DBRB 3SP1A 2G1UA 1NOIA 3GWZA 2Q29A 3N6VA 4UBLA 1PX0A 1OAOA 1AC5A 3TSAA 5GVRA 2C7PA 4MDEA 4KR6A 2ZEJA 2GZDA 5CXQA 2CZQA 4G8DA 4UTVA 2C9OA 4F3NA 5BV8A 3DONA 5AXBA 4MQUA 2XZTA 3KHTA 2GHIA 3PXDA 3ZNOA 1JPVA 1WQ1R 3FHOA 1W30A 3M0EA 3FN4A 1K6XA 1YA4A 4Y6GB 3QI7A 4BNIA 5IU6A 1DT5A 1E6MA 2P6UA 2H06A 3HVUA 1AHHA 2PH7A 3QEOA 4R2WA 2FN8A 2WYWA 3TLMA 1JLHA 1L5QA 2IX3A 4UEKA 3U3DA 3CH6A 3LL7A 3T3EA 1Q0QA 3GOQA 3SDZA 4ARBA 3D7KA 1FVFA 3NDRA 4REMA 5DFAA 5FTJA 1ZONA 1KEPA 2GEFA 3B60A 3Q12A 5DH9A 1V16A 5AXCA 4GXRA 1IB6A 4ZQEA 5LUBA 3TI7A 4IHQA 4DY6A 4EITA 3ICWA 3THXB 1MFPA 1MHTA 5KYTA 1XTUA 1EK6A 1Z2NX 3M4XA 3T5PA 1GTL1 5BUCA 2BGIA 2I6GA 4A8PA 3P5BA 4HBGA 5A4IS 4MS1B 4UMEA 1U7ZA 1VKNA 2DB3A 5LYJF 1KR5A 3RUDA 3AKEA 4ZANA 4I6JA 2QF7A 3PQ7A 1UANA 4OXYA 4MW2A 3VXKA 4Q3BA 1TVCA 3SFTA 2P3SA 4HDKB 1NFRA 4WZZA 5HTOA 3TSZA 4BDSA 2PBZA 2JAOA 3RRNA 4ETMA 3VISA 1YS6A 3A06A 5F5LA 3R5TA 3TNFA 3CA8A 1KQ3A 4AQ7A 4NBRA 4BJ5A 5D1HA 2VTBB 3VYRB 1ZMXA 3I8OA 3HB7A 3CLUC 4LJLA 5DN6D 2XKAA 4BXOB 5KC9A 2W58A 5JYEA 4KI7A 1W19A 1RRKA 2RGCA 4NFLA 2X0FA 1YMVA 4Q34A 3IR7A 4ZO6A 2PEZA 3PDUA 5CRIA 5DV9A 3UHFA 3WGQA 4K9OA 2WSBA 1EFVB 3L0PA 3IBSA 3KYBA 4X20A 5HA5A 1M75A 1WTAA 2J48A 2P5SA 4YRCA 1JVNA 1BEEA 1Y3HA 5ERYA 1SC1A 4CQLA 5KQMA 1CULC 2RK3A 4A3SA 2DCMA 2C5SA 3ZZTA 3OETA 3EX7C 4PQRA 1MBZA 4DADA 3DDZX 4U8HA 3WZMA 1GQQA 3OMWA 4Q47A 2BGTA 2IEZA 1C2TA 4YNBA 3ELYA 2X9QA 1F0PA 2G8NA 4KBFA 4RV4A 4TT3D 3QOYA 2VJPA 2B4YA 2WIBA 2ZI9A 3G9TA 1V45E 4R6WA 4JA2A 3CNLA 4PN7A 2YV3A 2FEAA 3OPQA 4LVCA 4TXJA 4KLRA 1HQCA 2BSQA 1QFJA 4EAAA 4D4LA 2NP6A 1ADFA 1XZNA 4LHSA 4XCXA 1EEHA 4IG4A 4JIMA 2WMNB 1JYSA 3F6PA 1JBQA 1XV5A 2VUSA 1T24A 4U9UA 1Y1QA 2YXBA 3K30A 4EWLA 1GCUA 3CO5A 4LJ4A 4X7RA 3D7LA 3N0TA 3ZE9A 5D7NA 1K3FA 4D81A 3OP4A 4CKYA 3MCTA 4UUNA 3GK3A 2EGUA 2WJHA 1QNFA 4HDMA 2JGDB 1EWTA 4I50A 2P5YA 1ZAKA 4PR0A 1LPBB 3WLTA 5ALEA 4LWQA 5KI6A 4EG3A 1J5PA 4IUBS 2NLOA 4U3JB 3ZWVA 2PGLA 4UHKA 3T94A 5AOVA 3K8OE 4B45A 5IUKC 4NC9A 1EVLA 3QK7A 2Q3CA 1QHHB 1NP3A 4NH0A 5JAPA 4G1BA 2IYPA 2QLLA 5B3AA 3X44A 3ZHSA 2UUOA 5FAXA 1F60A 2AK2A 1R0WA 3BCUA 1J8VA 1DV2A 3E1SA 5C9ZA 4CCAA 5IX8A 3DLPX 1WCIA 2GKGA 3LGAA 1RACA 5HIAA 2V6FA 4JH0A 3ABZA 5ALZA 3BS4A 2BFMA 4Y2YA 3I64A 3KELA 3W0LB 2BFAA 2HBRA 3C3KA 3NT4A 4IGIA 2GZHA 2LDBA 3ZD7A 1UMBA 1U90A 3U9SA 2XWSA 4M0UA 3W7AA 3U4CA 2QRVB 2HREA 1SUSA 4V39A 3GBPA 4WW0A 3OZVA 3UF0A 1XYGA 1IZ8A 1CX9B 2YC4C 4AQYB 2O57A 4KOAA 2I7CA 2Z6UA 5K3FB 1KJWA 1U8EA 3THYA 1HOXA 1NRJB 4H3VA 4OA5A 2F1IA 4WOCA 4LV8B 2H51A 3I09A 3P1JA 4JEUA 4Y1EA 1I6KA 1AXRA 3EDCA 1MOZA 2QE6A 4Q9KA 3AR5A 5LP6C 1P4AA 2R7AA 3G2MA 3BZWA 1N5DA 4H08A 4D8YA 3KLOA 4MQMA 1WDKA 1UDRA 3JWEA 1GL9B 4CTNA 5CLHA 3C7KA 3LCCA 3ORFA 4ZDJA 3C5CA 1PJLA 5DYWA 1J0DA 5EE5B 3FPHA 2VQEB 1U02A 2DFTA 3W2FA 1KK2A 4BMSA 2E49A 5FWNA 3NVKI 1F0KA 1KMHA 2XBLA 1RKUA 2FSHA 4TTQA 4A8TA 1U94A 4MYRA 4YMVA 2UYCA 3PNSA 1N77A 2Q5EA 2HLDD 2YVLA 3JASB 1UQUA 2A4MA 2IYEA 4PPNA 3SM3A 5B7NA 4FMBB 4F2WA 4JQYA 5ALRA 3EVGA 5F51A 2WJVA 2P69A 3O92A 1V43A 1AKVA 2CFIA 2CV2A 3TFOA 3ZQ6A 4LSMA 2QLTA 3UKJA 2ZB8A 3LVBA 1NMSA 2OPBA 4FEAA 2PO7A 1SZDA 2QT1A 3Q3CA 4MQEA 1Q0HA 4TS9A 4LRUA 2EFJA 2GCOB 3DOFA 4B3MB 1WKBA 1GP2A 1XMIA 1C8KA 3QKRA 1YF3A 5EWJB 1ELOA 1VL5A 3MGBA 3ENVA 5COBA 1ZH6A 1NULA 1N8SA 2VTVA 2YZ2A 5A5FA 5LU8A 4CNQA 1T4DA 5LQUA 1NXSA 1QLHA 2K5UA 2CNDA 3CNHA 3KB1A 4OB7A 4OHFA 3SX0A 1TF7A 1DIRA 1L7RA 1PFQA 3EXAA 3JQ9A 3OE7D 3LBHA 4FGJA 6PFKA 4GM1A 4I4TB 3RTDA 3BWXA 4TSFD 2JD0A 1K5GA 3WB2A 4X6LA 4CI9A 4DBLE 4RTJA 2ID4A 1I5RA 3P20A 1MAHA 1KIMA 1TJ3A 3IE0A 1ISFA 2NU9B 2Q2QA 5H83A 4PG6A 2BN4A 4R05A 3JWPA 3NZEA 4AC9A 4FB5A 4FR2A 2FPGB 5ITSA 4YJGB 1IY8A 2WDPA 