1SQ0A

Crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
DFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor (vWF) [Contains: Von Willebrand antige
publication title Crystal structure of the wild-type von Willebrand factor A1-glycoprotein Ibalpha complex reveals conformation differences with a complex bearing von Willebrand disease mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 72
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1sq0A00
4A0QA 5KYUA 3EOBI 4NEHB 2NUPB 4F1JA 3T3PB 3NIFB 1U0NA 4MMXB 1M10A 2B2XA 2NUTA 1IDOA 2NVOA 1PCXA 2VC2B 1JLMA 1N3YA 3V4PB 2VDKB 3NIGB 2ICAA 4HQLA 3EOAI 4M76B 3NIDB 3GXBA 3PPVA 4UM9D 1DGQA 4IXDA 3ZDZB 1SHTX 5KYYB 1QC5B 5KYNA 1RD4A 3EGDB 2VDMB 3HXQA 1NA5A 1SHUX 2VDRB 4MMZB 5KYXA 1T6BY 3F78A 4C29A 1M1XB 5KYWB 5E6RB 3K6SB 1CK4A 1RRKA 3RAGA 3PPWA 3FCUB 5E6SB 4NENA 1M2OA 3EH1A 3TW0A 3VI3B 4Z7NB 1FNSA 2IUEA 1RTKA 3M6FA 3ZQKA 1V7PC 4IGIA 3EGXB 3Q3GE 1M2VA 5E6UB 4C2BA 1PT6A 4JDUA 4CNBA 1MQAA 4HQFA 1Q0PA 3EG9B 1ZONA 2X5NA 5HDBB 4G1MB 5BV8A 4MMYB 1IJBA 4UM8B 4DMUB 2VDQB 3QA3E 1JEYA 4WFQA 4PN7A 1JEQA 4UM9B 4C2AA 4FX5A 1T0PA 3IJEB 4G1EB 2ADFA 1L5GB 3T3MB 5KYXB 2VDOB 2ODQA 3ZDXB 2NUPA 1XDGA 1XUOA 3ZE0B 4F1KA 1XDDA 5ES4B 3K71B 4XW2A 3TCXB 1MQ8B 1UEXC 5KYUB 1ZOOA 1BHQ1 1TYEB 3BQMB 1LFAA 3F74A 3V4VB 2I6SA 1MQ9A 4HQNA 4WJKB 2XWBF 3EH2A 3TVYA 4CN8A 2VDLB 3HXOA 3IBSA 2NUTB 1OAKA 5KYYA 1QC5A 3K72B 3TXAA 1YVRA 1MHPA 1RS0A 2ODPA 3VI4B 2VDNB 3FCSB 4HQOA 1DZIA 1AO3A 1IJKA 1N9ZA 2WW8A 3N2NA 3EFOA 3ZE1B 3ZDYB 1IDN1 4CN9A 1JEQB 1ATZA 1QCYA 5E6SA 1YVPA 1AOXA 4BJ3A 3EGXA 4IHKA 5E6UA 2I6QA 1BHO1 2XGGA 4NENB 5LN1A 4HQKA 2M32A 3BN3A 3E2MA 3PPXA 2O7NA 4WK4B 3EG9A 3HI6A 2QTVA 2XWJI 2VDPB 1M2VB 3ZE2B 4WK2B 1ZOPA 1SQ0A 2WINI 4Z7OB 1MJNA 1PD1A 3EGDA 3PPYA 3BQNB 4Z7QB 1U0OC 1MF7A 1PD0A 1AUQA 2I91A 1JV2B 1FE8A 4O02B 4WK0B 5E6RA 5HGJA 5HJ2A 5KYWA 1U8CB 1M1UA 3K6SA 3EFOB 1JEYB 1CQPA
chains in the Genus database with same CATH superfamily
4XJSA 2D59A 2JA1A 4R8MA 4OG2A 3UGTA 3H75A 1EXWA 1QZTA 2EL9A 4Q3DA 3THYA 3P27A 1T4GA 1WDMA 4GE3A 2QN1A 3RG2A 5TX7A 3NHJA 4PSCA 3ND7A 2I71A 3KT0A 2Y1EA 3NANA 5F77A 5FTMA 1QVZA 2ZRKA 1AQUA 1LJUA 5GZ1A 3G49A 4JLDA 4JJZA 4EVRA 2VA8A 1TXGA 3FPBA 4RZQA 4NDAA 4V39A 4CCYB 4UBLA 1O6BA 3K30A 3VSBA 3CGWA 4GPBA 2ZUBA 2BONA 4L7VA 4PZEA 3MLBA 4EYOA 1YWGO 1UADA 4CCSA 3G2KA 4TUYF 5K3CA 5JFOA 2NMVA 4HLCA 4ZI7B 2W2LA 3TD2A 4KR9A 5CLFA 1HE3A 1U9ZA 1ZI8A 1IUNA 1C9KA 4BQEA 3DA8A 1TTQB 4OI0A 3TRHA 5BSRA 3LM8A 4FZVA 5LYYA 5BR8B 1V41E 4J3FA 1BEUB 1DBWA 3ETEA 3FYHA 2DM6A 3NWBA 5HX7A 4MS4A 4AZVA 1MG0A 5EQDA 1NUSA 1JSCA 1Y80A 3JX9A 4H0CA 2W2NA 1U1DA 3IC5A 1PT6A 1K8ZB 2RH4A 4IV5A 4BYMA 2P9ZA 3OA2A 1RJWA 3DOHA 4MX8A 5C7YA 3R20A 1H2XA 5MGBA 3U60B 3DWFA 1GVHA 3BXFA 1IJBA 2HK6A 1U02A 2ZI9A 3CT4A 1UKVY 1TKRA 5IBQA 4D79A 3S2YA 1CUXA 1RWXA 4LG1A 1LC3A 4UTOA 1NOIA 2FFJA 2VNAA 1UT6A 4KIGA 4MW5A 3TSCA 4HB0A 5TT0A 1U6JA 5TEWA 4WCFA 2FN7A 2DKNA 5BN4B 5KTNA 4BNZA 3K70D 2JFNA 1MC1A 2RHCA 2HGSA 4K1LA 4KBFA 4XW2A 3WFJA 4YAIA 2IZZA 4MP6A 2AQKA 3ESDA 2H4HA 1Q11A 1OA1A 1AS2A 4MVJG 5CH8A 1PZXA 3VX4A 3WGZA 3TQRA 5C5DA 5JWOA 5AIAA 1QTQA 1E2FA 5GGXA 3FDIA 5L6MB 2W9XA 1CEQA 3RSQA 4CKCB 5JPCA 1QTNA 2DP4E 2C94A 1NVEA 2BGKA 1RYZA 3IT0A 1OHHA 1SK8A 1S7GA 4GSYA 2GD1O 4GRIA 4JLPA 3VR1A 3WJAA 2ZJ8A 2DTDA 3BWEA 4HC4A 2GYWA 1SXPA 1X3SA 4UU8A 4FFRA 2CCKA 1U4OA 2BCGY 5ALHA 2CLKB 5CA0F 2XWSA 3EDRA 3TPCA 3WB0A 1K6MA 1FF9A 3ZW7A 1K8QA 1DEAA 2IOFA 5CFQA 2RGWA 3A3NA 1E60A 4GOND 2AQ8A 1ZJ6A 2EW1A 3CLUD 4RMGA 5IAGA 4XD2A 4BWYA 4C87A 1XTKA 4GLOA 4HNHA 5ESWA 5TT1A 4G23A 1GRRA 4F2WA 2FRXA 3RVSA 4UJ3A 3V8EA 4Y1RA 3HXPA 3CURA 1M2WA 2QI9F 4JWTA 4MV1A 5H3CA 4BO2A 5KBYA 2VQFB 4X1IB 1HQYE 1YB6A 1V11A 4MKIA 4E4RA 3WMXA 4FE4A 2I4IA 5GJWC 1WHTA 2F43B 3L7YA 4AF7A 2VATA 1PFYA 4GGMX 3HNRA 3ZBQA 3KKLA 4MQFB 1KVSA 2X5JO 1QR6A 2PH5A 2LCIA 4C7XA 1GCGA 4X5OA 1LW6E 1A9RA 1R8YA 1L1FA 2UXBB 5KYWA 1KJ9A 4FMDF 2W58A 3ZCUA 4HGRA 1MRNA 3HUUA 4I2NA 5F2KA 4LYEA 1IWPB 1SD5A 4O4IA 1ADBA 3KOXA 3GLGA 1AS3A 2GI4A 4WLOA 4PC6A 2PZKA 2R68A 2XWQA 2DUMA 2A0XA 3NUGA 1BC5A 4NG4A 2NUPB 2J9RA 1VP9A 4MVWA 4O8CA 5DT2A 1C9MA 2WG2A 2QTGA 5JV5A 1AUPA 2POCA 5CCEA 1P1KA 4IDCA 2V0CA 1U3TA 4L8WB 3UK1A 4LF9B 1U0RA 3PX3A 4FI3F 1COWD 1VCMA 4YP0A 4Q34A 3AZOA 3TM5A 2Q3LA 4MB0A 3I9KA 1BA2A 4UZEA 4L57A 3DSRA 2ZBVA 3FSJX 4B7ZA 1BW9A 1MTZA 2PYIA 4Q03A 1RHKA 2QYOA 4Y2GA 1KP9A 2QJRA 4ESVA 3Q3HA 2W8BB 1NNEA 2J3MA 2OPHA 2IV3A 4DXHA 3GW8A 1OREA 5CB4F 2HMWA 3NAGA 2P77A 2ODAA 1JFFA 3UJ7A 2X0JA 4ZFNA 2FDRA 3P94A 2BF4A 1ZOSA 4C5CA 3Q3JB 3EYAA 5ED0A 2PS9A 2R6CA 3ANYB 2F8LA 2GUGA 1DCKA 4FEEA 3VZDA 4A23A 4DBVO 1GKUB 4K88A 3VHXA 2AVDA 2E49A 1C4WA 3V42A 3WGTA 1BH6A 1PI3A 2O54A 2HMUA 1OUMA 3QBDA 1RZVA 3WB1A 4FOTA 1GPBA 3FG9A 5KQSA 2VUTA 3WMWA 4FE7A 1FU4A 4L15A 1F7VA 3BL8A 5IKOA 5EXDA 2JLAA 4RK6A 4YAUA 3HCWA 1BE1A 1CS4C 1GSAA 3EZXA 3QHPA 4WXEA 5ERXA 4KN6A 5F9FA 1VLVA 4DQVA 2QUBA 5JI3E 3DUWA 2H2WA 3U7QA 1W36D 2ZZKA 2ZWOA 2CVQA 3GT3A 3LGSA 1OYWA 2NPOA 4GX2A 5C34B 2PYZA 2BGWA 4ZI3A 1UDCA 2C2YA 2WJ3A 1TEZA 3DL4A 3HADA 1M7GA 