1SQ0A

Crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
DFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Von Willebrand factor (vWF) [Contains: Von Willebrand antige
total genus 72
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1sq0A00
3PPVA 1JEQB 1YVPA 2ADFA 1QC5B 3GXBA 4WJKB 3EGDB 3TXAA 1JLMA 4WK2B 2WW8A 4BJ3A 1M2VB 1DZIA 1MF7A 4IHKA 2IUEA 1U0OC 2VC2B 1QCYA 3BN3A 1JEYB 4WFQA 5KYUB 2VDMB 4Z7NB 2ODPA 1JEQA 1TYEB 1PD0A 1FNSA 2VDNB 3EGDA 3NIDB 3K6SA 1OAKA 4C2AA 1T6BY 1M2VA 2ICAA 4HQFA 2I91A 2VDKB 4IGIA 1AUQA 4MMYB 1MQAA 4G1EB 2VDLB 3ZE2B 5KYWB 4HQOA 1JEYA 4UM9B 3NIFB 5KYUA 3K71B 3PPYA 4HQLA 3HXOA 3BQNB 1CQPA 3F74A 2NUTB 2I6SA 3T3PB 1AOXA 2WINI 3K6SB 3F78A 1MHPA 3EH2A 1YVRA 2XWBF 2QTVA 1JV2B 2XGGA 2M32A 3N2NA 4WK4B 3IJEB 4JDUA 5KYWA 5E6SB 1MJNA 5KYYA 3ZE0B 1L5GB 4CN9A 4UM9D 5KYNA 1PD1A 3HXQA 3VI3B 1M1XB 1AO3A 4XW2A 5HJ2A 1PCXA 2NUTA 2XWJI 4HQNA 2O7NA 4NENA 4F1JA 1BHO1 1NA5A 4G1MB 4HQKA 5E6UB 3ZDXB 5E6SA 2NUPA 4MMZB 5LN1A 1DGQA 5KYYB 1ZONA 4FX5A 3T3MB 4Z7OB 5E6RB 3NIGB 3QA3E 3FCUB 1V7PC 4Z7QB 3HI6A 4UM8B 3FCSB 4IXDA 4NENB 1M2OA 1IDN1 1N9ZA 3E2MA 5HDBB 5E6UA 2NUPB 3VI4B 3EOAI 1LFAA 5E6RA 2VDOB 1U8CB 1RD4A 1SQ0A 4F1KA 4PN7A 4O02B 2VDRB 5HGJA 1T0PA 4M76B 3EGXA 3PPXA 4CNBA 3TW0A 1FE8A 3PPWA 3M6FA 4A0QA 1MQ9A 2VDQB 3ZE1B 3EG9A 5KYXA 3TCXB 1MQ8B 2ODQA 1N3YA 4CN8A 3EOBI 1RTKA 1XDGA 1SHTX 1ZOOA 2B2XA 1M1UA 1IJKA 3ZDYB 4C29A 1ATZA 4NEHB 1XUOA 3V4VB 3BQMB 3EH1A 3EGXB 3ZQKA 1U0NA 2X5NA 3EFOB 3K72B 3RAGA 4DMUB 5BV8A 1ZOPA 1M10A 5KYXB 3EG9B 1IJBA 2I6QA 1Q0PA 1SHUX 3TVYA 1CK4A 1QC5A 1RS0A 1UEXC 3V4PB 3ZDZB 4WK0B 1PT6A 1XDDA 1BHQ1 3EFOA 3Q3GE 1IDOA 4MMXB 5ES4B 4C2BA 1RRKA 2NVOA 3IBSA 2VDPB
chains in the Genus database with same CATH superfamily
3PPVA 2RI1A 3ROXA 1X80A 3RIHA 1QOQB 3RO7A 1YBVA 4GZ3A 2OV6A 2ZJBA 3TXAA 4YJ2A 1L5HB 4XPIB 2PVCA 2R68A 1SXJA 2PY6A 4HX9A 2ZI6A 5TRTA 5F23A 4FYHA 9LDBA 3BTVA 1ZRNA 2OCIA 1GPNA 1EK6A 4KGVA 2JFUA 4YVFA 4N9WA 2C07A 2AUMA 2GPSA 4RPHA 3EUAA 4D9EA 4UFPA 1Q7TA 1JSCA 1WDMA 2I2AA 6LDHA 3UPUA 2VHZA 2R4TA 2QN7A 1Y5MA 2C8JA 3AGQA 1EFPA 4K0RA 4E2YA 1O9BA 5ENDA 4K7JA 2EF0A 3UJ8A 4EQ6B 3LOQA 4PQEA 2FW8A 2Z1MA 3M82A 1Z4KA 1YQDA 2H4FA 1U3CA 3COSA 3CSSA 3QKRA 5E38A 3EDYA 3WGIA 3BULA 5DNEA 3NVKI 4TTVA 4I4TF 1GV0A 1HDYA 3EMVA 4QDKA 1YR1A 3FB1A 2ALJA 2NUTB 1PYGA 3FYUB 1YRAA 1M7GA 1O08A 4HB0A 1NI5A 5DBEX 4NICA 1TT7A 1UC8A 1V48A 2ZR9A 4LCEA 2UXCB 1RI5A 3S27A 4A26A 3VJLA 4J1SA 2CN1A 2CHQA 1E18A 3E3MA 3EARA 5KX5A 2QL6A 1VJCA 1FFDA 5BV0A 4H7PA 1O5OA 3HVUA 3GPIA 3QYAA 2V7BA 3JQAD 3AY3A 5ADUS 5EZYA 2QSJA 1U0RA 3AY6A 1AH2A 2LW7A 2W6PA 3LXMA 5TARA 2YY7A 1U0FA 4JC0A 2XOXA 1XYYA 2R6HA 3A3NA 2CJFA 4PX9A 5CT5A 2BFAA 3ANLA 1IBLB 4ZYUA 1NP6A 1M2EA 1NX9A 1T1SA 2PUJA 3DBHB 3IJ5A 2H1CA 3L7MA 3PD1A 3PLRA 4XYMA 4DTIA 1P91A 1NUSA 2A5LA 1W9MA 1ZIYA 1N9ZA 2Z2XA 3GGJA 1P3DA 4WOCA 4FEEA 5T4FA 4DZRA 5IKPA 3RBXA 3KJZA 4NF2A 1QZUA 1PJ2A 1X0VA 2J30A 2PXCA 4EW3A 1SR8A 2YJ6A 3OU2A 3LHSA 2RCNA 3U4DA 3HB5X 1TM2A 1QS0A 4REQA 1KMMA 3CH6A 4HO1X 3DZJA 3TR0A 5LP6F 1GQFA 4DGQA 1IM8A 2G9ZA 1J2RA 4OX9Y 1U7DA 1S2IA 3PC3A 5AVKA 4HMOA 3A1FA 2CUKA 4X1OA 2FR8A 4ARZB 3U6KA 1WSDA 3I37X 2NU8A 1AGNA 3U7EB 4NX2A 4E30A 5MN5A 1GY8A 1Z26A 2VJYA 3GAAA 2G9QA 3GFOA 4N65A 4S24A 3SJUA 1M1UA 2BR5A 3ET4A 1T1JA 4UQLA 1MTOA 1U1IA 2CHEA 3A2MA 1QKIA 1APBA 3K1ZA 1VHQA 1EK1A 2B25A 2ZUBA 2VNJA 1JFSA 4J9VA 1U8AA 2WWTA 2IU3A 3OLCX 1UQUA 3PVCA 3LPDA 5BV1A 3FTPA 1JILA 2NZYA 3CUYA 4J1TA 3ODPA 4ZJUA 4BVHA 2RONA 5FLKA 5CX1A 3STHA 4GOXA 4MR9A 1XJQA 3KAQA 1NF8A 4JSRA 4WXRA 1GRVA 2EZ4A 2XDQB 4QYIA 4OLAA 4TMWA 4D3YA 4QU5A 3MTBA 2WUEA 2QZZA 5FPTA 3V2HA 3ZWWA 2PGJA 1ECBA 4UTOA 2VPWA 4GM1A 2C29D 2Z43A 3VNQA 3OQHA 1AXGA 3B2QA 4W9MC 4E3ZA 4CT0A 1SVKA 5IAGA 1PVOA 2D1RA 4X45A 4ZVLA 5KVQA 2WTBA 3QVUA 3W04A 4GR4A 2XJ4A 5J4HA 2Z58A 3IT3A 4BNJA 1DXYA 4OA5A 3P0RA 4PVCA 3U3RA 1D9ZA 1HQYE 3W9BA 4UNPA 3FFBA 3HCWA 5ITZA 3L5OA 5E9QA 3AVWA 3RODA 3USES 5SYAA 3OCVA 5F1YA 1ZK2A 3I61A 4QBGB 1MKYA 1P44A 1BE8A 1RMQA 1UMDB 1Z6TA 3I2IA 4AVYA 4W6QA 2IXEA 5JRZA 3H0EA 4YQZA 1PNVA 1KSGA 2CNOA 3THWA 4EHHA 4L8LA 5JATA 4MRPA 3ISJA 4DWWA 5B57C 2GF9A 3DGFC 1RXVA 5ALQA 3STWA 1JHUA 3L4JA 4K8OA 4MAFA 2DSNA 3NTQA 1AS3A 2EIHA 3L7NA 2WABA 4IHJF 4MPJA 1NUTA 4YGYA 2PXHA 5HTKA 5ALSA 8GPBA 3RWBA 3P19A 2WVHA 4Y9UA 1XKQA 1U2QA 2FWNA 2A1TR 3O4RA 4KJZA 3EVBA 1VRVA 3INGA 1WE2A 1Z68A 3IDFA 3IOYA 4IOJA 5HQJA 3M6MD 4JLSA 3GJYA 2B1QA 4I6JA 1H65A 2H2DA 4HDNA 1B74A 4GI2A 1GARA 5DNVA 3KSDO 3QRWA 4AL4A 2QORA 4RNCA 4CIDA 1QV9A 3JQRA 1HG1A 3O21A 4ECEA 1QS0B 4Q4JA 3TZKA 1L0BA 1LBHA 3HBNA 3EXAA 1M2GA 5AW9A 5JSHA 1WKVA 2GAIA 3EIOA 3FNRA 3OM9A 5SICE 1QQAA 3GK3A 3H86A 1G3UA 4GQAA 2VCYA 2JJ1A 1GGVA 3MJHA 3RYIA 3WZLA 4HGQA 2ID4A 4R1LA 1NY6A 1WR8A 4KRXA 2HLDD 4A2CA 2GDJA 4GP7A 1MPXA 1KEVA 3DEZA 4FMDF 3RSGA 1M54A 2PSEA 3X2SA 1IRIA 5HDQA 2JGAA 2F4NA 4LQCA 3KZNA 4QBIA 5JALA 1DDGA 2XWQA 4JXKA 4NATA 4Q1DA 3WGZA 4D8WA 4DG8A 5BN3B 1G5PA 3U16A 2FPIB 2VWPA 1DINA 1OBHA 2OG2A 1EFCA 4GGOA 2CDNA 4R54A 4KZKA 3FTEA 1Y1QA 2YVQA 2R8BA 