1HRKA

Crystal structure of human ferrochelatase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROCHELATASE
publication title The 2.0 A structure of human ferrochelatase, the terminal enzyme of heme biosynthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 137
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hrkA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hrkA01
4KLCA 2XVZA 3AQIA 2XWSA 4MK4A 1C9EA 2HRCA 4KLRA 2DJ5A 2H1WA 1QGOA 2HREA 1LBQA 2QD3A 2PO5A 3HCNA 2PNJA 3GOQA 2JH3A 3HCRA 1HRKA 1TJNA 2Q2NA 3HCPA 2XWQA 2Q3JA 1DOZA 2QD2A 1LD3A 2AC4A 2QD1A 1AK1A 2H1VA 3HCOA 4KMMA 3W1WA 2XVXA 2PO7A 2Q2OA 1C1HA 4F4DA 2XVYA 2XWPA 2HK6A 3LYHA 1N0IA 2AC2A 4CCSA 2QD5A 4KLAA 3M4ZA 2C8JA 2QD4A 1L8XA
chains in the Genus database with same CATH superfamily
3ORSA 2W7TA 3F7OA 2VDQB 3NWEA 3ROPA 1NQVA 4PQRA 3AKEA 3VSAA 4YDHB 1I6LA 3AJRA 3TL6A 3HO8A 3W8NA 1EWVA 4ALMA 1YJXA 2EGGA 4BWVA 3KT0A 3L07A 1W2WB 4DR5B 3AK4A 4LFCB 3CRW1 3OIVA 1N6KA 2HA4A 2JFHA 3ENKA 3B82A 4M6WB 3HDHA 5F3DA 1W19A 1Z4LA 4Y2XA 3IKVA 3ZI4A 3EEOA 2XVAA 1Q16A 2JF0A 3JAWA 1Z5NA 3VZSA 3U4QA 1N9KA 4RZIA 4DFDA 1XQVA 5AHRA 3IQIX 4CIYA 2PGXA 3HJRA 1DIRA 2BFBA 5AKGA 1G98A 1R9NA 3RABA 4E08A 5GM1A 5C5DA 2QYTA 3RADC 4IPTA 2BWJA 4NMWA 4CF7A 4R3UC 2I4OA 3KJGA 5DCYA 5SZIA 1CJKC 1QG6A 5DF1A 3RC9A 4OKSA 5DX1A 4N3CA 2MCFA 2GZRA 4BY9E 2H59A 3ZWMA 2R1VA 3QK7A 3W5SA 1I2MA 3FTPA 4FK8A 5CEFA 1MAUA 2P9TA 3L46A 1PJ3A 2HDOA 5TJHA 4WA8A 2R1TB 3C6ZA 4S1WA 4C2AA 1XRJA 2FGKA 3LO8A 3ESAA 2BKXA 2PJUA 3JZDA 3OPYA 4LXTA 2Q0HA 3O1IC 2NZYA 1WW8A 4Z3DA 3CBGA 4PO8A 3WWDA 4ERNA 2G8LA 4FFOA 5CB6A 1QV7A 3A1FA 1C50A 1DP4A 3DF9A 3B5EA 3SHOA 4BS9A 5JNTA 1KR5A 1MVNA 2NQTA 4WXEA 4N8SA 2HCJB 2J0UB 1C7FA 1N5IA 4HEQA 2IY9A 5HUQA 4RELA 4MDFA 1XTZA 2CL6X 5F2KA 5FTWA 5BV1A 1B23P 1RZRA 5DXJA 1C3JA 4QDJA 3ZDFA 3DA8A 4ZC1A 1E5VA 2AG6A 2VSYA 3GLSA 4B5LA 1QX3A 1S2LA 3E4DA 1W87A 2HCTA 2GX6A 3DHWC 3VOAA 4A8HA 2AYZA 3UJ7A 2PX6A 2CHQA 4R2JA 3CXRA 3FZGA 4CN8A 1QFXA 2QL9A 2R4QA 2BJWA 1I51A 2FWBA 4G4SP 4XGQA 2CLKB 4J6FA 1R4NB 2CNDA 1E69A 1XO1A 2X0DA 4B8ZA 4UFPA 5FUQA 1UINA 3T1OA 3T5BA 2ZI4A 3OZRA 3M5CA 3FPBA 5IWAB 3KKQA 5ES4B 2PUFA 2PA0A 4B8WA 3HI6A 3UBMA 1UBRS 2G0AA 1BJTA 2OC4A 2FWPA 1PWZA 3INNA 2BEWA 2V7UA 2AOUB 4O4IB 3MMPA 4RQAA 1DJMA 2ZP1A 5CT6A 3QEOA 4DYDA 1ZIPA 4XI9A 4BUCA 3WGVA 2WWTA 1EP3B 1L8LA 1XFDA 1CB0A 4PLPA 1HM5A 5JYBA 5IN5A 2PEZA 3QU4A 3HU5A 3G2IA 4QNRA 5TS2A 3QUAA 4ZDIA 2IH2A 2UZ1B 2ZETA 3A11A 4Q4DA 3TRHA 4YLYA 2ZRHA 4ZZ2A 3SNKA 4BKQA 3LYUA 2H6EA 1C3VA 2LP4Y 1JSZA 2MMCA 3OKFA 2R6CA 3J7TA 1WU7A 3W3AA 1MO3A 4MS3B 4QU8A 5LNK6 5FKJA 5ED4A 2ZT6A 5A2GA 5AESA 4O3FA 1F0PA 1L2TA 2GEDA 3N2EA 2RC5A 2XE4A 5HCUA 1R18A 4Q15A 3VAZA 3T35A 1JHMA 2P4SA 2YINC 3KHKA 1JQJC 1P1IA 4P3KA 5DB4A 4X97A 1CQPA 2B3DA 1N2BA 1VB5A 1DOZA 2NTYC 2WWFA 4JKOA 1IHPA 2W2PA 3GPIA 3MUEA 3MMSA 5DDIP 1G9SA 2J87A 3MIZA 5DGXA 4BAGA 1IQPA 4NX2A 4B2PA 4RTQA 2RAUA 2H31A 5JDCA 1C8KA 1OLXA 3KJEA 3MERA 3TOXA 2Q9AA 1QDUA 3DVRX 1JHRA 3GB9A 4YCLA 3AGQA 1V96A 4DLNA 1VMAA 5IZCC 3U7GA 4HDCA 3ZLBA 4WKNA 1JQ3A 3ZD8A 1OI2A 1SM4A 1SPXA 3B7WA 4HB2A 1CVIA 4PQYA 1DVRA 3U7IA 5AUOB 1S5PA 1YHNA 3WGQA 1QRUA 3DE1X 3IBTA 2OSBA 3IIMA 4QWWA 2WZBA 5IT0A 3NWOA 2OK7A 3UAXA 1W5FA 4N3AA 4WZBE 1PIWA 4DIMA 4PLHA 4Z1MA 3EBOA 3LQFA 2REBA 5DSZA 2IEZA 3A37A 3CCBA 3KZMA 4GDMA 4NYIQ 1YAHA 3JQ9C 2ZYSA 3T3DA 1PS0A 1ZOIA 3G5UA 4XFJA 3IUJA 3THSA 4GI3A 4BC0A 5B3JC 1ZUNA 1GVNB 4JLKA 1DIBA 3ZCXA 4Y7CA 1CF9A 1KTVA 2C83A 3Q9SA 4LJRA 1NHWA 4J3NA 1DAHA 1BDJA 2WJ3A 2YOHA 3ZLUA 5BRJA 1WMSA 5H9WA 2BTEA 4FGSA 4E88A 1I7DA 4BQQA 5AVWA 1E0SA 4A82A 3H2SA 3HO6A 4LEIA 1KEWA 4ND5A 1XTSA 3RI3A 1WCV1 4F4FA 4M88A 3G5AA 5KVAA 2FPIA 1PFYA 1XU7A 1QCCA 4K6KA 4REOA 1D6NA 4X6XA 5IHPA 5IFLA 3UHJA 4JENA 2ZZMA 3WQSB 2H4FA 1NVAA 2FEOA 3IDSA 3FF4A 4XGRA 3FOFC 4DAEA 1V4BA 2P40A 2Q0QA 3GUHA 4K9KA 4RPGA 1FA9A 1A3CA 2N1MA 2XMGA 3AYZB 4BFWA 4EK9A 1ZUWA 3ZWYA 4ZOLF 3LCRA 1ND6A 3PJFA 4HMOA 2NZJA 2PSHA 4GKAA 1YZGA 2CJWB 3ASYA 1GY8A 3KUXA 3PF9A 1P0IA 4N49A 4EY3A 2YIJA 3ZGVA 2I0FA 3JQBC 3M4ZA 4N5HX 4V02A 2FUKA 2P2GA 3K6RA 4BDSA 3MXTA 4UQLA 3KYCA 2BCGY 1RLTA 4UVHA 4IXTA 4H1VA 2GEJA 1SVUA 3C3AA 3PZRA 1PJTA 1Z0FA 4N0PA 1N7GA 5B4UA 3UF0A 4C7MA 3EPJA 1PZNA 1Z2AA 5AVQA 2D0IA 2WUVA 3WDKA 1KFCB 1WLSA 1K8QA 2DWCA 2MSLA 2VT2A 3BZUA 3PGLA 5G1NA 3U6BA 1FRVA 1MORA 4IXDA 2TSYB 4QUIA 2BI8A 2AJDA 4GZ3A 4PX9A 1NYLA 1A4RA 1UANA 1UDCA 1G8JA 1NVFA 4L3WA 4XKJA 1D2AA 5AKKA 2VSFA 2IDZA 1QYRA 3GF4A 3OLYA 4BQRA 4DQXA 4RXUA 1M67A 3PNKA 1GSAA 3QUSA 5HCIA 2YCLA 1EINA 3C3KA 2PGJA 1PEKE 1E6LA 4L78A 1SUSA 2HTFA 2P11A 3GP3A 3HXMA 1P7CA 1EK0A 4FFNA 1RYZA 5GONB 5H0IA 2DSNA 1KORA 5A04A 1E7RA 2XKAA 5J4HA 4EF6A 3K0AB 5D86A 1U0SY 1Y9DA 3EIOA 2PMWB 2FNAA 1NN3A 4EGJA 1IXSB 1YB1A 2PD4A 3FFWA 3SX2A 1KBOA 4NCNA 1TKCA 2DPXA 2FW8A 3FDIA 4IGIA 5IJ0A 2W4QA 1ZN9A 2YHIA 3IILA 1GZDA 2PR7A 2XUKA 2WILA 5FADA 4AO8A 4UBNA 2DETA 1BE6A 2OBLA 3BGWA 4RORA 5AK5A 3DM5A 2QK4A 3QEAZ 1MB3A 4WKBA 1UK9A 3KOMA 4ZZ1A 1BGVA 2OGWA 2ZAMA 5G0TA 1P6UA 3UICA 1U2GA 3LUFA 3EFBA 3IDQA 5IDVA 