5D7NA

Crystal structure of human sirt3 at an improved resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
271
structure length
271
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
publication title Seeding for sirtuins: microseed matrix seeding to obtain crystals of human Sirt3 and Sirt2 suitable for soaking.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 5d7nA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5d7nA01
1UPCA 2H4JA 5DEIA 4R8MA 3CF4G 4UUAA 4V1CI 2H2IA 3EYAA 4Q9DA 2JIBA 2DJIA 3GLSA 2AG1A 2OO5C 3OE1A 1YTLA 4K9LA 4BVHA 3CLTD 4UTXA 2JLAA 5FYQA 1Y9DA 4UTZA 3PKJA 3ZGVA 2QQFA 5MFZA 2A1TR 3GLUA 3PDHA 4GPEA 1POWA 3D81A 1ICIA 2VK1A 4UTVA 1J8FA 2PGNA 1PYDA 3U3DA 1PI3A 2VK4A 3CLUD 3ZGOA 1OZHA 2VBIA 4F4UA 1EFPA 2VBGA 5BWOA 2NYRA 3LQ1A 5MF6A 2EZUA 2UZ1A 2Q5OA 4KGDA 2WVHA 1M2JA 1T9DA 1S7GA 1N0HA 1SZCA 5AHKA 1D4OA 2JI7A 4KPUA 3E9YA 4QQ8A 4F56A 2Q5JA 3K35A 4UUBA 4JUCA 4UU7A 1U31A 2IHTA 3D7KA 3HWWA 2OORC 1M2KA 4K9MA 5D7NA 2JI6A 1M2NA 4BVFA 1UPAA 1S5PA 3EY9A 4K9PA 3CLSD 2FR8C 1Q17A 4JUFA 2Q28A 1U2GC 4FVTA 1Q14A 3GLRA 1V5EA 5DGTA 3JWPA 1OVMA 5EJ5A 5DGDA 4GM1A 4GG1A 1T9AA 4FZ3A 4C78A 1YBHA 2H2GA 4C7BA 3JR3A 4O8ZA 4MPPA 1T9CA 4RMJA 4ZZIA 2JI9A 3EA4A 1Q6ZA 4TWIA 2EZTA 4RJIA 1T9BA 4MQ5A 2VJYA 4K9OA 2EZ4A 1OZFA 2C31A 4QPZA 4Y6QA 4TWJA 2JI8A 4K9NA 1M2GA 1HZZC 2UZ1B 1PTJC 1OZGA 2OD2A 1E3TA 4V1CB 4J16C 4RJJA 4BN5A 5K2OA 5K6RA 4IAOA 3CLRD 1YC2A 2VBFA 4UTRA 2B4YA 3FLMA 4V1CA 4JUBA 4JU9A 3HWX1 2IHUA 1PT9A 3F6BX 1QPBA 4BVBA 2FRDC 5EJ9A 5EJAA 2H2HA 4L2IA 2BRUC 4KXQA 3F6EX 4JT8A 1YHZA 1PNQA 4JU8A 2FN3A 1ZPDA 1PVDA 4BN4A 1NM5C 1V5FA 1YI1A 2Q5QA 4L3OA 3FZNA 2IHVA 2VK8A 4IG9A 4K9QA 4D5EA 4X3OA 1MCZA 1EFVA 3D4BA 4Y6LA 4HDAA 4BVGA 5BWNA 2HJHA 1UPBA 1O96B 3GLTA 2WVAA 5K6TA 1PO7A 1M2HA 3IAFA 4D5GA 2FSVC 4RMIA 1POXA 2H59A 5K3SA 2OD7A 4QELA 1XLTC 2H4FA 4GM4A 4BUZA 1YI0A 2Q27A 2WVGA 4RMGA 4UTNA 5MFPA 4JUDX 4ZP1A 2V3WA 4COKA 5EJ7A 4FEEA 1U2DC 4G1CA 4JSRA 4Y6OA 3FSJX 4X3PA 4IF6A 4JT9A 4GM0A 2FWNA 5IMSA 1Q1AA 4MPJA 1U28C 2AG0A 4JD5A 1YNOA 1DJLA 5FEMA 5EJ6A 4MPRA 4GP9A 4I5IA 3PKIA 4J1TC 2Q5LA 2EZ8A 2EZ9A 3U31A 4FEGA 1Z8NA 2PGOA 2X7JA 2A1UA 4JUAA 2NXWA 4UU8A 2H2DA 2PANA 5BWLA 2OD9A 4BV2A 3RIYA 5MGNA 3IAEA 1BFDA 3ZG6A 5EJ4A 1SZDA 4K9KA 3RIGA 1MA3A 2H2FA 4RMHA 4MZXA 1PNOA 2JLCA 4BVEA 1YC5A 4RJKA 1JSCA 2H4HA 1O97D 5EJMA 2Q29A 1V5GA 4HD8A 5EJ8A 2QQGA 4BV3A 2W93A 1YHYA
chains in the Genus database with same CATH superfamily
3GVPA 2BE9A 2Y1EA 5F5NA 1PLLA 2YXLA 3U4AA 4YONB 5KWSA 3L1JA 4ZT4A 2YVLA 5B4UA 1W6UA 4BFZA 5BOSB 1D1PA 5JZ9A 1VL2A 1SHUX 1L4GA 1ADYA 4H1UA 4P5PA 4W82A 4DLWA 4O0LA 4RORA 3KLPX 4G86A 3RJMA 3RRYA 3FMPB 2CXOA 1MGOA 2VAXA 3VZBA 4F1WA 5ES3A 3LF1A 4QVKA 2OV6A 3WWDA 4GEKA 1P62B 4CMCA 4PIVA 1QHGA 4PQYA 2ZUTA 2DCMA 4DW8A 4JI5B 3UB4A 2JCSA 4KAJA 3EXHA 4ZIRB 2VUSA 3LL4A 3OU6A 1AG9A 4OBBA 3FHOA 1WUKS 4RPHA 1SG6A 1EDEA 3C8MA 3K2IA 4K1XA 2NU9B 4BVHA 3G5AA 4RVFA 3WYBA 4C3OB 2PAAA 1KPIA 1GCIA 3PPIA 2TRSB 1JFSA 3UUWA 4DJTA 1BHSA 4I7EA 1IN6A 1IATA 2QX4A 3HHEA 2FZVA 1OHHD 3V8MA 1IB0A 1U6IA 1XDZA 2WWIA 3WJ2A 4YS6A 1CG6A 4BU0A 3SF0A 1LC3A 1E2LA 5AOVA 2GHQA 2PX2A 4LZNA 4TSFA 4RK7A 1NJ5A 1V4NA 4GX2A 5B2EA 5JZMA 1QRRA 1JHYA 1DFHA 5FULA 4PZ0A 2CHQA 4MKHA 4YRFA 1ECPA 1Z17A 2JA2A 4WDRA 4ZVKA 5IG2A 1AKMA 3I6YA 1Z8DA 1XEWX 4PTYA 4I8XA 3R1IA 1UK7A 4EPXA 2I4OA 1XVAA 4KCGA 4ND8B 4PC7A 2JIZD 3KWFA 3NWBA 1E66A 1U1DA 1QHFA 1UZAA 1VDZA 2QU7A 5ALPA 1SVKA 3EVFA 3ZW7A 2GA9A 2R87A 4F2PA 4GGPA 4HVAA 4JR2A 4Q12A 2V6MA 3HL4A 3LD9A 1XAJA 2UXBB 2YYAA 3QFTA 3PR2B 1N4AA 1HRKA 3FSGA 4A27A 1EDOA 1PI3A 4D4JA 1GNQA 4HRYA 4W5HA 2CFIA 1CSEE 2QR5A 2SHKA 4QDOA 2PX8A 4CE6A 1U1EA 4OFXA 1YGYA 3HP4A 2RG7A 3LFHA 1QK4A 3P94A 2Y1WA 2YHBA 4UXJA 3WVNA 2QI9C 3TUJC 3FWNA 4DVJA 1UBSB 5BWOA 4YRGA 2YV2A 4Z0TA 5L51A 4NCKA 1UKYA 3GRFA 1EGAA 2HR1A 2NYRA 4UMEA 3IRVA 1AUXA 3D3KA 1PR3A 5LXTA 1HFWA 2PX6A 4E21A 3IAUA 4EATA 2AJLI 3TQTA 3UMCA 5JD5A 2HEIA 4OHZA 4CQLA 2PBFA 5AM5A 4DCOA 3MTBA 2Q6IA 5A6VA 3TLMA 4WTOA 1R8XA 4QLBA 2PVPA 3H5TA 4XWKA 3BWBA 4MVYA 1NATA 4EZEA 4LFAB 2QG6A 3S1SA 2ODTX 5BQ3A 2C78A 2KHZA 3HSKA 2NPFA 5LKRA 3ZNNA 3M82A 1NN3A 1R74A 3MTDA 4LCBA 4PYNA 4KPFC 4Q4JB 1X13A 3V8VA 3U4GA 3CUSA 3BULA 2O54A 1II0A 5KOJA 1JXOA 4Z5XA 2W9XA 3QZUA 4PG4A 1JU4A 5I9BA 3MB8A 1YFKA 4OYRA 3AVOA 4MYRA 2XECA 4WOPA 4ZYYA 4KRFA 1XT6A 3TJZA 2NVBA 4X00A 5KREA 2R8RA 1I7NA 3AIIA 3W8EA 2FP3A 3IR5A 4A03A 4D6YA 3TAHA 5CDYA 1ZZGA 3UJHA 1FXWA 1ENPA 1I3KA 2GBLC 4OYHA 4RKWA 1IN1A 2YYSA 221PA 3D6AA 4RDIA 1XG5A 4BP3A 2DTXA 3AFHA 4TRNA 3MWGA 1TUGA 2ENUA 3EQ8A 2D8MA 3BL5A 5G0SA 3RVMA 4XFJA 3TTXA 4PO3X 4XIFA 4E1VA 4O4JF 4BV9A 3FDIA 5JCXA 3UG7A 5D7NA 1X8KA 2FN8A 3KZKA 1E1YA 3BICA 4TL6A 4MUIA 4DRXA 2KLBA 4RVDA 1T2EA 3JSXA 2CVPA 3CKMA 3EGVA 2P2YA 4NJOA 4OM8A 3FWZA 3ROMA 2VSQA 5KAPA 3DHEA 1CQZA 4A0QA 2Q28A 1MXHA 1TUBB 3FFAA 4RFVA 1DIAA 5FIUA 5CCDA 1Z16A 3DL4A 1L5GB 5AVTA 5JNVA 4UVIA 4OP2A 4MCJA 3OZUA 1E4VA 1B0AA 3L7JA 2ZYTX 1DQPA 4MR7B 2XGJA 1ZVVA 3I9KA 3KFXA 4X41A 5BORA 4IJWA 1RZVA 3F5DA 3ACDA 2BMAA 3Q10A 4GQIA 4M0CA 