4FKZA 4Y6SA 1KJ8A 3FRIA 3NJ4A 3T5DA 3TZBA 4DG5A 5KTTA 5F4ZA 1A9SA 5IDWA 4AJNA 4DM7A 1QGOA 5ESDA 4YX9A 4RGVA 1TLTA 5IF3A 1JA1A 2PIDA 3LQFA 2N0SA 2CMHA 2VLBA 3ZDRA 1AKEA 4BTVA 2VCEA 4HRVA 5F1KA 4OFBA 1APBA 5LQUA 1L7AA 5IBPA 4CIVA 2OV3A 5DW3A 5TJ9A 3Q12A 3PX2A 1Y48E 2D2EA 5E4YA 2O8CA 3KZOA 4JXKA 3PL1A 4MWTA 1QJ4A 2QUAA 2HYDA 3JD4A 4LFCB 3LUJA 4PHFA 1I0ZA 2OBMA 3DD5A 3HE3A 4R54A 5TMBA 3TQSA 4BQPA 5CAEA 1MB4A 1IN7A 1BX0A 1KTVA 3W3AA 3G1WA 4O2LA 3ET5A 4RE6A 2QT0A 3H5WA 3MWYW 2YWXA 1WP4A 2FPGB 4GWLA 4IQ0A 1JMVA 3ZWCA 3MFYA 1EVYA 4D8XA 2GX6A 3WG9A 3R74A 4NAHA 2W83A 3DG9A 4BLWA 3K20A 1F06A 1IE3A 4CUZA 1DLIA 3IA2A 4BNNA 3IB6A 1WO8A 5FEUA 4Z7QB 2YN0A 1CRWG 4IWNA 2ZR8A 4P92A 4I6EA 1VYTA 5T3UA 4ZZIA 1VB3A 1GA6A 2X0FA 1XB2A 1K8XB 3RUIA 1LJLA 4MA0A 2GBIA 2JFPA 3COWA 1FQWA 3UMGA 4YY3B 1Z12A 1QG6A 2GHQA 2XKJE 3NETA 2C95A 3OLWA 3PWKA 5SZKB 4AY4A 1L7MA 4E1BA 1EFTA 1F9EA 1YB1A 4NE2A 3DWIA 3RSHA 1W88A 2QRQA 1W8IA 3NYRA 5DX8A 1ODKA 3UMRA 3ZV7A 2XBUA 3B13B 2NUTA 1IBSA 3BGSA 4PO3X 2QRZA 3EUEA 1HQDA 1NY6A 4PLYA 2JB9A 4QHYA 1F17A 4POAA 1BMDA 3O9ZA 3H1BA 4GHWA 1UOQA 4FBMA 4Q12A 4YFVA 1HFKA 2DERA 3AM3A 2R86A 2XT9A 2AEEA 2QKYA 3IDFA 2V7PA 1PQPA 1ISIA 2AD1A 1ZD3A 5HJ7A 4W5HA 3K0CC 3KT3A 1PJTA 4ER6A 4JI7B 2P8JA 4MV9A 4Z1MD 3C1AA 3VNUA 1ZNYA 4J2OA 5JNWA 1TMOA 2I33A 3VDRA 1ZQ1A 1NUHA 2OV4A 5AM5A 5JUWA 5GINE 3SX4A 4Z5XA 1OW3B 3WBKA 2XMCA 1VPTA 2PJUA 3EWSA 1H4SA 2Y0EA 4M36A 4MWGA 3TW8A 5FB3A 3BMNA 3WE7A 3X2FA 3PA6A 1V3QE 3Q8XB 4JQSA 2Z56A 4H4EA 2LVBA 3DE1X 1IZYA 2D13A 2J0UB 3KQOA 5G3YA 1ZUWA 3WKBA 1CIJA 4JB3A 4N9QA 4XB1A 4PG7A 2V58A 3EAFA 5CXQA 3IPYA 1ZVKA 3A6FA 1D09A 3EVAA 3HJNA 2CF5A 4MVJD 3VDNB 1LTQA 1OX4A 2YWGA 2Y4OA 4KE8A 3ZWNA 2DVMA 3SI7A 5CEJA 2VDOB 3V4LA 3IAXA 3NB0A 3RIMA 5I7AA 3WTCA 3BM5A 1FVOA 1RRFA 4ATNA 1M1YE 1N4DA 1YZNA 3K71B 4KMSA 2BEJA 3FMFA 3TYXA 1Y8RA 5I8PA 3OMLA 1BHQ1 1QVAA 2XCLA 3PGMA 4IMRA 4KVAA 4BNUA 4CTJA 2OG2A 1E1DA 4MUBA 5LNK6 4KP7A 2WPNA 3AEYA 4TTPA 4YP9A 4E08A 5BSVA 3VA7A 3A1DA 3LPLA 5FWYA 1XDWA 3DLAA 1CRZA 1VIVA 2HO4A 4IDFA 4PSDA 1B8VA 2Y1WA 3V4OA 5AHXA 1PG2A 2VDNB 2PRIA 2X9GA 3W6ZA 3NMUF 4G63A 5K8LA 5DTJA 3GG9A 4GNKA 1J7KA 4MRMA 4LF7B 4J0DA 1JGTA 3C6YA 3W06A 4WOBA 3RYIB 4CMEC 4EHAA 1QOPB 1MHTA 3NHWA 3SYMA 1TAUA 3B60A 4TT8A 3HM9A 1VG8A 1DNPA 1H2EA 2EG9A 1XYVA 4GBGA 3TEMA 2Z1DA 1R00A 2Q29A 2V03A 3WOHA 1CB7A 1P3DA 2ZK7A 3PC8A 2ZRNA 2E6UX 2PMFA 4XQ0A 2I6QA 2OGSA 4D9JA 3NKFA 4UTVA 1SC9A 1VMIA 3E2MA 1SUWA 2JCXA 4NCHA 3THXB 3DUFB 2XTAA 4M1WA 2NNLD 5TVGA 1LBHA 1KWGA 4MGEA 3EGVA 4QOGA 2FMHA 1ZN7A 1NAHA 4AUNA 1VI6A 3PTZA 1LI5A 1U2RA 3OX4A 2JGNA 2P5SA 3GVIA 3JYHA 4MDHA 1Z2EA 3ZZ0A 3ITKA 2OCGA 4NYJQ 3AEUB 4FUQA 5C9ZA 1WNTA 1MF7A 1VJTA 1TJ4A 3ESCA 4G5XA 1GZSA 1OI3A 1T0HB 4LQ4A 3GJ8A 1NF9A 1F2TB 4NZYA 3SBXA 4WWHA 1VKZA 1KP3A 4O4IF 3F73A 2CD9A 1K7CA 2IP4A 4XAQA 3GGOA 4OI1A 3F4BA 4YI5A 3N2IA 2PFKA 1FSFA 3ZQJA 2J5QA 4BVHA 2BUCA 2CKMA 5M2QA 2GJ9A 3SE7A 1D6JA 3DZFA 3H5VA 1B73A 2OBLA 2WIGA 4UBNA 1MEEA 4X91A 5EYPA 3HGMA 3HSSA 4JYPA 4D0NA 3QQ5A 1Q0UA 3MMXA 1DSSG 1CG6A 2XY4A 4YTEA 3H0CA 3W9YA 3DLHA 3QEOA 2WE7A 4M0FA 1RHJA 4WDRA 5B6IA 2EX0A 4YXWA 3NIGB 1AM4D 1YHNA 4NCXA 5EGNA 3X2SA 2ZM6B 3H2YA 2RCNA 2OAQ1 4G4GA 1JI0A 1KSHA 3RS2A 3QENA 4PGHA 4RABA 4MI1A 3IILA 1Z29A 1NZFA 2AG6A 3NCTA 4HKTA 2Q2VA 1VBNA 5A9TA 2P75A 2ZAOA 1CQJB 1RMQA 2BKEA 5IAOA 2B9EA 4P3KA 1VLJA 4QDOA 2PRSA 1FRVA 1I4OA 4D81A 1GUBA 1YI8A 3FFAA 3KNZA 1IZ0A 3OX3A 3P4YA 3MELA 2GKOA 4PFJA 4U7TB 4EI2A 4ZMBA 1A4XA 4KPYA 3LECA 1E0DA 2X0IA 3D7SA 3PHLA 2Z04A 1MOPA 2JG3A 3DMTA 3SJUA 3RYTC 1E94E 2Q3BA 4PYJA 1EFLA 3OCXA 2D1YA 4BB9A 2BL4A 3N2GA 3BGOS 1TA4A 1WZEA 1JDVA 1YB4A 2ZI4A 2BKAA 3N8NA 4P5PA 3CUTA 3BOSA 3L0BA 1UOEA 1P5HA 3TTWA 3T7CA 5GZ3A 1O94C 4WFQA 3RYFA 1GTVA 3O8QB 4NYMR 3KD2A 3OE7D 1S8FA 4U2BA 4RCYA 3LOPA 2CXRA 4MLZA 3HA5A 4IVNA 4ZVVA 2G83A 3M6IA 2HXGA 2OSBA 1VL6A 4OLJA 1HURA 1D7OA 3N7UA 4OHBA 1QDEA 4CMCA 4J6EA 3L77A 4NMLA 3QLEA 4O4LA 3BWVA 2AFIA 1VC2A 2QUKA 3TVYA 1G3IA 4W6ZA 2IHNA 1ZUNB 5JZSA 4OB8A 3MD0A 4CVNA 4BKPA 4NQRA 1T4BA 2NLOA 3CY6A 4F72A 2MU1A 2BRUC 4WBNF 3FIJA 1GUYA 1KERA 5ALVA 1AJEA 3VKGA 1E4EA 4EAQA 2W6NA 1AU9A 4PGFA 3R5SA 1NULA 4JU9A 4N5LA 2XTMA 5CT8A 4ER3A 1XE3A 5IN4A 1UXHA 5LQKA 2Z9DA 1RRPA 3E6AA 2XDAA 4HN9A 4RV4A 4EUSA 4QATA 5MFPA 1FLDA 3IR6A 1Q1AA 2QTTA 1MT3A 3AESB 4MVYA 4D25A 4JMLA 2XRZA 1GU0A 2R3SA 3SM9A 2NGRA 3O03A 5EPEA 2F67A 4RVGA 2VTEA 1SM4A 2B21A 2QTMA 2MDTA 3JQDA 4F56A 3HR8A 4PBTA 4B7XA 1XPOA 3OE5A 1C30B 3C45A 3FBTA 2IS1A 2QZSA 2O7NA 3MWEA 3FNEA 1ZP6A 1QCDA 3EZYA 2HHAA 2XWJI 3DLTA 3LRXA 4FFPA 3GIDA 4HDSA 4OHPA 3CVVA 3ZQ6A 1UINA 5L8VA 3I6ZA 3QVVA 1NUTA 2VP5A 4JUAA 2ZYRA 2IV2X 4U9HS 3A6DA 2C9OA 2FW6A 4QFMA 4YB8A 2HRZA 3JS5A 2FWJA 3AT1A 5JANA 3NKVA 3QEJA 1ICEA 3AP1A 1WIWA 4BL5A 5DSXA 4PIPA 1JB1A 3PX7A 1Q50A 3OM9A 5KJFA 1BN7A 2XZTA 1AC5A 1TD1A 3C8HA 3QE2A 4I4LA 3I1YA 4EMBA 4MUYA 3F3YA 5GTDA 4YRGA 1U28A 2I5PO 1QB7A 2WWXA 4LECA 4N5IX 4O25A 5A9SB 1KFJB 3PB3A 4AVYA 3NHSA 1H3EA 3TOSA 3JPWA 2XSZA 3KQQA 8MHTA 2AK3A 4DR4B 1HDGO 5K1ZA 4DSUA 3CEMA 1CUCA 2AMFA 3FWYA 1E89A 4LC0A 