5D7NA

Crystal structure of human sirt3 at an improved resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
271
structure length
271
Chain Sequence
b'GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
publication title Seeding for sirtuins: microseed matrix seeding to obtain crystals of human Sirt3 and Sirt2 suitable for soaking.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 88
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 5d7nA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5d7nA01
4FZ3A 4UTXA 3D4BA 4IG9A 4J16C 4D5GA 1M2KA 1PI3A 1POWA 1S7GA 3ZGVA 1YTLA 2Q29A 4JUFA 5EJ4A 1PO7A 2JI8A 5K2OA 3GLRA 4COKA 2BRUC 3GLUA 4GG1A 2JIBA 2H4FA 1OVMA 3ZG6A 2OO5C 4K9PA 1Q14A 1OZFA 4RJJA 4Q9DA 1V5FA 3IAFA 1E3TA 4FVTA 4BN5A 2Q5JA 4JUDX 4MPPA 1Q6ZA 4FEGA 1U31A 4I5IA 1U2GC 4JSRA 2V3WA 1PNQA 3CF4G 1YNOA 2JI9A 4UTVA 3PKIA 3ZGOA 4X3OA 2VK4A 4ZP1A 1JSCA 1O96B 2VK1A 1SZCA 2C31A 2EZ4A 1EFPA 1PYDA 4GP9A 1M2JA 4K9KA 4QPZA 4C7BA 4FEEA 1POXA 3EY9A 2VJYA 1HZZC 2AG0A 4QQ8A 2EZ8A 4IAOA 5EJ8A 2H2GA 1NM5C 3CLUD 3CLTD 4MZXA 3PDHA 1EFVA 4JUCA 2H2HA 1SZDA 3RIGA 5EJ9A 1T9AA 4Y6OA 2FWNA 2NYRA 5D7NA 2VBGA 2OD9A 1UPCA 3HWX1 4UTRA 2HJHA 2H2DA 1QPBA 1U28C 5DEIA 4J1TC 4JUBA 1Z8NA 1MA3A 4V1CA 5EJAA 4C78A 4MQ5A 2OD7A 2H4HA 5K6TA 4JU9A 5EJ6A 4BN4A 1YHZA 5EJ7A 5FYQA 4K9OA 1U2DC 4QELA 1MCZA 2DJIA 3JWPA 3CLSD 1M2NA 5IMSA 2AG1A 1PNOA 4V1CB 4HD8A 2FR8C 1M2HA 1ZPDA 2OD2A 5K3SA 2JLCA 5BWLA 4G1CA 3FZNA 1T9BA 1M2GA 1J8FA 4IF6A 3D81A 4RMGA 1YC2A 3D7KA 5FEMA 4BV2A 1ICIA 1OZHA 3CLRD 4JT9A 3K35A 4TWJA 1UPBA 3FLMA 4K9LA 1BFDA 4K9NA 5AHKA 5DGTA 2OORC 4RJIA 4O8ZA 3EA4A 3F6EX 1S5PA 3HWWA 2X7JA 4BVGA 2UZ1A 2IHUA 1YI1A 1PVDA 4MPJA 1Q1AA 4L3OA 2PGOA 2W93A 5K6RA 5BWNA 3F6BX 4UTZA 2A1UA 3RIYA 3JR3A 2QQGA 2VBFA 3OE1A 4GM1A 4BV3A 4Y6QA 4KPUA 2A1TR 2IHTA 5EJMA 2EZ9A 1V5EA 1D4OA 1YI0A 4K9QA 4BVEA 4HDAA 2Q5QA 2JLAA 2WVHA 4TWIA 2FSVC 4UUBA 4K9MA 5MF6A 5MGNA 4GPEA 1DJLA 1YC5A 2EZUA 4ZZIA 2H2FA 4V1CI 1T9DA 4UUAA 4KGDA 3U3DA 2UZ1B 2H2IA 5DGDA 4BUZA 3IAEA 1YBHA 2PGNA 4GM0A 4UU7A 2B4YA 4RMHA 4GM4A 2FRDC 1PTJC 4JUAA 4F56A 1O97D 1PT9A 2Q27A 2QQFA 4JU8A 4Y6LA 5MFZA 2Q28A 2Q5OA 2VBIA 1OZGA 1Y9DA 1Q17A 3GLSA 4D5EA 2PANA 2H59A 4X3PA 4BVFA 4UU8A 3E9YA 4RMJA 1XLTC 4BVBA 4F4UA 2VK8A 2WVGA 2IHVA 4RMIA 4RJKA 2WVAA 2JI7A 3GLTA 2JI6A 4JD5A 3U31A 4UTNA 4L2IA 3PKJA 1V5GA 2NXWA 4MPRA 5MFPA 2Q5LA 4BVHA 2EZTA 5BWOA 5EJ5A 3EYAA 1T9CA 4KXQA 1YHYA 2H4JA 3FSJX 3LQ1A 2FN3A 4JT8A 1N0HA 4R8MA 1UPAA
chains in the Genus database with same CATH superfamily
1XEXB 3HZZA 1K89A 1WZNA 4KK4A 4RSMA 3VPCA 4U7WA 2QRJA 2VYVA 1BDMA 2VJLA 1IYZA 4ZTBA 4C0XA 4CL3A 4AIRA 2XD4A 2RHLA 4MA5A 5T8KA 3JVVA 1DRUA 1KS9A 1POWA 3TJRA 5TGTA 3KRTA 4IZ6A 2HGZA 4ESHA 1E79A 1LRJA 1YTLA 4D8XA 1GUBA 5EJ4A 3PYLA 1KI8A 2KPOA 2UYOA 3NW9A 5L3QA 5DKFA 1NYRA 1U8UA 2MMGA 4F96A 5KYWB 2QSZA 3VKFA 1GADO 3KO8A 4FGKA 3LV8A 1CUZA 5EIEA 1R0YA 1KI7A 2BVNA 1WMDA 3BD7A 2FG6C 4GO1A 4ZVSA 3HBMA 3FPCA 4LCBA 3ORFA 5ECYA 3DWGA 2JIBA 1EFUA 1LVUA 2NQ2C 2ZUSA 3I5AA 3O83A 4YRBA 1B6RA 2QY9A 1JQDA 2IPNA 1O96A 1QKIA 4CT4B 1UEIA 1VLQA 2TYSB 3TLBA 4B4DA 2K5UA 4GIBA 4CPDA 4LVUA 4Y8VA 1NQTA 5G4LA 2WJ3A 4PFSA 5J2UA 2SICE 3FOEC 1F20A 4FOOA 3W6ZA 3LVQE 3VJRA 3F4LA 1FP2A 1SHZA 2R7KA 4H6WA 3AY7A 4CV2A 1B6TA 1NNI1 3UMJA 4KI7A 2GTPA 3W3AA 2WYUA 1T5OA 3O7MA 3FFBA 4J76A 1KAEA 1PTKA 3RS3A 1JXOA 2A9VA 4MLDA 4G5QA 5JOQA 3PDJA 4IIJB 4I3HA 3RIEA 4LHEA 3WO0A 4FVTA 1BX1A 4LOJA 3NTVA 4FMBB 1RP1A 4S0ZA 1ST3A 5KVCA 3OIFA 3L93A 2RFLA 4KTTE 3RG2A 2C61A 4QVIA 2V8BA 2ZUBA 4IO1A 4RHXA 4GOKA 4DDWA 3SKXA 3FSGA 3U4CA 4JSRA 3SX0A 4ZT4A 2JCSA 2XUGA 4GRAA 4QXAA 2OQVA 4HMOA 4DC0A 2GPTA 1GUDA 2HXYA 3UVEA 2REQB 3PFBA 3GH3A 4GBJA 2QUHA 1R8QA 3ORQA 3C6XA 4AZ3A 3EB9A 2BI7A 2RGDA 3K71B 3TI7A 2OZVA 4AO6A 5FB3A 3KOUA 8LDHA 1G1AA 3HSKA 4CKWA 3K8ZA 5EHGA 2X0IA 5BMVA 1JLLA 1OT5A 5HFNA 4E08A 5ADUS 3O3NB 3PNKA 2UUBB 1JEQA 1VKRA 3SE0A 3NBFA 4A2QA 3OQIB 2AG6A 4RCVA 3OBBA 3HKDA 1VHTA 3GJYA 3WL5A 1EVQA 4HTAA 4C3OB 2WHXA 2BGGA 3GRCA 2X77A 3Q88A 4ZFNA 4Y1RA 3ICOA 4X6YA 4BIMA 1FRVA 4B3DA 5DN6D 3HTXA 2NPOA 4KE9A 2DCUA 4RPLA 5FBQB 3U9TA 2EZ4A 3EUAA 1XPUA 1NBMA 3G0BA 1NJ6A 4ZALA 2KLBA 2VWGA 4HMPA 4N5MA 1GFSA 2VYQA 4AN4A 1VCNA 3GLGB 4TV9A 1MVOA 1WRBA 3VKVA 5DNUA 1FS6A 5TPZA 4DR3B 2GUWA 2BR4A 5A02A 1TIBA 1CR4A 4UVIA 3R23A 4I4TF 1TADA 5INTA 3L0OA 4FGWA 5C34B 3TLXA 5HRUA 3EXIA 3A3PA 4QQNA 1N1GA 1TM2A 3QXHA 1IB0A 2ADMA 5D3ZA 4WJLA 4TZ0A 4OBBA 1FLVA 2ZUVA 5L51A 4UHKA 2A0XA 2WM8A 3J81A 1JNXX 2HIAA 4PQGA 5JNRA 1FK8A 1ZG3A 3GYGA 1P4JA 2E4AA 1Z5WA 2PLNA 3ACBA 1S96A 3M9WA 1GT6A 1NVGA 1SRRA 3W5SA 3IKLA 1I2ZA 4AS3A 2PWZA 2NYRA 4FFVA 1W46A 4BGEA 3UB3A 1F0PA 3A06A 3QQPA 4LBWA 1H9AA 4MQBA 3OUUA 1UKYA 1X7YA 2YS6A 1N2OA 5CAEA 4K03A 1KOGA 3A2NA 4RDIA 4FGZA 1Z22A 3A4VA 3IO3A 3JQ9A 1JG2A 3REGA 5DW0A 3QEMA 1W48A 3PFFA 2PKRA 1SUCA 2NU7A 3KCQA 3DUWA 4N82A 2C5EA 5F33A 1Y98A 5DLPA 2RH9B 1NYQA 5FP0A 3B1KA 1WVGA 1AKUA 1YRAA 3N0VA 4XSGA 2D0PB 3GARA 4KBYA 3HK2A 3E9RA 1S3SA 5IU6A 2NU8B 3V4ZA 3V8QA 1F5NA 2GXQA 1K3UB 2YWGA 3HA3A 3VH4A 1KY4A 3RBAA 