4NRDA 1EP1B 2IUSA 1GA1A 4RLHA 1XJ5A 2WEKA 5HIIA 5B6PA 2V6IA 1U2QA 2JD2A 4R5HA 2R751 1Z08A 3PGMA 4EUEA 3W5DA 3O90A 4P0QB 1OF1A 2IU4A 3QVJA 4PS1A 5DBGA 4QDUA 3IEKA 3QKWA 3ZEIA 1CIPA 4ICIA 4IH4A 1H3EA 1LI5A 1SK9A 5ERYA 5E4YA 3SM9A 3IUJA 2GPSA 3FVTA 8ADHA 1HFKA 5KVAA 3EYWA 1EZZA 3DLHA 3ZDRA 3H2GA 4Z9BA 1ODSA 1DFIA 2WD9A 2QAJA 3U6BA 1DWUA 8MHTA 4D9IA 7GPBA 2HU5A 2W2LD 3PR1A 4C06A 1MX9A 1MN6A 2CLHB 1SCDA 2QVLA 5H3CA 4JELA 2BFEA 3C6YA 5I9MA 3BH6A 3EFHA 3ZXUB 3NHPA 2YDYA 4P2BA 3GFVA 4O2AB 4A73A 1XVLA 1EIWA 1I4TD 1YS2X 2A9RA 1SWWA 3LCUA 4MW6A 5CNKA 5GGXA 1OH8A 1N3BA 1XD9A 3N8IA 4CKZA 3OBIA 3N07A 4G5GA 4WBNF 2PUDA 4KNWA 4UNNA 9LDTA 5T7BA 1LEHA 4C88A 5K8CA 4MUJA 2WTUA 1CIVA 5FUVA 3VPBA 3WGGA 2C58A 4D9KA 1T9BA 1UT8A 4FQ8A 3WGNA 3SXPA 4CLRB 4HRXA 3FSEA 2RGXA 1D0VA 1E3JA 3LSTA 4KWIA 4N54A 1BFKA 4LI3X 1U2ZA 1OZFA 5TQVA 1TRHA 2XA1A 1C3XA 2C31A 2XVAA 1FOEB 2Q8QA 2VNJA 3MRTA 3O8NA 4KQHA 4LYEA 2Z3WA 5BYBA 1UK9A 2CZQA 4YGYA 4TWJA 3SYMA 2V9CA 3KL4A 4F21A 4DLZA 2EFYA 2BVNA 4QUGA 5SY4A 5L9AA 1Z0DA 2PVSA 1LFAA 1YFZA 3USES 4A91A 4F8JA 3ZJ4A 4BO7A 1L7DA 2O2XA 1JDSA 5IEJA 4XQEA 3SQWA 1ZM2A 3Q5DA 4OP3A 1CUVA 3PRHA 1PR0A 1KVTA 3FUWA 2ECPA 4AKEA 2ON6A 1RACA 1H23A 1ADJA 3CISA 3WS7A 3QEBZ 3WOVA 3D8TA 4RABA 3NGLA 2YS6A 2WB2A 3KJFA 1SN7A 4B2PA 2XXAB 1NW8A 4GGOA 5AFSA 1TMGE 3W2FA 1KNXA 1L4HA 2HU7A 4Y9UA 4GMDA 3F47A 3PG5A 2VHXA 2WZQA 4V1CA 2OCPA 5E7MA 2P7HA 2KB0A 2QROA 4AQYB 4JU9A 1N8TA 5K5EA 4EJ2A 3ADOA 3O8DA 4IILA 2PMEA 3SZ3A 1G8KA 1YJAA 1XTTA 1X9HA 2ZBUA 3G0IA 3S1LA 4BEWA 1PT9A 1GD1O 2NNLD 3GC6A 2XITA 4KKVA 4NYMQ 3U7HB 2FWAA 3I4FA 4AY2A 1OROA 1KYYA 3H2BA 1QZZA 1UBJS 1XDGA 4I2NA 4C2BA 1UJ4A 3NCHA 5IC4A 4FDMA 5BT8A 4J4BA 1G7TA 3MIIA 1D6MA 3CNOA 3DBVO 2XGSA 4O4IF 3WP1B 1HDEA 2CBZA 1E0DA 3BIJA 3DFKA 4LSGA 2ZXEA 3PTAA 2FG5A 3DVLA 2SKCA 2DETA 1JQAA 4X1IA 2JLZA 5CGQB 1KMMA 4AWBA 3JASB 1QYDA 4MLZA 1L7PA 1YZTA 1MQ8B 4TZ0A 3K53A 1DO0A 1R8YA 2K2WA 2J9ZB 3A4IA 1TA9A 5B1EA 4QWWA 2HJRA 1ZWLA 2O7VA 4F2GA 1KDOA 2BZ1A 3PNLA 3VYUB 2X19A 3ZBUA 4DMFA 2J3DA 1LZLA 2HAEA 4JA0A 3GNLA 1SUIA 3ADPA 1RYBA 3GL9A 1YZYA 1XZQA 1Z2DA 2IGBA 3OQVA 5BN3A 1O4WA 4OLBA 2GUWA 4X6YA 3REFA 2MYUA 1ICEA 1U7WA 3GDWA 3VH1A 1OAOC 4TV8F 2G1PA 1U63A 2R1UA 4TMFA 2VYQA 4CGYA 2H1RA 2ZBVA 3R09A 4HL6A 4RZ2A 1FW6A 1GQSA 3GRUA 5TV2A 1RPJA 4MYCA 2FZ4A 1QX4A 3AY6A 1IWBB 1Z2OX 1PR2A 4TPKA 3HUFA 2WHEA 1HL7A 3IB3A 2W22A 1CVRA 3KYDA 3LVBA 2D2IA 2FA9A 3RUAA 1PGNA 1Y7LA 3JW8A 2IOHA 3R6DA 3ABOB 3CINA 1NNSA 5CW2A 4PAGA 1QRTA 2ET6A 1J5XA 1IQUA 3GF4A 5KBYA 2Y0PA 1BU5A 2XRZA 1HLPA 4BFWA 3NBQA 1FQJA 4KW7A 1YDHA 3SDSA 3WKDA 4CFZA 5JRJA 5JYEA 2ZCUA 3P8ZA 1G8YA 3FNRA 3IDSA 3O3MB 4Q15A 1A9PA 4X44A 1TK2A 3IP7A 2ZWVA 4ND3A 4RDCA 2HK7A 1FDVA 2CDBA 4OXYA 4UHHA 4HTFA 3AGPA 5HKLA 2VDLB 4Z4GA 4OUKX 2WSYB 1XQYA 1SXJA 1MOQA 4EITA 5JZOA 2HGSA 4NBNA 4XRGA 1H6BA 4K86A 1J99A 3DDCA 4P83A 5G0WA 2FWPA 1SUWA 2DBYA 3HDYA 1IHOA 1QLJA 3MWLA 1Q0UA 4KWCA 4JLWA 4R7TA 3EPLA 3O5AA 3GEEA 1EJ0A 1EKXA 3FHJA 4J8PA 4JLAA 4V2IA 4CIXA 4EVIA 2ZAIA 5EHQA 2O0KA 1BEZA 1R9MA 4FIZA 5JARA 4CF3A 4NMXB 1IXZA 2FSPA 4F45A 1HYBA 1I2ZA 1RXEA 3MT8A 4LY9A 4ZT7A 1I7QB 2JAHA 1HDRA 3GP5A 4TL8A 2GEUA 2JJ2A 2R3SA 3HA3A 2QVGA 4QFMA 4AUNA 5LUAA 4INZA 1R8QA 5FJIA 2HMVA 3EISA 2OKGA 2ZIVB 3LXXA 5EIBC 3F7TA 3KU4A 4Z1OA 4BNIA 2QG9A 2LCIA 1P0IA 3LWNA 2BEKA 1PW5A 1V8PA 4L4ZA 2Z2KA 4M6WB 1Y48E 2Y6VA 3AP1A 2JBHA 4GICA 3TK1A 3DV9A 3VC2A 1EK6A 3A4NA 3HJRA 5K05A 3I9NA 3SQXA 3KPVA 5FV4A 3IHWA 3R9WA 3FUTA 3IIEA 5IZCC 2X3FA 1CDEA 1TADA 2BZSA 4LNHA 1KETA 3QLJA 4AL4A 3WK9A 3JD4A 3UJNA 1F9AA 1SBNE 1A4RA 1DEKA 2NO1A 1K7SN 1H0SA 1ZRHA 2YV3A 4WBXC 5REQA 4ZTZB 4I5IA 1HYEA 1M1YA 2VQSA 3UV3A 2PBRA 3K70D 3KHUA 3NPMA 4HPJB 4LQ4A 2O5CA 1XFAA 1PR4A 4V03A 2NUTB 3U7QB 1R4MB 1EWRA 2YZ7A 1RR6A 2REOA 4WCFB 5CXSA 1COWD 2BGLA 1M67A 4AZSA 5HRCA 1TZ2A 3I6BA 5JZBA 1EXMA 3WC4A 2R4UA 3VI3B 1NRIA 2QNIA 1XAHA 1K6EA 5A4JA 1ZMOA 2B0CA 2OEPA 1DC8A 2XD9A 2XKJE 3M6LA 1XKTA 3ZQKA 4EG8A 5HKAA 4ARAA 4EDFA 4L8GA 3GDFA 2FNAA 1NJ6A 1F38A 1E92A 2C7VA 1T0BA 2P7IA 5ED4A 3UHOA 2YJ3A 2XCSB 2C5BA 1IYZA 4Q18A 3SI7A 3T7DA 3B3AA 1A69A 1Z2NX 4RD2A 3TRIA 2ERCA 2GN1A 3TZCA 2AFHA 4W8GA 5CXQA 4G9BA 4DDTA 1PWEA 1EJBA 5CMLA 1E5TA 2XTNA 2QN7A 3N2GB 2JAPA 4G5XA 2YMLA 4BMOB 3BXXA 3AESB 2JCGA 4W9MC 4I46A 4NDAA 3OOEA 4WZAE 1Z73A 1U0GA 1GQYA 2WF9A 3H0CA 4KIFA 4XE5A 3T1VA 1OFHA 2FSSA 2Y0EA 1MENA 4IGFA 4L4RA 5CLFA 1G21B 5TC4A 1TYCA 1VIVA 3LT2A 1Y6QA 4QQKA 4WVFA 5LA6F 2NXEA 3A6DA 4HGRA 4PHCA 4P08A 2A1IA 4ARZA 1ZD3A 4S2EA 4U6SA 4EBFA 1BFUA 2GXQA 3UAVA 2OA0A 4POAA 4NS4A 3ZWVA 3RYFA 1L1RA 1ODKA 3K0FB 3QTTA 1OWPA 1ZRMA 2PTGA 1RYFA 3D4PA 3PQDA 2C4HA 4NTZA 3B1ZA 2JB9A 1BHJA 5LZ9A 2ZCVA 1YUMA 4B3CA 1U0LA 2YJNA 1L7RA 1K27A 2GTPA 4FYKA 1L4NA 3OLWA 4MA4A 1WXFA 1B8PA 2HA2A 4KVGA 2R9VA 5ADVA 4FWTA 2RCNA 2ZBQA 4I1VA 1PR1A 3IFSA 3HEMA 3BH0A 1B16A 4MKIA 2B7BA 1BH6A 1CUIA 4K46A 2YL2A 1ETUA 1Z5PA 2H4XA 2YC2C 3NIDB 1VP9A 4XYMA 1JMVA 1ES9A 3T7TA 1KI6B 1Z29A 2B4AA 4PLWA 5HIMA 3AF2A 3HU5A 3BCSA 4A82A 4MRMA 3HB1A 3OZXA 3DQQA 3MINB 4PXSA 4B7XA 3G89A 3QPBA 3CMCO 3R7FA 