4I9FA 1WVGA 4Q1AA 1DJOA 4RH3A 3VTAA 5J2UA 1ISRA 5GONB 4UNSA 3SR3A 1A1VA 2QN6A 4Q4AA 2ZATA 3PYXA 4P38A 4RCVA 4BO4A 5EQJB 5L3QB 5J3JA 1S2MA 3FXAA 4Y0AA 1TMKA 4LQLA 4UE6A 1NNSA 1B8PA 4JVOA 3T3EA 3TRFA 2HH9A 3WB2A 4HDKA 3WHIA 5TJHA 1M6WA 3B53X 3AZPA 1ILWA 1JU3A 1W19A 5B1SA 3DWEX 3AKEA 3X1KA 4BNFA 3RIHA 4CV1A 3GLGE 2JFHA 3OEED 1IAQA 3MGAA 2H1VA 1HE5A 4G56A 2ZBGA 4GMKA 2XUJA 1ULSA 4ZGBA 1R0ZA 4JBNA 3R5XA 1DC3A 2R4QA 5M5BA 1AZSC 1MDBA 3I12A 4GC5A 3AFNA 3CRW1 5IVKA 4LY0A 5CMLA 5JCJA 3KAPA 3JTMA 4KJXA 4AIRA 4H31A 5KNDA 4L4YA 1KE1A 1QRSA 1UFVA 2NV6A 1ZCJA 3BULA 1EG2A 4HFJA 5K99A 3IOMA 3Q1LA 1L5HB 2YUIA 4EITA 1CU1A 1XDDA 4B3RB 3EXEB 4FYXA 5FNZA 1RHQA 1YZYA 1JXOA 4EB6A 2V6JA 3G0CA 4B87A 4E6PA 5HKLA 2FN3A 3BGWA 2B8NA 3GAFA 1VFNA 2VHWA 3WKEA 2CJXA 2CF6A 4NOJA 2XRFA 3PDCA 2CVPA 3AY0A 5EI5A 2Y6UA 2WOJA 3VAZA 3U7EB 3I64A 1DE0A 3RUDA 2JKZA 3KYDB 1OF1A 3JQ7B 4JEMA 1GYQA 1NPTO 3RC3A 1Q92A 5TGDA 4BQNA 4DJJA 3AJRA 1DUVG 1SWVA 3S28A 3PSHA 1I1NA 4A7PA 1NE7A 4R1LA 3SS9X 1RWQA 2OBNA 1PLKA 1Q95A 1T4MA 1WAMA 3ESYA 4IYRA 1JT2A 3V8NA 3HKBB 3VAYA 4BNTA 2FR1A 3C1TA 1I4WA 3PGKA 4A91A 3JD1A 4LK2A 3V1LA 2P4UA 1DQSA 3D8NA 2GM5A 4KUHA 4O1IA 4PPYA 4RHCA 4WUVA 1HF3A 2OC9A 5HF9A 4C0AC 4NENB 1PGOA 1R88A 2AYZA 3KS9A 3OC6A 2J3QA 1NFRA 2AMJA 1OJLA 3ZJ4A 3HNPA 1MDFA 4M1KA 3W5CA 2L82A 4IUCS 2GZAA 1V45E 2SCUB 2O3TA 4FMBB 3CEJA 1PNQA 3CM0A 1TCCA 3NNDA 2X19A 2PKRA 3NNNA 4PQYA 4AJOA 1XNQB 1T36A 2AT1A 4KQJA 1TF2A 1YE8A 3I2KA 4M1ZA 4L3WA 1KSFX 1SD2A 2QL9A 1XAJA 1DPGA 3CO0S 3FNFA 3I1IA 3WRXC 3PUIA 3G2MA 1RXEA 3ZJ5A 1R0SA 4E46A 1BXKA 4TKVA 5ALJA 1EFRA 2DAPA 1K7FB 4N18A 5FADA 2AR9A 3IOBA 3CZMA 5L3SB 3PFGA 3A8TA 3I8SA 3H84A 1MIHA 1K6JA 5K3FA 1G8HA 3OBBA 3VNRA 2JRCA 5G0TA 3A1CA 1KI7A 1M6VA 5IXYA 4L2IA 2WUEA 4DBLC 3DHWC 1YXMA 2J6IA 3OUUA 2QM8A 2FRDA 3AILA 4C29A 2AW3A 2C31A 1MUUA 3LLSA 3LT4A 1WHSA 3DMDA 5EESA 4LJKA 5AKHA 1Q0SA 1N6PA 5EE1A 1TK9A 4GXRA 4YCDA 5HMLA 1SOVA 2AI2A 2I2XB 3ASYA 1WE2A 3FDFA 4GOXA 4MQ4A 3OVMA 1PJ2A 2BMDA 2BGGA 1QLHA 4RD0A 5K0LA 5E9JA 1QQTA 3GD5A 5G4KA 4WERA 1NQOA 1UZLA 4AJJA 1DQPA 2B8TA 2WNSA 4OSPA 1L5YA 1FUIA 3H87A 3Q7SA 2AE1A 2WWRA 4FHCA 4Y6LA 4MUIA 2IPXA 1JYSA 2R7KA 1X8LA 4ZRDA 1VL2A 3I6QA 1RJ9B 4JJ8A 4UQOA 5AK4A 5TGTA 4BUJA 4YQFA 4JX9A 1CY4A 4LY9A 5HCUA 2OFFA 2XNCA 1E7SA 3CX3A 4HX2A 5AJHA 2Q5CA 2AFHA 3CKMA 3GGCA 3JVUA 3DTNA 2J3JA 2NZYA 1KPHA 1M2FA 2XIJA 3P2EA 3VR4A 3V1NA 2ZWIA 1NGSA 1UOPA 2XCIA 5KYXB 2QD4A 1XUOA 3P4XA 1DIAA 4I4NA 4JU8A 1EM8B 2XB2A 3AVYA 2LRHA 3TD6A 5ES4B 5J2TB 4LGYA 4X66B 1J1ZA 5EZ6B 3HYLA 2APJA 4KXQA 4KV9A 1DLJA 2SKDA 5FTWA 2OXIA 4CLOB 2XXBA 1OLSA 1RPNA 5JATA 3ADOA 5I51A 2Z58A 5KYYA 3FNIA 1XEXA 3P8ZA 2TS1A 1PX0A 5EFOA 5C1IA 4EH1A 2RKOA 3K96A 1AKTA 2ZFUA 1AO3A 1IVNA 2PX8A 2H4FA 4LTDA 1R0CA 5KJ6A 2QL5A 1ENYA 1IDN1 2ZCUA 3MPOA 2O2EA 4OMCA 5J40A 3B2QA 2I4OA 2Y77A 4HB4A 3RTDA 5AVVA 1Z07A 3AB7A 1F3LA 3QXHA 4M2LA 2J9XB 3Q7PA 3U7FB 1QNFA 1ORIA 3R6GA 2C99A 4M8KA 2A0UA 1TL7C 1TU0A 5DTMA 1OCEA 3F1KA 3A37A 2ZVPX 3H1PA 2ZJ7A 5B2FA 4E0BA 1QRRA 4M99A 1TZJA 4MKXA 1FBTA 1BHSA 2W11A 3DKKA 2E4YA 2ZVJA 2W4MA 1BVUA 2IHKA 2XYGA 1UWCA 4YCJA 3NQ41 2YOHA 2V7QD 3CRZA 1AK9A 1JE0A 2WKSA 3F6EX 4REQB 4B7UA 2C2MA 3ZQUA 1Z7GA 1OFTA 3RF6A 3WK5A 2BPOA 1P61B 2VHJA 1E77A 1E1KA 1KKUA 1LQ2A 3IXLA 3ZUGA 3CLVA 3KYCB 3QBVA 3CFYA 2IYUA 1YQWA 3R44A 1E79D 1MX5A 3UAOA 4EY4A 3N2EA 3EBLA 3EYWA 3KUDA 1VE1A 4ZKEA 3W05A 5AKYA 2C88A 4E15A 4QUKA 5EXTA 1QNLA 2IDZA 2X2PA 5IJXA 4ZYWA 1PJZA 2VPWA 1N0IA 2QRLA 1AD2A 4DC9A 1Z08A 2DCMA 1H42A 3CZQA 4IAOA 1RCTE 4MUFA 3S55A 3RM3A 4DB4A 2FZGA 4E1VA 3RAJA 1NIPA 1GTJ1 2CFSA 3DZ8A 4Y9SA 3RSOA 4BLTA 5BYAA 1E2PA 2A5JA 1KFKB 2GZ2A 3SFVA 2V97A 3VZQA 2XHZA 3IFSA 3SZMA 4B48A 1F5NA 1KEEB 2NV2B 3PTLA 3VFDA 3VZBA 3LDGA 2GEBA 1A4IA 3VYRB 2UV8A 5DBOA 3ENNA 1SHZA 2CCGA 4F84A 4C4AA 1F38A 5JD5A 2FMXA 1M1XB 2GK7A 2Q3JA 1AURA 1HBJA 2XQFA 3PD1A 2C98A 4HJXA 4ZZ2A 3UATA 3A4VA 3WIDA 3SC2A 1GNSA 5TPWB 2WIJA 2PQ6A 4IS2A 1PR3A 4TLDA 4LZOA 3NUZA 4Z4HA 1X77A 2X77A 5A05A 4AY3A 4M8IA 1PRYA 3UMBA 3RVPA 3HXKA 2CK3D 4U2DA 3ZGOA 1OBCA 3ETLA 3QIVA 2H3EA 3WGNA 4WE3A 4EYEA 4CT4B 3ZX4A 4WGGA 2QNRA 1QO0A 4YRZA 2RI0A 1Q5PA 3KOWA 4U02A 3T6KA 3WGMA 2VRNA 3P2YA 5AHRA 4OK5A 3QYPA 4DLWA 1GPYA 1JEYA 1GPWB 4OAQA 3QG5A 1UMBB 4G01B 2J45A 5IYZA 3K0EA 5K8IA 3T3MB 4L50A 3GCGA 1NHGA 1Z0FA 2XZOA 4CKZA 4X94A 2ZIUB 1TB4A 3NTUA 5F1PA 4TUYB 3MRXA 1ZK0A 3R6TA 3TOCA 4AMBA 2CMDA 3DC7A 4YCLA 4OX9Y 5DLEA 2Y1OA 4XE5A 4R3NA 1S9DA 1H2BA 2OV2A 1SQ5A 2PZJA 3FJOA 4ZDIA 4FYJA 2B83A 4JLKA 1M2JA 1TYEB 1C29B 1E69A 2G9UA 2WUGA 4J1NA 1RQLA 2O0HA 4X1KA 1Z34A 3MJRA 1SHLA 2X3UA 5T67A 2JFXA 4N82A 1UZAA 5BV7A 5H3HA 4B6GA 3ZV4A 4E2ZA 2J48A 5AKEA 1XJ0A 1I4LD 4QDUA 1VLHA 3MMPA 4W1RA 3PBKA 2IHVA 3L0SA 1VG9B 3VPHA 2W2PA 2RGYA 1DG3A 1E1QA 1FSSA 1VA5A 1XZMA 1RWPA 3A1EA 1CFJA 1E4YA 2GJ8A 4E5PA 3S7TA 4RA6A 3QPVA 4UDOA 2D5BA 1MO6A 4L8FA 4QRIA 1MW8X 3D6AA 3QJGA 3FFWA 4U7DA 3HSKA 5DNEA 1JW9B 1T24A 3D4BA 5BR4A 3HU3A 3DFFA 4MR9B 2ERXA 1FPQA 2ETXA 1A3CA 1DIRA 2F8MA 5HK8A 4A1FA 2Y68A 2LP4Y 4DNQA 2E4AA 1F6DA 3REGA 3S8YA 4EUHA 4BCCA 4JLBA 3L8DA 