1HRKA

Crystal structure of human ferrochelatase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords FERROCHELATASE
publication title The 2.0 A structure of human ferrochelatase, the terminal enzyme of heme biosynthesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 137
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hrkA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hrkA01
2Q2NA 2XWPA 1HRKA 1C1HA 2XVYA 1L8XA 1AK1A 4KLAA 2QD1A 2PNJA 2H1VA 2AC4A 3HCOA 2DJ5A 1N0IA 2Q2OA 3HCRA 2PO7A 2QD5A 4F4DA 2XWQA 2XVXA 4KLRA 2HK6A 2XVZA 1LD3A 2QD3A 3W1WA 3HCNA 3M4ZA 4KLCA 3GOQA 1DOZA 1QGOA 3HCPA 1LBQA 2H1WA 2XWSA 2PO5A 2HRCA 3AQIA 4KMMA 2JH3A 2QD4A 4CCSA 3LYHA 2QD2A 2AC2A 4MK4A 2Q3JA 1C9EA 2HREA 1TJNA 2C8JA
chains in the Genus database with same CATH superfamily
4LPSA 2QAGC 3NHKA 2O2EA 4DLUA 4MUMA 3TI7A 5TMPA 5JS2A 3PRKE 1SVKA 1VCOA 2GPWA 1K8RA 1PSZA 5CGZA 2XMQA 5TR9A 3TQOA 3M89A 2AA3A 3AFOA 5GP1A 3ZY5A 4X3PA 2GESA 3DDCA 2TMYA 1V4VA 2POQX 1UUFA 3H8WA 4RL6A 4Y7CA 4EHJA 2WU4A 1DKNA 2NSJA 2QRPA 2X7JA 2YY7A 3RBAA 3TLBA 4JJKA 1XGKA 3CV3A 1J0CA 4C43A 1R4MB 2WJ4A 3DWGA 5JSZA 5JG7A 1ST3A 5D51S 2V7GA 1MEOA 1V1RB 2AQHA 1UBSB 3Q7QA 2ZI6A 3ZIUA 1RWXA 4IOJA 2HPAA 2HYDA 1WMDA 2YQ5A 3G23A 4A16A 2AZMA 5DLPA 3W6PA 4A6PA 3GIDA 5CJPA 3NOQA 4PZ0A 1CUBA 5EQJB 1FYWA 2VWGA 4R0MA 1XTBA 1CB0A 1DIGA 3EN0A 1G17A 2FMIA 3OFVA 1H2BA 3F1KA 2FQYA 5HCIA 5FOQA 3SNHA 3AT1A 1ECJA 3A11A 3FG9A 4E09A 4QUKA 4R2HA 4Y2HA 2O59A 1U0GA 4UJ3A 2FPPA 4B8ZA 5ISMA 2BR4A 4UBIA 1UDWA 4FW9A 1RM0A 1I4LD 1KZYC 1X7ZB 1XROA 2C4WA 2ZUTA 5HIJA 3BH0A 1M54A 3RVQA 3SHVA 2PUHA 2VIIA 2F55A 4FT2A 4L2IB 1ZM9A 5DMHA 2HZ7A 1UQRA 4MQ4A 2J0UB 3STWA 3RT1A 4P93A 1IG0A 1SCBA 4GX2A 1J8VA 4POAA 1BU5A 3E7WA 3L0SA 1JR2A 1ULUA 1WMAA 1VL8A 3OIVA 4FC7A 2ZRQA 4Q47A 3PNSA 3A3OA 4RELA 4UXHA 4AMUA 3I37X 4M9ZA 1HFJA 1H3NA 2PTHA 1XIVA 1H66A 3AERB 4TTQA 3UH1A 2QN9A 1U2DC 3M5CA 4OJYA 2UUAB 1YQXA 4HQLA 4KYTA 2WPNA 1E18A 3GMSA 3OAAD 5FWDA 3A06A 3AU8A 5KAMA 2VJBA 1GADO 4B3IA 3HEAA 3PIRA 1B1CA 4RF2A 3T5DA 1G38A 4RMNA 1G21A 2EERA 3H8SA 2QPOA 1CVLA 2R6HA 4KKVA 5T3YA 4H2DA 2I9PA 1BMQA 2EATA 2WZBA 1A77A 2NNWB 4LVNA 2QRMA 3R9IA 1Q1NA 2G17A 3E8XA 1YCGA 3J81k 1YR2A 5IU6A 4EECA 2FETA 2IU4A 