1T0HB 3A3NA 4ZARA 4G37A 4RE5A 4H7KA 1Z37A 3HJAA 1KP3A 3ZCXA 2WTMA 3GGSA 2DQYA 1MABA 1UBUS 3AUYA 2ZRGA 2OB1A 2ATVA 1P19A 2PA3A 3FW1A 2JNWA 1LDGA 2QJRA 4G8BA 5JAIA 1S2NA 2AIRA 4F84A 2NPOA 2VKQA 1NW6A 4NHOA 2G71A 3UHPA 1CJMA 5A5FA 1PJQA 4WUTA 2IY7A 4YJ3B 3NT4A 1TFRA 2GCGA 2J08A 1AVTA 1RABA 3HGQA 4RJTA 1FYXA 1V11A 1K88A 2CLIB 2OHFA 2VZ8A 3KSUA 5DLEA 2KLHA 1EA5A 1SEPA 4UTXA 1TK3A 1VA4A 2JLAA 3IBYA 5JTUA 3AVPA 4RC9A 3RVQA 1K7CA 4HATA 3TRDA 2P4HX 4L7VA 3GXBA 3A6LA 4Z51A 4L8YA 1DAFA 3BRWA 4N0DA 5ALOA 2V03A 4OI4A 1UKEA 2GK3A 4WXPA 5I51A 1DFGA 1YJBA 1Q21A 1YKSA 1DIOB 2MSNA 3UT5B 3F7NA 3CR3C 1GGHA 2AOXA 4J6EA 3SG0A 3DUFA 1RMYA 3LPCA 4HEJA 5AQEA 1K7XB 1WKBA 2HXSA 3FH0A 4FZVA 4MVJH 2OOSA 2V5UA 5ANRB 3WK8A 4XPIA 1EINA 3BAFA 1PBNA 2BHLA 4DCCA 6ADHA 3J81A 1OI3A 2ZJFA 5FI1B 2C59A 4Y2UA 1RAEA 3H17A 1ICIA 4ZHQA 2I7CA 3KQOA 5AK6A 5M3BA 3FPFA 4DTCA 4TT3A 3QVGB 2Q07A 2ZSDA 3MD0A 2BGUA 4CT0A 3WHIA 3KOWA 4O25A 4YJHA 3RC9A 4EB3A 4H7FA 2HB6A 4UEJA 1ZYUA 2FX2A 5JHGB 5ALGA 2PL9A 1QZXA 2XDQB 3Q7PA 3WI7A 3RRBA 3L07A 2VK4A 3D8BA 4JJIA 3WISA 4S2UA 3C1OA 4I1OA 3AHGA 1NT2A 4IJQA 2GAOA 2R48A 1FP4A 3VTZA 2P0YA 3TEJA 1DUVG 1BA2A 2MSEB 2X15A 5DM60 2RK3A 4QODA 4Z2YA 2RAFA 3VKUA 1WZ2A 5JJIA 3QFFA 1IXSB 5C8DA 3OECA 4U63A 3NR2A 5LBTA 3L0OA 1PJAA 3UICA 3PWSA 1FU7A 2ISCA 2PAFA 5F78A 3SC4A 3TMAA 3E18A 1DPGA 5MF6A 3K5PA 4NIMA 5NULA 3AZQA 1SCIA 1X1RA 4TTJA 4GZ6A 1V9CA 3H19A 5BV0A 1UK6A 3A9VA 3QUTA 4H08A 3QNWA 3CWQA 3G0BA 3L7NA 4P32A 4W5QA 3ETDA 2Y27A 1V7ZA 2UZ1A 3O74A 1ZUWA 2O0LA 4F7WA 1KGSA 3TLYA 4NZMA 2R2GA 2WVHA 1JQ5A 4CL2A 2YH2A 2OXEA 4DJFC 3QOYA 2WIFA 2AFHE 3L84A 4O6VA 4AK9A 1ESNA 3FWKA 3SQNA 2UXCB 4F60A 1MHPA 2EQ5A 1AD2A 3E7XA 4HN9A 4M1SA 4N3AA 4OK5A 1C7FA 3DM5A 3D4IA 4OHUA 5FKJA 5DN6D 1OYWA 4EKIA 3HN2A 4MPTA 4KPUA 2NNWB 1I3LA 1YAJA 3FKJA 3WGJA 3KYCA 4CV2A 2FUKA 2ZT5A 4G4GA 5CX1A 3T7CA 4YN3A 4IYJA 5J1TB 1C8BA 3VNAA 3MUEA 3OZ7A 2XLBA 5JYBA 2XV1A 1DRKA 1YZKA 3LK7A 3IS3A 3K35A 2EKPA 1UIRA 4MCHA 1JS1X 3ODGA 1HETA 4GX0A 2V58A 3UMMA 4X7PA 1KZ6A 1NUSA 5FFNA 2VPPA 1T3ZA 2JFXA 4MPDA 2AJ8A 3BKXA 2JRCA 3RH0A 2C04A 3MJDA 4NAHA 4HSGA 1B1CA 4PXAA 3WGVA 1CLEA 4W1QA 4DAEA 3AJRA 5BQFA 1QGED 3RU3A 4PFQA 4BNTA 2YMMA 3AR9A 2J6CA 5FI5A 1NKVA 5AHWA 3VZSA 3DJYA 4AJEA 4OLAA 4Q1CA 1HV8A 5TVKA 4YO7A 5BSKA 1UMCA 1PSZA 2YYYA 3LU1A 3E22B 3KEGA 4G0OA 1QOPB 4MR9A 2O3QA 4Z8XA 3NX4A 3P1JA 1LCIA 4OBXA 1Z5NA 1UBEA 1XJCA 3LE8A 3ZE7A 5BT9A 3R5XA 3TSZA 3Q0IA 4DV7B 4P6VF 3WSTA 4W5WA 5JC8A 2XMSA 3JYOA 1Z6YA 1NTOA 3K1AB 4MI1A 4D9NA 1WB6A 2GKOA 2HX1A 1IZZA 2BDEA 3DV0A 3PKZA 4G26A 4IFBA 3N05A 4O2BB 4PYQA 2ZK7A 2BFBB 1R0WA 1DL5A 3AJEA 1DT5A 4MZDA 3GLRA 1BJKA 1D07A 4C7MA 2FB9A 1PJCA 2F8SA 3CLSC 1M5RA 2DB3A 1FLNA 1PS8A 1L5VA 1O0SA 4CMGA 1IXKA 3LCMA 5JNTA 4UMDA 5EKXA 5HJ7A 2QJFA 2BHNA 5C53B 1V48A 3EASA 4MQBA 4R6WA 3EDOA 4FB5A 4DE5A 2OY0A 5KKAA 5HGXA 4TLLB 1ML3A 1E2MA 1ECJA 3D6UA 4GM1A 4FTWA 1NW9B 2DRIA 1A5SB 2PBLA 2UUPA 2VAMA 3GRZA 2PH5A 1G5RA 5KYUA 5TMEA 3SC2B 4C03A 2R11A 4A0SA 3P26A 4D9GA 1N5LA 1KO8A 1R37A 1XHFA 3ANNA 1DC3A 1CX9B 3OCJA 4U2FA 5JHHB 2R5NA 1YR7A 2DWCA 1SZPA 2IGTA 2XGMA 3TLCA 5K4AA 5I7WA 5JQGB 1E9CA 1XXHE 1GAWA 1QLHA 3WR5A 1P2FA 5TXGA 4RMJA 5FWYA 1Z7WA 1U7OA 5KQRA 1HQDA 1QDLB 2R1VA 3X2SA 1FYVA 4R8SA 1YJ8A 1GL3A 1Q6ZA 2G1AA 4FOOA 4XH9B 4W5NA 3BFKA 3ZZMA 2IHBA 4WZBA 3OOWA 2L82A 1UZLA 5J63A 3PDJA 3IQDB 2ZPAA 1A1SA 2ZPUA 3UB2A 5C8XA 1UZMA 1E6KA 2AUTA 4LX0A 4MQ5A 3KJGA 2I5PO 4GZ3A 4I50B 5LQSA 3SP1A 4ILKA 5C4IA 2EARA 1JJFA 2HMAA 3G2LA 3VGPA 4W1PA 1F0PA 2EZ4A 4Q47A 4QYSA 1JLLA 1YK0A 3H5WA 2R96A 2E4XA 3H9GA 3P71T 2P3SA 1GGNA 2ZSJA 3KV1A 3JAWA 2PX0A 3EG9B 1Y8AA 1T3HA 3G59A 4I9NA 3ZX4A 1PFQA 1X9IA 4F4CA 3ENKA 3IUEA 3B3GA 1QYCA 2Q2NA 1N5DA 1WXGA 3JWGA 3NHKA 4HDMB 3SCZA 5CT8A 5A3JA 1JAIA 3NIFB 3J81k 3FDZB 1JQKA 3JXEA 2PGJA 3BD6A 1N6HA 3EIFA 2IXDA 1F8XA 1F6WA 2OHVA 1KQPA 2OO5A 1FE8A 1E98A 3CUVA 4WLNA 2RGUA 4FDVA 3KJQA 2PLRA 1UPFA 1VSBA 3EAFA 4ML3A 2GZSA 3JQBA 4D9EA 4ED9A 5K6RA 2XYVA 5FBHA 1NSFA 3OCXA 2IKQA 1NOJA 2H9IA 2QPAA 2E6KA 1U99A 4KO4S 2J9FA 3KWMA 3EDRA 5ENZA 1GEEA 1RFGE 2GGSA 2W8ZA 1CZKA 2V7XA 3AIKA 4B84A 2YWXA 4LBWA 1V6AA 1D1TA 2XH8A 2YN0A 1T2NA 2VZ9A 1LRLA 1RQRA 2ZJ2A 4C3VA 1CVIA 4F38A 3C3BA 3I2JA 5A5EA 1N1DA 2WNIA 1JAZA 1KTVA 1O4VA 4LWQA 5ICCA 3S8YA 1SUCA 5CB8A 2B8TA 3K0KA 4Z8YA 1LPAB 4DEVA 2QMZA 3ISVA 2YWDA 3PVSA 4LNUB 4XQGA 5CFMA 3BREA 4LC1A 3UCEA 1QZTA 4A26A 3NV9A 2AN4A 1PT7A 3C8HA 4QNNA 4YT5A 3WGTA 2UUBB 1H2BA 2C84A 5HE9A 3DDUA 4CQMA 2NV2B 1SIOA 3GNTA 2HK8A 3D0KA 4BTEA 4UVEA 1A9SA 3TSWA 3K92A 3AY7A 1P7CA 3A6FA 5CNIA 5C35A 1B93A 3Q9UA 1MNQA 4U3JB 3STUA 2Z6VA 2Z83A 3WKBA 4JI2B 4I5FA 4IDPA 2NYAA 2W6PA 3M5CA 4U7DA 1KVUA 4JVOA 4QT4A 1AGYA 1Z34A 5E9AA 1TTPB 3OY7A 1VBKA 1V95A 2GS9A 2R6FA 4QDZA 3ONWA 1UEXC 1EIZA 2UVQA 2VK8A 3CCCA 4ZPJA 3W8RA 4D5EA 3EWAA 3P4YA 4MW7A 3TS1A 2WFMA 4R1SA 2CMDA 2UVPB 5H68A 4AZWA 5JS8A 3C3MA 4W7SA 1TW2A 3OZCA 1CULC 1DKOA 3G0GA 1Y8RA 3AUJB 2ONJA 5C7IO 1FFCA 5C8VA 2IZOA 2Y92A 3I1IA 3ROPA 3ZUPA 3GLGB 4N5MA 2FPLA 7ADHA 3IEVA 1L9KA 3TM4A 3OIWA 3N8DA 1M2OB 2GBPA 5AW0A 