5D7NA

Crystal structure of human sirt3 at an improved resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
271
structure length
271
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Seeding for sirtuins: microseed matrix seeding to obtain crystals of human Sirt3 and Sirt2 suitable for soaking.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
total genus 88
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 5d7nA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5d7nA01
1J8FA 2Q27A 3ZG6A 2EZ9A 1V5FA 1ZPDA 2C31A 2Q29A 4MPPA 2H4FA 4GG1A 5MFZA 2A1TR 4QELA 4BVFA 2V3WA 4KXQA 2VK8A 2W93A 2EZ4A 3RIYA 4K9KA 2H4JA 4KPUA 5DGDA 2OD2A 1Q1AA 3F6BX 5IMSA 2JI6A 5BWOA 1BFDA 2X7JA 4FVTA 4GPEA 2H59A 3U3DA 2AG1A 4RMIA 3CLSD 4UTNA 2OD9A 2FWNA 1DJLA 1T9AA 2UZ1A 3IAFA 5EJMA 4O8ZA 4RJJA 5K2OA 3FSJX 2A1UA 1YC2A 4UTZA 4D5GA 4BN5A 4BVBA 2VBGA 5EJAA 1T9BA 4D5EA 4BV2A 1YI1A 1SZCA 2H2HA 1E3TA 4TWJA 2BRUC 4L3OA 3GLRA 4J16C 4K9OA 2OD7A 4BVGA 1PYDA 5BWNA 4F4UA 2IHTA 1OZFA 2FSVC 3FZNA 4RJIA 2QQGA 1QPBA 3CLRD 3LQ1A 4FEGA 1S5PA 4QPZA 5EJ6A 1JSCA 3JWPA 1YTLA 3IAEA 3PKJA 2OO5C 4K9MA 3HWX1 2QQFA 5EJ7A 2WVGA 4C7BA 2Q5LA 1Q14A 4JU9A 1YNOA 4JUCA 1PTJC 1U28C 2Q5JA 1MCZA 1YHYA 4FEEA 1PNQA 2H2GA 3ZGOA 4JT8A 2PANA 4K9PA 3U31A 4BN4A 2EZUA 2HJHA 2FR8C 1Z8NA 4JT9A 1U31A 2IHUA 4RMGA 2AG0A 2NXWA 4C78A 4JU8A 3GLSA 4Y6QA 2OORC 1NM5C 5D7NA 2PGNA 2IHVA 1V5EA 1YI0A 3F6EX 4IG9A 3PDHA 1M2JA 2H4HA 2WVAA 2FRDC 4ZP1A 3PKIA 1Y9DA 2H2DA 3K35A 2JI7A 4JUDX 4UU7A 5MGNA 4UTXA 1N0HA 2VBIA 3D81A 4UTRA 4V1CB 2JLAA 4K9QA 4MPJA 4X3PA 1SZDA 5BWLA 1OZHA 3CLTD 3EYAA 2PGOA 1OVMA 1O96B 1M2GA 3CF4G 4GM0A 4COKA 4HDAA 3RIGA 2JI8A 4JUAA 1PO7A 3EY9A 1UPCA 4L2IA 2Q28A 4BVHA 4ZZIA 4GM4A 4X3OA 4UTVA 4G1CA 4F56A 1O97D 1UPBA 4R8MA 4V1CI 2FN3A 2VK1A 2WVHA 1HZZC 2H2IA 2JLCA 4JSRA 4RMJA 4BV3A 1U2GC 1M2KA 4IF6A 1T9CA 1YBHA 4GM1A 4J1TC 5MFPA 5AHKA 4RJKA 1EFVA 1EFPA 1MA3A 5EJ8A 3ZGVA 5K3SA 1Q6ZA 5K6TA 5EJ9A 1POWA 1T9DA 1U2DC 2DJIA 2UZ1B 1YHZA 3CLUD 3GLTA 1Q17A 4HD8A 5DEIA 3EA4A 4IAOA 3JR3A 2JIBA 2JI9A 5EJ5A 3FLMA 2VBFA 2NYRA 4MQ5A 4V1CA 1UPAA 1XLTC 1D4OA 4UUBA 1PNOA 1POXA 4BVEA 3HWWA 5FYQA 4KGDA 4FZ3A 2Q5QA 2Q5OA 4UUAA 2VJYA 2EZ8A 4RMHA 2EZTA 3OE1A 5K6RA 2B4YA 1PT9A 1OZGA 4TWIA 1M2NA 4BUZA 4JUBA 4GP9A 1ICIA 1S7GA 3GLUA 3D7KA 3E9YA 5MF6A 5FEMA 4K9LA 4Y6LA 1M2HA 1PVDA 4MZXA 4Q9DA 4JUFA 1YC5A 3D4BA 4UU8A 1PI3A 4MPRA 4JD5A 5DGTA 4I5IA 4QQ8A 4Y6OA 2H2FA 4K9NA 5EJ4A 2VK4A 1V5GA
chains in the Genus database with same CATH superfamily
1WB5A 1FBTA 4H2DA 1PGQA 2OZKA 2WT8A 4AMZA 2XMPA 3P4UA 2BGLA 3LD9A 4YA6A 3TCKA 5BQXA 2HNKA 4PO1A 3B3QA 2QS9A 1J0XO 2EIXA 4UUMA 1RIFA 2QMYA 4O1IA 2BWJA 2ZJZA 5HIMA 4AZ3A 4B33A 5DX0A 2ZRIA 4OUDB 3DOIA 1MOPA 3DR5A 1UMKA 4OM7A 1XAGA 1RAIA 1YWGO 4UTNA 4OQZA 2JJMA 2ODQA 3BBPA 4CKCA 2XNHA 4ZALA 4MRMA 3RYIA 3ET4A 3NQ41 4O4LA 1Y5LA 3I5MA 1OH7A 1UINA 1BROA 4QLOA 3BK7A 1NN5A 2WKWA 3JZMA 3PA8A 1FYVA 4Q3CA 2RH9B 3VMFA 3IAUA 1K4YA 2XITA 2BP7B 5DN6D 1F5NA 2WIJA 3WGKA 1QZ3A 3X1MA 3JVIA 4TT3D 5F2NA 5MN5A 1CQJA 3R1IA 5FI3A 3G7UA 3ZJUA 1YJBA 2OXCA 4PGAA 3OY7A 2XUKA 4BO3A 3QVMA 2B8TA 4EYOA 3Q9UA 5BSGA 5H16A 3GRZA 3NHWA 3FVQA 1O54A 4R8LA 1Z73A 1ZVVA 2PZJA 3WIBA 3M34A 3WL7A 1WPGA 5EFOA 1DC4A 2IHNA 1V1MB 2C99A 4EB6B 2QXYA 3DXZA 4WOCA 4QFDA 5H5JA 4ZO9A 1OY1A 3TZ6A 4XWWA 1AB5A 4MULA 5F7ZA 5MN6A 3GEMA 3ZDAA 1SXQA 2CLKB 5BV0A 1UBLS 4X1YA 1KFEB 1GFSA 2X0IA 3GMTA 1J56A 2XODA 3PNSA 4KXLA 5F2OA 2BGUA 3PX7A 5J40A 2VTBB 1NRWA 2I1LA 4J0QA 4NCHA 3VGPA 1ZI6A 2MOKA 5FTJA 2DQYA 4K9QA 3M5PA 3TW6A 4I1RA 3HJRA 3L43A 1G5RA 3TOZA 1DZIA 4I8IA 2QIOA 1E0AA 4R2MA 5BW8A 4H7HA 2ZJFA 1NLMA 1T8TA 3RUDA 4DCPA 2JFVA 1FLAA 2C07A 1VE3A 2XVAA 3CX3A 3NWEA 4FB5A 2JKZA 4MDEA 4B3GA 2QAJA 5JHHB 5ELLA 2NU8B 1R6XA 3CVOA 1EIZA 3H13A 3DL2A 3KZKA 3TBFA 4XUDA 4NXNB 1UKAA 1WXWA 2JFUA 3AX6A 4MCAA 1RSZA 4DLVA 4RD6A 4P82A 1QUFA 2WD7B 4PXAA 2FFQA 4WJLA 3TF5A 2G0NA 4GX0A 1ZVMA 1C29B 1ZW6A 1QH8A 1W8IA 1JQAA 1QM5A 1IY8A 2DJIA 4D9FA 4DW8A 2OGZA 1PZEA 5EIOA 2O8CB 3ZV3A 4J2HA 1UK7A 4KKVA 4RZUA 2A8YA 4K6HA 4ZT7A 1DKLA 4O4IB 1D4OA 3P9IA 2F64A 1U4NA 1EFRD 3VSDA 3SXUA 1MABA 1T43A 1XZMA 1V7PC 3ABZA 1XYGA 3HYRA 3OIGA 4RH3A 5U4XA 3TZEA 5EZ6B 5TF4A 4DREA 2ZYHA 1EBUA 2PMKA 4W9NC 4TOIA 3JRWA 2O3RA 1FDRA 4FFMA 2VSXA 2AJDA 4IXNA 4N5LA 3THWA 1ICIA 5IYZF 1E99A 1CP2A 2XAAA 4NYJQ 4HEA1 5D3QA 4LC0A 1A7AA 2B8WA 3FOAA 1NZFA 1CUIA 2ID7A 3D6MA 5A0FA 2Q6VA 1I7DA 2DC1A 2PUDA 3ICEA 2FW9A 1JZSA 1KRXA 3PC3A 1DAKA 1YCHA 3ZY6A 3PE3A 2P67A 2Z8YA 1ISFA 4IKPA 2ZBQA 4MI6A 1R5NA 5ULLA 2OUIA 3DM9B 1X8XA 1NY5A 2A1TR 5FBQB 1E6CA 4CV0A 1QTQA 2ORED 1HE8B 2ZEJA 2WUVA 2GEUA 2P40A 2YV2A 3TZCA 1VJRA 2HQBA 4E5SA 3VYWA 2JEYA 2PFSA 1B6RA 4YWHA 2EFJA 4KIWA 3M6LA 1ZEJA 4LXYA 4GE3A 3TJRA 1QPGA 3L6RA 2BEWA 2BRUA 1MJGA 4ZO8A 2NO5A 3UAGA 2PGJA 1E6LA 1I4OA 4Y8VA 1FNDA 3UA4A 2V03A 1Q7RA 3RROA 1SZCA 3U39A 4LKOA 5D5PA 3TIGA 3EUEA 1ECJA 1WXEA 2CE2X 4P3PA 1Z5NA 3HJTA 4NAUA 1XU9A 2PX0A 2ZIAA 1D2EA 4RF5A 2Q8NA 2ZRNA 4PINA 1WB9A 5SZJA 1PNVA 1P72A 3BL6A 4KFCA 4KNYA 2DH6A 2JZNA 3Q8WA 2HRDA 3HP1A 1T25A 4KX5A 