4GE3A 2AKEA 5DHAA 1Q0QA 3IESA 4UE2A 2IE0A 2PGDA 2ZW9A 3ECAA 2FYTA 3NCHA 1AV6A 1HF3A 1EDEA 3H11A 3R1IA 4IQ4A 2W70A 3DOCA 5K4HA 2Q7DA 4IIJB 2PL3A 4M99A 1X9IA 5HQ3A 3P0JA 1GT91 3C48A 4KSBA 3RV3A 2W6NA 1AJEA 5IJAA 3J7AC 1T5SA 3NYRA 4EUSA 1E9AA 2O0LA 4R8MA 1OYYA 4HWOA 2ODTX 2WJ4A 4S04A 1GTL1 2QRVA 3UK2A 2XUGA 3UTDA 3GCXA 4LI3X 2VPYA 3V8VA 4EEKA 5FWYA 4J1NA 2G06A 4LCJA 3UJ3X 1XD9A 2PSDA 1E1NA 1XBTA 2BP7B 2XQFA 3K15A 1QKJA 5GPBA 2NIPA 1HOXA 4MA5A 2JLSA 1J8DA 1KFKB 1N2SA 1PT5A 1PS8A 1R5OA 1U4NA 1VLHA 2A92A 1AQIA 2JFFA 4JENA 4OFZA 4HDMA 5E2AA 5FUBA 1GSAA 3SQXA 1NT2A 4EX7A 4KGDA 3FUUA 1MFPA 5GIOE 3TZQA 4M87A 4C4AA 1RYYA 1SG6A 4QTTB 3QVSA 5AVRA 2OZPA 5M5BA 1DRKA 3ZG6A 4WHMA 1NRWA 1FQOA 1AUQA 1OWOA 2OK8A 3TS1A 4UTPA 1U9IA 3FG9A 5GJCA 1JVNA 4Z9BA 4QDTA 3HFSA 1XTKA 2HF7A 1MIHA 2QTNA 3LTEA 3TH5A 3VO2A 5EP2A 2CLFB 1B0ZA 2BPOA 2RH9B 5A0VA 4C21A 1NHGA 3DV2A 3R0ZA 2XWBF 1I6KA 1B14A 1I4OA 1S9DA 4PTZA 4B4KA 3D1VA 5AVJA 5AKZA 2BT4A 3SNKA 1U90A 2QLBA 1I5EA 4HUQB 8AT1A 4HLUA 2OBFA 3SJ7A 1YCFA 5DTJA 1N33B 2C9MA 2GZMA 2CWDA 3RABA 2BDTA 3FBGA 3KB6A 5F12A 3TIFA 4ZYZA 1OLUB 2PKYX 2E48A 3MPUA 1JZSA 2GR9A 3NB0A 2H59A 2FU5C 1E5LA 4MRNA 3Q1KA 2NO0A 2HOQA 1A8SA 1TYBE 4KWEA 4B3CA 3HJGA 3VPDA 3GNSA 3GOQA 4BDSA 2XF8A 3SS8A 3FNHA 1YS9A 5F76A 2Q3HA 1BVRA 4I14A 3O1HB 2BF7A 4YCDA 4W9NC 1XJCA 4LHXA 3PFKA 5CJPA 1Q22A 2ASEA 2PX3A 4MVJH 2FSIA 4QPPA 5CDFA 5BXYA 3SDZA 1BEZA 4QVGA 5T4BA 3GPDG 3OF5A 1KY4A 4LJ6A 4B3XA 5K6AC 3M1AA 4D9NA 4DSAA 3LNTA 1E7RA 4S2UA 1JVSA 2F3QA 4PBTA 1K08A 1JF8A 2VUIB 1QH0A 4Q37A 3A2KA 4G4SO 1G6Q1 5BWLA 5L51A 3OKFA 2OFWA 3CO5A 1VIMA 4KTTE 4MHTA 2QG6A 5G4LA 1V7ZA 2RKOA 4AB1A 3VHXB 4FPXA 1RWVA 1ZM2A 4HR7A 4FGLA 2J31A 2B3DA 3NHKA 5DNWA 3FVQA 1HFWA 1TA4A 4UOQA 5EQJB 4IJUA 5EPOA 1Y4ZA 4IIJA 1V8ZA 1R6BX 2FQQA 4FHDA 3DDCA 4HBZA 3UXHA 3QPBA 2QPLA 6NULA 2W43A 1O58A 3W6ZA 2Q46A 4J7XA 2HA3A 1VKNA 1IUPA 3OSUA 4KK3A 3CA8A 4G4IA 4BFSA 1Z15A 3DD5A 3P71T 1P73A 3RAGA 4TUYF 3IFSA 1Z0AA 3W7AA 2Z8ZA 1QGUA 2HQBA 1JYFA 2WKQA 1UKAA 4HYTA 5DVZA 2Q9UA 1SCIA 2REBA 1S9HA 4F72A 2P9HA 1FNDA 1I3LA 2MYUA 3LU1A 1EQAA 3V33A 3X1ZA 2BZ0A 3WC4A 1DAEA 1EBBA 1NVAA 1WMBA 1GP2A 4R0NA 5F33A 1E2MA 2FE4A 3M49A 1EFUA 3U4GA 3KS9A 1KAHA 4Y7CA 3V8BA 1TK9A 4BLOA 1WG8A 2BUAA 3FWKA 1I24A 2C4NA 3H9BA 1HDCA 5AXBA 4IZHA 1WD5A 3KQQA 3T94A 5I4KA 1W36D 1KQNA 3A1TA 3GFPA 3C3EA 3Q2IA 4X93A 2XGOA 1NUHA 4TTSA 3ZDDA 4DMFA 1EFTA 1JJIA 1NN1A 3EZ9A 4P3YA 3E9QA 3CNBA 4K8RB 4F4UA 4ARBA 4BMSA 2B8NA 1NJSA 1N6OA 4V38A 4RGVA 4DDUA 2FSFA 1GNTA 2JH9A 5C8YB 1MO2A 5LA6B 1I6WA 2ZBQA 3CJRA 4L51A 1GPWB 1U6IA 2C9OA 2ZJFA 1E9SA 1MDBA 3KUKA 4FNOA 4JI0B 3NONA 1X7GA 4EY5A 1BRMA 5KVSA 4GGPA 2BCGY 5FB3A 1SK9A 2Z57A 4FQ5A 1JYEA 2YHAA 4KW7A 4NJMA 1V4BA 5SY4A 2F4VB 2EKQA 4OG2A 5FTKA 4H7HA 2I1QA 4R9SA 2IX9A 3MWGA 4RQUA 2DHQA 4B81A 1XQXA 1DFGA 3HCRA 1R4ZA 1Z35A 2WP8J 3IUSA 3W8RA 5DGTA 2QQGA 4N3GA 5F2KA 3F73A 2EJVA 3O84A 4M8IA 2YN2A 5K8LA 4M36A 4CG1A 1YSCA 3OE7D 1T0BA 3ZOKA 1VJRA 5BVHA 1HWYA 2K6GA 1E5TA 3M33A 4I4NA 4CKEB 2NSHA 4AS1A 3ZNQA 1HQDA 3BEDA 4OJKA 3CLVA 4UM7A 4ALLA 4TN5A 3PQFA 3TTSA 2PBZA 3VBCA 2I3BA 3ICEA 3TIIA 4ZTBA 3U5TA 2XVAA 2AS0A 1MRNA 3AHGA 4MV0A 5SV2A 3GRZA 3LBNA 1A1VA 4GPTA 1KO1A 1XNHA 2ZRJA 4TS9A 4ZZ3A 5CDUA 4YECA 3ZCUA 4ZKDA 2QYTA 2DR2A 521PA 3KSUA 3ROEA 1C30A 3KOMA 1TLTA 3GEEA 2VXOA 3RU9A 3SHQA 1QVVA 1UP7A 1DHRA 1OZHA 2Z9DA 1L5MA 1OC2A 3FYHA 1W87A 2BZGA 3HU5A 2WF6A 5JQGA 3AH8A 2V1UA 3V00A 4OJQA 1M6VA 3I5MA 4FMDB 4LRQA 2ENWA 3ZI0A 4B3DA 1UC5B 1T5TA 1EVIA 4BIIA 3T8YA 4IVQA 4D02A 4MQEA 1XCLA 3RC7A 1N5OX 2AI2A 2BVNA 3VUFA 1SVIA 1YR6A 5ED0A 2ACVA 4C89A 4ARAA 1ZUHA 2VO1A 4GF5A 1J9ZA 3OETA 3QEOA 1D5WA 1HDEA 4EI8A 5A04A 1NBWB 5EIOA 4ZODA 1KVRA 3SF0A 1N6LA 2QPOA 2WWXA 5IT5A 5T3YA 1U0EA 4BQIA 7YASA 1ZJWA 4KPGA 2VRWA 3OJOA 5IVHA 3QVGA 1W88A 4PYKA 1VI2A 4Z54A 1MJHA 1XNGA 3URMA 1B8VA 1IZ8A 2WYOA 4GKVA 3V7YA 3R23A 3PQCA 4IILA 3V2IA 4NCJA 2OHIA 2AMLA 4TV8A 4CL3A 2QIPA 1WX1A 5M7EA 3MS4A 3KD2A 1K5PA 1F3LA 3ACBA 1OBCA 2ATIA 2NU6B 2XYPA 4JUDX 4OD0A 1D1SA 4X6LA 1PG2A 5HK8A 4D7AA 4TVSA 4JXZA 2VH1A 4UHBA 5JD4A 1IQ0A 1S2DA 4B3IA 4Q39A 4Q02A 3DC2A 4AO8A 2ZRFA 2IZ5A 2CLLB 3KYDA 2VN8A 1BOOA 1M2KA 1T9AA 3D3KA 3T9FA 1VL6A 2ODPA 3ZIAD 4ZTUB 2GZ3A 1H0SA 2ZBRA 3AGPA 3F6PA 3DL4A 2OC4A 1XQVA 3C2QA 3KJIA 4R4JA 5IEBA 3T7RA 3DT6A 3SIRA 1EJ0A 2XCOA 1SU8A 1W48A 4IDHA 1I2MA 4XI9A 1AZWA 3NVDA 5LD2B 1X1DA 4ANFA 4EF5A 5H9VA 1KVQA 2K7FA 1JEYA 1C7RA 1ML3A 4WADA 1Q84A 1LPNA 1D3AA 1VA5A 3MVEA 4K2AA 1X6VA 4LMBA 3P0IA 4M0LA 4QX6A 5T64A 2XEDA 3BRCA 1CY0A 1BHSA 3HR7A 4BLUA 5C8VA 1A3CA 1FDIA 2FMTA 1PV1A 1E94E 1DTEA 4WCDA 3TRKA 4M22A 1R9MA 4IGKA 4KAXA 3HC7A 4CKEA 4YRIA 2NO9A 4AZ3A 2HXGA 2C2XA 4ZDWA 1GXSB 1SCQA 1NW7A 3GBVA 3UT0A 3E0QA 3GEBA 1NYRA 3QLUA 4OB7A 2WR8A 5DE3A 1CR6A 3LUDA 3OT1B 4B7CA 5JISA 1UP4A 3AB7A 4C14A 1SHLA 4ZIRA 1ND6A 3U1VA 2EATA 4PG4A 4URVR 2PX5A 3B1ZA 1OFVA 5K3AA 5T8KC 2ORWA 3NC4A 4KFRA 1N7GA 4TZTA 3MB8A 3VVBA 4IIVA 4EB3A 4IDBA 2WA2A 2R7NA 3E03A 4F92B 1Z4NA 1I3CA 3PRHA 3QWAA 2VKTA 4RH3A 4EWLA 5IAEA 1FPMA 5K0CA 4N47A 5FQNA 