7REQB 1KH1A 1QIIA 2R8PA 2Z43A 3E6AA 3EY4A 3TZKA 1YB6A 4WOKA 1PWZA 3TZHA 4CG2A 1JVBA 4JL6A 1AXRA 4ENVA 1C1XB 1XEXA 1WOYA 4FCWA 1DEAA 3L18A 4LX8A 4RY9A 1V39A 4ENPA 5A4FS 1Y89A 4FP9A 1K92A 4UKDA 4JLSA 2F2TA 4DKJA 4UNIA 4BBAA 1FDWA 4B4VA 2B3DA 3B6KA 3MK31 2X7HA 3Q0EA 4MTCA 2WTAA 2WP0A 3KXDA 2LPMA 2IKSA 5BYKA 3ILVA 3OP4A 4MKGA 2AI3A 4FPXA 4QC2A 3AUKA 2VF5X 3Q41A 5FNZA 3E81A 1PQ4A 2HLHA 1R0YA 1LA2A 3FYUC 3K5IA 4MKZA 2Z08A 1UEJA 1W0JA 3PC6A 1FX0B 4MEBA 5IWAB 4HGYA 3K09C 3C74A 4RFSB 5ALHA 1SPBS 4TUYA 5BP7A 4GO1A 2L17A 5DWQA 5BSUA 4EWLA 4DYVA 1FDIA 1O6CA 2FOLA 3UWDA 1NMXA 1G6Q1 4EY7A 3HO1A 2R7KA 3FVRA 3N8NA 1GAEO 3SZRA 2NSJA 4YI5A 3TW8B 3X1YA 4JUDX 3ENNA 3TSYA 1YWGO 4FOTA 1L5LA 3KQYA 5BWBA 3OQOA 2Z2YA 4JIMA 4WZBE 3TR6A 3WLHA 5EJ7A 5FP0A 3PF8A 2BZ0A 4MMZB 4XVUA 4WA8A 2P67A 3DBLA 2WU4A 5EL0A 2VHYA 2XMCA 3OE7D 4UBJA 4CMBA 1JYFA 1TA0A 3EQ6A 1HLFA 3PGXA 2A5GA 4F9FA 1GPAA 2CMHA 3E4DA 3GMSA 1PKXA 2HWUA 3AOEC 2Y1DA 4QYXA 2NT4A 1RP7A 3V7NA 3W9SA 3FKSD 4MP3A 3DR3A 1Z5VA 4MB2A 4NKRA 2O20A 1B73A 4HGQA 1HX7A 2WAXA 1NP7A 3Q15C 2FZEA 3DYBA 3JWHA 4GVPA 5T57A 2I6GA 1F12A 3VC1A 3KX2A 4DIDA 5B1SA 4IIYA 2X86A 4YUXA 3DBRB 3L1HA 4E2XA 4QGSA 4P7JA 3GDGA 3V8PA 3WWYA 5EI5A 3DZIA 4EG7A 2AN1A 4LBYA 2XE6A 3OQJA 4BRZA 3A1WA 3OT1A 1NVAA 3Q85A 4WDQA 3HNPA 1QHHB 4Q02A 3VH3A 1PN3A 3EDYA 3OC0A 4IR7A 4X7MA 3S5UA 1A04A 4UARA 2IUEA 1YB4A 4Q3CA 4B75A 3TNJA 4S05A 4RK4A 4I3FA 2RHMA 5AUOB 1REQA 2EHJA 1XZHA 5K09A 5CTAA 5KNDH 1SBZA 2BGKA 4JR1A 1P1FA 2Q21A 4EHDA 4YJKA 2D4AA 2CNBA 2XMRA 2J0SA 2PGOA 3L7BA 3UJCA 2IYOA 3UXMA 5KVQA 3E4CA 1X1QA 3EZXA 4OHFA 4E2WA 2VI5A 3M4JA 4K05A 4KXNA 5K3FA 4PS0A 2XNDA 2XB9A 2II6A 1XQ6A 1OXBB 2FX3A 3SIXA 1FMFA 3Q8XB 4OSOA 2OBLA 1D4FA 1JNXX 3N8HA 1QC5B 2W2OA 2E4UA 2QTMA 3CH6A 3HCCA 2BMFA 2BEVA 4UNQA 4DOMA 5F4BA 1YHNA 2FEMA 5COBA 2EJBA 4D57A 4HS9A 5FWAA 2R85A 2YXBA 3PNVA 1WUHS 3C2QA 4DM4A 4EMSA 5LNK6 2RKBA 3C97A 5EYPB 1SZDA 2N1MA 1RT9A 4LY6A 1YQXA 2C54A 1BS2A 3ZU6A 1OWLA 2X6TA 3ZEAA 4QSHA 3U9LA 1TU0A 1QSGA 2CDAA 3F1LA 3FPHA 4GPTA 4N49A 5CJJA 4MZXA 5IKMA 4RLFA 5FNVB 4RY2A 3KUKA 2J67A 4PC2A 4FZRA 6LDHA 5L4SA 3QVKA 2O8NA 2VH1A 3TVTA 2B30A 1RJ9B 3ZU3A 1GSIA 3RWOA 2R00C 1U8FO 3SC3A 3GFRA 1X1BA 3GZNB 5HFAA 1MV5A 1PTJA 3FYSA 2HIGA 1XCJA 4GBMA 4MS1B 4R8LA 4S1OA 4KMMA 3RTBA 1TJ5A 2M98A 1QK5A 3T7KA 4D9JA 1C2TA 1XWWA 2FOIA 3QLUC 4DJJA 3E1SA 2R0QC 1WCV1 1XWFA 1QV9A 3G9XA 3O7WA 2XF2A 4KTVE 4LXQA 1SU8A 2YIDA 5K0LA 4BGIA 4ZOQI 2JD0A 3BSWA 4F3TA 2V0CA 2B1JA 3B89A 1L5HB 3CH4B 3I2HA 3CZQA 5LOVB 3VR5D 3ZYCA 2VPZA 4BBZA 3RUIA 3L43A 3RT7A 4UFOA 2WWRA 3DKIA 2IUYA 4EVQA 2CV1A 2AX4A 4URZR 2V3CC 1FUUA 3DNFA 3H11A 3SYTA 5IJXA 4MHOA 1I2CA 4OCZA 2GJ4A 5KAMA 4TKVA 3EYAA 2RDMA 4IV8A 1F8GA 3UJ7A 3STXA 3FNHA 2I29A 4IJMA 2IBMA 4JH0A 3LCRA 3GLSA 4ZAFA 3UOWA 3AUXA 4IEIA 2IZ7A 4INOA 2BH2A 1IRXA 1Y5LA 3MRSA 2Q0HA 1XVVA 2W48A 4PYKA 5E38A 3VVCA 1E63A 1GPWB 4CF6A 3AIMA 3LY9A 4RKFA 3JX9A 5IT9A 2CMGA 2IZ6A 3JD1A 2V0GA 1AGRA 4WBNA 3GR6A 1L4UA 4MW1A 5ITVA 1X1CA 1BS9A 2F1OA 1JA0A 1JIKA 2KBFA 1GKKA 1NIPA 4JLBA 4U1RA 4YP7A 1IEXA 2PU5A 1YFJA 1WUYA 3M9LA 4B80A 1PT5A 1F14A 2C0CA 5FTWA 4AUMA 4BGEA 1YD7A 3DBHA 1CR4A 3IV6A 3E5HA 3PZBA 5F7ZA 4O08A 4JVLA 2YXNA 1LBTA 3KXLA 2CYCA 3ZUGA 5AKLA 1U7UA 1M54A 2XKAA 3QG1A 1M6VA 5EXSA 2KMLA 3C14C 4S3MA 5JXHA 3OPQA 4MV4A 1IBCA 4YPOA 2ID8A 1JTFA 1BRTA 1PL6A 3DEHA 1A5ZA 1NU6A 2A7QA 3EH1A 3KTDA 2R2AA 4YAOA 3KV3O 4DCNA 4MQ6A 2OKCA 4NZOA 2KYRA 4JFAA 3VR1A 3LLSA 4AO7A 3CF6R 2AYYA 4XFDA 2ADOA 3ABRB 1U4SA 2H5JA 4UNPA 3HADA 1Q7RA 4U0JA 1J24A 1A96A 3P27A 4F6RB 1XTUA 1ZD9A 1ZGAA 5EQTA 4G5OA 5K20A 3U3DA 4MW5A 5JBQA 3ZKWB 4XWAA 3OQMA 5DV9A 1FFYA 1SU4A 4KVZA 2VOEA 1HEUA 3FZGA 1JEYA 1RNLA 4HXEB 4IKEA 4QUBA 3UUFA 1X70A 3CEJA 3NHAA 4ENUA 1L4FA 2ZSBA 4KYVA 2UUCB 2GERA 3GIDA 4CEHB 4YIKA 2OO7A 2NSYA 3JVUA 4AMGA 5E0OA 1K5DA 1ZEJA 2H9AA 4XXHA 4DQ0A 5L8VA 1OIXA 4QO7A 4EG0A 1I5RA 3WQHA 1P75A 2GEBA 3NW9A 1PDVA 3CX4A 2A3NA 2EZUA 1KWGA 3ER8A 3FVQA 3R7WA 4PN7A 3P32A 1X38A 4N82A 4O4IA 5E2BA 3WLQA 3WWOA 3KPUA 1BTOA 3WK4A 1V8DA 1WLYA 3T6KA 3GVXA 3IE1A 5K8TA 4FYJA 3VR6A 4JYBA 2UYOA 4K1LA 2OWEA 5JPDA 2PWPA 1KK3A 4YRNA 4L50A 4N5LA 5CB4B 1DINA 4UQLA 3VZDA 3KKLA 2P8SA 3AUFA 1OT5A 4L51A 4M99A 3ONDA 3QEKA 1E20A 4R40A 4E7PA 2XZDA 2ZROA 3LCVB 3OQBA 4P53A 1JDVA 1FSZA 4ZT2A 2XSZD 3D02A 1U2DA 4EHBA 2FFBA 5CA1F 3D1VA 3N58A 5KB3A 2F48A 4DADA 2W2PA 4LN1A 2FHSA 2GWRA 2DTDA 5DSXA 4FWBA 3E9CA 3EXHC 1KEKA 3E9YA 1HTWA 3KRTA 2JH9A 4QQ8A 4R05A 5E7QA 1SMKA 4F56A 1D2GA 1GR0A 4HB2A 4TV8A 4DLBA 4LJ4A 4EG1A 4R2HA 3G2NA 3BK2A 3T94A 2HRRA 1RWXA 4N76A 1VLLA 1SQFA 1BCSB 1QIFA 3IKMB 3NT5A 1RVDA 3HA5A 4HAWA 5C51B 4HDMA 4M1ZA 1VSUA 3IUMA 2XT6A 3W2HA 4YRQA 2IBSA 2Y2UA 3EEFA 3BXZA 4WNAA 3UCXA 2AMYA 1Z06A 1MDBA 2PX4A 3N39C 3CW9A 5FT9A 1GZHB 1SOVA 4MUXA 1NF3A 4P8RA 3BMQB 3U3XA 4BCDA 3HVRA 2Y93A 1UEIA 1G2PA 4YNBA 1UPAA 4O1HA 3W2GA 1Y4DE 3EGIA 2CL5A 3I1JA 2HDWA 3QMMA 3HDQA 4NYJR 3TI9A 2GRUA 1SHZA 3EZYA 5SZJA 1FPQA 2NZUG 4UPEA 3KTOA 3PQ8A 4JUFA 4MV9A 2H3EA 1THZA 1Q83A 2GX6A 3LQKA 3M1AA 3LI2A 5CT6A 2ZLBA 2VTVA 1L5NA 5KDDA 