2AMYA 1G5IA 2G5GX 2AFIE 4CGZA 3OF5A 4QARA 5F4BA 1JEAA 1E9DA 2QQGA 4QBHA 3B1ZA 5AKXA 1T9KA 5FPHA 3USES 2WSLA 2HDWA 4GBED 5LM3A 2HHJA 3R7SA 3KCNA 4B5KA 1L5FA 3DFIA 3IB3A 5CA0B 4HDAA 1BWQA 4JT8A 1O87A 2PNFA 2NZXA 4B79A 3E27A 4N49A 1OGJA 3I34X 3M6UA 4MYHA 4I5EA 2FEWB 5JBNA 4I1RA 2O2HA 3ABRB 3ZYZA 3GAZA 1C8BA 2F6RA 3DEKA 3N86A 4XVRA 4O4HF 5C2JB 1P1CA 1QZZA 3CF2A 3NGLA 1YA4A 1DBSA 4LHXA 4QRDA 3GLFE 1GTZA 4KBGA 2XF2A 4UU1A 5J59A 3BQ9A 5B3JC 2O20A 2GBPA 1SXIA 1JA0A 3MUOA 4O5AA 3K0FA 4RXTA 1KU6A 4EW3A 1QVWA 1SHJA 1OB5A 2EVWX 1XTUA 3ELDA 1PTKA 2CEKA 4ZYLA 1NSYA 1W2GA 3FLBA 5FI3A 5TB5A 4F2DA 1IUOA 3WL6A 1ELOA 3L7KA 4DEYA 3BAFA 4MV6A 3SHOA 5ITWA 1RXCA 2QG9A 5JCOA 4OKIA 3O3OB 4JL5A 4X61A 5FBLB 4RTNA 1UZUA 2F3RA 1QZXA 2BBOA 2YHAA 4JX8A 1XAHA 4L6IA 2G09A 2BHLA 1X1QA 2HRBA 1V26A 2O5VA 3Q15C 4N6OA 1G6Q1 1N9GA 1YS2X 2LUOA 3L4EA 5BNIA 4G67A 3DEZA 1KYTA 4BC0A 4F7WA 2AF4C 1PNRA 4ITRC 1V4NA 1FFAA 1O1YA 1FP4A 2CL7X 3DONA 2NU9A 2XA1A 4BO7A 4PLTA 4QPCA 3U4DA 2VH1A 1R5BA 4L4UA 5CDYA 1Y9AA 3NV7A 3JW8A 3OMWA 4Q4HB 5A6SB 3LZDA 1M33A 4IO1A 2CFIA 2AOXA 3VJLA 1H2WA 1G63A 1U98A 2X86A 3F0TA 1Q3KA 3TK1A 3QLVC 3ON5A 4IHAA 1GN9A 3IKMB 2C00A 1UM9B 2D5IA 4KKVA 4LZNA 5DE3A 5ESXA 2WP0A 4Y7DA 1AKRA 1C1HA 5A3JA 5CB4B 1XRMA 2CV0A 4B7AA 3TOXA 6YASA 3EPJA 1RT9A 3OECA 1U99A 1U7HA 2L69A 1W4LA 2XPCA 3DBRA 3HDGA 5IMBA 5KNBD 2BR5A 3CVJA 2C4VA 4FHGA 2GLTA 1EQAA 2B25A 3WGIA 1TOAA 4UEQA 4L95C 4US0R 4PO8A 3IQIX 3GIWA 4DZRA 1GFZA 4NF2A 1VE6A 2KYRA 1XBTA 2ERYA 1O89A 4KYUA 1Y9ZA 4MNTA 4BC1A 3LRPA 2HDNB 2JFOA 2C1ZA 2YJNA 2AZ4A 1ZZEA 3EDOA 5FWAA 3OPNA 1Z4NA 3F49S 4PQGA 1USIA 1NKVA 1REQA 1ZJYA 4F3CA 3SHFA 3TNFA 2IU0A 1XXLA 4UTZA 1TJYA 3W3AH 2DEUA 3OIDA 4L0CA 1N2IA 1MJHA 3FN4A 5K8CA 2O2DA 4UM5A 3OJXA 1DFHA 2G63A 2P9BA 1OR8A 4XOUA 1DBVO 2VBCA 2QMYA 3DOEA 4KGDA 3RRYA 3PFHA 3VJKA 4B80A 3TZEA 3S6JA 3CUVA 1LH0A 3QFCA 4LOAA 3OIVA 3REQA 4YUWA 4BO6A 5AUNB 1V71A 3T0IA 4QG3A 2C4KA 2C3YA 3GEMA 5E7JA 2I78A 4BFXA 1OLUA 2VUSA 2I4TA 3VXKA 2HIAA 1OIWA 2VDWB 5IWAB 1JLRA 1X15A 4FUTA 1E6WA 1OTHA 1ZI9A 2EL7A 5E2IA 2FPRA 5T57A 4XX0B 2EKBA 4CL0A 2YZ2A 5ADUS 4OHWA 2REOA 2YHSA 1GGMA 4K03A 2JGAA 1HE2A 2P1RA 2GPTA 1SB9A 1BDMA 1ZCFA 2WVGA 4A03A 5HUQA 4GPEA 1KKMA 1LK7A 1QTRA 1UR5A 3LH5A 3U62A 1ONPA 5DNCA 5ICSA 3T7JA 4DGQA 5LJLA 4C05A 2OKGA 1JHDA 2Z8XA 3QVGA 3SKYA 2NO9A 1W8DA 2XYPA 3N2LA 4YMIA 4MWDA 2G5PA 4YV0A 5L9AA 2B5WA 2GCEA 1YS1X 3Q88A 3QE3A 4QOHA 2PX3A 3PUXA 5ITSA 3IP1A 5I7WA 2J09A 5J23A 1F0YA 2QV7A 2VT7A 4UNIA 3W2GA 3VOSA 1BOOA 2D4AA 2WIDA 3HCAA 1SOWA 3LCCA 3D5TA 2X0DA 4LJ8A 4OUDA 3UB4A 4EW1A 2PV7A 3QKSB 4RAQA 3CNQS 5AT1A 1B7GO 1IQPA 1V6AA 4OQPA 4YEDA 1TDJA 2RJOA 4L9SA 1ZG3A 3MYYA 4L4ZA 8OHMA 2X9QA 3M5CA 1MNQA 1G20A 3QVSA 4P31A 4EAAA 1P81A 3ORYA 3D3NA 4N5NA 1XVAA 3D3WA 5IT9A 4KLRA 4HBGA 2RAVA 4MW1A 1VJ0A 1ST3A 3L8MA 4KQCA 3P9YA 5AK5A 1V9CA 1SFRA 3LVRE 3C8UA 2VJAA 4Q1CA 2ZUSA 3THYB 1H69A 3ABQB 5DCLA 3ABOB 4D0LB 1A9OA 2DC1A 3L8ZA 3DZKA 1MO3A 3D2AA 1TUEA 1AF4A 1GNVA 1P17A 2VTKA 3I58A 2Z3WA 2AH5A 3IMGA 1CR4A 4MWOA 5EL0A 1AO0A 4W9NA 3HY3A 4P54A 1VSQA 4Y6RA 2O2YA 1L5VA 3MJ4A 5DNYB 3W8RA 1FS6A 3KHKA 1NNLA 3SK0A 1WKVA 3U4MA 3PDUA 1D0VA 4AJLA 4UHFA 2P7IA 2XB9A 3KOUA 1B3RA 5K3EA 3RC8A 4CM8B 1IG0A 2W2QA 3FYUC 3NORA 1G8JA 1Y7HA 4FCCA 5BSUA 3WNCA 2RHWA 3BYZA 4DRXB 4OXKA 2A7QA 4K0RA 1P19A 1FSPA 1IFXA 3G13A 1OSNA 3AUTA 2IHBA 3IXQA 4E33A 4M7RA 4X54A 3HS3A 4C7KA 1L7EA 3G2OA 5TXGA 2WSIA 1ZOOA 2OZVA 4JBLA 3FUUA 5FX2A 1A5AB 3TVDA 4EO7A 4F8EA 1SVUA 4IJ5A 4KE9A 5ALZA 1JFSA 3O6VA 1JIJA 1DC5A 5FO1A 3G1UA 4XM1A 1KBZA 1L8AA 1NJ1A 1SD1A 1YHYA 2FP4B 2ODPA 2X4GA 2WP8J 1WUKS 2BOVA 2GN1A 2R8EA 2QF7A 3LRTA 4FNOA 4I08A 4XGRA 4BLSA 1V8ZA 3B8EA 4RV5A 1IRXA 2AFRA 4TYWA 4KFUA 1PUJA 3B5JA 4G1VA 2C5SA 2YZKA 5H70A 2VHTA 1LBEA 1VFPA 4R8KA 1X1AA 1XKQA 2AFHE 2PK3A 2PT5A 2XEXA 1J56A 4FBLA 4URWR 3U3XA 3HUTA 4Y2JA 1YS9A 4GMFA 4ALLA 3K9WA 1MAVA 3CMMA 2HNBA 3M6AA 4F9FA 1EFPA 1ZGJA 2GWHA 3TGWA 2YDYA 3KLNA 4U9IS 4ZYTA 2CSUA 3QIAA 4MVJI 1EXNA 4GMGA 2PRZA 3ORQA 1KRHA 1ZC4A 3W79A 5HVNA 5GJCA 1G55A 5SYAA 3R9XA 4LGCA 1UBHS 5CX4A 2Z2IA 4B9EA 4MA5A 2JLRA 3UQYS 3VV2A 4MROA 4BY9E 3S40A 1KZYC 2DQSA 4R7GA 1Y3IA 1XZQA 4BWFB 2ONCA 3HJUA 4ROTA 1OXXK 3C1OA 4JYBA 4KQXA 2P2GA 3IEXA 4WCFC 4X1YB 1KQNA 1SO8A 1B2LA 1Y6JA 1SOMA 1WDWB 4QREA 1FZTA 3M9LA 4R1NA 1IDOA 5F3WB 3SHTA 2Z3ZA 3FCYA 1H0RA 4Y1RB 4FFDA 2QG4A 4ABTA 3WWCA 2W8ZA 1MRSA 2DQYA 4DZTA 3AR3A 2Y2VA 2O8EB 3KX2A 2I1LA 5SZJA 4FD3A 2ZE8A 3AUSA 2QX7A 2AOVA 4OP2A 5LVAA 3BL6A 4DV4B 2QJWA 1U31A 3RWOA 5EAIA 4WSOA 4UTNA 2OZLA 4BO8A 1AHIA 4XDGA 2OFXA 4CI9A 4R2XA 1JKFA 4YC7A 3M34A 5ES3A 2QG6A 5L4NA 3ZY4A 2NVUB 5KYWB 4RULA 1MR3F 1H0KA 3EQ8A 1HLPA 4C22A 1TZMA 3PPWA 2G06A 1O9HA 2YC4C 3QUSA 4K9DA 4KQHA 4O4IB 4V38A 3GDFA 4CUKA 4IDQA 1IOLA 2GN6A 2RBGA 1V5EA 4JHXA 3QJYA 1KI1A 4FTWA 2IUFA 1SCKA 2GCGA 1L5NA 4UHKA 2QLTA 3VTZA 2AMVA 1P8JA 3N58A 4MS1A 4LYFA 1I1QB 2O9JA 4H2DA 3X0DA 3D7LA 2DPLA 3GFFA 5FI1B 3RABA 1N0UA 2LGJA 2QAJA 2OZPA 1AGXA 1FXUA 2DLCX 3GB9A 1CUZA 2V6IA 3KWMA 4JLWA 3T7DA 5AKZA 4FNAA 4QYSA 1OXKB 5EP4A 1JA9A 2XMSA 4K6CA 