4EKNB 4EM6A 3FRJA 3BF8A 3GA0A 3P2JA 3MGAA 3IH5A 3QLUA 1U8ZA 4BDTA 1SK9A 4AQ7A 3CVYA 3FGPA 1LQUA 4F3NA 1DG9A 2W6MA 5L3QA 3JRNA 4FWTA 1SVKA 1MQSA 3IELA 4R2JA 4QULA 5HS6A 1EXWA 2A3RA 4BMNA 3ZHBA 4R1SA 1GAJA 2I3ZA 1PJBA 3JQFA 4O29A 4P36A 4RADA 4DG5A 5CA0F 4AJPA 2DUUA 3G9QA 2HTEA 1XA3A 5KDDA 3H84A 2P9QA 4X71A 5CG2A 2FZGA 1C3LA 1IJKA 2P3QA 2GESA 3MLBA 3FFWA 3QF7A 1W5EA 5DGXA 3UJHA 5TB5A 4D4GA 4AWBA 5JADA 1C14A 1GGHA 4P92A 2B34A 3G17A 3GU3A 2K2QB 3JZAA 3Q3CA 2WJGA 2OQVA 2A35A 1KKMA 2AXNA 2C1EA 1QH8B 3SZRA 1Z8FA 3KZXA 4TVOA 5HE8A 5LB2A 2R87A 1C3OB 2F9FA 2H00A 2JAWA 3B2EA 3DTVB 3EVNA 3OC6A 1KP9A 4PCUA 3TSOA 3WLJA 5JSUA 1HDGO 4FMDB 5DJ5A 1RKUA 3G2JA 2J0UA 3V55A 4Z5XA 2B2NA 3OPXA 3DE0X 3N2NA 1W0KD 2ZRFA 1O7JA 3K0AB 4B34A 3ZGVA 2ZYGA 5I4CA 2ATCA 2X23A 3GQBB 4GKJB 1YL5A 1DUIA 2PY6A 5A4JA 4QX6A 1FLDA 4MK4A 5DOZA 3I0ZA 3LBNA 1X8LA 2O5EA 2PFGA 3CURA 5TVGA 4KR3A 4KK3A 2IEDA 3E5NA 1JJAA 3X1DA 1GZUA 3DQPA 1Q1ZA 1SNYA 1WV0A 1MN6A 1IHUA 2YWFA 4KGDA 4Q03A 1XRJA 5ETJA 5FNZA 2G9VA 2Q6TA 3DNFA 3IKLA 4UJ5A 3RQSA 3EPJA 2EZ8A 1RAGA 3PD0A 5GVSA 5JDIC 1UDCA 1G7RA 4RTRA 1X15A 2I6SA 4R9VA 4IVPA 3MTJA 5FEMA 4FHEA 4DV0B 1XWFA 3LECA 2F7SA 1GSOA 2JRCA 4X9XA 5FB3A 2IVZA 3SC2A 1KTIA 3O84A 1X42A 1DWUA 4UFNA 1XMSA 3RUCA 3MUOA 3SN6A 3S6JA 4Q3BA 4UDOA 2YWEA 3CPHA 4YLYA 2OESA 1HT1E 4YN3A 3CNEA 4IH9A 3SICE 3T38A 3I61A 1TECE 1H9AA 3ENZA 3ZI7A 4QUEA 1T2UA 1V3QE 3MJEA 2Q5IA 2LV8A 3DJYA 1ESDA 3E8SA 1L5ZA 5IARA 3F67A 5PNTA 1R5JA 3GLGA 2H1WA 2GK7A 4ZWNA 5LZ8A 3Q8XB 2R85A 3SEQA 1L6RA 3K9WA 5K45A 4E2WA 4MP8A 3RFUA 1IM2A 1D2CA 4WKBA 5K2OA 2IJGX 2FPIA 4AAYA 2XI4A 3BUSA 2YINC 2DT8A 1VL2A 3FOEC 4R6XA 5CRIA 1UBJS 1OXSC 4LF4B 2WQ7A 1Z5GA 2AMVA 3PWSA 1OXUA 1RWPA 1PQWA 1A2BA 4OHRA 3I2HA 1A5SB 3AETB 2QN2A 3FY4A 3MJFA 1AQYA 1EUCA 1YUNA 2JGLA 4I8XA 3SIRA 4HFMA 2C2GA 1SG6A 5DM4A 5ALMA 4BJ5A 2HF2A 2PZMA 2JVKA 2WQ6A 1V4VA 2PZAA 3TL6A 2Y92A 3ZS8A 1DPFA 1HE4A 1P1IA 1RHKA 2B7CA 1A8SA 3E4DA 3U17A 4H59A 3V9PA 1EVEA 2XHZA 4DAEA 5EHIA 1SHUX 4LQLA 4DUZB 4ZXFA 4JCOA 5F2EA 2RK4A 3K0FB 4JX8A 4MYHA 3W0LB 1RWBA 3WO0A 4JB3A 4B31A 4E6EA 3RFVA 2ESRA 1T1SA 2ECKA 2EP8A 4W7HA 2MCFA 1Q77A 1DAMA 4R5HA 3EXFA 2BW0A 3OHSX 2H4HA 4X6LA 4PV7A 3I62A 1O3YA 2L17A 2Z0MA 4BDSA 1SVNA 4HPJB 5JTTA 3N8GA 4FILA 5ALEA 1MJFA 1R8QA 3I6QA 3MT0A 1W4BA 5JYCA 3JZIA 2VYVD 3PZRA 1QK4A 4IP0A 2PIDA 1YQUA 4NCJA 2E21A 4G65A 5DV9A 3MGKA 1LRKA 5JS6A 5I8ZA 4MLZA 4AX8A 3CZPA 2NV0A 4PX2A 5HKKD 1O2DA 1WBBA 1DZ3A 2C7VA 4EB6A 4G5QA 1V8FA 3VTKA 3HXKA 3U4AA 2A0XA 3BH6A 2FP4B 4OBBA 5E6RB 3RNOA 2ZRPA 4Y2TA 1MT3A 3OJOA 2AQIA 3A4LA 5DK4A 1V37A 2V8BA 5KWSA 2JFHA 5CDSA 2B30A 5DB4A 2OZPA 3ZI4A 1VZ2A 4B76A 5DRTA 1QH0A 1NRXA 2PEYA 2DMRA 1WCIA 3RU7A 1HFEL 3CT4A 1Z5PA 3BHJA 3KE9A 4Q82A 3LUBA 3UW3A 1R6AA 3DC2A 3P32A 5J4VA 3ABOB 2XNSA 2AYZA 5FHQA 4BNKA 4XM0A 4W5RA 4L8LA 3B38A 2VG8A 2ZI5A 3GGOA 2G1UA 3CF6R 3ZWPA 4I1PA 2FMKA 4WMLA 5IUKC 3WHPA 4CGZA 4K81B 2FWRA 1UXGA 1LUAA 3EIOA 4PXSA 3AM3A 5E2BA 3UPDA 1O1YA 1QB7A 2EOAA 2H3EA 2XMZA 3QLUC 4BL5A 4ZIRA 1MG0A 2XUGA 4GYJA 1SIWA 1Z25A 1A77A 2VOEA 2WWGA 4CKZA 4W9MC 2XT6A 1GAWA 5AM5A 3RU9A 3TVDA 1KZ4A 3Q3VA 2B0JA 1DPGA 3MJHA 3N2LA 4NARA 1G21A 1VRVA 2J0QA 4ZARA 1NBOA 5DWQA 2YHIA 3IQZA 1J39A 4P7GA 1XLWA 3ZWMA 3K9QO 1ISRA 2QRMA 4O2AA 2X14A 1Y33E 5IYZA 1DDGA 2Q3FA 2QLFA 3OLVA 3PGA1 1MLDA 1MV8A 3M4NA 4B7ZA 3MCUA 2HT1A 3UAXA 1SUEA 2ID4A 5JFOA 1GSAA 3F97A 4O2BA 4MWEA 5ALUA 4RO0A 1XDGA 4DB2A 3BILA 2QTLA 5TT1A 2I4TA 4NULA 3ZDQA 1CBUA 4ZDKA 2RIRA 1CUXA 3IMFA 3U4CA 4JB8A 2FWAA 4XDYA 2CL5A 1GU7A 2CVPA 2W2KB 5CLJA 4YMWA 2VDNB 4BVGA 1XX6A 4XM1A 3COYA 1K5DA 1TJ4A 2ET6A 4KQEA 3WX0A 4QG3A 2JGIA 3EPKA 4FEGA 2ZZNA 2EJVA 1UANA 1TAUA 4KPYA 2DVMA 3FPFA 3DFFA 3OWXA 1C2YA 2AFRA 2WVGA 3RK0A 4W82A 2NGRA 3KTAA 4G1VA 3UFXA 1X80A 3ENQA 2RHOA 4B40A 1E3SA 1BDBA 2GZAA 4XSHA 1YB5A 3I1IA 3PQ8A 4NR0A 5BSFA 4A91A 1G4AE 5H0IA 4BIMA 2QD1A 1H1TA 4AG3A 4G5YA 2C00A 1CDEA 1SOUA 4C06A 2DYKA 3NRJA 4W8OA 1ZBQA 2P2GA 4M1ZA 1L4KA 3AHDA 3UMRA 3WWZA 1HTTA 4XPIB 4CDNA 1TPYA 3ISJA 3AGPA 2RH5A 1QE0A 3Q7EA 3QX7A 3HJBA 3IUSA 1NDHA 4IDGA 4L1KA 5AH0A 5SYNA 1CE8B 5JH7A 2HAEA 2ES4A 2NU9A 1RU3A 1W6UA 3DZDA 4LHEA 4FP9A 3TM4A 4KAAA 4B6GA 2ZI6A 1EI9A 4RXTA 4N18A 5NULA 3TTWA 2P0EA 1JDTA 2QENA 3KEFA 1KWGA 3KKPA 3BMCA 5JPDA 3LC7O 2LZ0A 1IULA 4MWSA 1O0BA 1WTCA 1FMFA 3L7JA 3ZU3A 3VNAA 3OX4A 4MCIA 4WDRA 3VUEA 5J47A 3LHFA 3D4OA 2CSUA 2NUTB 4XQ9A 3FVRA 4GOJA 5FWXA 4R8MA 1AO3A 2OCPA 1NF8A 2FRDA 2ZJ5A 3PVZA 3WNBA 3TBKA 2FEWB 3L1IA 2PSSA 4PC3A 1X39A 5P21A 2OKGA 3FTDA 1A5AB 3TVTA 5B5SA 4AURA 2YDYA 4F93B 3R20A 4G81A 2MT9A 1JTFA 3CKLA 1SCDA 1ZNZA 3LMKA 5AOAA 2WZDA 2I99A 1RJEA 3K4PA 2QZZA 1Z37A 4LJ4A 2XD4A 3KEMA 4CMKA 3DWEX 1P2SA 4HYTA 5HIJA 4U3JB 3ROGA 1JN0A 4AZ3B 4Q3EA 2WG1A 1GZ5A 3E84A 2AOUB 1Z7EA 2HWXA 3ADBA 1VL6A 2PG3A 1XD2B 4NU8X 5HDQA 1U98A 4P4NA 4X6YA 1R0KA 3LTNC 3W5CA 2C96A 1SRRA 2DX7A 3C24A 1TM4E 3DOOA 1RE0A 1SBCA 5J9FA 3UJ3X 2G9ZA 4FCTA 4C7OB 4BO4A 2JGEA 1HGXA 1V7QA 5AOCA 4I5IA 5T4FA 3HPQA 4OJQA 1B7GO 4M1QA 1F51E 3RHSA 5J58A 4KC0A 5EJ4A 1E3DA 1JVBA 3TXAA 3H9GA 3SEFA 5CX4A 2DUJA 