2Y1WA 3TTYA 3OZEA 4PFKA 1T10A 1P4HA 3WHLA 4AJHA 3DEAA 4CDRA 1GZ5A 4FDVA 4XDHA 3O8LA 2HREA 1NV9A 4CKCB 3ZTWA 3TNJA 2GJSA 4PPNA 5H81A 2XVMA 4FE7A 4QOGA 1BJKA 3NDIA 4GT1A 3ICOA 3M70A 3DEKA 4UW9A 2RDMA 2JBAB 2X0KA 1ZL2A 3QPDA 2H1LA 3T7TA 2HLPA 3L6BA 1QO0D 3CH5A 4OM8A 2JDID 4RA6A 5BQPA 5G53C 1RYHA 3OY2A 1KAEA 4LS3A 1MX1A 3HCOA 3K9GA 5ED4A 4FHGA 1QIEA 1T34A 2C8LA 3Q8LA 3QKTA 1QVZA 2R4QA 1F48A 2X8BA 4NFLA 4ZPJA 3AVQA 8MHTA 3L7IA 4EVSA 4QM7A 3A8TA 2CNWA 2D5BA 1RRPA 1RRFA 3KPVA 3KR0A 4FVTA 1DE0A 4MROA 5KYXB 4BLSA 1ZDMA 2QN8A 3OE4A 3LQ4A 3RC9A 1SXIA 4N8EA 4WFIA 1B8UA 3HVIA 2RGXA 5BN4B 2WBLC 2XKBA 4O29A 1GUBA 4KQHA 4LXUA 5CVDA 4M83A 5JWHA 4IOMA 4BV8A 1YTUA 1BXRB 3R0JA 4ZDKA 2P3SA 1EGVB 4K88A 2NADA 4B6QA 2YXEA 4HLQB 1I4EB 4OSPA 4WKOA 3R7AA 2QU8A 5AP9A 4ZWNA 4BEWA 1A5BB 1V16A 3UWMA 5JI3E 2E1PA 3Q3EA 2UVDA 2ZRGA 2M6LA 3EWNA 2GZSA 1TCVA 3RIXA 3RROA 3VO1A 4K9DA 3VR5H 3LL4A 2GN0A 3RT1A 2W2TA 3KWLA 3GP3A 4TWBA 1O95C 2PCLA 4CODB 4ZU1X 4BGUA 1UBUS 3MOGA 3DP9A 2REQB 3H2YA 4C2UA 2WAXA 3VC7A 4HDAA 4DLXA 3ICPA 2VDMB 4H1UA 5CPBA 2I4NA 1TFUA 3ZVNA 4OI0A 1NT4A 1GA1A 1OFTA 3RWMB 3A1VA 2NZ8A 3CUTA 1R18A 5CVVA 3D8TA 1BFUA 1A77A 2PFSA 4PWZA 4Z0HO 5GOTA 4MVJM 1GXSA 2HA2A 3TMYA 1FP4A 3FPHA 4RHXA 3H99A 4KXWA 3OT1A 5EXPA 4GQIA 4J1QA 1CUDA 1KKLA 2IHBA 4F9EA 1M6EX 2FFBA 2V7GA 4X8OA 5LDDC 1VDZA 1SQ5A 4Q4DA 3UTCA 2FG6C 2FGJA 2K2QB 2QX9A 1YFLA 2RI0A 4NWIA 4B46A 2YKGA 3WG9A 3VJMA 1VB3A 3E9CA 3QSYA 2QIOA 1UKCA 2JLRA 4HMPA 2WSBA 1RTTA 4ZO7A 4RY8A 3L40A 2GYWA 4FOSA 1LPAB 3KU1A 3ORHA 4GBGA 3CJTA 1GTG1 4ZQGA 1PSWA 4D4JA 4M0FA 3WMWA 1NSFA 3BF7A 2JEZA 4LYDA 1RHMA 4JP5A 4OGKA 1PWYE 3PHJA 1JDZA 4UZEA 1TAGA 5UKDA 1ESNA 1G7SA 1SC1A 3FCYA 5KYYB 3PEUA 4UEJA 1A7KA 2PO7A 3DZIA 3G68A 1JJFA 1JHPA 5M3BA 2H7CA 3PQ6A 4NTZA 3ZDRA 4DIMA 5CXXA 5LP6C 4WY8A 2BR4A 4O4JF 1SZJG 2FSPA 3CB2A 4LZLA 3PXXA 3U1TA 3UMCA 4C0LA 3HK2A 3GF4A 3GJSA 3T06B 3EEFA 2MDTA 1E92A 4YK7A 3C6MA 1PX0A 4R68A 1EBUA 1N6PA 1ZJ5A 3ZHVA 4C22A 5KC9A 3OD5A 4DB2A 3FSGD 5A4KA 3MYRA 3KQMA 4EGAA 3PCXA 4TYYA 3CLKA 2HRCA 2JLAA 5EAIA 1RCUA 1E60A 3O8QB 4QUGA 1J2EA 5CLGA 5JXWA 3DDSA 2QP3A 3ILSA 4C05A 1E2PA 3HU1A 4FD3A 1BX3A 2JKZA 5BYBA 3PEWA 4CG2A 2J9ZB 4QOFA 4KB5A 2FKAA 5FWXB 3WL3A 1PBNA 3M3DA 1NBOA 3B3GA 4LMAA 1Z82A 3AP2A 5GONA 1BXRA 1KOGA 1CS0B 1XUOA 2MWMA 1G6OA 1YUBA 2PR7A 2VYNA 1W0CA 2OGSA 2Y2UA 3EGXB 3ABZA 4OFBA 4XYLA 2CFTA 3SXJA 4V1CA 4R98A 2ZSAA 5KKNB 1FBTA 1HT1E 3NHJA 4UBJA 1DC8A 3D3WB 2G5CA 5KTYA 3RS0A 1QM5A 1GJRA 4G5RA 4FDTA 1ECPA 1AA9A 5CK4A 5I3CA 2J6BA 2BKXA 2R6ZA 2MJLA 2SHKA 5ER6A 2BYTA 1FXWA 2QX6A 3FAKA 4HRXA 3R8CA 2P9GA 2FCAA 5DHPA 4ZJPA 4AC9A 2IL1A 4JR0A 1JDJA 2P4HX 5JZSA 4H3VA 4UD2A 1PR0A 4DREA 1Z7BA 4JMPA 3AM5A 1PK8A 1EVYA 2CDAA 3P0EA 2R79A 3EPJA 3TZHA 4MW0A 1SU6A 4NJEB 2AK2A 1D5CA 4BB6A 3I2YX 4GEKA 2YV4A 4AKGA 2PQMA 1E20A 3DV0A 3HXLA 5JNTA 3KLMX 5CEEA 2D0DA 1RXYA 5JHHB 1E0DA 1VHTA 3BD9A 3O2QB 3T52A 5B7NA 1QTRA 4QHTA 4UXHA 4Y7DA 1TEVA 5F3WB 3RFVA 5BNIA 2BMDA 1IHUA 3A4IA 3E9EA 3FLAA 4R1SA 4MYTA 3RSQA 4C0HA 1GAXA 2EXXA 2YOGA 4NU6A 4DJEC 1L8LA 2GZHA 4ZGBA 5JAPA 1CJSA 1NRJB 5LXTB 3DZKA 1P62B 4DV0B 1HTWA 3RAFC 3PFBA 5KYWB 2J6IA 1M67A 2R4UA 2YYAA 2PAFA 5FOUA 2O2ZA 1N34B 1JALA 2GKGA 3UUGA 4TLDA 1C29B 1QXSA 3ORRA 3Q11A 1XTUA 4YFVA 3V4OA 2QYHA 3EPHA 4GOJA 1CLUA 2YICA 3LFUA 1VLLA 1JPUA 3ZTTA 1VLJA 1PNQA 2OE2A 4W5HA 3ZPXA 2X22A 3L18A 1OV6A 5IVKA 1UBLS 4MJLA 4Q3NA 5I9SA 1NM5A 5ALVA 1S8NA 2HEIA 5CU7A 1OOEA 4IMRA 2CSXA 1K8QA 3L7DA 3RCBA 2FF7A 4UBNA 1YJCA 1M7BA 1NVEA 2WE8A 4BV3A 2IUYA 2YOHA 3EK2A 5EGNA 1QRUA 2VJCA 1J0DA 2B69A 3CGWA 4OKIA 4HUJA 3Q7PA 2XE4A 3I28A 4IUYA 3A4YA 4IH4A 5DBGA 4OQXA 2YC2C 1QHIA 2QTMA 3NUGA 4Q24A 4QJ5A 2ZETA 2YWXA 2V7WA 1XVLA 1HUQA 3UV6A 1XKLA 2M6RA 3LC2O 4G3XA 5B1YA 4B4UA 2ADOA 3DJYA 3O83A 3RJ5A 4KNYA 3SQWA 4WOJA 1U2PA 3FMFA 2NTNA 1F3OA 2Q3EA 2HU2A 3CF6R 3GGPA 4JL6A 3HFJA 5LQCA 5FUXA 5JSQA 1C0LA 1DC7A 2JCGA 3UIEA 4ZAZA 2IDMA 3SHFA 3N0WA 3ZCQA 5BUSA 5JAOA 3MJTA 1OFUA 3O8QA 1GZ4A 4IVRA 3ZN2A 1G3QA 1JQBA 1E8MA 4PZLA 2UZIR 4FGSA 4NCHA 2P7HA 1F1BA 1PV2A 5FNZA 4TLAA 4YAOA 5IP5A 4KFCA 1Q0ZA 3WWPA 3DVAA 4P0PB 2X4GA 1TE2A 4AZSA 3DF7A 3H9QA 3JTEA 5LNK6 3IE0A 1CW2B 4RGBA 2WKWA 3U9SA 4F46A 1ZWLA 4O63O 1J8VA 3EGXA 3K09C 2NUAB 3ROMA 3SIXA 3UMBA 2OKGA 1WZIA 4OXRA 5A3JA 2HU8A 1UBMS 3BXZA 5BP7A 3OMLA 5CIYA 3RTDA 2H4JA 2WPDA 1DJOA 1EUDB 1ONSA 1GKLA 2BN4A 2MU1A 1YWGO 2QZPA 3D5QA 2H63A 4POAA 1L4HA 5T6MA 3ZKWB 4F84A 3VJKA 1PYOA 1EG2A 1Z13A 2GJKA 4PGHA 1KEZA 3WS7A 5DN6D 1ULUA 2WAMA 3JZAA 3OZSA 4AYXA 4CMHA 3GQVA 2DSTA 3BX1A 3PQ5A 1RAFA 4RD4A 4JI5B 3PP8A 3HBAA 2RHDA 3T5PA 1N9GB 1FYXA 2PWZA 2DQSA 3A9UA 4U7PB 5IN5A 4LY9A 1W52X 2XEXA 2D4HA 1YNSA 4P2BA 1OYOA 1UK8A 3QPWA 2CLDX 3W8DA 1W1WA 1DQYA 2FDCA 1N77A 4FGZA 2C9DA 2PTHA 3DOUA 1VJ1A 3FLMA 3GMSA 3KQYA 3BB4A 1U8ZA 3QVXA 4FMPA 1A27A 1AZTA 2GCNA 2Q4TA 3IVCA 4QIHA 4IDPA 3ZXSA 5LQDA 4MA4A 2H0RA 2VQ3A 2WUFA 4V0MA 3X44A 1D07A 3Q5DA 4IIYA 2AWNA 5HHTA 4DA6A 1HX7A 2ZUEA 4MJ3A 2JD0A 3L3BA 2JDIA 5DHUA 1DC3A 4QGHA 4ZXFA 3VGPA 3P2YA 1PFWA 4DMKA 3JD3A 5KTKA 1OYWA 