3RO7A 1FTSA 2D0OB 2JAUA 1G20A 4NU5A 1C81A 3K0SA 1BFDA 1W6RA 5AM4A 1QOQB 2CXHA 4GVXA 3M3HA 2AN9A 1UDXA 4UHBA 5B1HA 3VBCA 4P98A 1JPNA 2W4MA 2NG1A 1NQXA 4P4LA 5HK8A 4MVXA 2DUUA 3TDKA 3NEPX 3WYAA 1IEQA 3IJEB 5BSKA 1G66A 1LS6A 2ZIZA 5BWOA 1Y3IA 1U9YA 2VUTA 4AJEA 1J0BA 3DAFA 5HKKA 3TBHA 5KOIA 4WFKA 4CCYB 3E22A 3FPFA 3NHRA 4MQBA 1ORRA 3NGXA 5LP6C 3VR2A 4YDQA 1Q0LA 4TXLA 1Q7CA 3SD7A 1AB6A 4GOOD 3PSHA 3R4CA 1PL7A 2FEMA 3QX7A 1ZHFA 5B1DA 4BNTA 5BORA 5JFOA 4AP6A 1P9WA 4O4HB 1HYEA 2Y71A 2V7WA 2EVWX 2YN2A 4PWZA 1XQ6A 2IHBA 3SHFA 3ER8A 4AROA 4F97A 3NRCA 1QHXA 1PTJC 3EMVA 3X1MA 1TQ2A 5LBTA 1WD7A 1OSNA 2ODTX 2C3PA 3B8EA 4E1VA 2F55A 1SD2A 2QRPA 2ZWVA 1NQ5A 2NX2A 1LZKA 2OHXA 9ABPA 1Q0TA 2O59A 5F7ZA 1F1JA 1Y1SA 2F3SA 4TTTS 1Y6ZA 3BUSA 4FEYA 5BR7A 4ALLA 1KKUA 5CA1B 2Z6VA 3KU1A 3RC2A 4HZUB 1UBCA 3OM0A 1M0TA 3P0EA 4N0DA 1NZDA 3RROA 3DSRA 4TTQA 1ZH4A 4YJ2F 2DHRA 2JPDA 1KSJA 1ORHA 4YWJA 2F59A 4OLHA 2B4AA 3W9BA 4YMUA 3RSHA 1BDBA 1IOLA 3HDQA 3LZ6A 1TRHA 1H65A 1NKSA 1E2PA 1TA0A 1PI3A 4LJ9A 3RS5A 1K5HA 1XJ0A 3DZCA 3I83A 3PUKA 1R4AA 4RS3A 4HDRA 3MYYA 4WZAE 4ZOLA 2G1UA 4BVEA 4IIHA 1JU3A 3M6LA 3Q0IA 2UZIR 3KSUA 1EWTA 1RMYA 3G79A 4BNYA 4I6JA 6GPBA 3Q87B 3OU6A 2VNHA 4BFUA 4EPTA 2A7QA 3FHOA 1I4LD 3GMSA 2C5FA 2PV7A 3PICA 1AE1A 1KPIA 1RQNA 4HFJA 4QARA 1D6MA 3MEQA 4JBWA 1E9EA 2CNBA 2R7LA 4G84A 1QE3A 4W9MC 1LX7A 4CEHB 2Q3JA 1KJNA 2YW9A 4IILA 5AR1A 4A1OA 3KQSA 4CT0A 1DIHA 4DM7A 2VK4A 2J7PD 1NRJB 4OK5A 4R8KA 3LHSA 3T0GA 3JWPA 2HBQA 1L1QA 4Q7LA 5I7OA 3P2EA 5FYDA 5IAJA 5I51A 3K2QA 4X20A 2EJUA 3GYGA 3MA0A 4AKHA 1DT3A 1ZJ5A 4TZTA 3RAGA 2KPOA 3WKDA 1N4AA 1KO8A 2VNSA 4RHYA 2IS2A 1TA9A 3D6MA 1RWBA 4GR9A 2FETA 1JVSA 2ZQ5A 1B15A 1PSWA 3FTDA 4QUHA 1GLNA 4H4CA 6REQB 5I3CA 2VZLA 4EYOA 2BHLA 5T3YA 1H0SA 1N5RA 3BZWA 3UH1A 2QV7A 5SZHB 3V1KA 5LL6P 3C3CA 4S0XA 2GF0A 2K7ZA 3C1UA 3GC6A 2PCLA 3AR3A 2JAHA 4PM4A 4D5EA 3ADCA 2Q21A 4KFSA 5I9IA 3M6VA 4JBYA 3WX0A 3OLCX 3K53A 1A2KC 3AFHA 1ID1A 5H70A 2DMRA 3QOWA 4D4JA 1FL9A 4PGAA 4JR1A 1T36B 2Q8NA 5AHXA 3T3MB 4E33A 2B69A 1RIIA 3MT8A 4HD8A 2JRLA 2EDAA 2X22A 4LPSA 2KLHA 1FRNA 2O5EA 2XQGA 4AJIA 3SNHA 1NULA 5KSYA 3LKVA 5ALIA 4JS0A 5AJZA 4JYAB 1F7UA 1JDBB 2W70A 4YJ3B 4TRMA 5CFMA 1MMFB 1NUUA 2FQ1A 3DV2A 2BGLA 1O94C 3ZV3A 1YRAA 3DLBA 1Y1PA 2BN4A 4I5IA 1PNQA 2OK8A 2YJ5A 4MZDA 1S2IA 1ML4A 3E7DA 2YWEA 2CJXA 4NYMQ 5AI0A 3AF6A 2IYQA 2VJKA 4HUQA 2ZSBA 4OOEA 1O87A 3QW4B 4WY8A 2IDMA 1Q0RA 1LSJA 2GTIA 2HL6A 3EGWA 4M1ZA 3LFUA 4AY5A 4MI1A 1EEXB 2OORC 4DANA 3NEAA 3T5CA 3A6FA 3EXG1 4TVKA 1XJWA 1ZI6A 4JL6A 3FPCA 3JRXA 5BURA 1OTXA 1YFJA 2LBPA 4ER5A 1ZLYA 5TXGA 3TAUA 3ZHVA 5CG1A 1VJDA 1Z33A 2APJA 3QITA 1U7OA 1G6KA 3P8ZA 4I1UA 3AWIA 1IG3A 4MK4A 5DWDA 3OJEA 3RSSA 3U5TA 1QGOA 4LMBA 1LEHA 1VJCA 2BP7B 5ITZB 3NDBB 5T4EA 5CIYA 1NU8A 1L8AA 3H05A 4LVNA 3L7IA 3DTVD 4LK2A 2VP6A 1B76A 3JD4A 3X1XA 2FZKA 3A25A 4DMGA 4U2KA 3GVCA 5JQWA 1EFRD 3GJRA 1ISFA 1KHHA 3ASVA 3GLHE 5HF8A 4HQ0A 1SURA 3O47A 4OQEA 4X1IA 1NUHA 1TL7C 4U7JA 3WMWA 3MRSA 2RHMA 1EWKA 2YY7A 3CE9A 2AC2A 4MYUA 5FTJA 3S1AA 3DBHA 2RBKA 1EVLA 1CDEA 2FUG6 5EJ7A 2GBGA 5H7XA 4ESEA 1BS1A 4JFRA 2RGEA 2LD4A 2Y4OA 1XBTA 3VZDA 4KR2A 4CGYA 2ZZNA 1S3GA 4LTMA 2ZJ7A 1OWNA 1RJDA 1WULS 4IQ4A 4EL0A 1DX4A 1P45A 5K8LA 4YJ2A 1M0EA 3WYGA 1GRVA 2Z6QA 3O92A 1S96A 1JDJA 3UMVA 4W63A 5CFLA 1V25A 4II3A 4YRFA 1OLOA 2CK3A 5A3QA 3KBBA 1NGSA 1Z75A 1EYZA 5CJ2A 3I5XA 2GXSA 3SR3A 5BUZA 4BBAA 4NWIA 3AHHA 5I7AA 3UXHA 2ZBUA 4XSGA 4C0BA 5FLYA 3QWFA 4M21A 3CVXA 3TCXB 4JNKA 1M1YE 4NK5A 1KFJB 1W48A 3BJIC 4RD3A 4HGZA 2QVGA 2ZYTX 1J97A 2J08A 1ACJA 1I1QB 1H8EA 2DWPA 3IALA 2JCSA 3DHEA 1Y42X 3G1WA 4LQLA 5KQMA 3AB3A 4RXTA 2QRJA 5A5VA 5EIOA 1I5OA 5ABPA 4KNYA 3M2PA 1QP8A 1TM5E 2AFVA 4INAA 3H5WA 4PE5B 4LJKA 5E7QA 1SGWA 3X1JA 2C7OA 2VATA 5HX7A 3MS4A 4M9XA 1ZD4A 4IDGA 1JVBA 3L0OA 1RQPA 1Q1NA 4G23A 3C41J 1BRMA 3EMBA 4K03A 4ZQGA 4D8XA 3WYFA 3LVQE 4BJ6A 4FKMA 4IUDS 3R7WA 2E1PA 5FL3A 4WNAB 4E4YA 3CZPA 4P4SA 1Y4SA 3TQQA 3DF7A 4IFEA 3NIDB 2GFIA 1DI0A 2WIGA 3BRCA 1VPWA 1U9IC 1JLLA 3L1JA 3ITNA 1Z2PX 1MOSA 4MRNA 2QTFA 3KYDA 4FNMA 2X5OA 4MVCA 2DHEA 3SJZA 3RUHA 3CNEA 3AR5A 1HDXA 1GPUA 2OHIA 3WDLA 1C30A 3CX6A 3PBKA 2GN1A 4LHEA 4BQPA 4J8PA 4IWNA 4OHKA 2VYVA 3D5QA 2I1QA 3RT9A 3A0RB 3ZXXA 3N3BC 3MCVA 2IUYA 2FOIA 3ZU4A 4B7ZA 3EG9B 2O7RA 3OJLA 3SS9X 1XJ5A 3QYPA 3S27A 4W8OA 2ORYA 4H35A 1IM5A 1CE8A 2A9FA 1OJ7A 2O2DA 3ETDA 3LPLA 5GPBA 4WD3A 5DULA 2PWBA 3TLAA 1O95D 2Z1MA 2UXBB 3KEOA 1FIUA 1L8XA 1NN0A 1EG2A 2I8AA 3FBTA 4QOIA 3HA7A 4P4GA 1FMCA 4RKEA 1C9EA 3I73A 2YS7A 3CKMA 4P33A 1W25A 1VE5A 5FF9A 3AJ8A 1CS0B 4YRJA 1E3IA 5BV7A 4DR3B 4L76A 2CFOA 3NKFA 5EQTA 3OWHA 3IIEA 1HPLA 4XAQA 1KYQA 2ZRDA 5A9RA 3TR6A 3E1SA 4FGJA 4D9NA 1E20A 4O8CA 4BGUA 2BBOA 3CH5A 3GA0A 3LDFA 3QKTA 1WD5A 4E31A 3K71B 1PBNA 1ZZGA 4NYJQ 4TRNA 5LDDC 2Y76A 4JK3A 4YP1A 1TLLA 5LIRA 5J9FA 4RD1A 2FW6A 3DE6X 1RHMA 4MSUA 2R4UA 2YWRA 2EL7A 2QKYA 2B36A 2F00A 4EUEA 2VUIB 1E92A 3DL7A 4K6OA 3QVVA 3JQ7A 1AXRA 1BXKA 1Z5PA 3QBVA 3ZY5A 1Y3HA 4E6PA 4ZU1X 5A7FA 1RLOA 4R01A 1M5UA 1PR2A 1GCUA 4LCJA 4PY2A 5BUCA 2VQFB 4WXRA 3ASUA 