3RTAA 1M7BA 4MGZR 3JZAA 2JLBA 3OF5A 4ZVVA 1LTKA 2RBEA 4D82A 1CE8A 3PGJA 3R0ZA 3RSOA 5EJAA 2FMFA 4Y8VA 1LBIA 2Z95A 3O90A 4WK4B 3TAXA 4KLAA 1S5PA 2VLBA 2J67A 3HM2A 4O4HA 2FWMX 1QR2A 1EFHA 4Q4HB 1QMPA 3A7EA 1WZNA 4C6SA 1DC3A 3UWSA 1RWKA 4HYYA 3BQMB 1JDNA 3ZV6A 4OQDA 3FBWA 5JCZA 2ZZMA 1DRKA 1DZIA 1MT3A 4H16A 3FXAA 4TTSA 5HF8A 5CJ2A 1P2SA 3HLKA 3IA7A 1YZYA 3KDSE 1DBRA 4U6NA 3TZBA 3FMVA 3IHKA 1N6RA 5TGTA 4XFDA 2FW1A 1X8XA 1Z13A 4NDAA 3YASA 3UK7A 1QIEA 2W71A 5A7HA 2EZ8A 2C57A 3KQHA 3UC9A 3W4IA 1FPQA 3OICA 1P2VA 4EYGA 3C74A 4M7RA 1KE2A 5TJ9A 2WJZB 2ZAIA 5K3OA 1MC4A 4ZV9A 1NR1A 1ML4A 2HIGA 1Z7EA 3AUJB 3E4CA 4EYKA 3I83A 5A4DA 3SHOA 4C76A 4DDWA 1M0EA 1E92A 1KQPA 5CLQA 1WXEA 5L3SA 2GFIA 5IFLA 1K5DA 2WF6A 1O6CA 1J00A 3FCOA 3K5HA 3M5DA 4KACA 1NXQA 2CEAA 4UC0A 1T2VA 5KYVA 2YMPA 1B8UA 1W36C 1OAOC 1RAGA 5COQA 1AKEA 1BFKA 1I4DD 2OBYA 3EDMA 4K5QA 1TUIA 2NAFA 4CFYA 1X1TA 1CQIA 2VQ3A 3G6WA 2RJ3A 4O1HA 4C3OB 3G9ZA 5BYKA 1U3FA 4QAJA 4O4LB 2WI8A 1UJMA 4QUHA 2YY5A 3LBAA 1A9ZA 4MGIR 4X85A 5FRDA 3TTSA 3VR5H 1YZFA 3CLHA 3FB4A 4M0KA 2B21A 4EZEA 4TSRA 4A6XA 1CF2O 4NPCA 3RYFB 5BR7A 1HOTA 4F4DA 3OT1B 1G6Q1 2FPPA 1LNZA 3A1WA 2D0IA 2EARA 2VT6A 4X44A 3TZEA 2OBXA 4U2GA 3OQHA 2H1OA 1GAWA 1PVOA 1E9AA 2QV7A 1I7PA 4P0PB 4ZCLA 3QFTA 4N7MA 4CV3A 5A9SB 4OV6B 3K0AB 3N74A 5LJLA 2QGZA 5KJ1A 1D2CA 4ZT6A 4D4JA 4E7OA 1WZCA 2W2VA 2DR0A 5DP1A 1BDMA 4Q4AA 1X2EA 1YONA 2RHBA 3KKOA 4H77A 2D1RA 1QH1A 2Q99A 3HCFA 4X66B 5TQ0A 2CXSA 3H18A 3K4PA 4QXMA 1H65A 2HEIA 2FW0A 3A4TA 3N28A 1RFLA 3CRRA 3QUCA 2PUFA 1E9VA 1NF3A 5I7RA 5HYVA 1U3DA 1ZCBA 2V4MA 3ZZMA 1UPTA 1ZGGA 4CMIB 5EJ8A 1JZQA 2PMKA 3G1TA 2XRZA 3TMAA 1LD3A 3KAPA 4EKGA 3BERA 4HDQB 1DAHA 4CKEA 1VL2A 3BE6A 1E59A 1X19A 1IOLA 2VDQB 3LGSA 4BB9A 3RYIA 2HQBA 1U2SA 2OPHA 4D6YA 4J75A 1HDZA 1KDVA 1OFUX 4JL8A 2OQRA 2QA5A 3QKTA 3GT0A 5KYUB 2PRZA 4TOIA 4XM0A 3I4FA 2G1AA 2X8WA 4AP9A 4YUWA 1UFQA 3ZCVA 4F11A 1YR8A 2PT9A 1Q91A 1RRFA 1QIIA 1P8AA 1TM2A 1VLVA 5EJEA 5EWLB 3ITNA 1EB9A 2ZUFA 3OFVA 2D06A 5CB4F 4ACBA 2D1FA 2WWXA 5HJ5A 3T38A 3GCWA 2QMHA 3T5AA 5BQ5A 1DEHA 1M6WA 4MK4A 3RJ5A 4B3TB 4PLYA 4FK8A 1FC0A 1VBFA 1GXSB 4UNQA 2CNWA 2H4ZA 2KWIA 5L7YA 4CGYA 5KPJA 2Z5VA 4C4SA 3U44A 3UYKA 1WHSB 1G6OA 2D0PB 2DLNA 1GU7A 3SYKA 3BXFA 1BXKA 3D0QA 1Y4AE 4LC1A 3HMQA 2GAOA 4LBWA 2E6UX 3N2ZB 2J7PD 3ZGYA 4C04A 4N5IX 4RWEA 4CIDA 3PRYA 3A2KA 4NZPA 3O93A 3RWMB 4BMXA 1VKRA 2V6JA 4P4LA 3IP7A 1HYBA 2NX2A 3C8MA 2X40A 2JRLA 4B47A 3AEKA 1QG0A 1XDGA 1YVUA 2JJ2A 1L7EA 5IABA 1LC3A 2Q2VA 5J2UF 1E1RD 4N5LA 4F8EA 1EXWA 2ERYA 2WD8A 5TVKA 5SZIA 3TSYA 3QPBA 1ZC4A 1GPLA 1GRQA 3FPJA 4QX6A 2NVBA 1YR9A 5JJKA 5HOQA 5ECYA 1LZLA 4R8VA 1FPMA 4YY3B 1YO6A 3FVVA 1IDN1 1Z0FA 1OI4A 1ZGBA 4OGKA 1SBIA 3UMCA 4X00A 3UXHA 1QOPB 3TTUA 2JLVA 1QMGA 3V3TA 2BFEA 2AQIA 4K87A 4ALNA 3T1YB 1RU3A 4GLBA 3KUUA 5B1IA 1OILA 1ZD5A 3BG5A 4TV8F 3BGVA 2CXXA 2ONJA 2GBCA 1WZ2A 2JFXA 5LOVB 4AO6A 4UQOA 3EPLA 3V7WA 1Z26A 3NVAA 5F4BA 1QVZA 2YOHA 3L6BA 5ALYA 3LWZA 4UXIA 4OK3A 3LL4A 4DWJA 2WWHA 4NE7A 1TDJA 4LG1A 3AY3A 4RY8A 5GJCA 1SBYA 4R01A 1T2DA 4WXHA 4CMKA 2PUWA 1HE5A 3GNLA 2Z9DA 1LRLA 2W2KA 5ALSA 3RW9A 4DLZA 1VRWA 4S2UA 3AW8A 4YP7A 5JSKA 4N48A 1Y42X 1J90A 2J9FB 1O1YA 5F3DA 3VNRA 4EKIA 4ZIRB 5AJXA 4LOHA 3F6BX 2M32A 2V3CC 3CUKA 3NGMA 2X5NA 3LW7A 4NLLA 4QM7A 1VLHA 2O8DB 2RC5A 3FJOA 4YECA 3ZZUA 1XJQA 2QJWA 4HDAA 4TVOA 5LBUA 1KARA 1A5ZA 1BX1A 4Q93A 1TUGA 2JGKA 3V48A 1IZ0A 4G0ZA 4QUBA 3I3SR 4O0LA 5H4GA 3RAFC 5K3AA 2JKVA 5A2GA 1T91A 3FFBA 1TUBB 4ZOLA 3A3YA 2VPQA 3PUHA 4QDZA 2EFCB 1Q84A 3H2BA 5JZBA 1TI7A 2BGJA 3UK0A 3EMBA 4B79A 3VOSA 3AI7A 4RTMA 1EYZA 2BAGA 4YT2A 1VJDA 3LC0A 4H6XA 1NWCA 1CJTC 2ZTLA 4V0KA 4HTFA 3BORA 1C4OA 