1HRKA

Crystal structure of human ferrochelatase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROCHELATASE
molecule tags Lyase
source organism Homo sapiens
publication title The 2.0 A structure of human ferrochelatase, the terminal enzyme of heme biosynthesis.
pubmed doi rcsb
total genus 137
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hrkA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hrkA01
1LBQA 2HREA 2C8JA 4KLRA 3AQIA 3GOQA 3LYHA 2Q3JA 2PO7A 2QD2A 2QD5A 4KLCA 2QD4A 1C1HA 2DJ5A 3M4ZA 2XVZA 2PO5A 2HRCA 4MK4A 2AC4A 1L8XA 3HCRA 3W1WA 1DOZA 2Q2NA 2XVXA 2QD3A 2XWPA 1QGOA 2PNJA 3HCOA 2H1VA 2H1WA 4KMMA 2AC2A 2JH3A 1N0IA 2HK6A 3HCNA 2QD1A 2XVYA 2XWQA 3HCPA 1C9EA 1LD3A 2Q2OA 1HRKA 2XWSA 1TJNA 4KLAA 4CCSA 1AK1A 4F4DA
chains in the Genus database with same CATH superfamily
3ZKWB 5DXAA 1RWVA 1SCBA 4PZUA 1STOA 1VZ2A 3C1UA 3WJ2A 4C0BA 2ZIGA 1BDMA 2DR3A 4XGQA 1CUJA 5AI8A 4A0HA 2GGSA 2OWEA 1N5RA 5DXFA 2O57A 4BXOB 3HK2A 4CF7A 4YWJA 4NL4H 2VK1A 2BV3A 2J59A 2CNNA 2JL1A 3ZIDA 1OLXA 3NOOA 1JDPA 2EQ5A 3NNNA 4ZRDA 5JSZA 4U02A 1MT0A 1Q3KA 3I4CA 2YWEA 2AKYA 2PMWB 4GMHA 5AT1A 1E2MA 4U3JB 4ZDJA 1HYGA 2WABA 2QJWA 4Q00A 2XR1A 4YRPA 1YDMA 2CXRA 4BKPA 3MJSA 1YB2A 3RF7A 1MZVA 5CFZA 1YFLA 4EGFA 2QX8A 4KXXA 4LKRA 3LOPA 1CNFA 1CY6A 3NDRA 5CITA 5EHZA 5DN6A 1MW9X 5IABA 2R48A 4FR5A 2O6LA 4MRRA 3DLCA 2B3TA 3F1LA 4PLGA 4F91B 1A4IA 4TKVB 1A95A 2Q5IA 4C3OB 2B99A 2H7YA 3X1MA 1NU8A 2QT1A 4FSDA 1J90A 1JA9A 2GM9A 1SKMA 1DKPA 2DLDA 4I9UA 4W5HA 4Z53A 1LW6E 4K28A 4XE5A 4EA9A 2D5AA 4R69A 1OWOA 3ROMA 2FUEA 1OREA 3V2GA 2E48A 1B74A 4GLFA 4WNIA 4G4GA 4AN1A 5JFOA 3KZXA 4YAOA 4K9SA 2MSKA 1PNTA 1GPJA 4LNHA 3QY9A 4BWFB 4NE2A 4ZT2A 5G40A 1OB5A 3MJTA 1FDSA 1Z15A 2GZDA 2HWWA 3KKPA 3ZWAA 1Z5GA 3D5TA 3C3AA 3GRPA 4K1XA 5FYDA 3HO1A 3WE7A 3BDAA 1PW5A 4ZI5A 1CQJB 1SIUA 5IKMA 1GFIA 1P0PA 3WJ7A 2R5NA 1RI5A 3BXFA 3GYBA 1L3BA 4EW6A 3KYDA 1GGNA 1R9NA 3P52A 5T4BA 4YCAA 2JIZA 5CLFA 1KHHA 3DJYA 3N76A 3N3BC 4IJMA 3TTWA 1Z4PX 1YZQA 1YMVA 4I4IA 1JUDA 2X0KA 1KMCA 3UHJA 1W87A 2SKDA 3GRYA 3R9XB 1EFTA 3NDIA 1YZHA 3DT8A 4OHOA 3W6ZA 2H4JA 1A77A 2OORA 3DYIA 4LQDA 1TLLA 4B3CA 1T6ZA 3AEQA 3GN1A 4CHGA 2IZZA 2EF0A 3BWVA 5I7SA 1PFKA 1E6CA 2X77A 2ZYUX 4NABA 2VOJA 4FGJA 4L9RA 4ZT7A 1T5TA 1SPXA 5C5EA 1F5NA 1TMKA 3HDQA 3GIWA 2ZVQX 3EXIA 3LC1O 3N2IA 4IX1A 3TECE 4PZYA 1I3KA 1FXUA 1YBHA 3B12A 8MHTA 3PHGA 3JD0A 3PQ7A 1ZR2A 5IW8A 1Q3HA 2HBQA 1ZD2P 1CQIB 1JLKA 3KFLA 4AIRA 4Z4GA 1ACLA 3HRHA 1W88B 5AW8A 4ZEMA 2D7CA 4IGFA 3LSYA 1E3LA 1XLVA 2PD3A 3PG5A 1R6UA 2XRMA 3S2FA 1T2UA 4MPTA 1ZD3A 5IJAA 1OD6A 4DM4A 4UHEA 1ADGA 1GL9B 3HV0A 4Y2GA 3GLIB 4MCJA 4URWR 3UW1A 3BMCB 3DCJA 4KXQA 3KQPA 4LGVA 1HMYA 1ZKDA 3VYRB 3BXGA 4HEA1 1C1XB 4A2PA 2CC2A 4KQ9A 3BA6A 2BGLA 1G8GA 4H2DA 4MR8B 5KNCH 3L0PA 3SSMA 4EGAA 2CDBA 221PA 1LZLA 3HA3A 2LR0A 4IIJA 5IF3A 3U4MA 4DA8A 4PS1A 2CF6A 1BDHA 1L7BA 1JEDA 4NYMQ 3FRHA 1E1RA 4JEMA 4A8TA 4FUTA 5A1TA 2GN9A 1EGHA 1DKQA 3AJ9A 5K6TA 3C8ZA 4WMLA 1GFSA 1OLUA 4Y0NA 5EWJA 4PG8A 1VECA 1NR5A 1VPTA 4IRXA 1YVDA 4OYRA 4R1NA 1PR5A 3MGBA 3VV3A 1KQPA 2AZMA 2YWDA 4AJ2A 4BBZA 3JAMA 2NO1A 1TK2A 1LPAB 3IVAA 3E9DA 3ND7A 2RH5A 1VC2A 2FI1A 2VDNB 3GJSA 4OATA 1LTQA 2J9YB 2WFLA 2ZVPX 4PSUA 4WHMA 5F73A 3THYA 3I42A 4Z4QA 2F1HA 4K8OA 3E6AA 1XYGA 3DTVB 3FA2A 1IEWA 5G53C 1IEQA 3UWOA 1VIAA 1MEJA 3SQLA 3E9QA 2R6ZA 3A6KA 4LQLA 3QMPA 5EN4A 3HYSA 3M0EA 4CQMA 4FTWA 4MQMA 3R3VA 1ZBQA 1CQXA 2PXCA 1KI6B 1UZAA 1IDOA 1UJ5A 1V7CA 3L46A 4IQ8A 3T0IA 3NHWA 4YDHB 5JH7A 1YB6A 4I6EA 4TYMA 1ADYA 4X00A 4A6PA 3DPUA 5JANA 3K71B 5EVCA 4QXOA 1GT91 4Q05A 1IEXA 2ZTUA 3R9WA 1MJGM 3GEIA 1DAHA 3NRBA 1QM5A 2FLWA 3EEQA 1XMSA 3CM0A 3FPSA 3FZGA 2BMDA 1H8EA 3H05A 4R16A 4RVDA 1AA6A 3I5XA 1Z2EA 4MVJA 1S9DA 1ICIA 1EHYA 2QGZA 3UUGA 2OV4A 5FPYA 1R0KA 4JL8A 16PKA 3CZQA 3OI7A 2VUIB 5IJWA 3LTNC 3CVVA 1JILA 3QE9Y 2LCQA 2FFJA 4U00A 3RSOA 1Y0BA 3Q9NA 3Q88A 1U81A 2REQA 1QLJA 3MD0A 3AOEC 1X7YB 3EWIA 4L7VA 4YJ3A 4LDPA 1FQWA 2JARA 4FI3C 5EY5B 4FZRA 4AS2A 2B6NA 2E6UX 1L5RA 3AP1A 3CSUA 4P7BA 2GTPA 2OGTA 4FS8A 3VUFA 2CW5A 5TS3A 2DUWA 3O31A 4MVXA 4ARUA 1IQRA 2YWXA 3VDXA 1H4QA 4JCCA 2FG7C 4IJKA 5EUQB 3GEDA 3ROFA 3GWZA 2ZDGA 3GO4A 2IKSA 3TSOA 3KUCA 4R8KA 1GR0A 1N75A 3TNDA 3VUEA 1U11A 1E8NA 3SAJA 1AQ6A 2Z5FA 4MUXA 1XPUA 3COPA 4KCGA 1D1SA 1B3RA 4DLLA 3D9QX 1EBFA 1LI4A 4YGYA 1ZD5A 1TC1A 4EYSA 2AMLA 3CSSA 3TW4A 5L3VA 1Q14A 5BT8A 4MPJA 1Z28A 2ZTMA 1IQUA 1C3OB 3W5UA 3PT9A 3GVXA 3GPLA 4GVXA 5HYVA 4KN6A 1L5NA 3Q3IA 1R4MA 3AL0C 1TQ4A 1XU4A 4QQKA 1DCMA 2CLEB 1SULA 3NIBA 4CEJB 2H54A 3RDPA 3ZU4A 1E3MA 1ONSA 2GM5A 1W4AA 5JJKA 1XEWY 4JY7A 2RDMA 5EZYA 3TIGA 2BZ1A 1E1DA 2WWTA 2C58A 5KYUA 2V6FA 1BGXT 3D5QA 4V0KA 8ABPA 2DBVO 2WM9B 4NMLA 1G7RA 1SQGA 4JROA 4PLPA 5HBGA 4HDKB 3HM2A 3N2LA 5BQFA 1EXVA 1SZCA 3MA0A 2EYUA 2NXWA 3CJQA 1JXOA 4PNEA 2XKAA 5KOIA 3U26A 3E48A 3JQPA 1QIKA 2YFHA 3CXRA 4HSGA 2ZGVA 4RY2A 4ZVKA 3UY4A 5T3YA 4CV1A 4L2IB 4EHDA 3PU6A 3ORHA 4L1KA 1E7SA 3AVYA 1KFCB 5GADl 3DBHA 3NZEA 4G8CA 4LPSA 9ABPA 4R3UC 1DBRA 3TQCA 4B5LA 4ZQCB 4DNQA 2A9RA 3DBVO 1QVVA 4WY8A 3BXZA 