5LD2B 1M1UA 1NNI1 1MTZA 2X1LA 3D3WB 5J58A 1SQFA 3BBLA 4AKHA 1Z4PX 2WJ6A 4E5VA 4YRBA 4D81A 3KUDA 2V9PA 3I6BA 4ZOLF 2QU8A 4GOJA 3E8MA 4D0NA 4PGMA 2N47A 4R8SA 1TRKA 1YV9A 4O2AF 2YNMA 1TQ6A 1FFXA 5HR5A 2PZBA 4LBZA 3A6PC 3C24A 1ZH2A 4RJKA 4KI0A 4KOEC 2FPGB 2XCUA 1U5BB 4L57A 4R7TA 2BDUA 4C0QC 3PI7A 4YUYA 3LT0A 4ZYYA 5EIWA 3M4JA 1QAQA 1RKUA 1SCJA 3SM3A 3A1CA 3TH5A 1GTG1 4DLTA 5FWNA 4Q6WA 1DIAA 5DNDA 1KI1A 1G5TA 4ZU3A 2IPOA 1HQDA 1T26A 2Z43A 3BHIA 1AKEA 3MTQA 5BV0A 1KRWA 1TT5A 3V6LA 2H1VA 3DJFA 3IBTA 2WSYB 1JYSA 4MCIA 1MX1A 4UCWA 4C6TA 5KQPA 3M6UA 2FGJA 4QQNA 2A3NA 3D0RA 5G53C 4D79A 1B00A 2ATXA 3PGKA 4B6QA 2VUHB 4U0JA 3AEKA 2JJMA 5I47A 4Z9FA 3GGJA 1M3SA 3IT2A 3WGLA 3GV0A 4HYQA 1QGUB 1TM4E 1CF4A 1ISIA 5FTKA 1GPBA 1XJWA 4PFSA 4EMUA 3EVBA 3ZGLA 5HF5A 4XW2A 1JE1A 2IH5A 2F6RA 4EM6A 1NVGA 3CURA 2ZR7A 4LOJA 3PZBA 4NR0A 1USKA 2YYYA 1H1LB 4ICIA 4QZVA 1L8OA 2ZYTX 4PYMA 1P5JA 1LSSA 2I54A 3W7VA 1NYLA 2XF2A 3LQRA 4FX5A 1N2HA 4DA9A 3B3JA 1A8QA 4ED9A 4HFJA 3ROXA 2VDLB 1QE5A 2EZTA 1GM5A 1ZHFA 3SFVA 4NCNA 5CVVA 4BASA 2YWXA 4A9AA 2VNIA 3KQWA 2P62A 1NVVQ 2J3MA 3R6GA 3FFTA 1O1YA 1RE1A 2F8MA 4OP1A 4ZI7A 1ZCFA 1PKEA 5LB2A 4MWZA 1OLXA 2OB1A 3CLSD 4XYMA 3WHKA 2J5BA 4DQDA 1EX6A 2R6R1 4EYQA 1ORDA 2O2XA 5KB3A 5J2TB 3B8HA 1VA4A 2IZ0A 3OOSA 1BQEA 2D1FA 2EL9A 1AF4A 1CV2A 1N2BA 4BEWA 1YBVA 3D02A 1XTKA 1QB7A 1U0EA 4Q37A 1R74A 3J7TA 3AC0A 5LQMA 1U2RA 2VLIA 3EDRA 3IRUA 1PW5A 1OIVA 5CBPB 5HZKA 3O8BA 3S7ZA 4BMSA 4FZRA 1AKYA 3OZAA 2FZKA 4NC9A 4YHHB 3AF5A 1AXGA 2RGNC 4WBNA 1AHHA 3LECA 1PTKA 2WF6A 3H04A 1M7BA 4XQ0A 1FP4B 2CUNA 2WG0A 3PYLA 1XPJA 4O4JB 4B3BA 1VE3A 3B51X 4K6FA 3RTGA 2KM1A 2XODA 3DKVA 4B17A 2I6GA 5HBGA 3TTSA 2Q5JA 1SVSA 4G8BA 3DUFB 4F3CA 5DU2A 1RADA 3GLKA 2HYIC 4B3XA 2IS6A 1X80A 1YVUA 1ODIA 1MB4A 4IF6A 1DCKA 1K0FA 3WNDA 1SMKA 1YZYA 3ER9A 1XZBA 2QLBA 2IWRA 4BMXA 1E5LA 1K75A 5E1OA 5IJAA 2QE7A 3SR3A 1YDMA 1G5PA 3U7JA 1O8CA 5FQOA 3RR2A 2FSVC 3ADPA 1ZBQA 1DIRA 3QLVC 1GNTA 3RS0A 3AL3A 3I01M 5K0BA 3KQQA 3UK0A 1ODTC 1Z7GA 2Y3IA 4HQKA 2WJ3A 3MPOA 3VKVA 3WLNA 3E1GA 1E6LA 4E2FA 2NYAA 4O2BF 3F5SA 4P22A 5JCXA 4FJ0A 2H3HA 3IUNA 3ST7A 1ZI9A 2CFIA 1E94E 5MN5A 4LJRA 2Z4SA 1E0JA 1GZUA 3C3PA 3AOEC 1CF9A 1RRMA 2JANA 4FNGA 4BVGA 4BECA 3AM1A 1UAYA 4FINA 