2ZR9A 4QNRA 3DEHA 3K0CA 5EKXA 3JATA 3B89A 3PPWA 4L0QA 2CFCA 2R5WA 4OI4A 3RRJA 1XTSA 1M7GA 4MQLA 4MAMA 2W4MA 4ZEOA 4O4IF 3SHWA 2JG3A 1SUPA 3O2SB 4CMCA 2PWPA 3UJNA 1H6CA 3GEPA 1PW5A 3IAXA 5K8UA 1RBMA 3WWDA 5JSUA 1C30B 2A6PA 4XGRA 3NLLA 1QLJA 5F4ZA 2QL9A 2ZBUA 2ZUBA 4JXKA 1DNPA 1KDZA 4EJSB 2OILA 5AM2A 1I7SB 1QFZA 2VNHA 2BTEA 4YRDA 2PTHA 3IP8A 5BWNA 4LK2A 3V8EA 1XDZA 2TMGA 3O8CA 2FEOA 4RTRA 1NT4A 5JD5A 2W2PA 5LR6A 3JQ9C 5A4AA 1K97A 2OZLB 2HU8A 4TXMA 5HW0A 1VDZA 3LLMA 4IAOA 3BL8A 2MINB 2PLRA 3NV9A 4N0DA 2V97A 5DHTA 1FRQA 3G1UA 4B3GA 3B8HA 5DHFA 1NMYA 4NHOA 3AYXB 3RC9A 4RCYA 1V0JA 2IYZA 1E1RA 1JR2A 1TTHA 3GI1A 3MB5A 4WXPA 5IC6A 3PQ8A 1D8AA 4RD6A 2QX4A 3Q3JB 4RZQA 3O26A 3VKHA 1R5JA 4IUDS 2P68A 1ZK2A 3E35A 4EHBA 3E3OA 2JFOA 4GVPA 1NVTA 2R6GA 3FPGA 3QE4A 1ZM7A 2MYNA 3BBPA 5EEGA 3SY8A 4E03A 4Z1OA 4C3ZA 1V8PA 3C4JA 2AVDA 1MX3A 2H16A 5BNTA 1XHFA 2IZ6A 2ZJ1A 3IGFA 3W8RA 4IDCA 3X1ZA 1FVXA 2O1WA 3TRHA 4F38A 2BZGA 3QXHA 4OYYA 4GWGA 5I48A 4O29A 1K0UA 5DULA 4KHPB 3FKSA 4MKIA 1XMQB 1R12A 3TQQA 1QQ5A 3FPEA 5C2JB 2BFNA 4G8JA 4J0JA 1G5QA 3CXUA 5HQ3A 1DFIA 4BKRA 3ZY3A 3FF4A 3C98A 5KQGA 3OQNA 2EFYA 2A9OA 3FBTA 5HCNA 4PSAA 1YS9A 2JI7A 4K8OA 4QQRA 1Q1AA 2PUGA 3EXIB 1R8XA 4P7GA 4U9IS 1WB4A 2X4IA 3WIEA 3E15A 5DM4A 3C8UA 1Y1RA 1JEQB 1YQQA 4CR8A 2TSYB 3GRPA 4YLGA 3T1OA 3VR2D 5DGIA 2VPYA 3OZEA 1VIMA 1ESDA 1R4MB 3I2KA 2G88A 1NNI1 4MYHA 3H84A 3NWBA 2Y93A 5CT8A 1DRVA 1ZUWA 2FQWA 3WDMA 2IL1A 2MR5A 4V3CA 4KRYA 1KTIA 1RP1A 4MVWA 2WOJA 1WP9A 2E4VA 4KWHA 1NX9A 4C0SA 4LN1A 2HWKA 2YOGA 1HEYA 2OV3A 4OSPA 1AF4A 2IU3A 1HEIA 3WWPA 1A8PA 2R87A 4QDXA 4I36A 2QIOA 3I2IA 1FP4B 5CFOA 1A96A 2JEYA 1QTIA 4UTOA 2QN2A 3A28A 2P9BA 1SU8A 2CGEA 3FNHA 1PNVA 4OQZA 2BFWA 2X0DA 4CTMA 1X7WB 3U49A 1N2GA 1JS1X 2P9JA 3T0FA 4EF4A 3GLFE 2RJNA 1HYEA 4NONA 3B85A 1Q22A 1G8JA 2GUWA 1N2CA 4DARA 1E20A 3BEDA 5C1OA 1RM0A 5HZGA 3CNQS 3ENWA 1LW7A 3NATA 3QRWA 4LOLA 4LXXA 2IUSA 2HLNA 4G5OA 2IYAA 4IEIA 3AJAA 4O4IB 3WR5A 4JUDX 1CZHA 4HXEB 1Z47A 4AMUA 4CKWB 3GCDA 3DHYA 5JVDF 3ZDRA 4L22A 2FMIA 3U60B 2VNJA 1P75A 3A10A 1JFLA 3L7IA 3B9QA 1T4CA 3TD9A 5DM70 1U1DA 1J4AA 4DMKA 621PA 4TVKA 3KYDA 2AZ4A 4FOLA 4XDZA 1V4VA 1JSZA 2B5VA 3H0CA 4EBFA 4BFTA 4EFMA 5C32A 1PF7E 3CH5A 3IQDB 4ZU1X 1O97C 2IYWA 3GP3A 4N12A 3TL6A 2VA8A 2VWGA 2OQIA 3NIWA 3BSWA 1JEEA 4JCOA 1D0IA 5SYMA 3CSSA 3HDGA 4NMMA 4E4RA 1ICEA 1Q95A 1FP6A 1GV1A 1IQ0A 3DLIA 2H85A 4W1SA 1E8NA 2ZGVA 5EA2A 1YBVA 2ZBQA 1ZH2A 2ESRA 3EAGA 3I9NA 5AW7A 1LCIA 1JPUA 1OYYA 2UVDA 4RPHA 1M2WA 2AE1A 3NHAA 1KP9A 3BBLA 4FFVA 1ECFA 4DIBA 4M60A 1JIXA 2B34A 1YGYA 3TTWA 2VP3A 1YVEI 5LDGA 2Y0DA 3BSSA 4MV8A 5IZCA 3WRWA 2XB2A 2WAYA 1S2DA 1NUTA 1HPLA 3VRHA 1QDLB 1PNOA 1CUUA 3EVEA 3RRFA 2QJRA 2D2VA 4D9JA 2GPBA 2ZRKA 3K72B 4MAFA 4AIRA 2YV5A 3AERA 4BGUA 3SE0A 1KAGA 4M7PA 4PBTA 4BNMA 4UQLA 1EFLA 5FCDA 1DINA 2BHLA 1A8UA 4DBLC 2QTTA 1MR3F 3NUQA 5J59A 2Y92A 3VR0A 2E1PA 4CEIB 2A0FA 2IY9A 4LV5B 5D5HA 4D80A 1WJGA 5A5EA 1JI0A 1KPGA 3CX7A 2I22A 2X4DA 2PO5A 2LP4Y 3DDHA 1DMRA 1X15A 1CUYA 1O5OA 1WUHS 2IXTA 3U3XA 1U5AA 2WPNA 3QVWA 2ZUSA 4H1VA 4XEUA 3LHFA 3P7MA 2ETXA 1EFPA 2E0IA 3GR6A 3VR2A 1UWLA 3RVMA 3H2ZA 2PSDA 3LT2A 1C8VB 3AEQB 3EGDB 3EW9A 4N4AA 3WHIA 2NXWA 2V5VA 2GUGA 1PU2A 2KPOA 2O7QA 3DL2A 2CJXA 1GLGA 3R7SA 5JWRA 1RXIA 3UJPA 1MC8A 3KT8A 1Z9BA 1IL0A 3KPUA 4URYR 4FQ5A 4Z99A 3W79A 1YFJA 1LJ8A 1DLJA 1PJ2A 2JAQA 3GAAA 3PNMA 4D9GA 2ONZA 4D9BA 4ZK6A 2H0AA 1A3CA 4FQ7A 2H1HA 4YQFA 4UPVA 3SN6A 5K99A 1SC6A 2VJMB 5HGXA 4OHZA 1BC5A 1XMXA 5ERXA 2CVFA 2YWRA 1UPCA 5SYNA 1DWQA 1V25A 3UGTA 1FSZA 2TMDA 3RS9A 4K9DA 5KS2A 4R0VA 1ML3A 3OESA 3P5SA 1ZCJA 2H11A 3KZXA 5A6SB 2IUYA 4MIOA 4B2YA 3DZGA 3LRPA 1ZWLA 3ETGA 1YDHA 