3K1TA 2ZJ8A 3NHMA 5DOVA 3S7TA 2H1LA 3NH9A 2H4FA 3LS2A 2VJBA 2ZCUA 3DV2A 3X1ZA 2VTVA 1BX3A 3DD5A 4PLPA 4L0DA 2D13A 2X15A 3ELYA 4Q12A 1SCKA 2RI6A 3V1YA 3A6FA 3VX3A 1NVMB 2GXSA 3P0IA 3OTGA 5EHGA 4KPFC 1WETA 3A6HA 1SHTX 1Q0SA 5B2ZA 4YDQA 1IVNA 4QEKA 4FFLA 5JRJA 1E2DA 3ERCA 4OMUA 3VOSA 4C07A 5K0JA 2I67A 1ZX1A 4H31A 1IWPB 1O08A 4JDPA 3VJMA 3N39C 3OA2A 2ATIA 4JP1A 2YYZA 4RD4A 5ENDA 2DWQA 5D1HA 1RIIA 3NEJA 4PQYA 1TVEA 4Q34A 1K06A 4X95A 5T8KC 1W4CA 2CVOA 4XWKA 3CM0A 2Q4TA 3IHTA 4RK7A 4UMDA 2IC5A 4BE4A 2I55A 4PNEA 3C3DA 4G0PA 2NN3C 4RV5A 4NE9A 3PRYA 2JIDA 3P9KA 3C0KA 3PZBA 1U5BB 1LK5A 1NUUA 1SU8A 2DECA 1XB2A 3GFQA 4M60A 1DX9A 2GHTA 3MWFA 4MIKA 4U6SA 3RRBA 3UJNA 2FUG6 2ZYAA 4TYQA 4QLAA 2NO0A 4YJHA 3AC0A 4GFDA 4ZD6A 2WVJA 4RSHA 1GZVA 4MINA 1PR9A 3LYAA 4BGDA 3WBKA 2ENUA 2QUAA 5DMXA 2YS7A 3HEBA 4QJ5A 1V39A 3GYGA 4XIYA 2GJ9A 2HCTA 4YAEA 4HLUC 4KMMA 2PO5A 4HFNA 3CW2A 2IYNA 1BCSA 4URZR 1XDZA 1Y3BE 4L0MA 2QTWB 3MT9A 4PLWA 4TV8F 1GA6A 4AXXA 2NUTA 4F8JA 4QXRA 5IYZB 3MBKA 2IYLD 2E2WA 5IASA 4JWTA 2OBBA 3HYNA 4FYIA 3C5VA 3WDKA 1I5OA 1J6UA 2P9GA 4DNPA 4DY4A 1IB0A 2IZ5A 3UATA 4E5VA 1R0RE 1Q15A 1W88B 4IQ8A 1QP4A 3PXEA 4XDZA 1U99A 4KFRA 4FDUA 4G9BA 2QRUA 1G8GA 4F5WA 1FJHA 5JFTA 1O96B 1Z3IX 3NTUA 3JARB 4RW0A 4W1QA 3REQA 2Q28A 1TZBA 2A5FA 4QE3A 3GGPA 4ZDIA 1D7AA 4J0FA 3ZW9A 1C30B 4B7XA 1Z6AA 4U3JA 1KI4A 4W9RA 2XCOA 3ZLTA 4I9NA 5MGBA 1RZRD 3T7SA 1X19A 5CVVA 4CL2A 1YZLA 3I2GA 4OOEA 4IMRA 3RVRA 1NJ5A 4H1VA 4K9SA 4D9NA 5UKDA 3ZWOA 1Q17A 1NC1A 2WIAA 4X6XA 3H2KA 2KW5A 1P7WA 4LCEA 1VSQA 1NFRA 3QJGA 1JSLA 1QVVA 3VPHA 5B36A 5JDIA 2YZNA 1XTTA 1IPEA 5BQPA 1TJ3A 1MO5A 2XRZA 3LDHA 1M8PA 1XMIA 3M33A 4JLJA 2FFAA 3D5TA 4UCXA 5FOTA 1AB6A 4BMOB 2PZBA 1KQFA 1QRTA 5THXA 3WOHA 1RYYA 3YASA 3KSAC 3OD5A 3PFWO 3QUAA 1UT6A 4M7RA 1AKTA 4S1TA 2A94A 1LQTA 4WLOA 1AKRA 3Q0IA 3EFEA 4UAVA 1GQQA 5GZ6A 5FTNA 2HJVA 3TW8B 3TUZC 3ZEIA 5K3EA 3FMIA 4U2CA 4K9NA 4WSOA 2C8LA 4OHPA 4GXNA 4HTFA 5TPZA 3ROXA 5L8VA 2YOFA 4BC0A 2DP4E 3KJHA 4LYEA 3I9KA 2ZBPA 5C8DA 1IXYA 1OBHA 1QYWA 1SUSA 3EX7C 4NPCA 3L6DA 1ZOOA 1FL9A 5B7QA 2HZ7A 1VG0B 3GCGA 4F9TA 5HS4A 2Z4RA 1Q19A 3ITDA 1MIOB 4S2EA 4TV9B 1SHZA 5AW1A 4FQ5A 4NV3A 2XUJA 2Y1EA 1TYAE 3LBIA 1I1QB 1ZD3A 3TAHA 3NT4A 4OQXA 3V97A 1N9KA 3LY8A 1T3TA 1I6KA 4DMUB 1TW2A 5KVCA 1DXYA 5TE9A 3RU2A 4YMLA 2YMLA 2A0FA 5EKSA 4QNNA 3KQMA 3CO5A 4XD2A 5C46F 2ZIGA 5DTIA 2C9ZA 4QYIB 4OP3A 2J8ZA 4F3KA 2IYXA 5KUTA 4YFYA 4DRXB 1KFKB 3JQGB 4RZ3A 5EZ5A 1EQUA 4BIIA 5IAOA 2YV3A 3AR3A 4UBMA 5IM4A 3D5EA 1DBVO 1MQ9A 3N0XA 1EK6A 3LV8A 5BV7A 4G0UA 2M6RA 3LPCA 1EBFA 4NFYA 1E8DA 4RK1A 4Y2QA 1RHRA 1Z5WA 2OFFA 3SKVA 2ZAIA 1QRRA 1KJNA 2RHGB 5DASA 3RF6A 1P1RA 1RZUA 1IY2A 2BM0A 2X3YA 3A3KA 2Y93A 3CNLA 1P7ZA 1OV4A 5TXGA 3Q6NA 1MC5A 1V26A 1FOEB 1N4DA 4GI1A 4QEZA 3I92A 1ISMA 2CMGA 4WV3A 1C8BA 3SZMA 1L2TA 4YECA 2Q1SA 3OJWA 2R11A 1ESZA 3L7YA 2CNDA 3L4SO 1RC1A 2RC6A 3L7AA 5TS2A 3MJDA 4G0QA 4WAUA 2E4WA 2G72A 3TDNA 3WYAA 1IOWA 1J07A 2NVUB 4WJZA 1AQJA 1W25A 4DDHA 4DPLA 3OG9A 3ZE7A 2XOEA 3FG9A 2WF9A 3CXUA 4C30A 2PS9A 3LVQE 4IV8A 3L7KA 4KTTE 2J0EA 4UNIA 5JWRA 4DV3B 4R6WA 3LXRA 3N3BC 4CVNA 4FGLA 9LDBA 2BL4A 5TGDA 3I53A 1CEYA 1H0RA 5CLQA 5DX8A 4CKYA 5H4GA 4IDOA 4QWWA 1M6WA 4GMXA 1OLSA 4FOLA 3C16C 4AKHA 1UC4B 4ABYA 2HSGA 3BZBA 3U7FB 4UXHA 3COPA 2XXAB 4M87A 1WCYA 1X7WB 2DR0A 3O4VA 3Q9SA 4ZKEA 5J2TA 2JGDA 3F5FA 3ASYA 1BWSA 3ON5A 2J7PA 2VT2A 3ESCA 4QQFA 2QTVB 1KBOA 2VCHA 3P5SA 1CJTC 4Y0NA 2GBCA 5DEIA 4QBGB 1USIA 2FZEA 4D97A 2FQWA 1A96A 2I03A 2JIBA 3AIKA 3EA5A 3TTTA 1FFGA 3T9BA 1O87A 2C57A 4MMYB 2ATXA 1R8YA 3DPUA 1P4HA 1D4ZA 2W22A 1DIOB 3BKXA 1AK9A 1UJCA 2Q6OA 2XGOA 3L5KA 2E4VA 1AF4A 4XYEA 2YOGA 1RC0A 4CCWA 5JCPA 5TMPA 3AERA 3TEJA 4QBTA 1YI8A 3B1VA 4DR5B 1L7BA 1M2HA 1KQ3A 2RJOA 3D7MA 4J07A 4LNAA 5LA6B 4HZUA 2IDMA 4IXWA 1ABBA 1PL0A 2C83A 4FYJA 4GPBA 3W2HA 1NRIA 3M9XA 2WJJA 4G4JA 4OPMA 4PVCA 5T6MA 2Q27A 1A8HA 1XEXA 1P18A 2HDWA 1O96A 2OGUA 1SAYA 2W6OA 2BGJA 3RS2A 1XRNA 3ZYZA 1N6KA 1PHRA 4JJ4A 2PX3A 5IEBA 1CS0A 2PU7A 1W5AA 3VGJA 3KSBC 1YIAA 3EZLA 4C08A 1XQWA 3UA3A 1ZHOA 1QYIA 3UVEA 3U3DA 1DJOA 5DKFA 3C8MA 1EA7A 4ARVA 1ULBA 1WJGA 1JLLB 3O1LA 4NE2A 1DMSA 4R2XA 3ZBUA 1JXAA 4HQRA 4QXQA 2VBGA 2BDEA 1ANKA 1EEXB 2BKLA 1YBAA 2XA2A 3A6DA 3P2IA 3O95A 1UEXC 2CVFA 3FIUA 3Q2OA 4O2AF 5I7AA 4G41A 3ZNNA 2GASA 5AJYA 2D7CA 3KIPA 3F47A 3FZNA 3WGTA 1G8MA 2PZ8A 1LF5A 4FZJA 4DA6A 4H08A 3PKJA 2I9KA 3WIOA 4HNGA 3BRQA 3KQTA 3IT3A 221PA 1JDBC 2HQSA 3IMKA 3L2OB 2YXDA 4GP7A 4YT8A 1EUYA 1D2MA 3SQDA 3DCJA 1ZKDA 2ZRBA 3OFSA 2FI1A 1QCCA 2VQ6A 2VJOA 4OI2A 5BNFA 1TT5B 1EVZA 1FLVA 2GN6A 2ZBFA 3RTCA 3CUVA 2HMAA 4KK4A 5AYVA 2JFGA 3M6WA 2BTQB 4N3BA 1VSTA 3R6TA 3WQSB 1IM5A 4DE5A 1YA4A 2VNSA 2BE9A 3MPUA 5B6IA 1XD8A 4ZCRA 3OZRA 4CQLA 3CX7A 4A15A 3ONWA 3ELBA 1A1VA 3SCZA 4AJIA 2FLWA 3JQ8A 1KC3A 1CC1S 3HVHA 2YWDA 3KJXA 2CBZA 3UB4A 1XNQB 2ASEA 4QUKA 5TIIA 3WOVA 2VDMB 3HEMA 1YK1A 3GDGA 1WCIB 2PWPA 4X1YB 5HPYB 4EIWA 2JCSA 1HT2E 3D6TB 3FUUA 1SCQA 3WJ7A 1AKEA 1BRTA 3CINA 4IQFA 3IT0A 4YP7A 1H05A 3QOYA 2CC2A 1EWKA 3DVAA 4LWQA 5JS1A 2JLBA 2O2CA 4GPAA 4HWKA 2ZIXB 