4I5FA 4KUHA 4U8HA 3PPXA 1F2UA 1Z0ZA 3W9SA 1JHAA 4LKOA 4V03A 1L5HB 4DMGA 1KOGA 3OZDA 1F5NA 5KVCA 1MXFA 4XUEA 1MGPA 2MSDB 1ECPA 2J4CA 3AUXA 4O59O 1K6EA 2ASEA 4GR4A 4WXHA 5LVAA 4ACAA 1BWSA 1QF7A 2VT2A 1Z2OX 3NHJA 3EZ7A 2F9LA 4OGGA 1N3IA 1C4XA 2WTXA 2WC1A 3LKZA 4NL4H 4GIBA 4ZAWA 3C4QA 4QRDA 5IKOA 5CDTA 3FHJA 3OTIA 4J49A 5ALJA 3DAPA 2OYCA 3TEMA 3TQCA 4EF5A 4OVKA 4RHFA 2FN7A 1ZIOA 2EYQA 2COEA 2VZLA 5CX1B 1NVWQ 1XLVA 2XAUA 2GJ9A 2IUFA 4FWBA 4G5GA 2BM0A 3E9NA 4E5DA 1RPZA 3HDQA 3EFOB 3LWNA 5IDVA 4BIMA 1RHKA 1T3LA 2H18A 3A2KA 1S4QA 3DL2A 3PC7A 4HLCA 4UNIA 3YASA 5HM8A 1EFLA 2MINA 3VM6A 2Q7OE 5HS6A 4NBRA 1KMHA 1GCAA 2XTZA 4YRTA 5GGYA 5JFGA 1NFQA 3WX0A 4NV0A 5FPYA 1PG5A 1WNFA 2CL5A 1TJ3A 1DJOA 2CWWA 4L78A 1RACA 1NURA 1VCIA 3I76A 3K32A 4YPVA 1K27A 1CTQA 1TIPA 4M0MA 2QT1A 3V8RA 1QIKA 2WWGA 4UEWA 5KBYA 2ERCA 4P54A 1OGYA 4IIXA 5A4FS 4BBJA 1IXYA 2J8ZA 4NCIA 3U7FB 4GFDA 1L4YA 4KE6A 5FAXA 3R7NA 2W58A 1CZUA 4WGGA 1U9CA 3C3KA 4NDZA 2OO3A 4U3JB 3RJ9A 4YNBA 5HXAA 2W6CX 3CW8X 4KITB 5FUQA 2H9IA 3ZNQA 3G5UA 3QVJA 1Y5RA 2VK2A 1KDYA 3NBQA 3QE0A 1UFVA 3QUQA 4EQ6B 2JGDA 2DJ5A 2V7TA 3HCRA 5DNCA 3V4OA 2AC7A 5I6DA 1M1XB 2FPIB 4WH0A 5CXSA 1AC5A 3VH2A 1ZK1A 1J07A 2L0XA 3BBPA 3OUTA 4CL8A 1Y8CA 3Q8KA 1OVGA 3TWOA 2VPYA 4DCMA 3F78A 2G1UA 3SD7A 1YZ3A 1M6NA 3LV8A 4IDFA 1N6OA 5KYXB 3WYEA 1IY8A 3MCWA 1WUKS 1XQYA 2MYNA 1PUXA 1RPTA 1XQ9A 4LC0A 4E70A 4HV4A 5B4UA 1TZ2A 2ZIXA 3WQBA 4HMOA 4BLWA 4QJ5A 1G8SA 2ZYIA 3F1LA 4FXOA 3KHTA 4DCTA 4EPWA 4F4CA 5B4TA 2H5JA 2VQFB 3ODGA 1RXSA 1D7AA 3Q4GA 2R3SA 2ZS9A 3CEJA 2ONYA 5I9MA 4CKBA 2BTQA 3PFKA 2WE7A 1NF2A 3JQAD 1GKLA 2G6TA 2GEJA 3K1ZA 4MKZA 2EW8A 1KC1A 1M2KA 3TUZC 1K4MA 1R15A 1ORIA 5U4XA 4F3TA 4XQCA 3PNKA 2ASVA 2ZU0C 1BKDR 3GAFA 2GNAA 3A3YA 3EQ9A 3IYLW 3LQQA 2NGRA 4LYJA 1IJBA 4A8JC 5HUJA 3QXSA 4MVJM 4YRCA 1XRMA 3GCZA 3TQIA 3UJPA 3I53A 1X9GA 2AJ8A 3KSMA 1HL7A 4I3FA 4Y1GA 4BE4A 4KHZA 4C7OA 3LMKA 1C0IA 4UTXA 4DMFA 4S05A 2AK3A 2QRJA 2ZSUA 4DB4A 4KXVA 3BZBA 2QW8A 5EZ6B 3LLVA 1TW3A 5TLSA 3JQ9C 3DWEX 1AKUA 4BJ6A 4CMAA 4ZHQA 3PR3A 5FX2A 5ALUA 3L8HA 1OFIA 3MOIA 1U8EA 5KQGA 1NUHA 4JJIA 5JC8A 2R6ZA 1G9SA 1G7TA 2G8NA 4G0ZA 4YEDA 2G9VA 5IWCA 1UP7A 1W47A 3CT4A 1NJSA 3KEMA 4J76A 5DK4A 2X6TA 3SZLA 3LBHA 3LYUA 4PQGA 