5D7NA

Crystal structure of human sirt3 at an improved resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
271
structure length
271
Chain Sequence
b'GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
publication title Seeding for sirtuins: microseed matrix seeding to obtain crystals of human Sirt3 and Sirt2 suitable for soaking.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 88
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 5d7nA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5d7nA01
4UUAA 3D4BA 2QQGA 1ICIA 2C31A 2IHUA 1NM5C 5EJ5A 2PANA 1UPAA 5K6TA 3F6BX 4V1CB 1V5GA 2Q5QA 2PGOA 1HZZC 4Y6LA 1D4OA 1E3TA 1SZCA 4GM0A 4RJIA 4BVGA 4BUZA 3PKIA 4COKA 4K9OA 2JLAA 2VJYA 4GM4A 1POXA 4RMIA 3F6EX 3EA4A 5EJMA 4GPEA 1EFPA 4K9PA 4BVEA 3FLMA 1Q17A 4FZ3A 4QPZA 2AG0A 3PKJA 4MZXA 2JI8A 4MPRA 4X3PA 1U2GC 1T9AA 2EZUA 1M2KA 5BWNA 4RMJA 2B4YA 4UTVA 2OORC 4K9NA 1POWA 1BFDA 3IAFA 5EJ7A 2H2DA 1PI3A 2QQFA 3GLRA 4JUFA 1UPCA 4Y6OA 5BWOA 2UZ1A 1YHYA 1PTJC 2EZTA 5EJAA 2WVGA 4BN5A 4UUBA 3RIGA 2H59A 2H2FA 1PT9A 1YTLA 1Y9DA 4JUAA 5D7NA 1M2NA 4UU7A 5MFPA 4RJJA 5MFZA 3OE1A 1PO7A 1MA3A 2Q5JA 4QELA 4O8ZA 2OO5C 2Q5LA 1PNQA 3E9YA 2Q27A 4KGDA 4IG9A 4RMHA 5MGNA 4C7BA 1XLTC 4JU9A 5EJ4A 2JI7A 1Q14A 2HJHA 3CF4G 3GLUA 5DGDA 2OD2A 4IAOA 4ZP1A 4K9QA 2VBFA 3ZGOA 1PVDA 4IF6A 4JUCA 4JT8A 2OD9A 3CLUD 1OZFA 4TWJA 1U31A 5MF6A 4J1TC 3EY9A 1U2DC 2H2HA 2H4FA 4HD8A 4GG1A 4HDAA 1YI0A 3CLTD 3RIYA 1M2HA 1YC5A 2PGNA 4L3OA 3CLRD 1O96B 4UTZA 5FYQA 4UTXA 4ZZIA 5EJ9A 1Z8NA 3D81A 2VK8A 5DGTA 1QPBA 4R8MA 2EZ9A 1DJLA 4FEEA 2W93A 3JWPA 1PNOA 2VK4A 3CLSD 4GP9A 4BV3A 2H2GA 2H4HA 4V1CI 2WVAA 4BN4A 1YBHA 4MPPA 4MPJA 1J8FA 4GM1A 2H2IA 3EYAA 5K3SA 1M2GA 2WVHA 3HWX1 4BVFA 4UTRA 1N0HA 4K9LA 1O97D 3JR3A 4QQ8A 4UTNA 1U28C 2OD7A 3GLTA 4RMGA 1T9BA 4JU8A 4F56A 3PDHA 1Q6ZA 4G1CA 4KXQA 4BV2A 4Q9DA 1YHZA 1EFVA 1UPBA 3LQ1A 1V5EA 2EZ8A 1JSCA 2IHTA 2JI6A 5BWLA 2JIBA 2BRUC 5IMSA 1ZPDA 3ZGVA 4F4UA 4JT9A 1YI1A 2AG1A 1SZDA 2FN3A 4FVTA 5K2OA 2VBIA 1T9CA 4KPUA 1Q1AA 1S5PA 4L2IA 2A1TR 2Q29A 2DJIA 4MQ5A 5AHKA 2Q5OA 5EJ6A 3HWWA 4UU8A 2FR8C 3K35A 4TWIA 4JD5A 2UZ1B 1S7GA 4V1CA 2V3WA 1PYDA 2EZ4A 2VBGA 2A1UA 1OVMA 4JUBA 2VK1A 1OZGA 3U31A 2H4JA 3U3DA 2FSVC 1M2JA 1MCZA 1YNOA 4Y6QA 4BVHA 2NXWA 4JUDX 4D5EA 3GLSA 4FEGA 2IHVA 4RJKA 4J16C 4K9KA 1OZHA 2FRDC 4BVBA 3ZG6A 2JLCA 1YC2A 3FSJX 2NYRA 2Q28A 5EJ8A 4X3OA 3IAEA 1V5FA 1T9DA 2X7JA 3FZNA 4JSRA 5FEMA 4I5IA 3D7KA 4D5GA 4C78A 5DEIA 5K6RA 2JI9A 4K9MA 2FWNA
chains in the Genus database with same CATH superfamily
4TXNA 1XO1A 5E3IA 1KI8A 1IHXA 1E1MA 1YKSA 4QLAA 3DZ8A 4BBZA 3GU3A 5EIAA 1AV7A 1U6IA 3QRWA 4QXMA 2FR8A 3FMIA 1DEHA 4QYMA 2QQGA 1V0JA 4AP5A 1WCV1 1QVZA 3KKLA 4A0QA 1TGYA 1FDTA 2RH9B 3K0EA 1D5WA 4GMHA 5KWSA 5C7OO 5IPFA 4RIHA 1EZ4A 2VR1A 1YS4A 3SQNA 1HNZB 3I73A 1VM6A 3SJCA 1EX9A 2QY6A 3UMCA 4HGYA 4F8JA 1PX0A 4FZVA 5LQSA 2ZIVB 1OJ7A 2GLXA 5LBIA 2CBZA 3D9QX 1RYYA 2VQSA 3UA3A 4RYDA 3W6UA 5AJHA 4FHZA 1RRFA 3B6ZA 3GLHA 1LBEA 2FZ4A 1HE2A 1NBMA 4LMBA 1WDKA 1R2QA 1CS0B 1PFKA 3KWLA 5D5PA 1M83A 4ACAA 2Y4NA 3CCBA 3P2OA 4WNAA 4YGXB 5HBRA 3SZMA 5BSEA 1L7VC 4LE2A 2FWRA 4XARA 3MUNA 1DBSA 2ZXFA 3QYFA 1S2GA 2XA9A 3QFSA 4WESB 5K3FA 2I76A 2H8GA 1PYGA 1OXXK 4RQAA 3ZNQA 4YRAA 5AUQA 5IKXA 1GSOA 3TO5A 1H0SA 2CLFB 2PSHA 4GLBA 4D9EA 1XU9A 3HA7A 2O8NA 3DQZA 2WJHA 5DFAA 3V2UA 2G71A 4ZCLA 1GO2A 2WHQA 3C3YA 3N28A 3SEFA 1YVPA 4D80A 5FL3A 2P0AA 4D43A 5BW6B 2WIKA 1Z5WA 1MO2A 2WD9A 4X64B 1NQXA 2WWTA 4B8WA 3EA4A 1YUBA 4OTZA 1FFXB 3RTEA 1T4GA 5C1IA 2AW5A 4WCFC 5THQA 5KQSA 4E5UA 2JFXA 1UP4A 3NJ4A 2IPLA 5ADWA 1E5VA 2ODBA 2WJIA 4X65B 1XHEA 4XUDA 1W5AA 3MWLA 4KOAA 4BLOA 2FDCA 4FQ8A 4NJMA 3P4YA 2VQEB 3V48A 4M8LA 2VA8A 1M6VA 2I1VB 2IYAA 4TL7A 1KO5A 2MR5A 4WK4B 3TQFA 2CV0A 1DIBA 2GYUA 3PXAA 1XFAA 5AK6A 5EKUA 4OOFA 1GYPA 3RFXA 5ESXA 3UW1A 4GUDA 5EZYA 5TS3A 1TAHA 5ALOA 1BOOA 4PC2A 5DHQA 4BB0A 2W2TA 4WZZA 1ZITA 3DOUA 3RROA 4BNJA 1B00A 3AEQB 3QJGA 4I4NA 3M6FA 4NMWA 4RYLA 1KJJA 1RHKA 4DIKA 4QT0A 1Y8QB 4V0RA 2HIAA 4J07A 4KR6A 1IHOA 2QUHA 3I2IA 4G1FA 2OHVA 2PZGA 3EXG2 2Y0DA 5F9HA 3MEQA 1GDHA 2DHRA 1X74A 4U7GA 3TTWA 4YMGA 4UM7A 3JQBA 5J59A 3ABOB 1E7WA 1EJ6A 1T2FA 4PPGA 5AUPB 1M34B 1XIVA 1HDEA 2GM3A 2FV8A 1K8RA 3W5SA 2XGOA 3KNZA 1QMPA 2WNSA 3WJ1A 3LNCA 2XZDA 1JEJA 1SXQA 2VAMA 3C70A 2WT9A 1F0KA 4MJ7A 4UOQA 3CH5A 1H1LB 1KMQA 2Q2WA 1DJNA 1OILA 1SOWA 3JZAA 5DX8A 4LSGA 4XRRA 3AG5A 3ABSB 4Y6OA 1PEYA 1I6WA 4LTDA 4ZVNA 1G5FA 5FFMA 1EYZA 2Z2ZA 1TD9A 1YHYA 3RHTA 3QKUA 4F04A 3AOEA 4C4OA 2Q0XA 1SHUX 4QULA 4UUBA 2XA1A 2YWXA 5HGXA 3KTFA 3LLVA 3UAOA 4E88A 3HL4A 5AI6A 2B0CA 3BG5A 1W7AA 3FDZA 4G85A 2HMUA 1I2CA 4UHHA 1EG7A 3IA2A 3SBDA 4KN9S 2X4DA 3PV0A 4LI0A 1PR2A 4PAMA 4PNZA 5CDGA 2FJ0A 1K7FB 1JILA 3D2CA 1SUIA 3TE7A 5TEVA 4CPDA 5DVZA 2VHUA 5K3OA 1ZC3A 4CEJB 3NVKI 1UINA 5A4FS 1KQ3A 3U5TA 3BWEA 1VKZA 2QRKA 1MA3A 2DPHA 3WNVA 4QELA 3HO1A 2N1MA 4D8TA 4OHCA 2ZYVX 3P2MA 5E9AA 1N4AA 5HMLA 2Q5LA 3E70C 2EX1A 3W5UA 5ADHA 4C30A 2AKEA 4LDAA 4GZ3A 3O8QA 3RK1A 1TRKA 4YRIA 2VJPA 2W2VA 3P2IA 1JSRA 1DIAA 4A6PA 1NX6A 4RPIA 5KNCH 3DEZA 