1F8UA 2ZITA 3G85A 3GVCA 4DMMA 1BXGB 2BWJA 4MB2A 5JTTA 1ZK3A 1HYQA 4MRNA 4S2UA 1J8YF 1QIFA 2J4FA 3KZKA 1F0YA 1P2VA 1MIOA 4G1FA 2EYUA 4HWTA 2QD4A 3K3PA 5GMOA 1AZSC 4MYTA 2A7QA 4RHFA 3I23A 1Z17A 4BTEA 2JD1A 1HTBA 4D41A 5JMTA 2GILA 1LJ8A 2PS1A 4EBBA 3GZJA 1KZHA 4C29A 4EPTA 2Q7XA 3SJUA 5HZHA 1Y8QB 2DHRA 4JU9A 4JJKA 2EBFX 1XEFA 4HDNB 5DLEA 3K09C 2GERA 3ZU4A 4GECA 2PFKA 2PJZA 3BOSA 3OT5A 2BMAA 3LA6A 1TD1A 1ZY2A 5CCBA 1PJ4A 4BWYA 1C29B 4TL9A 2BH9A 5EXSA 4AS2A 3T15A 3QFHA 2PHZA 3GPBA 3VOSA 3ZCTA 2QLLA 4E3WA 1II8B 4OUKX 3LGAA 1AZTA 1T5TA 2VH1A 3T7EA 1LH0A 2EKBA 3K0CA 4N0MA 4ZKEA 3U4MA 5J2UF 2QGFA 2JJQA 1EGHA 2QYOA 3KR0A 3OURA 4WESA 5DRTA 4ZRNA 5IMSA 2QN7A 3GFOA 4IIBA 3PX3A 1C9MA 5JCPA 2ZR8A 2Y27A 1WTCA 3I0ZA 4FHGA 4OSOA 1A9TA 3U19A 2FV8A 3HXKA 1SUIA 3IV6A 2VTVA 5BSKA 4PCAA 1JSXA 3LP8A 2PMDA 5IH7A 1ZBQA 3DZ8A 4B4WA 1OXMA 2HTFA 2HRQA 1UBFA 3GDGA 2Q6OA 4KQJA 4YMLA 1LRKA 2Y05A 3AV0B 5ALFA 2WIAA 2IV2X 1CFZA 2J6IA 2FETA 2E2WA 1Q6YA 3KOYA 1ODCA 4ATNA 5H9VA 1CVRA 2A33A 2AJCA 3R0QA 4HQNA 3W34A 5I7OA 2XB2A 2TMYA 1CEEA 3IVCA 2P1ZA 2AOTA 3EASA 1ZINA 1VGVA 3V4RA 1KZ9A 2A57A 5JCZA 2VNHA 5ITSA 2ZAYA 3H83A 3C4QA 3V1TC 3FZNA 4O63O 1I3NA 1DQYA 3K16A 1AURA 4H7JA 2XUFA 5JAIA 4IF6A 4Z49A 3AEQA 4UEKA 1KAQA 5DULA 2J9FA 2LBPA 3UK7A 4CI0B 4CM6A 4FFNA 2N3ZA 3HDYA 4W5NA 2QNBA 5AIAA 4NTZA 3QX8A 5BMVF 1PV1A 2W00A 1BDBA 1GTZA 1P74A 3C5VA 1Z5OA 3DD5A 5JW6A 4LZPA 5TIIA 4P4LA 4XOUA 1Z4MA 1ZQ9A 3ZHCA 1FX1A 1B23P 1UOEA 1VLMA 1KDRA 4HPWA 3USZA 4TLBA 3W9UA 1T8YA 1JUDA 3NWOA 3P9SA 3ZV4A 2A9FA 3T4PA 1VE1A 2XZTA 3QLEA 5JXWA 1JDTA 1IBRA 1NN0A 4RESA 1GNRA 3SBXA 4F92B 1OJ7A 1L0BA 1T4CA 4ESEA 1RXWA 1BFDA 1DMSA 2NU6A 2QEQA 1BYIA 2QNIA 3P2YA 4TV9F 2QVYX 3A28A 1SHUX 4QYIA 2D1TA 2V6JA 2A59A 3I1YA 5D51S 4ZCTA 4BAUA 4IHAA 4TYQA 4I6GA 2HF8A 3TIFA 2WU4A 1KY2A 3I72A 4P2BA 1VYUA 4EF5A 1TJ4A 4RO0A 5FPSA 2JFWA 2VTBA 1KI1A 1NVDA 4G8BA 1XVAA 2AX4A 5U9CA 3VHLB 2FMKA 3KJGA 3I92A 3GEHA 3TS1A 4B8ZA 10MHA 1QH0A 2WHRA 1U7DA 5F3DA 2G1UA 5TQ2B 1XFAA 2SKEA 3TTTA 4PICA 4CODB 3VNBA 3JWGA 3GJZA 4V03A 1KI9A 4U7PB 3RVPA 1T91A 6ADHA 4AVYA 1Q1AA 3HUEA 5EIXA 1YQXA 4IIGA 2XUOA 3CVJA 4IKEA 2VHXA 4WPGA 4L6IA 1KZ6A 5F9HA 3LX4A 2GX6A 4LBYA 5FHQA 4E1BA 2X6QA 4IRUB 5DNAA 3OE1A 3LBAA 2EIXA 3ZE2B 2X4DA 4Y6QA 3OJXA 5NLLA 2G1AA 4OJQA 4ACAA 4YRRA 4OJNA 2P9HA 1US8A 2HU8A 3CJRA 3OO0A 4DB4A 2BUBA 1CNMA 4S1NA 1P75A 1O5OA 4DYHA 4U2CA 1K6EA 2JLXA 4K1LA 2XMDA 3KEQA 4FT4A 2NZ2A 5AUQA 3SF8A 1D1PA 1TQ2A 4J0EA 3OM1A 1D2CA 2CJPA 4K9QA 3RS8A 3SMQA 3L8GA 4FFBB 4DCUA 1AS2A 1CYEA 4H4DA 4PAGA 1G21E 1F06A 3QOWA 2X4IA 3H11A 3OIUA 4MIEA 4CF3A 3PG5A 4KHZA 1JVBA 1BSVA 5HZMA 3AVPA 5BW6B 2PD4A 1U8FO 2Q1YA 3I6BA 1OT3A 1YCFA 1NDHA 3OUTA 4MJ7A 3ESCA 1RJFA 4NEHB 3U49A 4YMTA 3OMLA 2QAGA 2V54A 3LY8A 2X8BA 6PFKA 5JYDA 5LN1A 4ZAVA 1G4HA 1QPZA 4HSEA 2FRXA 2UZ1B 1T6ZA 3PCXA 1NBIA 2A84A 2DXIA 5KKNB 3K4PA 1DC3A 5AJUA 1RXCA 1XR3A 2JCXA 2NTJA 1BC5A 1V1MA 3OI7A 6YASA 3OY2A 2C57A 1XZQA 3Q40A 5ALQA 4JI2B 1V8DA 1A98A 2AE1A 3ANYB 1LPSA 3TW8A 4M1QA 1JWAB 3H86A 2GYWA 2CGEA 2XBUA 3LO8A 4IM7A 4NOKA 4OG2A 5LP6A 1DCTA 1U3GA 2P0AA 2DERA 1GV1A 4FHCA 1X80A 3B6ZA 2IOFK 3LPDA 3X1ZA 3GRFA 2QGZA 2EX4A 2ZULA 4O25A 3OIYA 3D6AA 4JBNA 2QR5A 4ZPXA 2CNWA 2JFQA 4GOMD 4KNWA 1UKAA 4KO1S 4YLGA 1HK7A 4A0FA 3DBHA 4A3SA 5BUSA 5JXGA 5LFAA 4G5XA 2VYND 4FYPA 4WV3A 1EEHA 1EG7A 1GNQA 1QQBA 3W7VA 1X42A 1Y0BA 4LC0A 4WLOA 5BSEA 1E9EA 3L43A 1XAIA 2Q28A 4UBNA 3LBNA 4BV8A 1C4XA 3JATA 3B6IA 1W93A 4WY5A 4O4IA 2W6PA 3PX7A 5T6BA 1ULSA 3BL8A 4I50A 4MTCA 2CF6A 1JQ5A 1C3EA 2H0QA 5BW4A 1W4AA 3BCHA 2HK9A 2X9LA 2EVWX 1CR0A 3FJOA 3I1JA 3RHFA 3UEOA 2HCFA 3BXFA 5LMZA 4MRPA 5JZSA 2IJGX 3RSLA 4YRAA 3IQEA 4RD2A 1KIFA 3IEXA 4UZSA 3LC0A 4MCAA 1FS4A 3N7TA 4I81A 4TTVA 4QHTA 5DM2A 4BVFA 2UYQA 1D8TA 1R8YA 5EI5A 4Z6KA 1ITZA 2IZ5A 3U7RA 4ZJZA 3QQ5A 1J99A 4ZYZA 1R66A 4RADA 4ZGBA 1XTKA 3GT3A 1X19A 1GEEA 1MOPA 4EGAA 4IFIA 1L7RA 4BBAA 2MOKA 5TJHA 4ZCMA 1USUA 3IGFA 1EWKA 4KDCA 4LA4A 1CCWA 4ARAA 3AEZA 4PPGA 3UK2A 1XTVA 4OSEA 4EJ6A 3MUEA 1OTYA 2FSGA 2YZGA 1SBYA 4LXHA 3R0JA 3ZDYB 5JDIA 1GA4A 3LQ4A 5EUBA 5LYJB 1EKXA 3FTFA 1KRWA 4JROA 1ULTA 2LTAA 1CQJA 1UF9A 5A4MS 3L8DA 4UTNA 1NYTA 1OPRA 3SSAA 2GEUA 2GM3A 2BEJA 2O06A 4RHTA 4Y0NA 4WKNA 1YHNA 2J5QA 3MFYA 4L2IA 4YJ3B 5FF9A 2F9MA 3VR6H 5K0JA 4KRFA 3VYUB 1NBEA 2RHMA 3JQ6A 4HNRA 2Z9CA 5DOVA 3CVVA 3IMCA 4QU5A 5IUKC 3VHXB 2AI2A 1QYIA 3NCTA 2IWHA 2QA5A 4EJ0A 3CVWA 3K8OE 1UR5A 3IUNA 4L02A 4NAHA 4L51A 3B85A 4IWXA 3WSVA 2IZOA 4W5JA 2VKTA 3SG0A 3GXBA 4WBSA 2XCSB 1LPNA 4LHSA 2AJLI 3P9PA 2YKGA 5LBUA 3ND6A 2RI1A 5CT5A 4LI0A 1QF7A 5EJIA 2OE2A 3ACDA 3FNIA 3MOGA 1VE3A 1EM8A 4FFMA 4B73A 1QIEA 4DR2B 4JEUA 1Q7CA 2ATCA 3KOXA 4FZVA 4BVJA 1L3BA 3OVMA 1B76A 4AUNA 1L8XA 3L1JA 3DH0A 3FPHA 4C4PA 2HNKA 1QK3A 3HJAA 4MV1A 2OECA 4NOLA 3RS7A 5KCMA 3MWEA 1KOLA 1SN7A 4KGXA 1G8JA 5F73A 3QUAA 3QYAA 4EYKA 4OI4A 1OXKB 2SECE 1USWA 3D6VA 2FFQA 1P1KA 5C3MA 2OKGA 1R4MB 2QL6A 3DM9B 4J0QA 2CJWB 3O3OB 2AOWA 4QC2A 4IQGA 2GJ4A 2OV4A 4QYWA 3TOCA 2BDUA 3NDPA 1Z4JA 5JJ5A 1JU9A 2GJ8A 3PYXA 1PD1A 1GA1A 3QG5A 3VZRA 5LA6A 1X94A 3A9WA 