2GXUA 5H0IA 3H9GA 2JS7A 2JG3A 4Q3LA 2J8ZA 2LNDA 1PUJA 3EIOA 4H1UA 2XCIA 2I54A 1KZ9A 5FWAA 4D42A 1GDDA 3PHJA 3RVDA 4JYAB 2IUYA 1Z47A 4DZRA 1IAVA 3PXBA 1GG8A 3A3KA 3EGIA 4HDOB 5EHIA 3UN1A 4YV0A 2VAWA 2WG0A 3BREA 1IHOA 1EFRD 1MC8A 3UW3A 4JOSA 4AD8A 3QVUA 4EPXA 4O33A 2BRUC 3EVAA 4DDKA 5CEJA 3LFTA 2EGGA 4NCNA 2HCTA 1LA2A 1MO3A 3D1LA 1LNSA 2H2WA 3K0CA 3WLJA 4WXEA 3K5IA 3ICQB 5T6MA 3FJ1A 1RJEA 5LZ5A 1PGOA 1JJFA 5EJ7A 4HTFA 3KRTA 2XEDA 2XNKA 1PEYA 3TNYA 3PQ3A 1WQ3A 3PFNA 1CUFA 3ZHVA 1WCIA 2IP2A 1W36D 1V41E 5T64A 2HBYA 4OLJA 5FWDA 3FN4A 2V7XA 1V3VA 2R8PA 3OM0A 2QAJA 2O8CA 2EBFX 4OM8A 2DHQA 1AX9A 4PFQA 2EJWA 2PGNA 4TS3A 4I1RA 1P2VA 3RGWS 1KGSA 3DB2A 4QOSA 4A6DA 1T9AA 2UUBB 4B7ZA 5CXSA 5ILQA 4H31A 4RTJA 3E27A 1OX6A 2VJMB 3KIPA 1I6MA 2SHKA 2RIRA 4OFXA 1Z25A 2C9OA 2O4CA 5JWHA 3ZWKA 4PLCA 3VAAA 4JI7B 4YS6A 5E7QA 1CW2B 1R0RE 3R5HA 4MUEA 1DWOA 1MV5A 1A04A 1IQPA 3C8HA 2ZBQA 2C8KA 3DP9A 5FBKA 3RWMB 4IV0A 3TJZA 3GC6A 3W3AD 6GPBA 1KOLA 1HY3A 1Q22A 1VA5A 2GILA 1EUZA 2ZRCA 3B48A 2QMOA 4GOXA 4J0GA 4YPFA 4BB5A 1G18A 1JZQA 2F3UA 4GEGA 4QTUB 1KMIY 3D6NB 1U6KA 2TMDA 4UD2A 3JZMA 1K75A 3D8SA 3CFYA 3PDIB 5AM4A 4FM9A 5I9BA 4CLRA 4GLLA 4ETIA 4UATA 3JALB 1JFSA 4HAUA 2F3TA 4YI3A 5CW2A 2HA5A 2FMFA 3MT8A 4N54A 1Q50A 2P9HA 2ZSDA 1JQDA 1YGYA 1ZA2A 4CIXA 1G3UA 1JF8A 4J4BA 2HO5A 3MWLA 3ISTA 3DD1A 3AH8A 3AF5A 5C3MA 5ITZA 2R25B 3GY0A 3HNOA 4Q66C 4G63A 3UGJA 3AETB 5KYWB 2XD9A 3H5OA 3KDPA 4LUCA 2EZ9A 2I7CA 2ZBPA 1H5NA 5FR1A 4A3SA 1VIDA 4AB1A 2F1KA 5TGDA 1EEHA 3HVHA 4REMA 3W9BA 1PNVA 2QRKA 3RAGA 4WCFB 1QHSA 2FEKA 3OQOA 1TYBE 2HY7A 2AJBA 3ELBA 3L5OA 3IOEA 4G6ZA 4AO7A 5CBKA 4O3FA 2AD1A 1M8KA 3EC1A 5SZHB 5EZ6B 1KDOA 5DNCA 4BWYA 1E89A 2ZIXB 5ICGA 2OA0A 3W8FA 1BE1A 4WNYA 1LJLA 1OWPA 4LYAA 5GGXA 4NYJR 5B7NA 4YRTA 4B44A 3TH5A 3MOSA 3OIFA 4MAAA 1QUEA 1II0A 2HPVA 4CF3A 1XRJA 3WFZA 3HN2A 4PZ9A 3GLGB 4WEOA 4YCSA 5EHQA 2A2ZA 3I9JA 1DXHA 3CZMA 2D1QA 1OLSB 2I2FA 4ND7A 3UJCA 2N0SA 4ABYA 2I7XA 2NVOA 4KO3S 5CHEA 2KSQA 3PQFA 4NE9A 1TKCA 4H1VA 4QUJA 4TT8A 3DTNA 2O8EA 1W75A 2JLRA 3KLOA 5JZVA 1DKOA 3OZEA 3QPDA 1YZVA 4HNSA 4OXIA 1B2RA 1N6PA 5DTJA 3ERCA 4XGIA 1EI9A 3VR6A 1JHZA 3LE8A 3MNFA 3ETJA 3H18A 4Q1VA 1LFDB 3GFPA 3L01A 3INGA 4HUQA 5SYAA 2VXBA 4G5QA 2B35A 4P82A 5LBTA 3VSBA 4RV5A 4BGEA 3B8EA 4GZ5A 4D3FA 1ICEA 1YULA 1TFUA 4F1KA 4KMMA 3M82A 4AYTA 3H9UA 1N4AA 5ALRA 1IN7A 2V6IA 3AUUA 2FH5B 2FFRA 5IEJA 1NR7A 1X7GA 2EL9A 2C92A 1PJ2A 3NCTA 4J16A 5KTNA 3UAWA 2W6ID 2UU9B 1F4LA 3IMGA 4AF6A 1OH8A 5AICA 1SBHA 4WNAA 5DHTA 3QEMA 4BO1A 1XEXA 3VHRA 4IGKA 1QGAA 2CNKA 2PR7A 1VPEA 2ZS8A 1RQLA 3EEBA 2GAJA 3QHQA 4K9QA 3SIRA 1G3MA 3SYMA 4EW3A 1IU9A 3RI3A 5LFAA 2FOIA 1ID1A 3KWLA 4CDNA 1JH9A 3WGLA 2II6A 1DCKA 1FDVA 3AXTA 1E69A 1YVUA 2P65A 2QGFA 3EXEB 3RTCA 1HEUA 4HQLA 4DC1A 4PE5B 1I1QB 4GP6A 5CD9A 3D6TB 1QORA 3NIWA 3UFBA 3BF8A 4P1ZA 1JH8A 2YHIA 3HYRA 3DZDA 2Y1XA 3BTOA 4BTEA 4MKRA 5REQB 3M3DA 3WKEA 2HNBA 3COWA 3P71T 4EG4A 1DTEA 1TCVA 2C2ZA 2LKDA 3DFMA 2HO4A 4L4UA 4YJFA 4DANA 4E31A 1ZUNA 1T8SA 2ZTHA 3NAMA 4NATA 3AFMA 2F3QA 2YASA 4W82A 5ESXA 1F0YA 3U4CA 3WXMA 1UM9B 2A78A 4YECA 1CR6A 2JAWA 3DE0X 3QKSA 1YC5A 3NJRA 4LY9A 4LDJA 4CR8A 3H1BA 4YXWA 4LIPD 3QW4B 4L4ZA 3UFXB 1IN4A 3DMRA 1V8FA 3GGGA 3EAQA 1E9BA 3AW8A 1FPQA 4S2EA 3PJGA 1KXZA 1K5GA 3WSTA 1UFKA 2QMYA 3PDJA 3Q7QA 2GZRA 1U2PA 4RPKA 3WRXA 2LZ0A 3WKCA 2XMGA 4DT1B 3SHVA 1ZNXA 3W9YA 2Z30A 2JFBA 4IIJF 3D43A 4RDHA 1B76A 4HAZA 2XVAA 1NQAO 2JGIA 3NTVA 3B2QA 3LGAA 3ZZTA 4B40A 2BFDB 2UYGA 5DIFA 1M5UA 2OYCA 3CLVA 3PC4A 2E4ZA 1RHJA 2NPOA 2AN3A 1RLTA 1XLWA 2Y0BA 3PDHA 1JEJA 3ZNNA 3EYWA 2KS6A 4MAMA 3FYUC 2KWIA 1XCBA 3LOUA 2WMDA 1W44A 3EZYA 3FOFC 1FLVA 3FNEA 3GUYA 4D9BA 4E6EA 4LOAA 2YIJA 3SQDA 5L9AA 3DBOB 4M1OA 3V1TC 3P9QA 1VHQA 4YMLA 2PKQP 3AHHA 1B00A 1MX1A 4TTSA 4EB0A 2V97A 4EVIA 2O3QA 3MBIA 1KWGA 2VN8A 4KQ1A 3IJEB 3MPUA 1S1CA 2VTBB 4BX0A 1JI0A 1ECPA 2WG1A 3K09A 1YVEI 4YHBA 2X2EA 4P5EA 3RHTA 4BMDA 5A5DA 4ENTA 2DB3A 3WGZA 2H52A 2WSSA 1LLCA 4MWOA 4NV1A 4U2EA 2G63A 2Q27A 1O7JA 2VZLA 5SZIA 3WICA 4ZALA 2AV6A 3C24A 1YS6A 1V37A 2Q3LA 3FBWA 4XQGA 2GEBA 1MJNA 3REOA 1E7QA 2GD6A 2MJLA 1TKRA 2WWXA 3NKLA 5DM1A 2OB1A 4I50A 2VDWB 1DGQA 1BO6A 3IHWA 1A9QA 1E4EA 4F45A 2BGWA 1YIAA 2Y0CA 3Q5DA 2B5WA 3QUBA 4QG3A 2HX1A 2ROQA 1J22A 1GKIA 3DDNA 3KQMA 4WT7A 3ZTTA 5HUJA 2XAAA 4MR8A 4DR2B 1AHPA 4BBPA 2I4LA 2MU1A 2A0UA 3DA8A 3HNPA 3I2IA 2YZKA 3Q7IA 5JAPA 3J81A 3RR2A 4UTPA 3GJ8A 1SVSA 2EX4A 2CNLA 2WF9A 2YYYA 5JEDA 3A9TA 3HJTA 3O4GA 1U5BA 2AMFA 2IC5A 4MQEA 4YONB 3O94A 3ZH2A 4D45A 5F64A 1PCXA 3AEUA 4BU1A 2X0DA 2JAUA 3OHMA 1Q0QA 3FKSD 1C3LA 2A0FA 5IFKA 1Z2NX 5I01A 3HB4X 3MCTA 4ENVA 2JGMA 1E2QA 1R15A 1WG8A 4DTCA 2AW5A 1YI0A 1K98A 1ZCJA 2VSQA 3O5AA 2VUTA 2XJ4A 2LIPA 1TL7C 3JWPA 3H04A 3IPCA 4OJTA 4KLRA 4GC5A 3VVBA 3OJLA 4JDUA 1OLOA 3RIMA 1E8DA 1N9GB 3AEKB 3SS9X 1JG3A 4GXNA 3OOJA 4V38A 5TF4A 4LWQA 2P6UA 1NKSA 4PC2A 3TEJA 4B4WA 4DA9A 2XUFA 1XG5A 4S24A 5M2QA 1QQ6A 1EEXB 4V0OA 4BAGA 1EZ1A 2OENG 4PNPA 1AT1A 1JBKA 2WY2D 3TRDA 3ZXSA 1KK2A 1Z75A 2ARKA 2XAUA 3A6LA 4OF4A 4PLHA 2XUQA 3RKRA 1YDEA 3LHKA 