3QVVA 2R1ZA 1NNLA 3GXBA 4B3HA 3KUCA 3WGNA 2B61A 1Z07A 5FFFA 2IW3A 3FX2A 3A6PC 1IBRA 1N2EA 3EXHC 1KR2A 3M6IA 3BFVA 1NN1A 2HT6A 2NV2B 2UVPA 2YZ2A 1STOA 3B3QA 3E9QA 3GXOA 4QOSA 4RE5A 1U1FA 4YECA 5EJ4A 4OX9Y 4IDOA 2MDTA 2HEGA 3CW8X 1YOVA 1NNI1 3AF4A 3FPBA 3MG9A 5FRDA 1MPTA 2I6UA 4UBMA 3E2IA 2P2ZA 4TSRA 3AVTA 4NQZA 4UVIA 2IPXA 2DQYA 4W5HA 5FD8A 2QMHA 3AM3A 4ILEA 1AKRA 1B2LA 1Z4KA 3MS7A 4X93A 5TB5A 3UKJA 3ZCXA 1PG5A 3FA2A 2VXCA 2VN8A 1ZR2A 4AJPA 1QYCA 1J4AA 1UK6A 4YXFA 3EQ6A 2AHRA 2FOLA 3E1SA 4FJ0A 5DYWA 4B33A 2HM7A 4CM9A 1I2ZA 4J1SA 4J91A 4LFBB 1ADJA 3KVOA 5F1OA 3C7TA 1I3NA 4LN1A 1W5FA 1L7BA 1OKKD 4UZEA 2GCEA 2J5XA 5L3QB 1N3LA 1MB9A 2AV6A 4H1WA 5L7WA 1YZGA 2G5PA 1B76A 1D0IA 3GEHA 3HRKA 4PYRA 2QN2A 4JT8A 2C9ZA 1KPIA 4W7SA 1HQYE 3KSMA 3MSCA 2QSUA 2PLFA 3EUAA 1QNFA 4K46A 1MFZA 4WN9B 3VDXA 1RJDA 5JEDA 1VPLA 1JU3A 3LLUA 4Z9FA 1OYOA 3QOWA 4Z53A 2Z2JA 5H4GA 1H66A 3O4IA 1JDUA 2B3TA 1GZUA 4UQOA 4AI6A 1YXMA 1P73A 1O9HA 4B74A 4F71A 2X41A 5I8ZA 1UT6A 4DMFA 3BMNB 1HRDA 1TO6A 1SQ5A 1UFVA 2QN3A 2X8BA 2BM1A 3H65A 3OEWA 1U0SY 3S2FA 5FULA 3IHLA 1EVKA 3PIDA 3ZR4B 4AJ1A 2JGKA 4CKZA 2FJUA 4BMDA 1EDBA 4AC9A 1QGAA 4YJGA 3U5ZB 1G5QA 3T5PA 1GG8A 3VNSA 3T4XA 3NOVA 4HD8A 2R6JA 3NNDA 4CIAA 1I10A 2DHDA 1YVUA 2JH8A 3KJGA 3ETDA 2I87A 1YNSA 3PQ8A 3EVZA 2HWUA 2I55A 4IJ6A 4MVXA 3L6UA 5G0SA 1KARA 5T8KA 4AJHA 1AB5A 5ALFA 1ZDMA 2QLLA 4NZPA 1V9CA 2CB0A 4YI3A 1FS4A 5A04A 2YMLA 4C6SA 3AVPA 3R7WA 4ESVA 1L4BA 4BE4A 4N39A 4P34A 3ZI7A 3KM0A 3M1LA 4ONEA 1THGA 3TKAA 3R76A 2JFBA 1NJ8A 1PDVA 4QOFA 3TXYA 1C30B 2FG6C 2WF7A 3K2EA 5AM2A 4BYGA 5AW7A 4YCJA 4QGSA 5B7QA 4QWWA 5DHSA 3EQ9A 3LRPA 1T3LA 3FPGA 4TQGA 2J3JA 4CMKA 3IP7A 2H7YA 3BF8A 4CG3A 4GF5A 4I50B 3YASA 3I34X 1JBQA 3H04A 1SEVA 1SEPA 2XTMA 3EGXB 5EHGA 1KOJA 4O2BB 4TS3A 3BWXA 1ZMOA 2PK3A 1OTXA 2XBMA 3S55A 3H13A 4LHXA 2AYYA 3AUTA 5C8VA 2MYNA 4PVDA 2ZRNA 1SXJC 4PHHA 1V1MA 4B3GA 2H2GA 4WLFA 4C21A 1ZM4A 3PA6A 5TVGA 1RJEA 1BG6A 2PKQP 3UOGA 2GEFA 3ZWMA 4OJTA 4ZYVA 3PEYA 4K87A 4RY9A 4KZPA 5AVVA 1DEXA 1IDN1 3R20A 3LGXA 3D7MA 3EZ6A 3LUGA 4UHJA 4DCTA 2BLLA 5IVPA 4E94A 2TMDA 3V00A 4ZOQI 4MPJA 2H5JA 4ZVMA 4WCFB 4KSYA 3D6JA 1M66A 1NVFA 2AZTA 4GP7A 3CNOA 5IBQA 3EZLA 2VQ3A 4R9VA 3HXOA 2AFIA 1C0PA 4D4LA 3B20A 1P4GA 2FUG1 3HYRA 4OQLA 4RUKA 5JXJA 4YCNA 2D6FA 2XUPA 2D4HA 1GTJ1 2O14A 3LT2A 2NVUB 4WERA 1VFPA 3GYGA 2PV7A 1EVJA 4OK3A 3ED1A 4JR2A 3RVJA 1Q2XA 4E4TA 4DV7B 3TLAA 2PX3A 3A32A 2WTBA 3DTVB 3GV0A 3MGCA 1CUAA 2XCOA 3ND8A 3QQ5A 4OBWA 4DSTA 4MUAA 3VHQA 2QZPA 3ZXIA 2Y1XA 2QYSA 3J7TA 1G291 4X20B 1N5RA 1P7VA 1V43A 1FFYA 3PDHA 1M6HA 3RU3A 3X44A 1VMEA 3I30X 4TTJA 5FUWA 3WMFA 2KYRA 2YXEA 3JASA 1WMEA 3DPIA 2ZYSA 1BHSA 2AVNA 4U1RA 1U1DA 2REQB 5AKIA 3WAGA 2IH2A 1IMJA 1MF7A 4X24A 5U1PA 4FR2A 2GK6A 2QW1A 2VDPB 3H17A 3JWGA 2WUWE 3E9NA 2C4KA 2OILA 1YGYA 4KYVA 3GGDA 1ISGA 4TTSA 5IXYA 4LC9A 1RTTA 3LPLA 2ARKA 3BZBA 5BWLA 3O83A 5FUQA 2FMHA 4YV7A 1I9CA 4NCNA 4H0FA 5ICCA 1Z3IX 1E9SA 1T5HX 2WDPA 4ADSG 3UXYA 4EVSA 3HBNA 4OLFA 4UEKA 4IQ0A 1HTWA 2YV1A 1BVRA 1DBWA 3QU7A 3OMXA 4W1PA 3WYCA 5BVGA 3E05A 3OF2A 3FSGD 3A05A 4HG2A 3NIWA 3WOVA 1JEAA 5HRCA 3IVMA 3MOSA 4HYTA 1ZCAA 2OV1A 1MH9A 5FQOA 1DXYA 4MWSA 5I9NA 5J2TF 2D2IA 1AS0A 1HSOA 1KDOA 1XXHA 3AMVA 4MKIA 3T06B 1EKXA 1NXWA 5KQRA 3HZOA 2C4TA 2EV9A 3EFOB 4MUBA 4KQ2A 2PS1A 2FSVA 3S1AA 4H31A 2A9PA 2E4VA 3FNRA 1XZHA 1SVSA 3A1EA 3DH0A 5DK4A 4A6XA 4YAGA 1UADA 4F2WA 2CJWA 3KALA 4UE6A 3ZHVA 1N34B 4O4JF 5AK3A 3QE9Y 2CDNA 1SD2A 4RK5A 1F2UB 2B37A 5G3ZA 1V16A 3LKBA 5KSZA 1WO8A 1UDAA 4Q1BA 1VJTA 2H0AA 1P9OA 1JIQA 3FNQA 1AKYA 3GJSA 3AKDA 3UBTA 1VBKA 1MQ9A 4G8JA 4Y2VA 3NOXA 1ZH8A 3FCEA 4G65A 1UDRA 2WE8A 4MINA 4JROA 4LC0A 1D1QA 1MJGM 4JMPA 4O33A 2QIOA 3EXHB 3GZNB 4U2GA 3BBLA 1W4CA 3EE6A 3MGKA 1N6HA 2G1JA 4PSUA 5AQEA 1ZMRA 5G40A 5D3ZA 3W5DA 1QF9A 1FDSA 3AONB 4J03A 1OE0A 5IYZA 3AHCA 2P9BA 4KNWA 3QLJA 4I1RA 1GFSA 1JVNA 1OBCA 3PYXA 4HGOA 3O94A 2VRBA 2O19A 2QLTA 3S27A 1O77A 2NZVG 3I37X 3LZ6A 3TZEA 3ZKWB 4KR3A 1OZGA 3HBFA 4WRRA 2BISA 3JRXA 5HTOA 2J32A 1JPNA 1ZNYA 1RW4A 2R8ZA 3HZHA 5HDBB 3W5VA 1IQPA 3ZXYA 3DNMA 2CT8A 2RI1A 4G41A 4TMFA 1HDCA 3OCYA 4DR6B 2NU9B 4MW4A 2ZRPA 3R9KA 4EHKA 1JIJA 3UJNA 1T8UA 1U63A 5LKAA 4LYDA 4KO4S 2PSFA 3F5FA 1NUUA 2Z3ZA 1ZIPA 2FFJA 2QQ5A 4G4SP 5IBPA 3DVRX 2VDJA 4H1VA 3TCNA 4Y2JA 4TWRA 5LCXA 4ZKEA 1EFRA 4S04A 3FUVA 1GZVA 1QP7A 2XJ4A 3H2JA 4I1UA 4NABA 4OYLA 2IHVA 1EUYA 2C0CA 5FPQA 2AVDA 2AEMA 2FX2A 1UMDA 1XGKA 2ZBFA 3AINA 1UZMA 4LWOA 2NU6B 2G3YA 4XSHA 3VH4A 1BXRA 1K06A 3G9XA 4KHZA 3O8RA 1K86A 3C3PA 3LDHA 3CC8A 4MS1A 2Y0BA 1AM4D 1YDEA 3DZHA 4OPMA 1WCYA 2GM5A 2KX7A 2VF8A 4HGRA 2WUEA 3LD9A 5AHRA 5H1YA 5L53A 5BQFA 1N1GA 1T8YA 2QSYA 4EA6A 2VC2B 2IHYA 4DY4A 3TZCA 3CZ9A 4F7WA 3NWBA 1Q74A 3CVYA 1N7JA 4MWGA 4QLBA 4PGGA 1KI4A 5A7GA 4WDQA 3AEUA 5K8LA 4YUYA 2PZAA 4EUFA 5JSQA 2PTGA 2HIHA 2OZKA 1P17A 2BELA 2F90A 1LD3A 1JHXA 2EWWA 3FPFA 1F8YA 1M10A 4YJ3F 3WMWA 1XXLA 5A4IS 1W19A 3JAMA 2NP7A 4NPAA 4JBNA 1L5WA 2J0SA 3R6LA 2GEUA 5DK6A 3RM3A 1ONOA 3C6QA 1DIRA 1IH8A 1KEUA 1G55A 4U02A 1UZLA 2Y67A 3GRKA 3COYA 3QEOA 5EI5A 1VXRA 3B1JA 1DTSA 