1E1RA 1PO7A 3CLTC 3FRHA 5AM0A 3QLUA 5GJWC 2R1VB 3AH8A 3LHSA 4F2HA 3M4XA 3H9EO 1RD4A 2IYUA 4W7SA 3REQA 2YBDA 4KGZA 3VR0A 4YFVA 4LOLA 5AQEA 4TYNA 4A8JA 1S2GA 4B4OA 3TTVA 1RBYA 1XZAA 2F8TA 4ZVKA 1S2NA 2CL0X 4PF1A 1EUYA 5EKTA 1DEKA 3DT9A 1UOQA 2RHGB 3T5TA 4NZ9A 1Z08A 3W79A 1PG0A 4JXJA 4HAXA 3HE3A 5DHPA 2X0RA 2W6OA 1HNXB 2BDTA 3F3YA 2PGDA 1SAYA 2FPIA 3X3HA 3GRUA 3TCNA 3CCBA 1FC0A 3F4KA 4M0MA 1Z8FA 4DHEA 1E0AA 2ATEA 1ZNYA 3TWOA 4LWOA 3ESAA 4YRJA 1T0BA 4Q9DA 4ENSA 3TW0A 5BV8A 5LP6F 1I36A 2DTDA 3DOUA 5CVCA 1ZNWA 4HDSB 1VZ2A 5F51A 1EJ2A 1VHJA 3LKBA 4JHXA 2B4KA 1KVRA 3AZQA 3Q3JB 4YDRA 4EUHA 1DAKA 1YD7A 2QSJA 3IEPA 3VR6D 4BLQA 4CKEA 2R6CA 3A6HA 1SO8A 3R3YA 2G0AA 3DMGA 4MIOA 3DZBA 3FCCA 3L6OO 4KZKA 2A2ZA 2XR1A 3L1UA 1T5DX 4FCCA 5CUQA 4ID3A 3CR7A 1RCUA 3T6KA 2OFOA 3GCWA 1A0OA 4CGYA 4NJMB 5IZCC 1AO0A 5CVDA 2JKYA 3NT2A 3UJHA 1FFXA 2YJZA 5F5NA 2WI8A 1NRWA 4US0R 1JKXA 4O4IF 5I8PA 3U16A 3QA9A 5ISMA 2UUAB 2N1BA 3BX1A 2J4CA 4I50F 4TT3A 4EW1A 1FW6A 2OUKA 1R8XA 1G18A 5B36A 4LY0A 2XJ4A 4FFPA 4EATA 1W5TA 2EG9A 3V1YA 1KMIY 2GO7A 2HKIA 3IEIA 3E9DA 1Z62A 3ANLA 3NDBB 4DGSA 1MJNA 3H3FA 1WULS 2PA0A 4RHUA 3OKCA 2PYZA 4LY9A 2L42A 3Q6MA 1EUCA 4G5RA 1FTQA 3RC8A 4L5AA 2PSHA 5CIWA 3U1VA 3BS4A 2OHIA 3H5VA 3SK0A 2DPGA 5T41A 3DOEA 4U2DA 4ZT3A 1QOQB 1K7SN 3BC1A 3T7SA 3CURA 1WY5A 3OWOA 1K8XB 2B5OA 2YV3A 4XJTA 3RJMA 1LBIA 5IC6A 1GT91 4GP9A 4EAAA 4YBZA 1EUZA 1ZAYA 5I01A 1KPGA 2A9JA 4W82A 1FIUA 1DBVO 2OCPA 3QVOA 4C7BA 3NKLA 4L73A 3AUTA 2HBQA 4UJ5A 4KI0A 4C4RA 4Z0NA 4TV8B 4AWXA 5E38A 4P3NA 1G5RA 1N7GA 5F64A 1I3KA 1G3IA 4LV8B 3LPCA 4FX5A 2F6RA 1NUSA 1J0EA 2C4NA 1NAHA 1VTKA 2PQ2A 2BFPA 2RBKA 4HDKA 4M83A 5IEJA 5AI5A 2JLRA 2FP3A 3C39A 3P9NA 4OGLA 1AK1A 4YQZA 3T9DA 4YCLA 1IZZA 2GBCA 3LUFA 2HIGA 4A8PA 1O89A 4GVLA 3PFIA 3GW8A 1F1JA 1L3CA 4H2DA 2VBGA 3R7WB 4F5WA 4QU8A 1DC5A 5IJAA 3UAVA 1UJBA 1QHFA 2Q2OA 1SXJB 3DEJA 1RYYA 3ZHZA 3VJMA 4NCNA 2F4NA 4UTRA 1Y5IA 3M6VA 2HJHA 1DBPA 4KSYA 2VF5X 1JXMA 3QG1A 4DR7B 1EXNA 1K27A 4UDYX 4AL4A 3UJ9A 5HVNA 4J9UE 1ZD1A 5C1PA 4MV9A 3R6GA 5I9LA 3UMVA 5TGZA 1UC5B 1ZRHA 3K8YA 4D25A 3H9CA 2NO1A 3CT6A 1IJEA 3VNQA 1PDWA 4W1QA 5CDYA 1JI3A 1G3RA 1MG0A 1T9GS 4BNDB 2C4VA 2IWRA 2OAQ1 1M83A 2C5HA 2P9GA 4RPJA 1HO3A 3SIRA 4IJWA 5JYEA 2MHCA 2FZVA 2ZQ5A 1S8OA 2V1XA 3MYYA 4GX2A 4QHSA 1DAEA 3ILXA 4Y2JA 8OHMA 3JD3A 3EXHC 3W1WA 2CDCA 3HCOA 1TJYA 1OYYA 2Z1MA 3KTFA 3W9YA 2Z5LA 1P2SA 4BP3A 4IDQA 4JUIA 4OQ4A 5G53C 4X8MA 4C7MA 2YZNA 3DO5A 2FDRA 4P7KA 3U3JA 3GJTA 1WMBA 4E13A 2H4HA 1JHDA 3LUCA 4M54A 5LA6F 3TYXA 3WWDA 4C06A 5CB6A 3NHAA 5EEHA 1THGA 2BKAA 1GY8A 1MT3A 2WKSA 2WSSD 2H1RA 3GJ3A 4KRYA 4DSTA 1YFLA 1RE0A 1XPJA 1QIIA 3QWBA 5EMHA 3TAXA 4F6LA 4YRQA 4OFZA 4P92A 5EKXA 1HYGA 2OFWA 1H9CA 5HOQA 4HVCA 5DU2A 1XROA 1OAAA 1F60A 3U0VA 1XF1A 3ZXIA 4Y3UA 2M6LA 5AW0A 2DPYA 3LW7A 1W88B 3FWPA 4LWZA 4MWTA 1U2DC 1U7ZA 1CJKC 4MPDA 2I1VB 2ZJ0A 4PO9A 4CTMA 3B5JA 2VN8A 3FDJA 4OSPA 2BTQA 5G02A 4WCFB 4EY4A 4XVCA 2XGMA 1EIWA 4A23A 3TD9A 1E8MA 1DHTA 3OKAA 1WS6A 1E1NA 4PANA 1ESDA 4PVCA 4CIAA 2NVUA 3EQ8A 2IY7A 3A6LA 1ZMOA 5H59A 1TZCA 1VI5A 2C0QA 1ZXLA 3KV3O 1FQJA 5HS6A 1A88A 1RZVA 2JFHA 4GYJA 4GXRA 2QQEA 4KV9A 4JYCA 3MBKA 2GN6A 1QFSA 4XCVA 5I9BA 4PEVA 1J8VA 1NYLA 3PGLA 1VPLA 1TRKA 2YMPA 2ZT6A 2QZ9A 3LBIA 1JFTA 1LXCA 4JSTA 3N2ZB 3S44A 4Z53A 3PEVA 3I5UA 1RDFA 1OPXA 2F00A 2JEZA 3V2GA 2KI5A 1ZJ5A 3WGNA 2Q8NA 1KEEB 2Q9UA 1JX6A 4FP9A 3UY4A 4B3MB 2OGWA 4LE2A 4ZHSA 1BROA 1Y89A 4YC7A 3GN2A 4I4LA 4J1TA 1S7CA 1DZIA 3IOYA 4FGJA 3NGMA 1P72A 5CB0A 3VBCA 2GZHA 4M7WA 3X1KA 1P0QA 1U6KA 3BL5A 3DF9A 3CEMA 3KSDO 1GGKA 5ALYA 3AYXB 1MDBA 3UUEA 5CTJA 1UMDA 4X8LA 2NZJA 2V65A 1Y8RB 2DBRA 5CGQB 2F8LA 5FBVB 3EFBA 4JC8A 5LZ8A 4AJPA 4WA7A 4TRMA 4GWKA 1SD5A 3EOAI 2OO7A 3KLPX 2I29A 1GAWA 1D03A 4H16A 1LBEA 3TRFA 3VJLA 3IXMA 4LXGA 5FOVA 3V8PA 3CV3A 2NPFA 1JLMA 1UC9A 2JFBA 1DC4A 3WGJA 2E4ZA 1UPBA 2GAAA 3FLMA 1SOUA 2PL9A 2V03A 3GFQA 1XCJA 4IKOA 4JSYA 4EI2A 5ITZA 2GK3A 4Q82A 1LVGA 1Y6FA 5JJLA 1WCV1 1KYTA 5HXAA 3JXEA 4C3UA 4YHHB 4NYIQ 1H6BA 2BY4A 3WYGA 5ELMA 3ZZ1A 4D9IA 4PLCA 4IQ0A 4PE5B 3CUVA 4XUDA 4O8ZA 3GFSA 2YOFA 1M75A 1U5AA 3JQ8B 5LJIA 1NDQA 2UZ3A 4V0LA 3GJ0A 2IBTA 2OC9A 2VCEA 5JSQA 3NUZA 3AB3A 2V6IA 3KUKA 3FMPB 2IHUA 3T61A 2TSYB 3R5JA 1SNYA 1UT6A 1YR1A 3K5HA 3B2EA 3EOZA 4TL7A 1LZKA 3INTA 4FBLA 5FV4A 2WU8A 3TX6A 1I7QB 1KMMA 1UPXA 2ZEJA 2VHEA 2QRVB 1Y3CE 2CL5A 4HGZA 3QMVA 4H77A 2ICAA 4Q39A 1LF5A 2IYXA 2L18A 5K6RA 4DWVA 4EA6A 3WTBA 5FT9A 3NRJA 4UVHA 3AESA 3I62A 1EUDA 1XZCA 5BWNA 2FR8A 3F6BX 3GUUA 2DFPA 3LGSA 3H99A 2A92A 4N3BA 3R7LA 5CG2A 1P5RA 5CX4A 1P2TA 2QI9F 4ND6A 5UKDA 2PMEA 3AEUB 3HP1A 1QX4A 2FZCA 4JJEA 5C37A 2JJ1D 1SURA 5ALJA 1M2VA 4NDAA 2M1ZA 2IEYA 4PZAA 5JAPA 3DMDA 1N33B 4MVJH 1GZUA 3JALB 4BV3A 2YFHA 5EESA 3H5RA 2MR5A 3ROPA 3U4AA 3WYBA 3FPAA 2ZUDA 1X8LA 3A9TA 1RZRD 1R64A 4J0KA 4BBZA 4CLXA 1E2QA 2YUTA 1CP3A 3IBFA 3QLTA 3UYKA 3TQOA 4R31A 3DHVA 4PZDA 4KMRA 4F7DA 4K3UA 3FMGA 4P5EA 3IUBA 1Z15A 2ZRDA 3G7UA 1BHO1 4BVEA 4E5UA 3OCZA 3GLFB 1UCFA 1YBMA 3EG5A 1JWLA 1PN3A 3N1UA 3R7BA 4PZYA 5TEVA 4C5BA 1UMCA 3M33A 4JBIA 2FWJA 5K05A 