3CR7A 4LIPD 3TFQA 4WKGA 2IYYA 4ER7A 1IB0A 2GEFA 4PZUA 1NN5A 4JBHA 1JNXX 5COBA 2ZTMA 4TWRA 4XWOA 3GLFA 5EHXA 4MROA 1S1MA 5IUKC 5JS1A 3ABSB 2JJ8A 3QHQA 5CVJA 3K70B 3MJHA 3OCUA 4GWLA 4WV3A 2ZI9A 2FMKA 4J1TA 3BFPA 1FQJA 1KQOA 2EBHX 3SBXA 3PENA 1VYHA 5JXHA 4OB6A 1LNZA 4Q16A 2Q1XA 5ALYA 3VOTA 3TLEA 4P4TA 1HG0A 5K0EA 2HMTA 3RREA 1L0BA 3L3BA 2Q7DA 1U3FA 1RYMA 5KOYA 3NVMB 1PBTA 2H9IA 3WLTA 4CM1A 1I7QB 4OHMA 2UYHA 1GJRA 4QOFA 5L7WA 3G17A 4OHUA 1A8PA 1G2QA 4KN6A 1E98A 4RX1A 4BYGA 1QCYA 3FH0A 4FYHA 3MYRA 5DEOA 4KRFA 5KTRA 4CEIB 4WA7A 1U6IA 1JYSA 5ARDA 3X2EA 1CQXA 3E2IA 5FUBA 5K0CA 1I94B 3I9NA 3NJRA 4F56A 3ZV4A 5IF9A 3TMAA 4UM9D 1H2RS 3S70A 1R6BX 1D2CA 2UZAA 4DHWA 2QX4A 3ISJA 3DT6A 3PXBA 2VHEA 2HQOA 3NPMA 1X15A 4RA6A 2H1CA 2IPNA 2WRZA 2ES4A 3F5QA 4RMJA 1SXJD 2HT1A 2ZM5A 2VEOA 4AECA 2GYYA 4CL3A 3ORYA 5CBKA 3L0BA 4WKPA 1Z6QA 3MJRA 3MMZA 2HF9A 5IPFA 4QQRA 3T06B 1YJ8A 3DTTA 1G6OA 2A4KA 2Y0BA 4GMXA 3KHTA 4ZHQF 5MN5A 3VR5D 2OZVA 3G2OA 1II8B 4L0MA 4WZZA 1SOUA 3OQ1A 3QEKA 1K8YB 4F2GA 1ZNXA 4DIFA 1YV9A 3BGSA 3Q12A 1Z7WA 2MJLA 2GUGA 3N7UA 3NM6B 4P7JA 1NHGA 4DLRA 2DBZA 5TEWA 5IF3A 3ZGZA 3RYTC 3DJYA 2ZIVB 1LUAA 2F3TA 4PZYA 2LE0A 3KAJA 4I99A 4AVYA 4RTSA 2Q2WA 4NPAA 4G86A 2A30A 4GIBA 4EUFA 1EFAA 2ETXA 3VO9A 2ODWA 2AN3A 4KWEA 4DGQA 1ZK0A 3HC7A 2QN3A 1F3OA 4TTJA 2IEGA 2PEYA 2IZOA 1P2GA 1DAOA 1OGYA 1YDFA 4KUEA 1TIBA 1VHLA 1TM7E 1UDWA 2O19A 3DZFA 5H3CA 3BXHA 4BNUA 2ZDHA 4GI5A 4QGBA 3MWEB 5GY7A 2A5YB 3RC3A 3N59A 2Y0EA 3EZNA 5J4LA 1IOWA 1LSSA 4EP1A 3NV7A 4TL7A 1YK1A 3MB8A 3LQ2A 4C0QC 2KWIA 5EZYB 1LJUA 5E6RA 5AH0A 4QPZA 1QV6A 2BLLA 5J2TF 3OO1A 3R41A 1GDHA 4GYKA 4RVGA 5EJ5A 3LW8A 5K3EA 4LC9A 1YBFA 4OTZA 3VYSB 3UMMA 3CEHA 3ADDA 4TVSA 4N5MA 1ZRSA 4U6NA 4RJTA 3GAAA 1YQTA 5BOSA 4X90A 5BSGA 3WGMA 1SIOA 3RIGA 1D1TA 3SS8A 2A9JA 2AFIA 4PU0A 3F8SA 3RSCA 1Q0ZA 3ABZA 1NATA 2X0IA 2DFDA 5A4JA 3KB6A 1XD9A 2CXQA 1NJSA 3U37A 3FDZB 4RK4A 1H9AA 1CJBA 3I9OA 2XKBA 3G8YA 2J5RA 4PLYA 1CY1A 1O2DA 3L1HA 2QRUA 2AI1A 4K8OA 1QNFA 4PCLA 2OD9A 4KR0A 1QR2A 3C3DA 3EXHB 3PGKA 1FTQA 1UBNA 3N76A 4EHBA 1I1NA 3OESA 2DUJA 3EGOA 1XTIA 5HKLA 1OH8A 4BX9A 1RJGA 4YDRA 2SKCA 4I1PA 2VTVA 2PAAA 3KJXA 4Q93A 5TB5A 2JBHA 3V55A 1WMBA 3DE7X 2JLZA 3LC2O 2OV2A 4KUHA 4MYCA 1BE1A 3WBJA 4NDAA 4YRIA 3IOEA 3MC1A 4D9KA 2R8YA 3EUAA 3MAAC 3W1WA 1DEKA 4UUBA 4X3PA 5CVCA 5KTTA 1IAVA 4LYYA 3EJWA 3OP1A 3N0RA 5FWYA 4J0FA 3SP1A 1FUIA 4HL6A 2MTBA 3QTLA 5CH3A 2ZUDA 5B6JA 2AK2A 2RI6A 3OUUA 2B30A 4M0LA 5EE3A 4AX8A 5HZGA 1G3QA 2P41A 4CF6A 4CM7A 2YXBA 1E96A 3H7AA 2GCOB 1PKEA 2DCUA 4IKOA 1XR3A 4O2BA 2XADA 3W2EA 2YWDA 4DJTA 1QKIA 2BCJQ 1GKUB 2XQJA 1G55A 3I39X 3QKRB 4U2DA 4DEYA 1RJ9B 4LJ4A 1YF3A 2ORVA 3F5DA 3ZWBA 2ZFUA 4Q4LA 1QQTA 2HRDA 4AIIA 5HQ3B 1QYCA 4DL9A 2P62A 3PHGA 4Z4GA 2I99A 4RZ2A 5FL7D 3QUTA 5KU7A 2JEOA 3QHPA 1O4WA 5HEKA 2WIBA 3UB4A 4RA9B 2AR0A 2OO3A 2X8JA 2LRHA 4MUHA 2FRXA 4NBWA 1GNTA 5I45A 1RM0A 2BTQA 4MQ6A 3H9CA 2VLIA 2OV4A 2X40A 3D31A 1DAIA 3BFVA 4HATA 1ZUD1 5JAUA 2PSSA 3DZDA 3D6UA 1FSSA 4MV1A 3HZHA 3PUZA 1LBQA 3ELWA 4LW8A 1A72A 4P31A 4TQAA 2C4KA 4FC6A 3RF6A 1YCDA 2GPSA 4BGVA 3BXFA 3UK1A 1QQ5A 4FONA 1S2MA 3D0RA 4H1TA 4XIJA 3WP1B 4BO1A 3L6RA 1E3JA 1JU4A 2CXUA 2QYOA 2Y9MB 1DQRA 3U4IA 4M53A 1Y3AA 1F6WA 4FFVA 3IOYA 5IJ9B 5FOQA 4XIIA 4B82A 2IRWA 5DN6D 4HT3B 1YH3A 3JQRA 4HFMA 5ICMA 1XEWY 1MEJA 3I8XA 3TS1A 4DSOA 5IZCA 4RXMA 4X00A 2AJCA 2CL0X 4KN9S 1MVOA 2H5IA 3NC4A 3W4JA 5K6RA 4I36A 3D4BA 3G1TA 5FO1A 5AHKA 1R50A 4UXJA 5DM60 5KNDD 3U6KA 5TT0A 1HDOA 5JTTA 1CY2A 3FA2A 3IE1A 2FZ4A 4RF2A 4Q7MB 3RNLA 5D85A 3QVTA 4JV5B 3EUWA 2OT3B 4KNWA 3ZI7A 2EBFX 5HDQA 3ANMA 4US2R 3EHDA 4DQLA 3AJAA 1ZM2A 3IA7A 2DKNA 5F7JA 5ECWA 3JQ9A 4Q4HB 5CBPA 2N42A 3A1WA 5KVCA 2VJMA 2OOSA 3ABQB 5KJFA 1IPHA 1YBVA 2HPAA 4DR1B 4FKBA 5J2UF 1GAEO 4RVOA 2PZAA 5FHRA 3WRXC 3VHQA 2OVBA 4RF3A 5FR2A 4ZOQI 5KDOA 1JWAB 3UZUA 3AEKB 5CDHA 2PN1A 2R2AA 2Z9DA 1WL8A 5B53A 4DS3A 2W6ZA 1IUPA 1KIFA 1DE0A 1F8FA 1GG8A 1HNXB 4C7OA 1PJBA 2OP1A 1EGAA 3GXOA 5AXBA 5J2TA 1E9AA 5E7JA 1SELA 4ZRDA 3R3ZA 4Q6WA 1HV8A 2Q4EA 4O1HA 4CG3A 5C32A 4W5OA 1PJLA 1FP7A 4HWRA 2VTBA 1VDZA 2RGGA 3NNSA 5B1EA 1XDDA 2YZGA 3ETJA 3PRJA 1D0VA 4ZO8A 5BQXA 2DFVA 1P75A 2MINB 3VBEA 2PRYA 4U0JA 3CUEF 3LO5A 1C7QA 3PHCA 2A4MA 4C20A 3FCCA 4WJZA 4O08A 4DYVA 4NBRA 3MHPA 3SXUA 5IBQA 3N2YA 1MF7A 3U7QA 3VDRA 3X43A 4EYSA 4XRRA 1TYCA 3HKBA 3D6FA 3OZ7A 3NNNA 4PFSA 2EGHA 4ZAYA 3RSQA 2XDWA 4DWJA 4E7OA 4JXXA 3DLHA 4F8EA 1C0IA 1MX3A 3CN7A 1XB2A 2HOQA 4QDUA 2PNFA 2OR3A 1AHPA 2EHJA 3GRZA 2PNJA 1BX3A 4HS9A 4O0LA 2B94A 1IRXA 4D57A 3R1IA 4ZAZA 3TZCA 2VZ8A 3BIFA 1RR6A 2IQIA 2ODNA 3VHRA 1Z63A 4V0LA 3MPOA 3HU1A 2P9ZA 2RGUA 3K20A 3AW8A 3RF7A 1Y63A 1GFIA 1SRQA 4DJAA 1QMGA 5AT1A 1T5OA 2EOAA 1ECBA 2VDWB 4E51A 5IARA 4QDTA 3I76A 2AW5A 2FA9A 2JATA 4HDSB 1YRYE 2CJYA 4UXIA 2C2BA 3WK8A 2WFMA 3KLMX 3TDNA 1M1NB 1SD5A 1OYVA 4BX3A 1NWHA 3AL3A 1QFJA 3JZIA 3HNPA 4UVIA 3AT1A 4K9DA 2O1EA 2IP1A 3FF1A 3QM1A 4ZYWA 4RTRA 3K0BA 4EAAA 3ZWQA 3DNPA 4JB0A 4ND7A 1WXQA 3ZY2A 5FPHA 3OEHD 4PZAA 2PZGA 4GOLD 1ACMA 3UW1A 3EX7C 3H9UA 3HKEA 4DREA 1WZUA 2QTHA 