2D7JA 4GPTA 4TUYF 2R7AA 1BHQ1 1C7IA 1KJ8A 1V2HE 2E4YA 2O2JA 2WR8A 2RAVA 1M72A 1KY3A 2JK1A 3GDHA 3MRXA 4V0MA 4EKEA 1P4AA 1NV8A 2JCBA 2OSVA 1BCSB 2PUVA 3K1AA 4IXMA 4WFKA 2PD6A 1CD5A 3B89A 1K89A 4LHXA 2F8SA 4JKOA 3HKCB 1OROA 3FFTA 2C29D 4LFBB 1A4RA 1MRZA 1KC1A 4CQMD 4NYIQ 1P0CA 1TZKA 3DBLA 3NM5A 4CM9D 5I8WA 3AF6A 2R5FA 1GQFA 3X1WA 5HQJA 2ORIA 2GD1O 3H3FA 3VR1A 1QYDA 1V1RB 4NJEA 3DOFA 5HR5A 3SE0A 4ED9A 4UUBA 1CG6A 1POXA 4RVGA 5B58T 4CMBA 3LW8A 4NHOA 4UUAA 5CNKA 2ZRMA 1US8B 3W6PA 3GP8A 2P4HX 1O8CA 4MWGA 1DEHA 1VJCA 1L3IA 1OTYA 5HFJA 3PNPA 1SURA 1GQRA 2JFBA 1O6BA 4FK8A 1CDDA 4OLJA 4TMZA 3TMKA 3EEQA 3CWZA 2QBYA 5AIAA 2C8VA 3D9QX 4JYMA 3E05A 5BYJA 4Q93A 1TZCA 5AOVA 2ZS8A 2ZRQA 3CGGA 5EL0A 3C14C 1OKKA 4KVGA 5DXJA 1Y5NA 2WI8A 2X7HA 4INJA 3OKAA 1G8JA 1M7GA 5DX1A 3ZE0B 2I2WA 2XOKA 4RD2A 3GEGA 1C0KA 1LSOA 1XMPA 3I0NA 3GAAA 2OBYA 4PX5A 5BXQC 1M0EA 4BE7B 3GLIB 1HDRA 4K0KB 3MERA 3JAWA 2JK0A 2KMLA 4DM7A 2AW3A 4RXUA 3TLCA 4GZ5A 1C4WA 3ICOA 4NFHA 5DBHX 4BO5A 2C4WA 1P1HA 3EXEB 1YC2A 1MNAA 2QTMA 4DDTA 2OILA 4UD2A 3T95A 3NAGA 3KELA 2HJGA 2C98A 1FTQA 4BMPB 1Q0HA 1AKQA 1FP4B 2VSNA 3CPSA 2CMHA 3NDIA 2WU1A 3LQ1A 2I1QA 1HDEA 3SZOA 4CL3A 1O95D 3VKUA 3S8EA 1BMDA 3IT2A 4FFRA 5GONF 3CGWA 2JATA 1JAYA 3DEKA 4GMDA 3VR5A 3E9QA 3B6MA 1B8OA 4D74A 1UPXA 1VYHA 3R4VA 1DSSG 2CUTA 1UMDA 1Z12A 1GR1A 2HLDD 2Z5FA 3GRUA 2LTAA 1Z2AA 4YLEA 2ZVJA 3UHOA 2VYFA 4CHTA 3QUTA 3QKWA 5A5GA 2AVNA 4FI3C 5HBGA 5ALNA 4XFKA 3HUDA 4LGVA 2FUNB 4DLYA 1NP3A 2Y1DA 2F4NA 1EEHA 4RMGA 3E03A 1LNQA 1Z0DA 3M6MD 5K51A 4REOA 4EG4A 1L7EA 5FLYA 3RSOA 3F5QA 2BH2A 2FEPA 1P1KA 2VHUA 3I52A 2ZE8A 5D7NA 3RU3A 5LZ2A 3DO6A 3CZ9A 1JUDA 2YZMA 4BNVA 3NMUF 4OQPA 2A9OA 4TTIA 1C7EA 2XV1A 4BNJA 2XUPA 1D6NA 1N0UA 2MTBA 4Z4FA 3F7MA 1ZM9A 5AXDA 3WV5A 1XDSA 2WB4A 2COUA 3QU9A 1V8ZA 4NCAA 3MUFA 2J4DA 1KKUA 1G2PA 2CXPA 2ZVQX 3JQ9A 2PKQP 1IONA 1E2MA 3JS5A 3DHEA 3OZFA 4XYLA 1U3DA 2YN4A 1WKVA 1ETUA 2HU8A 3ORQA 3GFPA 4XQGA 2NXCA 3VM6A 1ZHHA 4XVRA 4BRSA 4D42A 1EMDA 4DCJA 5T6BA 1SK8A 4DNQA 5K0SA 4AKTA 1A7KA 3HA3A 4KODA 4PYNA 2ZB4A 3HCOA 2WTEA 2VP9A 4E15A 1SG0A 2D1QA 4QT0A 2HR1A 2OO7A 3GQVA 4HVTA 3B9BA 1G16A 2PSDA 4X20B 1S89A 4R1LA 3KXDA 4P4TA 1ZH6A 2Q0XA 1RABA 4MGHA 5IT0A 4MVJM 4P4SB 1TVKA 3EA0A 4V0NA 5B58C 3DSRA 2G6BA 1XNJA 3VR5D 3LTEA 5DNCA 1U63A 2VZ9A 3S8MA 2BCJQ 4HGZA 4CTNA 3ETHA 5B64A 1V35A 4D9IA 1Y9AA 2ZJ6A 5FOUA 5EG5A 4NWIA 5DSZA 2QPTA 4ISBA 3N76A 1RXIA 2J4FA 2VPTA 4JJEA 5H9WA 2WV9A 3O0TA 3S44A 2OHIA 1V5IA 3B53X 1JBKA 3CZMA 4HXGA 2XDYA 4BNMA 2ALJA 4YRQA 5HUJA 4ZZ1A 4IO1A 4O3MA 5F98A 2CD9A 4BPRA 2WYOA 3G0OA 2DXIA 2MJLA 2Z04A 3IDZA 1ZU5A 1Y8QA 2W2VA 1N36B 1PR1A 2XXAA 1K0FA 4PS0A 2ONKA 3OT1A 3VJLA 4AMBA 1JX6A 4B3HA 2PLFA 4ER5A 5MF6A 1QO7A 4C03A 1L7VC 1MP0A 4LSMA 3F4BA 2FSGA 2WFAA 1XTKA 5DNYB 2GH1A 4EVQA 3EODA 3WKEA 1ZH4A 3MAGA 4A8JA 3EQ6A 5EZYF 3GW8A 1T8UA 1VE6A 3E8MA 3B8EA 2Y05A 4UQLA 2OO5A 3KUKA 1E2IA 4BMCA 4DR2B 2VRBA 2A33A 2CJYA 3GGCA 4JQZA 4RZSA 2ZYTX 2WJHA 3RKUA 4AKIA 5DYGA 3DEZA 2B92A 3DB2A 1SULA 4JODA 3FF4A 3DL7A 3FE2A 1N6PA 1UXJA 3DTVD 4PX9A 3QELB 4L5AA 2G8NA 4DJJA 1KYIA 3E9DA 1T2EA 4QGSA 5B1YA 4LOAA 3C15C 1JMYA 1FX0B 2I7DA 2OL4A 3H87A 3N86A 3OE4A 3GFFA 3OZEA 4XH9B 3AF4A 2C4TA 1UJ2A 2AG8A 2HA4A 1NE2A 4MI1A 4WDQA 5CG1A 2DT5A 1Y7PA 3W34A 1PQ4A 5L3QB 1J0AA 4LZOA 2WJ3A 3LDGA 4I3GA 2QDKA 3RJ5A 1S96A 1BS1A 4HMQA 2E55A 1K6MA 3PSHA 2N75A 9MHTA 3PLRA 5DDIP 421PA 7GPBA 1TL7C 2IOQA 5YASA 1J21A 3HR4A 1J2EA 4BFLA 4RA6A 1MVOA 3AJDA 4LGCA 2DFPA 2VYQA 4DC1A 4FOSA 3R3YA 4XOIA 4D9MA 4JI1B 3N5KA 3ZDCA 1XEXB 2UUOA 3V3KA 4E2YA 5GVRA 1OFVA 5KO2A 3VZBA 2R48A 5LZ4A 1VXOA 2OHJA 3AHIA 3WYEA 4ZZ3A 3CLSC 3ABRB 3KZVA 5TJHA 3IEVA 3ZU5A 5KTSA 1IBCA 4B3IA 3D0RA 3EVCA 3O4JA 5I47A 4HWTA 1FTSA 1I3KA 3B7PA 4I81A 4MHOA 3JZFA 4JL8A 3BPSA 3PGJA 4CCYB 1H4QA 4RH1A 3PPIA 2I6GA 1WOMA 1LBQA 2XTZA 2VSQA 3L05A 4HH4A 3TRHA 2GK6A 1GTRA 1WSWA 1XNHA 2XE7A 3AKDA 4KMOA 3UOWA 2J9FB 3DE4X 1I0ZA 5DHFA 4M8KA 2O59A 4A16A 5AKHA 1BEZA 2YN0A 3D64A 3LOPA 3IP9A 3E48A 4ME6A 4MA5A 4BZZA 1PF7E 2GBFA 3TDMA 4INOA 1G59A 1J33A 4ZVPA 4NCBA 1PJZA 1EM6A 4NBKA 3E1GA 1AGXA 3BB3A 3A6ZA 4H7PA 4CRWB 5FYDA 1GJRA 1ZD2P 3G0DA 2E82A 5AW8A 4WK6A 5IXSA 1OQAA 2CFRA 4UXJA 1ONOA 3QVGB 4HAXA 2IW1A 2V74B 3VR0A 2X9NA 3D02A 3CJQA 3WI7A 4HWSA 4O4JB 3QJ5A 3GRVA 5IFLA 1SKYB 1WLSA 4JJZA 4ZGBA 1F6WA 2O2ZA 4MVXA 3F96A 4NIMA 3DWIA 2O2DA 3ICVA 1HX7A 3F7NA 3A2MA 4AM8A 1CUVA 4BEJA 3W3AA 3BS4A 3G82C 1Z7GA 1CETA 2VDRB 1YJAA 2HI0A 3I37X 3KJIA 3TAXA 5KSWB 1I7SB 4B83A 2C59A 2PXHA 1DRKA 1YVDA 2NAFA 3BRWD 5AI4A 3ZWDA 1QHNA 3QBDA 5D7BA 1HL3A 5JROA 5KJ1A 3NEPX 1LFDB 1NPDA 1AU9A 2GXQA 1Y9EA 2A7QA 2JRLA 5ARDA 3TOVA 1C3VA 4Q7LA 3SIXA 1J9ZA 4N40A 1T91A 2C82A 1KWKA 3N0RA 1KARA 2JGNA 3G6KA 2VNIA 1RWWA 1JIVA 3C87A 3C8HA 3OSUA 3OQ1A 1IN8A 4LY9A 1CY7A 2B61A 4ZYWA 5IH3A 3R77A 1TA0A 1TC2A 1N5LA 2Y0BA 4RVDA 1L5WA 2LE0A 3G68A 1C7RA 4FBGA 4M53A 1QFSA 1ORWA 3EPRA 4FZ5A 3RUFA 5TDHA 2AHRA 4CDRA 4P4SA 5GAJA 1NOIA 2GKGA 2I3AA 3BWYA 3DBIA 4HWRA 4Q7KA 4JGBA 2VPWA 3N0TA 1LPAB 4EA6A 1PW5A 2RI0A 4MYRA 2GHQA 4QG7A 3A9VA 4B32A 4DIOA 4EQZA 