2P2ZA 2N46A 2PO7A 4L9AA 1FCJA 1JB1A 1M0TA 1OH7A 3WGUA 1CV2A 1YULA 2D06A 1H6CA 3SIPA 1EFLA 3ZOZA 2NUPA 3D6MA 5FQOA 2WG0A 3B5JA 2GJ9A 4R31A 1A3CA 1WMFA 1HNNA 2H0RA 4Y9TA 1A4IA 5EMNA 3TZ6A 3ORRA 4CLEA 3B1JA 3SAJA 2ERYA 3K9HA 3QU9A 2P9QA 3PI6A 4XCVA 3ZHCA 4DZTA 3NDBB 2ZRDA 2CFTA 3GLHA 1S2MA 1RQXA 4HYQA 4IJ6A 4JBHA 4AZTA 4EUHA 3KU1A 5JVDB 3C3AA 3ZJTA 1AZWA 4DZRA 5HQTA 2MYPA 5BN4A 2IYLD 4MO2A 5JS1A 2AZMA 1HQKA 1Z5ZA 2UZ0A 4J90A 1A72A 1FTNA 4IZIA 4J7UA 3L8MA 4IO1A 4KK4A 3UH0A 2FTKE 4KL8S 3PXXA 1GN9A 1ZIDA 1QORA 3G23A 4TS1A 1NM5A 1W0KA 2GD2A 4GX1A 1CK4A 1JQ3A 5DCLA 2OGWA 5DYYA 1LGYA 4JIGA 1CUGA 3R3VA 1DAEA 2JAWA 1XPOA 2VHQA 2D5IA 4JI6B 1VHQA 5DNYB 5IN4A 4L8WB 5K3CA 1RZRA 2OAEA 4BNWA 4D80A 1SOUA 3H05A 4IQGA 3VNQA 3GBPA 2JCVA 5IUNC 3IT1A 1S1CA 1BKSB 3HPRA 3VNBA 2PKEA 1FFGA 1NXPA 4EW6A 1CS0B 3N28A 2I2BA 2EZTA 2A0XA 3I5MA 3GV0A 3JZDA 4JT4A 4YJGB 3FROA 3T5DA 4CTMA 4V39A 4CGZA 2Z2JA 3O0TA 4GLFA 5ARDA 2ZZMA 1NZDA 2OLEA 1IPEA 3I34X 4K9OA 4UXHA 2JHFA 1ZOSA 1DAGA 1KH2A 3SEFA 1BU8A 1UJCA 1CQJB 2QORA 4RCZA 3H83A 3CR7A 4PTZA 4BV8A 4CYMA 4C43A 1EUZA 1WW3A 3REOA 3PX3A 1KFCB 1NXWA 1X94A 2AGVA 4AG5A 4RWZA 4D96A 4DUZB 4M0LA 5KTMA 4DFDA 3HBJA 4NQRA 4Q1BA 1EE9A 3DC7A 1Z12A 5FBZA 4D0LB 1G2OA 1UXHA 4NCNA 2PO5A 5HPYB 3HLKA 1IXRC 5KJEA 3FPCA 1RJEA 4NCHA 3W3AD 4ZO6A 4CM4B 4QRDA 2OAGA 2CNOA 3PTZA 2OD2A 1VCIA 2NG1A 3MLAA 4FLFA 1Q74A 1XLTA 4YDSA 1K06A 3KT3A 4E32A 1TYZA 3D1LA 2WHXA 2IHNA 5IVHA 4I3HA 1CZRA 1SXGA 4O29A 1E2PA 4LISA 2R1ZA 2DECA 3R77A 5FUWA 2GTHA 3WYNA 1AKVA 2NIPA 4QOEA 1IAQA 2OHHA 3O83A 3TL6A 3TNYA 2Q2QA 3F46A 3ZW9A 4I99A 1GM5A 4MCAA 5GOTA 1QP4A 3KQPA 5D1HA 3VH4A 1R4NB 4QXAA 4AMUA 1Z5WA 2JGDA 1XMSA 4TSRA 1EQAA 3EZFA 4ZO8A 3VAYA 3KTAB 3WMFA 4WY2A 5LA6A 2ZITA 3ELYA 1CPYA 4JP8A 4W6ZA 5DI3A 4II2A 5JNLA 4RCYA 3MWJA 3HM9A 3AGQA 3D59A 4B73A 2FRDC 1B23P 4L74A 3QF7A 2PRYA 3HN6A 5DMHA 3H2SA 4EQ6A 3KHSA 2PNJA 1M6WA 1NXOA 1TAHA 1U2RA 3CG4A 2KPOA 1YRWA 2WKPA 3GP3A 5E6SB 1XMVA 1MO3A 1ONBA 2WD7B 3A32A 1OWNA 3BD7A 4LHVA 3AVQA 4C2UA 1M7HA 1E3IA 5HOQA 4OK3A 3EZ2A 4NNOA 4WK4B 4E88A 2HJGA 2NACA 3K6SA 4RACA 2PYZA 4OEHA 1LPPA 1TLLA 1JI0A 2C97A 2EW8A 2ZYWX 5KWVA 4AI6A 4IHAA 2PR7A 2XOKA 1TZBA 2AEFA 2FN3A 1VYVA 4G1UC 4L02A 4DY6A 1GEGA 3WP0A 4Y2XA 4DMLA 5GJVC 1IY0A 2JLXA 3NOVA 2PT6A 1DAIA 2WJPA 2ZI6A 1ZEMA 2HUPA 4R98A 4M76B 1U8XX 5CFOA 4X85A 4EYSA 2AZTA 3LHDA 1WHSA 1UFVA 3HZHA 1IZYA 2HU8A 3OX2A 3HU3A 3UHAA 1C4XA 3K9WA 2B8WA 5EWMA 2FLVA 3DEFA 4LWZA 2X77A 4TYQA 2QG4A 3LY5A 3TW0A 4HUTA 1LK0A 4G5YA 4LVNA 3R0XA 1EG2A 1XDDA 1UQRA 1RI1A 1T5TA 3ZHSA 4B3HA 1O6GA 1WF3A 2G1JA 3GDOA 4Q7EA 3A1DA 4I4IA 1SXQA 2IS2A 1LW6E 4GIBA 1KTIA 4OHPA 4OJKA 4QLOA 4PPQA 2IHKA 4YPVA 1EFAA 4A8HA 3IELA 3NJ4A 4HK4A 4OM7A 2PFSA 3V1NA 3C5EA 3E9ZA 2ZRKA 3IC5A 4DIEA 2I65A 2WVAA 3BBLA 3RIXA 4B33A 5GIPE 2E4WA 2Q4OA 2EBFX 1M2HA 4E4TA 1E7WA 2Y0CA 4QNRA 4PRKA 1HLGA 5D6OA 2N75A 1C3JA 3N86A 4HP8A 4Y98A 3TQFA 1WO8A 4BNYA 4RZQA 5IT5A 2Y9PB 3HB7A 4C05A 1SCAA 3MOSA 2D8AA 3UTDA 1DO2A 3BDAA 3LAWA 3LYAA 2ZI9A 3H16A 4G1VA 4FB4A 5BV7A 1QTQA 5ALNA 2QVYX 3AQIA 2X5KO 1N2OA 4EO7A 1YVEI 4IDCA 1IHDA 2QRHA 4NFLA 2QTVB 1S02A 1ISRA 2MR6A 4EA7A 5I01A 2PQ6A 1C3OB 2VPQA 2BFAA 1ZJ6A 1W44A 4ND1A 4QM7A 5LQMA 3EZNA 2VCEA 3DOHA 2ZE5A 3H8SA 3OZVA 4MV3A 2E82A 4ZGGA 5JS7A 4ZYXA 4R1PA 4HGPA 4UNSA 4RGQA 3K6RA 3U4HA 5BQPA 3QIVA 4ANFA 3OQIB 4KXWA 4GDMA 5F7JA 2QBYB 2CW5A 1XJQA 1IBSA 1Y6JA 3FYCA 3W5VA 1JLMA 3SZUA 4B6EA 4UAGA 5KNCH 1V35A 2B0JA 3JSAA 3VJMA 1HFEL 3NAQA 4L7QA 4R83A 1UC4B 1I10A 3FNGA 2IYUA 2MT9A 3GUZA 2QF7A 1AZLA 4L6CA 3M6VA 4CG3A 1LKZA 5M34A 1AKNA 2WWFA 3KQUA 1GDTA 1VJDA 4MMXB 4JSRA 1E9EA 1UFOA 3LDUA 4RF3A 4AJHA 1XWIA 1QIJA 1YVUA 2C77A 5FPKA 5JJLA 2Y1CA 1KK0A 4IF6A 2QN8A 1GFZA 4JENA 4F4DA 3ED1A 4EI8A 5JMWA 5MHTA 4AJOA 4FKMA 1MC4A 4BO8A 1UM8A 3FVWA 1L1FA 1CRZA 2YNMD 1P5FA 2CUZA 1PLKA 2HEGA 1EVJA 1P2GA 4YCJA 4CKCA 2R68A 1XNJA 2WUFA 3AHEA 3F8TA 4O2AF 1GCUA 2W4MA 3GWGA 3KQQA 3ORYA 1EVKA 3A04A 4DDMA 1PUXA 4BWGA 3QVOA 1P0MA 4GP9A 4FNOA 4ER5A 5LQCA 3K0SA 1H8HA 2O5VA 2PT9A 1ZGGA 4MWCA 4R41A 4FOLA 2WF5A 3LDAA 1ZICA 1D1QA 4OLJA 1MT3A 3RI3A 5C1DA 5AXDA 2ZYIA 5JANA 2O06A 1JF8A 3U31A 1KYQA 1RJWA 2IYPA 2L2QA 3FR8A 2QR3A 4F5ZA 3KVYA 4WD3A 3T3DA 2X7JA 3P4XA 5AM2A 4IDGA 1X42A 3DOIA 4RS3A 4MAAA 3GT4A 5HG0A 1C0KA 5A7GA 1Z3IX 3U09A 4R2KA 4YRKA 1AO3A 3PWKA 4E13A 3C1AA 3A3PA 4UEQA 4K3VA 1N3IA 1Z36A 4Y1FA 5TS2A 3D3NA 3QU7A 3VBEA 5I7OA 2HMWA 1KXZA 3OI7A 4IG4A 4REOA 1DTWA 4RK0A 1RKVA 4NULA 3QEMA 2FMFA 4F1JA 2CE2X 1Q50A 5MN6A 1LJLA 3IAM1 2CDNA 2VJNA 2YXDA 4GW3A 1DWQA 4NFYA 5DGHA 5IN5A 3S2FA 5AH0A 1E2EA 3ZG6A 5FBVB 3ZLTA 5G4KB 5C1OA 2P9JA 3G9UA 4HYYA 2P1DA 1ZGCA 4CKWA 4M55A 2CGEA 1HRDA 4RHUA 4PIPA 4YAUA 4TKLA 1S2LA 3THYA 1KWKA 1CUXA 3JQFA 3RIGA 1OPXA 1Z0JA 3K73O 1H8ED 2YHAA 4LDPA 3SY8A 4CL8A 3P2KA 1NJGA 3S2ZA 3UATA 3W5UA 2RHHA 5HTOA 1QGOA 2QJTA 2VG8A 2REXB 2QLFA 3LBFA 2RKOA 3PNQA 3KR0A 1C3VA 4QHTA 3LPMA 1VRWA 4UEKA 3H8VA 4N7BA 1JA9A 5E1OA 1XMPA 1F2UA 3WGOA 4S04A 4ZAXA 2ORVA 1NVTA 2QE7A 2Y77A 4UVGA 4Z6KA 1OI7A 3HXTA 5A02A 1E7QA 3VU8A 3OQ1A 3QWIA 3ZDXB 1P74A 