5JPCA 1FFAA 1E89A 1ZVMA 2IYPA 5FEMA 5A5EA 1IVYA 1R6VA 3T0GA 4JUIA 1LCIA 1O57A 4I08A 2VH1A 3F2IA 4JCOA 3DL0A 4OMDA 5AXDA 5GONF 3BREA 3DCNA 4U9HS 3SZ3A 5EYPA 1RQXA 1NOKA 3H2KA 4TM8A 2X58A 3MJDA 4M8SA 1OYWA 3BK2A 4OXXA 4TVOA 1V5WA 5GOZA 1DRVA 4G56A 4B79A 2P4UA 3CRW1 5ALMA 1RYBA 1YOBA 1G9XA 2EDAA 2X76A 3FOCA 4M1WA 1G3QA 2ZSFA 2J0UB 3NHPA 3TTXA 4Q7LA 4QSMA 2NW6A 3IKTA 2UXBB 4MW7A 5B37A 3T1OA 1U0BB 2CDCA 4P3YA 2J9RA 2HMTA 1TUBB 2C1ZA 2VJQA 3PQ5A 3O26A 3OM8A 1SXJB 3JZDA 3BHNA 2G4VA 4TMYA 4PNEA 1ISFA 2E4WA 2FPXA 5TT1A 4B4VA 3RJTA 2N46A 2D0IA 4GMFA 5TGDA 5JJBA 1WABA 1ZK2A 4C4TA 4LRXA 2O4CA 3TECE 4D8UA 1OLOA 3PXGA 3TZBA 3G1TA 1QKJA 5KYTA 3PD1A 4L0CA 1MO3A 1ZWLA 2AJBA 2EP7A 2ZIWB 3WV5A 5FAXA 3AUKA 2I3GA 4HDCA 2J31A 2M6LA 4BWYA 2B6HA 3FTDA 4DLNA 3AM1A 1R5BA 2COUA 2BGTA 4OATA 3NTUA 4UOZA 2YV2A 3CJRA 1IQUA 3STYA 3GLGB 1A98A 1T5SA 5DGIA 1W1IA 4YP9A 1K8XB 1U2GA 2PAFA 2XXBA 1B0ZA 3NWEA 3LBYA 3QLTA 1GZ5A 3GDFA 4EYGA 1YQEA 5K5EA 2JLZA 4JXZA 5ALIA 1TIPA 1VMAA 1UWVA 2C07A 3AUAA 3DVAB 1UJ2A 4AZ3A 4BFCA 3UQZA 4BMZA 3GLIB 1Y6FA 1YZFA 2BH2A 2HSGA 2I3BA 2CXQA 1SD1A 4PYNA 5EMLA 1U80A 4RPJA 3RSGA 2SKCA 4OD0A 2ZWVA 4I2VA 3K1JA 2NNWB 4QUAA 3AETB 4CV2A 4XAQA 2O2IA 2FFBA 2HMVA 2HQBA 3B8HA 1WTAA 5KYYA 4NFYA 1QC5B 5A5FA 2G0NA 5E4TA 3N0RA 4PLFA 2ZAMA 3OZIA 5TF4A 1UQUA 2LXNA 2F3QA 4H6XA 1CRLA 3BD6A 3PJEA 5IXJA 1RYMA 1UM9B 1X14A 3BJIC 5SY6A 2D7JA 4MYSA 5EJMA 3LE8A 4W9NC 3IQDB 1KEEA 1L4LA 3JD0A 4XOIA 2V7EA 2R0QC 4P08A 1Z6TA 5F51A 4AZWA 4CWAA 1J2EA 8MHTA 2B36A 3P9NA 3RHSA 2F17A 4GOOD 2J5BA 3FHTA 2JAUA 1IYZA 1YSCA 1ZU5A 3NRBA 4HLUC 5DASA 1IOLA 3QF4B 4DQVA 3SVTA 3UMJA 2G5GX 3TQQA 4DKXA 3ZK7A 1PTJA 5CHYA 3MD9A 1FFWA 1G8GA 1YAHA 2VIIA 2QTFA 2X13A 3DYBA 3F5QA 4HK4A 3RVMA 1A50B 2FF7A 4RTSA 4GRIA 3N07A 3PR3A 2VZ9A 3KQMA 3BRQA 3RAGA 4ZAFA 1QBKC 4PC6A 4FZJA 1FUKA 2BFFB 4CQMD 3CUUA 4JP2A 4R2JA 1BN6A 3NGMA 1RC1A 4HC4A 1UH5A 3OM1A 2HRQA 4NIMA 4P5PA 3WK5A 3DFIA 2O1EA 3MRVA 1QGUB 3EDMA 4EJ0A 3BVPA 3WNDA 1SZJG 3K9QO 2VHEA 1LY1A 2H1CA 4HDRB 4YHHB 2C58A 3WWZA 4O59O 3U09A 3QGMA 4PSDA 1QFYA 4YUXA 2VTKA 1EFVB 1G1MA 4PGAA 1GTMA 1J9ZA 5LXTA 4MYRA 1MG0A 3LAWA 1KKLA 4IGFA 1EGAA 3PT5A 3NI2A 4Q1DA 1QR6A 1RQLA 1ST3A 2V5VA 5ECWA 1P2VA 3BQNB 4EO7A 5B58T 2QWXA 4UAGA 3W06A 3TLEA 3OIGA 3ZDAA 1XCJA 2A4KA 2GCOA 2R7MA 3RU7A 5L4LA 3BRCA 5BPFA 1JEQB 3RE1A 3UB4A 4DWOA 4XEUA 4TV8A 1YQWA 2AMFA 2CEKA 7MHTA 1A5TA 1B4DA 1CK4A 3HL0A 3LMKA 3LJKA 2GM9A 4TGLA 3TRKA 5GADl 4NBUA 1OB5A 3TPCA 2GB4A 3HGQA 3OP1A 1EZZA 3IUJA 2UZ3A 1YA6A 2NIPA 3LRXA 1LNZA 3ILSA 3IQEA 3ZW8A 5CVVA 3N8DA 2VP6A 2A5GA 2R1TB 2Q3DA 4GXTA 3GA0A 4G2TA 1ZFNA 5CD1A 1FTSA 3DM9B 4QG7A 3JQ8B 5BN3B 2G06A 4HDSA 1XUOA 5ENZA 1H9AA 3DEKA 2I6TA 2VZEA 2EAUA 1NI4B 1XU4A 3EDOA 4RXUA 4C7MA 1KP3A 2OV6A 3PQ4A 1PO7A 1OREA 1RS0A 4PO8A 4U7FA 3V4SA 3WGZA 4EJSC 4LYYA 5ALYA 1NLUA 1G8JA 3CIOA 4KIFA 4YONB 4IX1A 1E1KA 3RU9A 4CQMB 3KXPA 2QNIA 4Q3KA 2ZSKA 1SELA 3KYCA 1W59A 5JPIA 2IDZA 4XKJA 3H75A 4HDMA 3BWCA 2W2KA 4L8FA 3CU5A 3HTXA 3PR2B 3DBLA 2F64A 3B1FA 2LE0A 2A78A 3PJFA 4Z3DA 3B7PA 1P1FA 5DTMA 1NYTA 3KQVA 2XUIA 1SXJE 4L8VA 2QUJA 3GPCA 1O4WA 2FN9A 4WD3A 3JYOA 2CXNA 2WJ4A 3ZDXB 3EVBA 1ZN7A 2HYIC 2HJHA 3G2LA 4YP1A 4G0ZA 2H9IA 3TIVA 3FTEA 4B85A 5DOZA 3VTAA 1EUCB 3SBOA 2C7RA 2R751 4QFDA 2DUJA 4RWEA 5FYDA 1F48A 1M1NB 4DIEA 2GEKA 3O4JA 2GYYA 3I5XA 3G8CA 4EK9A 1ZEJA 1KYIA 1V11A 1P1KA 2VHXA 3DULA 4MDHA 5FOXA 4BLWA 2PWAA 4UEJA 3ZGOA 3CMMA 4Q93A 4WXYB 4IOKA 1R8SA 1WZIA 1W25A 4KQ9A 2B34A 1ODKA 2V97A 3B38A 1ISHA 3GPIA 3JQ9C 4G1BA 4J4HA 4NCHA 4PTZA 4L5BA 2NAFA 2YDYA 3S28A 1P74A 3B89A 1IZYA 3OCWA 4BMOB 3GLIE 3KYDA 3DBHB 1Q5PA 1PKEA 2I7DA 1ACJA 1GOTA 1WXXA 1AQUA 1FNBA 2W6QA 3QLEA 3A3OA 2JS7A 4LNAA 3W79A 5MN4A 5B64A 5E2BA 3ZTTA 1LS1A 1Z8HA 4HQKA 2DQKA 4LMRA 4MTLA 4CKBA 1QX4A 3NPAA 2QTNA 4F5DA 2X8JA 3HJCA 4EFMA 1DFIA 3CR3C 4GLOA 5IC6A 2Q3JA 4QJ5A 5JD4A 3QEAZ 1ZJ5A 4BVKA 1LDGA 4F93B 5F5LA 4QQKA 4C3UA 2B98A 1CF4A 2EBUA 2QTHA 4OQFA 4B3XA 1J8MF 5BSUA 1ZUHA 1LSOA 3EWNA 3O2JA 3AVOA 2ORYA 2BKEA 4TTQA 2QTVB 1VE9A 3FPSA 4YQZA 2ZE7A 1RJGA 1QIKA 4DIDA 1ZRNA 2Z1DA 1Z63A 1PZHA 1QORA 3UXEA 2EFHB 1UKAA 1VBFA 3A04A 1NDUA 2XUGA 4YJ3B 2O6HA 5A4MS 3F6SA 1QZTA 8ATCA 5HUHA 8OHMA 3AF3A 3D81A 1IBCA 4NS4A 1QPZA 3GUZA 3IAM1 1LF0A 4P35A 2OBYA 4BPRA 2P27A 3HU3A 1XAHA 2GAAA 1Y8ZA 4KO3S 3DHVA 5KX5F 3K70D 3N5KA 5CB0A 2YOGA 1NPTO 4KLCA 3QX9A 4PV7A 4FEEA 5EGNA 4I8XA 3VUEA 2W93A 4RETA 4WZBB 4DAEA 1X8LA 3FWPA 4DANA 3PP8A 5F7OA 1R8JA 1P18A 1YR2A 3E0XA 3E9EA 4JIMA 3B3JA 1Z0FA 4KFTA 1CJBA 2OHXA 2Q41A 1R15A 3C1OA 4UXHA 3VZDA 3GDOA 3RRMA 1HH4A 2MYPA 4OP3A 2YJZA 4BNNA 3NT2A 3M5CA 4U2FA 3O38A 1RWKA 5HF9A 4XYLA 3PQ2A 4QARA 3VX4A 4ESOA 1A97A 3CN9A 1XELA 5BQPA 1FXWF 3JV7A 3LKDA 3HU1A 3WJAA 3C6KA 2X4LA 2WVAA 3L1IA 3OU7A 3WSVA 2J5QA 2ISQA 2XE6A 2G1KA 4XIJA 3UF0A 3ZLVA 3ZXXA 5I8PA 2FW0A 4GO1A 2FMIA 4OL9A 3RS5A 4KPYA 1U8XX 4NL4H 5ES3A 3BIWA 3D6UA 4EKNB 3AHHA 3KOMA 5BRAA 4KRYA 2L18A 2WE7A 2LGJA 2H2IA 4WXEA 3HJUA 4LWQA 3RODA 4HNQA 4ML3A 4WIAA 4DDUA 3P96A 5IHPA 1JPUA 3EYAA 2XOKD 3CUSA 1UBSB 1L3CA 4B4OA 2PUGA 2O8BA 1GNVA 4D0GA 2OP0A 