2WF8A 5G4KA 5HRCA 4A1FA 5LZ2A 4W5TA 2HHJA 4V2UA 3DFFA 4D9JA 2HRRA 3QX3A 4LI0A 1HORA 1WABA 4I08A 3TINA 5AMXA 3LQRA 1L6IA 2CLMB 1C2TA 2P2ZA 3L02A 5JS8A 1HURA 5I7UA 1G66A 4Q3EA 5E8JA 3EVFA 1XIVA 4I5IA 4W8HA 2DP4E 5KWJA 1BRMA 2H4HA 3SSAA 1PBTA 2VHYA 1A2BA 2C57A 4O4IB 4HDKA 3DAFA 3UG6A 3VI3B 2QTWB 3OD1A 3CRZA 3SFVA 3TZQA 2LCFA 3T5PA 3IRUA 2GRAA 4U8GA 5G1OA 3H6KA 1YS9A 3G23A 1VXRA 5B53A 3RW9A 1RKUA 4DSNA 4CL3A 2BFNA 4UZEA 4ARAA 1QFXA 2H4XA 2WDPA 2VZ9A 4DCSA 1QQBA 1JDBB 1HSOA 5GZ3A 1QGUA 1DMRA 3ZWDA 3AEYA 2WUFA 4AZ3B 4D46A 1XDUA 4FNAA 3R9KA 1VJ0A 3DHEA 2ZAMA 3RUIA 4DQXA 2Y0DA 3HU3A 4PYNA 5C7LO 3OFND 3TE7A 2AZXA 3WYDA 3BWCA 3O74A 1SCUB 2EFJA 2V54A 1OFUA 2BF4A 4QRDA 1XFDA 4G0QA 3H8JA 1T6BY 4LJ7A 3KOZA 2X0RA 3LPMA 4Y9TA 4DIBA 4YV1A 3KM0A 3ORYA 5B7PA 4QYTA 1CY4A 1FFDA 3HXOA 3NTRA 4XQEA 1ZWLA 3EPLA 1WVIA 3W06A 1SG6A 3I8OA 4CMCA 3K1AB 4YCBA 1P1FA 1MC4A 1U0JA 1FP6A 4TQ9A 3VO8A 3F4LA 5KMGB 4PQEA 5J9FA 4V1CA 5A9RA 3NANA 1YBAA 3L9XA 5IZCC 4JKIA 4TUYA 2MCFA 2E85A 4AX8A 4Z4EA 3S1AA 4FC6A 4QYSA 2WTXA 4YRSA 2VH5R 2ZR0A 3FIUA 3WBKA 3M6VA 6REQB 4B17A 3N07A 5A5EA 3GRAA 4KVFA 2LCIA 4JCOA 3DKVA 4W5WA 1FYEA 3OQVA 3M34A 4Q48A 2L42A 1H2AS 1VKJA 2WWFA 3M7IA 3R5KA 4KFUA 4L8YA 1P6QA 2H48A 2P35A 2PN1A 2XMPA 3BBLA 4IHJB 1EWYA 4AF7A 1YIDA 3N8HA 4FCVA 4J1TC 3VZCA 1K89A 2PQMA 5DYYA 4BNTA 2SECE 5KVSA 3LBHA 1WBDA 2QNRA 2H2FA 4QRHA 4P4LA 5KHAA 4HI0E 4RHTA 4RULA 3HCDA 2IQ5A 2GPYA 3D59A 5KWIA 4C87A 1ZWKA 4URHA 1PLKA 1I3CA 4MRMA 5ADWA 1GL6A 2PWBA 2R6AA 1LU9A 4Q12A 2Q5FA 4K6HA 4NHOA 1ONPA 4BNIA 2YRXA 2WSYB 2ZUFA 3KQWA 2O48X 2B36A 1YR3A 4MDHA 3TB4A 4CBVA 5IT5A 2QMEA 4FIZA 3NBYC 3VM6A 621PA 3L8DA 4PYLA 2C4MA 1OZ0A 1ST3A 1K8YB 1AMOA 5BWCA 2NVBA 1YKSA 5KTTA 4ZOEA 1BS9A 1E2EA 2HIMA 2VK8A 2EDCA 3ENKA 4NOJA 4LFAB 2M6KA 4RD4A 2R2AA 1QTRA 4MVWA 4H0NA 5L3QA 3K6SA 4CQMB 3AKZA 1NJ5A 2C04A 1PJLA 2ZJ1A 1LDMA 1XLTA 1XXLA 2ZBFA 5AJTA 4G2NA 1T9HA 3IOYA 1R3UA 4PRZA 2IEYA 1RXYA 3IVCA 5ELLA 4JJIA 2QN6A 4NAVA 1UK8A 4Q82A 5DK4A 5BVGB 1PQUA 2FETA 2VDMB 4DR7B 2O59A 4R1OA 5TPZD 5DNUA 3QKIA 2HRZA 3E2MA 1X8JA 4ICIA 1O0SA 2UUAB 2Q1UA 4Q39A 1RXIA 2AL7A 2J5KA 2RHMA 1ZM9A 3CISA 1PF7E 3GDOA 4FDTA 4UAGA 3WKBA 1W0JD 3TTXA 4OLAA 4TROA 5FV4A 1S0UA 3I09A 4ARSA 1I4EB 4G1VA 3Q87B 4BLSA 3SQOA 2AFHA 2NMVA 3C4QA 2H1FA 1DCFA 4M21A 4J6FA 3R8FA 1AKVA 2BKXA 3G7UA 1GGHA 2Q5HA 3B20A 1W2WB 3LTEA 3OBIA 4WK4B 3RLIA 3T3OA 2IL1A 5EXDA 1MR3F 3IULA 1V39A 1J2EA 3AWIA 5IJZA 1GR1A 2OHXA 2A94A 2ZT5A 1Y37A 3D3QA 1HDYA 3OOEA 3Q6NA 3VNBA 1L4EA 2X0IA 3MMSA 2K2WA 3ZDEA 3LDHA 1R16A 521PA 2JI7A 1P4GA 1F2DA 1N8TA 3N28A 3ZTYA 2O5CA 4BO7A 4ZO8A 1FFCA 2RGAA 4ON9A 3QTBA 4BLWA 4L0CA 4ES6A 1XMOB 2VNJA 2RJOA 1P7PA 3SVLA 2XYQA 2GPBA 1CEEA 4EQZA 1JHDA 3PTLA 4OV6B 3PB3A 4XD7D 5LM3A 4AURA 4RVSA 3P94A 2IUSA 3ZI4A 1LPPA 1WB9A 4XWTA 3DMPA 1JFTA 4JP2A 3A10A 2WAYA 5CFPA 1ZMXA 2XUGA 4JEUA 5ITWA 1U8YA 2DT8A 1DJOA 4A0FA 1KNQA 4C0KA 5E7MA 4NENA 2WV9A 3RRNA 1AV7A 3HCOA 2JBAA 2F7SA 2QQ0A 3OPNA 5BWNA 1PZHA 2ZRJA 1DAFA 4R0VA 3PYMA 3UWSA 2YS7A 2R62A 3OTOB 2FV8A 2CDNA 4GZ3A 1BS2A 4M8SA 4OYYA 1XRRA 3RYHA 1Q6ZA 1S2GA 2CVOA 4R1UA 1QGUB 2ZYRA 4XH9B 2QRMA 2I03A 2QU7A 3DWGA 2W6NA 4HGQA 1WLSA 2ZE7A 3NC0C 2GETA 1Z0JA 1NMZA 2L69A 2XE8A 3FUVA 3OD5A 3LKBA 4GMKA 2QJTA 2WMNB 5COBA 4MIYA 1XQ1A 2LDXA 3D8HA 4P2BA 2QV7A 3RSFA 1TIBA 4QPJC 4Y7DA 1QIIA 1E62A 2UVDA 4LXQA 1SCAA 1VIMA 2PGIA 5GONF 1OR8A 2IVZA 5HOEA 1KO8A 1VGVA 3IMEA 3QBVA 5BRJA 3BC1A 5F3WB 2TS1A 1RYYA 2UUOA 2VA9A 3P9IA 3SIWA 2DKNA 1YB7A 1RAEA 3E7WA 3GROA 4QX6A 1GTZA 1V6SA 3WQQA 2OWDA 1WUTA 4TWBA 1XRMA 2V7EA 4AUNA 1PWZA 4HQRA 1DV2A 4UXIA 5C3UA 5JS7A 4KGDA 4HLDA 1HXHA 4EMUA 3S1SA 1YUMA 3IT1A 3P7MA 4G8JA 5KYNA 4LOIA 1GA6A 1Z29A 3H4TA 3EDMA 4RPIA 3UT0A 1Q0ZA 4UU7A 1IZ9A 4X20B 1Y3FE 2YOHA 3TW6A 3FMFA 3H3XA 1PW7A 4GSLA 3OE1A 1Y82A 3F2VA 2EX1A 3I2KA 1W35A 5FNVA 2Z4SA 4BDTA 4C7BA 2J5QA 1ARZA 1ADCA 2LP4Y 5IAKA 2BR4A 3I72A 3ELDA 4V2IA 3KQNA 1CNMA 5EE1A 5BORA 1LK5A 1TM4E 4OMDA 5JY1A 3QUTA 2A4KA 4WZAE 5SYNA 1Q1EA 2DPHA 3U44A 1EESA 3DXYA 1G2IA 3UENA 4N8EA 3HA5A 1QHHB 4PWZA 1VM6A 2NV6A 3QENA 4H6WA 4W5JA 3ZUPA 3E4CA 2ZSUA 3BD8A 3VU8A 3DTTA 3QTTA 3BFPA 5HF9A 5FWXA 1ACMA 2HJHA 5E9JA 5GJWC 1X14A 3GXBA 4Z51A 1DC7A 2Y1WA 4GOJA 4YIKA 1ULUA 1Z6PA 3ELUA 1CJVC 5K3AA 2GN1A 2FMUA 5CM2Z 4WGGA 5K0NA 3FJYA 3AV3A 1MUUA 3BEOA 1E8MA 4ETMA 1K7FB 5I7OA 4ATNA 1OGJA 4ENUA 2GDZA 2X3FA 3OEHD 5E9WA 4A0RA 1Q19A 1KYIA 1U2ZA 4GLOA 4NF2A 3MS4A 2XRYA 4PZPA 4D43A 1UZLA 2NGRA 4R7TA 5IVIA 2X19A 5A7GA 4E2YA 1P9LA 3V34A 3KQVA 1NZDA 2IXTA 2R6CA 3HA7A 3WADA 5CVUA 3ZC3A 5ERGB 4F72A 2ZZNA 3GP8A 1VP3A 3IOMA 3QUCA 1WKCA 2EX0A 1JDTA 2PRKA 1M6VA 2CVZA 4KLZA 3N1UA 4KMSA 5CDSA 2BZ0A 3TD9A 3ZWNA 1LB1B 2HOQA 3EG5A 1G5IA 2UZ3A 3FNBA 1C7EA 2ZWMA 1EVLA 3GAMA 4OHMA 3ZV6A 1V5WA 1VPLA 5KWVA 4I9GA 3PJDA 4LMAA 4CV3A 2NO0A 1HE4A 5LVAA 4JBGA 4JKOA 4ITVA 1HLDA 1EA5A 3QLUC 4TXNA 1UBSB 1YC2A 1ZUD1 2QZJA 4XIFA 4F8JA 2XB6A 7ABPA 1SU4A 1MBZA 1GTJ1 3WHLA 1M66A 4NBUA 3LPDA 3GRFA 5F2KA 4H16A 5T4EA 1P6XA 3CT4A 1CUWA 2ESRA 4WK2B 5CVJA 3N8KA 2Q9BA 5AKHA 3AR5A 1AHIA 1LI5A 1NVVQ 1TYDE 