3F2IA 2OTCA 3TNDA 3WMRA 5KTNA 1K86A 1B2LA 4OXYA 1VG9B 3EEBA 3QPBA 4YB8A 3K96A 4MAMA 4MPJA 4WN9B 5HBGA 1R8YA 3GFPA 3S2EA 2ILTA 2VZ9A 2PIDA 3P9XA 2Q4DA 4ALJA 3HSYA 4DA8A 2XKJE 1AM4D 1B1CA 2P7IA 3RRYA 5IYZB 3PD0A 1PJQA 1D4AA 1TTQB 2DR0A 4YA6A 4EBFA 4P93A 3UVEA 2R6GA 4LNUB 5B37A 2X2PA 4G37A 2G9NA 3NH6A 4LTNA 4DIDA 3NM5A 5BMVA 1VKHA 1Z4JA 2B8NA 2WD8A 4UDXX 5ALJA 5AO9A 5BSRA 3RKRA 4AK9A 5IAOA 2XMCA 5DXFA 4D44A 3OEWA 3CYFA 4LOLA 1VPLA 3GGCA 4JZKA 3B48A 3FI9A 1WSDA 1GAXA 1NQWA 4B75A 4A8TA 2OCPA 1U2RA 4I3GA 5IDYA 4L08A 5BNTA 4GRAA 1YU6A 2RKWA 4B45A 3CF4A 1XMPA 2ZU6A 4U8GA 4Y9DA 5ADHA 5LM3A 3UPDA 2E4UA 1JPJA 2XMPA 4I3FA 5LP6A 1CBUA 2VPQA 5EZSA 4X91A 3S7TA 1V41E 1YUNA 2R66A 2XECA 2W9XA 4QPPA 3PPWA 2VJLA 3BXOA 4Y2YA 1HUQA 2QX8A 4AJKA 2FRVA 1GPLA 1JFLA 3EB9A 1NXPA 4G8DA 4KHPB 3B89A 1RDFA 4OMCA 3ZCTA 2DCMA 2Y0CA 5AVSA 5FULA 2RCYA 3GCGA 4GH5A 1RI1A 3C3JA 2CZCA 2VP5A 2VT6A 2IPXA 3EEFA 4GGPA 4RLFA 4DBLE 5HYVA 1TEHA 5J2UA 1M2VB 2AZMA 1E1LA 1H42A 5JAHA 5EHGA 1YXMA 3RQIA 3EGXA 1OFHA 1ADJA 4RCZA 3KU4A 4G89A 8ATCA 3TAXA 3BD6A 1ORTA 3COWA 4B3TB 2JFUA 3RJTA 4UMDA 4DG8A 3HJFA 3D6JA 2YMMA 3OTGA 3KS9A 3STUA 4FYIA 3W0LB 1CR2A 5LMNB 5AVOA 1J20A 3HXTA 2XB4A 5HJ5A 5I4BA 2NTVA 2ZJOA 3HEAA 4W9NC 4TS9A 5KKAA 2UYQA 1DO8A 3C7AA 3N2GB 1JXOA 3HKDA 3QU2A 3Q3CA 4B0PA 1E9SA 2RK6A 1Z5ZA 4FILA 3I09A 1I3NA 2E6UX 4AS3A 4BNWA 4YAUA 2IA5A 1ZESA 4DQ0A 3FPKA 4KQJA 3B6JA 4D4MA 3Q41A 3PFFA 3ZDRA 1DIAA 4RPJA 2I80A 3H97A 4YN3A 4DCGA 3GFGA 2BIFA 4M98A 2XEDA 4OX9B 5FLEX 4CNQA 1XHLA 1E7YA 2YFYA 1EPUA 3TN7A 1QGUB 3KXKA 2BTOA 2G5PA 2NADA 2C8KA 5EAIA 3TUZC 1IXZA 1GV0A 2FE4A 3LCMA 3OKCA 4JHLA 1DQYA 2IV7A 3TZBA 1P5JA 4DZTA 5CLJA 2ZRNA 1WB4A 4O2LA 1PG5A 2JGNA 3HL0A 4I14A 4KAAA 1UF9A 4NCHA 3KOZA 1Z0ZA 3KQYA 3L92A 4TTVA 2Z08A 2QVCA 1CUSA 2G88A 2JFNA 1QQAA 3TTXA 4A8PA 1LRJA 4J16C 2PBFA 1J56A 2XYRA 3ZCVA 4C4XA 5DCUA 4L2IB 1VL5A 5CDYA 1C7EA 3VU8A 1ZNZA 1LSUA 5EKSA 4AJPA 3DVSX 3EIXA 3AUSA 4YAIA 3AHJA 3OLVA 4M8KA 5BYKA 3PEUA 4ZPJA 3UWOA 1CUWA 4KO8A 4X44A 1RZ3A 3ZCPA 4NHOA 4YMGA 3SFVA 2GFHA 1BVRA 4OQMA 1ISSA 1ZIYA 1BHQ1 2EKLA 1PFQA 2JBAA 4J0HA 3N53A 5CNJA 3HVUA 1JHXA 3SZOA 4DCMA 4E1BA 1GGJA 2VHZA 4XH9B 5A5EA 3RAJA 3S2GA 3W8FA 3IEIA 5DTJA 3UXYA 1O6BA 4UEOA 1EJ6A 2ZJZA 1CDZA 3ELBA 2WU1A 3CUYA 2R6FA 3GMTA 1XCPA 1TUBA 3L7JA 4G56A 5JCJA 2GKOA 3BZBA 3PNSA 4L0DA 4X94A 4YYEA 2Q6IA 3ZWKA 2QU8A 1TM2A 2ZATA 3CX4A 3HCDA 3PFGA 4ZAVA 2HXSA 5J58A 1H1DA 4RE6A 2J3EA 3UMFA 1D9XA 3BGIA 1I1OA 2K2WA 5AOBA 4W99A 4BCBA 2C9DA 2YVAA 4OEHA 3TZQA 3ELYA 4IGKA 5L95A 2YZNA 1ODSA 3IKMB 4MNTA 4BO9A 4HSGA 4WCFB 3CB2A 1PQUA 2XKKA 1PK9A 2BSQA 5ICEA 2EF1A 4ATNA 4F46A 1AUVA 3PRYA 3ID6C 2QPLA 1E6EA 1JR2A 2IYXA 3EULA 3MZ0A 4AQDA 2OY0A 3G2PA 1XKQA 4IJVA 1WV0A 3DE4X 2CLIB 1OU4A 1CJUC 1QS0B 2AMFA 1O94A 3KVRA 2DULA 3RYFB 5CITA 2X5JO 1CRZA 1NE7A 2FUCA 4IKEA 1JJBA 4V3CA 1QLHA 3VDXA 4DJFC 2I03A 2PYIA 3LY8A 2XMZA 3DVLA 2OECA 5G53C 5EOVA 1WOYA 5DN9A 3OWOA 1EVZA 1TC2A 1F2DA 1ZBDA 2OORA 3GLTA 2PR2A 2PT6A 1MQ9A 3KKZA 1RT9A 5PGMA 3SSAA 2ZUCA 3UKOA 4E5SA 4C7KA 1L5WA 2J9RA 4HC4A 5I47A 4JLOA 1YC5A 5KTMA 1QX4A 2PUGA 2XT9A 1K6MA 4MITA 3P32A 3TSZA 1U0RA 3HVIA 4QLBA 5K8JB 1H94A 1L4KA 1KERA 1A9XB 1Z5UA 1CUUA 2Y05A 3DMHA 2WABA 4U2BA 5B3AA 621PA 1AXEA 5AWFC 1W85B 1RPJA 4BJ5A 3QU9A 1CNFA 3LOUA 2LUOA 2WHYA 1G1MA 1TK9A 2C4HA 3H5IA 3SFZA 4C3VA 4DQKA 2DR2A 4AQ7A 1LI5A 4J0CA 3P0HA 5G40A 3WL7A 2C97A 4WBXC 4EHFA 3VVBA 1VXRA 1Y80A 3D8RA 4I9GA 3CUVA 5HF5A 4AJ4A 3EA4A 4B09A 1IK4A 2DPMA 2A9QA 2I62A 5BSHA 3KOWA 1FDUA 3OPVA 1Q11A 3M1IA 5KPJA 1GTL1 1PEYA 1SA0B 1YGYA 5CVUA 4TTAA 5K0FA 1GU1A 2XQIA 3LC7O 2JRCA 3QE2A 2YWHA 3PL1A 3BICA 4WFIA 2G67A 4FD2A 4FB4A 3OE7D 4JODA 3JVDA 1CDDA 5B5SA 3EQ8A 4R2LA 4DWVA 1VLJA 1I7LA 5EJ6A 2Q3EA 4J07A 2WNSA 4ES6A 3H2HA 3TEJA 4GYWA 1NMEA 4P32A 3J81k 4DR2B 1BU5A 4DQDA 2H63A 2HV8A 3E9QA 4CM4B 1XZCA 3AF3A 4DIEA 4UNSA 4GD3Q 3K9HA 3U1VA 2ZUVA 1QUFA 3S40A 3K0KA 3LUPA 4KV7A 5KTPA 4RMIA 2HWXA 3GUUA 5G0VA 1R8JA 4IMIB 1KDYA 4K88A 1S0UA 1CY7A 2BGIA 4BFLA 1M34B 1YZQA 1Z4MA 4XCXA 1M72A 3ZHYA 2G6BA 5CYFA 4ZI7F 5CNMA 5KX5B 3RC7A 5JROA 4CTKA 3THYA 1IAQA 3G0CA 2FFQA 1QLWA 3JYLA 2FZGA 4EJFA 3IXQA 1ILEA 4K6HA 3N70A 3T0IA 4X7RA 3VRHA 5A02A 4RULA 1NMYA 4LYJA 1J1ZA 4O4IF 3LLMA 4YX9A 5MDHA 4U4AA 5H68A 1PT9A 1U2TA 2LPMA 5IJWA 2OMEA 1C9JA 1PF7E 2C9CA 4DEVA 1PD1A 3EVFA 2FR8C 1PNVA 3WICA 2BR5A 1QPGA 2AQHA 1ISRA 3C2QA 3JSXA 3MWDA 1NKVA 4BVAA 1RLJA 1XVUA 4RLSA 1JKIA 1C7JA 4AWAA 1S2DA 3PJGA 2BT4A 2QP9X 1GZHB 1WNTA 3QXJA 5LYJF 4C76A 5LXTB 1U9IA 2C84A 3W8RA 2WSIA 2Y1GA 4BKUA 2OD2A 2X9QA 4TVBA 3M89A 3JYOA 3GVIA 1C1YA 3IAS6 4LZLA 5A4MS 3P2KA 5SZKB 4U7DA 2PFKA 2Y0PA 4Z53A 1LI7A 3OJWA 4FGKA 3QV2A 4LJAA 4KO2S 1NR7A 3DDNA 1A9PA 4D4IA 1LZLA 5DCLA 3K0EA 1PX2A 1NUSA 4J7CA 2QTMA 3ICWA 4I66A 2HRZA 1YBAA 3INGA 1YMVA 3MBKA 1AQ6A 3HA3A 3MAGA 1C7RA 4Q3NA 2P68A 3G0OA 1O5IA 4S1VA 1KZ1A 4CG1A 4HVCA 4YRZA 1AMUA 4FUQA 3RK1A 3ZEIA 4DLZA 1UOQA 2ODEA 1TCBA 4MS4B 4DN6A 1NKTA 3EOAI 1XE3A 4OB7A 2C4NA 4TKUB 1KMHA 2V7QA 1NP3A 2GCGA 2ZSJA 1G1AA 2HAEA 3GRRA 3PFWO 5FBQB 5GWXA 3ZDQA 