1WY7A 4GOLD 2JVJA 2YJNA 3RE1A 1H8HD 5JT1A 1EK2A 4AJOA 4ZEMA 1TM3E 4NU5A 3O47A 3VZQA 3CVVA 3QMWA 4RFSB 3W7BA 1GZUA 2G1JA 4CMBA 2BL4A 2O07A 3HBJA 1TJ4A 1XVUA 3CC8A 1J0EA 4HGPA 4KRYA 3SZMA 3UGJA 4GWKA 1TLLA 4CKXA 1E4VA 2C3PA 2JFXA 5JYDA 4K6FA 3CBGA 5AM1A 5JBNA 4ATNA 3OQOA 2NSLA 1P39A 3DTYA 3DE5X 3H6KA 4E32A 2KPOA 2F62A 3ROKA 1TUBB 1JIKA 3DYVA 5C3UA 2WWVD 2RK6A 4LZJA 4WEQA 4NMLA 2YDYA 5E8RA 2WJ6A 4NV3A 4BEJA 1J8QA 1MJFA 4CQMB 4KVZA 4LPSA 3O0DA 3H42B 5L3QA 3OTGA 3MCZA 3IAHA 4HQ6A 4KXFB 3EDOA 4TTRA 1HYEA 4KQCA 4LYGA 1LJUA 4MVJP 1EUCB 2PUWA 1P61B 3NFYA 4MLPA 5AHOA 4PYRA 2GM4A 1MC8A 4WLEA 3GI1A 4DDTA 2NV2B 3FVVA 4I1PA 2H4HA 4LV8B 3T7IA 5LNK1 4RTQA 2ACEA 4PHTA 2WWHA 2TECE 5YASA 2I3AA 2NTVA 3W5HA 2ZIFA 3QEBZ 1PS9A 5GZ3A 3D6UA 5EERA 3UK7A 3EQ7A 5THQA 1XCBA 3DVAB 2JFZA 5FLXA 4LIPD 4IOLA 2FOIA 1KI6A 2CK3D 4LDNA 4DEYA 2PRSA 3LXRA 4WKCA 3LD9A 1LH0A 4IFEA 2NUAA 3UHFA 4RD1A 3TX2A 1TIKA 2J09A 3FPSA 1C9YA 1Z7GA 3DXYA 3I32A 3VI4B 5EHXA 3OZUA 3OM8A 1GR1A 1FNMA 2Y99A 2AHRA 2OCPA 4ZVUA 5B7GA 4JEIA 1WF6A 4QDXA 4BLQA 1M34A 1ADBA 5K4AA 1YBMA 3HJUA 5KYVA 3G3EA 2IS2A 1PGJA 2QTGA 3AKZA 1NBHA 1Z5VA 4F3YA 2PR2A 4QO7A 4M7WA 5A7HA 3L05A 5IASA 5L4LA 3CSDA 2OBLA 5IXSA 1N9GA 1KYYA 2E18A 2FPPB 4E7PA 3DMDA 3HP4A 4KQ6A 2QMUA 4Y0VA 4TMKA 4ZV9A 1OKKD 1W25A 2NSYA 621PA 5KJEA 1GPAA 4QDUA 3M1YA 2FEMA 1A2BA 1G9TA 1J8FA 1X94A 4FILA 3Q3IA 4MQ4A 4X62B 3Q98A 2AGVA 3GGOA 5AW4A 4QL3A 1KERA 3WJ7A 1A96A 1K9VF 1ZAKA 2O0HA 2ZXEA 3CRW1 3CW2A 1FTNA 1C7EA 4J7AA 1O6CA 3EZLA 5EZSA 2LP4Y 3CY6A 3HB7A 2A14A 3NNDA 5LOVF 1ZNYA 2YIJA 1XA0A 2HMSA 2YYZA 5KCZA 1W75A 3V8RA 1O89A 1G291 2ZSHA 3NBAA 4DJ5X 2QHXA 3HR8A 5H16A 1S7GA 3T5DA 3T3IA 3VR6D 1U5CA 5BPFA 2MR5A 1E8DA 3T4EA 2XCRB 2LNDA 1KU6A 3PWSA 4IUBS 2QOEA 3ENKA 2HO5A 5EQFA 2DPMA 2Y76A 4W1QA 5EEGA 5BURA 1N6KA 1GN8A 2C4MA 2PBLA 2XD9A 4DPLA 3QMPA 3U09A 5IU6A 2KLBA 1DG1G 3PQ2A 5ESRA 5F7XA 4HS4A 2ZSBA 1TA9A 4JJ8A 1Z45A 3N07A 3X1JA 4ZCIA 3IL2A 2CFIA 4XLZA 5EI5A 1KH2A 3ZU6A 1N9KA 4QGBA 4S2EA 2OCKA 4YP1A 2OYRA 4R2MA 3UNXA 3GLHB 3OHSX 4I1SA 1T9GS 1VLVA 5TPZD 5EXDA 4UUNA 1FP7A 2E4UA 5IUJC 3ZWBA 1HYQA 1DOHA 2Q9BA 2C00A 2C20A 3ZQJA 4L8GA 1EVKA 1GUFA 1MH9A 1MENA 2A67A 3VSBA 5KOHA 1W5FA 4XA8A 4DLAA 3DMHA 2Q3DA 3EW7A 5CVUA 2EX1A 3BXEA 3OJLA 1KU0A 2OZEA 2AFIE 2IZ0A 3KQUA 1DWUA 3I9FA 2TRSB 4CN9A 4FFRA 4K05A 3IEUA 3CPSA 2RHOA 3KZXA 4XTRA 3KWJA 4ZQCB 5A3SA 4BVEA 2I8AA 1U3TA 1KI6B 1TU3A 3A1SA 2J5QA 1W19A 2ZZKA 1Z7EA 2Q5LA 3BGSA 1U4OA 1BKSB 1QQ6A 3NIBA 3ZDXB 1OWPA 2LIVA 4O5OA 2UXDB 3JVUA 2VYFA 5IN4A 3BWXA 3B2NA 3H5WA 1IUOA 1U6JA 1YOBA 2OORC 3BH6A 3QXJA 3WHKA 3WMRA 3OEEA 3EIFA 4G1VA 1M34B 2PKQP 1Q12A 1G5RA 2OGZA 4OKNA 4Y1GA 4EX6A 1MHTA 1ZK0A 3DUWA 2H8GA 3N7UA 3AI1A 2F43A 4J0CA 1UOPA 3U4AA 1P2BA 2VEDA 4B76A 1PJAA 1YFZA 1YS2X 5A2QA 2D2XA 3EEOA 3W7VA 2KBFA 3JVEA 5K0SA 1PR4A 1SD5A 4LOLA 4AJJA 1UKZA 2FPPA 1ADGA 3JAKB 5LDHA 4GNRA 1OXSC 4J0KA 3I1IA 1SXJD 3S3TA 1MZVA 1URPA 3DBRB 5K0NA 3I3SR 1J07A 1Z0ZA 3UN1A 2YJ3A 2JLYA 4N5NA 4X7BA 1FE8A 3RSFA 5H9WA 1LKZA 1A9RA 3E82A 4MW1A 2P0EA 5HPYB 2PMDA 4QPZA 5FUWA 1UIMA 3P2OA 4V0KA 3QFSA 3LQKA 2YIMA 2CF6A 3I9NA 3VH4A 4I8XA 1HT3A 4FLFA 3BL8A 1J5XA 3EGCA 5E0KB 3K0FB 5J2UA 3BRWA 2ZLBA 2NU7B 3C6YA 2A84A 3W8EA 3WLRA 2Q6VA 3IT0A 2GRAA 3D64A 4QBKA 4F71A 4MVJF 4H9GA 4R7GA 3ZLBA 4GVLA 1QYDA 3QBTA 1Z4PX 3V6LA 1PFKA 1FLAA 2RHHA 3KEQA 2E89A 3A06A 4RJJA 2Q5FA 4EUFA 3CEPB 5FLYA 3SC6A 3MBIA 1YVPA 3CLUC 1XN1A 2FX2A 2VHYA 4I81A 1LPOA 3GVIA 5ESWA 3C3PA 1FFGA 2JGDB 4J75A 3P32A 1WHTA 1ZGAA 4TL9A 4BLWA 5CT6A 1M0SA 1H2ZA 3PFHA 3B9PA 3WLLA 5IK2D 1C3XA 4H6VA 2R1TB 5AKJA 1FUIA 1OXVA 1USKA 3IPRA 1O0CA 1OAOC 4IIJF 4IEIA 1NLZA 1PJQA 1RDFA 2VLBA 2X1MA 1JJVA 4B6SA 5IDQA 1C3LA 2YFQA 4RW0A 8OHMA 1NYQA 1ZKDA 2C59A 2JRCA 3AEZA 3H5OA 2O8EA 4R31A 3WX0A 1OAAA 2VUSA 4U5QA 3MWLA 1M33A 1EBFA 4TMYA 4BO4A 4DLNA 1XYVA 1QG4A 1X3LA 3PUYA 1Q20A 1TJ3A 3EEQA 1P45A 2RB5A 1XDSA 2CXUA 3QUBA 1ZJJA 3D5EA 3WDMA 2JA1A 2XRYA 2Z5GA 3E15A 4AJIA 3EMKA 4MLCA 2QJOA 1BDMA 1IAQA 3RFCA 3GRPA 4U63A 3WGLA 4KX5A 4QC2A 4CIWA 4KWIA 4YJGA 2RFLA 1ZMOA 3QP9A 5B4TA 1TM5E 2ID7A 3TRIA 4MR8B 3RVMA 2DFPA 2LR0A 1QRSA 1NSYA 5D6NA 2NG1A 4I5IA 1Z0IA 4JELA 4UM9D 5FWDA 4D4LA 3HXQA 5FFMA 2HCRA 2NSJA 3OQPA 3HUDA 4PSKA 4U7HA 1Y81A 2N75A 4ZREA 3RWOA 4M8KA 3TRDA 2JLCA 4J49A 3VR5A 3W5IA 1GSHA 4FFBB 1JA9A 5KTMA 3ZD6A 4EPRA 1H3NA 3LYLA 4ZDJA 1EZ1A 4YP5A 4EHIA 3BJZA 4OJMX 4I9NA 5J1TB 4BQPA 1R0XA 5HKBA 1P3JA 1XVIA 2BEWB 3LHDA 4KLRA 3LGAA 1UCFA 1W47A 1Q0HA 2CDRA 3BILA 3N0TA 4HLCA 2Q0SA 4OQLA 1P9WA 2CNLA 3ICCA 4PPQA 5HXAA 1Z73A 2OO5A 3DDHA 4IXDA 5CTJA 3WNDA 4N7JA 1LTKA 2JGEA 5C81A 1GU0A 2R3SA 4F96A 3RIMA 3MS7A 3V6MA 1JXQA 1KC3A 3JQDA 3G5LA 5CDFE 3A0RB 3HA7A 1YIAA 4ER6A 2GCPA 3H7IA 1NC3A 3HUFA 3WL7A 4B85A 5COQA 4XGIA 4IF6A 2CBGA 3C85A 3MD9A 3O26A 1PWEA 2BEUB 4ZRMA 3WO0A 2RGCA 1KRWA 1PZFA 5B55A 4A0QA 2XRFA 5ADVA 3Q5EA 1XD2A 2FPKA 2L2QA 2DR3A 4M8LA 1Q6ZA 4NZMA 4CMCA 5IZCC 5D51S 1NX6A 3L01A 3COWA 1DVRA 1WV1A 1K89A 3B5JA 2GPJA 2QE7A 4RFLA 1EFLA 2VNAA 5DHSA 3BICA 3IUPA 2O3QA 2QF7A 4QOJA 2IHYA 2QZJA 