2OWDA 3T99A 4L22A 1PHRA 2VWPA 3DDNA 4R1LA 1FTNA 3WGGA 1TCCA 3WP1B 3IQZA 1ECFA 4X95A 4PLHA 3VBCA 3OKAA 2X77A 2FWAA 5CFPA 2OBXA 1S9DA 4AKIA 1XQWA 4QJIA 3NVAA 3QVOA 2Q6LA 2ZGVA 5FO0A 1OHHD 3CWCA 3U2QA 1N6RA 1XP5A 3PUVA 1K5GA 4FFLA 5D1NA 2B1GA 1JWBB 1UC4B 2FPGB 1MZVA 3DZJA 3OQPA 4GX0A 2X6RA 3W3AD 1WR8A 4D44A 1UANA 4G5SA 4IWNA 1NW6A 2ROQA 4HKTA 2J9ZB 3OHSX 2ZETA 1Q0RA 3PFWO 5EE5B 3N0TA 1UPBA 2VJCA 3EQ8A 4CFZA 2JATA 4FSXA 4J6FA 1JAHA 4XVUA 1O0BA 1GAEO 5B2FA 2H0QA 1U2DA 2AMLA 2H1WA 3BB1A 4K9RA 4X45A 1PE0A 2J3DA 3OPYA 1L5MA 4FLEA 4F9GA 1SR8A 2WU1A 1E5LA 2JIBA 4ND2A 5IMBA 3T7AA 3WDKA 5KB3A 3PDJA 3INTA 1DDGA 4GI1A 4QSHA 1ZPDA 1DG3A 1UPUA 2GO1A 1W2HA 2J9YB 2H52A 2CY0A 2RHDA 4DLBA 3TQSA 1KDRA 2YWCA 5FBQB 4A8PA 3S4YA 3ZGVA 1PWYE 2W6CX 1J24A 1E69A 4TMXA 3MLBA 1FMFA 3UGQA 3WGHA 1BE6A 1NJ5A 1F5NA 2I54A 3T38A 2QL7A 1W5BA 1XG5A 3TLYA 1GRNA 1G6KA 1UXIA 1DNPA 4US0R 2ZBEA 4GT1A 5EHZA 1NQ5A 3KXKA 3K9LA 2V98A 1BVHA 3EPJA 4DDKA 4JT4A 2IYNA 3TQRA 4FOTA 4DMUB 4CQNA 4D4HA 3RAFC 1UEJA 4KPUA 3CQ9A 3HN7A 1G6OA 1PEAA 2GN2A 3PCRB 5HF8A 3E3NA 2DTDA 2AUMA 2IU3A 1DUSA 4EEKA 5H16A 2WSYB 3GIWA 3S8MA 4IXWA 3GJZA 4L2IA 4XWAA 1FRQA 1DXQA 1OR8A 3O2SB 2C9YA 2Q29A 3NBKA 1DZ3A 3NFRA 4OXQA 4ARBA 4P84A 4EJSB 3ST7A 4LV8B 4CLEA 4TROA 2FFAA 2NUBA 4I4CA 2H16A 5CAEB 1HRKA 1D2MA 4NMHA 5HK8A 3AHIA 3U4HA 2CGEA 2D5AA 3OZFA 3VOSA 5C1DA 5JALA 1J23A 1EFKA 4AMGA 1WM1A 4CIYA 2PR2A 1XN4A 2D1YA 4GDFA 1Z26A 2DM6A 3ZIAA 2OHFA 1YIAA 3A1NA 3D7LA 1GAXA 1GVHA 1QG4A 4CF3A 4CEHB 3IMKA 2FCAA 4IJVA 4A8TA 3P7MA 3SF0A 3DUFB 2X86A 1V39A 2EHJA 4XYBA 3KEQA 1E0JA 4JEUA 5GP1A 1KE1A 5JXIA 1WW3A 1Z5PA 1F38A 5BSRA 3HYLA 3V8EA 1DFGA 4CMIA 1OVMA 1V5IA 4QBGB 4D0NA 4FXPA 4HY3A 4CM4A 1UP6A 1PN3A 3FIJA 3DJYA 3KR1A 4V0OA 1YR8A 1DARA 4Z9BA 3QVKA 5IDWA 5JAPA 3K8YA 4YT4A 2LNDA 1II9A 3BK1A 3AIMA 5FPPA 1F17A 3MS4A 2GCNA 3OZVA 4C1BA 2XRMA 2X2EA 2D1TA 2BTEA 3O8OB 1Y1LA 1Z6AA 5JZBA 2RHGB 1WNTA 5IF3A 3SOZA 3TOSA 5IX8A 2C7GA 1R6BX 2QQ0A 2YJ4A 3H87A 4HYQA 3N3BC 4J90A 4R2XA 4TS9A 3A9CA 3LC1O 4XJSA 3R6TA 4R71A 3KQHA 4WZBE 1CQZA 2OV3A 1OH5A 4LF5B 4ZI5A 2HOQA 3NBZC 1AQYA 1S8NA 1Z37A 2ZRGA 5ALRA 5CXQA 5GZ3A 4O2AF 2VO1A 4XASA 5G2OA 5JXWA 3BCRA 1FLVA 2F3SA 1NFFA 3TR6A 3TSAA 6Q21A 2FPRA 1DKPA 3PUWA 4QRDA 1ULUA 1QQTA 1CUUA 2RKBA 4JDUA 1QG6A 4B1FA 1UKVY 4LJAA 4YRGA 3OJ0A 3BSSA 4MGYR 4WQMA 3IOYA 2IFTA 4W9RA 2IS2A 4QEKA 2ZJ1A 4TZ0A 1DGQA 4FW8A 3WRYC 4BWGA 1ZGCA 1E3EA 5J5VA 3O84A 4PLCA 2BFCB 2A2ZA 1TCBA 4X3OA 2JAPA 1MO6A 1E0AA 4MGEA 5C5IA 2BM8A 1NMQA 4M9QA 5JFOA 2FPUA 1RM5A 1VHLA 4JB0A 2VYND 5F35A 2ACWA 1VKOA 3QP9A 1PGNA 1GQRA 1UMCB 2WIDA 3H2SA 1E20A 3KKQA 4NDZA 4RELA 3WXMA 2D7CA 3EEFA 4WBXC 4Q4AB 1T8TA 2H6EA 1X1AA 3MINA 2Q9CA 1YQTA 4C3OB 1JHOA 4Q4HB 2V1XA 2Y2UA 2R6HA 3F9IA 4DG8A 2O6LA 3QELB 1GLVA 3UCFA 4DA6A 1N6PA 1E79A 1QFJA 3ME5A 1TLLA 1W4LA 3FSEA 5AJWA 1F2DA 5ES4B 1RXUA 1B8VA 1CTQA 3IELA 2GUGA 3LOPA 3NEJA 3MMZA 2ISSD 4LXIA 2FWNA 4I1OA 3VH2A 3E7DA 5A4AA 1YS2X 2I9PA 3DLIA 4G84A 3V1UA 2RH8A 2UU9B 2QRUA 5AP9A 3HXQA 3S2SA 2ZEJA 4FDMA 4BX8A 1JTEA 4HB4A 2HJRA 2FFQA 3EVDA 1JL3A 2G0AA 3DXYA 1KL7A 4LXYA 1XE3A 4HR7A 4RVSA 3D4BA 1LRKA 1NJGA 2Z8XA 3PE4A 3RGGA 4EL5A 5FT9A 5FWYB 3QVTA 4NJEB 5L3RA 1YJAA 2BFNA 3RS4A 4RKYA 2JAQA 4C4XA 3PNQA 4JI4B 5EJFA 2M6SA 3OI7A 5LB2A 3HVJA 4KXLA 7ADHA 3KOWA 3D43A 1TMKA 2C97A 1ODLA 4ZEWA 1TW3A 5CYGA 4HWOA 2QD3A 2O50A 4A73A 4FYIA 4BNWA 3DAGA 1HO3A 4V1CB 3T1TA 4E4YA 2BFPA 3INGA 1N2CE 1NUHA 3RRXA 1NONA 5AKEA 2Y1KA 1I01A 1ZC4A 3D3WB 1FDVA 1U0GA 3OUTA 2HIMA 3EXIA 3DV0A 3JAKA 4L16A 3PI6A 4RD0A 3IIKA 1TJYA 1USIA 1VDMA 1CJUC 1E3TA 3G9ZA 3LLMA 5ALDA 5AT1A 4HDKB 2Q9AA 3SJ7A 5JADA 3WQBA 4HTFB 5BYKA 1GN9A 3WTCA 1YB2A 1DE0A 1JSLA 3D2LA 2WSBA 2CJPA 3H9BA 3L7NA 4RJIA 4EX7A 4JI8B 1QMGA 1FFHA 1S4MA 3PGKA 2GVNA 4GQAA 2W58A 4XM0A 5EGSA 3RS7A 3UJHA 2B8JA 4CMCA 3Q7RA 2YXDA 1X3LA 3FZQA 2BI4A 2PQMA 2FR0A 5KNDA 2A1IA 3MYYA 5C0OE 1MP0A 3WFZA 1XMPA 5E7QA 4GM4A 4CV3A 1IN5A 3R44A 3NHKA 2GJ9A 4ID3A 4IUYA 4RL6A 1NI3A 1W52X 5J40A 1XLVA 4HTAA 2QAGA 1JKJA 2HCBA 3DLBA 3QBJA 4RNDB 2I2DA 4URXR 5IM5A 1OH6A 2EW1A 3DOIA 1ZJZA 3I6MA 4REQB 2OXTA 4JR0A 3TL2A 4HZIA 4ALMA 4B6SA 3BILA 1XEWX 4DLKA 2NUAA 3JD3A 4R3NA 4UBOA 4D92A 4MV9A 1KAMA 3IAAA 4UM9D 1NRXA 2WR8A 4GBJA 4BKPA 1YJQA 2HK9A 2EARA 4KQMA 4PCAA 5AIAA 2PZ8A 4B32A 4DM4A 5CH3A 3QKTA 2E1RA 1E6CA 4Q01A 3UAYA 2GK7A 4WPGA 5GVRA 2JIMA 1EUDA 5BNTA 3KXIA 2RGUA 2JCXA 4Q3OA 4X94A 4B6EA 5KTPA 1KIAA 2B4AA 3DJFA 4HDOB 2ZBDA 4H1UA 4RVNA 4TLDA 1LPPA 4UVHA 3WXBA 3FB1A 1OV4A 4KQJA 3RAEC 1NFRA 1Y3AA 3AJ8A 3TSWA 3Q4GA 5BOSB 3Q87B 3K32A 3VR6H 3G2MA 3CVVA 3PEUA 4FSHA 4BO2A 2ZZNA 3MCTA 2FUCA 1VE3A 1YL5A 4N40A 1PLKA 2X1HA 3GDWA 4MRNA 4Q6WA 4QC2A 5FBLB 4GI3A 2XAUA 3GI1A 1HYQA 1XTUA 2QTMA 2RHWA 2Y2VA 3HP4A 3Q85A 1H9BA 2VH5R 5D1HA 4H4CA 4HFRA 3FPHA 2JEZA 3KEMA 3LUJA 4RSRA 3LPMA 4KQ6A 2B8WA 3S2YA 4ZT3A 4C5AA 3HUEA 5C8XA 5JMWA 4EI2A 3KXLA 4D4IA 3T7RA 4AB1A 4F4IA 2XECA 2DECA 1WNFA 2OCAA 4MVJH 4KWTA 2GCPA 1CT9A 1WX1A 1Y4DE 2ZWOA 1U0EA 4HCJA 4WKOA 5FFNA 3RYFA 2QQFA 1A9ZA 4PIVA 3VPXA 1P2GA 4G2NA 3GFTA 4WOBA 2AN3A 1AURA 1IXKA 