1YFKA 4G24A 4G9BA 3ZV5A 1GPWB 3AF4A 2JD0A 3PDUA 3RADC 1S2OA 2JFNA 2YZ2A 3LHIA 4FKZA 1HTWA 1N25A 4V0RA 3T7AA 4BKUA 1IH8A 1UDXA 3TIVA 4KN8A 5JS1A 4IUBS 1VL2A 3QNWA 3N86A 3S6JA 1DWUA 2IP2A 5F5XA 1EK6A 4JGGA 1HDXA 3FSEA 5FNVB 2B0CA 3BL6A 3C8HA 1EX1A 4PGGA 3JVIA 1Z56C 3BD8A 3E2IA 3B3JA 4RPCA 1T8TA 1CUWA 5JXJA 1GCGA 4GRDA 3LYUA 1HLPA 3H16A 2WUWE 4KX5A 5JE8A 7YASA 1ECFA 1VLZA 4FE4A 1YULA 1ZH6A 3G2NA 1PGQA 1DEXA 4XVHA 5JRZA 2JLBA 1B8VA 1E96A 1SBZA 3QU9A 1G3MA 4XX0A 4NHOA 2AW5A 2H5JA 3FBTA 4LXXA 3ZCVA 3C6BA 4F93B 3RFFA 5I45A 1TJNA 1BX3A 1TMOA 1PBNA 1VDMA 2IRWA 2VJBA 2XTAA 4U8HA 2C4MA 4H0CA 5GONA 4B43A 3TSOA 3NCHA 5CK4A 1E2JA 4GE0A 5CDFA 2WQ7A 2Y0DA 3EZYA 4BFVA 1S8AA 2YVUA 4MROA 5K0CA 3MCVA 2PWAA 3PFGA 5DNYB 4C1NA 1MW8X 3WNQA 3HJFA 3ZGYA 1RTKA 4UBMA 3T9EA 2QPAA 1QG2A 1XJQA 4OFWA 5ERYA 3ZYCA 1Z4LA 4TL6A 4MI9A 2TMGA 5F2NA 1OYWA 3QEAZ 3RYFA 1E9FA 2QLFA 3HYSA 2J31A 1A5SB 1R0LA 1Y9DA 2PBLA 4G23A 1OTHA 1AKMA 4HAZA 4XGRA 4ZA2A 3EEFA 3A8TA 3KAJA 3OWHA 5AHWA 4CMKA 1LX6A 2RGAA 5CVEA 3UAWA 1WBBA 1MGOA 2H59A 1PZFA 3ADBA 2FJPA 2JIOA 4MJLA 2QGNA 4HXFB 3QEJA 5AKGA 1NTRA 2EJCA 3DL0A 4XFDA 2MT9A 2AH5A 1SVLA 4X44A 3W8FA 4B71A 5LMNB 4A5SA 2NLOA 1G8YA 1RI2A 4RPIA 2KHZA 2FPGA 4LBZA 3RUCA 4UU8A 3AUFA 3UW3A 4E6PA 4N48A 5B4VA 1EVJA 3FY4A 4BFSA 3E9YA 1T2UA 5JAZA 1C1XB 4D3FA 3GPCA 4GVXA 1O77A 4GGPA 4IEEA 5FTLA 2QT9A 2V8OA 1U80A 1F8GA 2JIZA 4CFYA 1PLJA 2VJPA 4BMYA 3AR5A 1T4GA 1JKJA 1Q84A 1OH5A 4LJLA 4LF4B 1IN6A 1IXZA 3GUHA 3U7EB 2Z3ZA 4YP6A 5TQ0A 2YXPX 4RETA 2O23A 4BAGA 1M8JA 4BU0A 1TEHA 5K45A 3FCAA 1DIAA 3BA6A 4DVGA 3FLBA 4H0NA 1U90A 4TMVA 5D5PA 1HT1E 3RF6A 3M8KA 4A27A 4XFJA 1SQ6A 1U0RA 2J6HA 2QYHA 2QIPA 1IY0A 3EIHA 1E5QA 3DVQX 3NTLA 1UZLA 2HX1A 4KYVA 3PDCA 3EPKA 2ORWA 4A73A 1X39A 3G5TA 4N9WA 3JYPA 3ZW9A 3BIJA 1ZWLA 1PX2A 1RHQA 3AUUA 3MT7A 1DAGA 2O7NA 2WF6A 1V8OA 1I3MA 3LUBA 1PJTA 1EB8A 1W94A 5HR5A 4TLDA 3VZPA 1TKBA 1HYEA 1CEYA 1P4AA 4L08A 3NVKI 2LR0A 5REQA 4BFCA 5I6DA 5KNDA 5DM0A 4M36A 1R6AA 4D8YA 1XZLA 4FYMA 3SWWA 2WLTA 3BMXA 5CJJA 5BXYA 2INGX 2OK8A 4J1QA 3JRXA 4LMBA 1XXHB 4RTSA 2HB6A 3DBLA 3GFBA 2EQAA 4KRGA 3VTKA 3I64A 1SG9A 3NBAA 4J7AA 4MUHA 5L3VA 2D2EA 2Z9BA 1V6AA 5C7LO 3WLMA 5L3SA 1VKHA 3GAFA 1WP9A 2VKQA 1F6DA 3DLPX 5K4AA 2J7PD 1I13A 3ORHA 5TV2A 1WB6A 5KTNA 1ULAA 2DWPA 2OXRA 3MCAA 3NS7A 1FDOA 4Y9RA 1WPRA 4G26A 5D3QA 4E51A 2CFTA 2A1TS 5KSOA 2OLJA 3DLTA 3RJZA 3DEKA 3PU6A 5C5IA 1YE5A 4J16C 2QL9A 5LC1A 4QULA 1WB9A 1J0DA 3L8FA 1S1MA 4EHIA 2I2BA 2RCNA 2OAP1 3C1OA 4L50A 4LYHA 3WHKA 4DBLC 4G0YA 3RABA 3TTWA 5DGHA 2QT0A 3BMQA 3W5JA 4LDZA 2Q29A 3E7PA 1R4ZA 4E5YA 1YB6A 4LF6B 3NHUA 5AKEA 3TLGB 2V97A 1IATA 4GOXA 4I4CA 5J4KA 1UWCA 1NNEA 1XF9A 1A9OA 1MO5A 4J2TA 4OVKA 4TRNA 5IJ9A 2VJKA 1IJBA 1JI0A 5J3JA 1AF4A 3KQYA 1N6NA 1EXDA 2VA8A 4G9EA 2P8SA 3K9WA 1N3LA 5CVJA 2R8OA 1M2EA 2OOKA 2PY6A 2RAPA 2ERXA 1DQRA 2D4HA 3VMFA 3KFVA 5K0FA 5BURA 2SNIE 3KTAA 4J7UA 5HW0A 3LBFA 4L78A 1I7DA 1J9ZA 1W581 1SCKA 2Q7OE 4YRKA 3AM5A 5K8TA 2JIRA 4L4ZA 5EVJA 4MCIA 2VPQA 4B3JA 1YDWA 2JHAA 2V45A 3DKIA 3D3KA 4GOJA 3PCRB 4E22A 2ZBRA 4L5YA 1G59A 1OH7A 3FTEA 5K3BA 1Q50A 3DE1X 2C2WA 2Y1XA 4XA8A 2R1TA 4I1VA 1MF7A 2ZS7A 4X90A 3DUFA 3IT2A 1V47A 1YK1A 2R66A 3MB5A 2JFPA 3CRW1 3PGKA 1UXIA 4EF6A 4REQB 5JUWA 2PO7A 2WTMA 4NECA 3ZE7A 3PWTA 3OTOB 2XQKA 3OJFA 2PT9A 4OHXA 5LBTA 3WLAA 5JAMA 5JS6A 5KYXB 2R7AA 1JPVA 4IBOA 4PIMA 2D59A 1CNEA 2PVCA 2IEZA 1KVSA 3T52A 2PX2A 2H92A 2FW1A 2A7XA 3I2HA 2K6GA 5A71A 1JEYB 3V3KA 4EL0A 4IJ6A 5CLHA 5ES3A 2WDZA 5KQRA 2H16A 4B44A 1CUCA 2PGAA 2JZNA 1E9AA 1N9ZA 1JR4A 1P44A 1ELOA 4U39A 4Z54A 3P27A 3I6YA 5DN6A 5AQ1A 3ZGOA 1OAKA 2I1WA 1C4KA 2LW7A 5AKKA 4EI8A 2OHGA 4YJFB 1YJXA 3DMTC 1JSCA 4FUTA 2B6NA 2WM2A 1Y7HA 4RA9A 1YGYA 2OXIA 5EHNA 2CVZA 3SZMA 1G20A 1SU6A 2XMPA 2VT6A 3GFPA 1F38A 1XGKA 2FW6A 1D2RA 1YVEI 3P97A 2C31A 3JQFA 3NWJA 3DF7A 1RKBA 4F5YA 2XEXA 3L46A 1R0BA 1YVRA 1R12A 1HY3A 3B7PA 3HJGA 3S2UA 3E2MA 1MQAA 2BRUA 3F98A 4YIHA 1Q44A 1WSWA 5DX8A 1UKCA 4M88A 4MQFA 2FN4A 3M9LA 5CT6A 3OZSA 4KQMA 2DBVO 5EJ8A 5D6OA 3O8QA 4JIGA 5CA0A 3QELB 1E4EB 1DB3A 2YX1A 4WASA 3E5HA 1VZ3A 4JL6A 4XUEA 1QLJA 1DFGA 3D4NA 4R8SA 3WK9A 3R77A 1Z2NX 4ZVVA 1R7RA 1T0UA 1E2PA 1JFFA 1W8DA 3KPJA 1WXXA 5G0TA 3TSYA 4IG4A 4B09A 3OOWA 1PEYA 3R3SA 2HQSA 3JWEA 3QFTA 3L4BC 5IZ4A 1QIMA 1E3WB 2WICA 3WLOA 4Q3LA 2QRHA 2Q9CA 2FEKA 1MZPA 2BONA 4R40A 1BW9B 4CM4A 5CB4B 1GQYA 5E6UB 1U4OA 1X7ZB 2DFLA 5EE1A 2ZIVB 1UPCA 5LL6P 4RVUA 3BRCA 2RONA 3M4JA 1TUGA 3Q5DA 4HRVA 1YS2X 5CBPA 5EHQA 4X65B 1A27A 5EUQB 1WW3A 4GBGA 1HE5A 1NMQA 3ZDAA 4N9QA 4TMFA 3MCZA 4FPXA 1WU7A 4BJ3A 4ESVA 4HEQA 1UJNA 1ZP6A 2ZTMA 1O03A 1YBVA 3LFHA 4HB0A 1YKSA 2HWUA 2L2QA 4L8GA 2YJ5A 4LNUA 5AJTA 1D0SA 1PK9A 1U2GA 2CN1A 3P32A 4UASA 3JZMA 4ENWA 2QG4A 1XVUA 2WNIA 4BLOA 2ZPAA 1P7YA 1TPYA 1U5BB 4QOIA 1X7WB 1SK8A 4RE5A 1AQLA 4JQOA 3CBGA 3TRJA 2H9YA 3U3XA 1QE5A 2BHLA 4GI7A 1GAJA 3QLJA 2WD8A 5J43A 1YRHA 2ZJ3A 1MFZA 3ZU3A 2V0CA 3E27A 3KT3A 2E82A 5IDXA 3DT8A 1ISSA 4LE1A 3TOXA 2BGUA 3SHVA 1QVAA 4RJ2A 4RSRA 1SFRA 2IEGA 4GMXA 2J9RA 4KITB 2QDKA 1JHUA 4W6ZA 4P22A 4PQFA 4WIAA 4DNXA 