3GLFB 1EG7A 1NUPA 2PH3A 1FVFA 5HMMA 3DZIA 3ZCTA 4BZQA 1CUYA 1FYWA 1E1QD 2H2WA 3G5MA 3O31A 3AUXA 3BWXA 1ZUIA 3NO4A 5KQPA 3SPXA 4DHWA 1X14A 4ENPA 2BH9A 3GEHA 4MVJD 4C7BA 1WUKS 2WABA 1OXKB 4TS4A 3UF0A 4R54A 3R0VA 4FJ0A 2IYOA 2OCGA 4HFJA 3AW8A 3MAAC 2E0IA 1L5GB 1M1XB 3LUDA 1PJ3A 2ZRJA 1DKUA 5HCUA 3WQHA 2HA5A 2XVZA 3FPKA 3SBEA 3L8CA 4ZXPA 3K0SA 1Q95A 1N6OA 13PKA 3L3BA 4B5KA 3WYNA 2PZFA 2P4EA 2PH7A 5F1KA 1HC7A 2FB9A 1Z3CA 4XPIA 4JOQA 3Q8KA 2N3ZA 4L9WA 3PGXA 3FYCA 1KJIA 1TI7A 5BN4B 4YMVA 1D9ZA 1JJBA 3HABA 3R0JA 3JWIA 1Z33A 3Q8LA 1IRXA 4GHWA 4G23A 5K3DA 4RTQA 2G67A 5FPTA 1DIHA 4JVSB 3ANXA 2ID8A 1LNZA 3KKOA 4TXLA 2AFHE 5JVDF 1CUAA 3OT4A 3OURA 5JBNA 4W5TA 1GDDA 4BLVA 3ACCA 4HDRB 1DRJA 2C42A 1PYOA 3ABQB 4DEXA 1XROA 1B00A 1C0IA 3RAJA 4I36A 3MTGA 3PEUA 3NGXA 5D3ZA 2JAPA 4EZEA 2ATEA 4TXMA 1JEOA 2YUTA 5JRZA 5DGCA 1QHHB 4N0QA 5EXPA 5K0LA 3GX1A 5HM8A 3IE1A 3BMXA 1B1AA 3NNSA 4ZGGA 4JLOA 3V00A 3UBTA 1U9IA 1I51A 2X9VA 1JDZA 2F43A 2YWJA 4ZC1A 1V9SA 2BHSA 4G8DA 4O4HB 4QASA 3FUCA 3LP8A 3LVRE 3BQMB 4H3KB 4D8VA 1HZZA 5I7UA 3DWFA 3TW0A 3LCMA 3NXSA 3TKAA 2I7VA 3DL0A 1V96A 1B8PA 2NUPB 4Z7OB 4AZWA 2NSLA 4QGBA 1DAEA 1WD5A 2I8AA 3NR2A 3NVAA 5HG0A 3S1AA 1TADA 3D4BA 4JC8A 4ND6A 1IBKB 3DMGA 1X3SA 2XHEA 3DKPA 4B6QA 1DAFA 4UUNA 2NPOA 4ENUA 3HFRA 3TZBA 1DRUA 2EHDA 2I80A 2W37A 3A1EA 3P0FA 2VAPA 1U3GA 4Q15A 3A9SA 1U0JA 1UBSB 1W5BA 2WWWA 2ZI7A 1TK3A 3GJ8A 2YRWA 4ND3A 5HIKA 2EZ4A 2AKAB 2QTHA 1L5LA 2PFKA 3EIQA 4XWYA 3ZN2A 3ZXSA 5K8JB 1EVQA 1R8SA 2GZRA 2OZVA 4FVTA 2VJPA 1TE2A 3Q9LA 3T3PB 1U2TA 1X92A 1OYVA 4C0BA 4C3UA 3IKTA 4HLUA 2HK7A 4UTZA 1AKMA 1H1LB 3FFXA 5CW2A 5BVHA 5T41A 1PUJA 1W29A 4UAJA 3MMSA 3O7WA 3SHOA 4ES6A 5C8YB 1DEKA 3CNQS 4FHGA 5E4TA 1PYDA 3GCXA 2B36A 1C4XA 2IS1A 3RUEA 1QYVA 3O93A 1AHHA 4RE6A 2EP5A 3UT5B 4E94A 1XR3A 3V32A 4YEDA 5CB6A 1HKHA 3AUSA 3QPVA 3A31A 4IOKA 2AUTA 3VC7A 4YC7A 1W46A 3LZCA 1U1CA 3ZWVA 2PCJA 4OJNA 5FA8A 2FY8A 5GTDA 4BJHB 1LTKA 3HBAA 1C4KA 2AJCA 1NXWA 3SC2B 4CNBA 2YJTD 2VXOA 2AFVA 2J9GA 3VTFA 2LDBA 1ZFNA 4ZTZB 2YN2A 5DYTA 4PYOA 3WP0A 1VMIA 4WK2B 3WTCA 4WK4B 5JJLA 3OOSA 1E0SA 3OIDA 5BMVF 4OL9A 4MR7B 3U4DA 4TYMA 4DIBA 4R5MA 2BFAA 1TYEB 4H6PA 1Z0UA 2RGGA 1RI2A 4IG9A 3LDAA 2FPKA 4HH3C 5DGIA 5EMHA 1ACMA 1N7IA 4YFVA 1JSXA 2IV7A 4Z9XA 4JBLA 2ICAA 4PF1A 1XO1A 5IWAB 2ZDQA 3DDZX 4Z9FA 3WLEA 3I5AA 3QWAA 1MRSA 1HNZB 3PR2B 1LS6A 1GNLA 2ORVA 3DDUA 1QS0A 4RF4A 1VPWA 4LOIA 3ZIAA 2FPRA 2HF9A 3RG2A 5JBQA 1A9PA 1WPXA 4OQLA 5G53C 4Q4AA 3NBYC 2EVWX 4L6AA 4P3YA 3LFTA 2QVXX 4TTJA 5LYJB 3QPDA 1DQSA 1EFVA 4PWZA 1YUBA 1S8FA 2O3QA 3F9CA 4OQQA 2HPZA 2W6NA 4JR1A 1ODLA 2CVHA 3TOSA 2O2YA 3AR7A 5DLDA 3UGTA 2I8LA 4IX1A 5BR4A 5BV2P 5CVTA 5F7JA 3UJ9A 1RXUA 3KR9A 1DHTA 2C7GA 4Q1FA 1HEIA 1QQ7A 2G04A 4YONB 4OBWA 3T7EA 1GILA 4XRRA 3PI6A 2XUQA 2A9JA 2W43A 1N2CE 4DUGA 3HFGA 4E33A 2DZDA 4P0TA 1MC4A 3C1AA 3GA5A 1I3CA 3G02A 4XD7A 2OAEA 4E09A 3VC1A 1EM8A 5CITA 1AX9A 3Q6IA 3QVUA 3V8QA 2O5CA 1GARA 4RMHA 1JPNA 4G4GA 1KAEA 4BFXA 4LXGA 5JW6A 5MHTA 4P2GA 3R75A 3U1BA 4FKZA 1E1LA 4IHAA 3S55A 1GEEA 2H08A 4LY0A 2PA3A 4LXXA 2WOOA 2HWKA 4A23A 3IERA 2VTEA 3QKRB 5GOTA 4BLTA 4C0XA 3HLKA 2JIZA 2P41A 1SC6A 1UBFA 5CDFE 5FV7A 1UAYA 2PXAA 1OI3A 1JQEA 1RWNA 2JAOA 1JR3D 4QFMA 2FEXA 3CO0S 2ERYA 2P7IA 3X43A 3T5AA 3OMWA 1VDZA 1AGNA 1YMUA 1N92A 1GAEO 2BMEA 3CX6A 3VZRA 4GMKA 2QTGA 1XYVA 3PNLA 4RTJA 1QG6A 1VKZA 2IZ0A 3CV3A 4X45A 3N53A 1ZO8A 3L06A 2XB4A 1TGYA 2CXHA 4DBVO 1U2ZA 2VCEA 4E88A 4ZOAA 4BV2A 2QW8A 1E1RA 2PKEA 4GYYA 4D6PA 3OQNA 4D8TA 1PSDA 2ZUSA 4FX2A 5JECA 4IDBA 3JQAB 9LDTA 5F3WB 1QRDA 1KMCA 3WADA 2D4HA 4GF5A 4EYKA 2J45A 4LN1A 4ZVVA 1C1XA 4YWJA 4ZI2A 5ICMA 4ZHQB 5CURA 1YBFA 1F4LA 1IG0A 3DCNA 1AHPA 2DFDA 4MWCA 5B1HA 3EVGA 4IJMA 2WTUA 2ARKA 2EKBA 4AJ9A 2W98A 2IW3A 1R4MA 1LLUA 4M4SA 4JT8A 5I9TA 2H4XA 3NHBA 4P1ZA 3UB2A 2WF5A 1Y3DE 3UW1A 3KM0A 1KERA 5DK6A 3SU8A 1KMHA 1DC3A 2YJZA 3A9WA 1OWOA 3HDTA 3FPJA 2NZWA 3C39A 2ZIWB 3N07A 5DNEA 1FQOA 3QMVA 3IUQA 2OM2A 4WRRA 4WZAE 4DV4B 4CEHB 1Z0AA 3A7DA 3WL6A 3VH4A 3OU2A 4M1TA 4KE6A 4EP1A 2GERA 1G5FA 1XTPA 1TFUA 1ODTC 3L5OA 3ZK7A 3SYTA 1LJUA 1IOZA 2WK1A 3GH1A 5CJJA 1WXIA 4PYIA 4LMBA 2J3QA 1U2SA 4B6OA 4UU7A 4YCSA 1XNRB 2C7QA 2JZOA 5JD4A 3H16A 2CLMB 2X8WA 5IDXA 2P9CA 1KL7A 2VQDA 5CIYA 4DSAA 2JEZA 1ODFA 3P26A 3W6OA 1QWSA 2AR7A 3S27A 3ZWQA 2CD7A 4B2YA 1OLXA 3C41J 1YFKA 2Y3IA 4CLDA 3D59A 2QGNA 1N5JA 1MVNA 1P9NA 1Z38A 2V7TA 4QRDA 3TJZA 4D80A 3GT0A 1GADO 5IT5A 4H1TA 2ADMA 4CIDA 1NASA 1E2EA 2QEQA 1SXHA 5EHQA 5LLTA 2YHBA 1VBFA 3CISA 3VMMA 4FIDA 2J48A 4IIVA 4FW9A 5AVZA 2PJZA 1DTWA 1N3IA 3G9TA 4QNRA 2J6IA 4GMFA 4QBIA 4Y7CA 2JA1A 3HL4A 1RAHA 3IAM1 3PWZA 3QI7A 1SCJA 1XZEA 4GRDA 5AJHA 4YCMA 5I7FA 1CRZA 4IZIA 2JGDB 5AICA 1KEEB 4CKBB 3IO5A 4D0LB 1KVSA 4EUHA 1UIMA 1DMRA 2VHQA 4G5GA 1GG8A 1O03A 3N2IA 2P5SA 4IEFB 4UOQA 2CFIA 3P97A 1P0MA 1KZ9A 1P7VA 2CYBA 2VYND 3WLPA 3K70D 1C7FA 1ZSVA 2IXBA 1ETHA 4XEHA 3BSFA 5DHQA 3BAZA 3PFIA 5E4JA 4J1SA 4OHFA 2NMVA 1J0BA 3OJ0A 1A9TA 1RZRA 5DTEA 2J5QA 4RY2A 1ZY2A 3S3TA 1RADA 1DWOA 3CF0A 2UVPB 1LX7A 4LJKA 1ILWA 1G8PA 1IH8A 2ODEA 4IDEA 3USCS 4A2CA 