1SIWA 3QY0A 4L76A 3NAMA 4O08A 3TLJA 4NVRA 4Q7KA 5AI4A 4BX2A 1NVDA 4R4JA 2AKAB 1EFUA 4EEZA 1ONNA 4R2JA 3R0JA 1CZKA 3JAKA 1JFFB 2NWQA 1XZCA 1Z74A 1Q3HA 1SXGA 2DWUA 2W2KB 3NEAA 3FMIA 1ZGCA 3FPFA 4A8TA 1MB0A 2GSDA 3SZGA 5G3ZA 3S2ZA 5E8JA 4HQNA 4NK5A 2MYUA 3ASUA 3GAAA 2IZ7A 4GWGA 5KC9A 3CH6A 3VHXB 3JU3A 4PR0A 1QC5A 1YFLA 1EE9A 2NP7A 3C3KA 1H2RS 3RANA 3RRZA 1Q7GA 1DIOB 2WTMA 4OGWA 4CTOA 3RSSA 2XQGA 2F4VB 1LLFA 1TYDE 5IJ0B 1UJBA 4FHFA 4TMZA 3CRRA 4PGGA 3GN1A 1R37A 1SVKA 1UWLA 4G89A 1PEDA 4LIPD 3UJ9A 1DP4A 3V8MA 4AT1A 1EWQA 3P9RA 4H7JA 4ZICA 2FPIA 5ILGA 3EEBA 1Q12A 1XRJA 3UXEA 4CUJA 1HYGA 3CU5A 3U4QA 2D2XA 1XMVA 3FTEA 2IU4A 1FFXA 4PSUA 1UUFA 4REOA 3HV2A 1VCNA 3OWXA 1ORDA 3RI3A 4EX7A 3KPVA 2UUAB 1COWA 3I92A 5JSFA 4F3KA 5DHTA 5FNVA 2JATA 3B6IA 4A82A 1LVHA 2YIMA 4WBNB 1T5DX 5DM60 2ZYDA 5CBKA 3C15C 1C0EA 5CH3A 1AS0A 1FRFS 1YRQA 4B3IA 1S8NA 5KNCH 1QRAA 4GKVA 4JFRA 1WUYA 4QELA 1Z35A 3CZPA 1A2KC 2R6HA 1XR3A 4JXZA 3QM1A 1T10A 2A94A 1EGAA 3JQEA 4FLFA 3OPVA 4GKAA 1JG4A 2O8DA 1L7VC 2CVZA 3AERA 3R3UA 4YJGA 4CEIB 3ZVLA 3PEWA 4PCAA 2GK3A 2JVIA 3FJYA 4AY5A 4BQQA 5CAEB 1PZGA 1ZISA 1RAFA 3H6HA 1ODTC 5K8VA 2I9PA 3S27A 1OZ0A 3HSYA 1G8YA 2I4NA 3D8BA 1RXVA 1O3YA 1DO8A 1SMKA 2V55B 3V2GA 5KC8A 1Q14A 1WXFA 3AX6A 3RTGA 3FOWA 3UXMA 5FUMA 3KKZA 3QKUA 5K0GA 1KHTA 5AVYA 2LKCA 2P8SA 4AP5A 3ENQA 5HNKA 1T8RA 2Y0DA 2PO7A 3MLEA 4YP6A 3N6VA 3AVPA 5MN5A 1BE8A 4OQYA 4TKZA 1TM3E 3WGYA 3CLSD 3PRYA 2G1AA 3FUTA 3RK0A 5B5SA 2XXAB 4N3CA 3ZUPA 5AJTA 5IC6A 5HIAA 3U4CA 3OY7A 1O9BA 4W5WA 4H17A 3W04A 3DFMA 3KVRA 3O7MA 1U9IA 1RBZA 5DGTA 5KIAA 4FYYA 5FPTA 4TXHA 4YPVA 1A5SB 4HPXB 3KOYA 4K1XA 4PNEA 2ECOA 2GCPA 3IHLA 5EP2A 1L4KA 5KNDH 3A3KA 2NU6A 1XA4A 1I4TD 1PG0A 4MJLA 1NG1A 2HA3A 3CCFA 1MVNA 2J46A 3D81A 1UMCB 2YMLA 2FWRA 3NH6A 3PITA 3U3MA 2AXPA 3U3RA 1G7SA 1TMYA 5AK3A 1V8FA 3IJEB 4AG5A 2XF8A 3C3AA 5GJBA 3VBCA 2MINA 3C6ZA 3L93A 3R3JA 5YASA 4CMBA 4KPUB 2WJ4A 4ZQGA 3I4FA 1J8QA 1S5PA 2R62A 1RYNA 3LUCA 5AMXA 4HYQA 2ZR9A 1BMTA 1E8DA 4KEAA 4UPVA 1N2EA 3TW8B 4AX8A 1E1NA 3BMNB 2E5WA 4O4JA 1NV9A 3G6KA 1KARA 1WETA 3PKIA 4OX9B 2IYRA 4KQEA 1HQCA 4QUJA 1A8UA 1FFGA 4HMOA 2F9LA 2J4CA 1W85A 3C7DB 4RK1A 2R84A 2ZRHA 4LHEA 3HK2A 1VLZA 4HEHA 4HZGA 3ZWQA 1QP4A 1C3OA 1RYHA 3P1JA 2HW8A 4B6RA 3VSCA 4F6RB 2ISCA 1CJVC 1KH1A 4AY2A 1RYEA 2CLMB 5F73A 3RTAA 3T34A 1OX4B 1VI2A 4QTXA 2VYQA 3FKQA 4RMIA 3IEUA 4WKCA 4ER7A 5JS1A 1YJQA 1Z06A 3R5TA 2PCLA 1QO7A 4LXHA 4YAWA 4DA9A 1F4VA 1ZH2A 3EISA 3ID6C 3LA8A 4K9MA 4DBZA 1HEIA 1Y8RB 2Z4RA 3BFVA 3F7MA 3LV8A 1ZD8A 5A9RA 2V1UA 1ZICA 4TLBA 2C7PA 3GLHA 3KDSE 1QWOA 4RM2A 4DUGA 5LQNA 4FYKA 1VHJA 3HA3A 1MJNA 3LYLA 3NOXA 5A4AA 3B48A 4FYHA 4KNYA 3U6KA 4W5RA 3FOCA 5D6NA 6PFKA 1BWPA 4LDJA 4NSNA 1PJ4A 2YCLA 4O02B 2YMPA 4ND1A 3K5WA 4MRMB 3SQNA 1UPXA 4M7OA 1ZGHA 4YJ2A 4YCBA 4Z1MA 4G0ZA 4C30A 2FXIA 2JGMA 2PSJA 2IEBA 5ALRA 2DR3A 3KL4A 5F7XA 1QQ7A 2YZ7A 3MS2A 1O0CA 2CV2A 3NG1A 4KODA 4OXQA 4N1AA 2YFQA 5TS3A 5I3CA 1M8PA 2C92A 1TIBA 1WX1A 3EDCA 4GQIA 1P4JA 1PJ8A 3IS3A 1EQ2A 2MYNA 2WFMA 2Y1DA 3EUFA 4A8JB 3OLYA 4PPNA 2XUZA 2R8XA 3BZWA 1JIVA 1WV0A 2Q21A 2R85A 3M70A 5GIOE 5K0ZA 3ZDZB 5IKEA 3TZLA 1FYDA 1HDCA 2IW1A 4HDNA 1ZXLA 2VDMB 1XJQA 3HCCA 1HC7A 3VH2A 4MVJA 1JQLB 4MITA 1NF3A 3T38A 2GXSA 1LSJA 1RRVA 3CUWA 2RC6A 5EWMA 3G6WA 3TNLA 2O3JA 2OKCA 4NCNA 1E2QA 1F51E 2GESA 2CYAA 3H83A 4XOIA 3ZDEA 1SKMA 2Y93A 4L02A 4QGFA 1TPYA 4I46A 4UOQA 1JFLA 3ZR4B 4AX4A 3GCWA 4EJSB 2PSSA 2VZ0A 3JQFA 3WAGA 1V7PC 3VYSB 1BWSA 2E7ZA 1AT1A 3Q3GE 3VNSA 1C41A 2I2BA 2PXHA 2WHQA 1F8UA 1VMEA 3VR4H 1NATA 1Y5NA 1IN8A 4JDUA 5EMJA 2P2NA 3ZLTA 5A06A 5DHFA 2F3UA 1U4SA 2X5NA 1KC3A 3PKZA 2JD2A 1KVQA 1C3JA 3MINA 2IYAA 1SIBE 5K0TA 2X6QA 3CH4B 4F3NA 3LQYA 2JI6A 4PGAA 2W70A 4UM9B 1JKJA 2AOTA 1QORA 3FDZA 2JAHA 2W0MA 4J2HA 5TMDA 4KR3A 2ZR0A 4DCJA 2JKVA 1SXJB 3S8EA 3M1YA 1FX1A 1PS0A 2A3RA 2OQ2A 1QWSA 2XW6A 3GRZA 1AXEA 1G8AA 4QQ8A 1EK5A 4XX1A 5ADWA 1CZOA 3MJEA 4OL9A 1BGXT 5LQSA 4P0PB 4JITA 2W5UA 3I52A 3PU6A 3K8QA 2DFDA 2WZQA 5HMMA 3G5UA 2R6DA 4UM7A 3KR2A 1NXWA 3USCS 3UWOA 4G5FA 1FTYA 1N57A 3B3GA 4FSXA 1YQTA 4BXOA 5AVQA 3KKEA 5JJBA 1JHXA 2OAGA 5ALUA 3UN1A 3SLKA 5ALLA 3TTXA 3TZKA 3OLZA 5KYKA 4URVR 4J7AA 5K01A 1V43A 5FBVB 5KWSA 2HFJA 2C9BA 2IYPA 4JZYA 2F9MA 2B7BA 4UFNA 1VMKA 3WGLA 1Z6YA 2GAFA 5H7XA 1Q57A 2XGGA 4TMKA 3L6CA 2GBCA 2OB2A 3B6ZA 4RBNA 1ZAKA 3MBKA 3SZOA 2B36A 3GPIA 2I6XA 1MOSA 4O2AA 3HDVA 2BGLA 1RWVA 3H5TA 3I37X 1CETA 1IXSB 4TYQA 1OWLA 4NL4H 4OHMA 4OBEA 1QH8A 3HG7A 1KC1A 3ZLVA 3O38A 1NWHA 1WMFA 4X44A 3FPLA 4LNUA 4ESOA 1BMQA 1T13A 2WEKA 4FCVA 3X2EA 4B6FA 1AK1A 1EGVB 2L19A 3CVYA 3S1SA 2JCGA 1YOVB 3A26A 3WLIA 4BNXA 3GZTB 5K0FA 3AETB 4ER5A 2B99A 4RM3A 4TLCA 5ER6A 2UYCA 2MSEB 1P60A 4HWSA 2RJ3A 4Z7JA 4ZHQA 1FYXA 1D3AA 3ELBA 1UK7A 1JAZA 2UZ4A 4G6ZA 2QZZA 4G0MA 1PR4A 3BILA 3MWEB 3PEUA 4EIWA 3C6QA 3O8DA 1JG1A 2X0NA 3ANSA 3IP9A 2C5HA 3QKRA 4WJZA 4EKEA 3LS2A 4MUGA 1GL3A 3DYBA 4PG6A 4OBWA 1Z2DA 4E22A 4DCSA 4XSHA 1X3LA 1TVKA 2XA2A 2H5EA 4AUMA 1KIFA 2P2SA 1ZD4A 2E55A 2H1WA 3H16A 3TMYA 5CVCA 3TXXA 1ZW6A 3O3CA 3JQCA 4UHJA 3VKWA 2WKRA 3OE7A 1V5WA 3EVBA 