1SVIA 1DAOA 1NOKA 3DXFA 5KS2A 3S1AA 2QXUA 4LOIA 2ZM5A 3UJDA 3D7RA 1KYXA 1XUOA 1WQ4A 1JXAA 5EJ7A 1RW4A 4KQWA 1PFWA 1VL5A 3ORSA 4PO1A 3TAHA 3OM0A 4I2NA 5B1SA 5JXHA 3ZLJA 2NUBA 2BE9A 3RWOA 3L5KA 2X8JB 4DQXA 1TGYA 1BD3A 4NXMB 1CLEA 4H18A 5B7QA 2CEAA 3KQUA 5K09A 3HVHA 1W35A 5TC4A 4ZHQB 3OM9A 1REQA 3S55A 4DCNA 5EUCA 3VU8A 4HAUA 1X0VA 4G5GA 3UATA 5JVDB 4YRTA 1MAWA 4PZ0A 4I1PA 4WGFA 3EGXA 4A2PA 1OOEA 2XVMA 4MNTA 4O4HA 5F7OA 2BEVB 2WWYA 1I51A 2AOVA 5EA2A 1XWFA 1C3JA 1KXZA 4X6XA 1Z4QA 1NE2A 5K99A 1E20A 2Y0EA 3EFEA 2XLCA 3AT1A 3P8ZA 4JK3A 1EH5A 1JHOA 2OORA 5HKLA 2WJZB 2GKGA 2BI4A 4BY9E 1M2HA 1E1QD 2VR1A 3UMSA 3AI7A 3NAGA 3CH7A 3SFZA 4PG4A 4KLAA 3QHPA 1XA4A 4BO6A 1T36B 1JN0A 2HZ7A 3ISVA 2AMFA 3NC1C 1EBUA 4GXTA 4JJIA 4QUKA 4Z3DA 3A1DA 2PL3A 3I04M 3T8YA 2R3SA 1A8IA 3KPUA 1J24A 4RF4A 1H2ZA 1XAJA 1OFUX 3KVRA 2A9RA 3LMKA 2MTBA 3BMOB 4H15A 2ZDQA 4R05A 3DYVA 2O8NA 1C3OB 3GK3A 1FYDA 4JCCA 5AKZA 1VKNA 3BB4A 4NIMA 4P84A 4R2XA 4FJ1A 4HNVA 3N87A 4Q9JA 1QHHA 1Y1KE 2YRFA 1ZOLA 3RVKA 3GEPA 4AROA 4EKYA 4JHLA 1HE8B 3OCUA 3LCCA 4IDCA 3LFUA 3OPNA 2JGAA 3CZAA 4FI3C 4CE6A 3AVQA 4YWJA 4DS3A 1LQUA 4LOHA 3K9FC 4ZOBA 5LU9A 1GTL1 1B2LA 2O2IA 2OBXA 1EE2A 4Z7QB 3CXUA 4HNAA 2CVQA 1P81A 4D0SA 1N6PA 3LCJA 1WUTA 3DVSX 2W2KB 2GBGA 2EWVA 4GKBA 4MJ3A 1W5AA 1ZIPA 1PDOA 3EZGA 2JIPA 2XQIA 3ENNA 2HLNA 2BT4A 3CSUA 1Q5PA 4RTQA 3ZCXA 2OT3B 5FCDA 1WF6A 2P40A 1ZGHA 2ZJ6A 3FB4A 1JE1A 4P8RA 3OP4A 4UOQA 5DFAA 2IIBA 1ADGA 3DOIA 1YS4A 4L0MA 4XKJA 4C1BA 4C0SA 2CXUA 2EQ5A 5AHKA 2HCRA 2R5FA 4EHNA 4JZYA 3E9CA 5M3BA 3MLAA 1OX4A 1E0SA 1S0UA 2QD1A 4I1SA 5D7BA 5DBOA 4M0KA 3EGDB 3SLGA 3U2QA 3OFKA 2RH8A 3F6EX 4I99A 2YUIA 5TQVA 1W87A 3JYQA 2AUMA 1L8OA 1VHLA 2IZ7A 3EAFA 3AJDA 2CDRA 3DOCA 4WK6A 3VU3A 3WLSA 3COVA 5EY5B 5JBIA 1Z18A 4KR6A 2O8EB 4D46A 4GQBA 2Q4RA 3AJ9A 2M1XA 1ZK1A 2PD3A 4ZJPA 1OH8A 2UVQA 3UAGA 1JLSA 2W4MA 3U7JA 3K9BA 2N1MA 4JL8A 3X1XA 3RS4A 2ZJ1A 1FDIA 3MLBA 3KR2A 2V0GA 2GFQA 3IT3A 3L8MA 2R1ZA 4UMDA 1SELA 1J97A 3KJNA 5CW2A 4M99A 3Q4GA 2EFGA 2VBFA 2ZZKA 1JHAA 3HU1A 5A3JA 3UXEA 2C5SA 4A5OA 4Q18A 4UJ3A 1VM6A 3PLNA 4QFDA 3KKOA 2WM9B 3CCFA 4KVFA 2I9KA 2BGWA 1VG1A 4RWEA 3DL7A 4FDTA 4WH0A 2ZJZA 4R71A 2FEXA 3S5JA 2HT6A 4LHZA 1ODSA 2NYVA 4JB0A 4Q4LA 3DDOA 4QE3A 1YDEA 3M3DA 4EO9A 3F73A 1Y5LA 1UK9A 2AS0A 2SHKA 1DAPA 2ZE7A 3M1LA 4NZMA 4NL4H 4RY8A 3RJ5A 5DK4A 3T7IA 5JNTA 4M0DA 3T4XA 5J2TA 3FCUB 1G7TA 1VHDA 4UNPA 5DK6A 2ZYAA 3DZDA 3RWMB 3ZJTA 3U60B 3ELUA 1C5KA 4H7EA 1ZD8A 2KBEA 2CLEB 2B8TA 3MSCA 5H16A 4G0WA 4RELA 2BW0A 1QFMA 5BY2A 2GHIA 3IODA 3NM4A 2C5GA 2CNLA 2VO1A 4OFBA 5IAJA 1Y34E 1DAFA 2QUAA 3I76A 4H6VA 4KX3A 4MO9A 2QM3A 4TGLA 2OFPA 1J20A 2YN0A 5KINB 1J2EA 4Q16A 1JZTA 1GXSB 3BRWD 4BO8A 1Z33A 3GQVA 4JLAA 3V9AA 4DRYA 5EG5A 4BYMA 2FFBA 1KO8A 1YT5A 1OIXA 2BJHA 2FJ0A 4GM0A 1JG4A 2CFIA 2Z6VA 2EXXA 2ZUUA 1AK9A 3OPVA 4ZO8A 2VZLA 4JMLA 4TTQA 2W6CX 2KWIA 2V4ZA 4DA8A 5FBZA 1IIBA 4F2PA 2YIDA 3HRKA 1XRMA 4RMHA 5A9SB 4CW7A 4IOLA 3E9ZA 2VYNA 1JG1A 2H6EA 3TTUA 4LV6A 1M0WA 5JPDA 4O4HF 1PFUA 1XDSA 1YZQA 3NH6A 1L6RA 3C3YA 4LGYA 1N9KA 4X3CA 5F76A 2XXJA 1E3IA 2QAIA 2R8XA 2QLNA 3UZUA 2FRDC 2J9GA 2JKVA 2IHNA 3OBIA 4B1FA 4NE2A 4HDOB 1N5MA 2IEIA 3IAXA 2DR0A 2W0MA 3B6EA 3HDJA 4WBNB 1CZLA 2QRQA 1A82A 4DV3B 3NYRA 3CC8A 5SYMA 3KHTA 4IQ8A 1IULA 1MJFA 2PZBA 2OFXA 3PQ2A 1UINA 1YL7A 1WVIA 2B61A 3RS9A 4Z4CA 3EZ6A 4ZMBA 4AG5A 1TC2A 1JV2B 3GDFA 3WQRA 2ODEA 1OXBB 4IDGA 2A9OA 2VAPA 2PX8A 1JALA 4G1UC 5KOJB 3HXOA 1XG5A 4HFMA 4IHJA 1ZONA 3L2OB 1TW2A 4FGSA 1ONPA 5CLJA 4G5OA 3SEFA 3PUXA 3SHFA 1FX0B 4DM7A 3NWPA 2AQKA 4NESA 1OV4A 1HFEL 4XYMA 5DCLA 3SX2A 5ICEA 1DELA 2VDWA 4DSAA 2P90A 4XGKA 5I51A 1ARZA 1RFLA 1U7UA 1SC4A 3M81A 1SUWA 4FSXA 1KI2A 2X9QA 5L3ZA 5AVQA 2PCLA 4B6SA 4C2UA 1ZSNA 4AX4A 1RQGA 1Z6GA 4F21A 1O57A 4OKIA 2XF2A 4NOJA 1CS0B 2VWPA 4AULA 4MUGA 4KEAA 1QHEA 1Q0QA 2WVGA 3IV9A 4XWGA 1YNSA 1BJRE 1NI4B 2ZB3A 1B1CA 4NG5A 4LDNA 3VPXA 4MWCA 4ZK2A 1L4LA 4RVSA 4RFLA 2W2VA 1R9NA 4L8YA 4MVJI 5JZ9A 1N8KA 3HCDA 1GPJA 3VYWA 4NVRA 3QV2A 4QG3A 1QTQA 2WWIA 5EZQA 4MUNA 2JI6A 4JD5A 1NQXA 1F2DA 1I94B 1NV9A 4KAXA 1RRKA 3H04A 4QU9A 3T38A 2PJRA 3UMCA 1Z6YA 2EOAA 1RBQA 2REOA 2WKRA 3CFYA 1VCIA 3KNZA 4H60A 4MV6A 1I30A 3U3RA 2PZ8A 2BC9A 4GZ3A 2YR0A 3QVUA 2FZLA 4JQCA 1TQDA 5DTQA 1C1YA 1W1WA 1WKCA 1L5HB 2H1VA 4RZHA 2XDWA 3RFUA 1E0JA 2V4MA 4WVFA 3JD2A 5ED4A 1YJ8A 4YI5A 3ZGXA 3NXSA 3V4SA 1SH7A 1W75A 2WEKA 1KE2A 1SKYE 4NS4A 4XPIB 2G6BA 5DI9A 821PA 1M7HA 3NIGB 4GQAA 5FHRA 3OZTA 1T9CA 1XTJA 3QU2A 1XEWY 4P4GA 4E5VA 2CCGA 2EV9A 4DT1A 1V48A 3KCNA 5CYPA 4MS3A 1P18A 1ZA2A 1QC5B 1XQVA 3JRNA 4H31A 5TMEA 1MJGA 2VNJA 4LF8B 3O90A 3MLEA 2J59A 2YZKA 5G0UA 421PA 1KQPA 4XR9A 1SC6A 2BJWA 3VFDA 4YQYA 4FFRA 5E6SB 5GIPE 4R3UC 5G1NA 3ZWNA 1A5ZA 1H2YA 1YONA 1SXJC 2O3JA 3TXYA 2WR8A 1CZUA 1BNCA 4K8OA 1HKUA 4GKAA 5E7IA 1NQVA 1P4GA 2ZR9A 1XIVA 2ZCVA 3UAZA 3UHAA 2ISSD 2XCQA 4BJHB 4IG9A 5C51B 4U02A 4B0OA 4QRDA 2LGJA 4ROSA 4L5IA 3W6NA 4GC9A 1BDHA 1UK7A 5A2GA 3ZI7A 1KQ3A 2DE0X 4WN9A 5GZ6A 1DIGA 4M7RA 4C7KA 2HJGA 3CYFA 5J2TF 1NXSA 3PK0A 3IR7A 4BE4A 1BDJA 1KH1A 1O1YA 3AEYA 3HDQA 4O1MA 2V5AA 