3PG5A 3DMTC 3PFKA 1KQPA 1UPAA 1XA4A 1SMKA 1YMQA 2D4HA 4WLOA 3SJBA 3V8BA 5K3FB 1C3OB 1O8CA 1H85A 4BNHA 4C01A 4EFKA 2ZUEA 3N9IA 5EJMA 5AM1A 1K6XA 4CM3A 1RP7A 2JJYA 2R68A 3IIKA 3NANA 1REQB 5M04A 1X7HA 1Z25A 2BZ0A 2I55A 4TKVB 5GM2A 2QN7A 1Y4UA 1QH0A 2FPWA 3G0DA 5IBRA 3ZTTA 3G9TA 1QHEA 5TPZA 4DV1B 1XZJA 1AXGA 5ADUS 3FSGA 3SIWA 2HC9A 2YWXA 4TLMB 3KSBC 2CUTA 3DEAA 2N47A 3N7AA 1SUBA 2JIRA 5KKCA 3B5JA 4B81A 2YHBA 4R1TA 4O4LB 1MIOB 3TIIA 2VJOA 3OAAD 4Y1RB 1OWLA 2H00A 2DQZA 4YALA 4C6TB 4W6QA 3LUDA 5A0FA 2LNDA 3D4IA 2X76A 4B6EA 4L9SA 4XJTA 3JYQA 3PI7A 4GMFA 1G0OA 1EEHA 5K51A 4G8BA 1J00A 1GQRA 4RGYA 1C0LA 1TJNA 1KYVA 4REQA 5DHSA 4GGMX 4EY8A 4PG8A 3VKHA 3CRRA 4FR0A 1NBME 3M82A 1YZHA 2JKZA 2X86A 2YDYA 4F9EA 5BVGA 2VPTA 1QTRA 1WMFA 3IPRA 4OSOA 4ZALA 4C4ZA 3CEMA 4Q7JB 3R5TA 5T64A 2GBLA 4BZXA 4CLOA 1EI9A 2Q2QA 3D59A 4Y0AA 3KZKA 3RS0A 1E1RD 2H0QA 1IUOA 2ETVA 2AN1A 4ZAWA 5JO9A 1FPQA 2ISQA 3P5SA 4RH1A 5KC8A 4MKXA 5LQRA 3U44B 2RGYA 3B1XA 3LTEA 1VLLA 4FOLA 3FZEA 2AFRA 3KRTA 2E4WA 4XIGS 5FNVB 2ZJ2A 5L53A 5HQJA 3JD1A 1N2IA 4U6QA 2PM8A 5DCWA 1QU2A 4IH9A 1GPKA 1H2ZA 5AXCA 1TAQA 1CY4A 3BERA 1EUCB 2OG2A 3KB8A 4KO3S 1VYUA 3GZNA 4EY7A 4CR8A 5EYPB 2AZDA 1T0IA 3PIIA 2ZI6A 3HBFA 3STHA 3EF0A 5THKA 3AI7A 2JGRA 4OF4A 2EU8A 1WLYA 5EWMA 4J29A 3CR3C 4GM4A 4U7PB 1VP9A 3DEIA 3KG2A 1GZUA 5T3UA 3BWMA 1ZS9A 2XTMA 1C9MA 1QIGA 5FTKA 5LLSA 4Z3KA 1VCMA 4JSYA 4F4HA 4ZI7A 4LHXA 3GLGA 1FFEA 1KTIA 1I36A 2IOQA 2QB5A 2JVKA 2VYNA 3H2JA 4OVKA 4E22A 1EE2A 1N0VC 1S1CA 3VO2A 2R44A 4NP6A 4Q47A 3QLUA 2GYVA 4Q4JA 3K5IA 1C2YA 2R1UA 2BFNA 3F74A 2VAPA 3T7IA 3RYCB 4M83A 2YVUA 1USKA 4AZ0B 3A9UA 3I9FA 4L4ZA 3UXMA 2HCBA 4LWPA 1VA4A 1JHAA 1QF9A 2F48A 2R6HA 1Z6ZA 2XA2A 4DT1B 1MA3A 4K28A 2YYYA 5ERYA 4JELA 3SZMA 3ZUPA 4TMVA 3AVUA 5LYJA 1C9DB 1CEQA 3WXMA 4Q19A 3BJEA 1A7AA 1LDYA 1RQ7A 2A5LA 4OQFA 2GPJA 5CDGA 3K4HA 3GHYA 5KI6A 1CRQA 1YFKA 4QXOA 3DOIA 3T3PB 1CUXA 2X77A 5AUQA 4X71A 1ZEJA 3SSNA 2P4QA 1N2CB 1Q7BA 1X13A 3CGGA 4BP9A 1E7WA 4EO9A 1KZ7B 5AIAA 4N0QA 4OJYA 3NEJA 2XIJA 5HQTA 2LXNA 5K7SA 3K8ZA 3W05A 1SK9A 2VNJA 3NYQA 5A7HA 1JI0A 5KYGA 4ACAA 3DM9B 4PLCA 3KQHA 2IIPA 4YGXB 2H9AA 3K05A 4EG6A 4ZHSA 5CNKA 3GL9A 2QMHA 5CLHA 4R51A 1TYDE 1SCUB 3NVDA 4EGFA 5DIZA 1PT8A 1E5QA 1ZGAA 4QPJC 2WA2A 4XDYA 2X7HA 2HADA 3A1SA 3G2HA 1U0BB 3EZ7A 2FRDA 3VSCA 1S2NA 1S9HA 3FPSA 4BNMA 2FZWA 4JT9A 2ATXA 4ETNA 2GHQA 4O4HF 1LF0A 2J3KA 2I91A 4BQEA 1G5HA 3P94A 4X6UA 2DHDA 3E18A 3S1SA 2O8FA 1BH6A 2QTNA 3II6X 1OYOA 1O0CA 4N7JA 2BEUA 5H3HA 3SBEA 1MH1A 2QVLA 2EGUA 1F6BA 2UVPA 3HUDA 3IESA 4OUDA 4YAWA 1SKMA 4TL8A 5JFGA 2ZTHA 4LHZA 5JBNA 3CGWA 3KQNA 3ZE2B 1K3TA 4AJ1A 1XJQA 2GWHA 1XQ9A 2VG8A 5ECYA 4DSAA 1EUZA 3C87A 2BDTA 5G0UA 2A1UA 2WUWE 5TQVA 3T9CA 4BNDB 1J8QA 5I7UA 1JAZA 4ND2A 5AQ1A 1W73A 3WQHA 1SIBE 3E61A 4LJ5A 1APBA 2W58A 1Q0PA 1A1VA 4MXDA 1KVSA 3BS4A 3G0BA 2OYCA 1AMOA 1MAAA 4QGHA 4P58A 4OYHA 5JG7A 2P9EA 3BFXA 1U11A 3A04A 3DO8A 5BOVA 3ZHUA 2CT8A 3EK2A 2GNPA 2X2FA 1JU9A 3KV1A 2W2KA 4QC2A 2G9QA 5HCNA 3E9MA 4W1RA 1Z4NA 4CJXA 4K5QA 5E0KB 2VIIA 5LQKA 3S68A 3FETA 3FLBA 1H1TA 1YZNA 4Z8YA 3SVTA 2PAFA 2AYXA 3G9ZA 2V74B 1UDAA 3A28A 3LPNA 5C51B 2DFKB 2A78A 4HGYA 3Q2OA 1PR9A 2Y9PB 2NVBA 3OOWA 3PXCX 4V38A 3GIWA 4R41A 3ONFA 3WXBA 1HK7A 4KR6A 1K5DA 1RYEA 3FYSA 2H7VA 4RJLA 3AY7A 4MVJF 3PIRA 1UC5B 4H1UA 4MGZR 3UAYA 4HTFA 3ZOKA 1L7NA 3CNOA 1WSBA 1YZ3A 3JQ8B 4C0SA 2D0DA 4FTWA 2WT9A 3IUSA 1NVVR 3KVVA 3NBYC 4GXNA 2E7ZA 5L3ZA 5CDFE 2QD2A 4M0FA 2Q27A 2HJSA 3N2NA 1HWYA 3JZMA 4ANFA 3WG9A 2V1XA 3TPCA 4AC9A 3VR3A 3FYHA 4B6QA 3CUWA 4PZCA 5D3QA 3IHWA 5K5EA 1Z3IX 5A5DA 1JRLA 1OW3B 4Q82A 4AJNA 1S8FA 1IEWA 3BIOA 1K0UA 2BMWA 3SPXA 1LBSA 3IPCA 4PAGA 5B57C 1CY6A 4FQ8A 2XUFA 3SIXA 2CKDA 1BMFD 3FWKA 2PJZA 1TADA 4I6EA 5H5JA 3HCEA 1ICEA 1K5PA 4JB2A 1NE2A 4PONA 4DZRA 4GP7A 1XAHA 1Z74A 2F1JA 1NBIA 3MT0A 1V5IA 4RMNA 4U0KA 3O26A 4Y2PA 3C8ZA 1NXWA 5THQA 3T7DA 3UKDA 4KMOA 3I1JA 2HIMA 4DKJA 3AVYA 1L5QA 2GZ3A 1VRCA 3GLIB 1TZ2A 4M7WA 4JI4B 4MDYA 4D1YA 3WL3A 4R0VA 3BRSA 5BN4A 1J07A 4YR9A 3PQ4A 1I3OA 1E2LA 2WQ6A 2BGWA 3AKZA 2BC9A 1CUHA 3U60B 3L02A 1PVOA 2QY6A 3D3KA 2AIRA 4XDHA 3R6WA 2VYFA 4NULA 1L4GA 5FEUA 4Z4EA 3IIJA 1EB9A 1X7WA 1CX9B 1GQYA 3NIGB 4PX2A 5KZMB 4QEZA 5BPHA 1ETHA 1HQCA 3DVAA 3INTA 4R40A 2C0QA 1RJWA 3BJRA 3C6KA 4BKOA 2OYSA 3WRXA 1MIHA 2A2ZA 2QR3A 3D4OA 2FSVA 4P3NA 2P9CA 4PRZA 2IZZA 3UXEA 2BFDA 3W2GA 2RFLA 1EDEA 1OFUA 3DMNA 2P5SA 1N7IA 1Z12A 3FNGA 1P9OA 4K9OA 1P80A 1XFAA 2VCYA 3S0JA 4AO6A 4ZTZB 3PQDA 4YT2A 1NF8A 2A0FA 2YV4A 3H84A 3F67A 1OYYA 2ADFA 3KJIA 2CZQA 2GJ4A 1M8FA 4NZPA 1F5NA 3WLQA 3RJ9A 1V45E 5EZ6B 3HY6A 4W4TA 4IVRA 2ZRAA 4HAYA 1RXVA 3L1KA 4POAA 1MFZA 2O8NA 5EWLB 2E3JA 2OZEA 1PK7A 4KPUB 3RYIA 3EFEA 1ULBA 5B1SA 4KFCA 4P1ZA 3ZD6A 2XNDD 3UT6A 1P4JA 2HHAA 2JJ1D 1ISGA 3BB4A 4TYQA 2C7QA 4GP9A 5L4NA 1W75A 3AUUA 4B84A 4JLPA 2VHVA 4AZ3A 3WSTA 1D7OA 3LXUX 4E14A 2QGFA 4TUYB 5M29A 4U5QA 4NSNA 4X3OA 1COWD 1EQ2A 2W00A 4CXMA 3E5MA 3Q3GE 2PTHA 4QRIA 1E2DA 1TPZA 1K3FA 4FYWA 3GD5A 2XRFA 5LD2C 1T34A 3I45A 1R0LA 4CL2A 1UAYA 4QPDA 4X62B 3S5UA 3CZRA 3B7PA 1HBJA 