1THTA 2RSLA 3I6YA 4MRMB 5C52B 1N92A 2FUEA 5KCMA 4NJEB 4DCNA 1DOHA 3F5QA 4HN4B 1SVUA 2RONA 2JZOA 2F3QA 5JZVA 2EEZA 4RVHA 1RJEA 3OSUA 1JQLB 3DEFA 3S99A 1Y7TA 1X80A 2CHUA 2OHXA 3TDMA 1PT5A 5IULC 3HP7A 1ODKA 5FFNA 1LBHA 3EEFA 3LWNA 2FQXA 2O3SA 1NJ2A 4ZA2A 1LVHA 3ZHQA 4M22A 4B6FA 4DLBA 1J22A 2WKSA 1C7RA 1NYRA 3D3KA 3H4TA 2XCQA 3DKKA 3HB4X 3K2EA 3PJFA 1UM9B 5TB5A 2Q3FA 1J09A 3FUVA 4KUGA 3HK2A 1T8UA 4J6EA 3DCJA 4IDEA 1CETA 1TECE 4JVSB 4PF1A 4UEJA 5DM1A 1Z5UA 4DN6A 3KS9A 2ZCUA 4GEGA 1Y8AA 1IXYA 2G28A 1FFXA 3O03A 3UJHA 3VPBA 3R0QA 4PONA 4CM8A 3GLFA 2QUZA 2J6CA 2IEBA 2LVBA 4MNTA 1VKOA 4N5HX 4WUTA 4QTXA 1G8HA 1XNRB 4YAEA 1Y8CA 4LF8B 4ZOLF 1GYPA 2GS9A 1ULHA 3D3WB 2UDPA 4WCDA 3MOIA 2MMCA 2ID9A 1IHPA 3LMKA 3MS4A 4L16A 1A1SA 1F8FA 3A9VA 5D3MA 4E14A 4EB6B 1MX5A 2B83A 1RPTA 2E4UA 2J8ZA 5IZ4A 4S0XA 2WA2A 1TQDA 3VTAA 3GU3A 2YHAA 4FGLA 4F5DA 4L74A 2XTZA 3K0CC 3K6RA 1UDCA 2RH4A 3KZ1E 4GRIA 4OA8A 2NADA 2FPRA 1KY4A 1OD6A 3C3DA 4R8KA 3C1TA 4GM4A 2X0JA 4EX7A 2V7BA 2BBTA 1G5TA 2GESA 3BFJA 1RR6A 3DC7A 2YX1A 4KFSA 1SHTX 4ZT7A 4MXDA 2O5CA 1JLLA 1UT6A 2YH2A 3IIKA 1E18A 3NQ41 4P98A 3JAKA 4KXXA 3VO2A 1KFJB 1A2KC 2AD1A 1JJBA 2GMWA 1DRWA 4GQBA 4HJXA 5AICA 4RQUA 3WJ7A 1US8A 1E89A 3HU3A 4B2IA 4Q9AA 3A70A 5FPPA 4QSHA 4LFBB 2PMCA 2ENWA 4Q4JA 1IZ7A 2IITA 5D85A 1POWA 2I2BA 4TQGA 1UDAA 1I1OA 1NFFA 3V6LA 2YUIA 4CUKA 3BKWA 3L5OA 3OOEA 1ESEA 1BSVA 4OXIA 3H8WA 4ALIA 1GPBA 2FRDA 1A82A 4IDDA 1F0NA 1TLTA 3BYZA 2WSSD 4MVJI 4ZU6X 2CZCA 1OXXK 3HKBB 5IHPA 1XI2A 3FETA 2NO4A 1V8OA 2VXYA 4U2FA 1BHO1 5JTTA 3GXBA 3OQ6A 4YCMA 3CFYA 4R1LA 1CZRA 2QSJA 4CU2A 1WKCA 2IU6A 5IJ9B 3C6MA 4BO3A 2IYQA 4RKEA 3DGEC 4HX5A 2ON6A 2P1ZA 1NPTO 3BRQA 4BP1A 3V80A 2OAEA 1L8LA 5EFOA 5J9FA 2W2NA 3TBKA 3AO0B 2V1XA 4ND8B 4FBGA 2VAXA 4Q7LA 5EOVA 3D81A 3WYDA 5KSWB 2XECA 1EZ1A 1LA2A 4XVCA 4L78A 3QNUA 1KZGB 2R25B 4U1RA 4QVIA 4OI2A 3PVCA 4E2YA 3GQBB 1JMKC 1PKEA 3A4NA 3KHKA 3PGXA 1NN1A 2AI3A 3O82A 1EXDA 1WF3A 2CF5A 3MCZA 3TQTA 1G21B 2Q1TA 3KR1A 3GYGA 1SVWA 1HDEA 4N0PA 4R0NA 4ZCPA 2VH1A 4GVLA 4G1EB 1RWNA 4YJHB 1NVEA 1YU6A 4RXTA 2P2GA 3ZU3A 5A9RA 1M2JA 1EX9A 2ISCA 3H4VA 3N7AA 4FPXA 4PYOA 4M9XA 3I6MA 1SOWA 4YT4A 1X0XA 2G6BA 3JTEA 3EOBI 2GTIA 3F9CA 3MELA 2HB6A 2KBEA 4GKBA 4Z4IA 4QUKA 3L7MA 3FW1A 3DOCA 3NEJA 3DAPA 2PG3A 3OIFA 1PO7A 4I2NA 2RI1A 3KJXA 4ETIA 2YHUA 3DZHA 4UD6A 2FJ0A 1Z4LA 2I33A 2OV2A 1CDDA 5IT0A 2W0SA 2HCFA 4YCNA 1XAHA 2DBYA 3D2AA 2QX9A 3T12A 1O95D 2G5GX 3F6YA 1TVKA 2IF0A 3VC1A 1C0KA 4DCVA 1U0GA 4RK5A 1RYDA 2VDKB 1V39A 1VBNA 3SHVA 4BS9A 5IDQA 1SWVA 4DLSA 1PZXA 4P53A 5CCBA 3R20A 1QANA 3KFVA 4BLVA 1DG1G 4P2BA 4B48A 4F2HA 2OKCA 5LQMA 2CJWB 3E81A 3STXA 2O2XA 4HBZA 4QE3A 1RHMA 4BDTA 1Z29A 1K92A 4M9SA 1OIVA 1JQKA 1V96A 3TXXA 4JC8A 5K8JB 4G5HA 4OBWA 3GEBA 3KVYA 2ZROA 2F1RA 4P3PA 3NT2A 3INTA 4WKCA 3BTUA 4MA5A 3WLIA 4MA0A 2CJYA 3THXA 4IHAA 5LQRA 2WWIA 3RAGA 2CWWA 3BPSA 3JYQA 3ROQA 1VJ1A 2WJ6A 1KI7A 5EESA 3VNVA 5EKDA 4N41A 3L4SO 1PUIA 3LECA 3HP1A 1WOMA 4BN0A 1SVMA 4MS1A 4RHYA 4LSZA 2EJBA 1WUKS 4DMHA 2V65A 4A23A 2X6QA 3HVJA 3CW2A 2XBUA 1LPOA 3S29A 5B57C 1EFCA 4WOBA 2Q3BA 1X38A 3HBNA 4HYEA 4GSLA 3VC2A 1TYAE 1ZBQA 4FHZA 5ENZA 3AY6A 1KZ6A 2BGNA 3CU5A 4FYVA 4NZ9A 2ZIGA 5DCYA 1GIAA 1J0EA 1P4RA 3K9NA 2BKAA 2GM4A 3L49A 2DHCA 2HPZA 1N2BA 1V5GA 5CVDA 2VTBA 3WYNA 2Q8NA 2QENA 5FTMA 5CTAA 5B30A 4TROA 2UYQA 4D46A 4NG5A 3ZH2A 2NOAA 5JV5A 2FWAA 3R8XA 1CUAA 2X3FA 1ZR2A 4BXOA 1FSFA 2BE9A 2XITA 2Y4OA 3JD3A 3OG9A 3A3PA 4FWIB 4CUJA 5IZCC 1LNSA 1F4LA 3UB3A 2R1UA 2VZEA 2HA5A 4URFA 5E6RB 2XOEA 5H82A 3ROEA 1EFVA 2A8YA 2XDAA 1QYIA 3IAM6 4J1TA 5BW6B 3IDAA 4KV7A 1IEVA 4X1IB 5DIFA 4CCYB 5EG5A 5IDVA 2GFHA 3HY6A 3LKVA 4LV6A 1YVRA 1RE0A 