3NXKA 2F2TA 1ECGA 2HM7A 2P9TA 3C16C 2BH2A 2AJBA 1VSQA 3BDAA 3F5DA 1DMSA 4G6ZA 5ALOA 1UJ4A 4QUAA 4QYTA 5J9FA 5KYKA 5H3HA 2H1IA 2FQXA 5EZQA 4H16A 3FN4A 2E85A 4JVLA 2WF5A 1BQEA 3NG1A 1L2TA 1TDJA 4BE9A 3M4NA 3Q2OA 3QKSB 3SYKA 3QXGA 1KMNA 2IP1A 3E48A 4M9SA 2I67A 4JLBA 3B1XA 2OLJA 4HZIA 4NAUA 4S1TA 5AMXA 2V0NA 2R7AA 2ZI3A 1N2GA 1NVFA 4JQCA 3ZBTA 5BN5A 1KTIA 3COZA 2QU7A 2P7IA 3D4PA 4X1YA 3U9LA 1Y7PA 3VKUA 4Y9RA 4NL4H 1RJ9A 4ZARA 2BHTA 4PG6A 4F3RA 3O94A 5GJBA 3TUJC 5IKXA 3IUNA 3GQBB 3PIIA 1G8AA 2ONKA 2R8XA 1REQB 3GA0A 2A5FA 3W3AA 4GLLA 4I4LA 4IDGA 3MF4A 4PE5B 4EPTA 5BSHA 4U7TB 5ALPA 5EJMA 3TL2A 5DISB 1E3QA 3K0CA 3QQPA 1GU1A 2HLNA 2V4ZA 3QTLA 4JBHA 1SHZA 3AL0C 4ZFNA 5A6VA 2MSKA 1T4GA 4PZAA 4X61A 3ZDEA 1Q1QA 1XALA 3WQHA 4DJFC 1C1HA 1LLQA 3RRMA 1Y9JA 5DBFA 1XKXA 2FOLA 1DKNA 4J3NA 4B3HA 3F4BA 4AAYA 5B1EA 1Y5RA 5KSZA 1A2OA 2DHCA 2QR2A 3UJDA 5FYDA 2XDYA 5G1OA 1G1MA 3VAYA 3DNPA 3H3XA 2X13A 4QQRA 1IZ9A 2FZEA 1Q1ZA 1RPZA 2EKDA 5JW6A 1X1CA 1IY8A 1YRHA 2VRCD 5SZKB 1R10A 3LHKA 3WYNA 2HA4A 4GXNA 5BSWA 1XZGA 1H6BA 4KQWA 4ILKA 4IIUA 1C0EA 2OCAA 1ENYA 2P77A 1KRHA 2DRIA 3AO0B 1P7CA 3IKMB 3NVAA 4XASA 4PNEA 2R86A 5JMTA 1JI3A 3NTRA 3AR8A 2ZKIA 1CY4A 5C1PA 3SIPA 4YLYA 5AHKA 1CZHA 4UHJA 3PI7A 2C9YA 3U7QA 3RRXA 3T1QA 5LN1A 1GTRA 1IBRA 2BGMA 2GHIA 1XFDA 2CXPA 3ESZA 3NPAA 1LDBA 1V3UA 3HKEA 1GVNB 1A9SA 1SVOA 3NIGB 3TLBA 1NVUQ 2Q0XA 2XMQA 3R7BA 4LI0A 4CUZA 4U2FA 2Q1XA 2QA5A 5CLHA 3KJNA 1H1LA 4QPJC 1SH7A 1QQBA 4EJSC 1GQQA 1U3DA 1VBMA 1WUIS 2O3JA 3Q0IA 3DNMA 1SVSA 3II6X 4UARA 4WEOA 3UYLA 4A91A 1ODKA 3CJQA 1ETUA 5KNBA 2XB9A 3DLBA 3FLEA 1I3KA 4ZQHA 3RT7A 2HMWA 5E7JA 1J7KA 1DJLA 4YRCA 3AUFA 4RF4A 1F6WA 2BMWA 3L0SA 4E3WA 3CNQS 1JHAA 4NPHA 4K9PA 1M2OB 4YX9A 4CKBB 3QITA 1JSRA 2Q1WA 4BO3A 1WNFA 4RF2A 3A70A 3GNLA 1T6XA 2ABWA 2QPTA 3NR2A 1NJFA 4AZWA 2XAUA 2VPPA 4MI3A 1L6IA 2R00C 3O8BA 4OQMA 2EBUA 5C37A 3ESYA 1I8TA 2IHNA 1MPTA 4MV3A 5JYEA 1XU4A 3QVOA 4AG6A 3ZW9A 4MHOA 3K9HA 2P2DA 4PGMA 1AGYA 3NOVA 1XMJA 4OBXA 4CLDA 1XR3A 3IE2A 5C8XA 2WM2A 1D2MA 4IDEA 2OSBA 4PNHA 5AUQA 4G4GA 2V3CC 4BUJA 4YS6A 2J59A 4ZRDA 3E27A 4WK6A 2HZ7A 2YWFA 4P3NA 4NFYA 1GTJ1 4PLCA 1K06A 1PT6A 3DMNA 4TS3A 4CFYA 4CWAA 5JG7A 5JD5A 1CEYA 3QLTA 2BFFA 4MKGA 1HOTA 4YCSA 2H9YA 3FFAA 2B21A 3C6QA 4BJHB 2X1HA 1ZCAA 1EXWA 2NTJA 3DA8A 2VYCA 4IOKA 4ZYLA 4G0VA 2ZJ2A 3V7UA 1Z0FA 3PI6A 4JY7A 1NXTA 4MVCA 1YCHA 2DXIA 3QEMA 3TBFA 4RM3A 2GAOA 2R6FA 5I9BA 3A28A 3O1IC 1WXHA 1GGFA 2RGDA 1Z5PA 5ECGC 4JA0A 3UFXA 5BWMA 2ZYGA 3H9EO 1TYEB 2YJ5A 2V3WA 2CSUA 3LL7A 2JZNA 3PS9A 1YRYE 4L73A 4MVYA 3LVFO 4XE5A 3TSWA 3VVMA 4F91B 4II7A 2ZRKA 5IT9A 5IBQA 2PV0A 3GJ7A 5JAUA 3A6HA 3PNKA 1GZVA 3BAZA 3HJRA 5DGHA 4QUDA 3DEYX 1MT3A 4TWZA 2BFEA 2W8BB 5AQ1A 2R00A 3IDAA 2NUBA 3QOYA 2P4EA 1CRQA 3KDPA 3OKAA 4I9GA 4ODIA 1YQEA 1ADFA 2M98A 3U13A 1R3UA 2XH8A 4Q5IA 4KIWA 5DIZA 4PNZA 1VSTA 2W2OA 4G5HA 1PP4A 3RGGA 2C5EA 1EFPB 4CDMA 1THGA 2BE7A 2BFNA 4BTLA 4RTLA 3FGPA 4X6UA 5EJ8A 3L93A 4OFWA 1KYTA 3PSHA 1KQ3A 1FRNA 2WU4A 4OO3A 2OYCA 1P2UA 3X1KA 1RXWA 1D0SA 3N87A 1R12A 4OYYA 1AC5A 2SICE 1S4QA 3FHLA 1NASA 2YHUA 1F60A 1EB9A 5IYZB 3WRWA 4KXXA 1FK8A 4K0KB 1LSJA 4DIKA 4MVWA 1PN3A 1DAPA 2VJPA 1UJCA 2AH5A 3EAFA 3EYWA 1T2FA 5CDTA 1FNNA 4RK1A 2YN4A 3ME5A 4MV6A 3INRA 2QN1A 1I9CA 3M2PA 4JBGA 2Q8PA 3G0HA 1MQSA 1R66A 1OB2A 1K27A 2P68A 4AJPA 4G0NA 4IF4A 5B7QA 3MRTA 2C3UA 2I4IA 1MVLA 1O54A 1ZMRA 2FZVA 3LFHA 4UTNA 1XCJA 2WJ3A 3D3JA 1H05A 3E8SA 4EZEA 3A9CA 1YQWA 5ALYA 4UAUA 1SXGA 1IMOA 1O2DA 4I4TA 1S89A 4N54A 4YUXA 5L95A 1U3WA 4IR7A 4K3VA 5KJCA 2BTEA 4RMIA 2OQVA 1RT9A 1M5RA 4CLOB 4CMGA 1VSBA 4HK4A 3H4VA 4ABYA 4YCJA 3L82B 2J41A 2VQSA 1W1IA 2XVZA 3TE7A 4CU5A 4F6RB 2DEUA 5DGCA 2GPBA 3GPBA 3NBXX 4HDOB 4TLEA 3ITDA 5A1TA 1C9NA 2CYCA 3WP1B 2BFCB 3QYPA 1P1KA 5KNCH 4O1MA 5F52A 5L53A 3GRAA 2Y68A 2D2VA 1C9MA 2OB1A 2UZAA 1ATZA 2YCLA 3K70D 1C7QA 2IKQA 1KK2A 3E22B 2Q50A 3A26A 4OQFA 4BASA 3EFOB 4KTVE 1N36B 2PGIA 3FOFC 1MJGA 3GHHA 1NVKA 2QUIA 4PRZA 1GITA 3RC8A 3JQ6A 1HDOA 2B4QA 5KIAA 3VYRB 3RUPA 3COVA 3GJTA 1DNPA 2HEGA 5KTOA 1RQLA 3AETB 4IRUB 4EFNA 2Y77A 2QY9A 4GC9A 3IAM1 3FYCA 1A8HA 1FXWF 1PKEA 3CEMA 3GFSA 4HTFA 3DXXA 3QLJA 4QPNA 1NW3A 2DBZA 4B75A 4LF8B 2FN4A 3BDVA 4HDKA 4M37A 5HIAA 1AE1A 4MI1A 3IBSA 4Y8VA 3STYA 3WV5A 3BMCA 1MLDA 3PC8C 1Q2XA 4BMNA 4CR7A 1V7QA 2WF7A 2ZSUA 3GVPA 1EMDA 4G97A 4ZOLF 3HN2A 2VRNA 4BJ3A 1M2VB 5KQSA 4S1PA 2DLCX 3LECA 4WCFC 1DUSA 5AR1A 3RIYA 4DY4A 4WECA 3SQOA 3DMGA 4QYIB 3WFZA 4BGEA 3RAEC 4AKIA 3PX7A 1E0KA 3GCWA 1KIFA 4GPIB 1OLSA 3ZJVA 3EGDA 2VPXA 3GZJA 4CGZA 4MB2A 3S2IA 2ZU0C 2UYYA 3W4IA 1JX6A 1T1GA 3MXTA 1QF6A 2CXTA 4XKJA 3TAXA 3LY8A 4JUAA 1A9XA 3OMXA 2QROA 3CCBA 1ZI9A 3B1KA 4DLYA 4UC0A 5E1MA 5AK0A 4YONB 2B92A 2AYXA 3ITKA 3ITNA 3LBAA 4NARA 3RK4A 1OXMA 1YA6A 3BMQB 1MAAA 5TC4A 3RPEA 5C53B 1JMYA 1H85A 1T9ZA 2OHVA 1A7UA 4NESA 1UMDA 1PL6A 1U2DA 4H3KB 2YC4C 4AWBA 4TV9F 2VTBA 1ISGA 4FYMA 4D0RA 4YPVA 4IBOA 4FKMA 3H4MA 2QTBA 3T3GA 4BNDA 3VH1A 4ZCQA 3ZY5A 4LYFA 3H5NA 3LX4A 3MGGA 4GDMA 5TQJA 1CRPA 2L19A 5CFNA 4KBFA 4C01A 2ZI7A 1JG7A 1M3SA 5CFOA 