3S2FA 1K4MA 1M1NA 2BIFA 3G8BA 1Y3IA 3QG1A 2H1SA 1N5IA 1BAPA 2H7VA 4MKIA 3WRYA 4TTVA 5AUNB 1QCDA 4K9KA 3ZYCA 2WC1A 2NO7A 3DMRA 2XVMA 4AMUA 1JR6A 4DDMA 2ETXA 2XBUA 3FLEA 3OPNA 4HX9A 1IY0A 3FOCA 3BQ9A 3ZD8A 5K0GA 1ZKMA 2IE8A 4AYWA 4M1KA 3O21A 5A4FS 4CL8A 3I83A 1QC5A 2E89A 2C2BA 2HXSA 2RB5A 3M6FA 4HGRA 4LOHA 4P81A 3VHLB 2M9MA 3DMPA 4F9EA 4ARUA 3FSGA 1ZH0A 1U2GA 1Z0JA 5BWNA 2O8FA 1SOAA 2E48A 3TQRA 4R16A 5ALFA 1S5PA 2D3WA 1FW8A 2TRSB 2X42A 3I9MA 3TTVA 4NPAA 2FWJA 2VEOA 3W7BA 2XBLA 4FFBB 4I4LA 4DWVA 1Q1BA 1ZIPA 1YH3A 1OX4B 2VP6A 1U7OA 2BFCA 1U9CA 3GZ4A 3IV6A 4JC0A 4W6QA 1JU9A 1YZHA 2BKVA 5DHTA 5AP9A 4CDMA 1BQ4A 2P27A 1GXSB 2WQZA 3FMFA 4R69A 4KPUB 5CIQA 5CA1F 5KX5A 10MHA 3B6IA 1FRZA 4WK0B 4H7IA 1C1DA 4QM7A 1T5OA 4PO9A 1MB4A 4DVJA 2VP3A 4M1SA 4TXJA 5BSWA 3LK7A 3O2NA 5T3YA 4M55A 4CQJA 2QBYB 2X6RA 1CZRA 3C4JA 3G2QA 2WSBA 4TTAA 1QOZA 4QAJA 3UHAA 4EBFA 3GJ4A 1FF9A 4F1JA 2H16A 2HJSA 3ZJTA 1LDYA 3WDSA 2BGWA 5JE8A 3KAKA 2QRVA 4JC5A 4URVR 1ZK0A 1DGQA 3UO8B 3X2EA 3JQ8B 1EGVB 2R60A 2WTAA 3HKBB 3MA0A 5TMBA 1DINA 4X3PA 4PRYA 1F8FA 5AR1A 3V4VB 2WEKA 5CD9A 4IIJA 1IN1A 1NJ8A 4PN7A 4MHSA 4CEIB 3A4YA 1B23P 1YRLA 4FD2A 4KPGA 1EE1A 3IP8A 1Q92A 2QTVA 3PX2A 1CNEA 4OKIA 2WWHA 4PRKA 4QDOA 5AKGA 1Q21A 3V6LA 4DN6A 4C0HA 4ZYXA 1IJFA 3QE4A 1O97D 4ITVA 2BKUA 1ULUA 3GFVA 4RMJA 3EUAA 5HIIA 3WIUA 5MFPA 3QV2A 4UARA 1FP4A 1UWLA 4IV0A 4IO0A 2VRCD 2HLDA 4GI2A 3DYVA 2RGCA 3ANTA 3DULA 1PKXA 2PT5A 4P32A 3FCXA 3N7TA 5JAQA 3L79A 4EGCB 4EMSA 1JLRA 2QN9A 4X84A 2DCMA 2R6ZA 1F9EA 3NBUA 1FYXA 1D7OA 2OBXA 4KGXA 3PL5A 3H9BA 3M3PA 4YBRA 3DUWA 5ALSA 3QA9A 3L0IB 3S4YA 1JIUA 2M6SA 3GJQA 4UW9A 3RFTA 4RLSA 1Z0FA 2AR9A 3HG7A 1J8YF 3OMXA 4FGWA 3K5HA 4KR0A 1VB5A 5BUZA 2FX3A 2O1EA 3H7AA 4U8GA 4LTNA 3VU9B 5KJFA 3Q1LA 4Q4HB 3E2IA 1DNPA 4NV0A 4OAPA 5L3SA 1FY2A 1BXRB 4C4OA 1HEYA 3THWB 4XI9A 4M0MA 4C22A 8AT1A 2PL9A 5CXSA 3QWHA 2CLOB 4LBWA 4KQ2A 5KPJA 1F8GA 1Q0ZA 5SZIA 5K6AC 4YUYA 3ZG6A 1TUBA 1HK7A 1Q44A 2ISQA 4FUQA 5IULC 4M1EA 2UYQA 4FCWA 1II0A 1PGPA 5DCYA 4FSXA 2PLAA 2BFFA 3X2SA 4TROA 1GNRA 4L5BA 1CIJA 4U00A 4ZU3A 1GNVA 4EVIA 1A9SA 5LQJA 4YUWA 2BCEA 2OP0A 2W9XA 5ALJA 1SCUA 1KAHA 4A0RA 3ME5A 1JT2A 1TB4A 2FZCA 2O0KA 4D57A 4CEJB 1B26A 1TT5A 1C8KA 5KBYA 3UUGA 4MLPA 4R9SA 2ZG6A 3KKMA 2ISCA 4J43A 1P77A 1VL8A 1YASA 4TKMA 1PDOA 5BRNA 3RFCA 5IPFA 5L9AA 2G07A 2CV0A 1U0HC 5IJZA 3QLTA 2EFGA 4Q3DA 3GO4A 1R2QA 1U0SY 4KJXA 3M4XA 2EW8A 1RI1A 2MSCB 2N42A 2CNNA 3O82A 1E63A 3TL3A 4YAWA 3X1KA 3KQSA 4DR4B 3W8NA 2BUBA 3QGMA 1TLTA 2GCNA 2JD0A 3SXPA 3ENNA 3G88A 5I7VA 4KR7A 5EYPB 4UZFA 5CK5A 5AKJA 1JEAA 3SFVA 1WBDA 3M6AA 2GT1A 1V16B 2O7SA 2BEVA 5FQOA 1R5OA 2O3TA 4FKBA 3SX2A 1YI0A 5AVQA 5FWNA 1WUHS 1FP7A 2V6FA 4MGEA 4J8PA 4D9KA 1RPZA 3K0BA 1YZ3A 1LZKA 1WY5A 3O8LA 3ZVLA 3NOXA 4ZN6A 4DANA 2P5UA 3INGA 5AD1A 5B2EA 3F9RA 4IVRA 2FWMX 3GVCA 1VPTA 2AZXA 2FEMA 1R3UA 4IVQA 5K05A 1GP2A 4GGMX 1B4DA 2H07A 2R8XA 4RKEA 1OH6A 4AY2A 1R6DA 1NLYA 3ANMA 3CSDA 4BVAA 2I65A 2IIPA 2QQEA 2A1UB 1VGVA 1WDLA 3DVQX 4GBMA 4F56A 1AG9A 5IDVA 3TZQA 4BO9A 5HW0A 3VR6A 4MOWA 4IF6A 4Q16A 5HJEA 4CKXA 2H8GA 2A59A 3OLQA 4OOFA 1SXIA 5ALIA 4MVJA 1OREA 1CULC 5BT9A 4DSNA 1D04A 1R9JA 3OF3A 4FNAA 4I9GA 3VQTA 4AYTA 3L1JA 3D1JA 3EMBA 4A8HA 4DLPA 4US1R 1T2FA 2SBTA 2NPIA 2OVBA 1BOOA 2PT7A 3EGCA 4C89A 3I23A 4N9QA 5C7YA 3F0TA 4MROA 3LXUX 2A6PA 4B2LA 5IXJA 3BDIA 2LCQA 3H4IA 3TSYA 1BHJA 1WKCA 3I9FA 2C5GA 3Q3JB 3KOUA 4CIXA 2NVUA 4B6SA 4GBED 1E3EA 3DQQA 3MSXA 3G5UA 4IFBA 4R2WA 5AHWA 3H4TA 5JATA 5T67A 1LNSA 1CUBA 1W0JA 1HMPA 5B7GA 2JLQA 5HTKA 2H0AA 1UZUA 1QBKC 2L82A 2QB5A 2H52A 3D7SA 4GGOA 3OM1A 1JECA 4GX2A 3JQ9C 3SZ3A 4E3ZA 1L4YA 4C5AA 3CLHA 4LJ8A 5GIPE 5AW9A 3PR3A 3D6UA 3IXQA 2C5AA 1V6SA 4MUYA 1L8OA 1X1DA 4A6EA 4BMYA 2AEFA 4IIFA 4AJ1A 3E70C 2DQSA 4G9EA 1YB1A 4RZHA 3V4PB 1DBWA 1WF6A 1ZNWA 3R40A 4BGVA 4F6RB 2PMFA 4FR0A 4IIJF 4ARZB 3GNQA 1F8XA 3FFBA 4B71A 4BWGA 2QLMA 2FG7C 3OEYA 4EO7A 1R0LA 3AVWA 4Y0AA 1CXZA 3AYZB 1PFWA 3V8RA 4E4TA 4RLHA 4D5EA 2MWMA 1GGEA 3PT5A 2BRUC 3OEED 2V5AA 4UM9D 3AR8A 5T64A 1D2HA 2OB1A 1X38A 2Q2OA 2A92A 1YU9A 2AN1A 3R5XA 4YCDA 1RBMA 1XHFA 3PFBA 2D54A 2W42A 1ZC3A 3MZ0A 1Z2NX 2JKVA 1YE3A 3EH1A 3PC8C 4GS5A 4PC2A 5JNUA 1HI9A 2BEVB 2EBUA 4B7AA 5HXAA 5L53A 4K6FA 4AVYA 1DX6A 2P9YA 1QGUA 2YW2A 1M75A 3LX5A 2IH5A 1R16A 1GU0A 3OZXA 4WUTA 2GCIA 2ZUDA 3ED1A 5J5VA 4EUKA 5EFZA 4BZXA 2JNWA 1CW2B 1XTIA 2HL6A 5EI5A 1U31A 4X1KA 3ES9A 2PJUA 3NJ8A 3PDIB 2C4VA 2WF7A 1CFJA 3BD8A 2X5KO 2AD5A 1SVUA 1HYGA 1Z7WA 5B3JC 3KTOA 3HO1A 3TZKA 3JX9A 3SHWA 3LZ6A 4X97A 4Q9NA 4ZP1A 3S68A 5PGMA 4IRMA 2GPJA 4G01B 4BBJA 3R5KA 5L4SA 4HS9A 1SIUA 2QYTA 5G0SA 1TQ2A 1XCGB 3CEAA 1KKLA 3EIXA 3EVDA 2R1VA 1SU4A 1WUJS 3ILYA 1VBMA 3KSDO 4IQ0A 3JAWB 5JSHA 3BWCA 4FLEA 3RW9A 1I4LD 3WFJA 4EPRA 2Z57A 5DEOA 3OZIA 1ESMA 2XCSB 2F1RA 3IPRA 4BFTA 1XP5A 4CUKA 5IZ4A 1XPUA 1H6DA 1SXJA 3LWNA 4YT5A 2OG2A 2VWHA 1ZK1A 1UKZA 3CLVA 3KLNA 3W8FA 4HQKA 3T7TA 1FDVA 4EZBA 1EFCA 3OOYA 5D6NA 1CERA 4AICA 5DHRA 4DS3A 1ZUNA 2D8MA 2EG5A 5NLLA 4OREX 1K5PA 1Q11A 2JJYA 3L9WA 4YGXB 5G1OA 4TLLB 1QDUA 4J7UA 5CEJA 1EFKA 1XTUA 2GFQA 4XASA 