4B2LA 1BEEA 3K70D 4IQ4A 2F9FA 4X97A 5A04A 5A4KA 1PGJA 1VG0B 2R7KA 2C3OA 5BSTA 3W5VA 4AMGA 4GXQA 4UHCA 1DTWB 1QV6A 2Q49A 3TAHA 1RCFA 1T8TA 3TSYA 3FH0A 4A7PA 1WHSB 5DHPA 2PRJA 2PE5A 2PTGA 4LHZA 4ENSA 2PWYA 4MVJE 4EQ6B 3DFZA 3NV7A 1TFRA 2V45A 4CMJA 5JSZB 2YIVX 4TQGA 3VJLA 2QXTA 2UYOA 4KXMA 1BYIA 2HF2A 2Z4RA 4LRYA 4YJ3F 3ETCA 3IIEA 1ZZEA 1HTTA 1N7GA 2IUEA 1MDBA 1A8SA 5BV7A 3F9CA 3HEBA 2OQRA 3K2BA 3FHLA 3U0VA 1J33A 3DYBA 3IALA 1RRGA 3VH2A 3WK9A 5CAEA 4ER0A 3OIDA 3KB1A 2V7GA 1QBKC 2JGAA 3CT6A 3O8BA 1BN7A 2BLLA 5D3MA 1BRTA 1S7GA 1SVIA 1TIPA 4V0LA 1ESCA 1V35A 3DOHA 1RHRA 1NXPA 4DRZA 2IKQA 4IDAA 5GIOE 1NBOA 2FMTA 5DULA 3ITNA 1IUNA 1CUDA 4AJJA 5IXJA 1GCUA 4WZBB 3KKMA 1C41A 1KR2A 1LRKA 3OCCA 3EXEA 1QZXA 3GUUA 5GTDA 2RGXA 5HM6A 2BSQA 3AVVA 3NPMA 1G5PA 1UXJA 3FHOA 2J87A 3A1DA 2Y77A 4WWHA 2I4MA 4B6JA 4F11A 1SEVA 4ZCMA 2XBMA 3MLAA 2QW1A 2R6R1 4UXHA 3LMKA 3WLMA 4AYWA 3HUTA 3TCXB 5K6RA 2QBYA 1IULA 1YSCA 2MR5A 3U7JA 1UWCA 1YU6A 4M60A 5FXMA 2ODQA 4P4NA 2WYVA 4FGWA 4OB6A 1P60A 1A71A 1GLGA 3NTXA 5JXWA 4ZOCA 1QLHA 1SQSA 5BYKA 2IHNA 4I4TB 4EG1A 5FOQA 5K8JB 1QF6A 2GBGA 4E1VA 5K0EA 2ISSD 4B4VA 1BNCA 1WX1A 3RQIA 3NAZA 4F9EA 5DE3A 3QKRA 2IIBA 3TLKA 2HJSA 5EZQA 2OFWA 4LXIA 4Y1EA 1TJPB 2O06A 2HZBA 3DE6X 2ES4A 4JSYA 3AFHA 1RRFA 4U6SA 1G3QA 1KMMA 2YOFA 3OLXA 3HBNA 5EIBD 3WYBA 3KT8A 2VC2B 4L8WB 1KI4A 3EF0A 5DBOA 1CIJA 3K1TA 5FBHA 5IKOA 2NAPA 1TEXA 2WEKA 3RUEA 2QTTA 2YXDA 2Y99A 2O52A 3A31A 3C6XA 4B79A 2O7QA 2NUAB 1P45A 5T7BA 4E5UA 3G79A 4UUPA 1AKWA 2R6DA 4BASA 3OF3A 4PICA 3KJGA 4W1RA 5HBRA 1R0XA 4CWAA 1T2EA 5F3RA 1VG1A 2H1CA 1ISPA 3I5AA 1E9SA 3CPJB 4P3XA 1DC5A 1XZNA 1E6EA 3NDJA 4F3YA 2JZOA 1JFFB 3KZVA 2W2NA 3OEED 4OLFA 5LWQA 3ZDCA 2RHTA 3B7GA 5EJ8A 3KTOA 4MDYA 4UM8B 2X5JO 2ZS9A 1XEFA 4TLMB 1EK1A 1F14A 1OMOA 1UBMS 2C8JA 5LOVF 3JASB 1K8XB 1ACJA 3DV9A 3C7CB 3F7OA 5GWXA 1RXUA 3QYFA 4RA9B 3CW9A 4D4LA 3RS0A 5LR6A 4RF3A 3AETA 4BZWA 5KYWA 3KAKA 1G5FA 1NQOA 1EP9A 3ZWMA 4IFTA 4K7JA 4YV7A 4J2OA 2QR3A 4PQRA 4EFKA 3DEAA 4NZYA 2I91A 2IS4A 4Q4AB 1RLUA 4BFYA 4ZHQF 3JAWB 4R9RA 4P0QB 3EGCA 3HBJA 3I6MA 4Q24A 4B31A 4OQXA 3BGSA 4TV9A 5ALZA 1TEZA 4XCQA 1B8PA 4X71A 2GT1A 1SHUX 3JVEA 2PUTA 4FZ3A 4XYGA 1KWKA 2L17A 4ALLA 4BP1A 3EF3A 1GQSA 4FB4A 3WVNA 1Y8RB 4MUIA 3CX6A 1KJYA 5J47A 4U7GA 4DDMA 2C2GA 2R87A 3RU2A 4RFSA 3F7MA 3TMYA 3T0GA 1YMUA 4CL8A 1WL8A 3QUQA 1I7NA 2KMLA 4L4SA 4Z0PA 3W2FA 3W8NA 5L4LA 4WZAA 4M1YA 2JFVA 4MK4A 4EY6A 4MJXA 4MULA 4DQLA 1U8ZA 3N0WA 3TOXA 3C7TA 4H35A 1IYZA 3VO9A 1XT6A 2PCJA 4RQUA 3BGDA 2XB8A 3GG2A 3CH4B 4RXMA 4MV8A 1NUAA 1NVXQ 4OPMA 3AEUB 5HIIA 4JC0A 4HY3A 4WLVA 3UJ3X 1J99A 2PRSA 3I2YX 1Z6QA 2GF0A 4BBAA 2IBMA 2BY4A 3D7MA 3KR1A 3SZGA 1BKYA 1CK4A 1O9BA 2QLBA 3FTNA 2JD0A 4LC1A 3ZE8A 2ZUTA 1LGYA 1R6BX 3D3EA 1Y34E 3AOGA 4EFMA 4Y0VA 4DC0A 1R6DA 2BKLA 1C4WA 1DQZA 1EX6A 3GBSA 1RPNA 3RVPA 2W6CX 3VC2A 1RYMA 2F9LA 3R23A 4MINA 3REFA 4AROA 2O7NA 4ESVA 3EGXB 4IUBS 2OG2A 2XZOA 4V03A 3MCZA 3DNMA 5AHWA 4CN8A 1TUGA 2PS0A 1HT0A 5JBIA 5IXSA 3DD5A 4JA2A 5HJEA 3OX4A 3NUZA 4QDZA 5JCZA 5JZOA 3BWBA 3FTCA 1S2NA 4R0NA 4C08A 4D6YA 1QO7A 1ZXXA 4UTVA 3ACDA 4EEKA 3OWOA 3HCFA 2JJ1D 3PHCA 5AW9A 5M7EA 3SZ3A 4F4FA 1SY7A 2XWJI 1K27A 5DCYA 3W8RA 1LCIA 3CX4A 2EJTA 1YBMA 4UVEA 4AN0A 1N3IA 4FWBA 4RF5A 4X95A 2X58A 4KQHA 4RK4A 5J2TF 2HXGA 1WV0A 1K06A 4TTRA 1TRHA 4YRJA 5JY6A 1R1DA 3I61A 1QU2A 3ZWQA 4OXXA 3BMQA 4JUFA 4PN3A 2FW0A 2HA3A 4GD3Q 1UT8A 8LDHA 1P81A 1S8OA 4AYXA 2ZLBA 2NUAA 2VP3A 2JDID 1NBAA 1I9GA 2M1XA 2VBIA 2YZ7A 3GT3A 2ZAIA 3TPFA 3JVVA 2CXOA 4MR9A 4ETWA 1VFPA 2EJUA 1ZNYA 1OYVA 1I4DD 821PA 3M33A 2VPPA 2FEPA 4UARA 2VPIA 2J0QA 1GFZA 1W5FA 3CX7A 1ZZGA 1RDFA 4MVJH 3S44A 2JFYA 3WK5A 2NACA 4BLQA 1H2HA 1P2UA 1DQRA 4CKZA 1D0SA 2WIGA 1SHLA 3KYCA 3QNWA 4TZTA 1QTQA 1NUHA 3V1UA 1QCZA 5HR5A 3D7KA 3MJRA 4CVNA 3QNUA 4P3YA 5COQA 1T8WA 5KNDA 4S2UA 2IEDA 2YBEA 1U7PA 4PHCA 3S1AB 4PAGA 1FL9A 4H6VA 2W8BB 1T34A 2CJFA 3MT0A 3NJ8A 3P19A 4R8MA 5D7BA 1Q16A 3ETDA 4XDYA 1QGED 2NM0A 4I4LA 4ZFNA 1JU4A 5H16A 4HBZA 4B5KA 1GT6A 4LZAA 1VBMA 5JDCC 3HZRA 5GONA 1FUKA 1XDBA 2BOVA 1P1IA 5ESRA 4MUGA 2CF5A 2QUAA 2H08A 2CBXA 1JA1A 1FFSA 2RC6A 1SIWA 3VR3A 5JTTA 2IZ5A 1D8TA 1E2KA 2CL5A 3I04A 4GHWA 1PLLA 4MWDA 4WCDA 2A58A 3KZ1E 1HFEL 3STVA 4JBNA 1SA0A 3OCVA 3RREA 2LIVA 4ALMA 5C53B 1E7WA 1J2JA 2WJIA 4BWGA 4NEHB 2G36A 2P3SA 2YV1A 3AC0A 3CU5A 4HYYA 2DGDA 4E46A 4ZJPA 4G0WA 1E2HA 5JARA 1JIKA 2AA3A 2ZYTX 3FVTA 2BEVB 1HZJA 4ZANA 2D2VA 4OFZA 2Y0PA 4L4RA 1M6WA 3KQHA 2LXNA 3TTSA 2OFOA 4HDNA 4MB2A 2XB4A 2FN3A 4C20A 2ON6A 2C4HA 1CUVA 3L05A 4E5MA 1CUBA 2XUKA 1A2QA 4S1VA 3S55A 5A4AA 3T7SA 6REQA 2BF7A 4DA0A 2IY9A 2DE0X 3T1HB 4AM8A 4EVQA 1I01A 2WFMA 3PICA 4PF1A 5DBEX 1P44A 3W78A 1J0AA 4CMEA 3EGDA 1DFIA 1DIGA 4QU9A 4ZO6A 1O9GA 5JS2A 5A7HA 1EFDN 2R00A 2PV7A 1RYDA 2PGAA 4QGGA 1MB4A 4J1TA 1SUIA 4NNOA 1CUZA 3UK1A 1XXHB 4EBFA 5HX7A 3OG9A 4UM9D 1EWRA 1XEWX 2P79A 1VYUA 5PGMA 5I5EA 3HCEA 3QA3E 1MNQA 4BVGA 2ISCA 5K0JA 1OHHD 2XYGA 1U3GA 2QW0X 1GN9A 1RIIA 3G89A 3JQAA 4L76A 2OPHA 1THZA 3G0CA 3GUHA 3H2KA 2GK6A 2OFFA 1IJFA 3R8XA 1BOFA 2A1IA 3D4BA 4XIJA 