4ROTA 2H3EA 3K32A 4LWOA 3T5GA 4F4CA 5FOQA 1TMGE 4ONEA 1O94A 4KSCA 2QDKA 4R40A 1ZIXA 2YINC 4O2BF 1QZZA 2Q6KA 1I6MA 2VTEA 4HMQA 3S2UA 5AW8A 2RSLA 721PA 4JOSA 4M46A 4L9RA 4CTOA 3F6RA 3C5EA 1M6WA 1COWA 1RKVA 3V1UA 2QN6A 3QEJA 1N5LA 2GN9A 3O3NB 1UJMA 1O97C 4LOIA 4MP8A 3JQ7B 4WVFA 4BFCA 4LJ7A 5SY9A 4L15A 3R20A 3NM6B 3TXXA 5DYYA 3QV1A 2VYND 3B53X 3RC1A 3RYIB 3S2FA 3TCXB 5I51A 2AXNA 3ZDQA 3HUTA 5AXAA 5T3UA 2YRWA 1TOAA 3KHSA 1JIIA 3S68A 3L1UA 4I1VA 4Z9XA 5LQUA 1ZSNA 3EEYA 5FI5A 3AF6A 3AETA 1EAYA 4BMVA 1EEXB 4HTFB 1WVMA 1WUYA 1T1RA 3CX4A 3AY0A 4ZT6A 5CDSA 3HBMA 4YMVA 3EVFA 4UEKA 2EFDB 3BWBA 4ZI7F 2GT1A 2DVMA 1UDCA 1K6IA 3BTUA 1KGDA 5TY0A 1YOVA 1FLVA 2PKRA 3Q7SA 1ZK4A 2AJDA 3TR5A 3ZJ5A 4EGJA 5LMZA 4MW6A 1Z5ZA 3I62A 4H27A 2V8OA 2XNDD 3JASB 2DKNA 4HGRA 1QVAA 4UAVA 1EP3B 3SE7A 1ECLA 3OE5A 4D9FA 3H11B 2J3IA 1BROA 3L04A 2WM8A 3OIVA 4MPPA 3Q85A 1BE1A 3H5VA 4NABA 1Q1AA 3VDMA 1NVVR 4JI2B 2AA3A 1AKWA 4URUR 5CFMA 1PKXA 5KSPA 3THSA 1D2CA 1MF7A 1BGWA 2AKYA 1M2WA 4PLWA 4BZZA 5JJBA 7ABPA 5LBTA 1YMQA 3D2AA 3JZFA 3LVQE 4XFJA 3IIMA 1A9XB 3LZ6A 2EW2A 3OZIA 1K8XB 2R8PA 1D2GA 2XV1A 1X8LA 3VR4H 3LY7A 1WDTA 4F8YA 3OY7A 1HE8B 5CNJA 2D0OB 4IINA 4JVNA 4LSWA 1DBPA 4MDHA 3STVA 1U8FO 3BMQA 2Q7OE 3OQIB 5EVCA 2FUCA 4OQEA 5GZ6A 4OQQA 3ZXYA 2JAXA 5D1NA 1CE8B 5HS6A 5IZ4A 3LX6A 3MHPA 5EP1A 1U99A 2W48A 4JX9A 4Y98A 4O4HF 1L7BA 2Z6AA 5P8WA 3LGXA 4E5SA 2AG8A 4NZYA 5EKDA 2A9OA 5HQTA 5L4NA 2ZXFA 4GECA 1W5TA 3GGSA 1XC7A 2PKCA 1V37A 1IHDA 3GRCA 4UBLA 2ADMA 2B6HA 1VJTA 3IJEB 4TTJA 5EE9A 2PKQO 2GHRA 3T9DA 1F9EA 3EVGA 4EK9A 3ECSA 3TQQA 3EWAA 3A6DA 3LK7A 4JT2A 4WZZA 2WJAA 3DM9B 4LXYA 4N6GA 1M73E 3L1KA 3LWZA 4XEUA 4YEDA 2ZVQX 4UMEA 4PX2A 2J3EA 1UAYA 1W9HA 5C46F 1JA1A 1H4VB 5DYIA 4KE7A 2IY7A 2FSGA 1E7YA 1H6CA 3I8OA 1DAMA 4FT2A 4DR5B 2IA5A 3QUAA 2WM3A 4B5LA 4K9SA 3UHOA 5JNVA 1NNEA 3Q10A 3VYVA 2HY7A 4B7XA 4KPEC 4EG4A 3IOMA 4A8TA 1DJMA 1UAAA 5JARA 1UPUA 2FJUA 2JAOA 3D0KA 4TWAA 4KG7A 3TEMA 1T5LA 4DBLE 2YW2A 1LX6A 2C5HA 5KKCA 3JQ7A 1CZKA 1UZLA 3M5CA 3PJGA 1V0JA 3THYA 2E6KA 3UK1A 2I66A 5LOVB 3OZBA 2UVPA 3SKVA 2GRJA 5LR6A 4L76A 1KQOA 4O4IB 5IS2A 1W59A 3WLEA 4NNOA 4HEA6 2Q4EA 3GJ8A 2M1ZA 4H31A 4QOHA 4YLGA 4DLLA 5EMHA 4EVQA 2FDXA 3NEJA 5JVDF 3SVLA 3ZLJA 2ZWMA 4JV5B 2R6JA 3IAEA 2VSYA 3PRYA 5KNDA 1DSSG 3BSSA 4NV0A 2Y66A 4YN3A 3R0VA 1ABEA 1L8XA 2R7LA 1HSOA 4KI0A 4WKPA 4C7OA 2W9XA 3JSAA 1Y9DA 3AESA 1JU3A 2QVYX 1CWUA 2PAAA 4TT8A 4RD6A 2H18A 3KKEA 3EODA 3JZDA 1CUWA 1L8OA 1YOVB 2DPXA 3PHHA 3R9KA 1OU0A 1ULAA 1Y1PA 3TYXA 2QRMA 1TKAA 2ZP1A 1PZHA 1FXSA 2ZQ5A 1JR3E 3DOJA 3G9ZA 4XIIA 1M0TA 1QF9A 2QM0A 3G85A 4ZVTA 3W2EA 3AF5A 3DV9A 5EFOA 5I7UA 5JS6A 3OBBA 3FVWA 1T8UA 2UUAB 1IBSA 1FFWA 3IVRA 3IUJA 4LG1A 2CE2X 3V48A 3HS3A 4OHRA 3T54A 3MLEA 4QRIA 4X6XA 3TFQA 3V4PB 4Q3BA 2O7SA 1XA4A 3ORSA 4KQFA 5G3ZA 2CJWB 4BQSA 2VHUA 4X90A 2Q0QA 3RS9A 4KN8A 1AURA 4KR2A 2ZRCA 3WZ2A 3T12A 3ZWNA 2FPLA 1B6GA 1F9AA 4BVLA 4WOBA 1QGUB 3W5SA 3P7MA 3AB8A 3CTMA 4E4TA 4MVJI 1GZ6A 3J7TA 4L9WA 4WXPA 2OA0A 3UH0A 4BWYA 3M4XA 4OAQA 2B1GA 4IFIA 3E70C 4YPOA 4OGWA 3TTVA 4LDZA 1EM6A 5EE0A 4BDTA 1JR2A 1Z6ZA 2HAEA 1EZ4A 3VO9A 1YZVA 2FLVA 1VMKA 4NVRA 3ZWMA 4KDRA 4V0ME 3G5AA 1LDGA 3IXLA 4KQIA 4X94A 3GDFA 4ZRNA 2VOEA 4Z7NB 3ZK9A 2JIMA 4UHKA 4DCSA 3FTNA 1F2DA 1IPFA 1J00A 1KI9A 1SKQA 4GOOD 4M1EA 4NDZA 3FZEA 2P41A 2R1VB 4MRRA 1X19A 2V58A 1XU7A 5KDLA 3FWZA 3FZYA 5FH9A 4YMIA 5IKMA 3K31A 3CX3A 1XTBA 3F9CA 3FHCB 4CMEA 1SCAA 1TT5B 4YYEA 3KR2A 3K9BA 4FLMA 1W6UA 4BO0A 1G2IA 4HC4A 1MEEA 2O0MA 2VQDA 3Q6IA 5C8YA 3EH2A 2XKJE 3FE2A 3DZBA 3FPBA 4I8DA 4LSZA 2HYDA 5GV8A 1MAWA 5AKLA 3F8SA 2JASA 1SUDA 5JNRA 3ND5A 3IRVA 4P54A 1PGPA 3ED5A 4JJ4A 3CQ9A 4DQUA 2EHJA 1Q3TA 4JXXA 4KEAA 1R6AA 4NJMB 4TKVB 4K28A 5A4IS 5JNWA 3EF3A 1UFOA 3F5SA 2FLKA 1GNPA 1ODIA 1ODLA 3G6WA 4GYJA 4D8XA 1HRKA 5TX7A 1P77A 1DQRA 3OUUA 2UVPB 4ESHA 1QP0A 2HRQA 4FX5A 4QGFA 5B1HA 1PJBA 1LQUA 1CUEA 3FOCA 3UFBA 2H4WA 3MTJA 3KDAA 4D74A 5AVUA 1YZHA 1E9VA 2FOXA 5LL6P 4L2IB 2HHJA 3AUSA 4KOAA 3FDFA 1T3SA 4Q1AA 1VL2A 3ZZNA 3B5IA 5BSTA 2WA1A 3NH6A 1UMBA 1JMVA 3RUIA 4BMDA 3UAZA 1EFDN 2XSZD 3V4SA 4DARA 1T5BA 5DO9A 4QPCA 4YUWA 2XMDA 1S6YA 3F4KA 2WWGA 4LZOA 1F38A 5DK6A 4DT1A 1DELA 1Z4QA 2WNHA 4I1OA 3M5WA 4Q3AA 1UBJS 3WGOA 3M81A 4X41A 2QW1A 1AA6A 2XRZA 3QFTA 2F8SA 3A1EA 4E13A 3IHWA 3KEOA 4HZUA 1JDSA 5CB6A 1Q74A 4EA9A 1SUFA 1V4NA 1JIUA 2K4MA 2BKUA 1LV7A 1FS4A 3MWDA 4CN8A 3OG9A 1NHWA 3UWDA 2WJGA 2G1PA 1PZMA 2QSZA 3UAWA 4NEHB 2ZRPA 4BKOA 2IP4A 3HM2A 4II2A 3RUHA 4D0GA 2HJVA 4LJ8A 4RZSA 1MG0A 2E37A 3HACA 2XYHA 3LSYA 4QFDA 2AF3C 2X9GA 5TDHA 2Q5CA 3WA7A 2CUZA 3F7MA 4LV6A 2IS1A 2Q9AA 5TF4A 3T5TA 5TGTA 3LO5A 5FTNA 1IZZA 4E2WA 1P7VA 1WZCA 3RVKA 3TLCA 2BM1A 4P84A 3Q8XB 4LOAA 2X6RA 2P4SA 2I3ZA 1J24A 2IVFA 1BWQA 2BWJA 2C98A 1V11A 1KAOA 2ZSJA 3I0ZA 4DNQA 2Q6LA 4LXIA 1D6JA 2JIQA 5KNBD 2OD9A 4JJIA 5EE1A 5TVGA 2FFJA 3L7BA 2WMYA 2Y1OA 2ZPUA 2WFLB 5E4JA 2HYIC 4BLVA 3T3OA 4GPBA 1NMYA 3QG5A 3UJNA 2ZK7A 3KSBC 1E2LA 1H8ED 3DHVA 1GTVA 2NTYC 3HL0A 4LNUA 4PCLA 4R84A 3PJEA 3VPSA 2KHZA 1OI7A 4JEMA 5IC4A 4ENRA 5IMBA 