3FUXA 4PO8A 1WD5A 3GOHA 5CX1A 4G0UA 3ZH9B 1VKZA 4AW9A 4RZ3A 2WWVD 3GLRA 2ZAIA 4YMIA 2XB8A 3GCZA 4HLDA 1OROA 4U2EA 4GZ5A 3HRHA 3DDZX 4LC9A 1TZKA 4UM9B 2FGKA 2WMNB 1UEXC 4BQSA 2QT1A 2BJVA 3NYIA 3V55A 3Q8KA 3BSFA 5ALMA 3NFRA 5KREA 5LQMA 3H5AA 4N7JA 3IAM1 2NXCA 2VUHB 4X7PA 4GXQA 4D9NA 4F3CA 4P4SA 3UV7A 4ZI3A 3IUYA 5AM4A 3PC4A 2WJ6A 1BD4A 3N2GB 5EMLA 1EFKA 3PE6A 4F8EA 3B53X 4MUFA 4I55A 1PJLA 3VR6A 3VUEA 5CDTA 3VR5H 3IP3A 1K92A 1N3YA 3MGAA 1OZFA 4BX0A 1EZ1A 4KPUB 5KNBH 4MTLA 4KC0A 5KX5A 3RFCA 1KVUA 3Q3HA 3DWIA 1NR7A 2I1QA 5IYZB 3GFRA 3E05A 4WCFC 3S99A 2W90A 3A3KA 3W5VA 4A16A 3R0VA 4A6XA 1NC1A 3TH5A 1QZZA 5IN4A 4PAWA 3KTDA 1EK0A 5EZYB 4OHVA 1WOMA 5CH8A 1EVIA 2GN2A 3SNKA 2AF3C 1FP7A 4HQRA 4R0VA 4DMGA 5BOSA 3IESA 2GM5A 3HCAA 3TL2A 1TQ4A 2QQ5A 3KL4A 5HQJA 4RTLA 1E63A 4G36A 1DVRA 3DZHA 4HWRA 2WF9A 4NBKA 5COBA 3GOQA 4GW3A 3B9RA 5KYKA 1GARA 2HJ9A 4OK5A 4V39A 3FKQA 2WZQA 4AFNA 1IG3A 3M5PA 3LWZA 3ITDA 1NMEA 1QGUA 5DTIA 3BTSA 4JYBA 3X1WA 1PYOA 4IHJF 5HRAA 2PMKA 2XCRB 3PT5A 3H42B 1CVIA 2QUBA 4MUBA 1J5EB 3NETA 4F9TA 2IUUA 2WW8A 3N9IA 4ABTA 1Z5PA 3R44A 3IDSA 4MQEB 3UH0A 2UUCB 2FWBA 2ZBVA 2P3QA 3D7SA 3HL4A 2PV7A 2WU1A 5DW3A 2CVFA 2JAOA 5ITVA 3BZWA 3OH8A 1WZEA 4PWZA 5IPFA 3R0XA 2V5UA 2ZI3A 5BWMA 1Z63A 2Q0SA 2VK1A 3QE9Y 1R0KA 3P9ZA 4M8NE 1JIJA 4R8KA 3AVYA 4REMA 3BWVA 3OD1A 2GCIA 3NPMA 1ZCJA 2EU8A 2ZBEA 3O8OB 2VZEA 2VHQA 2EAUA 2VA9A 3EW9A 4MVJE 2XLBA 5F1OA 2QPTA 4A2WA 1TPZA 5JJIA 3TR5A 5DMXA 1CUUA 1P8JA 3IO5A 4TTSA 2QLTA 3GGPA 3QVMA 4J75A 1UWKA 1CB0A 2IXBA 2VJYA 1BWPA 4QQ8A 5GY7A 2MSCB 2FTKE 3TQTA 3X1DA 3CRVA 4KIJA 4O4JA 5IRCD 1K68A 5BT8A 1FSPA 1HOXA 1NJ2A 1D2GA 5JBNA 4BNGA 4LYAA 3CLTD 3KQMA 3BQMB 3RRFA 1O58A 1OB2A 2IOYA 2WJ4A 4CTNA 5IKMA 3PDHA 1EGMB 3LDUA 3ZE8A 4IFBA 4R9NA 2BLNA 4RK4A 1LCIA 3UO8B 1HRDA 4BNIA 4JUCA 4D43A 3H8WA 2H2HA 3NFYA 1KEPA 1H2EA 2ECPA 1CJBA 2P78A 2PZFA 5DTJA 3TJMA 2Y1EA 1GTJ1 3TR6A 2JA1A 4NWIA 5KTKA 1FP4B 3G9ZA 3S8MA 2AQIA 2PT6A 3VR5D 4AJHA 2B0JA 5ELXA 1EDZA 1IZYA 2EERA 1A95A 1T1GA 1YZTA 3QU7A 2HD4A 4M6WA 4ECEA 3AJ8A 1T2DA 1XCPA 3QVJA 2XYGA 1STOA 2AT1A 4M9SA 4AJ9A 2BELA 1J0XO 5KNBD 3U4QA 3TW6A 3OFSA 3JU3A 2FW0A 5EE0A 2E87A 4GYYA 5B1IA 5K0GA 2X40A 2RGNA 3F0TA 2CLDX 3DCJA 3Q7TA 2ZT5A 3FYUC 3ADOA 4CMEC 1FFAA 3KP1A 4IX9A 2JW5A 4BB9A 1R0RE 1I80A 4HVLA 2ENUA 2I4RA 3HKEB 1DDGA 2H57A 2O0JA 4PYKA 4R1QA 2P4EA 1CE8A 1QH8B 3CLRC 4NENA 4RHEA 4NU5A 4LFCB 3EVAA 5BR8B 3N0XA 1B42A 4XOIA 5KDDA 3QE4A 3OEED 1H23A 6REQA 5JJCA 5K01A 4PR0A 2ZVDA 1C14A 1M8GA 2WSSA 3MJSA 3QKIA 4KOAA 3PXGA 3V8BA 1DC8A 2IYLD 4G01B 1IUKA 3D6JA 2W98A 4MVJG 4RULA 2HC9A 5FI0B 3SHWA 5JAUA 3DPIA 2CSUA 3UOGA 3PXDA 1KTIA 5A1TA 4Z4QA 2D1FA 4EABA 5HCUA 3JZDA 3A4NA 3STTA 3ZCPA 3G3EA 4NZZA 4YV0A 5AW2A 1V7ZA 1I4OA 3OX1A 3CVXA 4WZZA 4HDMA 3H9QA 4OHMA 1OAOC 4BKMA 5A3VA 1Z0ZA 2RJ3A 1LNQA 3R74A 4PINA 4PLTA 4HYTA 5T3YA 1GM5A 3IE2A 3LYLA 4TT8A 3WFJA 1DEAA 1EDBA 1E2UA 3V2HA 2G76A 2V7XA 3RU2A 1E3JA 3ZKAA 1UKZA 4RIEA 5DCUA 4YI3A 3ZWXA 3VC7A 2VFAA 3BXZA 3HVRA 1V4VA 1J8MF 4I55F 1YJ5A 5CU7A 3PQFA 4EZIA 2UU9B 5AWFC 4BDSA 3EFOB 1DTWA 1M2NA 3JQBA 1LVHA 1G8SA 4R68A 3NHLA 2FPSA 1LTKA 5PNTA 2I78A 4EBFA 5KX5F 1LDNA 3QPUA 2BZSA 4OMFG 2ZB2A 1QDUA 3V7WA 1H5QA 1JJAA 1IBCA 1AD2A 1X77A 2ID9A 3WGZA 1DO8A 1EVLA 1V3UA 4AJIA 3TNLA 5K3SA 3G5LA 5GVSA 3QP9A 2WUVA 1D5WA 3L6UA 1PR1A 1U0TA 1ZUHA 1XCOA 4DVJA 4OJYA 1E2KA 4KR7A 4AJEA 4EM6A 3CUTA 5D2CA 4D45A 5HHTA 4DMUB 1TE2A 3GRPA 3MWGA 3E1KA 3MXOA 4CCYB 1WX1A 3KJHA 4UAVA 2Z8YA 4JVNA 4E5DA 4CKZA 1YACA 3ZOKA 1JQBA 2OCYC 4L9AA 3AJRA 4ND8A 3T3MB 4DRZA 4EGFA 2NUTA 4LWQA 4BFXA 3B36A 3GUVA 3UCFA 4BLUA 4O2LA 4CLRB 4OMCA 2BR3A 2JBWA 3MHPA 2ECQA 2GRJA 3C8ZA 3H84A 1ZJZA 2WE7A 1Q19A 3PQ4A 3REFA 4AQ7A 3KZ1E 2ZAOA 4Y0VA 4PX2A 3X0DA 2F4VB 5I9SA 1JQEA 3LUAA 1E2IA 2COKA 1VE6A 3H9BA 5JCJD 4OMDA 2AEEA 1T5HX 2MWMA 1DUIA 3HRIA 3CNBA 5GZ3A 1XPOA 3PXAA 4UM5A 4JVMA 1PWYE 4TRJA 4IIEA 3CB2A 2G6TA 4CBVA 1KK2A 2Z08A 2WWTA 3H5TA 2FW8A 1DFIA 4PXYA 2BFDB 3O9VA 3EBOA 2YY7A 4HFNA 2K2WA 3HACA 3R75A 3KKQA 1DHRA 4CT5A 4QDXA 1LFAA 1LS6A 1QVRA 4DLLA 1D07A 5THXA 1LBSA 2O57A 2VJNA 4PRKA 4PY2A 3RW9A 4O4JF 2VWHA 4PCLA 5D5HA 3VSEA 4AG3A 3HR4A 3AU9A 3N0RA 2AEFA 3C3KA 2VSNA 1QS0B 3GWGA 2JLSA 3TLYA 1YB4A 1J25A 4CMIB 3RU9A 3QHAA 3R9WA 1FUUA 3L9WA 3MQ2A 4GPTA 5DT2A 1XMVA 4AZ3B 1ONNA 3VR2D 4XM0A 5LNK1 3R9XB 4C88A 4BL5A 4Q47A 3EISA 2ZWPA 5IG2A 2OO3A 1P3JA 3NV7A 5AOVA 2O2DA 1ZJYA 1JSZA 3OZWA 2JJ1A 3QVSA 2YIVX 4OK6A 2HF7A 4URWR 4YMSA 3ZWAA 4CWAA 4HH3C 4IXWA 4JA2A 1OCEA 2A5JA 1RZRA 2FN9A 2BCGY 3PJFA 2ZUFA 4AZSA 3IJ5A 1F2VA 2IK8A 4CV1A 3NBXX 4DJEC 1BS9A 2AEMA 3Q1KA 2CYBA 4Y2TA 3JQDA 3G9QA 3AW9A 4BKRA 4MWDA 5C5CA 4LSWA 4MRMA 3OLQA 1OIWA 2ZBDA 1ZJ4A 4LY6A 4D0LB 2H63A 2I8LA 4DV2B 2Y1CA 3TOZA 5HSGA 3NVAA 4D0NA 2DUNA 5DISB 4EHBA 1F14A 2FSUA 3R3VA 1E3QA 3K6SA 2ENWA 4J3JA 2GJSA 4OJTA 3O4HA 1KH2A 5KPJA 1NKSA 3EXIB 4NABA 5LVAA 2JJYA 4RL4A 2FMIA 2D1QA 2X5NA 5CH5A 1PWEA 5JSFA 4QAQA 5CLFA 2AFVA 3KB8A 4DLVA 3SHQA 2Y2UA 1K4KA 3U62A 2IHYA 2BFFA 3S2ZA 3T5PA 1C8BA 3I01A 1XN4A 2JK1A 3D4LA 1V8FA 3P5BA 4JGIA 4ZDIA 5F23A 3BULA 1SWVA 3BXOA 