2F7SA 4HAWA 1RRCA 1PFKA 2X0KA 4FHGA 2ZKIA 1VOTA 2BM1A 3P9RA 4JUFA 2WJGA 2TMYA 3MCZA 5CDSA 3JQDA 4FOPA 2G0TA 1GPAA 3EGDB 3MJTA 3PXEA 4H4DA 1VIYA 4MJLA 2JEYA 3OZTA 1W36D 1WF6A 3MRTA 1DZ3A 2IUEA 3OBBA 1E0JA 4W7SA 3S55A 4DMHA 3QKWA 4CTJA 1VE3A 4OOFA 3BEDA 3EE6A 3RC1A 3EPHA 4W5JA 5B1YA 3IR5A 1E2KA 2SECE 1WY5A 4I8IA 1KK0A 4OMUA 3UMJA 2O7QA 3LF2A 4C14A 4RTOA 5K05A 1AT1A 3O8NA 1ZH0A 2REOA 1KEEB 3OZGA 2IPAB 3ET4A 1PZGA 3ODGA 4A1FA 4KOAA 3D2CA 3R3WA 1VTKA 4NI5A 4BNIA 4MVJA 3GPBA 3BOSA 3H18A 4JI1B 1L5VA 1V1MB 3HFRA 4L5YA 2HNKA 3RUEA 3LLCA 3ZX4A 5C1DA 3SEQA 2Q2NA 1W59A 1XTBA 3L5KA 5DISB 6Q21A 1VPTA 4OP3A 3OKPA 1G7TA 2JFOA 1FP4B 2ZREA 1H8HD 3K8YA 1SOAA 3RCBA 1MB9A 2HK8A 2YMLA 4RABA 2YJTD 3DTYA 1RKQA 1AQYA 5EVCA 4F2HA 1E63A 1US8A 2X7JA 4RGBA 2E48A 2ZS7A 1CNMA 4B3XA 4L6AA 5H80A 2O3UA 2JFFA 4BLUA 4XYBA 2IH4A 1TU3A 1D5WA 1XNGA 4RPLA 3INYA 1N3YA 1GEEA 3FE2A 4HZIA 2ZJAA 3DC7A 4PPFA 1PVDA 2PMCA 4Z4FA 1R10A 2CMKA 1B1AA 2FP4A 3NHLA 4N40A 5DTEA 4CMBA 1XRLA 3HWRA 1SVIA 3T34A 5J5CA 4N0MA 4DLPA 4FIDA 4GXTA 6REQA 4HAIA 4K1LA 3KR2A 3B51X 2XMBA 1ORWA 2P69A 2W6IA 1E4EB 3B6ZA 3AU9A 3IEXA 4TMZA 4AY2A 1QQ7A 5CD9A 1OAOC 2QVBA 3EISA 4YLGA 3R3UA 1FXSA 1BXRA 2EEPA 3UYLA 2JIZA 4AYXA 1R0ZA 2J5XA 4JJ7A 3GFFA 3NDJA 3ED1A 3E7WA 3EEIA 1FFHA 4ARZB 3LKZA 5AUNB 5H16A 1T9KA 4HK4A 4NMMA 1RD4A 4X54A 1YQDA 4A6DA 2F1KA 3O94A 1GAJA 1YVUA 3GJZA 3V5NA 2CB0A 3NXKA 5A9SA 3G7UA 1Y81A 1GDDA 1JLKA 5E6SB 5FFFA 2VK1A 1I8TA 1C41A 2XSZA 4KFUA 3VAAA 2J3MA 2Y1OA 1QQBA 2V6BA 3DTVB 4OSPA 2Z8XA 3HCNA 2J9GA 5DBFA 1GVHA 1Q7GA 1XZEA 4Y1EA 2AMLA 5IEBA 4ECAA 1J0AA 1G5QA 4G1MB 4FC7A 5JZVA 4ZV4A 2DGDA 4R3NA 1C8LA 2H1VA 2QENA 4G0PA 1E9DA 1V8BA 3H5AA 3QVMA 4MWBA 3I34X 3EW7A 3OEED 4KRYA 2UXCB 3I2IA 1ZN7A 1FYDA 1JG2A 4JIMA 3TNJA 2L17A 3H0CA 3QMWA 4MR8A 4M54A 4OH1A 5IT9A 4OP1A 4TV9B 3IUQA 1QBKC 3BTSA 1M34E 4Q4AB 4RE5A 5FHQA 4DMCA 4GYJA 1Y82A 3S2UA 3L6DA 1CUCA 3N0TA 3RVBA 3RBAA 3TFWA 1QO0A 1BFUA 4W9NA 4C0WA 3A9RA 5BSEA 1ITZA 1Z6GA 4EYEA 5DNYB 2QQ5A 5KWVA 4F3TA 1XROA 1XNQB 2Q99A 1PNOA 2FFJA 5AJVB 2LKCA 4YK7A 4YREA 3V32A 2FP3A 4JITA 5L4LA 3KJZA 3JQFC 5AM2A 3MD9A 4TVOA 4D3SA 2RARA 1X8JA 1NZJA 2HGSA 4HAXA 4A4DA 4HZGA 3VR4D 1K1EA 1TKRA 1T3GA 4OO3A 5E6UA 3BWYA 4QEDA 3ECSA 1F48A 4M7RA 4R05A 3W2FA 1NJ8A 2AJTA 3FXAA 4DLVA 4H9GA 2JJ2A 1F9AA 2GAJA 2NZUG 4KYUA 5C4MA 1YVDA 3KJQA 3IRUA 1DC5A 1V6AA 1QVAA 3DCNA 3P7MA 1IE3A 1UUFA 2IJGX 5AP9A 1K2VN 4WK2B 5T57A 5B4TA 3FSJX 1UXOA 3HYSA 3S7ZA 3QTTA 4DM4A 2PGIA 2RJ3A 4UTRA 2O8EA 4QPCA 3OZWA 2QGNA 3AKYA 3G9QA 2YICA 4D9CA 1Z2EA 3GA7A 4UQOA 3UJBA 5CXUA 5HKBA 2BFAA 2XTJA 1O58A 5EGSA 3TR5A 4F92B 3FPGA 1NLFA 1JHPA 1TU4A 4Q1DA 3HACA 4HAZA 4F6CA 4IUBS 3UUWA 5KDLA 3V4SA 3SBDA 2BM0A 1CULC 4OY3A 4WFJA 2CC2A 2V7PA 3E2MA 3RRBA 1C9NA 4E03A 1NSTA 2PZFA 1J25A 5DM2A 1ZDMA 4MRPA 1QH1B 3TNLA 3VVLA 5IKMA 3O2QB 4WDRA 1VHJA 3CNLA 3VYVA 1IBMB 1RBYA 3PV0A 2C2KA 4IO1A 1ZO8A 3L7MA 5JZ9A 3T9AA 5CCBA 4DV4B 1UZUA 4B1FA 2ZSEA 1IYZA 4QU5A 1HR0B 2PX3A 3NH9A 2CB9A 3QXSA 4PSUA 4K9NA 2VDUE 2P79A 3CVVA 1WZIA 7ABPA 1TTTA 2BRUA 3IHTA 3WGIA 2F3QA 1NQAO 2FF5A 3ACCA 3AF2A 3WMGA 4TYWA 2PVCA 2CVFA 3I0MA 2HYIC 1CIPA 4BATA 4RO0A 5A4DA 1N5KA 5KVVA 4YY3B 2ZM6B 1XPJA 2ZRMA 1YNOA 2WYOA 2CDRA 1GUYA 4GZMA 4IL5A 4F3YA 1EQUA 2V58A 2ECFA 3QQ5A 4RTMA 1P5HA 4KL8S 1QWSA 1OLUA 5G4LA 1NSFA 2GI4A 3L1IA 3HGQA 1JG3A 3BMOB 3KWFA 2IEBA 3BK1A 2ZE8A 4LUCA 3GVPA 1C1XA 1RMTA 3D8HA 1YAJA 6ABPA 5ALGA 4TV8B 1UT8A 4DTCA 4B76A 1HDYA 4C0KA 1EZZA 3K6SB 1OZGA 5IVHA 4R31A 1FYXA 1Y8AA 3QXXA 4B7CA 4COKA 4RHEA 4PO9A 5EY5B 3GDWA 2IOFA 2PQ2A 3A9SA 3LHFA 5ALHA 2XLBA 1W9MA 1ORIA 3W90A 4ZMRA 5DI9A 1R3DA 5FAKA 3JATA 1C4OA 2JHCA 2WF9A 2XE8A 2B35A 5E3IA 1LY1A 2P3QA 4S05A 4L4RA 3UHPA 2H08A 4LV6A 4WUVA 1TO6A 2QN1A 4HYEA 4KXWA 1H93A 5U4XA 4UEWA 2FSIA 1PJCA 2ZVJA 5LQDA 1K92A 1FTWA 3LUJA 3Q3HA 1OBVA 1Y9JA 4C21A 3B70A 2JLAA 3FVWA 4KXVA 4UOQA 3HU2A 4HDMA 2IHYA 4XVRA 5EIEA 4RZSA 1DTWA 1VLZA 5JPIA 2HU2A 1WHTB 3QPDA 2QW1A 3O4RA 5A5GA 1THMA 2A94A 3OLZA 2BEJA 2GHTA 2ZE6A 1ODLA 3DMGA 4AZSA 5FAXA 3DE2X 4PC6A 5DTRA 2H11A 3OLWA 1Q14A 3PITA 4QOJA 3C74A 3Q7TA 3LM8A 3R77A 1U2ZA 1D04A 1LWOA 1Q1AA 3R0JA 4LNAA 4NMXB 4B43A 1X1TA 5L3SA 5I9TA 4UCFA 1YASA 3KEFA 3VNBA 4KO4S 4G4SO 3BL5A 3ETGA 1A7JA 4LRXA 1JHVA 2O5VA 3Q6MA 1JI3A 3A14A 1IY1A 1M76A 1X7GA 1YJBA 1RAIA 4K40A 4K9PA 1FVFA 4RGVA 4ZIRB 4D9FA 3MNFA 2G63A 3MJCA 4OCZA 4PFJA 1BOFA 1W4BA 4ABTA 3WKEA 2YZ7A 3DYIA 4BFTA 2QPAA 2I4LA 4F6LA 4UM9B 1B2RA 4RKRA 4B4OA 4JJEA 3CONA 5TC4A 5BT8A 3CF4G 1RHRA 2DT8A 2XYHA 4QXMA 1E6MA 1ZJJA 4UZFA 1CUDA 1KSFX 1VBFA 4Y30A 5DH9A 3K9FC 2D1QA 4M9UA 3U3JA 2PGOA 1SXJB 2PZKA 4B6GA 3LC1O 2I6XA 1MN6A 4HDNB 1E64A 3IEPA 1GT6A 5JO0A 3QI2A 4D42A 2WM8A 4UU8A 4LXUA 1E0DA 3BHMA 2ZYGA 3LBFA 4MR9A 1BE8A 3DNFA 3QF4A 1Z0UA 1XZ8A 1NX6A 3SDZA 3JWGA 3VXKA 1XTPA 4QM6A 4WK6A 1E60A 1C14A 1OIXA 1HDIA 2QXTA 3N2IA 1OX6A 3MLEA 1UBKS 1WZEA 2BGUA 1XK6A 2FK7A 3BDIA 4LZAA 3DXFA 3MM4A 4IDAA 4J91A 3GX1A 3LPAA 1KYYA 1QHGA 2R86A 1N2CE 1J99A 1QVZA 3LWDA 5DP2A 2BEVA 3U4MA 3NHJA 2DFTA 1JG7A 1G4UR 1DINA 1P2BA 4CIVA 3KOYA 3R0XA 