2MDTA 4AO8A 2GZ3A 1Y3HA 3ILYA 3PUWA 4FMDB 3B8EA 4HB3A 5IVKA 1AGPA 1K0UA 1C9JA 4X20B 4X7RA 1W1UA 4CWAA 3ZDQA 4CFYA 1CUUA 1ECCA 3RAJA 2DP4E 1VRCA 5FWXA 3STVA 4BFVA 3SE7A 3DE6X 1PVOA 2H00A 4L0MA 5DWDA 1EU1A 1XZJA 2IEAA 4XJSA 2GRJA 2G36A 3MWFA 2MSCB 1XO1A 2VS1A 2WM8A 2XY4A 1A9OA 4M38A 1JBEA 3KQHA 5LMNB 3GFTA 2O8VA 4QU0A 3D0RA 3IAXA 4UJ3A 2AOTB 1M1NB 1T9GS 3HDGA 2JGAA 4GXRA 4WE3A 3TIGA 3CPEA 4MUKA 3MCZA 4XZ3A 1EG7A 1S8FA 4C2AA 4X84A 1OLSB 2QRVB 1WCWA 1X7ZB 3AP2A 3IQXA 3K05A 3TIIA 3HKCB 2EEZA 4UZFA 3WL7A 1VSQA 3AP3A 3N8KA 4RTRA 3D3JA 5AJYA 2EWVA 2OWDA 2EJWA 4NMLA 5AHXA 5LU8A 2JIQA 1XXLA 1LFDB 3PGVA 3D8SA 3EAGA 4Q1DA 2DPHA 4AYWA 3OOHA 2XB8A 1QVWA 1TVKB 4M37A 1A7KA 3RHTA 3WHKA 1A2QA 1JB9A 4BE9A 3BMXA 1Z0UA 4FSDA 4WH0A 2PA0A 5FBKA 1N9ZA 1Y9DA 3AM3A 3RK1A 5EPOA 4D97A 5F9FA 5CT9A 4LGVA 4BZWA 1P8JA 3ADDA 1QFSA 3D6NB 1MHTA 3K9BA 3UO8B 2NZVG 2Z4RA 2C29D 2BGNA 3SHFA 1U8ZA 1V7QA 4R1TA 3FOZA 1S2GA 4MVXA 5HXAA 2AKYA 3JQ8B 4YROA 3ORFA 5CIYA 1EB9A 1IC6A 1IN7A 1QB8A 3DTNA 3E3NA 3I5UA 3IDFA 5EZ6B 2Y1FA 4C7OB 3IUQA 1P9LA 4M86A 3EXIB 1LTQA 3KYBA 3B70A 4DXHA 1Z3CA 3GJ6A 1SU7A 1EFUA 3E61A 3LO5A 3SS8A 3GLFA 4LW8A 1YK1A 1R64A 4A4DA 1AGXA 2NSLA 3I1FA 5BURA 3K1ZA 4PW0A 4PZLA 3EOBI 1MC5A 4F3RA 4D4HA 3NGXA 4UZSA 5FA5A 2QM7A 9LDBA 4IVQA 1QP0A 4UATA 3QKTA 2XUAA 1NAIA 3LQ4A 1OH5A 1QJ4A 2EKBA 3P9SA 2A1UB 2ZUVA 2FSFA 1IU9A 1VXRA 3Q72A 1X7WB 3GRPA 1FMCA 3ITKA 2EFGA 4RHEA 1BDBA 1Z2EA 2FMXA 1Z26A 2QUIA 4AF8A 3LXMA 3ZGZA 3FCAA 4IUYA 4I08A 2IYRA 4LZWA 2O7RA 1XE3A 5JS2A 1GPBA 3QJYA 4BIIA 4S1PA 1E2JA 2XCTB 2A9JA 3FMFA 1NQWA 3IAAA 1V1RA 2L69A 2ZIUB 3ZPXA 1QS0B 1L5WA 1XKLA 2B9VA 2F9LA 1OD6A 3O8LA 2J6IA 5GINE 3A9CA 1VDMA 3HJCA 3KDSE 4C14A 4F92B 1NBMA 2CLMB 3UFXA 1CEXA 1CP3A 2W2KB 2JGJA 2QTRA 3E70C 4MNTA 4B4WA 1KJQA 4DR3B 1M10A 1WVIA 2M1XA 4IDOA 1S7GA 3IR7A 1VB3A 3ZDCA 2HQBA 4B5LA 1L8LA 2Z4SA 4BNDA 2ZSFA 4ZN6A 3LZ6A 2WQZA 2QL7A 3SXUA 3I72A 4OB7A 1II8B 2O2HA 3S68A 1EVZA 4NMHA 1C7JA 5K0NA 3ZV6A 1L5RA 2FP4B 2NTEA 4HMPA 4ZOEA 5AKXA 3AX6A 2JHGA 2X1LA 4JBGA 2YRWA 4AZ3A 4ZYUA 4MP6A 3TZLA 3K4HA 3ZH2A 4TVSA 4C1BA 3OFNA 5TMDA 2OGSA 1YQWA 4EM6A 5I8WA 3RWMB 2QUZA 3O4HA 2MINB 4C6TB 4HY3A 5IASA 2GAFA 3B7PA 3BXOA 2J59A 3IJPA 4B8YA 1OQAA 1OKKA 3FM9A 4K9RA 2OBXA 4ZQCB 1J33A 1QCCA 4M1MA 5DRTA 5HFJA 3UJ3X 4L0QA 2OAQ1 2BGTA 1BDHA 1YTUA 1DCMA 3RS5A 2AFVA 4KXMA 1EESA 2G9QA 5JEEA 3DD5A 3BGIA 4RFLA 3HB5X 4G2NA 4AAYA 4K6CA 3DDHA 3I0MA 5A3QA 1NDHA 1Z5GA 1C0EA 3PYXA 4R2JA 4YREA 1TIKA 1YONA 1SKQA 1JR4A 5T4HA 4DUGD 1ZXLA 1CY6A 5HP4A 3C7CB 1HEYA 2WZCA 3A1VA 3CJQA 2PCLA 3CTPA 1W59A 5F7XA 3MPOA 1M0EA 2JAUA 1Q7EA 4KLRA 4NXMB 1YA4A 2PUWA 1G5IA 5BV2P 5JT1A 2Q7OE 1YACA 3Q8MA 1RZ3A 2J5QA 3AERA 2QN3A 1KMNA 1VM6A 1A9XB 2FF5A 1G2IA 3FGZA 4H3HB 1BE8A 4NPCA 4U7JA 3LX8A 2CHGA 3FCCA 3RC7A 4D98A 4EYKA 4CLOA 2A88A 1TM1E 2EATA 4G1EB 3SS7X 4YJFA 2F3UA 4LXYA 2QRJA 1PG0A 2ZRPA 3IJ5A 1UOPA 3WRXA 2WILA 3C3JA 2YN2A 2HSGA 1PG5A 1MDFA 1R5BA 2XDYA 5FH9A 1OC2A 5JCJD 3ZHXA 2DFLA 4BNLA 4RA6B 2YRXA 1SK8A 2ZTHA 1QVZA 4ZOAA 4ALIA 1E3MA 3BB1A 3V4FA 3JRWA 4QZVA 1DJMA 4ZOLF 1O95D 3L06A 3ABZA 1YF3A 3NBUA 2X0KA 1C5KA 1QOZA 2PEYA 4M7PA 3SX0A 4ZYWA 2O7NA 4Z9YA 2FWRA 1YBHA 3KJXA 2I91A 1CF4A 5A5VA 1O87A 2ZP1A 3GQVA 2V5AA 5B4VA 1XZPA 4DCSA 3VKVA 2QRQA 6Q21A 3CGWA 4J0FA 1P9WA 3MFYA 4ESVA 5KO2A 2FR1A 3GJ5A 1HDYA 1OFIA 2FXVA 3O2JA 4R6XA 1L2TA 2O3UA 3WO0A 2XUFA 1H4VB 1K9VF 4ITVA 5J2TB 3W5AA 1WA5A 2XZOA 4DSNA 1KR2A 4ILEA 4CF4A 2RAUA 4NE2A 1HTTA 2BOVA 4FGWA 4GPZA 1X7GA 4TYMA 1C14A 1S6YA 2VTKA 4ZEMA 1ISMA 3PQ7A 1QQ5A 5FR1A 5LR6A 1T29A 1ZG3A 4WV3A 3GLFE 3MILA 4R81A 2BBTA 2F00A 3C7TA 4KNYA 5KVCA 5L3RA 2QMQA 4LCEA 4Y0AA 4KE8A 4YJ3F 1U0EA 2F90A 2UYQA 4JI4B 3I12A 2H31A 4M8LA 2XVMA 4KDFA 2HHLA 1Y6FA 3HEAA 1KYVA 4LF8B 2V1UA 1I01A 4U8GA 1XPJA 3I30X 4HDSA 2VP6A 1KO4A 1M2GA 3GB9A 4OYYA 1NXSA 4X0EA 3UPTA 3HLYA 4X66B 5YASA 1P0FA 2P79A 3R0ZA 3VPAA 4BLSA 3CEPB 1FJGB 4HEA1 2HHJA 2BE7A 2BKVA 2JK0A 2HXYA 2XJ9A 3QFHA 4OHXA 4R2MA 4C0SA 3K3PA 2FSIA 4J16C 2DFKB 3KEOA 4MWEA 1ZU4A 4J2OA 5HTKA 3K1TA 1ZN2A 3HFGA 2GBFA 3B12A 5U4QA 4EW3A 5MN5A 5T5QA 3CLRD 2W11A 5EEGA 1ND5A 2XBMA 1UODA 1Q5PA 1USVA 1CUYA 2WYIA 1Y5RA 2VDPB 3A06A 2A94A 1ACJA 1ISIA 1XK6A 5AVWA 4Q1AA 5JD4A 5LYJB 4KR6A 3VC7A 2B4YA 4UBMA 3AKDA 3T15A 2UZIR 3ZCTA 4RHFA 3AH8A 4PSCA 3TCKA 2C9ZA 4R3WA 1X6VA 1TI7A 3L01A 4EMTA 2FQ1A 2O6HA 5ICSA 4I6JA 4II3A 1NF8A 4AKHA 2WIGA 1UH5A 1KVRA 1UP4A 3HA7A 4FHGA 1SUEA 3AEQB 5B58T 3QQ5A 5HKKA 1C7IA 5EQFA 1VSVA 3OEHD 3BMOB 3B2NA 4CM8B 3LZDA 1KZYC 2W2MA 2XEDA 3PFCA 3K71B 2H2HA 2DFDA 3C3WA 3HKBA 2AE2A 1ZLXA 5GV8A 2LDXA 2IZ5A 3KAPA 3ROXA 3GOHA 1SXHA 3JQ7A 2OCYC 3E5MA 4KQCA 1EZ1A 4LIPD 1KEEB 3ZD7A 3X1JA 3KBOA 1VP3A 3R5FA 3QF4B 2VPTA 3GG9A 5L40A 2WYVA 3I9FA 3WZLA 1CQIB 1AN0A 4F2WA 3QYAA 4ND2A 3RC1A 4PYOA 1I14A 1SKYB 121PA 3K9FC 3GPDG 1ECFA 2FJPA 4B2LA 2QB5A 1GZ5A 1N2CB 3BVPA 4KWEA 2Y1KA 4HQOA 3K4PA 2OQVA 4LUCA 4JZYA 3W7VA 4EIWA 3FUCA 1OREA 2X0IA 3H5AA 2FSHA 3UYLA 1OPRA 3C4JA 4DDUA 5AUPB 3M7IA 4PYMA 4BCCA 1LX6A 4DCVA 2B94A 2BFMA 4JJZA 1DVRA 1PEKE 1NZJA 1QBGA 3QMPA 4KI7A 4KPGA 