1IAQA 4YONB 3UTDA 5BP7A 4ER3A 1G2QA 1X7YB 5G4KA 4XWAA 1B16A 4QGHA 4BKOA 4HMQA 2UZIR 3D3JA 4RLSA 4WBXC 3QVXA 1XCBA 2ZKIA 4NHEA 5FUWA 1LSSA 1Y6RA 5EJGA 2C2MA 1GZ4A 1Y3IA 4ESOA 4QNRA 2NU7B 2O2XA 3EVZA 4PC1A 4Z2YA 1DDOA 4Q5IA 3UPTA 2P2ZA 4KWHA 3NQ41 3RGWS 2GCGA 4RU1A 4IJQA 3URKA 3WWPA 4C3VA 2YYYA 5F1YA 2XV1A 2VP5A 2XSZD 4K2AA 3MQ4A 1J8QA 4C4XA 3ACCA 1RLJA 3IP5A 2H48A 2C2KA 5IVPA 1V16A 1Z0DA 2BM9A 3HVJA 3MA0A 2QX6A 1TZBA 3E8MA 3NBKA 3TZCA 5K0NA 4LGCA 5F4BA 3RTGA 2DU8A 1DXQA 1WXEA 3EVBA 3R40A 2GBLC 3MM4A 2XUZA 3KKLA 4JUAA 1B26A 1YRQA 4FNMA 1TA0A 3RCBA 2Q4TA 3K4HA 1XL0A 4B7AA 3B6JA 3BMCA 4YV1A 2F3SA 4Q3BA 4O2RA 4NH0A 1VRVA 2IZ0A 1D3AA 2AFHE 4Q24A 1NVFA 1R00A 3B3FA 4OBWA 1WJGA 4FT2A 4NMHA 2JGDB 4OGKA 2B8NA 5GVRA 4BVAA 2HRZA 5BN3A 2A5GA 4RTRA 1N9GB 2R5WA 2XXBA 3NM6B 1KU0A 1B0PA 5TF4A 2DRIA 3T9BA 4K81B 1WOYA 3GLSA 1Z5UA 2J3JA 2PANA 4H59A 4JP1A 4UREA 5H81A 4AZVA 4DLZA 1KGSA 3VC3A 2DSTA 4R16A 3L6RA 4U1RA 3KOOA 2YCBA 2IIQA 5LMCA 4EGCB 2J0QA 4BO4A 5IXYA 3N6VA 5BVGA 2A30A 1EVZA 3HR7A 1WDKA 1IN4A 3CF0A 4F4FA 3AEKA 3K0KA 2A14A 1Z7WA 2QQ0A 1E8NA 4KMMA 1W2WB 4RMJA 3BIWA 1DE0A 3EYWA 3F5MA 1XLTC 2PX5A 3M6MD 4O1IA 4F2GA 3R4VA 3DVAB 4U4AA 4RA6B 1KBQA 3BIOA 3N3BC 4EB0A 1M6EX 3EA5A 2FSVA 1H6CA 2QM8A 3O1JC 5DSXA 3R7SA 2ONZA 5BN4A 4CKBA 1YFZA 4A10A 1CY1A 3AXTA 4ZQEA 5C81A 4FONA 2RSLA 3E3LA 2DP4E 4LTMA 4IPTA 5JATA 3IBSA 3IP1A 4WXRA 1UANA 1DNPA 1OTXA 4R69A 3RVBA 4GEKA 2CLSA 4MW7A 5IX8A 4O2BB 3RHZA 5E6RA 3ID6C 3H6GA 4IDPA 1W0CA 1TF7A 3IPYA 4GH5A 2DSNA 4M37A 4JI4B 1PRYA 4U9HS 2BYTA 4GGMX 3SD7A 4DG9A 4MPRA 1ESNA 5LUAA 3W6PA 5FWXA 2F48A 1EQAA 2G9VA 4PNEA 5BRAA 1P9NA 4BZWA 2GT1A 3BE5A 4LS3A 4P98A 1YR3A 1UMBA 2BISA 2HEIA 1LTQA 3WDLA 5G3YA 2MINA 3ZU5A 4RNDB 1OLXA 3SZGA 2Q4BA 3DTYA 1K5PA 2J7PA 2VDLB 5C52B 1GP2A 4D4GA 3QVVA 3T35A 4DBZA 3THYB 1DKRA 1MX3A 2I3DA 2X58A 3DR3A 4WE3A 4NV0A 1LB1B 4PTYA 4RTNA 1XHLA 2B1IA 5C1BA 1YS9A 3VNSA 2AMLA 1I3CA 4F85A 5MHTA 4PV7A 1FQWA 2OHVA 3HUTA 3R4CA 3E48A 4O8CA 1SBHA 1EG2A 5IAEA 1ZZGA 4DXAA 4GUAA 3VPDA 1RWMA 4FZ3A 1RE1A 4FCVA 3ROEA 1OUMA 1T9ZA 2R5NA 3E82A 4MI6A 5D87A 1QORA 3LDGA 5B3JA 3RHSA 2CV1A 1WNFA 1MV5A 1RWVA 4QYIB 4DFDA 5KMGB 1TVKB 5SZKB 4Q19A 2W58A 1N5KA 4URYR 3JPYA 1LSJA 1EFDN 1K6XA 3DLIA 3OQHA 1KFCB 2XD9A 3DCIA 3A7EA 4KFSA 3EGWA 4YROA 1B8OA 1WL8A 3H2BA 3HCFA 3RJTA 4QTXA 2EJUA 3ESYA 2YWFA 1CDDA 4MINA 2YYZA 1GR0A 4EW2A 1MB4A 2ZGVA 3EJWA 4KLRA 1QWSA 1K2VN 4QXPA 3ANMA 3ER6A 5FBWB 3K5IA 3P9XA 1BXRA 1IZ7A 1GYQA 4GG1A 5KYYA 1ZUIA 4Q3CA 1LNZA 4OLFA 7REQA 3U6BA 4ER7A 5K51A 4OBEA 3RLIA 4Z5XA 3IPCA 1IY9A 3PDIB 4KPEC 3MERA 4D9JA 3QVGB 4UXHA 4QM7A 4MLZA 1J1IA 5FI3A 2CNKA 2GCOA 2OO5C 4YWHA 1N5DA 4GPD1 1Q14A 3WHLA 1VJ0A 3WK8A 3K0FA 1UXHA 2HDOA 5IDYA 4C4ZA 1K5GA 4TMYA 3I6IA 1LK7A 5L3RA 1IUNA 1JB1A 1MW9X 4ZT5A 1WETA 1NTOA 1R8JA 3W77A 3ZW8A 1L6IA 1I2MA 4BB0A 4K0KB 1E2FA 5JYCA 5K03A 1O4WA 3M1YA 2VTDA 1P0CA 2WF8A 4DSOA 2IXAA 4DLPA 2HA3A 3A70A 1LI7A 1OXXK 1OX5A 2Q5JA 1IWOA 1JLHA 4ONEA 1RYMA 1E2DA 1RXEA 3DZKA 5DYIA 1U31A 5F52A 4YMGA 1J2TA 4YAFA 4A2CA 4AN1A 2H7XA 4N7BA 2W42A 3TNDA 2ZT7A 5KQGA 2XWPA 4AMUA 1U2SA 2I6QA 1QK4A 4XM1A 3ZHXA 1XFDA 4FD2A 1F7VA 4HL6A 2DM6A 4HQLA 2E3JA 3RRNA 3HCWA 4KIFA 3B2QA 3CF4G 5L6MB 4ZVUA 1H66A 3SR3A 4YAGA 5IJWA 2C59A 4NS1A 1U7HA 4A6DA 3VSBA 4KN5A 1VLVA 2NXNA 1U6JA 2QXYA 1A8UA 1QGDA 1YNOA 3ENZA 4UNIA 4MUKA 5I48A 2RHRA 2WD7A 1XDUA 2IEDA 1NY6A 2WTBA 1V1MB 3AFOA 3JWIA 4B8WA 4R0MA 5BMOA 4RTOA 4TS3A 1VYHA 2Y6UA 4XXHA 3TW8B 2BGIA 1NW4A 3K0EA 5YASA 5KHLB 4E15A 1JIQA 2Z09A 4R3WA 5BRNA 3ZGNA 2J0UA 3O2SB 2XCOA 4GI1A 3SYMA 2NMVA 4HNUA 1NQ5A 4DC1A 3CLSC 2P9CA 1EFPA 3RFVA 1QQ7A 1QZTA 1TM1E 3SKVA 1JJ7A 4WTOA 4EPVA 4OKNA 5DP1A 4QT4A 1P9RA 2XWQA 3FTQA 2PEYA 1LU9A 1UAYA 2Y0PA 3M5DA 5A3SA 2JGLA 2UZ4A 2FXVA 4LYEA 5P8WA 3SJCA 1CQPA 1VKJA 2AG0A 4RV9A 3MMZA 4DCCA 5TQJA 2WLSA 4CM8B 2CYAA 2V6GA 1CRPA 2G1PA 3S2YA 2BDEA 2HMVA 3ZWQA 3NJRA 1PQWA 5KJEA 3EQ2A 2MYTA 3IA7A 2Z98A 3V1KA 1V3QE 2CMGA 2EATA 4G4IA 3W1EA 1U3DA 2FW9A 4YRZA 1WXIA 5I5GA 1C8LA 4EY5A 1MXFA 1QFJA 1M2OA 1J07A 3K8QA 5IKPA 4A7PA 1M34E 1JKFA 1SZDA 3K1JA 3KHSA 2G5CA 2HADA 3DONA 2Q46A 4MVXA 5AVJA 2GD0A 1IUPA 1XNHA 4FDMA 5AVXA 5D8DA 2YVAA 4OOEA 4P0PB 4P5PA 4ITUA 1SXQA 4G1VA 4TTIA 2UDPA 5D6NA 2OD9A 4LDJA 3A1EA 4LZZA 3J7TA 4XJSA 3S8EA 4F3TA 3Q7EA 1QIGA 3UWDA 2H4WA 2ZQYA 3FPEA 3L7NA 3SX4A 4PSVA 4QLAA 1TYEB 1YCDA 1KZ7B 1QTRA 3LS2A 3PNBA 1VP3A 4P7JA 4RCZA 2C9OA 2WHPA 4Q4JA 4C3ZA 3AONB 3HLYA 4PLZA 3I30X 4QD3A 1F5SA 4FMDB 1ESMA 2QTAA 2F3TA 1ENOA 4EX7A 2PRYA 1QJCA 4QARA 4KV7A 3OMXA 5JQGA 3R41A 4M9RA 3HO1A 2YVLA 1HE1C 1LUAA 3PHGA 3QV1A 2H52A 1WUYA 1J21A 1FU7A 2X0NA 3B52X 3CEJA 4JLJA 3UNXA 4A82A 5DBFA 1ZHHA 4LTDA 4BV9A 1VJTA 4PRZA 3T3GA 4LDQA 1ADCA 1A97A 1N7JA 4AK9A 2J5KA 4Q0MA 1KYIA 3KT8A 2ZQZA 4E46A 1SOAA 2IGBA 3F3MA 4R9VA 3EY4A 4KO2S 1LLUA 1Z28A 5ENZA 1N57A 3QY9A 5MDHA 3Q3IA 4U7FA 1BJTA 5HF5A 4B34A 4JI7B 2P5UA 1MIHA 2JL1A 5IKOA 4OFXA 5AVOA 3TQQA 1KOJA 2P1DA 2W71A 4MCJA 3O9ZA 3BSYA 1NVWQ 3SHOA 3CRQA 5F2EA 2EIHA 5C9ZA 2Y1KA 3BGVA 4LVNA 3AM4A 1NVXQ 2VNIA 3OF2A 3U26A 3ITNA 3A1FA 4BO9A 