The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
88
|
sequence length |
271
|
structure length |
271
|
Chain Sequence |
b'GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
NAD-dependent protein deacetylase sirtuin-3, mitochondrial
|
publication title |
Seeding for sirtuins: microseed matrix seeding to obtain crystals of human Sirt3 and Sirt2 suitable for soaking.
pubmed doi rcsb |
source organism |
Homo sapiens
|
molecule tags |
Hydrolase
|
total genus |
88
|
structure length |
271
|
sequence length |
271
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature |
ec
3.5.1.-: |
pdb deposition date | 2015-08-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02146 | SIR2 | Sir2 family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | SIR2/SIRT2 'Small Domain' | SIR2/SIRT2 'Small Domain' | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | TPP-binding domain |