3KJZA 5D6OA 3DCJA 1JXAA 1K5PA 6REQB 1P3Y1 4WJKB 5I8WA 5BQ5A 5JS1A 3I42A 3QF7A 4NDAA 3P9ZA 3RFUA 4JJKA 3AF1A 4BFTA 2IYQA 3FLEA 3KTAA 3RSZA 5CBKA 1GNSA 2H54A 3B3GA 1E2NA 3LVBA 2BFWA 2J45A 3CURA 5TARA 3VPFA 2O2EA 3KE8A 1XRSB 4KKVA 3G9UA 3RG2A 3UIEA 3ZC3A 4F6LA 1RBZA 4BUJA 4EUSA 2VXYA 5AVJA 5CTAA 5IUJC 3QFCA 4HDNA 4YY3B 1GR0A 1HE4A 1PFUA 2HRDA 1Z2CA 2CNKA 2YIVX 3AO0B 4KQ1A 4MPTA 5LP6C 4JSYA 4L27A 4BFZA 2DR3A 1WPRA 1GQYA 3JY6A 4L5YA 3SXUB 2QL9A 5GVSA 1LV7A 1KP2A 2X7HA 3PSAA 1NF8A 1Z73A 2TYSB 4MKFA 4Z49A 3CPJB 1EGHA 2IUYA 1X2EA 4RX1A 2V0CA 1O5TA 3IOCA 1I0IA 3ZVKA 3MBOA 2ZI9A 1UJMA 4XWYA 5ALXA 3ONNA 4E3WA 4CL8A 1G5HA 2C4NA 5FTJA 5HUJA 1VYVA 2JJYA 4B6QA 3Q3JB 1L5HB 2J3KA 4RZHA 4ENRA 1W34A 1T9KA 2BIFA 1YU6A 3TI7A 2NAPA 3OTWA 4QQRA 4YMWA 1PFQA 1WMSA 4IG9A 4QIHA 3B1XA 3SJUA 5EIXA 3L6OO 4QTTB 5T64A 1TKCA 2WAAA 1T13A 2KW5A 4B8ZA 3TOXA 4UAJA 2ZDGA 1B8PA 3KHUA 4GI5A 4O4LF 1LVHA 4PPYA 4YREA 3H5TA 4IX9A 5A5GA 2P6OA 5LZ8A 1Q7CA 4KRFA 3UC9A 6ABPA 5J1SB 4QM7A 2JANA 3EXEB 3TVYA 3ZLTA 5DW0A 3HLYA 2DXIA 1VIMA 3F9CA 3ZWCA 5JFGA 3A10A 4O4HA 1XQ9A 3QPVA 4WNYA 1NMSA 4PSVA 4DMGA 1K4MA 1PJRA 2UKDA 4L15A 4L78A 5H81A 1D6JA 2GARA 1M0EA 4LHWA 4LF8B 3BKXA 1X7YA 3DKKA 2WILA 3E7WA 3PUXA 3ELUA 3R75A 3T0IA 4WZAB 3JD1A 4F3RA 4F5ZA 1HKHA 3RFFA 1NDQA 5KSYA 2DY1A 4Z9YA 3WNQA 1L7QA 3AEXA 1E2DA 4PHCA 1S2MA 3P27A 1NBOA 3ZUPA 2PAAA 4EPVA 4HWPA 2OPBA 2FMUA 3SS7X 3GEIA 3I2KA 4J7CA 5E1MA 3WS7A 5F76A 4IF6A 4CVNA 5BR1A 1XF1A 2HKIA 4PN7A 4DV5B 2J46A 3DTTA 2VDRB 3EMBA 4L4RA 4FE4A 3DZGA 4H18A 1TK3A 1FJHA 4ROSA 3WA6A 2K87A 3KOYA 1QIJA 1U7TA 4V2IA 1ZA1A 1CUJA 2DPYA 1JEOA 2HU5A 3JQDA 4YLYA 3F71A 4YXWA 4GSKA 3M6LA 1M1YB 1U8EA 1LTQA 3AR5A 4Q47A 2PQ0A 2GZ2A 4UATA 5AR1A 1ODTC 3V3TA 4NOMA 3D5EA 1KRWA 1E6KA 3V1MA 3GJ4A 4RVOA 4GICA 5E6SA 4KXFB 2IZ5A 1TJ4A 2CLOB 2OK8A 1CQIB 4L0MA 4WASA 1NXQA 2RGAA 4RVFA 1RVDA 2JL1A 1KZ1A 2FTKE 3PGLA 1IIRA 2YZNA 2NGRA 3GYBA 2OY0A 2QVYX 2XLCA 3OCCA 3CLRD 4K6FA 4MUHA 4Q3EA 1N5IA 4BFVA 3HVKA 1I4DD 2IE8A 4R2HA 3VR3D 1R16A 2HF9A 3K5PA 5DPMA 5BMVF 2OHGA 4UEOA 4HHEA 3W1EA 1U7ZA 3LCRA 1KVSA 5C4MA 3HSSA 2I7CA 5CDTA 1QPBA 1NW4A 1JDTA 2X0IA 3LK7A 1AHIA 2OB2A 3FVTA 4L5IA 3R7DA 5CM2Z 3U9SA 3M6AA 3Q3VA 1ZONA 3DT8A 4P5EA 4YCMA 2GN0A 1HQKA 5REQA 2M6KA 2ZJFA 5GMOA 1A5ZA 2PY6A 2PX4A 3PXDA 2TMYA 4AZTA 1O4VA 1XMQB 3JWPA 2PYDA 4HEHA 2PMFA 5CNMA 5GINE 3PC4A 3DXFA 1X7ZA 4K3VA 3TEFA 2YICA 1ZGAA 3C45A 1HT2E 1AO3A 1T0IA 3F7NA 4GDMA 3W8DA 1J0BA 1E6WA 3QJYA 1QP4A 1NAIA 4F4FA 4Z1MA 4ZQBA 1GADO 4Y2SA 4BEWA 2IQIA 1RQ2A 2CXSA 3RBVA 4YB8A 3T1VA 4EY3A 1SUFA 1GQOA 3Q0EA 1VBNA 3DW3X 1RC0A 3ZTYA 2Q9BA 4LY9A 3WYGA 2FPIA 5T8KC 2FUNB 1XWIA 3QNMA 4GOXA 1G20A 1K66A 2MSLA 3O4FA 3RW9A 5C8YF 2RBKA 3GGSA 4G0YA 5ICFA 5NLLA 1IY2A 4BIIA 3F1LA 4JOQA 5HJ2A 2ZWMA 4OGKA 1C3OA 5EL0A 4E5VA 5FA5A 4EYOA 2DJ5A 4RD1A 4FGSA 3WDLA 4IQGA 2A7XA 1U0LA 1TAGA 4DNFA 3GLHB 4MS4A 1IOWA 4QU8A 5HEKA 1XCOA 1KSFX 2HSJA 2PE5A 2ERYA 1X9GA 2OQRA 3FYCA 4ARVA 1NGSA 3CKLA 5U4XA 4H7PA 4N03A 1LPSA 1GGHA 1T29A 2NYAA 3ML1A 1Y4ZA 5PGMA 1W46A 5K3FB 5CT8A 1W0JD 5F21A 1H5QA 3VZBA 1E99A 3WKBA 5JBQA 3FOFC 1EM8A 1U8AA 2Q1WA 2MSCB 3TSCA 1NG1A 1ORRA 4J7UA 1Z88A 2EW8A 4OIMA 2QP4A 4XGIA 5DNVA 1Q0PA 4MUGA 4B9AA 4DADA 2LRHA 2YC4C 5T41A 3LF1A 2HRZA 3R0XA 4Y9UA 1IWBB 4K28A 1YMUA 3ZPXA 5A6SA 1I7QB 3L8CA 1CUFA 4ZEXA 2AG8A 1PF7E 1Z7EA 4Q7JB 3U1BA 4RJ2A 2OHOA 1TYZA 2YWRA 1V5EA 4TLLB 3G85A 1R8XA 3PQDA 1WVGA 4ND7A 5F9MA 4X1OA 5FOQA 2OM2A 3TGWA 2P0EA 3EGDA 2K6GA 3A1FA 4M0FA 3RVQA 4DTIA 2V3CC 1J2YA 1YZKA 1ZGGA 2QS9A 3QK7A 4P8RA 5LQMA 1E77A 2RAPA 4KE8A 4DT1A 1SU4A 2JFZA 3RYIA 3QA3E 4MI3A 3NBQA 2AUNA 2D74A 4JY7A 4M1OA 1YE5A 4JT9A 1QJCA 2BMJA 2CLMB 1XEAA 1K98A 3D4NA 2AG1A 2ZPTX 3IUSA 4MUKA 3AR7A 4N0EA 4WZAE 5IKPA 2BGJA 1JEYA 2ZVDA 1N5MA 4IFBA 2WP8J 2Y8EA 1CVIA 3JVIA 2BKUA 2ZBGA 1QXSA 1SUWA 2QRVA 4HEA1 4LECA 4QOGA 5LP6B 3ANYB 3UAXA 2P90A 1MJGA 1G7TA 3I9V1 5CFOA 1HLDA 1XCPA 4J0DA 1SUEA 3RREA 1E7YA 3AP1A 4DIOA 1JHDA 3TK1A 3TRFA 3R5TA 3KOZA 3WQHA 2V7QA 1WP4A 3EIHA 1SCKA 3RUFA 3ZHSA 4TYMA 4Q48A 1ZJWA 4KR9A 3OSUA 4ZAYA 2ZIZA 1EM6A 3OZ7A 1XMSA 5ALZA 1G6HA 1X1DA 3EIOA 3TGPA 1EWRA 1JH8A 2AEJA 2YR0A 2BJHA 2C99A 2G6BA 1IUPA 1DT5A 4NX2A 5H3CA 3RABA 4LF6B 5AH0A 3RT1A 2CUZA 3E9CA 1R8QA 4UU8A 2JA2A 4REMA 1JHYA 3K35A 2J9XB 4KLRA 1FRZA 3SMQA 1DEKA 5JVDA 1FSSA 2XADA 2Y27A 4GOLD 3IHWA 3CVUA 3IOMA 3R23A 2Z43A 5BVHA 3B6EA 4GRAA 5CDFA 1R4ZA 4DMRA 4R0VA 2QZSA 4EBFA 2OGZA 1KI9A 2F3PA 4D3DA 3EOAI 2VUUA 2P77A 4IVQA 3CUWA 4RGVA 5FJIA 3PZBA 3T9CA 2NSYA 3FDZB 4CDNA 2XWBF 2RHBA 3L82B 1EDDA 2B9VA 2FSHA 1PK9A 2XVAA 2FKAA 4FYJA 3EAQA 3AR2A 5HZKA 2IXGA 2FSVC 4R1UA 5ELLA 13PKA 3LYAA 1REQA 3FWZA 3UV7A 1XC7A 4PQEA 4LHEA 3IR5A 3PPXA 5HPYB 1Z5ZA 4IIEA 3G0CA 1SVUA 2I4LA 3O6VA 5A0FA 1CFZA 5FUYA 5KJEA 3MLEA 3TE6A 2I4TA 1IIBA 1K1EA 4I5FA 2WZDA 4BFUA 1PNRA 4JUDX 5FOUA 4DXDA 3EUEA 4LXGA 2RE8A 3DE0X 2ZYWX 1XI2A 5ICSA 3VZPA 4MW0A 1K89A 2R68A 3COPA 4J16C 3F4BA 1YR1A 2JAXA 2H4XA 1EB8A 1UKBA 1V45E 3H2IA 3GP3A 4RK4A 4XX0A 3F4LA 3S2UA 2J1LA 1C1XB 4NCXA 1RZRD 2X1MA 3TNFA 2O7VA 2IS4A 3R3ZA 1UEXC 4UFOA 4HVTA 2UVPB 