4GICA 3N74A 1C1DB 4G4SO 4MR8A 5IBCA 4LRYA 1H8EA 3O8OA 3B20A 5CBPB 2IX3A 1JLKA 4KN5A 1Q0LA 2COEA 2RHTA 2M2IA 3PFNA 2HO5A 3UC5A 1LY1A 4YV1A 4K5QA 4JHXA 2TMKA 1L9XA 3TRJA 1A8IA 5SZKB 1QIFA 5LQRA 3SQNA 3PITA 3LHDA 4JVLA 3GZNA 4Q6BA 3F71A 1DCMA 4L22A 3FA2A 2JS7A 4QQRA 2WNIA 4UMFA 1JDNA 2ONJA 4PONA 3PR1A 3GOHA 1SBQA 4X3CA 3USZA 3ITKA 1W19A 4LI0A 2BHRA 1BRMA 4U6NA 4B7CA 4HDNA 3RGWS 5BR1A 5FQNA 1QYXA 5D1NA 5LXTF 1IVYA 3O8NA 4MTCA 2ZITA 4E5PA 2Q3BA 3EGXA 5DXFA 4BKOA 1P33A 4DLRA 3CF2A 2IYRA 5CB4B 2WILA 2MSNA 5D00A 4BB6A 3FETA 1J9GA 1IWOA 3CIFA 2HF7A 2R5WA 1H23A 4LYJA 3BFJA 2XECA 4DLWA 5L3SB 4NJEB 3GLFE 1W4ZA 2VT7A 4OFBA 5CFPA 1GDTA 1UH5A 1U11A 1Z16A 2ON6A 2Y0EA 1WY7A 3U7QB 2V9ZA 3LC1O 1L5KA 3HBFA 3VNUA 1LBTA 2FPLA 1TUBB 4U9UA 2OENG 1QKKA 2P2YA 5A9SB 2Q5LA 3FI9A 4JNCA 4TS3A 1N1MA 5DNVA 3HHPA 1M1YA 1JI3A 4LOKA 3T35A 3GFGA 1ZDMA 3TX6A 1TKCA 4DCTA 2FE4A 4E1BA 4EY5A 2IYSA 4JYBA 3OZAA 3ZGOA 3KTAB 4CGYA 3M1IA 1KY4A 1U8UA 4RY9A 3KSZO 3JW8A 2JLRA 3LQ4A 4JT9A 1E79A 1EGQA 1KAOA 3LRXA 4RAOA 5EXEA 3PFGA 4J6EA 4C7OA 3HXOA 2JBAB 3ZY4A 2SKEA 1CY8A 3DDOA 3IP3A 2ZSHA 5IK2A 4C1BA 2I2CA 3CKKA 2WVAA 1SKQA 2C88A 2GPBA 2QPOA 4DV2B 4Y1RB 3TR5A 3EWNA 4JLSA 5AVJA 3DHYA 4RFLA 3WBJA 2RGUA 1A9ZA 4A8TA 5JSQA 4V1CB 1H0HA 3OTQA 3TRIA 2CJPA 2IA5A 2R00C 1U81A 2WP0A 2Z2XA 3PUYA 5FNVF 2G9NA 4BQNA 3RCBA 2C7BA 4EHLA 1DFHA 1NJ2A 1SIBE 2VWQA 4JIMA 3S2IA 2R7LA 4RJ2A 3HJNA 3EFOB 3T3EA 3CKYA 2OGSA 2AS0A 5DVZA 2QMUA 3IVRA 2J5XA 1UPCA 2QUHA 4K6GA 2AJBA 3VOAA 3O8OB 7ABPA 3KVYA 1PAUA 5JG7A 1T2VA 4FONA 3O1HB 4LY6A 4WXRA 1UMDB 5ALWA 2GCPA 2ZTMA 1SCAA 2ZYDA 3EDMA 1V8PA 2IODA 1FNBA 1KEZA 1NVWQ 2PBRA 5KSPA 3A36A 3AY6A 5F7OA 4JP3A 1M1NB 1GKLA 4XUGB 2XADA 1DC8A 3TLAA 1RRCA 4AECA 1UDAA 3KG2A 4BOYA 2GYYA 4OU5A 2HIMA 1NP7A 1GZ6A 2HTFA 1H4VB 2W6CX 4Z99A 2CXRA 4XOUA 1D0SA 5FF9A 5B2FA 2H7YA 2BI4A 4BQEA 1V43A 4K26A 5CCEA 2OHGA 1EVKA 3ZXUB 3C3XA 3NI2A 1RAEA 3GG9A 4JITA 3ROPA 3EZ2A 4AS3A 1KF0A 2FEOA 3CLKA 3FSRA 4PX3A 1MGOA 2PKXA 5AKIA 1GRRA 3K2QA 3KT8A 2UZ4A 4N3CA 1WO8A 3FPBA 3H2BA 5HEKA 2A9VA 1DTEA 4D82A 5IKMA 1VE5A 3LC2O 1L3CA 1NF3A 3MTQA 3AY0A 4UM8B 2D2XA 3ZU2A 1AKYA 2QP4A 3IP7A 5LBTA 1N4AA 4HMPA 3C5HA 1NW4A 4IGAA 1O8BA 3WV4A 5AM3A 1JA9A 1XXHA 4NU0A 4MI3A 4WWHA 3VO1A 1E9VA 1EXMA 3UICA 3X1XA 1MA0A 3BDAA 1KI9A 1KOJA 5JANA 2FQ1A 2PGXA 3VH2A 5IHPA 4JI7B 1EINA 4M1OA 4TMTA 4KACA 4DWOA 3B5JA 4JVOA 3D6JA 5JSKA 2W0SA 4HAYA 4WHMA 4D9JA 4LVOA 4B81A 5JS7A 4G25A 1R6UA 2OHFA 2W71A 1X7XA 2PLNA 2XMQA 3GVIA 1F8UA 3JWJA 2QUBA 4WL0A 3AV0B 5K2MA 1PVOA 4R31A 4U9IS 3C6YA 1ADJA 4OI4A 3RARA 4EHJA 4DCSA 2Z8XA 2YICA 3JWGA 5FWDA 2QI9C 5AM1A 4EB3A 2XCTB 5DT2A 3WGHA 1Q74A 4AMYA 2ONYA 4F6RA 3ZGZA 2XZLA 5TR9A 1ECCA 1P6UA 1NU8A 4BQQA 4C4ZA 3WLIA 5KB3A 2P9ZA 1QFZA 4D44A 2WM3A 5AI5A 1M2FA 1Y8AA 2VSFA 3U81A 4AZTA 1ODJA 4BCBA 1W7AA 3FD8A 1F0KA 4MS1B 4LYGA 4AJHA 1N9GB 2Z2JA 3TUIC 4DV5B 1KS9A 4EY4A 1YQQA 3IP5A 4EDHA 5A6SA 2ZR8A 4DLAA 2ZPTX 3KUCA 4L74A 1WU8A 3C5EA 2CFCA 3U3RA 3IP1A 3A3PA 1E7YA 4BKUA 1YOVA 1Y6ZA 5GJVC 4CCSA 1V45E 1RYNA 3FFAA 4IIEA 5G4KB 3ZBQA 1XK6A 1SC1A 4HP8A 4PQGA 1FSZA 2CGEA 2R6FA 4YR9A 4CR8A 4D96A 3OQVA 1WXHA 4FE7A 1K88A 2VWPA 4B48A 4TLEA 4G1CA 1UK8A 1HDCA 1ONNA 2QLTA 4YRAA 3RVQA 2IEBA 3VISA 3E53A 3R3JA 4QDZA 5IF9A 4AJLA 3VKFA 5E3JA 3ZKWA 1BH6A 3B1FA 5FFFA 5J2UF 1EFPA 1XD9A 2PXCA 3D1LA 3PGLA 3QVKA 2OCKA 1WLYA 1QHYA 2WYUA 2Z2ZA 1U0EA 2X8BA 1G6HA 2YIVX 3BFXA 4MO2A 4UE2A 1M8KA 2PRKA 1WHTB 2XEXA 1KHTA 3ZE6A 1XKLA 2CNWD 4KYUA 1JQKA 4GLOA 3R9XA 1L5NA 1T4CB 2MMCA 2WIBA 1ELOA 1Z4NA 4PAWA 4EO9A 1EJ0A 2GARA 2YCBA 4MKHA 4FYKA 5JNTA 2BFBA 4RESA 4B46A 1RPTA 2B4QA 2WZQA 3NXKA 4PG6A 2PV7A 3Q88A 3HSKA 3RRNA 1OFGA 3JAKA 1NTRA 5FTMA 4LC9A 5KSYA 4BNDB 4QQ8A 5IKPA 4QBFA 4URXR 2CDNA 3UCEA 1FFHA 1VP3A 2VJDA 4MW9A 3VOTA 3I1FA 3K96A 1ZPDA 2REQB 2IXEA 1TJYA 2VPXA 4FYHA 3E9ZA 4I4NA 1YB2A 3HFSA 3VKVA 5MN4A 3GLIE 1WZ2A 2KM1A 2B82A 5GWXA 2FQQA 2H18A 5AXCA 1L5HA 1VMAA 1LI4A 1CK4A 4LJ6A 4EHKA 1FX1A 4QARA 4HDKA 2OE2A 4RJTA 5A5FA 2YXEA 1NVVQ 5HRUA 2CLDX 1YRQA 4M54A 1SBNE 5IVDA 2BGRA 4E4YA 3AVTA 1KE1A 3LYLA 4YNBA 4RCZA 4DDVA 3C3KA 5SY6A 3DEJA 1X9HA 1MBZA 1ZXBA 1QBGA 4HGPA 1Y37A 4Q4LA 3VDNB 3E9EA 4X5OA 2RHDA 1NURA 4L08A 3V2HA 3AO0B 2PUJA 3ZU4A 4RNCA 3T54A 3W1WA 2F59A 4LV8B 1RLMA 3WA6A 1SVIA 3MM4A 4DCGA 3AZQA 4HDNB 4A3SA 4TYYA 2RC5A 1FVHA 2HK8A 4MV4A 3L41A 1GZHB 5A4AA 1T9KA 2G8LA 3EDOA 1K7SN 1M7BA 2XA9A 3AEYA 3F8TA 4IHJA 4OKNA 1IVSA 4FWIB 5I3ZA 4YB8A 1C8VB 1P2GA 3LF2A 1IEXA 1Q7BA 3GFTA 4FFNA 4BLSA 3T7DA 3OD1A 5DU2A 2AZ4A 2AG0A 2EFYA 1JKIA 1JFFB 2B8JA 1EDOA 2B21A 2GLTA 3I73A 3UAYA 1XEFA 3L8MA 3VBCA 3OZCA 2IQ5A 2PL1A 2PLRA 2X19A 1JB9A 4YYEA 2OV6A 1KR5A 3NG1A 2OLEA 3W8RA 5LD2B 4IDCA 1ECBA 3EAGA 2FN4A 3MINB 4RLQA 5A7FA 3GROA 2VBIA 2VUHB 4FHFA 4KB5A 4TMVA 5EUBA 4D41A 2DERA 3MB5A 1F4VA 1SZDA 1TQ8A 3FTNA 1G66A 2IX9A 4GZLA 1IUOA 1WPRA 3BCSA 3ROMA 4CM4B 4JZKA 4P6VF 1K7EB 1XZIA 3H11B 3DBOB 3BWEA 1Z6GA 1J2UA 2BUCA 2YH2A 1KDOA 3G2LA 4KI7A 4ZT6A 3D4IA 4DPKA 1E92A 1V4NA 4H7FA 1MMFB 1LVHA 2GN0A 3E8XA 2GWRA 5BSUA 4AY5A 2X77A 1RHQA 721PA 3V8VA 1YS4A 2GJ8A 