2IU6A 4EMUA 2B0CA 1P1FA 4TMFA 4EHDA 1O97D 3AF1A 2FR8A 3FNBA 1P62B 3DUFB 4LBZA 1T8UA 3O21A 4EFMA 3WBFA 5JCOC 4Q3LA 2JW5A 3DKPA 2QTBA 1IN8A 1OPXA 4H7DA 4IBOA 1GZSA 3STTA 1KJZA 3EZ2A 4M99A 3HYNA 2QLNA 4NBSA 3Q0EA 7REQA 4PSDA 3R6LA 4RW0A 2BGNA 4CKCA 1WNFA 5CA0B 5DI3B 3LS2A 2GPWA 4TPKA 3MINA 1CD5A 3ONWA 3B60A 3BGVA 2WM3A 2AI3A 3TQHA 2BJHA 4R81A 1E6CA 1GKLA 1RRKA 5JSUA 5CD1A 2H2GA 1NAIA 1NVKA 1CUGA 4YP0A 5BW4A 5C7IO 4PNPA 1XD8A 3ENWA 4WVFA 1U7WA 3JQAB 5ED0A 2IDKA 5LQAA 2J1LA 2Z43A 3V1TC 1MAWA 3X1DA 1F2VA 3D7LA 5LWHA 1K97A 4AW9A 2IYAA 2R0QC 4BZZA 3ITKA 4ZCPA 2X7XA 1R5OA 1ENOA 2A0KA 4KXMA 2Q6VA 1V4NA 3RTEA 1UK7A 1T2EA 2B6NA 1Z5OA 1N8KA 4ICIA 4LX0A 1X1EA 3VV2A 2O52A 1J2TA 1XQ1A 4B3DA 3PIDA 1THTA 2WSYB 2POCA 1NM5A 1P2FA 2LDBA 3CKLA 3LBIA 1EBFA 4URXR 2NWQA 3AKDA 2L0XA 4MMZB 1Q7EA 5JARA 4DIOA 5AVKA 3NG1A 1CRPA 2PX0A 2JCVA 1FNMA 4FXOA 2AC4A 4MQEA 1AKVA 3WA7A 2F43B 1DKOA 2FFBA 4GLLA 3ROZA 4YRBA 4BMSA 1LVHA 1ONNA 2YVLA 3QBEA 4YJDA 4KITB 5KJCA 1Y1TA 1TVCA 3HSSA 2RB5A 1G16A 1KQ3A 2V9PA 4GQBA 4NATA 3IUYA 3E6AA 4HNGA 4J75A 5DLQC 4LXHA 3F3SA 1VHTA 2PTGA 1A5AB 5GJVC 4J43A 1SHKA 1HDEA 3CKKA 3LV8A 3VX3A 2H2AA 3SN6A 5JSQA 2R25B 1W88A 5DO9A 3A6JA 3PHHA 4KQMA 4UHKA 5ICFA 2OBMA 2QJRA 4D0SA 1GQOA 1TYEB 3MN1A 4IIJF 3DYVA 1VHQA 5EVJA 3TECE 4QVKA 3CS3A 4WFQA 5TGZA 3KLOA 3PQ5A 4OHBA 2JDIA 3V8EA 4P0PB 4ZVSA 2JANA 3T7AA 3A2LA 1W5SA 3GEDA 1W4LA 2WP8J 4UDYX 5LDGA 4DLSA 1F60A 3E05A 4P7KA 2C2GA 3AERA 4I4LA 1J2UA 4ZYVA 1G9TA 2FFRA 4MPRA 1EP9A 4MV4A 4M0PA 3GAMA 3HHEA 2O8DA 4DMKA 3K32A 3WLAA 4UEQA 1UPBA 3PHJA 4ITRC 3RUDA 1QRRA 4RWEA 2IYPA 4DLXA 1AKTA 2YOGA 1C3XA 4GC5A 4FEGA 4I5EA 4B6FA 1JJ7A 1J33A 1MJGM 3D4LA 4BLTA 5KCZA 1X19A 4RUKA 3KYBA 2EP8A 5C0OE 4BOYA 1HOXA 3PDIA 1MXFA 2IZ0A 2IWHA 1FUKA 1PL0A 2NXCA 3MJVA 1GUZA 1OQAA 1XTUA 5C1IA 4RADA 3VHXA 4BZWA 2H0AA 5L4SA 4CIWA 1EM6A 4UFNA 3ZCUA 4MIYA 4DG9A 4MO9A 2B82A 3ZVNA 2NTJA 3I2GA 2SHKA 2XDQA 1B8PA 4QODA 1GUFA 1NL3A 3LT5A 4POOA 2B5OA 4A9AA 3E5NA 3QE4A 2HCFA 3CSSA 1PWXA 3ZNOA 3GLIE 1ZNWA 1FPMA 2P1ZA 4RK1A 4H0NA 2H3EA 5ENZA 1QYDA 2G9VA 2ZBVA 2X1MA 3RHTA 2P65A 4BU0A 3ZGLA 1JLSA 2ZVDA 3X1YA 2P35A 1SBZA 1AHIA 1Y3FE 3EIHA 3G7NA 3FVVA 4OREX 1QZXA 1PV1A 2FPPB 2DHQA 3WOVA 3PTZA 5GZ1A 1ZJWA 3BWXA 4KXNA 5F23A 2OHVA 3QVXA 3DKKA 4PG4A 4CTNA 3AOEA 5ALNA 5LZ2A 2I33A 1T8WA 3I5YA 3AQ4A 3NPAA 2BHRA 1FJXA 2D1FA 3TLYA 2F90A 3IMGA 5AI4A 1WF3A 4D26A 1UAAA 3GLQA 2AD5A 1OXMA 2PBRA 1NXVA 1Z73A 4D4HA 2VHYA 4HWSA 3RTDA 5A1JA 1U1FA 4HXYA 4DJ5X 5DYGA 2VDJA 3R3JA 4EF5A 1ENYA 3ZLTA 4PG6A 4M87A 5E9QA 4WOJA 1N2XA 3LXXA 3NYWA 4NH4A 5KTYA 1O96B 1ZN8A 1XCOA 4XUEA 5IYZF 4OXIA 1BA3A 2QI9C 1UWVA 5CVDA 1X38A 4L4UA 3KSMA 1IBSA 3THXA 2HIHA 1BJKA 1LX6A 4PNEA 1H1LB 2JIOA 3H2ZA 3R5HA 3IBYA 4V0ME 4TT8A 2QT0A 1D09A 2Z5LA 1NJ2A 3NYRA 3KBOA 2D00A 4BVKA 2PPVA 2H29A 4OX9Y 2BMEA 2CCKA 3RUIA 3HWSA 1M2OA 2WF6A 4LGCA 1E3EA 1GZ7A 1ZD2P 2H1HA 3UUGA 4B7UA 2J85A 2YWBA 4NHEA 2XB6A 2WWVD 3VTFA 5ELLA 2Z6UA 1M0WA 3QVGB 3C15C 2GN4A 2V03A 4UHHA 1PNRA 1VMIA 3V1YA 1AUOA 4EWLA 4JH0A 1WAMA 1JHUA 3LGXA 2R3SA 1X86B 5BV0A 3CW8X 1VA5A 4FE3A 4NENA 2BCEA 3GCZA 1U7TA 2W2LA 2VPWA 4YRGA 2I67A 1DSSG 2YV2A 4GVPA 2ERXA 4WW0A 1R4ZA 3IX7A 3RRMA 3W3AD 1NLZA 1W9HA 1FNNA 1P19A 2C2ZA 2OXCA 1D3AA 2C00A 2FR1A 3LVBA 3QY9A 4JJAA 1U1IA 2HLNA 4ENPA 2R65A 2ZPAA 1FP1D 3U80A 5HE9A 4FOTA 1M66A 3VPHA 1U7XA 4HB4A 2JGLA 3LBAA 3DG9A 3ML1A 1VRWA 2Q8PA 4FFSA 1V16A 3WQRA 1Z28A 2X1HA 2Q6TA 3CX7A 4RPKA 5K0JA 3TZLA 4Z6KA 1K98A 3W77A 5CIQA 3TGPA 4G5FA 2W6JA 2OFOA 5FLXA 3WYNA 4RETA 1IZ0A 3V6MA 4AKSA 5FR1A 3R7LA 1BJRE 1Q15A 1U3UA 1GLGA 3QXCA 3AGPA 2FI1A 4U9UA 1X39A 2QSZA 3WYBA 5IRCD 1YT5A 4Z4IA 1AUXA 2QLTA 4UVDA 4IIJA 4XUDA 4CQMA 5KYUA 4HGQA 1FLDA 4FFWA 4UVEA 2WPDA 5KYXA 5HP4A 5TPWA 4GR4A 1SKQA 3GJ8A 4PAQA 2CE2X 1YQ9A 4HVTA 1PD0A 4ETMA 3N86A 5EJ2A 1Z9BA 5A0VA 3OETA 5IKEA 2WNIA 4BAZA 2ZSUA 1LB1B 1YI0A 2OCDA 3MWKA 5E1BA 4WOPA 5L51A 5BMOA 2IHKA 4Z2AA 1J0CA 4MWEA 4ND8A 4UPDA 3TD2A 3OJXA 4P3PA 4P7FA 1P8AA 5A9TA 4H15A 5JSKA 1DKMA 4R1OA 3ROMA 3ZE1B 4D8VA 1CFJA 3TB4A 5B7NA 1DWPA 4MW1A 3T3HA 4F5WA 1Z45A 1F7VA 4AG5A 1BWSA 1GARA 4JROA 3UT5B 2XMRA 4WHMA 1D4ZA 5A7GA 2W2MA 3Q3IA 2XNSA 1TMOA 1X0XA 3A3KA 3U3OA 4ND4A 1CR6A 1DCKA 2EV9A 3VJLA 5HRAA 1IZ8A 1QGYA 4QOHA 1U0FA 4BZQA 5FUMA 2R85A 5IXJA 3IAHA 2VXYA 2DY0A 2OCXA 5C1PA 3UAOA 2QG6A 1PR0A 1VXOA 2AKAB 4OLFA 3O38A 4FFBA 2V7TA 4CHTA 1T2CA 2G9RA 4FN5A 1YJCA 1XLUA 4KO1S 2ZSFA 2FFAA 4OFZA 4R9RA 4MLZA 2FWRA 4I08A 4WCVA 1N9ZA 2C5BA 1ZFNA 2DFLA 2J41A 4H7KA 2H0RA 4HWTA 3RVMA 4EO7A 1CYEA 2BF7A 2WIFA 4EG1A 4GX0A 1JJAA 1WXFA 3IV9A 4BP1A 2Q5JA 3T7TA 3G9UA 3VU3A 1XMIA 1L7OA 2GRJA 2XY4A 5ALVA 5BN3A 1P60A 4O1MA 1RXSA 3GRFA 2FWNA 3EGEA 3HYLA 1F51E 3CNHA 4B2IA 4E5VA 1GRNA 4F85A 3LQ4A 1B4DA 3OJOA 4ZV7A 3BCUA 5EMHA 2AWNA 1PJ8A 2XWBF 5ILQA 4KN8A 5KKNB 2Q2OA 4BX8A 3HVRA 1ZIDA 2JA2A 4JL5A 4DHEA 2YCBA 4OM8A 4WN9A 3IULA 4Q3EA 2P4HX 4NU6A 4RDXA 1NUAA 3HYCA 1V5WA 5KNCH 1L5RA 3N8DA 4MR7B 5DKFA 3MTBA 5IK2A 3W6OA 1ONOA 4EITA 1B43A 4E3ZA 4N6GA 3ELDA 2ZJ1A 3EQ6A 4M9QA 1EFVB 1DO0A 1LC0A 5ALSA 4EFDA 1FU4A 