1N2IA 1E89A 4I4TA 3ZI7A 1J0BA 4BWGA 1Z2PX 4DR1B 2IBTA 2O8FA 1CJVC 2GHTA 2I4IA 3P32A 3Q0EA 2NTNA 3M3HA 4WCFC 3ZHSA 1X8JA 4CKWB 1LSUA 3RRJA 1L5YA 2GAIA 1VSVA 3PDIA 4OOFA 4UFNA 3PQ4A 5CK4A 1Y6QA 2JLZA 1ZUIA 3MINA 1RT9A 2Q4EA 1DWOA 3ZCUA 1FTGA 1JLLB 2ICAA 5TMBA 1EWRA 4TWZA 1ZVQA 1YZGA 3OPYA 1DIOB 2R8YA 3EOBI 3K8OE 5KVQA 4D2IA 4LQ4A 4XH9B 1I4DD 3JQDA 3L77A 4YAGA 3GGGA 3H65A 4E2WA 2ZIEA 4IH1A 4IVNA 3EY9A 3L5OA 4HYYA 4K86A 1YNOA 3VYTB 1L0BA 1KZ1A 1ZVJA 3JALA 3OECA 1NBIA 3C3BA 5B53A 4C2UA 4A0HA 4Y2VA 1GUAA 3CLTD 4TROA 1T6XA 2QQ0A 5KUTA 4KMRA 4TT3A 1FMCA 4DNXA 1FFAA 5KDOA 2AN1A 1NBEA 3QNMA 4JUIA 7GPBA 4GX5A 1MO2A 2OFXA 5DO9A 4MP8A 2ZB4A 3KS9A 4I3GA 1FYVA 1DPFA 3AYXB 4OJTA 1Z34A 1R10A 3LVFO 5KMGB 3KAQA 3LPNA 2GA9A 2V7VA 1J4AA 5JW6A 4L7QA 1RBQA 1Y1SA 2Y8EA 4K3UA 4LOKA 1CJBA 4ARBA 1XVVA 4J0GA 1X7WB 1OH5A 3G8CA 1J8FA 4ESHA 1LTQA 2ZRFA 3ONNA 1JR6A 3AQ4A 3BC1A 1HM5A 1XHEA 2P6RA 3LLUA 1G5IA 3P0FA 4CQMB 3EXAA 5FULA 2W6QA 3O1LA 5JS8A 3PX3A 4BXOB 4MR8B 3QENA 5JYEA 4CL3A 4BIIA 2AB0A 1GVNB 5J9FA 2VFAA 3H0EA 3NATA 3IXQA 3UPTA 1DDGA 1FLAA 2PVSA 3ISTA 5IVHA 4R7ZA 3ZWVA 1SUPA 1WXFA 2FK8A 1ISSA 3D9QX 5K4AA 1K7EB 2W5UA 3MGCA 5F9FA 4YAOA 4HGQA 3KTOA 1YIOA 4FYWA 4OQPA 2EQ5A 4TMZA 2FK7A 4GRAA 1UKCA 5ALVA 2SHKA 3V4VB 1DRKA 4QUJA 1Z6YA 4GVLA 3RE1A 4K40A 1G6KA 2CL6X 1JP7A 4ZREA 1YFKA 1XAIA 3D64A 1PFQA 1OTYA 2EDAA 4YRLA 5GIPE 3GBPA 4B40A 1H2YA 3BSYA 4ZEXA 5EMHA 4S1TA 2W42A 3ZYZA 1U5CA 4X44A 1X1EA 4L02A 5AVOA 3SF8B 3WKCA 3NJ8A 2C5HA 1O9BA 3D5TA 3OTQA 4ZARA 4TMKA 5D1HA 1H2ZA 3L0IB 5JIBA 5F78A 2DY1A 3W05A 4ENSA 4MYTA 5ESWA 4BP9A 5TY0A 1X7ZA 1B8PA 3VC2A 4BRWA 3LJKA 1CX9B 3AUAA 1LD3A 4JI1B 1P4HA 5B1SA 2J0UA 4CTKA 2WHQA 4RSGA 3FVWA 3JSAA 1KJZA 1SUIA 5MN4A 1NQAO 5DB4A 3MOSA 3PPWA 4HXFB 2YZ7A 4UMFA 3V2HA 3QFRA 4EJ0A 4EL0A 1EWTA 2OC4A 3BWBA 4GMFA 3MUNA 5B4VA 1B6SA 5F77A 2UU9B 3ONEA 2QZJA 3KOMA 3OX4A 4FYMA 2G0AA 2FUCA 4WAUA 1KZHA 1U9ZA 1FYFA 1YB4A 2M6SA 3OMXA 3AERA 2NW6A 3C39A 1DEKA 3N0TA 3H99A 4HPJB 3HKBB 2DWUA 1J2RA 1JG6A 1ORHA 2MSKA 1SIBE 3CSDA 3WIVA 2B6NA 2ST1A 1U7ZA 3CRNA 5IT0A 1R9MA 1GUZA 1N1MA 1Y34E 5F1PA 2H4XA 3ZWWA 4DG8A 1ADCA 4YMIA 1R9JA 3ICQB 4Y1FA 3LOPA 1W5AA 2FEOA 2W2KB 5I8WA 4H7JA 4Q3CA 5H5JA 4WX2B 3D3WA 2HMYB 2PJUA 3OO0A 3ZJ5A 