2HT6A 3B7GA 4JVLA 4MJXA 3HUEA 2OVBA 2QMEA 4L4XA 2QSYA 4TLDA 4M0FA 2QBYA 3BMXA 3DQQA 1DEXA 3FUUA 2PXHA 3NT5A 4R2HA 3U4GA 3UPUA 3HN7A 5EN4A 2I4IA 5K2MA 1E7WA 5BSHA 4MP3A 3DTTA 1HG1A 3VAZA 2ZZKA 3VR4A 3FYUA 2Y0BA 1DBSA 3VZBA 2D0OB 2IHTA 4H7IA 3L7AA 7GPBA 1FS5A 2NUBA 4RENA 1UZNA 3PI6A 1AB6A 1QF7A 1YULA 3PHJA 3RFCA 3WK8A 4EHJA 1CUXA 4GHWA 1GYQA 5IS2A 3ROKA 5F7OA 5IARA 2YJ3A 5CT5A 1PZGA 3PC4A 3AHIA 3F71A 4Q5IA 1I2AA 3V2IA 1OVGA 2HUPA 4POAA 3KVVA 2B8JA 4BVGA 3FOWA 1AZSC 4KN5A 1WLSA 4UVGA 5DBIA 5HIJA 3P27A 3FDIA 3OZAA 2WFLA 2FW7A 3N2NA 2OG1A 1ENZA 4MO9A 3NDIA 1M54A 3M6AA 2JFNA 4G2TA 2HMVA 4KPFC 1H5UA 1QHHA 4MI6A 2FGJA 3GLGB 4ZVTA 1H42A 1QWOA 2A84A 2P7HA 2IUUA 3PGA1 1GGJA 3TKYA 4AZ0B 4ZK2A 2HI0A 2DP4E 1XF9A 3AUSA 2UXCB 2EGGA 4CQMD 2QX6A 2YN4A 3A31A 4GX0A 3NHMA 1PN3A 4G1UC 2IHNA 3DZIA 5FBZA 3WJ2A 1YRLA 3R7LA 1RYEA 2HF7A 1BE8A 2X41A 3B7WA 4M1WA 4YROA 3LA8A 2D3TA 2LDXA 2M98A 2X5XA 1L4MA 4U5XA 3L0ZA 3U7QA 3RO7A 1VJ5A 2VRNA 1JWAB 1LSUA 1E3EA 3AKDA 4MYTA 4OM7A 5TARA 5FWDA 5U4QA 4A91A 1FQJA 1SMKA 4W6ZA 2J4DA 5K3FA 3MCVA 4KL8S 2F2TA 4G5SA 4BQRA 5BMVA 2HIAA 2QJOA 2A30A 1UH5A 1N0UA 3Q8XB 1VJCA 1WZEA 1P7WA 4Q3CA 1CJMA 4UDYX 3S28A 2IFTA 3MW8A 5LCXA 3B6JA 1P73A 2JATA 4N1AA 2OHHA 3AVPA 4F21A 3KPVA 1VMIA 4OXKA 4PZ0A 3WY9A 3CR3C 2CB0A 1NIJA 3R40A 5KMGA 5I45A 3PB3A 2QAJA 3GXOA 4FYIA 3S2YA 4DGQA 1MGOA 3A9CA 4G4SO 1PFUA 4C7MA 3H97A 1J8DA 5CT6A 3GJ4A 5FJJA 4LJRA 4MTLA 3K1AA 2HGSA 2Q0SA 2YC2C 3KVOA 3OQVA 2I4MA 2JA2A 5CIQA 4KMSA 3EBPA 4DW8A 4BKQA 4PO8A 1QONA 5DSZA 5GZ1A 4MB0A 3GIWA 2OO5A 3E05A 1FTYA 4I08A 4MEBA 1XMVA 2XTNA 1KA9H 3BCSA 1G3UA 3TW0A 2H7YA 1OH8A 2IU4A 2JIBA 3F5FA 2VHCA 3F1LA 3Q6MA 4GI2A 3K1JA 4L75A 3MG9A 5TEVA 2ZWIA 3X1MA 4E08A 2AHOA 5M34A 2GCOA 2I6UA 4F4FA 3KSAC 1A9XB 4CEHA 1NF2A 2C4UA 3G8AA 3M6VA 3JPYA 5EWJA 4BO7A 2R0QC 2VJNA 3DMGA 3IQEA 3IE2A 2XWPA 4FD3A 4RLFA 4BLSA 1DUVG 1VCNA 2ENUA 4LCEA 3SKYA 3SJBA 2B6NA 4LYFA 4D9HA 1WE2A 4ZVOA 2OC4A 1MDFA 2CD7A 3TVTA 3OOSA 1ZOPA 4PLWA 1TMGE 2FFHA 2CUTA 2JRCA 1JP7A 3PICA 3RF7A 3PSHA 5E7QA 4XVUA 2VDRB 5KQSA 3EQ6A 4I4TA 4QQ8A 3JVVA 1QRUA 1NURA 4CWAA 2Z3ZA 2O8CB 3VAYA 4EW6A 4P35A 1JFTA 3UGJA 1VG0B 1HRKA 4RVFA 2QPOA 2LXNA 4G5GA 1CR1A 4HQ0A 3MJDA 2GAIA 1DL5A 2A2ZA 3KHUA 1KFEB 5CGZA 3KWFA 1S2LA 4RM2A 1EVYA 1GVNB 1ILEA 3NTVA 3WKEA 2AHRA 2HWXA 2L42A 2FFBA 3AUAA 3S68A 1G59A 2ECFA 1C7QA 2VSFA 3PCXA 1JR3E 3BWVA 4NHEA 5HWSA 4GXNA 4ESOA 2F7SA 5E95A 2EIXA 4P1ZA 4EATA 1PRYA 1PWHA 3PHGA 1M1UA 7REQB 5EI5A 3CLTC 4V24A 4D4IA 5C8DA 1XTQA 3QJGA 2VOEA 4KDCA 5PGMA 1DC4A 1M8KA 3EOZA 5EKUA 3G7UA 1XEWY 1SULA 5BORA 4CM6A 1W87A 1FTSA 1WD5A 1PT6A 1YHNA 4J76A 3KDPA 2DUNA 2NZ8A 5ALVA 2QZ4A 1QIFA 2VNIA 1E61A 1I6WA 3A6LA 3NAQA 4IDFA 4RPJA 4ZTBA 4D4GA 1NY6A 3N7UA 1R18A 2JHGA 1GNSA 1V11B 2OGWA 3N7TA 4ENVA 4L4ZA 4HGNA 3SJZA 2NSLA 4HH0A 3LGXA 1XNGA 1TAQA 5ETJA 3TH5A 3PWTA 4F2DA 3BUSA 4M87A 4EHDA 3FGPA 4OX9Y 3EC2A 1E8DA 4X54A 3A2LA 1MAAA 5K20A 3ZTYA 1Z6PA 1USWA 2EKLA 3ZY4A 1H0HA 2EEPA 2IE0A 2PZ8A 3ADBA 3EPKA 3IVRA 4KIWA 4QC2A 1QO7A 3LUFA 2IOFK 2GDJA 1JR3D 4B09A 2XT6A 2R60A 3IMFA 4LQCA 4EUFA 4HUJA 2Q0HA 2PMDA 4YXWD 4D25A 3BFKA 3CNOA 1CCWA 1QCYA 3BDIA 3VKGA 4URVR 1U8CB 4FYWA 2BKLA 1RXUA 1GNTA 1CLEA 2ZI3A 4KSCA 1P81A 1QTNA 3CZ5A 4NXMB 4AIIA 4RS4A 1W48A 3KVNA 5IC5A 4AS1A 3HLTA 3CEAA 4AUNA 2R4UA 3DVQX 4D3SA 4O4LA 1GG5A 4EL5A 1TJYA 4JC5A 4WX2B 4I5IA 4KXUA 4JKOA 1L7OA 4ZMRA 4GMKA 3D5QA 5LB4A 4DXDA 3ZBUA 4V1CI 2PSSA 3LPAA 1NMXA 3KQMA 5LYYA 3OT1A 3R0IA 2YINC 3ETHA 4UHJA 1DCMA 4ARSA 5JAIA 4OHOA 2I4RA 4S24A 3SBXA 4OLAA 1Z17A 1ZMRA 2RAPA 4GZLA 4TUYF 4YAOA 1H23A 5EQTA 5SZKB 3OLCX 2GKOA 5A9SA 5K01A 3WV4A 3KO8A 2GD6A 4KWIA 3DVRX 1N7JA 1ZNXA 1IWBB 1OXUA 