3GV0A 4QYIB 1P2VA 1LI4A 1VM6A 2PMFA 3QSGA 2LCFA 2Q6LA 2O0MA 2P9HA 2GZ1A 3C8HA 1RVV1 4LOKA 3V1UA 4DADA 3QENA 4JVMA 3AX6A 1GQSA 1U3TA 3SQDA 4FWIB 4GAEA 2C0PA 1L6RA 4I4NA 3M3PA 4FMDB 1GCGA 3HS3A 2JK0A 4HYYA 4UKDA 3TLZA 2BHTA 3DBLA 2HU7A 1ZCAA 2PH3A 3PWKA 4L5CA 4LSWA 2GCNA 3BORA 2O4CA 2OL4A 2X58A 4UD2A 2UUOA 1U8CB 1NQOA 5A0TA 2F17A 1IDOA 2ZUBA 4O2RA 3N1UA 3CLTC 3JASA 1OLSA 1U0TA 1UMCA 4YRLA 3B78A 3O91A 3SF8B 1VE7A 3VNUA 1TCCA 2C03A 3VO8A 3FRIA 2JFWA 4Z5XA 2D5CA 3GBPA 4D45A 1J2JA 4YT5A 1E18A 3VH3A 3IVCA 2YFHA 2EERA 2OQVA 3L84A 2WVHA 1R12A 2DX7A 3EXFB 4O6VA 1R9GA 2DERA 5FT9A 3KAQA 2Y1CA 3O73A 4G63A 3CJQA 1A4XA 1ZL0A 1ZVMA 5D8DA 2OHGA 5KBYA 4Y6RA 4LWZA 1QRSA 1TU0A 1O03A 1E79D 2QLFA 1KI9A 1R4MA 1CUZA 4IHKA 5F73A 3FIJA 3ABRB 3STVA 1Q84A 4KE8A 1EG7A 5JNVA 2OQIA 3GRVA 2EYQA 2X0NA 1RM5A 4R8VA 1XQWA 1ST2A 3M6XA 3VR2D 4EUHA 2C98A 1F38A 3H1FA 1IWOA 3JQEA 2OXTA 3I04M 4C5BA 4DDMA 1JIKA 3EMKA 2O05A 4MH0R 4RV5A 3O7WA 5FI5A 1Y8RA 2XWQA 1PT5A 3FOZA 3OICA 3RSZA 4MB2A 3UJHA 3GK3A 2ZRGA 1T9HA 3QELB 1SQ0A 1TNDA 3FYTA 3QLEA 4NJEB 3ABIA 2A84A 3UANA 1KWGA 2HWYA 3DEFA 4QFBA 1ZOSA 3QOXA 2FMIA 2O8BA 5AKIA 1Y3CE 3J80A 1SO8A 2FDRA 3F90A 3VYUB 4YUVA 4V1CB 3WLKX 4ENRA 3A31A 1NBHA 4RD4A 4OI0A 1TD9A 3W6ZA 1I0ZA 3KZVA 1WBJB 2Z4SA 3ZJ5A 5SZJA 1GTRA 3B6MA 3RYHB 1S7CA 3NUZA 3IP3A 5KX5F 2IYZA 4MCHA 3W8DA 3EXIB 3K6JA 5DNDA 1NDQA 4L6IA 4Q34A 5KYWA 4XCVA 2NXJA 3BMNB 2XDAA 4QSMA 3UNXA 2RGCA 3RGGA 3ICEA 4U8HA 1COZA 5E7MA 5TVKA 1CEEA 1ESNA 5K3CA 1QJCA 2BGGA 4EJSA 4MUIA 5REQB 5FPQA 4MRVA 4MB6A 3VPDA 2TMKA 4O25A 3QMVA 2EFGA 3R5JA 4HNAB 4M7PA 4OP2A 3JTEA 4Q9HA 1JFFA 4P80A 4PRKA 2OWEA 4Q3KA 3IOMA 1GGNA 1NG1A 2ZWIA 5KNBA 2X4IA 1EX1A 4E30A 1TT5B 1U3WA 2EZTA 1XRNA 1K7SN 2I4IA 3H99A 1OZ0A 4JMLA 2J5KA 4OFBA 5EMKA 3WNQA 5K8VA 2WQ7A 3NX4A 1P8JA 2ORIA 4KX5A 1M6VB 3DMDA 4OA5A 4J1QA 1NW3A 2FHPA 5JH7B 2ZYRA 4QTYA 1VZ2A 1DELA 4J6EA 5D6OA 3L0IB 1RAFA 2B4TO 3K0FB 1NFFA 2VDVE 4OH7A 4UE3S 4V2UA 2KBEA 4FS8A 5LA6F 3RIYA 2XCSB 4A8JB 1A5BB 5DNWA 5GVRA 4HTAA 5CXXA 2NUTA 1FRFS 1R3UA 4OG2A 3YASA 4LDNA 4NBNA 1H3FA 1JIXA 1D9ZA 2OHOA 2AFHA 1AV6A 3TE6A 3N39C 2JLUA 1T26A 2I7XA 4YMTA 2GB4A 2MSDB 3LQKA 2VVTA 4S1TA 4QG3A 1GN8A 5IANA 2QMOA 1V9LA 3C3MA 1DWQA 1ECGA 1UJMA 2H5JA 5JYEA 4JLBA 4R0MA 2G71A 1LK7A 3AFIA 5JD3A 3KIPA 1V26A 5E1MA 4I1OA 4H31A 1ZRNA 2CD7A 1A2QA 1KH1A 4B3MB 2VK8A 4Q0MA 2F8SA 2PCJA 4NABA 5IN4A 4ASUD 2QVYX 3IT1A 2Z6AA 3KTAA 1NJGA 1QIIA 3NATA 3PQEA 4WESA 3LYAA 3G2JA 4D9GA 3HM2A 5IXSA 4JI3B 3HCBA 2MIIA 5BXQC 1BVUA 1Q0HA 3FWHA 2R4TA 2W90A 1F0NA 5HS4A 4BMDA 1CZKA 1XMSA 4B6SA 1ONBA 3IB3A 1TEZA 1SXJE 4G0MA 2ZROA 4KB5A 1B0UA 4IDFA 3F3YA 2VN8A 1SBHA 1PWEA 2V7GA 4ZO9A 4AP9A 1ZK1A 1TJ4A 3LSTA 4G5HA 5HMMA 4M0MA 1AA6A 1KE1A 3NOXA 1BW9A 2OP0A 3KFXA 1JJVA 3F4BA 1PWHA 2E21A 4EQ6B 5BQ3A 4LQDA 1YR9A 2VSOA 4XLTA 1C1DB 1Z15A 1P29A 2A1IA 1Z18A 4KGDA 3OQVA 1JB9A 1KI7A 2XNCA 3AR7A 3CWZA 4GUAA 1OXXK 4PGFA 2FKAA 3UCXA 3V4OA 3W4KA 4N76A 1H2XA 1GTZA 4A0QA 4HBGA 5EEHA 3CPSA 1GLVA 3JQFA 3IVRA 1YUBA 2C88A 3KUUA 1PJSA 2OB2A 3DXYA 3NEYA 5D1NA 4PLWA 1L7RA 3QWIA 4L51A 4G0QA 4QKQA 2I2DA 3FI0A 3GJ4A 4N65A 1UT6A 5JPDA 1U3CA 3OIDA 2GARA 2REXB 5CU7A 1MB4A 2G77B 1QIKA 1E8DA 3I2YX 4NE2A 3IKJA 4XOUA 4LMAA 3VNVA 4YJGB 1V1RB 1WW2A 3L4BC 3L79A 4ND3A 1UJ6A 4F72A 1OFIA 5FNVF 2NT4A 3OIGA 1KY3A 4J9VA 1KAGA 3B9BA 3TI9A 4YI3A 3V8NA 2Q7XA 5C3UA 1BXGA 2B78A 3IUBA 4B6OA 3QXGA 1JHQA 1AB5A 1XOIA 4MA4A 1V8FA 3A7EA 3SKYA 4F6RA 2A5JA 1EK2A 3BG5A 3NT2A 4RFSB 2Q1UA 2PKWA 3QFCA 4HYQA 4RHFA 5EUMA 1DO2A 1RABA 3ZE0B 2CVHA 4F93B 1I7NA 1QHNA 3DDUA 4P5DA 2PU7A 2IHJA 5CRIA 4MUXA 2MR5A 1RRGA 4CGZA 5L40A 7YASA 4D9JA 3PNOA 3M9WA 4GSLA 4CODB 3BF8A 1GO2A 2QJOA 4II2A 5EHIA 1JR3A 1XEXB 2A1TS 2C9BA 3OOYA 4KMRA 4C0HA 4DA7A 3ENQA 4ER6A 2QW8A 1BS9A 4JOCA 3TIVA 4RIHA 3WADA 4RPCA 3TW8B 2VBIA 1NJ6A 3B7GA 1CQIA 1OB5A 3UCEA 4GO1A 4ZFNA 4PIVA 1K68A 3A2NA 4I1YA 1W7AA 2X0FA 3G2QA 1TLFA 5ALEA 3ZTYA 4MHOA 4EABA 3GFQA 3OQMA 1Z0KA 3AJDA 5LBUA 5B30A 4EARA 2YW2A 4BU1A 3M9XA 1A9OA 2PMEA 4C9BA 5JFTA 2O20A 4OATA 2GAOA 2GDJA 1UMBB 1VZ3A 1JT2A 4JYPA 4NZYA 5D84A 1B73A 1OC2A 3ADPA 3ROGA 3GGGA 1C8VB 4OJMX 3LECA 4BRUA 4G5QA 1RBQA 3WFJA 4EEXA 5LXTA 3K8QA 4OV6B 1SKBA 3OF2A 3ROTA 3G8DA 3RD5A 1TMYA 3UGTA 2WB4A 4PTLA 1QH8B 2GEKA 1ZAKA 2NV6A 3BWEA 4MS1A 1Z26A 5MF6A 2NZVG 4FM9A 1Z37A 4WVLA 3D3QA 4HB0A 3C6MA 4Q9JA 2HLDD 5LA6A 3RARA 1P0FA 3OT1A 5JCXA 4G9EA 2IEIA 4KJZA 5F2OA 3SM9A 2OV1A 5B2ZA 5ITVA 3RAEC 1JFSA 1X14A 3K9CA 2BVNA 3E3LA 4JEIA 4FCVA 4MS4A 2QZZA 4N3NA 4LGYA 3QHAA 3E5RA 1X74A 2FF7A 3ADKA 4WOBA 1M8JA 3HDTA 3U4DA 1KS9A 2SKDA 5AW8A 3CO0S 1J2EA 2IXTA 3QPVA 1S89A 5K3FA 4RK7A 1QE0A 5EMMA 3OCWA 3HQ4O 4OBBA 3U7FB 5DZSA 1N5JA 2G1AA 2ZAGA 4S04A 3KLNA 4JJIA 4EZIA 2WYUA 4B35A 2X5KO 3HKCB 4IJUA 5JWHA 2YUTA 4FT4A 3L4KA 1JEDA 3KB2A 2XXAA 1T6ZA 1U65A 2XEXA 4MICA 3CW2A 4R7ZA 3GJQA 1YHYA 5DM1A 5HM8A 2AOVA 4MLDA 3IB6A 2V6IA 4CIBA 2VYVD 4IINA 4QOEA 2N3ZA 3CWCA 4BEVA 4E7PA 4C4OA 4HCJA 1B6TA 1A5TA 3PJEA 3TQOA 5JASA 1KRHA 5HE8A 3C6XA 4F96A 1K88A 1MTZA 2NN3C 4Y1RA 3NFRA 1D5CA 2O2GA 2QUBA 1ETUA