1Z39A 2CK3D 2RIRA 2IVZA 2P9ZA 2EKDA 2XCQA 3B1ZA 1SURA 1XA0A 3L0OA 3GO4A 1HEYA 1K6IA 1YOVB 4LYHA 3J80A 2D54A 1L1FA 4O4LB 5CLLA 2EG5A 1M74A 1DQRA 5CH8A 4FEAA 4FFWA 5EXTA 3NKFA 1G21A 1TGVA 1ZNXA 2XMPA 5T4FA 3BM5A 3FBTA 5IH3A 1TUGA 3ZY4A 2OQ2A 3ROFA 2GZMA 3LPAA 4TYNA 3IHKA 1BA3A 2OGTA 1IPHA 1KJIA 1BD3A 1J00A 1QCCA 1WS6A 2HGSA 5J43A 3SMVA 4OHYA 2XCIA 3MHPA 1AIPA 1SWVA 2GLUA 4B47A 3N6RA 4BNFA 1XK7A 2BUAA 5AVRA 1H9CA 2CBGA 3WMGA 1KFCB 4ZPJA 3GLHE 5KAMA 1EHIA 4K5QA 1NBME 1QYDA 3ESAA 4ZQGA 4MW6A 5FKJA 3TN7A 2B2XA 3WGTA 1LSJA 2IY9A 4PONA 4RKEA 2YIJA 3G2OA 1QZXA 2QR3A 3N2LA 1ZI6A 4HFNA 3KKPA 4C0WA 3H86A 1YULA 3B6IA 2K7FA 3ZIDA 1JQAA 3R7NA 5F2EA 3BGDA 5IN5A 1NQVA 2XUHA 3W6NA 3G0DA 4C4PA 4ZARA 2Q0HA 1JG1A 4L72A 3KQWA 2P69A 5FPKA 2ATCA 4BBAA 1FSFA 1F7UA 4TZKA 1VRWA 1EX6A 3IMGA 3STTA 1AC5A 2Y9PB 3MWFA 1Z5VA 3RWMB 2DH6A 4CMJA 4G4SO 5KYGA 5AVKA 4TYPA 3B12A 2QMOA 4YJGB 3NYQA 4L9WA 1VB5A 2B4TO 2O7NA 2R84A 4FHDA 4AJ9A 4L73A 3DS8A 1WB5A 3ENVA 2XIQA 5K0BA 1QM5A 3I76A 3LC7O 4B2YA 2YJNA 3A1CA 2AW3A 3VYUB 1Q7RA 4LX0A 3BMQA 5MN5A 1ML3A 4TMZA 3V9AA 1V4VA 4HS4A 2YTZA 1QH0A 3KSBC 2W2NA 1G7RA 4UUPA 3HM9A 3E5NA 4R54A 2Q3CA 1LDYA 2H7XA 2PVSA 3OCZA 4DQ0A 3GT0A 1VPVA 4J0GA 3KJNA 4TN5A 2FRVA 3GEPA 4WFQA 4HB0A 3RS0A 3WWPA 5LJIA 2XA2A 2P3OA 2W48A 4L7VA 1CZOA 3NWPA 4LXTA 2OCGA 4NEHB 4E09A 3R5HA 4MWZA 3STUA 5B36A 3M1IA 3GCGA 1PD0A 2QDXA 2BD0A 3KLBA 4PAOA 4YEDA 5BSTA 3WBJA 1K97A 3ZEIA 1OLSA 2EFJA 5JASA 5KQGA 2J9FA 4ZAZA 2GESA 2BBTA 1B1CA 2BH9A 3QQPA 1DBQA 3FHCB 5LWQA 1I13A 4PRKA 4AK9A 1F4VA 4FOPA 4BLTA 2MSWA 3JS5A 3AGQA 2CHFA 4EG0A 4R69A 4LJRA 2HREA 4BTLA 4C14A 3D8NA 5F78A 5HIMA 4B5KA 2O20A 4ND8B 4YRRA 4W99A 2ZKIA 3HU5A 4RDIA 3TEMA 2LD4A 1FX0A 2HXGA 1LKZA 2QPAA 2QG6A 1QB8A 3H4IA 3O1JC 1B93A 3JWHA 4TUYF 5EE9A 3BJMA 3E2MA 2HRCA 2FY8A 5KQLA 2WZQA 4GPEA 1EP9A 1VCHA 4E11A 3FLMA 3BSWA 3GX1A 4XDHA 4EG7A 1E2GA 3KEGA 3A25A 1DWOA 2C4UA 3C0KA 1XD9A 1KEWA 2QI9C 4TT3D 2GPAA 3T34A 2FG5A 4JJZA 4HP8A 2HLDD 4RTPA 5MGBA 1CUYA 4G37A 2JIDA 5BMVA 3QOFA 4QDJA 3NBMA 2C77A 4F2PA 5I9IA 2DFDA 5HJ5A 4UM8B 3TMKA 5DOVA 5K01A 2Q8PA 1T36A 1HPLA 3FKSD 3C87A 5I9LA 3W5AA 2Z08A 3BE4A 1U2GC 1EK0A 3C4JA 3O9VA 2HRRA 5IZCA 4NR0A 5KHOC 1RYDA 3MTGA 1BIFA 3AV0B 3IV7A 3KKNA 2PS3A 3OOHA 3RSFA 2QTGA 4EPXA 1XKQA 3A11A 2W90A 4G8BA 2IBMA 2OAGA 4IXTA 5EMNA 2HJWA 1N3IA 4X84A 3EZFA 3H16A 3LCCA 4HXGA 3ND6A 4OHFA 1C3JA 2PJUA 4DBZA 1Q3HA 1HYHA 2HA5A 5DM2A 4N5NA 4CKCB 3VZSA 3KVVA 3ONWA 4MQUA 5ITSA 5LL6P 1I0LA 2ZKLA 2A0WA 2AR0A 1RRMA 1ZINA 1EA5A 1JEDA 3N8IA 4PYLA 4DNQA 1FLDA 3HA2A 4AF7A 1N9GA 1NMZA 3L4BA 1NG9A 1Y33E 2QXUA 4PZEA 3NTRA 3TPZA 5HM6A 2H2DA 3L0ZA 4Q7KA 3RF6A 2Y1WA 3LECA 4JA0A 4JLMA 4UEQA 5CU7A 3T8YA 2IBSA 3FGNA 4EVRA 2PYIA 1IONA 1OBOA 2FSIA 3NDRA 5C8YA 3ZCSA 3THXB 4YAFA 4YWJA 1VJGA 4JC0A 1DO2A 5KJFA 1V8FA 1A1VA 2D00A 4W5JA 4X8OA 2JHPA 3L02A 4Y6RA 4YMUA 2FZCA 5JMOA 3DWIA 3K96A 2IIBA 3Q9LA 2ZJ6A 5I7RA 3QKWA 4P36A 1PTJC 2B69A 3UT5A 3AEYA 3AY0A 4YJ2F 1E1RA 2GX6A 1FXUA 3I45A 5IFKA 4JT2A 1DQSA 2WWHA 3FROA 3RIGA 1E7SA 2XB8A 2G9ZA 2ZR9A 4LJ9A 4BMPB 1PQ4A 2I4MA 1DX9A 3TB6A 3D3KA 5K0ZA 4JLUA 5K3AA 2D1QA 4DUGA 3QMWA 2WJVA 3EXFB 1PTKA 3BS4A 5CVEA 4YRFA 1KJ8A 1W47A 4YTEA 1P75A 1QANA 4ZAWA 2IV3A 1ND5A 2PA0A 4IQ8A 4X7PA 3MOIA 4KWIA 4PLVA 3WDMA 4MW2A 1XXHB 3AEZA 2PBZA 3KZ1E 1SHLA 2WPDA 2NYUA 1EE2A 2FZVA 1NF3A 2PWZA 4MWCA 4YX9A 4GBED 1IU9A 3OUUA 5EJGA 2W2OA 3D4IA 1C5KA 5M04A 2YIDA 4E4RA 4WK2B 2ZR0A 4KI7A 3WRXA 4H60A 1AF4A 3IBCA 3HDJA 3L7KA 2Q5CA 4JOCA 1KY2A 1UBLS 1V4BA 4EB6B 3E18A 1DOHA 4B9EA 1WCWA 1NUAA 1Z17A 3FPCA 3A4TA 5KVQA 5EUCA 4U0KA 4E5PA 1ULZA 5DSZA 3LUAA 5IDXA 1T0PA 2XYPA 3RJ9A 2C2BA 5F9FA 1X1SA 5KC9A 3KKMA 2WFMA 3K9WA 1IC6A 4DCUA 3ORFA 4XW2A 4DPMA 3ZNOA 4EG4A 1TLTA 1ZRSA 5CA0A 1J1IA 1C9DB 4EO9A 2HF8A 1C7ZA 2HFKA 3KZCA 3TBHA 3BD8A 4BB9A 3VX3A 3U4AA 4RA9A 5KSPA 1QQAA 3GJ5A 1TQ2A 2X8WA 1PJQA 3I1JA 3PI7A 1PEDA 2R87A 1Y1TA 4LOAA 5COQA 1CV2A 1QE5A 3C5HA 3NAQA 5JLAA 5L51A 1ILEA 1CIJA 3BL8A 2QLFA 5GTDA 1BX1A 3NEYA 2C7VA 3OAAD 1QKKA 1D2CA 3GFBA 1KU6A 2SICE 3GN2A 3JD4A 3L6CA 4GWGA 4UKDA 1YB6A 5FB3A 2SKEA 4MAMA 3E82A 1JQJC 4M7RA 1I36A 4P54A 4Y18A 4YMIA 5BV7A 4BOYA 1QB7A 1L5OA 1P33A 2P9YA 4BMYA 2CN1A 2OORA 4F9TA 1BS9A 1C7RA 3N75A 3VYSB 2V6FA 1GPJA 4FGWA 4EDHA 2JK1A 2ACKA 2VZ8A 3ANTA 4ENTA 5JLJA 3DL4A 2X0JA 4ON9A 1NAHA 3HB0A 5D86A 1UMDB 3GD7A 2ZB7A 1JYEA 5B5SA 3OFJA 2JLUA 2AF3C 1I4OA 3R3HA 3T61A 1F9AA 5C53B 4MS1B 1O6CA 4S1NA 4XE5A 2XNJA 1J21A 1RQ7A 2R6DA 2DUMA 2ZTUA 1DX4A 4ZI7F 3Q5GA 3K8OE 3ROKA 1NW5A 2VPXA 1KH2A 1MAHA 4HDAA 1DV2A 3GFVA 5IP5A 1KR5A 2QUAA 3D8BA 5F77A 1SK9A 3NASA 2HPAA 5JQGF 4RAOA 3WLJA 1VTKA 4LWPA 1X2BA 4PVCA 3OE7A 3A1DA 1U3CA 5F33A 1BRMA 1YIOA 4LFAB 5DMXA 3G8DA 3W4KA 1XNQB 2AFIE 3Q7SA 2CD9A 1V3TA 2Q6TA 1FFSA 4UXJA 5CW2A 3HO6A 3CPHA 3LHFA 1GFWA 2LP4Y 4OB7A 4ZZIA 4TV9A 5HIKA 5HXAA 4E30A 1KJWA 4QDTA 1PUIA 1T4DA 4R8KA 1KOFA 4TKUA 5JEEA 3EOBI 4Q1AA 1PT7A 2O57A 3L8HA 4FT4A 3UMSA 5IT5A 4W9MC 2BHRA 4YQFA 1EHYA 4D25A 2R6R1 5AICA 4J0KA 2BF7A 2BOVA 1K8ZB 2TECE 1O7JA 4B83A 3GPBA 2XWQA 4BCDA 4H27A 5GZ6A 3U37A 3J81A 5JS7A 