2BEVB 4Y9TA 3FUCA 1Z16A 3TW0A 1C0EA 3O74A 3OCUA 3K05A 7REQB 4FMCB 1F5SA 2DWCA 4IMPA 1DG3A 4IJKA 1LC3A 5A3SA 3TOXA 5CCXA 1D2GA 3RD5A 2R2AA 2EARA 3FPLA 1DCFA 5KDDA 2FVXA 1HETA 4WLVA 5ALZA 1I1QB 2ZSFA 1DRUA 3R41A 2AHRA 4AN1A 1VHJA 3IBSA 3NXKA 5DHQA 1K4YA 4DDMA 3AWDA 4HCJA 3MPUA 3W8RA 2JHAA 2OAQ1 2FPGA 5AJXA 1U5BA 1VBFA 4F11A 1ZOPA 5C31A 2JK1A 5K8TA 3AIMA 1JN0A 1QZTA 3S28A 1BXRB 1IN4A 4J0HA 3M7IA 1CZKA 1PV4A 3PITA 1E5TA 1T9CA 2ZJ0A 1P2TA 5HKAA 1E2QA 2Y77A 4RKQA 2ID7A 2JH3A 3GEMA 3DLPX 1H2WA 2BBWA 1E7QA 2QW0X 3KX2A 1CNFA 5KOYA 1FRZA 2I7DA 2FP3A 3LSTA 1II9A 3BTUA 3PQ3A 1JFVA 4PTLA 1VGVA 2A1TR 3AP3A 3Q3HA 1J2UA 1WW3A 2X4IA 4RA9B 1EFTA 3PXCX 4WNCA 2CFSA 4UNSA 4NRDA 3T35A 3C8ZA 2VRBA 3EUFA 1TYDE 3OM1A 4OGKA 3L6UA 1TA4A 2FDCA 3R7WB 4YUXA 2XMRA 3T7KA 1Z29A 2VTBA 1A95A 2VRCD 3BH6A 4EUNA 3BDIA 1DFHA 3ET5A 4DSOA 3VGPA 1V39A 5LXTA 1H1LA 2OORC 3G2IA 2EJTA 2Z5VA 4WKNA 4WUVA 4BQIA 1G291 1A7JA 4MTLA 4EMBA 2Q4DA 3EUWA 5DT9A 3L04A 3PE6A 5A0FA 3TPFA 1ZINA 4AMYA 521PA 3HP4A 1IY0A 3NTXA 4E1AA 4WBSA 1EP9A 2Q1XA 5H81A 5B1IA 1T6ZA 2H4JA 1RM3A 2FRXA 3T1TA 1J00A 4DNQA 1Y37A 3DVRX 3FNRA 1NQUA 3DMPA 3LKDA 5HYVA 2X86A 4OBWA 4IJMA 4NESA 2WJYA 3OZ7A 5CM2Z 3U9SA 2QN3A 2ACEA 3LW8A 3BEDA 4X97A 1ZP6A 3SKVA 4BZQA 4CLRB 4F3RA 3LM8A 4IMIB 5E7IA 2ID4A 1D2EA 5J2TA 2P9FA 2QUJA 4QO8A 4J3NA 5JDCC 1G5QA 3DE4X 3BVPA 1E6MA 4HI0E 1RQ7A 3UWMA 2A9JA 1KP2A 3I92A 5TQVA 1U3UA 1Q0HA 1CR6A 1T5OA 2G9QA 2YR0A 1HLFA 2NVWA 3EQ7A 4HL6A 5DTEA 5CBPA 3IAAA 1OB2A 4WXEA 4JB2A 2H00A 4JBHA 1TE2A 2BFEB 2EL7A 2XHZA 2JD1A 1N5DA 1K6JA 2BGUA 3AEQB 3OD5A 4P33A 3OEHA 3T5MA 3ZU3A 5LA6B 3K0AB 4BKMA 5KEIA 5E7MA 5C32A 1XPUA 1OKKA 5JS1A 1A69A 4O4JA 3LCUA 4ZO7A 4BX0A 1QCDA 2XUDA 1NQWA 1WXXA 2EKZA 4DBLC 3A9VA 3JPWA 4RDCA 1DJNA 4IHJB 5CDHA 1NULA 1U6KA 2CVZA 5JCPA 2H16A 2PRJA 2VYND 3DUFA 3I01A 3OEEA 2A0UA 2CNLA 2GRAA 2XUGA 3CZPA 3FN4A 4KN5A 4ZQEA 4TYYA 3BIJA 4LJ8A 4E2YA 2D1YA 4L5CA 1RWBA 1E61A 1XZNA 2CN1A 4NDAA 5HX7A 3FMIA 3FPFA 3N7UA 4JOQA 1ULHA 4AO6A 3GVXA 2CVPA 5FLXA 2WSSD 4YCCA 1PQUA 5JJBA 3ZJVA 3RK1A 3ZZMA 3THOA 2FN8A 1M0EA 1U28A 3T15A 2NV0A 2I7VA 5FTMA 3VU1A 2NVOA 5ERGB 4HDKB 3BJRA 1JVNA 1OYWA 1DAFA 3JS5A 3OFND 4RCVA 3WL8A 1XRQA 5DYTA 1KDZA 2YXLA 3IL2A 2FV8A 1XZPA 1I8TA 