1C3OB 1ZHFA 3PU6A 4C0BA 1NKVA 3QA3E 4OQYA 3SSMA 2Y1CA 4DCOA 1CUSA 1UJ2A 2HQOA 3JAWB 5HR5A 2PS1A 1DEKA 4XLLA 2UYGA 3AC0A 4YIKA 4X65B 4NI5A 1GPJA 3KE9A 3QX9A 1YDMA 1AUPA 1WXGA 2EP7A 4UBJA 1HTWA 2REBA 1P0MA 3HUDA 1PG2A 2CL6X 1ECCA 2FUG6 2JPDA 1NRWA 2G72A 4FI3F 4ROSA 4U7JA 1ZMOA 2ZJOA 4EECA 3HO1A 4Y2RA 1KJJA 3QF4B 4N54A 3RVLA 1FLNA 1NUHA 4PRYA 3FVWA 3PDCA 1Q21A 4PN3A 1NLYA 3ILXA 1UBSB 2KQUA 2AN1A 2R79A 1Y6ZA 4O3FA 5EUQB 2NU8B 3E18A 3OQIB 3EQZA 3W6ZA 1LVGA 2ZI4A 4KE7A 3E9EA 3FYDA 1ZJ5A 3D6FA 4REOA 2GF0A 3RVJA 3RADC 1Z4KA 5KYUA 2ODEA 1VFPA 3UPDA 1ODTC 1TTPB 4J1TC 1T2FA 5J5VA 1RI5A 3VKFA 4QASA 5LZ9A 4DC0A 2XMBA 4NAUA 1JT9A 1M6VA 3PPIA 3DLHA 1Z56C 3ZK9A 3Q3EA 3GAMA 3QVTA 2FQYA 2QY6A 4ML3A 4QPPA 1GL6A 2GPYA 3VH3A 3U3ZA 1BROA 1B74A 1X7DA 3QG5A 1J42A 3SLRA 2XZOA 1JHZA 2FB9A 2I6QA 3FYUC 3LLUA 4B4DA 1V35A 5JH7B 3EZFA 3NOXA 2M2IA 4OAPA 5T67A 4QL3A 2HXGA 3LHSA 4DE5A 4NK4A 1CZOA 1WHSA 4FFBB 4NCHA 3K0KA 4U9HS 4QECA 3EHDA 4CMAA 4W9MC 2ORYA 2GJ8A 3AR9A 1U8YA 1UBHS 2P2YA 4A8HA 4G0OA 2WUFA 5JNTA 3SVTA 1XTZA 2ZREA 3B48A 3UMYA 1RXSA 3FM9A 2COKA 1RWXA 4PC6A 3HBFA 3G17A 1CZNA 4BNDB 3K0SA 2Q4EA 4XASA 4MW9A 4LHWA 3X0DA 4CQJA 3GRAA 1JIIA 2JGAA 3QYPA 3LY9A 1HM5A 1FFYA 1BU8A 5JBQA 4OHWA 5CW1A 1OI3A 3L7LA 1FEZA 4ISCA 3PEFA 4L0MA 1CQJA 1R74A 4G1MB 4HAYA 2QQEA 4F8YA 1NXTA 4TL6A 5AVRA 3IP6A 2W6NA 5FLEX 2BGWA 4FZ5A 8ADHA 2Z6AA 3SR0A 5BSFA 4LISA 4QU9A 5J5AA 5BOVA 3TZQA 3KT0A 3LOQA 2CXQA 2RGWA 2I2AA 1QRTA 2A9PA 3LSYA 5THKA 5LA6B 1YS7A 3TE6A 5ALWA 3HEBA 1SXHA 2I4OA 5EUCA 3A6KA 4KAFA 4LF7B 1ZRNA 3CEHA 5LOVA 4BC1A 3O1IC 3T5TA 4RH0A 1EJBA 4Z7NB 3VJRA 4O2AB 1LKZA 5HDBB 2R5NA 3CF6R 3QVXA 4KGXA 2EDAA 2P0AA 1NL3A 1FOEB 3LLCA 4E5DA 2A9VA 3NANA 3QVGB 4YH1A 3HFRA 4L5JA 4CKZA 1GUDA 5FFFA 3FGNA 1DZ3A 5TNXA 3HVRA 1M9NA 3F6EX 2XAUA 1U7TA 4B6JA 1UXHA 3ZLVA 1YL7A 4ZIRA 1GO2A 1KY2A 1OFTA 3A1FA 5LPNA 2H5LA 3SG0A 2ADOA 4FNOA 2I4TA 3CM0A 1EJ2A 1QVAA 5D86A 3EVFA 3C7CB 3JSXA 4JR1A 1KQOA 1X9IA 1ZPDA 2GBLA 4RSHA 2W6ZA 1YRYE 1XQWA 4RZHA 4Q9LA 3P2EA 1T43A 1IG3A 2J5RA 3SFZA 2XB9A 3U1TA 1IH8A 1KSFX 1O6ZA 2ZYVX 3UENA 1L9XA 1UJNA 1BJTA 3IBCA 3I9FA 4GR4A 1N2EA 2BM1A 2PIAA 1R6TA 1ZFNA 4QWWA 4W8HA 3AM4A 3JV7A 2F8TA 1CYEA 3ZUPA 4WINA 3X1XA 1U3UA 4WCFB 3GRRA 1C7JA 3LRTA 3QJYA 1C1XB 3BK1A 4DDKA 1LWOA 4HEA1 4DCGA 2Q4RA 4RF5A 3FNGA 1WLYA 121PA 3PFKA 1NXOA 3GJQA 2OO5C 4J91A 1OLOA 5AKHA 4H60A 2P6RA 1G3IA 1VP3A 4V0RA 3UMGA 2GZMA 4KKXB 2R97A 3V42A 4R2KA 3Q7EA 1OFGA 2VG8A 4WXYB 3CX6A 4B0PA 4HAOA 3TZCA 4OD0A 1SXQA 3KKEA 2P9GA 1BO6A 1C30A 2VO1A 1R9MA 4QUGA 4RVGA 4U7TB 4UVEA 5ES4B 1YNSA 1GGMA 4CF5A 4EJSA 1HFKA 3UMJA 2D2FA 3WYAA 3HJRA 1Q74A 3EWAA 2VF5X 1FDWA 2R47A 3AB8A 3DYBA 1M2VB 1JGTA 2F4NA 1M2FA 2OZLA 4HLQB 2OM6A 5GIPE 1AJEA 5BSGA 2ZAGA 1U3TA 2WWWA 4IS2A 4C14A 1GAQA 2I0FA 3PD7A 1YZGA 3CZQA 1H2XA 4PHCA 3ZXIA 2AD5A 1I1NA 1VBKA 5IBRA 5ICFA 3LT4A 3V1KA 3TCXB 4ZAVA 5IDXA 4R3WA 3GAZA 3T7CA 1SKYE 5CYGA 3MD9A 4XWWA 3ER8A 1Q7TA 1ULTA 1YL5A 1YKSA 4PIVA 2R4TA 3R23A 4QXRA 1KDRA 1AQNA 4CIBA 2J3MA 2V6GA 3H4IA 4U7DA 3P0JA 1T9AA 4BP9A 2QUAA 1OPXA 4PQYA 2AC7A 2IHBA 3UMVA 2X7XA 2XDQB 2CLHB 1NN5A 5LXTF 3NYWA 3DPUA 1IIRA 3E0XA 3SI7A 2C29D 1J1ZA 2CCGA 3I45A 2O2IA 3D1LA 3PVSA 5CT4A 3ZH9B 4RLHA 2YTZA 3OIVA 4J29A 3F74A 4B80A 4FDMA 3KQNA 3KJHA 5LN1A 1E5DA 4BMDA 5ALFA 3ZCSA 1CJCA 4EGFA 5ITWA 3N59A 5B3KA 4MLZA 4ZZ1A 3OCXA 1E69A 4MB6A 3L02A 4IH9A 2J59A 2B8NA 4TM7A 1VBMA 4XI9A 1JEQA 3R0JA 1BAPA 1TM5E 1ORTA 1UM8A 2ZSFA 5DGHA 5ESRA 1IY2A 1EK1A 4TRNA 1KVTA 2HZ7A 2HV9A 1BGXT 3IPRA 2QKYA 4BQQA 1T2UA 3NKVA 3RK0A 1RQLA 1I7QB 1FL9A 3EZLA 4IHJF 4DCJA 4LCJA 4EY7A 4WLFA 3KJEA 5IXJA 3VNBA 3DR5A 3O8LA 1FP1D 2BFFB 2EU8A 5FNVF 1NXPA 3PXXA 1I10A 