5JD4A 4TTPA 3HKEA 4JVLA 4ALIA 4BV3A 1Q1QA 4BNJA 5EIFA 2IF0A 1LV7A 3RF6A 1MAUA 3KKZA 4ENRA 2GKSA 5HDBB 3WDMA 1HTBA 3PRKE 4JC5A 5YASA 4EMBA 4Y2YA 1JNYA 4HNTA 1K9VF 4N7BA 4OJMX 3P4YA 4R7GA 1WXFA 3NRJA 3T5MA 1M6NA 1QV9A 1OXXK 2H00A 4F2GA 5EWJB 1M34E 1CP3A 4L85A 4DLKA 4Z7NB 2NG1A 4KO8A 3W3ZB 4D97A 4V1CI 1M2EA 2GFQA 3G7SA 4ZT3A 2G9NA 3LXUX 4QD3A 5CDHA 4P32A 4DWOA 3TUZC 1EA7A 5B4VA 5DIZA 5D2CA 4P53A 3HR4A 3K0FA 4DLWA 1R9MA 1E3QA 3OJ0A 2WSBA 4FZJA 2H7VA 4LWZA 2YWHA 4IJ5A 4PQGA 3LX6A 3OOYA 2D5CA 4XFDA 4PHTA 1KY5A 1H4VB 3K9GA 4LX0A 5BN4B 4OH1A 2IK8A 4ZZ0A 3MINA 2VAXA 4D92A 1BWRA 3C3KA 3DBIA 5FNVF 1AF7A 2OZEA 5ALDA 2POQX 4UNNA 2O3JA 4RZSA 1H8HA 3TRJA 3CUTA 2XWBF 3EASA 3O2SB 1T4CB 2HU8A 2NO5A 1N1EA 2WIAA 3ILSA 2IYWA 2ZE8A 4H6PA 1V7ZA 2A35A 1MDFA 1KEEB 2XMBA 3DL0A 2WU1A 3ADOA 4PFJA 3CURA 3OA2A 5KCZA 3WA7A 3KP1A 1JAYA 4MOWA 3CA8A 4OHBA 1MABB 4QJ3A 1T2NA 1TRKA 1VMDA 1WLYA 4C7KA 3SU8A 3G0GA 1PIWA 1XC7A 2H7XA 3JQ6A 2YWBA 3K8YA 4G0OA 1JEQB 2BFAA 1PQPA 4KTTE 4R81A 1HDEA 3NHUA 3PXGA 4LVCA 3VTFA 1YQUA 1TO6A 4PYQA 1L7AA 3U61B 2QUJA 3QVVA 4GMDA 2RB4A 3NWEA 4QXAA 2WB4A 4ZOLB 4ZCRA 4MUJA 4N5NA 1NG9A 2ZREA 2QTVB 3V8MA 1EKXA 4JJKA 3H83A 4C4XA 1B4DA 3P9SA 3ZVNA 4GI2A 4A0QA 4GYWA 3TQFA 3ADCA 3A28A 4Q4LA 1A72A 1N3BA 1Q7BA 2W4IA 2C96A 3ETLA 4OQEA 4OXYA 3VPFA 4CIBA 2WYIA 3R3YA 3HXLA 1T36B 4M8IA 3NC1C 1V2HE 3ZHOA 3QITA 1E2GA 4WXPA 5E3IA 3DEIA 1ESEA 1R5OA 2OY0A 3BGWA 3BXOA 1H2WA 2BCEA 3CH5A 1CUGA 1AXEA 4I81A 2WC1A 1IN8A 4H0FA 1P91A 1FP4A 4KN8A 1R6TA 4RKRA 1A7UA 1KAHA 3ICCA 2WT8A 1XKTA 4DBVO 5LD2B 2PZLA 1JZSA 5JE8A 1CDOA 5AKLA 1NXTA 3S5JA 1O0CA 2AF3C 3L7JA 5JT1A 1ZD8A 4TKUA 1VB5A 2O19A 3A6DA 3FBGA 1RFGE 3K2QA 1QQ7A 3OT4A 4K9PA 1P9WA 3UAXA 3UPUA 1WXDA 1WQ1R 3COJA 1E18A 1Z56C 4MQFB 2PZMA 2C5SA 1ZVJA 2POCA 3NJ4A 1K6JA 1Z8HA 3JQAB 4QARA 5FADA 5JPIA 1UBGA 4IZ6A 3H5VA 1MC1A 3OTWA 4IZOA 4RVUA 3OMLA 5HGXA 4QTXA 1NC3A 5IK2D 5FI3A 1DG9A 2WSMA 4EG5A 5LNK6 4M0UA 1V96A 3AUFA 1CPYA 1QIGA 2PXXA 2J07A 1N6KA 2OGWA 3KWMA 3T9AA 2DX7A 3G8YA 3HFJA 4LZZA 5ITVA 4CFYA 3C3YA 3TIXB 4ZYLA 4ZAGA 1Y4ZA 4HZIA 1IBLB 3W1EA 1MH9A 2VYND 2WDZA 1CFZA 3ADPA 2J0VA 3A2NA 4I4TA 5L3SA 3ZHCA 4EI2A 1U2GC 1X0VA 1XTBA 1UMBB 2B1QA 2VP6A 3FDFA 1L8OA 4AJ1A 1WP9A 2E49A 4P93A 2LRHA 4PX9A 1Z5UA 2NT4A 3A1WA 4MTCA 3R3JA 5T67A 2G5CA 2GHIA 4Q9NA 5KNCA 4P7KA 3TGPA 5K8LA 1T24A 2PMCA 4LXUA 5H83A 2BM8A 3OU6A 1XYYA 2RGWA 1GPAA 4TXHA 3G0HA 3AM1A 4MO2A 1RE1A 3M2TA 1GSIA 1K6XA 1XTVA 1GQOA 2EHJA 4NFSA 1N2HA 1A69A 1MVLA 2AZDA 1C3VA 4GZLA 4HXFB 4I9NA 4GBMA 2VLBA 4N12A 3UT6A 4E4RA 1QX3A 1U7UA 4ZT6A 3RSZA 3WRYA 1OGIA 5IUNC 3B1ZA 4BLTA 4Z2AA 3ADBA 1TQ8A 3ESRA 5KQRA 5LP6B 1RJFA 3X1DA 3QBDA 4OHUA 1ZK1A 1UP6A 4EA8A 2IZ0A 2QYSA 1DB3A 1QZ3A 2W2OA 2A59A 4X85A 3M5CA 4KW7A 5DGTA 5JSQA 1TPYA 4L27A 5EMHA 1VSBA 3NBXX 4M2LA 2HIAA 1L7PA 3JZAA 1JQ3A 4AZTA 1OV6A 2GDJA 2F9MA 4RNCA 3IX7A 2CVFA 4FUQA 4DRYA 3OPVA 4EJFA 1T2AA 2XTNA 3D54D 3HR7A 1JW9B 3IBTA 3QFSA 2VSXA 5HA5A 1PL0A 4UHJA 1ZGCA 4CM4A 5BUZA 1B3BA 4AC9A 1T2VA 2YFYA 3QOYA 5BP7A 1KKUA 2SBTA 2HT1A 1NVGA 1YRYE 2W71A 5IN4A 1SVLA 1XDDA 2EFGA 3DUWA 4KR2A 2AN5A 5C31A 2G9VA 3WLKX 4F4JA 1HDGO 1QTIA 3FZNA 1LC0A 3FPEA 1XCOA 4WACA 4IIYA 3UXYA 4GFDA 5L6MB 3VA7A 1QG2A 4AS3A 3OT1B 3V8EA 2G4CA 3U4IA 1PV4A 5J58A 3V80A 2VA8A 3L1HA 2G6TA 2DLCX 2Z43A 2WF7A 3I2HA 1DO8A 1OVMA 4LOLA 3IQHX 1NBEA 3WJ1A 4OHRA 1FYXA 1G0OA 2JJ2D 1VRWA 1Z18A 2EKPA 3H6HA 4X45A 1G6KA 3HR8A 4HTAA 2Q9CA 3R41A 4LK2A 5CEFA 3OIWA 2IITA 2ORED 5CVEA 3TDNA 3GUZA 3JD2A 3IAXA 1B26A 2YQ5A 1TZMA 3E5HA 1XZ8A 4YAEA 2OK8A 5KCMA 4E94A 3W0LB 4R3WA 4KN9S 3FOZA 5EMLA 3E7PA 5AHRA 1Y4UA 5FFFA 1G5TA 3NORA 4YRIA 2IS6A 3ZNOA 2O0KA 1DUIA 1LJUA 4D9GA 2ZIXA 5B58C 2OL4A 4WK0B 2IRWA 2YZNA 4ZIRA 2NTJA 2V7QD 1WEKA 1T8RA 1E61A 3DW3X 3P8ZA 4LVNA 3AVOA 1Y3IA 5AK3A 1NVDA 3FUTA 5ICMA 3RAJA 3V4SA 3PX3A 1CRZA 4KYIB 1DDOA 2GEDA 3VPHA 4L9WA 3ED1A 1GAQA 4XWKA 4C29A 2PUWA 1DG1G 3SKYA 5KEIA 5DASA 1YZLA 5IKXA 2C3MA 1N2OA 5DLPA 3WAJA 1NVKA 3AHCA 1NRXA 4GOOD 4IQGA 5FUVA 3TM4A 1V11B 1LDBA 2ZDHA 3QIVA 1U0SY 5DGIA 3ZD9A 2ZJ2A 3FHCB 1V9SA 3BD9A 5CK4A 4GEKA 2YZGA 3B1WA 2W70A 3JXEA 3C3PA 4WFKA 2C7VA 3KSZO 4G65A 5JNSA 5F35A 3L43A 4FWTA 4ZDWA 1RWXA 3LU1A 4LXGA 3NT4A 3DFUA 2PY6A 2CHUA 5EPEA 4DR6B 1PGQA 1FRQA 1DBSA 2V9ZA 4O4LB 1DKUA 4MX8A 5IH7A 2FWNA 2KBFA 2V03A 3OZAA 1NW9B 1VB3A 1H23A 2ZYDA 3ON5A 4Q3BA 3UAZA 1WPGA 4BKUA 2HDWA 5KDDA 5CYFA 4O08A 1KOGA 3HZZA 1XAHA 3ND8A 3GLKA 2X0NA 5EE9A 1U9IC 1SNYA 1T4BA 3GWGA 3L7OA 4X1KB 4LMBA 1WMEA 3TI9A 1TEHA 1YRAA 2XA2A 5KOYA 1HM5A 1UPTA 3JSAA 421PA 4E5KA 5BN3A 3FJOA 3SJUA 3OFJA 2FGKA 4BJ6A 1KZ4A 2IU6A 3NS7A 4IKEA 4W1QA 5KOHA 1OXVA 4DHWA 5FOWA 1K63A 1N33B 2B6HA 2CHGA 3QKTA 2QM8A 3EEIA 2FKNA 3C6BA 1KI1A 4X8LA 2NNLD 2Y1FA 4N0PA 1JALA 4KP7A 4DLPA 5LQUA 3A3NA 3HMKA 5CA1B 1T0BA 1NUPA 2X9VA 1A5ZA 4CM1A 5BN4A 1SHKA 4ZQFA 2WZBA 1IVSA 2YJNA 1RQ7A 1F2VA 1NN5A 2A6PA 2HMWA 3EVEA 4C76A 1BC5A 2V74B 3SVZA 3QEKA 3FOEC 1P77A 1DEKA 5ANRB 4BC1A 1CUUA 1EHCA 1CRPA 3X2FA 5MDHA 4II3A 3N70A 2AN9A 2ODBA 2B3DA 2DF8A 3DZHA 3D7NA 3FPBA 3N05A 4B45A 1E20A 1HI9A 