5B64A 4EHDA 2ODAA 1WQ3A 2W2QA 1A5AB 4QNMA 4EB8A 3A1CA 5ELMA 3HXPA 1GYPA 2CZGA 2I55A 3U7IA 4YRSA 3CF0A 4D5EA 3FB4A 4FUQA 5EUBA 4BU0A 4G65A 2WNSA 4ENQA 3B6MA 3IIEA 5EIEA 3VR3D 4DDHA 2DB3A 1U0BB 1RRVA 1OH8A 4FSHA 4H4CA 3GU3A 4TTPA 2OFXA 4J03A 3L77A 4L16A 1IB0A 1KSHA 3KYDB 5CGQB 4IJKA 5H5JA 4YAIA 4AICA 1F8GA 2OMKA 2G71A 5F2OA 4CM3A 1CRZA 4MW5A 2A3RA 3E2PA 1CQPA 3F74A 1JKJA 4FGWA 2A1UA 1MOZA 4GI3A 3OJCA 2B1JA 4MWDA 4PSCA 1XCGB 1DJNA 2ZPAA 5FF9A 1RQNA 1ZOIA 1Y7LA 2W4MA 1NWHA 4ZGGA 5BWCA 5BXQC 4AQYB 3FNQA 3OZGA 3K8YA 1SRQA 1C41A 3LDAA 1EYZA 4KI7A 4R8RA 1X9HA 4RDIA 6ABPA 1JQJC 2XE6A 3GFVA 1UPCA 1QFZA 2NXWA 1R74A 1Q50A 1YF3A 1T0UA 4LY0A 5HJ5A 2FEXA 3WGMA 3KJEA 1EJ2A 4M1OA 5LYJA 1UJ6A 2QQ5A 4C6TA 3IEMA 4ETIA 1NMZA 4GHWA 4BC0A 2VXYA 1CYEA 4FC7A 1HBJA 4Z7OB 1I7SB 4PYNA 2UUBB 2CD9A 4XM2A 3WTCA 2C0PA 2Q5IA 1QO7A 3AI7A 3CLSD 1U6KA 4AZVA 4MCAA 1DFIA 4ZT4A 1MFZA 1TC2A 5CIQA 4QYXA 4PG5A 3KZKA 1L4UA 4NY1A 3WXMA 2PANA 5DWDA 2PLRA 3NU1A 1E4EA 3T38A 1R0WA 1IXYA 4MWCA 1LB1B 1VGVA 3SWWA 4K9LA 1Q1BA 3R5KA 4Y6PA 3MWDB 3CUUA 3A1NA 1QG2A 3QIVA 3W6PA 2AOWA 1LNZA 2J46A 3CIFA 4BN5A 1GKUB 2NZXA 5HGJA 1MEJA 4QT4A 3AJRA 4CKCA 4MS1B 1HURA 2O20A 4U7FA 5AW6A 1CY2A 3JATB 5FAKA 1S3FA 2AR0A 5EWMB 4HNUA 1G18A 1IAVA 4YCMA 5AOVA 1BQ4A 4RMGA 4DRXB 1BXZA 1KP2A 2JBAA 4G0ZA 1Q15A 1TVCA 3NYIA 2NYVA 1TIPA 4C4PA 5GTDA 4XGQA 1QWOA 5HYVA 1EB8A 2G09A 1IZ7A 2NNWB 3FOAA 4INJA 3IMKA 1ML4A 4AQ7A 1AKEA 2QAJA 4RF3A 4Q4HB 2R8OA 4B2YA 1A8IA 2WWFA 1UPBA 3RVBA 4IYRA 2ET6A 2WFLA 4RQBA 2JGLA 3W77A 8ATCA 3TG2A 3HCDA 5AW7A 1OX5A 4R2WA 5E0OA 4KQKA 1NBIA 2CFRA 2VPTA 3ZWKA 1ZR4A 3ETHA 4IGAA 2QGZA 2Z2KA 1ULTA 2HPAA 3KLBA 4G1CA 2DT8A 1A88A 5LU8A 5T8KA 3HWWA 4F5EA 2GMWA 2H0AA 4KN9S 3TAHA 3VPBA 1UXOA 3AF4A 3HLTA 4CCWA 3RTCA 1LVGA 1Z0KA 4HHEA 3USZA 2Z0MA 1G4HA 2XUDA 4F2WA 4D44A 3QLVA 1T6NA 2YJGA 2QLMA 3T7EA 1LX7A 3DSRA 3G0DA 1DUVG 2WTAA 1JR6A 1F7VA 2IU4A 2JAQA 2PLAA 4FN4A 4BO5A 1YUNA 3DBLA 3GT4A 2QRKA 4B8WA 1VG9B 1FW8A 3VPCA 5DSTA 3ABRB 4YCCA 4JI4B 1TPZA 1JGTA 4J2OA 2QMQA 2LBPA 2BBTA 1YMVA 1A2KC 1NKTA 1GPH1 1U9ZA 1MQAA 5K3SA 1U8TA 1UFRA 3VOBA 4J7CA 2J0UA 5KNDH 2PX6A 1GTMA 3BSFA 5CCEA 1LXCA 1RHQA 2X4LA 4KPYA 1H6AA 3KT6A 5FUVA 2EVWX 4GXTA 3DL7A 3RS8A 1BKYA 2PHZA 2WVGA 4DC1A 2PL5A 3O7WA 2RGNC 1DMRA 3KKZA 2P8JA 5KO2A 1NVDA 1NVTA 1T0HB 5JZBA 2I4OA 4CF7A 2JHFA 1UANA 3F7TA 3GJXC 5ALTA 4RKEA 1AF4A 1IRXA 1XTIA 1KYXA 3O5AA 5CLJA 3FWYA 2VK4A 4KQ2A 4PLPA 1XQ6A 1P5ZB 2FX5A 4RK6A 5FV4A 5JMOA 3GGGA 2IYZA 5K0ZA 1RLUA 4LGMA 1SUSA 5IC5A 2FUKA 3P2KA 4G8JA 3W2IA 1DU4A 2JEYA 1A2QA 2MHCA 1EFRD 3K9QO 3LP8A 1E4EB 1Q7EA 4OXXA 1U1FA 1A7JA 2F1KA 4HN9A 2Z8XA 1X8XA 1V3TA 1RIFA 3Q41A 5IYZF 1QIMA 4RZHA 1E61A 1Y63A 5I9NA 2UXBB 4GSYA 5J2TB 2XQGA 4RTRA 4W1PA 5COBA 4X8LA 3JQBA 5HWSA 2NUPB 1NU8A 5IAJA 1RWNA 3E5RA 4WV3A 1QO9A 4P98A 4P08A 4CQLB 2VPZA 1G19A 5IBCA 2VATA 4EW1A 1NAIA 2OV1A 4IICA 3GVHA 3S2YA 3UJHA 1AQNA 3AZQA 1QIHA 4EJSB 5AI8A 5HK9A 1Z4LA 1ZIOA 1O6ZA 3KQVA 5CD9A 3C87A 1E3DA 4QLAA 5JOQA 2VT7A 3E7WA 3TKAA 5PNTA 2OBXA 2W58A 4JC4A 4ADSG 3C5VA 3VX3A 5BR7A 3FJ1A 4PO3X 1TZJA 4R9UC 5HMMA 2O8CB 4HH0A 1WUHS 2JJ2D 2VHXA 1GT6A 3R41A 4TQUS 1VJ5A 1A9YA 3P2EA 3FOZA 4RS4A 3O8NA 1GYRA 3AZPA 1VECA 4FQ8A 4P3XA 4TSRA 4TX1A 1K6JA 2GILA 1U80A 4TVOA 4XH9B 2XXAA 1ZFNA 3N2KB 1DOZA 4NYIQ 4EKYA 3WK7A 3E81A 4HWGA 4K6CA 3U4HA 3B60A 2I6QA 4IJQA 3R2JA 4K1LA 1DO8A 2E7ZA 3HJHA 5ARDA 1QC5A 1IQPA 4DABA 1QMPA 4CW7A 1KL7A 3BHIA 3IP5A 1II9A 4O4JA 1WBDA 3O6VA 1CS0A 3TZEA 2PZ8A 3SXUB 4Y2JA 3V4LA 4I8IA 3F5MA 1HG0A 2IYNA 3H2IA 2DGDA 4MEBA 2GAFA 3OOEA 3NRCA 5SYNA 2YQ5A 4EHAA 4MO2A 3FNEA 4NPCA 1T2VA 2XECA 5CA0A 5TQ0A 3WMEA 2F7SA 5FP0A 4A92A 4F6CA 3REGA 1WETA 4RMJA 3NH9A 3OCXA 3G02A 5K45A 3VHLB 3LCCA 3A14A 1OI4A 1H2YA 1R6DA 2VT3A 3PX3A 1FOEB 1IOLA 1BRTA 1V71A 1CRWG 2WUGA 1E79A 3NQ41 4UE6A 1P1IA 5K3CA 4RMHA 2VZ9A 4RPGA 1Q0UA 2XQIA 3FNGA 4PVDA 5EP3A 4LDPA 2P5SA 1OI2A 1CTQA 221PA 4OX9B 4RWZA 2EQ5A 1G5QA 4LYYA 3GCDA 5THKA 3DV0B 2ZBVA 1IXSB 4RQTA 3RVQA 3PVSA 4IIHA 3T9BA 3GRUA 3WRXA 2G76A 3OM0A 1AU9A 1SCKA 1I2AA 3CLRD 3MJRA 4KGZA 4OFXA 5TGDA 1V43A 4FR5A 3E7FA 1U8EA 2X0IA 1Z75A 3VTFA 3WHPA 5KS2A 3NGXA 2HXSA 5LXTA 4A0FA 3N1UA 1X2BA 2TS1A 5CFLA 2GM3A 4P33A 1Z39A 1SKMA 1TMYA 2V9ZA 3ZDCA 2CXNA 4R2JA 4QEKA 2BR3A 3M6AA 1RQGA 1ZM4A 3O4GA 1VI5A 2P4UA 2Y9PB 5EZYF 2ZYAA 2XIQA 2W6OA 4D6YA 4EABA 2IYOA 4IM7A 5BY2A 4H4DA 1FP6A 1RI2A 1I5RA 2QTVB 5I5EA 3RRYA 3TJZA 1X38A 4Q1VA 1XWIA 5IBPA 3BWCA 4BNIA 4TSFA 3CUVA 4D6PA 5AWFC 4DWVA 4V02A 1PYDA 1D2HA 2D62A 3VTAA 1N0VC 1XLTC 3DE4X 5AKKA 1ORDA 1WMSA 2ZYSA 2CLSA 4DM4A 1LF5A 5EQTA 1GFZA 1SWWA 1V7PC 4LISA 4RNDB 1ANKA 2OO7A 3E6AA 4M86A 2QG9A 4YT2A 3PRKE 1JWAB 1W0JA 5E95A 5FPKA 2E4XA 4HI0E 3GFRA 4MP3A 2DAPA 4YUVA 3VAZA 3JAWA 1XXLA 2Z83A 2PZFA 2YWCA 3K8ZA 4M89A 1ICIA 2QSYA 4QU9A 3A6KA 1FL9A 1US8A 3DBOB 4M6WB 5EG5A 1V1JA 2PYDA 3AJEA 5A4AA 1JEOA 3QX3A 4JYAB 3A9VA 1M8GA 3IJRA 4XFKA 1JHYA 5AM5A 4FGKA 2GK7A 1XTJA 2WU8A 4JR2A 4WKNA 5FL3A 1NBME 3O2NA 4YJ3F 3VQTA 3W5JA 3W90A 4AF8A 2ZRIA 3CR7A 2IOQA 1GRNA 2IYTA 5IJXA 4CM9D 2ZUCA 4R01A 