1PR2A 2G5CA 1A76A 1CUBA 4AJ1A 1SU8A 1J5XA 1X74A 1RLIA 3C3EA 1D2EA 3DT9A 1C1YA 1QG2A 1ACLA 1LDGA 3QELA 4I8DA 3SHWA 1O97C 2HCJB 3RU7A 2GPBA 3Q0EA 1QV6A 2E85A 4WGFA 3CUSA 3RIXA 1MOQA 2NU8A 4IINA 1L6RA 1YT5A 3LLUA 4K2HA 4MIKA 1Q0PA 7REQA 3R8FA 4RMHA 4BBAA 1IBRA 1K3UB 1QHGA 2WUWE 1KJQA 2IELA 1U7PA 2NTVA 3FWNA 4KQGA 2FB9A 4RL6A 4IP0A 1XI2A 4RPLA 3TI9A 3BORA 2ZBUA 2W4IA 5NULA 5KHLB 4EWLA 1XQ6A 4NU5A 2PN1A 1HDXA 2X9VA 3X1YA 2HHCA 2HPZA 3D31A 4LYYA 4KKXB 1SZDA 4FR0A 5JSHA 3GGDA 3NHBA 1SCDA 5A3SA 3RNLA 3ADCA 1S2IA 1UJ5A 2AXQA 4LYAA 1GAEO 3KPUA 4ALKA 2E37A 3D4NA 4D6PA 1S2NA 3TQFA 4LZJA 1P4AA 3IX7A 3M2TA 4B32A 1DOHA 4YMLA 3EK2A 4CEJA 2IUTA 3Q11A 4N0DA 4RENA 3JCZA 2LR0A 4HMPA 1U28C 4MH0R 4K28A 4O4JF 1IU9A 3UUFA 2IYZA 2F1HA 3BREA 1FFYA 1K9VF 3GFRA 3EJ6A 3P7MA 4H16A 4YAKA 3TEJA 4R98A 3V5NA 3NPMA 5AVOA 3U16A 3BCSA 5EIWA 2DUUA 1T0UA 2QRVA 1TU4A 2ZSDA 4EVSA 2VZ8A 1T9BA 2PG3A 2XMGA 2Y6VA 3MWJA 4QICA 3RAPR 3MERA 2GPNA 1GTMA 5E9WA 1FMTA 1NAIA 4ZVSA 5E6SA 2X5XA 1GPNA 2AN3A 2H1HA 1N0HA 3RC2A 4MQUA 4DCOA 4M3NA 1E98A 4XYEA 3K4HA 3ES9A 4KOAA 4C4YA 4MKZA 1LS1A 3THRA 4WOKA 4AURA 1QHXA 5I01A 3RV3A 3OJ0A 3KYIB 3R7AA 5FAXA 4RSHA 2UUOA 5JWRA 2HR1A 1FRNA 4XCQA 4RJJA 3SF0A 1X8JA 4HNAB 1NW8A 3RUHA 1RHRA 2VSQA 5CVDA 3T1YB 3I45A 3WSVA 4QU8A 2GM9A 4TMVA 4BE9A 1LSOA 1S8AA 2ODWA 1I3OA 4LXUA 5I9BA 2E4WA 2HBYA 1V48A 1I13A 2AJ8A 2DZDA 3RSCA 5LP1A 1E2HA 3AU8A 1JLHA 2RGXA 4GU5A 2O7VA 1E1LA 1IXRC 1ZOIA 2YJ3A 5CLHA 2C97A 1BCSA 1SG9A 2VAXA 3AEQB 3ZNOA 1YUBA 1YA6A 1JIKA 3U9TA 2D3WA 2DBQA 2V54A 3ENKA 1BDJA 4MW9A 1TJ3A 2CHGA 2FKAA 1IY1A 1RHUA 1V1RA 4J91A 2V0NA 3BC1A 3G0OA 4Y2VA 5EJAA 3PNQA 2WFLA 3OEEA 1R5OA 2FQYA 2REBA 1U04A 2R2AA 2LIVA 4RSMA 3DCNA 2XQJA 3ZXYA 2JGRA 2EXXA 1OWOA 2Q5JA 3M49A 3NIDB 4W7SA 3QXGA 3UWSA 2VNSA 1YU6A 5F21A 4C4SA 2HZ7A 3X43A 4WFIA 3NWPA 1JLKA 3TQTA 3U3JA 1SC1A 1V3VA 3GVPA 3NO4A 4ZOBA 4D3ZA 3IYLW 5JNLA 4ZEMA 1DC4A 1I0IA 3QA9A 4FYMA 1D5CA 4IR7A 5ELMA 5CVUA 3ZG6A 2O3UA 1K4YA 1VPEA 4IOLA 4M0MA 3T7SA 2O2GA 3DNFA 3EC2A 3JQ8B 3E7PA 5I9SA 3W78A 1GRQA 2VJYA 1QRTA 1XJ5A 2FQWA 3FCCA 3K0AA 4JR2A 1D2CA 3LY9A 4O4HB 3UK7A 3ZVNA 1MP0A 2IXDA 4I0WB 4AP6A 2IOYA 4XYGA 4K6GA 3WL5A 2L17A 1NUQA 1AKWA 1JHYA 2R6FA 3EVNA 4FOOA 1PJCA 3K9NA 4QYMA 5D1NA 4AJ9A 1B76A 3UAYA 2ZRLA 2QQ0A 3L8HA 2PZMA 4AN1A 2JIRA 4L2IB 4FGLA 3GRYA 2ZYWX 3ICQB 3H42B 2AQIA 3MFQA 2XUGA 4H1VA 1D1SA 2BGNA 4CIXA 4IOMA 3L1HA 1ODJA 1P7PA 5FFMA 1P3JA 1V1MB 1G64A 3PUYA 1WHSB 2G07A 2WZDA 3AEXA 5H81A 2OOKA 3AK4A 2FEXA 4J03A 4L8LA 1NVTA 1I1OA 3CRNA 5DXAA 5FWXA 6LDHA 3WGVA 2YRXA 2KWIA 1ZBDA 4PSAA 2ACEA 1JJBA 1I6WA 4ALNA 3HJTA 4RE5A 3PQCA 4Q1EA 3SSMA 2XD9A 1N77A 3DL2A 1F48A 1M3SA 3MN1A 4OK3A 5CJ2A 4W5JA 5FUVA 2A1TR 1J99A 3THWA 4CMJA 1EUCA 3OCZA 3VTFA 3C14C 1X9IA 3AFIA 3HV0A 5SY9A 2B9VA 5IX8A 2WIAA 3PNSA 5BY2A 3FPJA 2RHBA 1OXVA 4W7IA 4ZTUB 2JCVA 3Q9LA 2FVYA 2FRDC 4LWOA 4Z3OA 4I55A 1ZCAA 4Q66C 5GOTA 5DW0A 1QE0A 1G38A 3MRVA 2O2XA 1E2NA 1JXAA 1UT8A 3F1LA 4H6PA 2Z43A 3BBLA 4J1TA 4YUAA 1SVMA 3KD3A 5AKJA 4DM4A 1A82A 3WVNA 4E5SA 4DA4A 3JZIA 3DDNA 4LCEA 3LXUX 3DE6X 3E1GA 4P3XA 1PKXA 1DQYA 1TT7A 1B42A 4TM8A 5JO9A 3ZPXA 4F6CA 1DKOA 1M2VB 4E13A 1EINA 2YY7A 2BSXA 1WNFA 2H7VA 1JWLA 1DAOA 4W8HA 5IM4A 5ENVA 4BBPA 4X20A 1KS9A 2UUPA 4X7BA 4BDSA 5DIFA 1WQ4A 4AI6A 1C0PA 3E53A 2C1EA 4TXLA 5JEEA 1NJGA 2REQB 4JNKA 4RK4A 5KKAA 4CLRB 4BB5A 3ORRA 2JI8A 3PI7A 2CE7A 3VZRA 5IDXA 3W2IA 5LP6A 2A33A 2FCAA 1Q0TA 4IQGA 5E3IA 1NNUA 1ODIA 5ICMA 3VH3A 1YIOA 3AG5A 3EN0A 3IRVA 4JI2B 2DBZA 4EO4A 1VHQA 2EKQA 3JVDA 5ITVA 3HBMA 1W48A 3V97A 5BVHA 4PRLA 5KCMA 1TVCA 1EDBA 1R0BA 1TQDA 1U2QA 3TQHA 2D3TA 1G3RA 2R7AA 2BW0A 1W49A 4N54A 3T1VA 3U3ZA 4CIWA 2WVHA 1R6DA 1Y0BA 1YBMA 3K2BA 4R6XA 2CLEB 1H3NA 4GLFA 3NBAA 1T2UA 4KMOA 5EP3A 5F52A 3OQOA 4EA9A 4CMIA 1SOUA 1COZA 4NABA 3RU2A 4J07A 3KB1A 5DNUA 4GE0A 3IHKA 4QQNA 1ZEMA 2K5UA 1F4PA 2QPTA 3QU7A 4JASB 4PZLA 2RKBA 2ZIWB 4EG3A 4S0ZA 3RS5A 2YWEA 2X15A 4IMIB 2H07A 1XQVA 4C2BA 1Z75A 5C80A 1FLAA 1L8QA 3Q2OA 3DAGA 4BX8A 1F8YA 2E89A 2I8LA 5AH0A 3BH7A 1H8ED 2CE2X 2DG2A 2Q3MA 5FWNA 1QONA 4MEJA 3OU7A 3EIQA 1T5LA 4MI9A 1NZJA 3T4EA 4YV1A 4GPIB 3JQBC 1CC1S 5EHZA 1Z5GA 3JSAA 2D0DA 4Q9DA 2IXFA 4O63O 1ACJA 4V0ME 1L5GB 4HAYA 4LSZA 3ZTWA 3VKUA 1UAAA 1U63A 1RBQA 4QUAA 1XDGA 3EGIA 4X7PA 3SXUB 3I3SR 2CFTA 2J0QA 3E5NA 4BRWA 2O8BA 1IULA 1SCUA 2DFPA 4NV3A 4YCNA 3ESZA 4MVJE 3SC2B 2IS4A 2X1LA 1BE0A 3KKNA 4ZCIA 5CTJA 1DAEA 2GZDA 4C6TB 4Q7QA 1NBIA 4NONA 5ALYA 5FAKA 2I9KA 4F9EA 1V39A 3V00A 3PWZA 4JFAA 3M4NA 1O4WA 4U2FA 1PJ3A 4R9UC 3R9IA 4W7HA 5TDHA 4LS3A 1M6EX 2C82A 3MJVA 2OZEA 3CRMA 4KO8A 3DR5A 5D3ZA 1YRYE 2IHJA 1LWOA 2BEUA 2V7QA 3H3JA 4K2AA 1YZGA 2QV0A 3HU5A 3WKCA 2H0QA 2PZGA 4BO5A 1IJKA 3K9CA 3DOOA 3WHKA 5CLIA 2CFRA 4IW3B 1NYTA 4HNRA 2VBFA 3E8MA 1AA9A 2CLCX 1J2TA 1SRQA 2XDWA 1JJ7A 1E79A 1STOA 1IBCA 3B78A 1II0A 3GXOA 3O90A 4JY7A 4QWMA 1XVTA 2O8VA 2EDAA 2GEVA 3A1VA 2JLWA 3T0GA 3UTDA 5J9FA 2GEFA 3ENZA 4XLZA 5KVQA 2LDBA 1AN9A 1CERA 4NS1A 5DK6A 4LJAA 2HU7A 5H68A 2MHCA 2HCFA 2YY6A 1J8FA 4WZBE 5U4QA 1M8KA 3MCTA 5AW7A 1HX7A 1J70A 4UBKA 4J9UE 4Q15A 4NJEA 