4K9RA 4X65B 1C0LA 3JAKB 4Z8YA 4JUCA 4OBXA 3PQ5A 1NJFA 3PGXA 5GJBA 1F8YA 2QE7A 4JU8A 3LCUA 1UOEA 3P5SA 4QAQA 3C4VA 1U99A 4G5FA 4H7EA 4EB3A 2QHXA 1FFGA 3PUIA 2O7VA 3RTBA 1KI2A 1PG2A 3FYHA 5CFMA 4ZCSA 4D9CA 4LXYA 4BVAA 4JB0A 3BMNB 3OFNA 3EE6A 3TXYA 4NP6A 4OXRA 3QELB 4TV8F 1F3OA 1UDWA 2BD0A 1DX4A 3GPDG 4D9KA 2IPAB 3IKTA 4RMIA 5DNDA 4JVMA 1L8QA 4BQIA 1GPDG 2FSVA 2JGKA 4P86A 1FSPA 1H6CA 5ALEA 3S8MA 3V2HA 3IP5A 2H31A 2J4CA 3LV8A 1TCCA 3MT7A 3IBCA 1A76A 3KAJA 1FTNA 2JGJA 2VDWA 2Y2VA 3DOEA 2ORYA 1ZGZA 3C87A 2BM9A 5HS4A 4J8PA 1D4FA 1G9TA 3D4LA 1X8KA 2GAOA 3PWTA 1HTWA 1Z4QA 5A4IS 4F0JA 4M0EA 3PK0A 3UH0A 1PT6A 1PBNA 2AZ4A 3QPVA 3X1ZA 1S2IA 5H70A 4F60A 3TIVA 2Z2XA 2B1RA 5EZYB 2ZG6A 5BNIA 1SKYE 3DCYA 3DO8A 4J0KA 4EJSA 3GEMA 5EHGA 5TQ0B 4QATA 3E2PA 4Z1MD 5DKFA 1CJBA 1NDUA 3ANSA 5EYPB 4RKYA 2AWNA 4E2WA 2VDOB 5TJHA 4LYFA 1R4MB 3CRW1 4O29A 3V8VA 1SM4A 1P80A 2H4ZA 2I99A 2R6GA 3EGWA 3EEYA 3F6BX 2GPJA 1P4RA 3TE6A 4H9GA 3ZQ4A 4IPTA 1YR6A 2BP7B 2DTDA 2WJ6A 4G2TA 4NPAA 4NU5A 4C0JA 1MOPA 2FWJA 3CLRD 4IJVA 1M2JA 2V9PA 4DMGA 1N5IA 3AWDA 4JASB 3W04A 5BQXA 1QYCA 3EIFA 3CR8A 3UB4A 4AKHA 3ZW8A 1QOZA 2VJBA 3OCWA 3ZJUA 4BRSA 1X70A 3AUKA 3TIFA 3TF5A 3K9HA 2NSJA 4H3SA 3CF0A 1I7PA 3F78A 4QFMA 1L8XA 1E4OA 2J3DA 2NV2B 3LX5A 1NY5A 3MWGA 3R6DA 1PYGA 2V6JA 3ASUA 4L2IA 5CJJA 4EHBA 2Z09A 4M53A 2OXIA 3CTMA 3OQNA 4I19A 5CXUA 5FEMA 2NQ2C 5BURA 4Q4JA 1AS2A 2EL7A 4I8IA 2P9GA 2J9FB 2ZBVA 4QREA 3CLHA 5F5XA 3ZDBA 3G5TA 3Q8MA 1GQFA 3ANXA 1SBNE 3LUBA 2PX5A 2REOA 2W11A 3DEZA 1RYEA 2ODEA 2VF4X 2QJOA 2ADOA 5LQSA 2QL5A 4DCOA 2DEUA 1ESZA 3GAAA 1ORDA 2R8BA 4NCBA 4JQZA 1JFRA 3CHYA 1CZRA 4M1EA 4R7ZA 4D57A 1XZMA 4MKHA 2HI0A 4FFWA 2XXJA 4QGHA 5H9WA 3THOA 4LN1A 1UFQA 2O2CA 4OQNA 4KGZA 4HNUA 3GZ4A 3COSA 1K6IA 3K73O 2UZ1B 2ZT7A 5KZMB 2WU0A 3HN7A 4WX2B 3USZA 1VLZA 3KTAB 4LZPA 3G6KA 4J94A 4DQUA 1U80A 1H3EA 2F67A 4BO5A 3K94A 4CE6A 2VNHA 1ADJA 1YD7A 1ILEA 4BNGA 1ZH6A 5HFNA 1XMVA 3ZDRA 2D2XA 4WE3A 3FG9A 2ZVDA 3CUYA 1YBFA 1SVWA 2C4WA 3OJCA 4MVJP 1R12A 2BHTA 3H8SA 4LVUA 4XVUA 3TB6A 3FWPA 2P9ZA 2O8BA 4GYKA 1SXPA 4ARCA 1O1YA 1WTAA 2IHKA 1YF3A 4BMSA 4HF7A 3V7NA 2VJPA 1JQKA 4K6OA 1GGKA 3N8DA 4OMUA 3IP1A 2COKA 2G1UA 2V1UA 1MO4A 3VPSA 3L0BA 4PZAA 3CGWA 4HRYA 4EJ6A 2C83A 3H11B 3H3FA 5JCOC 2H1WA 3GK3A 4XD7A 3WDSA 1N7HA 4LRSB 5FBWB 3R7WA 2FUG1 2ZJ6A 4TXJA 4X24A 4YWHA 4OQDA 4TS1A 2PUEA 5JNUA 2PEZA 3O8OA 3DO5A 2QNBA 1ZN2A 1EE1A 5IVHA 5ED0A 5BW8A 3KXDA 2AD5A 2QX4A 5B1DA 4QBHA 1LQ2A 4WESA 1IG0A 3OZ7A 1N0UA 4W9RA 5E7JA 3OF5A 1Q74A 1UMDB 1Y4SA 1KI7A 4I1OA 3F74A 1MRNA 2ZXUA 1CFJA 4C89A 5HF8A 3RU7A 1KEWA 5B4UA 1Q7RA 1Z7BA 3BBPA 1L7EA 2ZB3A 3HMQA 1T0IA 3T9BA 4RW0A 5LJIA 4WW0A 1P1RA 5JSUA 5DM0A 1GVHA 2ZYGA 3B6JA 2OZPA 5KI6A 2VNKA 1A27A 3L77A 5CAEB 4X92A 4LDZA 5JAMA 2HJGA 3CCBA 4IR7A 4OAOA 1H6BA 2KW5A 1S2DA 3PQ6A 5G3YA 4BB6A 1OZHA 1YJAA 4EO4A 2J85A 2VT2A 1QZUA 4JXZA 1EVZA 1JYFA 4N0EA 3OJXA 1WETA 5I8PA 3T4EA 1I0LA 2I4RA 2ZSKA 4XYEA 1SUAA 4KWHA 3DQZA 2XEXA 1J25A 1Y3CE 3VX3A 3QLVA 2O2ZA 4G4JA 5DN9A 5DYWA 2B7BA 1Z17A 4EF5A 4HDRB 3VKUA 5JOQA 3ADKA 4FXOA 1LBTA 4OBBA 2YVQA 1ZMTA 3ME5A 4WY2A 3P32A 1EHIA 5ALFA 2GHTA 2IYZA 2Y0EA 4RZXA 5LP6F 4KPUB 4WL0A 3I3OA 4PY2A 2VRCD 4BNZA 4PZEA 3EZFA 6ABPA 1RZVA 1JB1A 4HN9A 4IYJA 2B8NA 1BCRB 5BSFA 2NUTA 3TDKA 1GOTA 1D2CA 3BULA 2P4HX 2FPXA 1TD9A 1D03A 1PLJA 1UXKA 1ZSNA 4G07A 4LBZA 2NZ8A 2W2LA 1OVGA 1XTSA 5F3DA 3ZWWA 2GCNA 5LU9A 1V8DA 1M33A 1RAIA 1RW4A 2ZIAA 1Z08A 2QLLA 3PDIA 4FFPA 5JMTA 4LQCA 4HPJB 5B37A 5LMUB 2DWPA 5GZ1A 1QRAA 5A6SB 4YMHA 2XITA 1SXJA 1EUDB 1OJLA 1RADA 3HDJA 3LX4A 4JP5A 4YGXB 5FFMA 4BAUA 4YCCA 3VR2A 3NC4A 3S2EA 2Q5OA 5EZYF 3Q8WA 4AU1A 4HNRA 1S8FA 1WF3A 4U9HS 4WQMA 1TF2A 2RHJA 4QVIA 4XVRA 3GLFB 2D7DA 3QMVA 2J9GA 3NO4A 1KEEA 4RF4A 4TRJA 4Y1RB 1P0QA 3HBFA 1SBCA 4PGAA 4QBTA 2NVUB 2LTAA 3PFHA 1UC4B 3KOOA 4HB4A 4WOBA 3S0JA 2IS1A 2OAEA 3BH6A 4WVLA 4OKSA 2HIGA 3PNYA 3UKDA 3RS7A 2AWOA 1AB5A 3NBMA 1L1FA 1YUBA 2NYVA 3ETGA 2D3WA 4YJ2F 4YT8A 2JHPA 3K31A 4LCEA 5FYQA 3EMBA 4OB7A 2VJYA 3RHFA 3EAGA 4P3KA 2EJBA 4P4UA 1CRWG 3E7DA 1SK9A 3TSAA 1MOQA 4E13A 1HL3A 2QVYX 3GNSA 1VG9B 4R51A 1GAWA 2RG1A 3CEAA 4NS4A 2P7HA 2YS6A 3A9WA 4M9XA 3DE1X 3GJRA 1BMDA 3EJ6A 4DLYA 1L5HB 4CGZA 1XMIA 4J9UE 4M1WA 3ZHQA 5IZCA 1TQDA 4B7CA 2QTNA 5ITSA 3W5DA 3HN6A 3D0QA 4FXPA 4J6EA 4EHJA 4RTRA 4IDBA 4DARA 1HQCA 1HK7A 1T1SA 1ZY2A 1QIEA 5EIXA 4KPGA 3WMRA 2CVHA 3OOSA 2RBKA 4CODB 5TT1A 3VR4A 4DIOA 4C7OB 1ISJA 1NWCA 3MWEA 1SKBA 2Q2NA 1EG2A 4IVRA 2XMRA 2XUHA 3GMIA 4Y9RA 2X0FA 1LWOA 3TMAA 3O8NA 4XUGB 4N5HX 3H9JA 1XZPA 3A36A 2WHEA 3L8EA 5BT9A 2P2YA 4KPYA 1SUSA 2H85A 1IOLA 5LUAA 2PAFA 1T3TA 3SP1A 1DAPA 1M5TA 1VE6A 3CE9A 3RS3A 1H8HD 4EGJA 1CUXA 1U8EA 4RH1A 3R7SA 4HGPA 4CMIA 4N41A 2NU9B 4MYUA 1NYLA 1AKNA 3GLHE 4IKOA 4GKBA 3ROGA 4CEIA 5BW5A 2ZQZA 5BV1A 4RABA 2JIPA 3AGPA 2OXEA 1XHEA 1SD1A 4KHZA 5HF5A 1XFAA 4KDCA 4YP5A 3RT7A 4F4CA 2WWYA 5FJJA 3LLVA 2FSHA 2QTCA 5G1NA 4AJEA 2BE9A 2P6PA 2WD8A 3GLTA 5HF6A 3B9PA 1Z13A 3DOUA 2YXBA 4M46A 2E5WA 1VKZA 4OQ4A 2X6RA 3RT9A 3SQXA 3NETA 1W59A 2A5YB 4YB8A 3U2QA 1Z6GA 3T38A 5JXIA 4RKQA 