3HVUA 1MPTA 5E9AA 1MJ5A 1NWHA 1P9RA 1ZISA 5F1YA 4DUYB 4CZ2A 4B82A 1WNFA 3ANYB 4EFLA 4XWOA 2EGUA 1ZK4A 4PM4A 2H4YA 3WLLA 3ZDFA 5BQFA 4V39A 5K0EA 4A82A 2GNPA 1SKBA 1M83A 5CJ2A 3I12A 4NV1A 2Y0PA 3AFMA 3KOMA 3PJFA 4HADA 5LQKA 1YOBA 1W4LA 4PZYA 3KOYA 3H86A 3RJTA 5I9SA 3TQSA 4DR1B 2JJ1D 2RHCA 2REOA 5JNWA 3GIDA 3DA8A 3QUCA 4JX9A 4X8OA 2LWIA 4XE5A 1E59A 3MFQA 3DTNA 2O48X 1EUCB 3NIDB 4A03A 4BUZA 1F2DA 5IN5A 1J24A 4EHAA 2IYUA 2BR5A 1N9GA 1P4GA 5KYYB 3TMAA 3INRA 5CA0A 2W7TA 3D7RA 3LUGA 5E7IA 1WUTA 2XMCA 2J4CA 1VIYA 4IIXA 4AULA 4F85A 1EUDA 1ZAKA 1J90A 1QLHA 4KIFA 3ULKA 4NXMB 1NNI1 3RBVA 2IXFA 1NKVA 3I0MA 4JI5B 3B6EA 4JL6A 3S5JA 2ZU0C 2XTMA 2E6UX 2OWEA 1PQPA 2PA0A 2Z30A 3A04A 1XJ0A 3BMQB 4IFEA 4PLFA 3RYFB 2WB2A 3CB2A 3P94A 1SD5A 1RBYA 5JZ9A 3EUWA 1N2BA 3W2EA 2O0MA 5EKUA 3E9NA 3DYBA 1NJGA 3UM9A 2V58A 2HJRA 4CLEA 3H18A 1P8JA 3UUWA 2XKKA 4MWZA 4M0KA 4O8ZA 2HRCA 3LP6A 4M1MA 2ECQA 3OZVA 3UJAA 1ITZA 1UJ5A 3ECSA 2OTCA 4KWEA 2C2HA 1RRKA 3F98A 4K6CA 2O14A 3NBMA 4CV3A 5AW2A 3C70A 3MUNA 1RKVA 4QPZA 2GEBA 3EDQA 3EBPA 1PUIA 3DVRX 1G0NA 2ASVA 1C9MA 1DC7A 2HREA 3FHJA 3HZHA 4I2NA 3L7DA 1DE0A 2YIMA 3NW9A 1G55A 4HLQB 3WGQA 5FL7A 1YNOA 3GBPA 3HDGA 3MWKA 1XJQA 1EQAA 1VI2A 4RM2A 4RZXA 3VHRA 4NQRA 4D3FA 2FXIA 2A14A 3ZHSA 2FMXA 2YJGA 3SVLA 2EF0A 1NIJA 2PX5A 2ZIVB 3ID6C 4O2BB 1W1WA 1Z28A 1SEPA 2ZRLA 3LUAA 4L15A 2FZLA 3RHFA 4RTPA 1UP4A 3RAEC 3GQBA 1BXRA 2PGAA 4QOHA 4J3NA 1N34B 2BLNA 5CH8A 1DXQA 1U7XA 1UJ4A 1EJBA 2VFAA 4U7DA 4ARIA 1N2XA 3D3WA 2ZYUX 1PEYA 3D8RA 4Z1MA 1QIHA 2D2EA 1KEVA 3RSGA 3UK0A 3KP1A 3N70A 4HUJA 1QQBA 4FNGA 3LCJA 1P2BA 3D81A 4UTRA 2QRVB 1E6EA 1YQWA 2JLSA 3SYKA 3UK2A 1DAIA 3GRPA 4NNJA 2QV0A 4ALMA 1C41A 2GJAA 4OI1A 3NTOA 1WA5A 2WM2A 3EY9A 2G5GX 3F6SA 3T5DA 2RGDA 1BC5A 5LXTB 3K92A 3W5IA 4F5YA 2B35A 4GSLA 3IQEA 2DQKA 4R9RA 4S0ZA 4U02A 4WGGA 2SNIE 1NQTA 3F90A 2H4WA 4LS3A 5E0KB 3O2JA 3KB2A 2LUOA 2C2YA 3R23A 4PEVA 1GPKA 1QYCA 5AKLA 4ZPXA 5EZSA 3UYKA 4LECA 4JNKA 5B1DA 5A71A 1U0FA 1XALA 3UOGA 1N9ZA 3Q10A 2OK7A 1BX1A 4Z4IA 3BD7A 4RDCA 5LA6F 1O4WA 5JZOA 3A0RB 3CLUD 2R7KA 4IJ5A 4CLOA 1M2WA 2BC9A 2XWPA 2BTEA 3D8SA 4JP5A 3T9FA 3FRHA 3V7YA 3U4QB 3GFBA 5CB0A 5AHOA 1MXFA 2W2KA 3JVVA 3KYBA 2JJQA 3O47A 4ILKA 4JBIA 5F77A 1V1RA 3ZWAA 4CIVA 4D9GA 1ESCA 3QPUA 1QO0D 4MRMB 4UQPA 4X85A 3WJ1A 2ECFA 1I3NA 3NAQA 3CEMA 4TTPA 3WGGA 4PANA 2WFLA 4LCBA 2JHAA 4U2KA 4Y2SA 4CMIA 5F23A 3C3BA 3OCUA 5JNSA 1D2RA 3KT3A 1CJMA 4XAQA 2OR3A 4YDRA 4GZ6A 3JQCA 4QU9A 4UVEA 4PG7A 1OU4A 4IXTA 5KOYA 1T3ZA 1C3EA 1RI4A 3OU7A 1HNWB 3R3SA 1J8FA 2PYIA 3UMFA 1S8AA 1AS0A 1VG9B 4PSVA 4MRSA 4CIYA 3STUA 3PX3A 4C0LA 3HBNA 5I7EA 4HUQA 3RIYA 5EE9A 4HNQA 3WIVA 4IGIA 3K0HA 5LN1A 1ZGHA 2HHHB 2ORYA 1I33A 4UBIA 1M10A 1CJSA 3PXUA 4JUIA 4FFBA 3MQ2A 1F2VA 4PSAA 4Q3AA 4BN5A 2WPDD 3K0KA 3UXEA 5EWLA 3NHUA 2A9KA 1G21E 2OFXA 3STWA 3T15A 2WMOB 1K8YB 5KWIA 2V65A 4REQB 2IHTA 2PPLA 4S05A 1OZFA 4YCAA 1CUCA 1IDOA 1RRMA 1BGVA 2QRZA 2QSJA 4PZPA 4CM9A 5DI3A 1EWQA 3M6VA 3PUJA 4LF8B 5LVAA 2RB4A 3CN7A 3KEGA 1MX5A 4CQMB 2PJRA 1JZQA 1MO6A 3UQYS 3BCRA 4Y18A 4JU9A 1PBNA 2O2IA 4FHCA 4BC1A 2QIPA 3AOEA 4L5YA 4QVGA 1JV2B 2WWXA 1KZGB 3K0CC 1A98A 1PT6A 1WDTA 1Z26A 2UXDB 3FYHA 4LRXA 4Q00A 3IOCA 3VO2A 4GSKA 5IC5A 4DYHA 4L5CA 3AP3A 1OAOA 3I34X 5GM1A 1BCRA 7ADHA 1VLQA 4FOPA 3IODA 2JASA 2OORC 3FSGD 2WD7A 3BFPA 5BN1A 1Y9JA 2P90A 3ADKA 4B43A 4BB0A 3PQ2A 3QFCA 4F4HA 1IBRA 1ZR2A 4B5LA 3VDQA 4N3GA 3VXKA 2JH9A 4Z51A 3W5AA 3HB4X 1U0TA 4EA7A 4XCXA 1M1YE 2RKBA 3R41A 1H2XA 4EYQA 3K5PA 2BJWA 4QOJA 3ENVA 4CM8B 4IHJF 4ZJUA 1ODSA 2ZS7A 1R0ZA 1U5CA 2JGRA 3HH8A 3MAJA 1Z0SA 5LIPA 3P5BA 3V6MA 4E5YA 1KGDA 1RYEA 2I2DA 3I6IA 2A5YB 1UM8A 3AZPA 3H6KA 2CMKA 3AI3A 2WUDA 3SC4A 4BN0A 4BMVA 2GVZC 2KI5A 3GXOA 3KQUA 1UFRA 1RVDA 3G0IA 4Q66C 2AX4A 1RBZA 3FJ1A 5DGHA 2C7OA 4X20A 4JBYA 1EVYA 4KAXA 5CFMA 5DIFA 3GAFA 1TLLA 2IE0A 4M88A 2BUAA 3BORA 1VYVA 4GKKB 2BFDA 3KOOA 3O3OB 3QVVA 5A3SA 4G97A 4C14A 2HW8A 4M1YA 2BM8A 5EVCA 4ER7A 2G40A 2OSBA 3LFHA 3LKZA 1PNRA 3WIDA 3O5AA 2HIHA 3FM9A 3K8YA 1E8MA 4JJ8A 2R6HA 1YDEA 1SBIA 3UMGA 1DQNA 1NBWB 3TGWA 5FYQA 2P6NA 4JJFA 1TRHA 3CNOA 4QXMA 5C37A 2VT3A 2XLBA 5HZMA 4IM7A 4II3A 2GBGA 4PZ9A 1GN9A 3TW4A 5CLFA 4ZT5A 1OH5A 5ANRB 2JFWA 4WZAB 4PCLA 1Y63A 2NP6A 1JALA 4CT4B 3TE6A 3KD3A 4UU8A 1J4AA 3F5DA 5A0TA 1TIBA 3OKCA 1N75A 1KNQA 4LE1A 4PAGA 2AK3A 2QMOA 1YQEA 4TSFA 2Q4RA 1K2VN 2WHXA 3KPVA 4JLUA 3VZCA 4ZQCB 1G5HA 3OCJA 5JCJD 5K4GA 3ND5A 1JDSA 1M66A 4YCCA 3UPTA 3MT8A 4OAQA 3EGDB 4ZOLF 4FOOA 5DLYA 1LWNA 4DWWA 2GQ0A 2N9UA 4ZVKA 1ZUD1 2H2AA 1XMVA 3KB1A 1QJCA 4FPXA 4ECAA 1L5QA 2G7ZA 2V6GA 5KOHB 4BKMA 3GLRA 3RIMA 4IIDA 4N6NA 2YZGA 2WA2A 5J2UA 2Q50A 4AFNA 1JU3A 3EVTA 4OO3A 1QPBA 4OA8A 4W5HA 1H66A 1E0KA 3B9QA 3I5YA 4PSUA 4RPIA 1YJ8A 1L4GA 3PLNA 4TQUS 5LDGA 4X65B 5GPBA 2REXB 4HTFB 2V45A 1SHJA 4EFNA 2PL5A 1T4DA 2QQ5A 3RYFA 4AP6A 3A6EA 2MINB 2CLLB 3KT6A 1SH7A 4ALIA 2FFHA 2II6A 3NM6B 1Y8ZA 2QT9A 3U5ZB 2ZQ5A 3EXIB 4FFWA 2DUNA 4F96A 1U7TA 1GTSA 5DHAA 5EERA 3RF7A 2HJHA 3V80A 4CTKA 3CMMA 4JASB 5CP8A 2PRIA 1NW3A 3GPDG 4TX1A 2WWIA 4BWFB 3TLJA 3T94A 3GP5A 3WYCA 3ZWCA