3O0TA 1OYOA 3INYA 4LXTA 3ZWPA 2WNIA 4IJVA 3QYAA 1FEZA 5K3BA 3GLIB 1XPRA 2GDJA 1MIOA 3DOUA 5K45A 4N3NA 2FX2A 3O93A 4HK4A 3LWBA 3CUUA 5PNTA 4QOEA 3M33A 2PJDA 2HLPA 2QYSA 3H2BA 3GJSA 2OC4A 3EAQA 3PFWO 1XALA 2X22A 4Q1BA 1EVJA 1XD2A 4A0QA 1O9GA 3GCZA 2B20A 4QBKA 4YDQA 2FSVA 1ODLA 4K6HA 5JR3A 3VU9A 1J20A 1I5EA 1N8TA 4OB6A 4TRNA 1QGDA 3RJTA 4EFDA 4KG7A 5JAUA 2B4RO 1AKYA 1CIPA 2MSCB 2WFAA 3EXHA 4R16A 2VYND 1UJCA 2ODEA 3AFGA 1EGHA 3H2KA 4G8JA 4NZOA 4U7WA 2CK3A 3ZXXA 3LFHA 2C96A 2QTHA 4BFLA 3NS7A 1W59A 5CFZA 4M0CA 1A8QA 4KQFA 1HY3A 1MAHA 1GHTA 4G26A 1SUBA 4EVQA 4YYZA 4MQEA 1A72A 2OWEA 1BKDR 4MHSA 4R83A 2QGZA 4EMUA 2O59A 3I53A 1JIQA 2HYIC 1PHRA 3FLAA 2Y2UA 2ASEA 4NZZA 4UAGA 1IM8A 2H52A 1CCWA 1P31A 2A30A 2YFKA 2VPYA 1FFWA 1MXFA 2FN8A 1ECBA 4B4KA 1SY7A 3TRDA 4HL6A 5HQ3A 1QGUB 4ZXPA 4DJFC 5TQ0A 4PANA 1M0WA 3FETA 4ZI5A 3TIVA 4YRKA 4BMXA 4AC9A 1DMRA 3RSZA 2W6QA 4MMYB 3PGA1 3HVKA 4B9AA 4IX9A 2V5UA 4YMVA 2MR5A 1NXXA 2R7MA 4KPFC 4Q9HA 1GXSA 1A8PA 5CDFA 1QK3A 4B3GA 5L4LA 4Q24A 3D43A 4D97A 1A8SA 1ICIA 1QF7A 4MGIR 1ZM7A 2NNWB 1YQUA 4XGQA 3FNBA 3WBFA 3SDBA 5DP1A 2E6KA 1SIOA 3GBVA 5EUMA 1G5HA 5AQ1A 2FJUA 1GQ2A 4MP8A 1W0KD 2JZOA 2Z2JA 2GTIA 3TF5A 1YK1A 3QBJA 3KXDA 1DJQA 2A59A 2HJVA 1JHRA 3AO0B 3FTCA 3LT0A 4N7BA 4UHEA 5CGZA 3UOAB 3V1TC 3ONDA 4LWZA 3UB3A 3P32A 1VLLA 3FOFC 3QP9A 1WBBA 4HXGA 2JPDA 3GP3A 2OCBA 5CT6A 4CJXA 3QVTA 1GDDA 4TVKA 4KK3A 4MCIA 1A9QA 5COQA 2RGEA 1NQXA 1LU9A 5B1DA 1RWWA 2VF8A 1IWOA 4J49A 2PVSA 3TUJC 1QHIA 4TMXA 5KNLA 4JUDX 2WAOA 1EX1A 4LXQA 5FOQA 5JCOC 4I55F 2PWZA 5I5GA 4YWHA 1CQIA 1XU7A 2D0IA 3BTUA 2DTXA 3MQ4A 5DISB 4NYJR 2HO5A 1NN0A 3PKJA 3JQPA 3M6LA 4KGXA 1CKEA 5EWLB 2UYHA 1XDUA 4U3JA 1CNEA 1RIFA 3MWLA 4K86A 3UW1A 5DHSA 1T8SA 3OZIA 1T25A 4JODA 1ZOPA 2F1KA 5T41A 4JBHA 4DLTA 1UK9A 1ISGA 3W90A 3HYCA 3BIWA 4Z7OB 2GPYA 2YXNA 2WF8A 4M37A 3IEIA 2Z95A 4C6RA 1HT0A 3UOGA 1JV2B 2GF0A 3C98A 4D7AA 2VFAA 3BGVA 1JILA 3OSUA 2VJCA 1ZQ9A 3OBIA 5D87A 5CCXA 1L4LA 4ZP1A 3L4SO 4NX2A 2HSGA 3P5BA 4R9SA 4RVDA 3TW6A 1S2LA 4FHZA 4M8LA 3DKIA 2R8PA 5K9ZA 4ZQCB 1EBBA 3FZYA 3Q87B 3CW8X 4KRYA 4J94A 4XGKA 4PX2A 1RBMA 1H5UA 3NAQA 4TZ0A 1L8LA 3MA0A 1GUDA 2DRIA 1C2TA 3C6BA 3ME5A 3CB4A 3AR8A 1VPVA 1J8MF 2IGTA 4OU5A 1KEPA 1Y8QB 5KDLA 5M7EA 1WCIB 4DR5B 3I1FA 2FFQA 3WADA 3R6DA 3Q9SA 3RH0A 2CDAA 1Z45A 2P6OA 1KA9H 1S8OA 2YW2A 1O58A 4KO4S 1JZSA 4MRAA 4P32A 1NBWB 4TVSA 4NNPA 1Q21A 3I9NA 4EG7A 2O8FB 3SZLA 5B57C 2VJKA 3OPXA 2R5NA 1KH2A 2PEZA 5G41A 4BB0A 1DTWA 1CUDA 2P4HX 1PHPA 3UYLA 1C0LA 1DBIA 3SM3A 3OZSA 5IAJA 3ZU4A 3QE0A 4X8HA 1KFEB 5KNBA 3LAWA 4B33A 2NVBA 2Q8PA 4EDFA 1R1DA 3X1JA 3CVUA 1I4EB 4A8PA 4CKYA 1YFZA 4PFQA 2GZRA 2FEKA 3K2EA 3M81A 4IYJA 2Q5LA 1XHFA 3ZDCA 2IEDA 3GWGA 5DYIA 2YXEA 4XVHA 1EWVA 3AB3A 4TV9F 1XIVA 3FHCB 4C6SA 3TEFA 2WILA 2H2FA 3HB7A 3F47A 2WU4A 4H3SA 4OUDB 3UZUA 5JNRA 1DZ3A 3FYDA 5B4VA 3T35A 3PDIB 3OOHA 1T0PA 1P45A 4ENVA 3O94A 3ZIAA 1G20B 5JAZA 2B5OA 3GDHA 2C9DA 3QU4A 3WGJA 3WMEA 1GU1A 2F7SA 1CE8A 4A2CA 4ZI2A 1F0NA 2C5BA 2QBYB 4D9NA 5JVDF 3Q5DA 3FFTA 1H4TA 2OE2A 3FUCA 5A7FA 1E8NA 2AYXA 1VJGA 3H8VA 4MINA 1UKZA 3W5SA 1N78A 1C9DB 2QX6A 4LKRA 4LUCA 2GN2A 3K1AA 4DDHA 1UEIA 2IJGX 3UFXB 1YE5A 4CKEA 3N3BC 1QAQA 4QUIA 1MZPA 2YUTA 1SHKA 2FR0A 2XMBA 1IMOA 4LXXA 1RPAA 1OYYA 4CTNA 3BAZA 3X1DA 4FXOA 4U0KA 1GPH1 2C2GA 1B1AA 3AWDA 2YHUA 3TSYA 1R50A 1RRMA 3JYPA 3H5IA 5B3LA 2PRYA 4G2NA 4ZVLA 4E88A 1G8SA 4KX3A 1UJ2A 1R5JA 4OEHA 1JEJA 2WE8A 3R7NA 4XEUA 2Q50A 3OT1A 3K1YA 1BX3A 1UODA 4OH1A 2DWPA 4ZOEA 3NHRA 4OF4A 3J81k 1TCVA 3M4JA 3P9XA 3C4VA 2IS2A 3HHEA 3DHEA 3L82B 4JWKA 4NU8X 1W5BA 3W4KA 1YDWA 1OROA 4W9NC 4YRPA 1B15A 1CDDA 1WTAA 1YMVA 1ES9A 1OB2A 2AA3A 1NW5A 1JIUA 1GYRA 1T9HA 4KSCA 1W44A 4M53A 3UB2A 1NLUA 1XHEA 2DFNA 1QK5A 1B1CA 4KQ6A 4QOSA 1NZDA 2IFTA 1B6RA 3I9V1 2ZUTA 1QYRA 5REQB 4F8JA 4KWHA 4BQOA 3BX1A 3S68A 4WJLA 3Q7QA 4RMJA 4LFBB 1ZSYA 2QX8A 1A9TA 2IOFK 1DUSA 4E70A 3PRJA 1JBKA 4UXIA 3IIJA 2I7TA 4QNMA 1GO2A 1KXJA 1EFPB 3UANA 5JH7A 3HKDB 4MVJH 1LD3A 2GJKA 3A7DA 1ACMA 3PE4A 4EATA 4RK5A 5FO0A 1W7AA 4DT1B 1VHWA 3UCXA 2WMOB 4NIMA 4K3VA 4HAWA 4ZYXA 4YV2A 1BYIA 3AOGA 3AXTA 3LUKA 3PNPA 2KE5A 1OT3A 2VSYA 4FOLA 4KZKA 4QPJC 4RNDB 2AN4A 3D4PA 1ENPA 3O21A 4MZXA 1ZRNA 2WABA 1T3LA 3JQ6A 3HYRA 4OYHA 4ZQEA 3B70A 4PQRA 2ADOA 5HIIA 2A57A 2I55A 3V4FA 3WDMA 4CLDA 2VNIA 1XTTA 3QVXA 5DM70 2NT4A 1RBYA 3WO1A 1OI7A 5CD1A 4LSMA 1WXQA 3ZQKA 5LZ5A 3HCRA 3BMQA 5B6PA 2BFFA 3AGPA 2QVYX 3OAAA 2G77B 2ZTMA 4REMA 1NPDA 2IVFA 3O4JA 4G0QA 4D0GA 4HWOA 2ZREA 1WXWA 3KV1A 3N07A 4LXYA 4ZK6A 1FW8A 2ISQA 2YY5A 4AO6A 4QDJA 5CVVA 5FOSA 1YU9A 3C3DA 1UZMA 3W77A 4INZA 1Z4KA 4PYOA 1MJGM 5I45A 3FB1A 1PZMA 4HDMB 1GSIA 4P7JA 3EIHA 5D3MA 1U0SY 1Z56C 5SV2A 4BE7B 3L6EA 4FEAA 3DMNA 3ENVA 1E63A 2XYRA 3FHJA 2XDYA 3FI0A 5AD1A 1KDOA 2OHJA 5CCBA 1KMIY 1D1QA 3RPEA 4DCNA 1VYVA 1RDFA 4DLBA 3PQ4A 2Q28A 3CLRD 3I5MA 5IAAA 2ZCVA 1YJ8A 1Z5ZA 2IWHA 1JECA 3JD2A 4CG1A 5IBCA 1BQEA 3T9DA 5KWIA 3RJ5A 3SNKA 3SSNA 2HEGA 3AIKA 4ARZB 4HPWA 3X1XA 1CQWA 5HGXA 1G9TA 2WKWA 2ZSEA 3O84A 1JEEA 3HWWA 3TDKA 2ZIXA 1IMJA 1LWNA 2D0OB 3E15A 4EHJA 3A1TA 