1XCGB 4OGLA 1LPNA 3VSCA 5MN5A 3ROZA 2PZJA 2Z2XA 1Y1SA 2G0AA 3IBTA 2AS0A 1PZHA 1JA9A 2RK4A 3KTDA 4YRKA 1SOVA 4H18A 4PGGA 1ZIPA 5E6UB 1NUUA 2PLFA 3ZYZA 2NO9A 1D03A 2V6MA 5M7EA 1ECJA 4W9NA 4WNIA 1T9DA 3TXAA 4KQKA 5DXAA 4HDSB 1X7WA 3KTAB 1M5UA 1E2BA 2WYIA 2PUTA 3P96A 4HQRA 4L8VA 1AGNA 1IN8A 3E5RA 4IUYA 1PV1A 1KE1A 5BV2P 2JLYA 3DFMA 1CQPA 1XELA 2X15A 3U7JA 1UXKA 2IS6A 1QP8A 2B4TO 2W6JD 4HDCA 3HVHA 5HCUA 3QWIA 4EF6A 4CKWA 5IM4F 2Y0CA 2FSIA 3FSEA 4JX8A 3SQOA 3UAWA 1U4OA 1ZC3A 1YUNA 2P78A 4WNAB 4DLPA 3DM9B 1JSLA 1AA9A 3SC2B 3M83A 1L4LA 3L4JA 2O5EA 1I6MA 3V97A 1SUFA 1RYZA 3LTNC 4RF3A 2GRUA 4NOJA 5IXSA 1PR9A 4DJFC 1C3JA 3MIZA 3SYMA 1I5EA 1CIPA 2KW5A 3D59A 4C08A 3U9LA 3OZUA 4J03A 1PJCA 1E0SA 2F90A 1MU0A 2W2OA 2JA1A 3AL2A 3CISA 4N5DA 4WN3A 1T8WA 5JG7A 4JQZA 3K94A 3V6MA 4C3VA 1KEWA 1CEYA 2VUUA 3VVLA 3HB1A 3QF7A 4V02A 5T3YA 3QE0A 3DNMA 2WK1A 4MULA 4EEZA 4K05A 3N2IA 4HWOA 4JJAA 1LC0A 4L0CA 2HADA 1X8LA 2XMRA 4ZVLA 4HY3A 1R0XA 4LDNA 1E66A 3TX2A 2LR0A 3SJAA 1VMKA 1KIFA 2GN8A 3BH0A 4QDJA 1DBQA 2NG1A 3NJ4A 1LNQA 1W49A 4U0JA 5KVSA 1Y9JA 4A0QA 1JTVA 1CFJA 2QV0A 5GY7A 1UZLA 2FG6C 4XD7A 5FP0A 4F91B 3V4ZA 1SHUX 3KJFA 4NMXB 4OHXA 5I9IA 4WT7A 1A50B 4G0QA 1DELA 4A0FA 4CQMB 1JDBC 2CD9A 5FBRB 5BR4A 5A6VA 3BE4A 4Y1GA 1DOZA 4Q19A 4NFHA 4HQLA 1Z62A 4JVOA 3BF8A 2X0IA 4NK5A 5JQWA 3UWKA 3AXTA 1G60A 3RC3A 3X2EA 4ZGBA 3KSZO 4P33A 3INNA 3ZVMA 5ALQA 1VG8A 3H5RA 1HZJA 4EVSA 1KFKB 3PNKA 5ICGA 1TKCA 3PNBA 2JK1A 1PX2A 2BIFA 1L5OA 2HMWA 2QLJA 4XYGA 1Z75A 4Y2VA 4O59O 2ZUDA 2B9VA 4PX3A 3JYHA 4CM4B 1EA5A 3P45A 3W5DA 4FS3A 3OUUA 4IHJB 3FVQA 3GFSA 4L07A 1RC8A 5CT9A 1G21E 1OLXB 4R1NA 3A1DA 1XRRA 1NNEA 3MJCA 2FE1A 3D1JA 3AHFA 5FA6A 1ZZEA 2HLHA 4A5SA 4PYIA 2EKBA 2FGKA 1FZQA 1XA3A 3H1FA 4I81A 4Q1VA 4EFKA 3QU5A 2NU7B 2E82A 2OCXA 4GMXA 5JALA 1E0DA 1QC5B 1AMNA 1B42A 3HZHA 1M2KA 1UWCA 2H18A 2O59A 4U4AA 5A5VA 3W2HA 3D54D 3LUJA 2G82A 1JRLA 2W90A 5CNIA 4BZQA 3PLAE 3GH3A 4L72A 1W4BA 4TWZA 3C2QA 3UQYS 1QKIA 3HYRA 3IUSA 5CURA 2NV0A 1ZZGA 2OGTA 3AXSA 1OX6A 2JFVA 4R2IA 3HP4A 1PDVA 5A6SA 2WM2A 3FI0A 2I9KA 3S5JA 4XLZA 1KMNA 2B2XA 4EKEA 1YBHA 2KI5A 4F9EA 2BD0A 1M34B 1D4ZA 1T6XA 3L7NA 4NJEA 4BLWA 4YPFA 3MN1A 4RMIA 1E2EA 4A26A 2C2YA 3TJRA 2ZSEA 4F96A 4QBTA 2OBLA 1XRJA 3AFMA 2IDJA 4FDUA 4UBKA 4HEHA 3WLJA 3TQCA 1ZVQA 2CNKA 2CFOA 2J46A 3OZXA 2AEJA 4JEIA 2QIPA 1VFNA 3VPCA 1NDHA 1ISHA 1N5KA 4MLCA 1JPJA 2XW6A 3SIWA 2Q1UA 3UGQA 2YJ5A 4S35A 3FG9A 3NEAA 3P9KA 4R40A 4B7UA 3BIJA 3BMOA 3GC6A 1G98A 2GBLC 4GE3A 3T1QA 2B2CA 3VU9A 4BVKA 5A3RA 1V8BA 2Z6VA 2A3NA 3MCAA 4OHMA 1KO7A 1V7ZA 1FXWA 4UM9D 4EJ6A 3L8EA 3TRFA 4DC9A 1UQRA 1E2UA 5FKJA 3H5TA 1V37A 1ZD2P 2ECPA 4ZAXA 4WSOA 4O2RA 1P0IA 1CQWA 5C7IO 1C9MA 5TIIA 1WPXA 5D6OA 4CIYA 3UV7A 1YDFA 2EERA 3O8NA 1E3DA 4MVJF 3PYLA 4TN5A 3C5HA 4GPD1 4XWGA 4PYRA 3UCXA 2E37A 2PBFA 4ZYWA 4XPIA 4MQFA 1MLDA 2X5KO 4WASA 2VDJA 1DAMA 2G9RA 4B7XA 2XB6A 4B32A 1QF9A 1U3CA 2QRGA 1CY7A 1TCVA 2MIIA 4LMAA 1HETA 2VDOB 1C9JA 3MBKA 4DUGA 2EHDA 2NV6A 2ZJFA 3L7CA 4HB3A 3TR0A 5DNVA 5L6LB 4LE0A 1DU4A 1IPHA 1YJBA 2D1YA 4YWHA 1BGWA 4RSGA 4UDXX 1WUIS 3LQ1A 5ED0A 4CDRA 5EQFA 3T15A 3W5AA 2AE2A 5B1DA 1SG6A 4JI6B 4EJSC 1SHJA 2GBFA 1S2GA 2VH2A 3IO5A 2NTJA 3AW9A 2R1TA 3G23A 3RFTA 3SYNA 4CMEA 1VHLA 1TTTA 2EC5A 3EXEB 2OZKA 3MMXA 5EIBC 3R76A 4XYLA 2JGFA 1LSSA 2D7CA 4KODA 1J2EA 1KKUA 1BVYF 3RC8A 4W5NA 1BTOA 4WA7A 5IF9A 4NAVA 3DO5A 1YQEA 4BOYA 4UBIA 3SC4A 3AR7A 2I29A 4CV2A 4AY4A 5KQRA 4G9BA 5F23A 3HKBA 1J0XO 5A1JA 2IOFA 3C7DB 2AR0A 3CZCA 4O8ZA 4KIGA 2P2DA 3VVMA 8ATCA 1MO3A 3A7DA 5HUJA 1C3XA 3GP8A 3DZFA 5F2NA 1CP3A 1QE5A 3RIHA 1KMIY 3T0GA 3OLZA 5IJ9A 3DMTA 2OP0A 3SK0A 1A4XA 3Q3VA 4RETA 4ND8A 1GKIA 1NATA 