5JS6A 2ECOA 1LSOA 2VQ6A 4KWEA 2G6BA 5M2QA 2M9MA 2C9BA 2W9XA 4PNHA 3TOSA 4C7MA 3AVPA 3Q12A 5DK6A 5FI0B 1K89A 1JU3A 1GAEO 4Q7JB 1D0SA 1JIQA 1HT1E 1XI2A 2GM4A 2SKDA 1COWA 5GMOA 3WIOA 3ZZ0A 2WR8A 4REOA 2UZAA 1W0KD 4N3AA 3J81A 3MT0A 3S0JA 5DTJA 4QFBA 1VMEA 1E1CB 2HCBA 2ZANA 4NBVA 4JDUA 4LV8B 4C0HA 4CTJA 3GHYA 1JDBB 1PT6A 2G1JA 2ZRMA 3QNWA 3H1PA 1CS0B 3EW9A 3GUUA 2QSYA 1T1SA 2HOQA 2J5RA 4R6WA 3M5PA 4ETIA 3Q40A 4Z86A 2Z4RA 3DOEA 4RD1A 2O5VA 1ZOSA 5C4MA 2CBZA 4EQZA 4FIZA 2YW2A 2J87A 3ESCA 5EJ2A 5CX1A 2FPKA 4F45A 1ICIA 1YRBA 3T1VA 1IJFA 1GGNA 4YRSA 1U9YA 2QM0A 4AS2A 3A1VA 3EFOA 1ZR2A 2VDNB 2C8LA 4UVGA 2Z1MA 4PX5A 1CK4A 3I6QA 1RQLA 4BEBA 1OPXA 3I30X 4JYPA 1DEOA 1H6DA 1TQDA 2XYPA 4KXYA 2PCLA 5I4IA 3KP1A 1BAPA 1JW9B 1YL6A 2X7XA 4Q1VA 3JQBC 3UG7A 1IBRA 1V41E 1QIDA 4BFTA 5B58C 2ODNA 1DLJA 1EK1A 4ILEA 4D4MA 2V54A 4HPWA 2PX8A 4MQLA 5LOVB 4OB8A 4ITUA 1JDUA 3T7JA 1K7XB 1W36D 3EOZA 1IBCA 5BR7A 3K8ZA 4M1SA 5ALOA 4B6OA 4ML3A 5ER9A 4RVOA 1P1JA 4GSYA 3HCAA 2GVZC 3FOEC 4DVGA 1BHQ1 2AMVA 2K2WA 2RHMA 1JAZA 3S2FA 3MTGA 5C1OA 3VAYA 3KTFA 4U3JA 3WWCA 3NUGA 5EE5B 3SEQA 5IXJA 5KU1A 5ADHA 2J59A 3WGKA 2DHRA 1HFKA 2R5FA 3FDJA 2ZDGA 4JC5A 2QLLA 1YNSA 3CISA 4ZQHA 2P2GA 1N9ZA 3PD1A 4EQ6A 3VH3A 4EEZA 2FPIA 2IUEA 5K09A 2WT8A 1KFBB 3WZ2A 1DC3A 3IEUA 1Z5UA 5THKA 3T9BA 1CUCA 1HGXA 1E5QA 3FNIA 4F21A 7ADHA 5I8PA 1HMYA 1HDGO 3HCOA 5E7QA 1NFFA 1AU9A 1Y33E 2GSWA 3OZSA 1L7OA 4LA4A 1IHUA 5H4HA 2BKUA 2X8WA 4N18A 2RKBA 4NOMA 4RHTA 2DTDA 3AUYA 4R8LA 5CYPA 1Z6TA 5AI0A 1Q7RA 4QTZA 3UK6A 1EBBA 1J6UA 4DWWA 3QP9A 5JCJD 3WZMA 4AT1A 4ZDIA 4F84A 3ILHA 4MVJA 5CM8B 1D2AA 3FNHA 5BV7A 1UBMS 3W90A 1TYBE 3EIEA 3PJEA 1PLJA 2H1IA 2P1ZA 1T35A 1VMKA 5AVQA 2Q5LA 4C4ZA 4KW7A 1U6JA 2WYUA 3QMVA 1EP1B 1T5DX 1DKLA 4PG5A 5GONF 3T9AA 5D6OA 3G17A 4M1TA 4ZV9A 4J1NA 2QX6A 2FY8A 4JITA 1UK9A 5ECDA 5GADl 3MTIA 1TMYA 4UBNA 3PCTA 2HK6A 5ALHA 3K5HA 3QRWA 3VC1A 1VKRA 3WL4A 1IOWA 4DWVA 2X5OA 4ALLA 1E9VA 2PZEA 3FPSA 3GNSA 1Y8RB 3LF1A 4ISBA 5I3CA 1GHTA 4YCAA 1QORA 3P2MA 4IXNA 3LC2O 1LPSA 2CVHA 1IK4A 2XKJE 1VRCA 3RS7A 3O4VA 1OT3A 2FSUA 2PSSA 4HEA6 1QDEA 3P52A 2NXEA 1TRHA 4GYKA 4L0DA 3RU7A 4Z6KA 3HADA 4B44A 4MLDA 4X64B 4BB0A 1W5SA 5BNIA 1ND5A 2FQQA 2V4ZA 3KJQA 3QVMA 4LY0A 3KDSE 5F1YA 4A2PA 