2H85A 3FMFA 1KIFA 5EYPB 3AXSA 4KAAA 4XPIA 2YHIA 4YAWA 1QFMA 2O0JA 2QY9A 3U7RA 1FW8A 1Z12A 2IHBA 2QD2A 3AJEA 5ALUA 2CE7A 4LDJA 2DT8A 3SZOA 3W8RA 2C83A 1XCGB 2BLNA 3GEBA 2AR7A 1TE2A 3DHWC 4KR0A 2XRFA 4FX2A 4QDKA 5J4YA 3AUJB 4BN4A 4YRDA 5DWVA 2OG2A 3PNMA 1HNNA 1M8PA 4KACA 1TTPB 2ENUA 3FWHA 1YHNA 2QLMA 3R5KA 1G8AA 2HJGA 3BMCB 5D3MA 5B4VA 2O8EB 2W6OA 4Y30A 3HE3A 3LCJA 1ZLYA 1KZ4A 4KX5A 4I6GA 1WBBA 4QFCA 3REGA 4D6YA 4I8DA 3GRAA 1J8DA 2ZJ7A 4B3RB 5AOCA 3CRNA 4G23A 4P0QB 2EJVA 3QVLA 3KVRA 1SU7A 3IAS1 3P0HA 4NZNA 2EFYA 1P3JA 2V8OA 4HNRA 1XXHE 1SAYA 1PU2A 4W8HA 3WADA 2W6IA 2VLIA 5FR1A 4MI9A 3JQRA 1BMFD 4CCYA 1A76A 4MQLA 2IKSA 5GJCA 2F43A 1TF5A 4AZ3B 1RHUA 4EHIA 4NYIR 1Q22A 2PUFA 3BULA 3UMVA 1SBTA 3TR5A 3OX4A 4FQ5A 4M1YA 1BS1A 1VG0B 3L84A 4QXOA 3JCZA 4LUCA 1QLWA 4P4LA 1Z6ZA 4GX5A 4B2IA 2I91A 4W5TA 2PUBA 5KYYB 4Q7QA 1I4TD 3N7UA 4YMHA 3MWDB 4PX3A 1R0WA 1SB9A 2FLKA 2GZ1A 3ZHQA 4MA5A 4BX0A 4FIZA 5A1TA 5IT9A 1NE7A 5EPEA 4EY6A 2D59A 1KEEB 1TLFA 4LGCA 2YCBA 4A2QA 4YPOA 1D9XA 4N3AA 1H6BA 5IW8A 3VAAA 1FP2A 4IJWA 2B5OA 4WWHA 2D0PB 4RM2A 4EM6A 5A06A 2R86A 4B84A 3DDHA 1SULA 2A33A 1N2ZA 1I3OA 1HXHA 4WUTA 3SYTA 2J41A 1QSGA 3FGPA 5ALJA 4BP8A 1DC6A 4X1IA 3T3PB 3U4CA 1U0RA 1Q1ZA 4FUQA 4ER6A 5AJVB 3ZZUA 4MV0A 4L50A 4OHXA 4A2CA 3HFJA 3PQ6A 2AQ8A 2QL5A 1LQUA 1C7FA 3DD5A 3GF4A 3I53A 1V8ZA 2G9VA 2FMXA 4OGFA 4AUEA 5F7XA 1BFKA 1MC5A 2YX1A 3K20A 4DG9A 4NZ9A 4OL0A 2I2BA 4HN9A 3ZGXA 3DO8A 5HZMA 2Q4EA 4XDZA 2XVYA 3PBKA 3Q8XB 4I7EA 3CF6R 4KRGA 2ZJ2A 4P7BA 4AIRA 5J2UF 2EF1A 1FS6A 3Q9UA 4FYVA 1KFEB 1M6WA 1C9JA 4LE0A 4A2PA 1PV4A 4Q7MB 3TFQA 4K6CA 3LOQA 3V4OA 4DCSA 2BAGA 4I1YA 1BAPA 4U5QA 3RLIA 1Z2OX 2W43A 3KP1A 2HK7A 3EAFA 2PKWA 4I4TF 4IOJA 4DNXA 2M9MA 5EKSA 3ORSA 5EJ6A 1XP8A 5JHHB 4ZOCA 5KINB 3GJ6A 2AD5A 1IZ9A 2BP7A 3SE0A 1NVUQ 1A27A 5CG1A 5LXTB 1XZ8A 4K6GA 5J1TB 3UTCA 1W29A 2RGNA 5AW9A 1H4VB 2BR3A 4CM8A 2Y0CA 3LIIA 2ZCJA 3LA8A 1XAIA 3O8DA 4I8IA 5L9AA 2FUG6 2OGSA 1FTGA 1OA1A 1QO0A 2R44A 1ISMA 3KWJA 2QTBA 2GTIA 4BMXA 3MJCA 2JFWA 2NZXA 2J7PA 3WL5A 2RK3A 3PC6A 3ZLBA 4RO0A 4F6CA 3VAYA 4QTYA 4LJKA 4AY2A 2DWCA 3VPHA 3D0KA 1BE8A 1GPLA 1ZUNA 2WLSA 2HSWA 4L8LA 1PZMA 4P93A 4NZYA 1B6RA 4RQUA 4LGYA 3SP1A 3TJZA 3FCUB 4BTEA 1VSUA 4EPYA 5KIAA 2ZM5A 2XT6A 2KPOA 2ZYHA 3JRWA 1NV8A 2Z58A 4JLVA 2ZB8A 1PJSA 3M3HA 3KPJA 3ZX4A 4KUHA 2VJMA 4BLUA 2X1LA 2F9LA 1P7CA 1YNOA 2GK3A 3IPRA 3V7NA 4HDSB 4Y6QA 3V34A 3ZH9B 1Y82A 2ZSDA 5G4KA 3U62A 5AIBA 5LUAA 2WJWA 4XLLA 4MWBA 2Y68A 5AJZA 4ZVQA 3ZW7A 1U8TA 1L5GB 4ERXA 2GZAA 4J1QA 2OXIA 3GBVA 1LLFA 1LH0A 3F73A 4RLHA 2HBZA 3DDZX 4PLTA 1LUAA 1XRQA 2SHKA 5LUBA 1HYBA 3PLRA 1YUMA 2C8LA 3N2ZB 3KYCB 3ONDA 2BGLA 3FLAA 1ULTA 4KWEA 2C5SA 3TNDA 4MDFA 1AXRA 2C57A 2EJWA 3QXGA 5CYPA 3NXKA 4AO7A 3IPCA 1KJZA 3L7LA 4D9HA 2OXCA 4EKYA 1WWKA 2GAFA 4RTNA 4JR1A 5HRUA 1RFGE 1JJBA 2FI1A 1UDWA 4BX9A 4EKDA 3K72B 4HZUA 5BT8A 3EASA 3E9RA 3ZWKA 3ZVRA 1NYLA 4DF3A 1FXSA 3LGAA 4FYYA 4RY0A 1G38A 1QRTA 1OBVA 2IK8A 1ODJA 1QAMA 2V6MA 3A2KA 1RMYA 5SZJA 4DDTA 1UJBA 3LO5A 3UKDA 3OURA 3K4HA 2ADOA 1EDEA 2NUPA 2X40A 3OZDA 3HWSA 4NQRA 3HB5X 3GB9A 5DLPA 7ABPA 1PR1A 1HEIA 2R8PA 1YU9A 4R9UC 2X7JA 3MAGA 4WACA 7MDHA 2CSXA 3H2ZA 1N4DA 2WK1A 1HDRA 1CQWA 2Z57A 3M1YA 2J85A 3V7WA 4E13A 4Z7JA 1YZ3A 1E18A 1OLUA 2I7XA 3WOHA 3PHGA 3AL2A 3R8CA 4Y1RA 4RK0A 2VZ0A 4BPBA 3PQEA 1TF7A 1L0BA 1NVXQ 1SH7A 1BZYA 1UBMS 2FWMX 4I55F 3HMQA 4JS0A 3R40A 2ZE6A 4M7WA 2DMRA 3R5JA 5E4YA 3UK2A 2PIAA 2PH7A 3K4QA 3NALA 4TKMA 4CG0A 5B53A 3RFCA 4DRXB 5HRAA 3MHTA 3DFKA 1JQKA 1COZA 3PPVA 1MENA 1Q1GA 1IN4A 3QE3A 3RKSA 1RJFA 5LLTA 2O59A 1QHXA 1QZZA 2FWPA 1MABA 3IRUA 4CKBB 5ALQA 3PDCA 2IELA 1BVYF 1C8VB 1HKUA 1OFTA 2D8AA 2IHUA 2X8JB 2X9QA 3O3CA 1LLQA 1NU6A 2W70A 4H0CA 5DM0A 2GEDA 3ZCQA 2W0MA 1EQ2A 1MNQA 3MBKA 3TOCA 1HSZA 1U94A 1HETA 4AZ0A 2ID8A 3C1TA 5FNVA 1FYEA 1Z5UA 1J90A 1EWYA 4NE7A 4ZVOA 3IUMA 1DBRA 2GJ8A 4DS3A 1UPAA 1CVRA 3TS1A 2QLBA 4JGBA 3TI9A 2FZWA 1XMVA 3K0HA 4GX2A 4IKPA 4OA8A 5EZQA 3CGGA 5SICE 1JU9A 1A7JA 1L9XA 2Q1XA 3IP9A 3L7CA 1IOVA 3RKRA 3GG2A 3ZDQA 1F7VA 4FFMA 4FOLA 4K2HA 3L8YA 2HJVA 1GGJA 2MMCA 4NU8X 1T2EA 1QOQB 4KGVA 2BM0A 3IJRA 2X2PA 1B41A 1MPXA 4G9GA 3E3AA 4O8CA 5C7YA 5AVXA 3KFXA 4OXIA 5JCJD 5EUQB 3JRNA 2OZLB 2PU7A 3KZKA 3THYB 4X6LA 4DEYA 3DW1X 4HZGA 2X9VA 4GXQA 2J33A 5HA5A 1U2ZA 3WMEA 5DN9A 3ZV6A 3H5NA 3S81A 4RMIA 5BUSA 1UKZA 1VJ5A 4G67A 4K8RB 4F8EA 4Q3DA 1OI4A 5EINA 2X0FA 2CHQA 3F6YA 3VNQA 5IJAA 5LA6A 1PJZA 2BDEA 2CFCA 3JPYA 5I7EA 3NETA 2E2WA 3PNYA 3R8XA 2CNWA 5CFNA 2QZ4A 3CS3A 3OX3A 4QU9A 1M72A 4MYTA 4BFLA 2IA5A 1N2HA 5B3JA 5BSGA 1BYIA 1Z34A 3HVHA 3RS3A 4BEJA 3UH0A 4E2ZA 4F60A 2J0QA 3AZPA 3LWDA 4DYDA 2C3UA 4ZMRA 1FL9A 2A1TS 2VRCA 4RTKA 2E7ZA 4PX5A 5ENDA 5TVKA 1GGKA 4S1PA 2WQZA 4AN4A 1GG2A 1Z7GA 3HB4X 5BN5A 3OFNA 1KAQA 5H02A 3ZH2A 3L07A 5TLSA 4L6CA 4TKLA 1Y5LA 2GVDC 3AG6A 4Q3NA 4LK2A 5K0JA 3WLMA 1H2FA 3MF4A 5EE0A 2YQZA 4E15A 4D9IA 2MIIA 3ONVA 2HXYA 1XDUA 2DBVO 1CUZA 5EEHA 1HY3A 3GAMA 1BGWA 1V8BA 4GI2A 2VDWA 2R00A 3INYA 1S2NA 1C7EA 1WCXA 3KJIA 3PE6A 4KE9A 2WTEA 5LLSA 2Z6AA 3AERA 4NC9A 5CJJA 3SEQA 3UT0A 4HQNA 2G9NA 