4YJ2B 4WLNA 2P2DA 4IUCS 2DJIA 2FX3A 3ESRA 3EIXA 5FKJA 2NQTA 3W5DA 1NBWB 4WOCA 2FE1A 2AJBA 4RVFA 4CLOA 2R6JA 1E1QA 1ZOSA 1ABBA 1I0ZA 4M38A 2I3ZA 1YDFA 2WZCA 1N2CE 1VE5A 1XKQA 3ISTA 3QSGA 4GHWA 1CUSA 3SE7A 3ZLTA 3L4KA 2AK2A 2X3UA 3BWCA 4LPSA 2FWRA 3IQDB 1NXPA 3ABQB 1DAHA 1Q3KA 4HD8A 4DHWA 3NDRA 3FLAA 1WXGA 5BNZA 4WJZA 4IZOA 1U9JA 1GUZA 2DKFA 5CCDA 1HDYA 4BNNA 2R84A 3HCNA 1K86A 4G4JA 4IMIB 1VPEA 4WDQA 3B89A 1WW2A 1F2UA 4EGQA 5J40A 1H4VB 2B1GA 2FPLA 2DVMA 4IO0A 1BE0A 3HNPA 1KRHA 2Q2NA 3QKSB 1ESEA 3PJEA 2JH8A 1W5EA 1V96A 3HBAA 1TM3E 2BMWA 1ZFNA 1V3TA 4KIUA 3DXYA 4X9XA 3RUFA 4U6NA 1ZQ1A 3RYTC 4M9UA 1YF3A 4G1CA 1T9BA 2C84A 1NFQA 2Q50A 4WK4B 3SM9A 3ZZ0A 4X7MA 4X1KA 4W7HA 4DBVO 5JD4A 4OGWA 3EGEA 1FRZA 3M2PA 4OI0A 4JYAB 2OBFA 2V6BA 3CSDA 2VHUA 5JSZA 5EWJB 1FEZA 3IDFA 3H8JA 5ERGB 5HGJA 2OUIA 4Q9NA 3D8UA 1YJBA 2ZVQX 4J0JA 5LUBA 4PRYA 4QFMA 4R51A 2D2VA 5GM2A 4BV2A 2RHHA 1XTPA 3AR4A 2EARA 4KDEA 3O8RA 2CE7A 1VDZA 2Z9DA 3PXCX 3WL4A 4OP1A 4Q7LA 3ILHA 5D3MB 2ORIA 4NCHA 4QWWA 3ZY4A 5JALA 4HADA 3NXKA 2CBGA 5LQRA 1I4TD 5EYPB 4EHFA 1UBRS 3K09A 1B0UA 5DGTA 2QE6A 5FO0A 2D1YA 2WMYA 3TG8A 1KNQA 2OCBA 2YY6A 3TKLA 2VAXA 4HS9A 4A15A 2PSEA 4OI2A 1OH6A 2G5PA 1RQLA 3GJRA 1M74A 2QVGA 8AT1A 1PGPA 3NTRA 1UL1X 3BN3A 1DBWA 2QN9A 2DGDA 1UQTA 3SGLA 3LX8A 1DC7A 3COYA 5ITWA 1FP6A 1ZGJA 1TEZA 1EMDA 1H2AS 4RLHA 4UHJA 4XIIA 1QDLB 2O1EA 2Q5IA 3ZGLA 2I6TA 2CKDA 1E6MA 4PSKA 3PENA 5DHQA 4JZKA 3CF4A 4PLFA 3AOEC 1A4UA 5DBHX 1N36B 3ER8A 4BUCA 2XITA 3KB1A 2W93A 3RV3A 4I66A 2P1RA 3RSGA 3UWPA 1D6MA 4TRRA 4ZJYA 4OM8A 1BZYA 3ZDBA 3FCOA 1KFEB 3DWEX 4D8VA 1FLDA 2OV6A 2VSQA 3A9CA 3H2JA 4Q9IA 1RAGA 3PQ7A 3D0KA 5CHYA 4ER5A 4F1JA 2HMAA 3W8EA 1W73A 1AGPA 2BGJA 2QYTA 3CUEF 3M5WA 4JP2A 2QBYA 3JQGA 4C04A 2HQRA 3MWDA 2P4HX 3ZE9A 3T5AA 1UDBA 3D5QA 2VH5R 3PA6A 1KQOA 5DXFA 4CTKA 1QRAA 1NL3A 2CUTA 1YVPA 4IV5A 5BUZA 4E4YA 1D4OA 1AKNA 4YRMA 2QRGA 1AE1A 1DBRA 2B1RA 2RHTA 2V59A 2YIMA 2IU6A 3UUGA 5JQGF 1XRSB 3N7UA 4LOAA 1F6BA 2CNOA 2CJFA 3ANTA 3E4DA 2PR7A 1MEEA 2E18A 4XDGA 3H2SA 3RIHA 4Q1AA 3E81A 4EDFA 4KE8A 5G0SA 2J45A 2NXEA 3P9QA 3B8HA 4QUGA 5T6MA 1MOZA 3BRWA 1CUVA 2YIJA 4KMOA 4MRSA 2XPCA 3DOJA 3KPVA 1HLGA 1WV0A 2VBCA 5TPWA 2B7CA 1KP9A 1BRMA 2WRZA 4TQUS 5B55A 3S8YA 2H2FA 1PG2A 3QWHA 5MN5A 2FB9A 3EN0A 1QOPB 3BB3A 1W6RA 1F9EA 5EE9A 5E9AA 1VE9A 1XVIA 2IV7A 5CIQA 1T0HB 4ZDKA 4D9CA 4CCSA 8ADHA 5HUHA 2FMFA 1AOXA 5TMPA 1RADA 4PHGA 3AL2A 3OE4A 5DM1A 1D4FA 1JBQA 4Q01A 4BUZA 3R7FA 1V25A 2J6BA 3O1HB 3G8AA 4KQIA 1V9LA 4TROA 2XMBA 4LFAB 2XE4A 4UU7A 1PJCA 4HNHA 1ZI8A 2VLBA 1MN6A 2P35A 3KKEA 5BSRA 3ZE1B 3ZKWB 2WAMA 5A0VA 5JI2E 4EFMA 5KJCA 2X15A 4JX8A 3FR8A 4GPBA 4OH7A 2RGCA 4XX1A 3SAJA 4QO7A 3BH6A 4ZZ3A 2VTKA 5AUOB 3V8RA 5AM2A 1XNQB 3PD0A 1SQFA 5ALWA 4E2FA 5JNSA 1O08A 4CL8A 3QEOA 1GTG1 2KM1A 1EE1A 3C87A 4FHEA 4ZAXA 5FBRB 4DEXA 4ZQFA 3H0KA 4TWRA 4FWIB 1G8MA 1WPXA 1M66A 2D62A 3HCRA 2HSEA 1QP7A 4TSKA 1M1UA 1V45E 5K3FA 5U1PA 1LX7A 2WJIA 2Z43A 3HEBA 2DFKB 1PWHA 4X66B 3FYHA 5MFZA 1CIJA 5EMJA 1KWKA 1AQ6A 1D9ZA 4G63A 1LLFA 3CX8A 2F1KA 3P9CA 1W0KD 3EIEA 2WYVA 4MUYA 3D31A 4M1EA 4CRWB 3AF3A 3IIJA 2IE8A 5FWAA 5HM6A 5LU8A 2H1CA 3DBVO 3GF4A 1GRQA 1X74A 3RQIA 2IYZA 1C9YA 5LZ5A 1I01A 1Z38A 4BMXA 4TMXA 4Z51A 4OQPA 1ETUA 3CH4B 1XRRA 1RRPA 1S2IA 3LI2A 3KT6A 4TM8A 3D0OA 2VRCD 1EAMA 3DB1A 1O0SA 3PR3A 4WMLA 1ZI6A 1GV0A 3EMKA 4LX0A 3CZRA 1BH2A 1XZHA 3AIMA 3I83A 2RIRA 2HPVA 1Q95A 4WADA 4A0HA 4N0PA 2DQZA 4WY2A 1SVOA 1C8VB 3MRVA 5JEDA 1OFIA 3ZDRA 1XK7A 2JF0A 3RAFC 1CQIB 1D0IA 2GZRA 2XNDD 2R79A 5HBRA 4BLVA 1PD0A 2FR1A 2JGKA 4Q1DA 1GFWA 1GITA 3OLCX 4AZ0A 2WYHA 3D3WA 3ONWA 1UXGA 4X20A 3HP4A 1GPDG 3KD2A 1E4YA 3QBTA 4MR8B 3ZU6A 1BH6A 2ZIXB 4EKEA 3SY8A 5A03A 3GAAA 2FSSA 4QRIA 1YA8A 3G7SA 1IHPA 5DLYA 3UOAB 3D2AA 4CFSA 1R0XA 3PNYA 4UD2A 5ELLA 2XAUA 2WT4A 3CIFA 2VPZA 1M3SA 1EK1A 3NIDB 4NBNA 4UPVA 4B7CA 4LXYA 2OYSA 1MFPA 3DLAA 3EC1A 1V5GA 2NUAB 4QEKA 2EHJA 4RF5A 2OMKA 2WIBA 3A2MA 4MA0A 4PBRA 3WMGA 2AN9A 3WK4A 5KWJA 1L8QA 3SJBA 4IMJB 2AL7A 4YMHA 1V11B 3HKBB 3I4LA 4IV8A 4YACA 4BVHA 1XRQA 3TB6A 2UYYA 2XQFA 2X42A 4N49A 4JLSA 1GNPA 5EJ5A 4X54A 1UMDB 2PT5A 2VHZA 5F7ZA 5DRYA 3WGLA 1CY0A 2XWJI 3TBHA 2I55A 4A9AA 1I1NA 1RWBA 3IT1A 4M1OA 1XLVA 4AY6A 1PJ2A 4HGYA 2J3IA 1YZ3A 3VRHA 1YQUA 1SHJA 4NDZA 3AVVA 2GCNA 2IF0A 3KAPA 4NCXA 3DDUA 2QVZX 3G0GA 4MDHA 3I1IA 3UCEA 221PA 1QH1B 5LIPA 2NPIA 1TF2A 3NX4A 1SQ5A 4UU1A 1ZDMA 2GI4A 1C2YA 2C8JA 2Q49A 4GX0A 4WKOA 3W9SA 5ITZB 3LVBA 3BSSA 3CRRA 2Q5CA 1UP4A 2QMYA 4NZYA 3KUXA 5FAKA 4U7TB 2HI0A 4MS4A 3R0ZA 1AS3A 3RTDA 3VDNB 1N2CA 2O0LA 3M89A 3F5DA 5E1MA 4EHJA 5D85A 3TVTA 3DAHA 3KV1A 5ALZA 5KTMA 4RDCA 3PJGA 3VTZA 3DW3X 4GC5A 4FDLA 1L4BA 2YXBA 3V97A 5K5EA 4DTIA 1GYRA 2WHEA 3G6KA 4LQCA 2DQKA 2P9QA 3AIIA 3LP6A 1VGQA 2VYFA 2YQZA 4UDOA 4G4SP 3VPBA 4B81A 1ABFA 4GUDA 1YQQA 2VF4X 1FFDA 1NIJA 2EJWA 2X0KA 2QVXX 4Z7JA 4B87A 2FR0A 4UVEA 1UC4B 1Y3AA 2HR1A 2PMBA 4TX1A 4FIDA 5IFKA 5BSGA 4F97A 1M2VB 1YH3A 2JAHA 5LSAA 2HPAA 1CK4A 4K9PA 1XJ0A 3UT6A 4LXIA 1KFBB 2Z4TA 2E4UA 2Y71A 4QLOA 5ARDA 1VRCA 4RJJA 1C8KA 5A9TA 5C7YA 2B2XA 2AZXA 1GJRA 1MJ5A