1OXBB 3AP3A 3TLGA 3KR9A 2YXLA 2H2AA 3ZU3A 4LF5B 1SQSA 3G5TA 3K8ZA 3NTOA 3QEMA 5KKCA 3RVKA 5FPSA 2JGKA 5LWHA 1V5GA 1QFMA 2YBDA 5LCXA 2JANA 1RCUA 1IEWA 2WM8A 5BQXA 3A58B 4WN9B 3K70C 3N7TA 2WYVA 2XUIA 3W5AA 2D0PB 3I0ZA 1OKKA 3O1IC 3QPUA 4BGDA 4QAQA 1QSGA 3KWJA 2WD7A 4OUKX 5K3OA 3R7BA 4AKEA 3WFZA 3BB4A 1H9BA 1DELA 4N5DA 1J8VA 4EG5A 4PEVA 2OQIA 2G08A 4J0HA 4NI5A 1F0PA 1WQ1R 1HQKA 4JVSB 3BICA 3C85A 1SC4A 1SBZA 3FDJA 1OH8A 3HN6A 4EFMA 3LBNA 5HTOA 1J23A 5K2OA 1MO4A 2FPIB 3GJZA 4TV8F 4ZT4A 1RM0A 4X6YA 4ARBA 5LMNB 2IHUA 4HAXA 2C4UA 1D8TA 1DKRA 2CLOB 4J8PA 3CLUC 2TYSB 4NBRA 5C4GB 5DHUA 1DQRA 4G4IA 1XRQA 3RJMA 1WKBA 6ADHA 1XGKA 2RGNA 2VF7A 2ZSHA 5DWQA 3W7AA 3RYHA 4S2EA 4IFBA 4HAOA 4RA9B 3V33A 1RNLA 3OQPA 4AZ3B 4CKBB 2GYVA 1G1AA 3SEAA 2HJSA 3KK0A 3OU2A 3QLTA 1UFOA 1K06A 2XI4A 5D01A 1I24A 2QK4A 3IUSA 4DV5B 2QNBA 5K20A 4IUDS 4OCZA 1G59A 4YBRA 1DDOA 5ARBA 1CW2B 2V0GA 2IY8A 2OHGA 3UKDA 2M2IA 5GPBA 1N6IA 5F98A 1NWCA 1X7DA 2CDRA 4YQYA 4Z1OA 3T5CA 2AYYA 4ZQFA 2O8DB 3EW7A 3AERB 4MW2A 4XR4A 4YJGB 1VHDA 2GO7A 5AIBA 1P0QA 2RGCA 1AGPA 4J9VA 3CB2A 3F6BX 3I4LA 1QX4A 2XUFA 4EYGA 3ESAA 3OTQA 4B81A 1Z22A 3ZGYA 1I3LA 5TARA 2R8ZA 1KZ1A 4H60A 2IX3A 4N39A 1DS6A 5AWFC 4MJ3A 1QLJA 1P4HA 3JALB 4I9GA 1EJ0A 1QHHB 3PIDA 5T6BA 5IRCD 5CDGA 3UHJA 1C7FA 2PKYX 3GLTA 3HL0A 1P1IA 4QU0A 5AVRA 1QS0A 2P3LA 2PSEA 3BF7A 1P9WA 3EVFA 3OCWA 5E1MA 4URXR 1SC3A 3OZRA 1TQ6A 4UDYX 3THOA 3WL3A 5BW5A 4KNWA 3MQFA 1FX0B 3O74A 1A98A 3JQAB 5BPHA 3VKFA 2BFNA 4DYHA 3HVJA 1U0HC 4P9NA 1W5FA 3HXTA 5J58A 2AWOA 4YECA 3MC1A 3ROGA 3UT6A 4F2PA 4FILA 4F38A 5B1HA 3SQLA 1KWKA 1X19A 2YZNA 1G291 1TIPA 1XTVA 1JB9A 3H2SA 4CCYA 2RGAA 4ZALA 2QP4A 2BMFA 1YVUA 2H00A 4C0QC 4IHJF 1G2PA 3N53A 1NR1A 1T1IA 2NU6B 5AKGA 5DF1A 4YWJA 5IPFA 2OO5A 2RK3A 4M0EA 2H5LA 4O5OA 4WNAB 1KK0A 2BFBB 3AY6A 3KLBA 1WCXA 2QTBA 3U17A 5EJGA 4EF6A 2ZYTX 3A4LA 1MO5A 1TVEA 2ZT7A 2PWBA 4M60A 5GMOA 4DCCA 3T3NA 3U5ZB 1XCBA 4HGOA 4YNBA 5F5XA 2CDNA 2P5UA 1Y4DE 2XOXA 4RZIA 4EM6A 2BTEA 4C20A 4OAOA 2HU2A 2A84A 3EZ6A 2ZB3A 4L16A 5CDFE 1W36C 1O6FA 2WLTA 4JC5A 4NARA 2ZANA 4W9RA 1N2SA 1M2OB 5HDQA 1E4VA 1WPXA 1PT9A 2KLBA 3KPJA 4GC9A 5JARA 1T3ZA 2TMGA 4LF8B 1I3MA 1DV2A 3DEHA 2FK7A 3DNMA 4O4JB 1KJYA 1B93A 2GFHA 1SPXA 4DS3A 4C4XA 5JDIA 3Q8LA 2Q5QA 2GJAA 3LX5A 4B6QA 1MA0A 2WR8A 2XR1A 3TE6A 4E3ZA 1PWHA 4IDEA 1UOOA 3ZC3A 3KKQA 5BPFA 5BN4A 2FU5C 1JQ5A 3Q8MA 1GRNA 5HZKA 4RPIA 5LXTA 4NMWA 4BO1A 4D9CA 3KM0A 2P11A 5IWCA 1NRXA 1N7IA 4EYKA 4GWKA 3HWSA 3HB9A 3UWPA 3F2IA 2V5AA 3FPEA 3ZV6A 5A04A 3VKVA 2PGJA 3JQ9A 3LW8A 2A5FA 1YI0A 4WRRA 2AZMA 2XUAA 1T9ZA 5K6RA 2LE0A 3F7OA 4FCWA 2Q07A 1VIMA 4CKWA 1NXPA 3DE5X 1FFCA 4CKCA 4XPZA 2OCIA 4MEBA 5JRDS 5EA2A 5IP5A 1HLFA 3G2IA 4Q6WA 4L75A 4AJ4A 4A0HA 2V3VA 1AUVA 3GLHB 3FPCA 5LQCA 2PUWA 2JA2A 3ZD9A 1ZFNA 2GUWA 1Q19A 2YYSA 3UA4A 1CEYA 3LVQE 1PJRA 3E22B 5BVGB 2HNAA 5BYBA 2QTCA 4B09A 1ZGAA 1JALA 2PR7A 1MJFA 1R15A 1UKBA 2HY7A 6ABPA 4DUYB 1QP7A 1VL8A 3URMA 1DDGA 4EB0A 2H4JA 3GNQA 4AN0A 4EJMA 3I9FA 2FW1A 4D4LA 2WQZA 4EY8A 3C5CA 2BKUA 4X1IA 2VAVA 4YYEA 4TL7A 3VDQA 1ZJ4A 2F43A 1NXVA 4HXEB 2AKYA 2LZ0A 2HMTA 4FIZA 4LHSA 4R3WA 4EK9A 1OFUX 1KO1A 3ROKA 3TTSA 2XMQA 3OP1A 4JKOA 1U94A 1PV2A 2DJ5A 3EG9B 3K05A 1E2EA 3AIOA 1R6UA 3FPGA 1XLWA 5L3ZA 3UKJA 3H8SA 4Q39A 2WJYA 2OR3A 1ZSVA 2FQ1A 3NWJA 3RRXA 1BJRE 1ZMBA 1XZDA 1T9GS 2MTBA 1N0WA 2WJAA 4HDOB 1JDUA 5FOWA 1X8XA 4YK7A 5E4JA 3ZJTA 2NUPA 1RQ7A 4E30A 3DE3X 5EWMB 3JWPA 2XYQA 1ENOA 3FMGA 5HKKD 4I4IA 1OC4A 4N3GA 4P36A 4FC7A 4UCXA 1TLFA 221PA 2Q5HA 3AG6A 3LKBA 1B3BA 3GT4A 1QFZA 2JIPA 2BJHA 4F6LA 2P3SA 4ETNA 2DLNA 3HTXA 5I7HA 3TPFA 2YNMD 2IUYA 2ON6A 2KX7A 3ULKA 1ILEA 5JD6A 1PWXA 1KE2A 4BLVA 1BTOA 1H1DA 1KORA 5D84A 3EPPA 3TGPA 1VGVA 1IBKB 3MILA 3PXAA 2W8BA 5J63A 3RASA 4U7HA 2CUZA 4WLFA 3ZWVA 1AKUA 4ENRA 1DX9A 4NWIA 3BJMA 1JKJB 3SYKA 4EKNB 3I6MA 1L4HA 1A2QA 3FDZB 4JKIA 4CR7A 1RZRD 3SVZA 3HPRA 1KOLA 3NYWA 1CZUA 1FP6A 3S2IA 3SX2A 3RUEA 4DR6B 2Q3EA 4FZ5A 3LQ2A 2ODBA 1OTYA 1W4RA 2HHLA 3AEKB 4JD5A 3W8FA 3ETJA 3CW2A 1TMGE 4R69A 2GZ1A 4KV7A 3ZHQA 1RFLA 4IH9A 5FF9A 2H1RA 2J6BA 1GKIA 2H6EA 3UC5A 4RHFA 2ID7A 2VP2A 2Z6UA 2J0EA 3QUQA 3GUYA 3PDHA 1E3JA 2CXTA 4AF8A 3BQNB 4E2WA 5L7TA 2GJ4A 3HB4X 2I62A 2ZT6A 4MA4A 2RGGA 3L8CA 1TIKA 2J5KA 5LB2A 5T3YA 3DW3X 4C3ZA 1SU4A 2PGOA 4KREA 4WD3A 1VLQA 2QRUA 4JGIA 4F11A 1SUDA 3EOBI 3GLSA 4N48A 1VE9A 2WYWA 1NHWA 5SYMA 1JIXA 3A6GA 2J3LA 4FB4A 3AF2A 2EWVA 1P2GA 3Q9UA 3ETDA 5KX5F 5LZ4A 1NKTA 2MT9A 4XVQA 4ZMSA 4TMTA 3OIWA 1N2ZA 2QVBA 3GMIA 3R09A 1ORVA 4G86A 4PLWA 3MJTA 4PZZA 1WM1A 2EIHA 4QTZA 1XZKA 4D4IA 3H1AA 4QYWA 6AT1A 2H29A 3B9PA 2NM0A 1EAMA 2YYZA 4YUVA 4N6NA 2PU5A 1J9ZA 4HNVA 2WWGA 5ALSA 3WO0A 1SHUX 2Z08A 4LNUB 1UC4B 3GOHA 1ZKDA 4HH4A 2C4HA 2PR2A 3QGMA 4GNRA 1KYVA 1D8AA 2Q6KA 4D82A 1Y5IA 4DMCA 4EPRA 3MRSA 4KWEA 4NMHA 1E2LA 4G0NA 3S2FA 4BASA 1GR1A 1N6OA 1W2WB 2WAMA 5ETJA 5BV0A 3SQWA 2FPGA 1JBQA 2JI9A 3G0BA 4Z2AA 5BSKA 2YWFA 3RU9A 4BIMA 2I03A 1IHDA 3BDAA 1AKMA 1AZTA 3DDZX 1KVTA 3VNVA 2JS7A 1FLVA 3NTRA 2FHSA 3MYRA 2P0EA 2IBSA 1KAGA 3OUTA 4R0VA 3R40A 1QQAA 5MHTA 1W1UA 4P2BA 3GGJA 5DI9A