4BLRA 3L4JA 5HF6A 2BZ1A 4JEUA 4FEGA 2GXAA 2PFGA 4OX9Y 1LZKA 1E6CA 3OQ1A 4RV5A 4D26A 4LJ6A 3HEMA 1P4SA 1PWEA 4M38A 4WFKA 5FL7D 2OXTA 3KT6A 2IGBA 1TI7A 1WQ1R 1P0FA 1SELA 1T1IA 3KWFA 2AN5A 5JBIA 1JLLA 3ONVA 2FR1A 2X1MA 4Z8YA 3LUPA 2DBQA 5FB3A 1K9SA 2WIGA 2OHFA 3I8SA 3LC1O 3NIFB 4GP7A 2FZLA 2W6IA 1PR0A 1A8UA 2CLSA 1LRLA 2IFTA 4EGFA 3A14A 3CUUA 4M9QA 4BNVA 4JI7B 2N42A 4YAEA 3H9UA 1SU7A 3AR4A 1Y63A 3M1LA 2O7SA 1V11B 5AICA 3C41J 2HI0A 3ANSA 2R8PA 4L6CA 1ZXBA 1PJSA 1WDLA 4L9SA 4X95A 2JJ1A 1F8GA 1PQYA 3E3MA 4QFMA 4BVAA 1OX6A 2WFZA 1C41A 2YCBA 2QG6A 2GVNA 2V6FA 5NULA 5EMKA 1MX3A 4UU7A 1DAEA 3LVBA 3ZN2A 4F5EA 3K73O 3EEQA 1G18A 3M9XA 4DUYB 4Y1EA 2VJOA 5A0VA 4K9QA 3OLCX 2V55B 5JEEA 2DUWA 1CY0A 2BEKA 5L3ZA 1IN7A 1KI3A 4BNWA 2ZIWB 2D00A 5BQPA 4MUAA 4FK8A 4RK4A 3URKA 3PUIA 5KMGA 2NT4A 4MMZB 2ZAMA 3R5KA 2C2OA 5CYOA 2VA8A 3DEJA 3IDZA 4NTZA 4DQKA 3RLIA 4NSNA 4DJFC 1M2OB 1TJNA 1X7WA 3IA2A 3NGLA 3N8GA 1HZZC 2O5RA 1SHTX 5A03A 2WQ6A 1CY7A 4JI0B 4CQMA 4YRZA 3QPBA 2F17A 1NVVR 2VF7A 2H17A 1P4GA 4TWIA 3C4VA 3EBPA 4B7ZA 1N2SA 5GY7A 4ZCIA 3U60B 3LCVB 1DQZA 2NP7A 4E5SA 1NQ5A 1N2CA 2I2DA 2YQ4A 2BC9A 4JLKA 3FNBA 3ZHTA 4O6VA 5IASA 2WJHA 1YT5A 1DJLA 2X0KA 1DJMA 1G20B 3TNLA 1M8JA 3QOXA 1EVQA 5EESA 3G8YA 2AUNA 4JKYA 3SJCA 4S2EA 2IXAA 1C7IA 4OAOA 5IYZF 4WGFA 2AE2A 2EF1A 2FG6C 3JVEA 1UDCA 1Z83A 2GMWA 1TO1E 2FMXA 2XGOA 2ZAGA 2VF8A 4JKOA 4CF6A 2CJXA 3WLHA 1YQEA 2RG1A 3G85A 2J32A 1ZNZA 3M6AA 1QUFA 1E2JA 2Q7DA 1PK9A 4PZYA 4P4GA 1A4RA 1NF3A 1WZIA 4HQ0A 3VTZA 3K9HA 4CL2A 4KNYA 4XCXA 3Q8LA 1G66A 4W82A 3R9XB 3FSEA 3FCOA 3S2ZA 4TVSA 4JYZA 1AXRA 1M8PA 1NMZA 2JBHA 1H8ED 2XRFA 4QVGA 4FYJA 5K4HA 3UPUA 4U2BA 1SBCA 1EVJA 3N28A 2ZDHA 2WWVD 5JZMA 3R6LA 5BXQC 1XTUA 5BW8A 4BP8A 3CX3A 1NBME 3PBKA 3ELWA 2C5AA 3KKMA 4B32A 1A9OA 1IE3A 3EGCA 4UU0A 5B3KA 2QDXA 4WBXC 4IOLA 5JTTA 3G2JA 4ZT7A 4AQ7A 4BNFA 4GLBA 2RH4A 2HU5A 1T36B 2P2SA 3UIEA 3U48A 4R9RA 3GBVA 2RAUA 4ZEMA 1ZOOA 3A32A 4V0MA 2NX2A 1VPEA 1UBEA 3EZNA 1WVMA 3PE3A 4OQXA 1P33A 4C5CA 5I51A 3VR5D 1XKQA 1BW9A 2N3ZA 3HZZA 1FBNA 3M1AA 2I3ZA 3QLUA 1R0BA 1DJQA 4ARIA 4LCBA 3HKBA 1OC4A 3SDZA 4D0GA 2HBRA 4IIFA 5FBRB 5CBKA 3JYHA 3LX6A 3QWIA 3ZD6A 4IRMA 3VBCA 4YJ2A 2ZPUA 4RX1A 2DPYA 5G1OA 1OC2A 1LW6E 1ZL2A 2W2OA 