3LXXA 4Y0AA 1E4EB 4J0DA 3RYHB 3KEMA 1T9ZA 1U0LA 2YICA 5DGDA 1UBEA 1RWWA 2IX9A 4RMNA 2Q3BA 3SEZA 1X7WB 3OC6A 1VSVA 3LBYA 2P6OA 1XU7A 1WNTA 2PZFA 3OJOA 2IPXA 4UVGA 3OA0A 1BQ4A 1BA2A 1CS4C 3RKUA 3M4ZA 5AJUA 3BWYA 4IIFA 2C61A 1VE3A 4YDSA 4J3NA 1B42A 4PN7A 1X1SA 4OAPA 2HSJA 1SUWA 5LYJF 2XXAA 4QHYA 4ZVNA 2V3VA 1K88A 2OTCA 5AKKA 3CO0S 4ZZ1A 3IQZA 1O6ZA 4RY0A 4TS4A 3L4BC 4P5PA 1QQAA 2VJAA 4G9EA 3VR5A 5DNAA 4BP3A 1P1HA 3MW8A 4BQNA 3AIMA 2QX7A 4KTVE 2Q07A 2FWMX 1PVOA 4DPLA 3HSKA 1T4MA 3GLVA 1ZRHA 3L4SO 3B36A 4DW8A 4DIEA 1F2UA 3BWEA 5CX4A 2PO7A 1W30A 3R0XA 3BSSA 5HKAA 4AK9A 3RYCB 4CJXA 4LF9B 1NIPA 2P9FA 1Z0SA 2QTGA 3K9WA 4PANA 2QEQA 3HKCB 1RWQA 4PYOA 1N7JA 3E8XA 5G0UA 4DUZB 1M2OA 2DUJA 3NX4A 4NJMB 1PJ4A 1QS0A 4KK4A 1UAYA 1BVHA 5ERYA 5EMNA 1GUZA 2FWPA 5IARA 5HQ3B 4J49A 2EF1A 1H66A 1N2GA 2YYAA 2ZE6A 2QUBA 5LMCA 4DWVA 4RADA 2AGVA 2J5BA 4X6YA 1NUQA 2R3SA 2QMUA 1W94A 1Y6ZA 4GI5A 4FGZA 1VKHA 1AM4D 3GFFA 3MGAA 4GMXA 4Q9KA 4ZEOA 2PUGA 4O3MA 1VMAA 4TTJA 5H5JA 2LDBA 3D6MA 3VH3A 4RE6A 5HW0A 3M89A 2WZQA 1XZCA 1Z2PX 2CKDA 1SPBS 4RVOA 4QTZA 1ODTC 4N5IX 2CJYA 3CCCA 3NT2A 4MYRA 2ZT6A 4D4JA 4DABA 1M34A 5JC1A 3HHPA 4A10A 4YTEA 3WB1A 3MELA 3PNPA 2YHSA 1E66A 1PR6A 3G2MA 5B2EA 1YQGA 1BQ3A 2RH4A 3UXHA 4WZAB 1CUYA 1FSGA 2DXIA 4KO4S 4QUGA 2B37A 2B4RO 2IHJA 1J8DA 1GPBA 2OSVA 3AR9A 1DBQA 1L4MA 1XVTA 2C7OA 2OD9A 4TWAA 4R9VA 1OTYA 1XRPA 3A1EA 4UBJA 3TQIA 3GVPA 2Z56A 1EQUA 2C97A 3RUCA 5C7OO 2Q6TA 3QU5A 5AI5A 4IDPA 4D3XA 2J08A 4OJKA 2EJVA 1F1JA 4GDFA 1YDWA 4ZYUA 3G17A 4DMFA 5CYPA 2F8SA 3T1TA 5KQGA 3G9XA 3QEBZ 4V0MA 3G2NA 7AT1A 3ZU5A 3KVNA 1A2OA 5JPDA 2RBGA 2VYVD 1DJMA 1E79A 3A9RA 1PFUA 1E94E 1OIXA 5E2BA 3NASA 1D9ZA 3I2JA 2CL6X 1GPKA 1XEXB 5EYPA 5IN5A 3T61A 4BFZA 3R5XA 3VJKA 3WLTA 3TD2A 4H15A 3TKYA 4HLCA 1FFHA 4EX6A 4HDMB 1NMSA 3FNQA 4LF6B 5JLJA 4URUR 3IP6A 4RANA 3OKAA 4LZJA 1HRDA 1KO5A 3WDKA 5IDXA 1THTA 3GCGA 1TCBA 2QS9A 3WR5A 2AEFA 2DQSA 4MYTA 1RWBA 1ADBA 4PVCA 4L5CA 1SKUA 5GAJA 5TR9A 3LNTA 1SC3A 5CLLA 4FX2A 4QFDA 3ZGZA 3LUCA 4TRMA 3WI7A 3HVUA 4PXSA 2QJFA 3C3XA 4ZI2A 2Q3HA 4L5JA 1E7RA 4JMLA 3NBAA 1VL8A 4YAWA 1DKRA 1NVWQ 2JKYA 4BEVA 1PN3A 3U1BA 2F90A 1S4MA 2AKAB 3FX2A 4A27A 3GV0A 1D1PA 2G76A 2B61A 3EQ2A 3GNQA 2MSLA 1F2TB 3CF6R 3TO5A 3ZXUB 4AXBA 5BR4A 3ZD7A 4JYZA 1W4RA 4UNQA 4NC9A 5AVJA 1QFMA 4BFLA 1TA9A 4DL9A 2NAFA 4K88A 4RA6A 4E0BA 1TAHA 2VI5A 4NBRA 4G1UC 3WDLA 4HNVA 4TMXA 3IP7A 2OGUA 3ROZA 1NJGA 1ZM7A 2FSUA 4JNCA 3OECA 4H0CA 1MHPA 1QVWA 2BBTA 3IT2A 1VCIA 3R6LA 3U5TA 3ACBA 3DEKA 3TZKA 4D9MA 2FPGB 4TRNA 4O1MA 1BXRA 4ISCA 2VS1A 4JR1A 3KFVA 4UAVA 3O3NB 3QEJA 4RMGA 1C50A 3CRNA 1DINA 3SSOA 4JJFA 4Z3KA 2C88A 3JZIA 4P8RA 4HLUC 1PFWA 4RVNA 4BCBA 3B60A 2XF8A 3JY6A 2YC4C 4Y6PA 5DN6D 1E0JA 3MOGA 4UUAA 4UVHA 2DERA 3MWYW 4M36A 3IBSA 3TOCA 3UQZA 3V46A 1Z6AA 4YT5A 3O6VA 2ZWPA 1CS0A 3DE7X 5J5AA 2WHRA 4RIHA 2FRVA 1YTLA 3BIOA 4E15A 4UHDA 4W5OA 1G8FA 3SHFA 1T91A 3BB4A 5ALNA 5AOBA 4ARIA 1F8XA 1IB0A 4L0MA 1QK3A 1JKJB 4Q3OA 3H1GA 3ZGXA 2IYYA 2O1XA 3I28A 1REQB 3NIGB 3HU5A 1O94A 2FTKE 5E4TA 1E3EA 3QIAA 3M1IA 3L04A 3SOPA 2PKRA 2XCRB 2ZU0C 4Q6WA 5J2UF 1KNXA 2Q1WA 4XOIA 1AXGA 2YCBA 3U19A 1TLFA 1G0NA 5TMPA 3DT6A 4QTYA 3D2CA 3R3HA 3AGQA 4HVCA 5LQMA 2YH2A 4LHSA 5C8DA 3L1JA 3WLNA 2FZLA 3S81A 2X3YA 4LECA 3KDAA 4QEDA 2JHCA 2G0AA 1A4XA 2HSZA 2OZKA 1K5DA 2YJ6A 3DUFB 4YHHB 4TYNA 2FZ5A 3Q0EA 2A4MA 4KQEA 3NB0A 4XB1A 4XFKA 1XNRB 4LRUA 4B73A 4WKOA 2XRZA 2FUNB 3PFBA 2AF4C 2I2WA 2VBFA 4GP9A 2XSZA 4GECA 4U4AA 2RHLA 1WEHA 1CQWA 5ETJA 4C4ZA 1EUYA 4G01B 2YHBA 3DHVA 2B5OA 4KQWA 1WHSA 2Z2IA 3RUFA 4D3YA 4K86A 2OG1A 4X7MA 4ZTBA 2CMKA 4NNPA 5KJFA 1MGOA 1SOVA 3TX2A 1QH1A 1U02A 1LLUA 2H3EA 3G7NA 3HACA 4L15A 5LZ9A 1R8SA 3W34A 5CIQA 1R8XA 1IH8A 1FW8A 1JR3E 4DEYA 1QYWA 3RS4A 4I1YA 3N2ZB 1MEEA 1UKZA 3BCSA 5A9SB 1A8PA 1GTRA 4LMRA 4LSGA 2B78A 3L41A 2RI1A 4DMKA 5KSOA 1T9CA 4DPMA 1ORRA 3DF7A 1V6CA 4W5QA 1U0RA 3KTDA 4IUCS 4B2YA 2EZ4A 2JVJA 1IC6A 1YMQA 1DC8A 3LUFA 4A2QA 5C8YF 2X1VA 3CBGA 2ZIVB 3QK7A 3GOQA 4YAGA 4LDQA 4NKRA 4XWOA 5ULLA 1QG4A 5FBLB 5JPCA 1SXHA 1PI3A 3WWOA 2BBSA 4LHXA 4WN9B 5E6SB 5C9ZA 1OJ7A 3GLGE 3RVMA 5KWEA 4K6GA 2Q29A 3I83A 4S1WA 1MB3A 2AFIE 3UJAA 4TKMA 4DN6A 3EPJA 3WK4A 5BR8B 3RVOA 1ZAKA 4KVAA 1VHWA 3TGWA 4BO3A 3IEPA 2GQ0A 1USWA 1Z5NA 2XOKD 4UVDA 5DU2A 4H7FA 3RFVA 2YYSA 3K3PA 2ZRHA 4B2IA 3A05A 5TVGA 1XV5A 2MHCA 4RK0A 4KXNA 1QGDA 5K1ZA 2OK7A 1AGPA 1NSTA 1QGZA 3AF3A 3MQFA 1GDTA 2ZKLA 4JUBA 4F2DA 1KJNA 2FZ4A 3QG1A 3V32A 2GESA 4EVSA 5CFLA 3E9RA 1W85B 3S2GA 2RHRA 3H5AA 5CVTA 1HE5A 1CETA 2JCSA 1X86B 2YXLA 2O5EA 4EYQA 5EVJA 2ZPTX 1NZJA 4KSCA 3Q0TA 2ZM5A 1YQTA 1JSCA 4NH4A 1MIOB 1US8B 2QAGB 1B8NA 4QGSA 1L0BA 2G70A 2RGBA 4JP8A 1NQTA 4QU5A 2ZXFA 4DJDC 4UASA 1CEXA 1B93A 1M6YA 2Q2QA 2VHCA 4DR4B 1QU3A 2FFHA 4ZVUA 1XF1A 3JWGA 1N7IA 4BQFA 1UL1X 2HQOA 1K9SA 2CZCA 2PX3A 3CG0A 3HDVA 3LCCA 5E9QA 5K9ZA 4U7DA 1KPGA 1OKKD 1XJWA 1XQXA 3DFKA 1C30A 5A71A 3TRKA 1Y81A 5SYMA 2JIDA 1DUSA 2I9KA 1IK6A 1VL1A 2XMQA 1JE0A 1AK2A 3F8TA 3ZTWA 2X9QA 3L92A 1Z6TA 4O2AF 5DISB 3WBBA 1EDOA 3H97A 3GDHA 3UF0A 4Q7JB 2CLDX 2MSCB 2BWJA 