3RF7A 2WUVA 3T1OA 3TB4A 2GAJA 2JK1A 2ZIAA 4CKWA 2GA9A 3V3TA 3D8NA 5FYQA 3OEHD 3QH4A 4JQZA 3HDHA 1I80A 3W2GA 3TOSA 1A50B 4EG8A 3N2YA 4WPGA 3JQCA 3E1SA 2EDCA 4EGSA 4JNKA 3F5FA 4H08A 5DHTA 4Z6KA 1XRQA 1X7YA 2CXSA 2GPYA 4XGRA 4AD8A 4BL5A 2FN9A 3UJ6A 4JODA 2OQIA 2JLZA 4YT5A 2P8SA 3ILYA 3OFND 1HE2A 5E4YA 1CJCA 3ZLTA 1QLWA 2CXOA 1SUWA 3IAM6 3OPQA 1U9JA 2GN1A 3TOZA 1G3MA 1VE6A 1QPGA 2EV9A 4YRZA 5LUAA 2ZB8A 4FOLA 4ZCPA 2SKDA 3EWSA 4I5FA 5TT0A 3VC2A 3VZSA 3JWJA 4B83A 2GCOA 4OHYA 2X9VA 1VL1A 4YRDA 3O1JC 4ARUA 3SGLA 1BDIA 3UOGA 5JSYA 1SUEA 2AC4A 3IQDB 3MIZA 1XF9A 4CEIB 2AFHB 2HD4A 3DMFA 1PR5A 4LZNA 2J6HA 5JY6A 4NIMA 3A2LA 1BH6A 3AHIA 3KE8A 3GBSA 5CDGA 3WYGA 2DUUA 2HGSA 3GUZA 5AKGA 1FSSA 3KLPX 5CHEA 2HX1A 1V8DA 4XGNA 2NAFA 1E7WA 4HSEA 3VNVA 1UKYA 2A58A 2QUJA 3LQYA 4JR1A 4MW4A 4HFNA 3TLXA 1EFKA 3ICVA 3NP7A 1JV2B 1J6UA 1YZUA 4BE4A 4M0DA 4L28A 1E96A 1R9JA 4MQBA 4NFHA 5HF5A 3GEGA 3K4PA 5FR2A 5B3AA 1QU3A 3C39A 3OAAA 1LF0A 3RYHB 4V3BA 1GVHA 4YO7A 3ZU5A 3CIOA 4DSUA 1DLJA 2AW3A 2NYRA 1NXQA 4C7BA 4G84A 1SBTA 5JCPA 5EY5B 1FC0A 1EJ6A 4A10A 4PS1A 1HE3A 4CMEC 1CR0A 1VM6A 5JJCA 3I01M 4RC9A 4DOMA 3CH4B 3L8ZA 4CQMA 4PSAA 3ZZUA 2G04A 2GBCA 5B3JC 4KXNA 1DI0A 2GHQA 3GLTA 1NW4A 3G8AA 4FFMA 1KR5A 4DNFA 3H84A 4HNSA 2DUMA 5CB8A 5C8ZA 1IDN1 4WQMA 1L7EA 5LU9A 3AJ9A 3O8OB 1E5VA 2Q1SA 2I1VB 2XNHA 3OPVA 5BNFA 1CF2O 2C5FA 5J1SB 1UEIA 2M1XA 2C4WA 2QL5A 3CU5A 4IZ6A 4RZUA 5DKFA 3T35A 3FPCA 4RY0A 1D1TA 2BBSA 1ISSA 5EWLB 5BPHA 3DLAA 3TD2A 3NDBB 1L5RA 2WY2D 4CM4B 1YK0A 4F06A 1T0PA 3K0AB 1IHXA 2ZAMA 3WYEA 1HLGA 2A0UA 3H1FA 3E8XA 4O2RA 1NUAA 4RTPA 1YVEI 1XMQB 4ZEWA 5IMSA 4M98A 1LW7A 1E6UA 5CYOA 1KNQA 2NZWA 3AP3A 1ZITA 4O2AB 1VJ0A 1RBZA 3ZQKA 1U0NA 1SBHA 1OPRA 2FWPA 3K70C 4ZI2A 3LDFA 4Y2VA 3MW8A 2UZ4A 3TCNA 4BRWA 1TYZA 2OZLA 2VP3A 4HN2A 3BF8A 1RKXA 3JR3A 4RJLA 1N1EA 1UXHA 2IPXA 2EW1A 3CGGA 4KK4A 4K5QA 1M8PA 4YAEA 5DYGA 5A9SB 2HKIA 1D4FA 1RXSA 4UU8A 3U3KA 5C1OA 5JS7A 1AMOA 1G8FA 1G64A 2R96A 3RAPR 3VR2D 1VLQA 3CXUA 2AI1A 5FNVF 5HRCA 3AHFA 4H7IA 2FQ1A 2WMOB 4JOBA 2QVXX 2AXPA 2W37A 3IPCA 4TUYB 2COKA 3N2IA 4B6GA 3NX4A 3VU0A 5CP8A 3D7MA 4DMLA 2B20A 2B98A 2X9NA 1G7RA 4XUGB 4CEHB 1O4WA 1K63A 2YHIB 1CQIA 5K3DA 4LX8A 4QM6A 2LGJA 1OAKA 1Z5UA 4W5OA 2AFIB 2PFKA 3FCXA 1EXNA 2PT5A 1SG0A 3N0XA 3BXGA 1X7DA 1WVIA 2KM1A 3BE4A 1LEHA 1SKBA 4S1OA 2HDWA 5COAA 1RYFA 5DK4A 2I29A 3VPFA 5TSDA 4UNRA 5EGSA 5JNSA 4MA0A 1AKVA 1R0SA 3I23A 3RYHA 5HKKD 5K0JA 1M6HA 1JEAA 3QWBA 1O95A 2XGJA 3TMKA 3R5TA 3UBTA 3R75A 5FA6A 1QYCA 2YY6A 2Y3IA 5K0FA 2FMIA 2OGTA 3C0KA 4N8SA 5D85A 4KVFA 4OAPA 4DMMA 5K8VA 1W49A 3LVBA 3Q15C 4WK4B 2XA1A 3ZEIA 3ZD8A 4AS2A 4C4OA 5FPYA 3U7FB 4PY2A 1UFQA 3IAUA 1AXRA 1M34E 2NXCA 2Q2OA 3I9KA 3NATA 2PNJA 2R44A 3GOHA 5DIFA 3TIGA 3GT0A 5KOHB 3H0KA 3ZZMA 3KTAB 2NQ8A 2R8RA 4FJ2A 4C4ZA 4I3FA 4DUGA 1VB5A 2A5JA 3H97A 4G1MB 2C2WA 3IEIA 1PGQA 4UAJA 1KFCB 3X1DA 4JOQA 1J1UA 3PUJA 3HNPA 5E6RB 2J0EA 1MGOA 3ZGNA 4C6HA 2EZ9A 3UXMA 2O1XA 3KOZA 4UM8B 4FXOA 2YJ4A 5HZMA 4V0RA 5EKTA 1BQ3A 4WFJA 2ZWOA 3JS5A 2VL7A 2H17A 3NALA 1MZPA 3KSAC 2VWQA 3ITEA 1QYRA 5FBRB 3LLSA 3R76A 3MJVA 2HUPA 2HCFA 2Q3LA 5KU7A 4B3RB 2AN9A 2W2VA 3HP1A 4RHUA 5AW5A 1LK7A 4D82A 1WSBA 4YV7A 1QTQA 2VPIA 4KGXA 3LT2A 5KJFA 2R751 5FEUA 1EX7A 4OYRA 5L3VA 1E2BA 3DCNA 4YI5A 4XD7A 3B5EA 1H93A 1Y3BE 3H18A 1YHYA 2SNIE 3KV1A 1O6FA 4GE0A 2HK8A 4QDOA 3SFVA 3WMGA 1RFLA 3AHEA 5EIHA 1WMFA 1E64A 1ORIA 1E32A 3NI2A 2OZLB 1Y4UA 2HSZA 2YZ2A 2P91A 3NHSA 4RADA 2YRXA 3ISVA 2ORIA 4Z49A 4C0SA 3EC1A 4W5NA 1AHIA 4MAMA 4ZOLB 4KO1S 2YHSA 2B5OA 5ICGA 1CERA 4F5DA 5B3KA 4EBFA 2GD0A 5FQOA 4IIGA 5LP1A 3U56A 1MCZA 1YU6A 3L7KA 3HVHA 3HCNA 2AJ8A 4L5CA 5LZ7A 1WUKS 2ES4A 2VP2A 1MB0A 5HILA 2AG6A 5T4EA 1XDDA 1XHEA 2GASA 3S1AA 5DV9A 4XSGA 1ZGBA 3EJWA 2RE8A 1ZUD1 3EQ6A 1JDUA 4F4HA 1UDBA 2QENA 3FNFA 1Z62A 4U6QA 4CEHA 1BFDA 2NLOA 3I09A 2A4MA 1R6XA 1V47A 2QJTA 2VJBA 4WAUA 5EHNA 3V2UA 1PSZA 3O8DA 1UBFA 2AFIA 3CW9A 3F2VA 3KELA 4BFLA 1QJ4A 1UDRA 3DMTA 1TFRA 2C61A 1DTWB 1GDTA 2WTEA 1FFXB 1VA4A 4OB8A 2EP8A 3MXOA 3FRIA 2H2HA 3PQ3A 2OKCA 4TXJA 5EHQA 4EHKA 1ESCA 3AJAA 1CNFA 1HFJA 3RLFA 4B6RA 1F2TA 2PUCA 1VJDA 1JQ5A 1KHTA 1WB6A 2BGIA 3K6SA 4ABTA 3LI2A 5BWNA 1ULHA 1YDEA 3GBPA 1TYAE 1L9KA 1WHTB 2DWCA 2QRGA 4ZAYA 2ZIZA 4ZOEA 2N42A 1FVHA 3PPIA 3AVTA 1OY1A 4KV7A 2R1TA 1R1DA 1JLLA 4URYR 3GUUA 3HFRA 1TTHA 1RYNA 1TQ6A 4D4GA 1K4KA 3LUAA 3S1SA 1GKKA 5LFAA 1U8XX 1NY5A 2IK8A 3CCCA 1ZRSA 5MFZA 1WOYA 5F1KA 3HB0A 2OCYC 3PFGA 1U8YA 1DUIA 4JYPA 4EY6A 1VL0A 3TQOA 1DAKA 3OPYB 2IT1A 4WW0A 1GAQA 4BFXA 4M0UA 1YE8A 4NYJQ 1EQUA 1ECJA 2BI8A 1YRBA 3GLGA 4A3SA 1EX6A 3TLEA 2QAIA 3JX9A 4JP3A 4RM2A 1L4KA 2FPWA 4F1JA 3WNZA 5HZHA 1RCTE 4YIHA 2Q3BA 3UW3A 4LNHA 4UU0A 5AKEA 2X2FA 3SF8A 1NNLA 2YQZA 3G59A 5AW0A 1ONPA 1S8AA 2C82A 5DX8A 1CQZA 4KFSA 3TLGB 3V2GA 4MGYR 2OAP1 4B8ZA 4GO1A 1MRZA 7AT1A 3HM9A 5I7OA 2NVWA 5KU1A 1WDKA 3KKQA 3OI7A 4B1FA 3PNQA 1UK9A 1YASA 2AVDA 2ZVPX 3H6HA 1H4SA 2C4TA 5ALGA 3WKEA 4FYWA 5B1SA 1QGED 3GJ0A 3OP1A 1GZ3A 4BB0A 4IAOA 3DQPA 4NG5A 2ZTUA 4LMPA 3S7TA 3OWXA 1QF7A 2ANBA 2J5RA 2WIAA