4F7DA 4YY3B 2A9KA 3ENVA 4NCAA 1F4LA 1NJ8A 4JKYA 5D84A 3S28A 4PR0A 4BVGA 4MUFA 3D6TB 1JR2A 4E4YA 1W5FA 1NOIA 3EGDA 4N9QA 2BUCA 3I8SA 3U37A 1Y5NA 4FE7A 3M2TA 2ONZA 5JDCC 1LTHR 2G25A 3IAS6 2IUTA 3OZWA 1TCCA 1WZUA 1G42A 1UBOS 3DV2A 1CY1A 3IILA 4TMYA 1U1GA 4TXMA 3ZHYA 4A8JA 1Q0LA 2YTZA 3CLHA 3H9EO 4U2CA 4BVKA 1VXOA 1KAMA 4FONA 4GOND 5E6UB 4YRPA 4B6JA 1PQPA 2BTOA 3CPHA 4I1UA 2PJRA 2L19A 5JQWA 1RM5A 1QRDA 4A6EA 4KBGA 2WJVA 3EA0A 4R8VA 5LQDA 4ZQBA 4MW0A 5BNZA 2ZM6B 3IVMA 2ZW9A 5KQLA 5TGDA 2PRZA 4ND4A 4U9UA 2NU7A 4OQPA 4MWZA 5G2OA 3Q5GA 4N03A 3IVRA 1Y8ZA 4O3FA 1NFQA 1KAOA 1UQTA 1Z15A 4FHEA 4OMFG 4CEIB 1T4CB 4GEGA 2BKXA 5FBQB 4CL3A 3B9PA 4B44A 1NC1A 1WBDA 1AQNA 3V7FA 2Q1WA 4WADA 1XXHB 2FW7A 3DE2X 2FZWA 1KZ7B 4O2BF 1TLTA 4UOZA 3IB6A 1FP7A 2P1RA 4BO6A 3UMVA 1M6NA 3H84A 5KWEA 1R6XA 2DGDA 4ZT3A 5K0SA 1K8QA 3Q3HA 1VECA 2Q5FA 1DCKA 4IGEA 1UFKA 4RV5A 4OREX 4F5WA 4WFIA 2IHJA 4J2HA 1KMHB 2HO5A 4H7IA 1DKMA 3FWYA 2R47A 4W7HA 1UMBA 5BV1A 3CLKA 4BGUA 2LBPA 5FAKA 2JJ1A 2CL7X 2FLWA 4JMPA 2WUVA 3EGXB 4FNGA 5K4HA 2WFLB 3AM5A 4C4XA 3GARA 3EFBA 3KQLA 2N9UA 1DOAA 1W4RA 1ZK3A 3CGGA 1C41A 4G25A 3SF8A 3TLEA 4H59A 5B7QA 2DR2A 1QXSA 4JSTA 4KQ9A 5JQGF 4LJLA 2X76A 2BMDA 2FMKA 1QH1A 4FBLA 1VMAA 2G17A 1VL1A 4NZPA 4PLTA 4EA8A 4WOJA 3COJA 5EUMA 4UFNA 1ISFA 1B0ZA 1N9GB 1B6GA 1FJHA 2O3TA 1IPHA 1UKVY 1QH8A 4NE7A 3PQ3A 3I39X 2G80A 3JATA 4JEIA 2I76A 2I3DA 5AKEA 2IHZA 2EZ8A 5CBPB 2PLNA 3W9UA 3EXEB 1SY7A 3EVGA 1FUIA 1QHXA 1QUFA 3GJRA 3OX3A 4FEGA 4POOA 1Z8NA 4I50F 4K6MA 5CA1A 4JYMA 4TZKA 1EHYA 2GAAA 4EJMA 2DCUA 3G68A 3DE1X 5C8YA 1JEJA 2RGWA 1TAGA 3G13A 3PXCX 1BMFA 1RW4A 3IOCA 3U19A 4WOCA 3T5GA 2OD9A 1ST3A 1QCZA 1JR3A 4JITA 1CY2A 2Z8ZA 2SICE 4URVR 2A9VA 3IAEA 2YV1A 2FPGB 4AM8A 3A05A 4M0KA 1PS0A 3UV7A 1V9LA 2C2HA 2W6ID 3FOBA 3GW8A 4A2QA 1DG3A 2CVZA 4Z4CA 4NCBA 1LPBB 2ZSEA 2RKWA 3ZZUA 3GBSA 3PX2A 5EE5B 1XA0A 3AB8A 1ORVA 1IBKB 2D1FA 3MGAA 1B42A 2N1BA 3WWZA 1JXQA 1KI7A 4PY2A 1L5OA 2VYVD 2IS6A 1K4MA 1RTKA 1YKGA 3QPUA 1N2XA 4CV3A 3IVGA 2Q3CA 3ORHA 4NEHB 1SB9A 1J0CA 2EQAA 1OMOA 2ZB7A 3KQVA 3M5WA 4IUDS 2B6HA 2AQHA 3OJXA 4RVUA 3HG7A 1YC5A 1JMKC 1EXWA 3HXKA 4P4SB 1JSCA 4F1KA 4RV9A 1IHYA 1TM7E 2XUDA 3HO6A 1ZIXA 3N0VA 4RD6A 5EJMA 2H65A 4JP3A 4NECA 1I13A 1HZZA 3GUHA 1KAQA 4TX1A 4YRJA 3QEAZ 2QNRA 4Y30A 5C1PA 2PUFA 4BBJA 3KSBC 3UANA 2XBLA 1ESDA 3R3WA 4YT4A 2IOFA 3F73A 3DB1A 4QWMA 4KXFB 1FNCA 3RVBA 1TC1A 2BEWB 3WBBA 4D4GA 5HK9A 3I92A 2AN9A 3CSSA 4KR7A 3C6ZA 1CRQA 1M8PA 4K87A 2F8MA 4JSYA 1JH9A 3QFRA 5EPEA 3VPXA 3FRHA 5KNLA 2QAGA 2GCPA 2C1XA 1O97C 1QRAA 4MW2A 4RXMA 4UDXX 2O8EB 4V3BA 2PQ0A 2VSYA 4UUAA 3PPXA 4RHYA 1OXTA 4R1QA 3DDOA 1LBEA 2B35A 5IH3A 1KKMA 3C6MA 3L6DA 1CDOA 1X7DA 1YI8A 3N0WA 2GM5A 1N5IA 1YH3A 1QAOA 1N57A 2ILTA 4BYMA 5C46F 3GVHA 1TF7A 2FEAA 4OFWA 3C45A 3Q7SA 5BOSA 4JYZA 4C7VA 2QAIA 4G9EA 3ZZTA 1OGJA 1GWNA 3EVZA 1MC1A 1P81A 1BWRA 1MPXA 3UG6A 1MA0A 4CQNA 3K20A 3HH8A 2CWDA 2P2LA 3DWEX 4MR8B 2L18A 3MQ4A 3S8EA 3EIHA 1F3LA 1NX6A 1UPTA 1VZ3A 1BS1A 1JXAA 1U0NA 4YASA 3T7JA 3RS8A 1ILEA 4XM1A 3IMEA 3LTNC 4MGKR 5D1NA 2H1WA 3K1JA 3FVVA 2Q3MA 4FYMA 4U4AA 1N92A 3DLPX 1TO2E 4N0QA 4QUIA 3RSZA 4LC0A 3MWYW 3WLMA 2OT3B 1F1BA 2Z2IA 5T4EA 4FU0A 3FHCB 5L6MB 2QPTA 3TDNA 1UOEA 4M9CA 4EPTA 3WTBA 2KQUA 1NVMB 2XXBA 1E5XA 1UWKA 2NU9A 4QVGA 1BIFA 4AZVA 1QGAA 5I7HA 1NRJB 3NONA 2W71A 4GYYA 2IW3A 5DHUA 4AJ4A 4YUAA 2XCRB 1JLRA 4KODA 1PJ2A 3NBAA 3I0NA 3QEOA 4V3CA 1W9MA 5ESDA 1R0BA 2A5FA 2W6OA 1TPYA 4IX1A 4IIJA 1IZ8A 4P3PA 1A88A 4QPPA 4JHXA 4YRDA 3ZDDA 4DF3A 4LDRA 1CETA 4P1ZA 3ZHRA 2ZVDA 3IHLA 1EFTA 3KWJA 4ROSA 2A4MA 3DTYA 4FINA 2VZ0A 1U1IA 2JF0A 3LV8A 2BN4A 2ZTMA 4MUGA 3WL3A 3HKEB 1ZI8A 2QVXX 2W43A 4QLAA 1MBZA 1YFLA 1PHPA 2VYNA 4BQSA 4WESA 5JFTA 1RLJA 5FFFA 3HJFA 3THSA 4RZHA 4GL2A 4Y1EA 1DV1A 1WPGA 2D0DA 2WYUA 3X0DA 1KOJA 1MRSA 1PWHA 1TJ3A 2A9PA 4JBIA 1OFUX 4PE5B 1KERA 3LPLA 4V0NA 1IVSA 3T3NA 1A1VA 4Y9SA 3FNBA 3IV7A 1BNCA 1U5CA 3VYVA 3VSBA 2A0FA 1T10A 2HPHA 2YV5A 2QTBA 1JG4A 1LF5A 1N2ZA 2Q3BA 2RB4A 2VBGA 4FDTA 2ZJZA 4JBXA 4LVCA 3T35A 3CBQA 4D8XA 3A2NA 2ZT6A 3VV2A 4D82A 3KZMA 3DAGA 2AI2A 4JC5A 1ORTA 2QYHA 3WB1A 1O8CA 3RVOA 2BMJA 2GZDA 3K4QA 4BOYA 1EX1A 2PS3A 1VE3A 1KK2A 1RXCA 2VXYA 4EB8A 3OLVA 1SPXA 1ZINA 4FNMA 4C1NA 3X1DA 2NO5A 3IP1A 1JR3E 4NV1A 3UT6A 4EX7A 5JXJA 1OB2A 4HDRB 2JZNA 4LXXA 5FADA 3WAGA 3PDIA 4NL4H 4QREA 2O8BB 1AKUA 1JLHA 4QUDA 1NG9A 1LQ2A 3KT0A 5D6NA 4J0CA 2IYWA 3TQRA 3OTOB 3LGXA 3PFBA 5ALIA 1E1RD 3MJEA 4YP5A 3C7AA 5EMHA 2O1XA 4NJEA 1D4OA 3AEKB 3B8HA 3MMNA 4W8OA 3N9IA 4BZZA 4XWOA 2XUQA 4MIOA 1CERA 3E15A 5CURA 4JZKA 2B36A 2NTNA 3P9PA 1PGPA 2ZUCA 3R5HA 5DXJA 4D3SA 1OBFO 4Q4JA 3S7TA 3I9MA 3ISTA 5IMBA 3D2LA 3IIMA 5FORA 5IW8A 3UK6A 3ZBQA 4IPTA 4YRRA 2COKA 3B60A 1WTCA 2PMKA 3JQ6A 4X6UA 3SLRA 2ZWAA 3PDWA 4ZMRA 4JJKA 4OQEA 2PKYX 3AB7A 1MEOA 4X1OA 3HJGA 1Y7PA 5CM8B 4KFTA 2GTIA 1U28A 2OORC 2QRPA 3LP5A 3SQLA 3Q2OA 3EK2A 1YBVA 3FUUA 4J0EA 5AJHA 4GKJB 1LBSA 4ZEOA 4FX2A 1P29A 1YVDA 2G0TA 1Q3HA 1TO1E 2QK4A 5LQNA 2GN0A 4PBSA 3GPLA 1YQEA 2AOWA 4J1TA 1Q2UA 3BGVA 5BRAA 4PLCA 2M6RA 3NCTA 2NQ8A 4BASA 3IKVA 