2SECE 3Q1KA 5D3QA 1Y5RA 2QAGC 4XH9B 3HHPA 5EJ7A 3QBTA 1YZTA 2PZBA 2G67A 5LQUA 2GPYA 1U0TA 1HLFA 3FCSB 2GJKA 1B42A 5GOTA 1VKRA 3TOVA 1U02A 3CUVA 4ZVKA 2NZYA 2Q2OA 1JMVA 2V0NA 1O08A 5LOVF 3CUEF 9MHTA 1WHSA 3EIUA 3MZ0A 2Z9CA 5CFLA 3U4MA 4G0OA 4IBOA 5AKZA 5DTIA 1M2OA 3QVJA 1J07A 3BHJA 1NUPA 3QWIA 5B55A 2OENG 3OT1A 5JD5A 4PHTA 1RPAA 3DCYA 4BWVA 3TLMA 1W6UA 4M0LA 1FNSA 1ZXBA 2X2FA 1U99A 4YO7A 1GXSA 1NJ2A 3H99A 2AXEA 2BEJA 3QEMA 1N7IA 4P7GA 1AGRA 4ROTA 3H9CA 2ZVPX 3JVVA 4DJJA 5LNK1 1PJBA 2C5AA 2A0UA 3LL7A 1ONPA 3IDZA 5HX7A 4HWKA 5LDHA 5IWAB 1VLZA 3CH6A 3FMVA 1ADFA 1Z6PA 3GARA 1U7OA 2CBXA 2N3ZA 2WC1A 3GA7A 3NTLA 1VLLA 4QBTA 5F4ZA 1E92A 4DIMA 2IP4A 4LWZA 2DX7A 1Q20A 3TTSA 1LNQA 4FHFA 4L5CA 3BAFA 4JQSA 2VSYA 3GL9A 4H17A 3OE1A 2ZBUA 4UJ3A 3RH0A 3WFJA 4B87A 4D46A 2FETA 1KJNA 3RAJA 5IJ0B 4P4SA 4BAZA 2FLWA 821PA 3E9YA 3QVXA 3AUYA 4R0MA 2C9DA 4OHMA 1LBSA 4F4CA 1WZ2A 4KAJA 1H3FA 2VUHB 1TX4B 1IEWA 3JTMA 4PAQA 5K6AA 3OEEA 2D3WA 3M4NA 2O8DA 4LRSB 3H0EA 4Q1CA 4ASUD 3MJ4A 4EHHA 3BFJA 4Q9JA 3Q8LA 2XTNA 4I4TB 2G1UA 2OSVA 2V58A 3NG1A 1O6BA 2DTXA 3Q2OA 4WOJA 1N0UA 1A72A 1TM7E 2G07A 3OA0A 5D84A 1T0JB 3H4MA 4JQOA 1SRRA 4AROA 4F91B 4TSFA 3CSUA 3V7FA 1H42A 2J67A 3DOOA 1GQQA 2ONKA 3P19A 4QYXA 3VR5H 4CUKA 1QRUA 1O89A 1TT5A 1W4AA 1MC8A 2ST1A 2CZGA 3WGLA 2OC9A 2OBBA 1E0KA 3WKDA 1S89A 3CRZA 3IBSA 3SDZA 1TFRA 1X87A 4CMIB 4FYKA 4NXNB 1S7CA 3BQMB 3NR2A 1CZLA 3KCNA 4BNXA 3FBWA 1L4YA 1FP1D 3MWGA 3GY0A 4YJKA 3E23A 2YVQA 4WJLA 1FYXA 4FYHA 4C0AC 4DR4B 2CHUA 2W6PA 2WM9B 2BSAA 1DPFA 1UJ4A 3ND7A 5EHNA 4EA8A 3CLRC 1TYEB 5AW8A 1CEYA 2RG7A 1JP7A 4ZT6A 4CUZA 1G42A 2ZUVA 4GE0A 2NU8B 2B5VA 5ITWA 4FC6A 4YFVA 3TZ6A 1N5KA 2EQBA 4B35A 5BN1A 1OB2A 1T24A 2Z4SA 4AMBA 3C3AA 1HGXA 1S2IA 2C20A 1FSGA 1WA5A 4LMAA 4CTOA 3IEUA 2IDKA 5DIZA 3RFVA 1GL7A 3KK0A 3NDJA 3GFFA 3TTYA 2KM1A 5DMHA 4GSLA 3RJMA 5B1EA 3K0SA 1E2KA 3EY9A 1TW2A 2HWXA 5JJCA 4XEHA 4ZZ3A 1KXZA 2Y0PA 3C3WA 2QRZA 2VYVA 4M76B 5CBPB 4KVZA 3O21A 1GT91 5GM1A 3IE2A 4ND3A 4ZCQA 3DSRA 3WZMA 1BEZA 3QKRA 2Y66A 4A7PA 3AZOA 3SBEA 4DV2B 1TZCA 4MDEA 1O96B 1DAHA 3FI0A 4GVPA 1QDUA 3HR7A 4LVNA 1T5TA 3FH0A 3SVLA 1VXOA 5KSOA 5JT1A 2BR5A 2ODAA 4HSEA 1O95D 4LQDA 5BO5A 5KI6A 5DYIA 4BEVA 5GPBA 2Q2QA 2V1UA 3MINB 1XQYA 3K9FC 3VOBA 3N2GA 5BW8A 1LPMA 4UM9B 4IDQA 3NKVA 4F38A 4QU0A 3R74A 4R8MA 3Q6MA 1BA2A 4QPPA 4Z4HA 1ZOPA 3A06A 1J70A 4RABA 2PQ2A 3P52A 3WMRA 3MWYW 2PMDA 2HR1A 3S7TA 3NM5A 1U28A 3ZJ4A 3KQYA 4PCLA 4UDXX 4JZKA 4MI6A 2VK4A 1KI3A 4RM3A 3T1HB 3L7DA 2QQEA 2B92A 2P35A 1R88A 1WULS 3BL6A 3SU8A 5K8TA 1RCTE 4BV3A 1E94E 2G83A 1NR7A 5C1BA 3Q15C 1L8AA 1I7NA 2YMMA 5IAEA 1K3UB 5A9SA 4IQ4A 4ZYXA 3O3OB 1NASA 1SNYA 1JA9A 4LE1A 1WUTA 1WSDA 2F48A 1XNJA 3ONEA 3IVXA 2Q7DA 3H5OA 4EARA 2HF2A 4RHYA 3ZDCA 3ZZ1A 1Q7EA 5HDQA 4CN8A 4AJ2A 5A6VA 3CEPB 3VU9A 3AVVA 5A3QA 4WFKA 2BI8A 1PGJA 2X42A 4BQRA 4ECAA 2XDWA 4G0WA 2QA5A 2JASA 1DELA 4LYGA 4I9GA 1M8FA 1LSSA 2Y6VA 3EXAA 3ZLUA 1E7RA 1RM3A 4L02A 3AUXA 4XJXA 6LDHA 4N6NA 5CM8B 3WLLA 3N39C 4E1VA 5FLXA 3OPQA 3O8CA 5C3UA 1KO8A 4GZ6A 5BQ3A 1XPJA 1UMBB 1NBIA 2F3UA 3F96A 3L6DA 2YDXA 3HJBA 1OYYA 4Z4CA 2GFHA 2YINC 3IDQA 2B25A 4U7PB 3CF0A 1CUHA 1G0NA 3EXIB 1E2JA 1LQTA 3AJRA 4HL6A 4IIBA 3KB1A 4KO2S 3WVNA 4JYCA 5ALEA 2W6ZA 1ZCFA 1HFWA 3PYMA 5CX1A 2GUWA 1PEKE 3GRRA 5AHWA 4Z99A 2CKMA 1KF0A 4HFMA 1JG6A 1SOVA 2XGSA 3D7SA 5TJ9A 1PS8A 3HKDB 2A0YA 3MUOA 3QLVC 3RVKA 1V6CA 4C0XA 5I7OA 1LFDB 3GPDG 1LBTA 5ILQA 3RSLA 2HX1A 1CY0A 3E27A 3VOAA 1OAKA 4QGAA 2QAGB 5EMMA 2ZYUX 2X4IA 2WIFA 4IO0A 1KMCA 3UUEA 4ALLA 5CFRA 4W8OA 1YD7A 2F59A 2NUAB 1PAUA 1UCFA 3R6WA 5J58A 1WD5A 3AF2A 3D8UA 1K8YB 2J5RA 1H5NA 3LXMA 1H8HA 1XDZA 1XSEA 1XZDA 2ID9A 4ZREA 5TQ0B 1KZ6A 2L82A 4BIMA 4PN3A 5JSHA 1EUDB 2PKCA 1OX5A 4PGMA 5GV8A 3U7FB 3MUFA 3C15C 1QK3A 2E5LB 2VHTA 4H7KA 4C08A 1IZZA 1FYFA 3IAM6 3L46A 3B1YA 5JNLA 5D5HA 1J0EA 3A37A 3EZ9A 2R65A 1IRIA 3OOYA 4JLKA 4G24A 3TL3A 4BNZA 1RXWA 3PEEA 3CR8A 2C2YA 2P6NA 2XNCA 2Z4TA 3IR6A 3V8VA 4ARSA 1YAJA 3PC8A 1Q92A 3G2PA 4QXQA 5F98A 1SQGA 3LPCA 1CF9A 1PDWA 1HDGO 1DL5A 3DBIA 2EJBA 4HAOA 4OK6A 4PWYA 5KYUA 3RBXA 5KVAA 1Q1EA 2PLAA 2WU4A 3HYNA 4Q0MA 3SI7A 2L0XA 3K5HA 1AA6A 2I2WA 2NSDA 3K2BA 4B7UA 3SKYA 2D5IA 1FTWA 3DB1A 3REFA 3GUVA 1TZKA 4A82A 4NOLA 1NIPA 3QXXA 4N9WA 1E32A 2Z8YM 1G2QA 1PL0A 2OGWA 2E4YA 2HB6A 3FCYA 3TD9A 3D5QA 3SDSA 2PS0A 1WF3A 2QVGA 3OQOA 3II6X 4Q00A 5CB4F 1WZUA 4YASA 3NC4A 4OUKX 2O2YA 2CMDA 2RGDA 2NWQA 1ZWKA 3TCKA 2PXXA 4EKGA 4AECA 5EKDA 3E0QA 2ZSIA 2RJ3A 3RC9A 1DT3A 1J06A 4GWKA 4FKBA 5J5AA 1N2GA 1T1RA 2A6PA 3FHJA 4PAGA 1VQ1A 1GPWB 5CFZA 4HEJA 1GCOA 1H85A 5THXA 2QG9A 5LZ9A 4ARCA 1UFKA 4P38A 1OT3A 4HS9A 4WADA 4MIEA 4BNHA 4NSNA 4LSMA 2HZBA 3U39A 3ZHYA 1T2AA 4CKWB 4OI2A 1C7IA 2FW7A 1RI2A 2D1RA 1DBPA 4MR9A 3C5CA 2AXPA 2B7BA 4EW1A 3VO1A 2W5UA 4XSVA 1SVWA 3F90A 3KV3O 1E1DA 1EE9A 3GVCA 4LIPD 3V1NA 5B12A 4O2RA 5A2QA 3M81A 1OH7A 1J0CA 2WABA 3DKRA 1T8RA 3KJXA 4IHJA 1CNFA 3R0JA 5FCDA 1WQ4A 2PSEA 3W1VA 1RKXA 1CP2A 2PCJA 4DNOA 5FEUA 2P6MA 2MWMA 4AW9A 3T3NA 4BYMA 3E5HA 1BGVA 5KOYA 4QBHA 3K16A 4HLNA 3I0ZA 3QVGA 4Y0VA 3I05A 3SG0A 1G5TA 1R74A