1EQ2A 4U7JA 1KDTA 2CWWA 2I76A 4YJKA 1H65A 5L7TA 4LHYA 2F4VB 3LQ4A 1HT2E 2D7JA 1NXQA 2IOHA 3PE3A 1KDYA 3RGGA 3C1OA 1EFVA 4KV7A 2EFYA 3TW8A 4PLFA 4DAEA 4PGGA 4XQCA 2O23A 4IHJF 3K9BA 4NOKA 4MV5A 2X76A 1DCTA 3HVIA 2R7NA 1UPFA 4BFSA 3PXUA 2I6TA 4EG6A 3KX2A 5DWDA 3R3SA 2OXTA 1Z26A 3FCXA 2FSPA 3P2IA 3QLVC 4LBYA 1RM5A 2J3JA 3G5MA 1W36C 1ULHA 5C51B 3NHRA 2MSWA 2QM3A 2I3ZA 4PLVA 2X2OA 1MG5A 4E5PA 4E5YA 5GONB 1CS0B 2QD4A 1QIDA 4Z7JA 5C7IO 4EYEA 3BB1A 1A5BB 5CB4A 1UDCA 1IE3A 5BO5A 3MF4A 1FEZA 3UGKA 3HDHA 5K3DA 1ZMBA 2D0DA 3AU8A 2AK2A 2UV8A 3I9MA 3KVVA 3DE4X 1MG0A 5GGYA 3GUCA 3PGJA 4Z49A 1N0VC 2DFLA 1KIAA 3VHQA 1OX4A 2CSUA 2C2WA 3LDUA 4I2NA 3UHPA 4NQZA 3R5JA 4CTOA 4FEGA 3ZQUA 5IU6A 4QBIA 1P73A 3G6WA 1I4WA 4PBRA 2A5FA 4OBEA 3MB5A 3Q12A 4UM9B 3CE6A 3LX8A 4ND5A 1RLIA 5F7JA 4BQEA 2B4YA 5CVDA 3VU1A 4BGVA 4JP1A 1UJNA 3NATA 4D99A 3GLFA 1B8UA 1J0EA 2B0CA 4L57A 1YCFA 1KF0A 5H4HA 4ZGGA 2AEJA 1XCPA 3QYPA 4LHEA 3HP1A 3EUEA 3EK2A 4UUBA 3GCWA 4EP1A 2I6XA 4UEQA 4G0XA 4IQFA 3KU4A 4XVHA 1E63A 2OOSA 2P77A 3S40A 3SLRA 2P7IA 1RMYA 3ZZNA 4DG5A 3A25A 4YRDA 2AUNA 3PYXA 1V8BA 3SVTA 1ULTA 4FDMA 2B8TA 5T8KC 1RAHA 4I8DA 2D3TA 2JANA 1E64A 1P7YA 4XJXA 1KS2A 1AC5A 4IIXA 4JQCA 1YK1A 4JBXA 4ZO7A 5GINE 3CS3A 3FE2A 1TTPB 3BX1A 5DB4A 2TYSB 2D6FA 3P9RA 3R6GA 4PPFA 4RM3A 4DKXA 3EDQA 1MX5A 4MIEA 1YR8A 4YALA 3LYHA 3UC9A 2ZM6B 1XMQB 5DYGA 1BWSA 1Z0KA 2EHDA 3KK0A 3Q3EA 3V6LA 1E4VA 4NZOA 10MHA 5FL7A 1KEPA 4ESOA 2G1AA 2JATA 5IHPA 1RPJA 1ZL0A 5DM60 2FVXA 4S1TA 2MINA 3AMVA 3ZY4A 3EZ9A 4A2WA 1T4GA 2BFFA 4BCDA 3G8CA 1L4NA 3PIRA 4AQYB 3BHIA 1PT9A 2COUA 5JR3A 2QRHA 2HMUA 3F49S 4IRMA 1RAAA 4OP1A 1B6SA 3KC2A 4QRIA 3R5TA 4EJMA 1SU8A 3P2OA 4G0YA 1Y8QB 4RJJA 3PXCX 1UK9A 3UCFA 4UBNA 2ONYA 2Y4NA 1T1EA 4DYHA 1R0BA 2IZ6A 5AH0A 2FFQA 1XCLA 1DFGA 2IY7A 4OQLA 3JX9A 2FPPA 3ROEA 1W4LA 5HIMA 4DYVA 4Q9IA 1H4TA 2DC1A 4GS5A 1L5ZA 2QBYB 3BG5A 1SXJE 3URMA 2WOJA 3EGDB 4JEHA 2VPYA 4KQKA 2EOAA 4ZJUA 2XVZA 4K1LA 4DR3B 3UG7A 1FMJA 2H65A 1MO2A 5F7ZA 4IKPA 4B9EA 3Q7RA 3X3HA 1KYTA 2OOKA 2Z2YA 1ZO8A 3BL6A 3EFOB 4N82A 5FBZA 4R2XA 1P7CA 1G8AA 1MENA 1ML4A 3ONVA 3WHKA 2HCBA 3CG4A 4B47A 2FYTA 2PLWA 3WBFA 3DZKA 3LZ6A 1KTVA 1DADA 3E9MA 3LH5A 1H1LB 5ALKA 2GZAA 2GCPA 2WSSD 5CM9C 5JFGA 4CEHB 5CH8A 5AHXA 2FX5A 3BSYA 3ZE0B 3OX1A 4QU0A 3VV2A 4ZDIA 2PUBA 3TBKA 4XIGS 1OAOC 4EHAA 2BUAA 4E2XA 3BL5A 2IT1A 1EVJA 4O59O 1J2UA 5CFRA 4DV1B 3DZGA 2GLUA 1AQYA 5E0KB 5MGNA 3IDQA 4PC7A 5H68A 3WL5A 2C8LA 2FG6C 4YNBA 1T8UA 5WRFA 1K97A 3NHMA 4NR0A 1XA4A 1SKQA 1WBJB 2GJAA 2WWRA 3H1AA 4L6AA 2DWOA 1U3UA 5TQVA 4GVPA 4GYJA 4LJ5A 4CETA 1JEYA 1U7OA 5K05A 3QKUA 4ZHQA 1R5BA 4M8KA 4YCNA 3DMYA 3OKFA 5K3SA 2NYRA 4Y1FA 4DDWA 6NULA 1D5CA 5B55A 1CJUC 4P3PA 3UAVA 1G38A 2QRNA 4RVGA 2QTMA 2HTFA 1KJZA 2BSAA 4CM5A 1IJBA 1XQWA 2R2GA 2VQFB 1SHZA 2CUNA 2H2HA 1OXBB 3FDZA 4FILA 4KVZA 3NEJA 2KB0A 5KTOA 1GCOA 4KEAA 2AOUB 4WFIA 1UKYA 1UF9A 2HEIA 4WFQA 5C4IA 3P0FA 2QW8A 3QEMB 4H1HA 4PIMA 4QYMA 4YBRA 4KDRA 1X3LA 1IZ8A 1N5OX 3LLSA 5KMGA 2P5SA 3EIUA 4C2UA 1RPAA 1BE8A 1RWNA 2R97A 2J3KA 5BSKA 5K6AA 3TEMA 3GVCA 5JMWA 4FHFA 1O5IA 1R10A 3AVTA 3HWX1 5AVYA 5BQPA 3GFTA 1SBIA 5BNFA 3G0OA 1I1HA 3BWXA 2B9EA 1FDIA 3KUDA 5B3AA 1GRQA 3SK0A 2FAXA 4GP7A 3AU9A 4DLNA 1LBEA 1USGA 2QSUA 4KPEC 2CMFA 3Q9UA 2CUTA 4UFOA 5ABPA 4DV3B 1FS5A 1A9XB 1DSSG 1OZAA 4TLBA 5CT5A 2J9FA 1YRHA 2IXEA 2XUAA 2YXNA 3GLQA 5A03A 1NF9A 1YL6A 1RCTE 2MINB 3FCSB 3O90A 5FF9A 4CMBA 1PD0A 1S9HA 1ZX1A 3BMXA 4K6KA 3N0TA 3O2NA 3SYNA 3V4ZA 4DMMA 3FZQA 4ALNA 2J6HA 2W58A 2KQUA 2QLTA 3BT7A 4CMAA 4QC2A 5CYOA 2Q4TA 4ZHQB 4A03A 1KI8A 2C1ZA 2ZQYA 1VLQA 3KZNA 3ZU2A 2PRYA 3N8NA 3ADDA 4X91A 5JJLA 1DAIA 1OAOA 3G9TA 5JO0A 5LZ4A 1EWTA 1P2GA 3K96A 3A1VA 1KH1A 3QF4B 4Y9UA 3LO5A 1O6FA 1P5JA 3VR4D 5C46F 3KAPA 1BOOA 5JDCA 1IONA 1LBIA 2DFVA 3GD7A 4J7CA 5F78A 1ONNA 1KC3A 1PK9A 4LE1A 1L4KA 2XDQA 4ARVA 1T9GS 2ZUVA 2V65A 4Q1CA 1AUPA 3CKLA 4QELA 2PUCA 1DPGA 3PUYA 1N6RA 2PSEA 2XCQA 4ZZ3A 2Z08A 4EARA 3ZJTA 1V5GA 1HE1C 4NFLA 4X3PA 4XGKA 1WW2A 5I3CA 2NP7A 3PNLA 2BFBA 2XYVA 4M99A 4AJIA 1DTSA 4N0MA 1NNEA 3OZDA 4KV9A 2JAXA 2HK7A 3BOSA 3FLAA 5H1YA 5J4YA 2DU8A 1NBME 1WB6A 3A3PA 5DZSA 2HW8A 2FB9A 4FMBB 5EQJB 4HSEA 1UFVA 2QLJA 2ICAA 1E1QD 1Q95A 5K01A 3E84A 3LC0A 5AW3A 1S3GA 4CDGA 1R0CA 1U0OC 5EEGA 1H3FA 2OC4A 4FYXA 3K7EA 5F12A 3HC7A 4K03A 4A2CA 4BUJA 4DDVA 4OVKA 2G83A 1RACA 4IDDA 1QCDA 3M49A 1Q0SA 3UATA 4D9IA 3N2GA 1CJCA 1Z45A 3LZDA 4CTMA 3EQ8A 1K7XB 4RWZA 2H06A 3OTHA 3U4HA 3ZDYB 4CQLB 4CRWB 4AWAA 2JLUA 1K8RA 1ZGGA 1N3LA 4QXMA 3ESYA 3K35A 3KV3O 3CLSC 4LF4B 1S96A 3T7JA 1KK3A 3IPXA 1BE0A 4CLXA 1A9YA 4WSOA 4RPGA 3ORFA 4NFYA 2RKWA 4HL6A 3TLCA 1ZI9A 5K8CA 7ADHA 1U1EA 1M75A 2GTHA 3KJEA 5DGCA 3UHFA 1GUBA 1LI7A 4M0DA 4JR0A 4LQ4A 1P17A 2WUGA 3VZBA 3B1FA 5C5IA 3KD3A 4Z8XA 2IV3A 1G60A 3VQTA 3ZDAA 1JG1A 2AIRA 4HEQA 1DWUA 4BS9A 1VI6A 3TL6A 1JHVA 1K5PA 1KAQA 3GGCA 3NTQA 5JQGB 4CFSA 1O95D 3TXAA 4DDHA 4JJEA 3RS5A 2FMKA 2PCLA 1RBYA 2BKEA 3E82A 4KQCA 4XDGA 3B9RA 3W6UA 2V55B 4GICA 3K0KA 5CB0A 3VPCA 2AG0A 2NW6A 4GKVA 4D02A 1QG0A 1U6IA 3MBKA 1QXSA 1MA3A 5AI0A 1DWPA 1QVAA