1E1QA 1Q7CA 1YBMA 2QTZA 3BRSA 4KN6A 4EJFA 1GR1A 1V96A 1Z2PX 3F5QA 5KUTA 3PUKA 3GGCA 2GPYA 2XI4A 3D4LA 4AS1A 1VCHA 1GT6A 1OLXB 1BMQA 2H5IA 1W29A 2HY7A 5AXBA 1QE5A 1T3GA 2BR4A 1QWSA 4GKBA 4Z7JA 3IYLW 4EGJA 5FNVF 1W52X 3AFMA 4DUPA 3PHHA 1TUBA 2H4ZA 4C0QC 1GL6A 2DY0A 3CRRA 3NEAA 1QLWA 3FCOA 3SWWA 3HJHA 4C9BA 4DV0B 4TS9A 4MR7A 5D51S 1P1JA 3F8WA 4J9VA 1ZHHA 2GYVA 4QEKA 1EZ4A 2GN8A 3IP5A 1EP9A 4UMFA 5CYFA 4ZRDA 2IS1A 4WHMA 3AKYA 1Y3IA 1PEYA 3A1UA 1ZJ5A 1H6AA 4QJIA 3VR2A 4C3ZA 1O96A 5JD6A 3KKQA 4BLUA 3MCWA 3IVCA 4QBIA 1XCPA 3HLTA 2W0SA 4N3BA 3O3OB 1P1RA 5CUQA 5EMKA 3E82A 2VRCD 2XZPA 4BFTA 2IITA 3EFOB 2ZG6A 1J0DA 2QL9A 3HRKA 1WLSA 4GKVA 1CKEA 2N42A 4LV5B 5E4FA 4ABTA 4G0ZA 3TIVA 1EJ6A 1ONOA 4IQ8A 5BN5B 2VQ6A 3LA6A 4B3FX 1CNEA 3IEMA 2YMQA 3IODA 4A0FA 1Z6AA 2DPGA 2JI9A 4O0MA 4MINA 2MYTA 2FN4A 4DZZA 3H1AA 2DY1A 2J3HA 2CMKA 4MQEA 1ADBA 3VVLA 3BFPA 1T5HX 5HW0A 1SKUA 4LE0A 1FYEA 1C50A 1MW9X 3H2ZA 1SIUA 1WCYA 2LKCA 4H15A 4AYXA 2I78A 4QPZA 2PSHA 3DZKA 4J0DA 1V3QE 4B4KA 4BLVA 1WDWB 5EC8A 1FMLA 1IFXA 2ZRAA 4GNRA 1MPTA 2ECOA 1SZJG 4P5DA 4BJHB 1J42A 3R8XA 2TMGA 2LE0A 3SR0A 4E07A 2GZ1A 2VDUE 2DWOA 1SQ6A 5KNBA 1PP4A 1EXDA 1ZOIA 3VMFA 1RDFA 4D2IA 4CLRA 2HA3A 3CKYA 2NZYA 1JHQA 4LDJA 1H22A 2GYYA 3CLVA 4MLCA 2FKNA 3CPJB 3GCDA 1T1JA 3RKUA 4TWAA 1F0KA 5LDHA 3P97A 5JWOA 3VDQA 2P3QA 1V37A 1LD3A 3DA8A 4YGXB 4HS4A 3S55A 5CLLA 5CP8A 2KI5A 3QEJA 1P7VA 2OBBA 4Q4HB 3VPDA 1VI6A 1OH6A 2J3EA 2V7QD 4OMCA 1KE2A 1UXKA 2CCKA 3SBDA 1M74A 3UENA 4HN4B 1E94E 5CH3A 4TGLA 3AYZB 2FXIA 4F85A 3PGLA 1XVTA 2AB0A 4QAJA 1AU9A 2XB6A 5DU2A 4CKXA 4QOSA 2VAVA 3ABIA 3FLMA 5B57C 1FRZA 4TVOA 1GAJA 2I1LA 1MVOA 1OWMA 1UWLA 2A14A 4Y2VA 3EBOA 1PK7A 3W1WA 3DAOA 4R1MA 1Q7TA 4WX2B 2R6AA 1Q3TA 5CH5A 1TKRA 3IDOA 1Z0ZA 3C3YA 3P4UA 3RCBA 4PU0A 1X92A 3DOFA 3MG9A 1FQOA 4L9RA 1XF9A 1N7HA 3NKLA 1R0SA 2J3QA 2NGRA 3N74A 4J7XA 2PYIA 4E6PA 4EKEA 4QTTB 2D7DA 4AURA 2GJAA 4I1IA 4ZJYA 1IZ7A 4TSFD 2QVBA 4R0NA 4H4DA 4X6XA 4B09A 4LRSB 1UAYA 3OJEA 1KP2A 3F6YA 3RSGA 3F6SA 1GG5A 3DWGA 2D7JA 3I8XA 5LM3A 1RSZA 3BE4A 1NE7A 3I83A 3OP1A 4N40A 5KIAA 4WUVA 1EI9A 2G28A 3A36A 5EHZA 3TYXA 2EF0A 3N7UA 4BN4A 2CK3A 2Y9MB 1NM5C 1R66A 3CHYA 3D7NA 4FFDA 4HH4A 1ORRA 1Z75A 5JCOA 3ON5A 4MGEA 4P3KA 4Q39A 2E49A 3MMSA 3H4VA 4QYTA 5DGXA 4Q24A 4AQ7A 5CB4F 1N2GA 1KC3A 1ZA1A 2GZAA 3F6RA 2BBWA 2HQOA 3FSGD 2V8BA 3SD7A 1UUFA 1G8HA 5HF8A 4NSNA 2ZJ5A 1NQ5A 1PJ3A 1S4MA 2CBGA 4JNCA 1RKBA 1ZKDA 4N01A 4KXLA 1T2AA 1EFRA 3CX6A 4BP9A 2E48A 4FOSA 1CEEA 2F3RA 1V43A 4ECAA 2X42A 4EA9A 1UBNA 2ZWMA 4LTDA 4EAAA 1MB9A 5JG7A 2PIAA 2A3RA 2X3UA 4R1LA 5I7UA 3I5XA 4AYTA 1U80A 4ZRNA 4I1SA 1NMEA 1QKJA 1XYGA 3TIXB 1N34B 2LD4A 2X1HA 2XUZA 3L7LA 4H6WA 3KVRA 5DX8A 2XADA 4DCPA 3VKGA 5BR8B 1G4AE 4A2WA 2ZZNA 4N3GA 4FW8A 4KMRA 2JLQA 1CFZA 2AE1A 2PWBA 2Y71A 3DSRA 3CT6A 4HEQA 1RYZA 4RXUA 3QE9Y 3IAM6 4PLFA 1U3DA 3NBXX 4CG1A 4KK3A 1PK8A 5C3UA 1T4GA 1OXMA 2HFJA 3G2IA 4OXRA 2C4KA 2XVXA 5CIWA 5B1YA 1W1WA 1YZLA 2IDJA 3B9RA 1EXVA 1G3IA 3QVXA 2C5HA 1XLTC 2PZFA 1QNFA 2WIDA 3L8CA 4QXRA 2V7WA 1KPGA 4IZHA 1QZUA 4HNSA 1G6OA 2FRXA 3QNUA 2VP0A 4HTAA 4KLZA 2OUKA 5JMTA 1Y1KE 4HWTA 4DB4A 1DBRA 2I99A 1ITZA 3CT4A 1G5TA 1XZNA 1M5UA 1CVLA 4Q9NA 4BVLA 6YASA 1DIHA 2HZ7A 3QXSA 1RM4A 1ZC3A 2Y66A 1D2AA 1NR7A 1IE3A 2OV2A 4ZFNA 4ZJPA 3NMUF 4JOQA 2EU8A 3W05A 5H4HA 3FTPA 5JVDF 2WT9A 4OQ4A 5CDSA 4ZQEA 3E2PA 1F0NA 4DXDA 3VSEA 3CLTC 2HL6A 2BBOA 4GNKA 4WCVA 4Z7NB 1NN0A 3IT2A 2G0NA 4GQBA 3JZMA 3GI1A 5SZKB 4C3UA 4F8EA 2WMNB 3HXMA 1R5OA 1LZKA 3GA7A 4HNAA 3QBVA 1F20A 1VI5A 3ZXXA 2CNWA 3CX3A 1UF9A 4JXJA 2ZTUA 1JHMA 4OIFA 4YUWA 5JSKA 3BL6A 1XZBA 2QRUA 1Y4ZA 3E7PA 5JOQA 1G8MA 1SUSA 3UTCA 1B26A 3TPZA 1NDQA 4M6WA 1GKLA 2P3OA 4JJEA 3C8ZA 5DEOA 3PB3A 2ECKA 1Q77A 2P0AA 3BSYA 3PFKA 1H1DA 3AXTA 1TW3A 2DBVO 3H2JA 1RRFA 1R3DA 1ZD1A 2C1ZA 3PWZA 4O02B 4LSMA 3CJRA 4FYYA 4R2IA 4GVXA 3UWSA 3C5HA 4G4IA 2HLPA 4OHRA 5CVDA 1G1MA 1VHTA 3GLIB 3ICEA 3VNVA 2NADA 4QBKA 1JG3A 3IT0A 3T9CA 2POQX 1U8YA 3T9BA 5JWHA 2I6UA 3O1LA 4CFSA 3DH0A 1J07A 2P30A 2C9OA 3BRCA 1JRLA 4IIBA 5TY0A 2NXWA 3NFRA 2WSBA 4OHYA 4CEJB 2NUTA 3U7QA 3TGWA 1R4MA 4IDDA 3D7MA 4XVQA 2BUAA 3JQGB 3Q0TA 2O07A 2I71A 2BH9A 4HWGA 3TN7A 3UPUA 3W5CA 5MGNA 4D9CA 1HXHA 3V6MA 1N32B 5F21A 3GQBB 2JBAA 3FIUA 1BGWA 3G0DA 3N6XA 2WLSA 1IL0A 4ZMBA 3OJWA 1U6KA 4H6XA 4R71A 4RO0A 4JHLA 4DYHA 1IDOA 5EJ4A 3V7WA 1EVEA 1XGKA 3ZJ5A 3F5SA 1BMTA 2BM0A 4GQAA 5HMLA 4RVNA 2GHIA 3CUUA 3KR2A 2E4ZA 3R3YA 2YZGA 1B00A 3O6VA 3OTHA 4L5IA 3F5MA 5BNWA 1AK1A 1XVIA 2HHAA 2XEXA 3N2GA 4NMWA 4XJXA 5A62A 4GHWA 5GPBA 1IUNA 1TZKA 2ZBGA 4RU1A 3LWZA 3HMKA 2D2EA 4L5BA 1Z4OA 2ZR0A 3UB3A 5EKSA 3R23A 2Q4BA 3M2PA 3G49A 4UOEA 2LUOA 4GOOD 3OPXA 1NYRA 5EWLB 1CUAA 1G21A 2W4IA 4K5QA 2X4IA 4DGSA 4Z4FA 1EH5A 1N0WA 1VJGA 2EFEB 2PEZA 4UM9D 4DUYB 2BISA 3VR6H 1O6FA 4BTVA 3R3JA 2ZIGA 2F4NA 3V1LA 5JATA 4X65B 1J23A 5JNRA 1P17A 5TSDA 3R3SA 4ISBA 2FUNB 4QOHA 5DE3A 5LQKA 3SX2A 3K0FA 3LYUA 3T5BA 4JB8A 4KHZA 1XSEA 5EG5A 2Q2VA 2W6MA 1OBVA 4DWVA 1IIRA 2D4HA 1PL7A 1W4AA 2NW6A 2PG3A 3NTLA 1URPA 3EE6A 4ID9A 5HSGA 4ZOLA 4R8MA 3CF4G 1IG3A 1AN9A