1SY7A 2YBEA 4LTMA 3ZWBA 1EVIA 3P2JA 3DBVO 3OPNA 4ZYXA 2HPVA 3FF1A 5AHRA 4QSMA 3F78A 2NW6A 3F3MA 3EQ8A 2X23A 1UPAA 4INOA 3AR8A 3QFSA 4HCJA 2RIPA 4A0GA 4I46A 3KEOA 5M29A 1BXGA 1SU7A 4WLVA 5ALNA 2DLDA 2IWRA 1BCSA 3GQBA 2XMPA 3KM0A 5ALGA 4MWCA 4CT4B 4FDLA 1DDIA 3TRDA 2HK9A 2LE0A 4F12A 4DXHA 1JJAA 1KZ4A 1G21A 2I7TA 2AMLA 1BE1A 1U8XX 4KHZA 3HCOA 4GYYA 4XLTA 3OM9A 2HU5A 2X5JO 3AFGA 3HVIA 4JODA 4BFUA 4RTSA 1RQ7A 2C7RA 1AH2A 4S2EA 4W1PA 4S1TA 1C14A 2PPVA 4NVRA 1CUIA 2DPYA 2FZ4A 3O4JA 1RFGE 2Y1LA 1IDOA 1P2BA 1NI5A 1REQB 2ETVA 1S4MA 1T9HA 4GNRA 3SQNA 2PVCA 3W90A 2IV7A 1S01A 2Z2IA 4GVXA 4HL6A 5ESWA 5DN9A 4LK3A 3W5VA 3NBMA 2DF8A 3FPKA 3KIPA 3PE3A 3SX2A 3KSRA 1HZZA 1VL0A 5BN4B 1P0CA 1KI2A 3WWCA 4ZVMA 3SQLA 1T13A 3FOZA 3ZHYA 1AS0A 2ZYIA 1V26A 2VF7A 3MYRA 3DF7A 4HAXA 5B1HA 4C0AC 1EE2A 3QXSA 2XQVA 2PPLA 3JS5A 4RV9A 3AMVA 3N6RA 2ZYTX 1OZFA 3HJCA 4EY5A 4UOZA 5FH9A 2DSTA 4W9NC 3PD0A 2OB1A 3LP5A 3PC8A 3SOZA 5L95A 4OHBA 2ODTX 3N5CA 1Q6YA 3D6TB 3ILSA 1Q0UA 3QEBZ 5DNCA 1JAZA 3F9RA 1P91A 5CNKA 2W4QA 5BRAA 5K0SA 4IIFA 4GZMA 3RRZA 3R7DA 4Q3AA 4JLNA 4TYYA 1BDJA 5CBKA 2Z0MA 3GY0A 4BNKA 4ZAYA 4PU0A 2Q50A 3DTVD 3FKJA 3N5KA 4FX2A 4ZD6A 3WGHA 4DZZA 4PW0A 4NESA 3DD5A 5EY5B 3UT5B 3V1NA 3LK7A 1KPIA 5INTA 4UHBA 3GELA 3PGKA 4D8WA 4CXMA 3H19A 4KLCA 3S70A 3DE7X 1SUAA 2GK7A 2HHCA 4CL3A 5HJ7A 3KJQA 2C5EA 3WQSB 2WG2A 1XMOB 4MMZB 3RHTA 2GGSA 2CHQA 2H4WA 2G25A 3I61A 4II7A 5T4EA 2QRKA 2B35A 2GWHA 2WTXA 2ZSAA 3MSXA 2WM3A 3VHLB 4X3PA 1BMQA 4EPRA 3OJEA 1KH3A 4L5CA 5CVJA 3I1FA 4AY3A 1UMCB 2PX4A 1V95A 3JQ7B 4JYBA 4AYWA 1J5EB 2XH8A 5LZ4A 1K89A 1NLMA 2VR1A 5G4KA 1Z2CA 1JB1A 1R10A 1Z22A 2AMVA 1Z0UA 3AUTA 3PG5A 4FMCB 1L5LA 4OXNA 2BF4A 4RHCA 3VU3A 2J33A 1YOBA 4NV1A 3T41A 4CT0A 2JL1A 4V0SA 2WP0A 2YFKA 3B1JA 3TJMA 2EFDB 3UM9A 2R3SA 4KK4A 2IIBA 3NDJA 5EZYA 5EJ4A 2EBUA 3A04A 2AKAB 4KDEA 5E6RA 2IH2A 5AM3A 1P8JA 1Y5LA 3ED5A 3OWOA 3BAFA 1HKUA 3QP9A 1VCHA 4YBZA 3VR3D 4BFCA 2P40A 3ZIDA 1MDBA 4Y2SA 3STWA 2WLSA 3EXG2 5CFZA 3BMCA 4KQ6A 5BQPA 2NSYA 3HBJA 3F7MA 4PLHA 1XDDA 2W98A 1OOEA 4H7PA 4MARA 2OQ2A 3ETCA 1ZJZA 4BATA 4BFVA 4Y2HA 1VZ3A 3C3EA 2HSDA 1MH9A 2F67A 1XU7A 3WLFA 2QTRA 3KEFA 4Q66C 3BVPA 2ZB2A 2O2YA 1VG9B 4OLFA 1YIDA 3GG2A 4X95A 1B8PA 4QT4A 3L4EA 3E03A 1G0NA 1ZKDA 1N8NA 4C7BA 2D5BA 1QP4A 2GETA 3JD2A 5FBHA 5B4UA 5B1EA 1UXIA 5K3DA 3LUDA 3CYFA 3P2MA 3T5BA 1AF7A 4HXGA 2E4WA 1C4WA 3M9XA 2QYSA 2YWEA 4OMCA 3SNKA 3OOHA 3KKLA 3ZY5A 5KYYA 2YWJA 2VYND 2YJ6A 2BTQA 3G49A 1WW3A 1KEEB 1SKUA 2CL7X 3M4JA 4K6OA 5AM0A 1MO4A 5TRTA 3SF0A 4MUXA 5EINA 1R8SA 2FR0A 4G0VA 4COKA 2QRMA 1BN7A 2RBGA 3N53A 1FU7A 3AG5A 1W6RA 4G8BA 4ZRDA 4GM0A 2H4YA 4XW2A 1U3VA 1RYFA 3IFSA 4DLAA 2PCLA 3MERA 3S7ZA 4ZT2A 3GLGA 4UAGA 4CV0A 1P5ZB 3CLRC 2OE2A 2MCFA 5ULLA 2H9AA 5HZMA 1CZKA 2WC1A 2H07A 3OY2A 4YUVA 4R1MA 1CJUC 1N0VC 4RQTA 5EWMA 5BN5B 2HJSA 4PIMA 4JASB 3SSNA 1MGPA 2F9LA 4PLFA 4UJ3A 3KOZA 1F2DA 4ICIA 4TQUS 1Z74A 4R81A 4HAWA 3ANLA 1G20E 1D2EA 3ONFA 4P3YA 5E2IA 3K53A 3V4PB 1HQYE 4GOJA 2O7RA 3R7AA 3N0WA 2QQ0A 4UNSA 4MV0A 3BD7A 2JDID 3P9ZA 4B76A 4EO7A 1P1CA 3NBXX 2Y67A 1KFBB 4H0CA 1II8B 3AR2A 2ZVDA 1ZOOA 2AFRA 2VRCA 2ATCA 1H9CA 3E58A 1AM4D 2IGBA 4E6EA 2ZRDA 1PK8A 1FVHA 3BWCA 1F1JA 1M6HA 4IFIA 4AS2A 3BH6A 3GJXC 4UNNA 1LI7A 5K3CA 8ABPA 2A58A 3FDXA 2XEXA 1IPEA 5K3BA 1B6TA 1BKSB 4IS3A 2C4MA 5FL3A 4P54A 2D0DA 1DDOA 3S6JA 4AMYA 4DPKA 3AUKA 4HD8A 4OY3A 4JBXA 1EUDB 4Y1RB 2QZJA 4IJVA 3WLKX 1PYOA 1XHEA 3GFRA 4EKNB 4EVRA 1LLUA 5B36A 1WU8A 3FOAA 4UOQA 4ZVSA 4WGFA 3AQ4A 4EM6A 5SZHB 1T0PA 1D2AA 2DU8A 3FWZA 5BW4A 2H5JA 1EFRA 2ZTVA 1B8OA 4ZQFA 1QPGA 3PE6A 3ON5A 4MRSA 3WMFA 2D5CA 4QIHA 4II2A 4J0KA 1JEDA 3P0HA 4R7GA 1QQBA 2WJ4A 3ED1A 2FOLA 5TY0A