3OSUA 2L19A 3NGXA 3RTEA 3X43A 4F1JA 4M8NE 4B6SA 2WT4A 1LS1A 5LQDA 2QM7A 1XVUA 1CETA 2IX9A 4QSHA 5ALNA 3A36A 1A88A 4MZXA 4TYQA 3ZHQA 2W2KA 1Z4KA 2CVFA 3K0BA 1M10A 2ID9A 2VUTA 1CW2B 4K6HA 3HXTA 2ONCA 2RAPA 4OU4A 4KQEA 2ZYWX 3I2YX 4Q1AA 5AK6A 8OHMA 1Y8ZA 1NDUA 1RKVA 1ZC3A 2WABA 2BEVA 2FWMX 1H8HA 2IU3A 3QFHA 4YS6A 1Z0SA 2XYRA 3TOVA 4AJKA 4EL5A 4PBTA 5EZYF 2ZJ2A 3CRMA 1SRQA 1E9EA 3AY6A 3TTVA 1SM4A 1THGA 2X5KO 3W1EA 1EZ4A 2YMPA 4A6XA 2AZXA 1JLRA 3KB6A 1Q84A 1WB4A 2FZVA 3FFAA 4RKFA 3MS4A 4OLFA 4IIVA 1Q95A 4PYQA 1UOPA 4NCJA 5IAEA 2G25A 1MO3A 4C0JA 1D4OA 1ONSA 2D0DA 1PFWA 2FB9A 4N6OA 4YONB 3AEXA 2F7SA 4JYBA 2ZUSA 1Y4UA 1E2UA 3KVRA 1L8XA 1JBEA 2XA2A 3ONFA 4MUBA 4P4NA 3UUWA 5BORA 2ZSDA 3FCAA 3S2EA 3UAVA 2EKDA 5DLYA 1CWUA 4H3VA 1IRIA 2IDKA 3P9XA 1M8FA 1Z12A 1HXHA 2VC2B 4K6GA 2FUNB 1TC1A 2DFLA 2PHZA 5E38A 4XWKA 3K71B 2IS4A 1IY1A 3HS3A 4X61A 3LK6A 3DFKA 1BMTA 3D4IA 5LKRA 1E8NA 4CMEC 3BQNB 5DCLA 3KDAA 4D3SA 1ZWLA 4PHGA 4X5OA 1FQKA 1M33A 3ROKA 4WVLA 1H9AA 1T1JA 3ETHA 4BJ1A 1FQOA 1BTOA 1UJNA 4MULA 3P9RA 3S7TA 5D5QA 4Z3KA 1XDBA 3U80A 4PY2A 5ALFA 4ID3A 2C8JA 1NW3A 4JGIA 1ZMBA 2Z6VA 3OHPA 1RBYA 4GSKA 3R7WA 4WLEA 2L42A 2QP3A 1IG3A 4HRAA 1EM8B 2IHZA 2VDOB 4JP1A 4LDPA 1BFDA 1IOLA 1U8UA 3DZBA 3O91A 4R83A 3WAKA 5DE3A 5JSUA 1Q1EA 1U1GA 1X77A 5JQGF 2CXUA 2J3EA 2PD3A 3QFTA 4IH9A 5FP0A 4ZK2A 1EK2A 1NASA 4JHXA 4U39A 1RYNA 1VQ1A 2W4IA 3FPAA 5D3QA 5TF4A 3AEYA 1T5SA 4YPOA 1BDHA 1EE9A 4I50B 1JG2A 2BI4A 2FAXA 2R6GA 3IV6A 1L1RA 5JXGA 3AG5A 2D2XA 3CRW1 4HAXA 1S8AA 2HX1A 3QKSB 4MV3A 4C7JA 5CFMA 5JJCA 4MA0A 1YR9A 1AJEA 1MB0A 3MT8A 5JMWA 5MGBA 3AR7A 3GJQA 3RK0A 2F3SA 1N6HA 4RSHA 3KSUA 1F1BA 2H1OA 4CLRA 3QX3A 5DP1A 5JLAA 4ARSA 4PGGA 5T4BA 4JB3A 5HKLA 5CT5A 2O3UA 1YU9A 3DEIA 4IL5A 1FFBA 2A88A 2LGJA 1PZHA 5P8WA 1N92A 2HHCA 2PL1A 1EUZA 2W2XA 3B48A 1WXQA 1QYVA 1SG6A 2HMTA 2FUKA 4MRRA 3OC0A 3K0FB 2QN7A 2ZBEA 1YS6A 1KGDA 3GXBA 5C1PA 2PKXA 2WB2A 3C4JA 2BFEA 3AEQA 1JHQA 1ISJA 1LPPA 2EX0A 2K87A 5LA6A 1UF9A 2H48A 5F7JA 4I99A 3RV4A 4BJ3A 1BC5A 4YRMA 5I01A 1J5EB 4PCLA 3VO9A 3QPVA 1F4LA 2ZSAA 3GFBA 4IHJA 4B2YA 2OG2A 3H6HA 3DW3X 4BV2A 4EPVA 3HCWA 1QH9A 2RHHA 2NYRA 3ND8A 4R54A 3BORA 4DILA 3R3SA 1JEJA 2WDZA 1HF3A 3OT4A 3IP3A 4UAGA 2CZQA 4QBIA 1DCTA 4KGZA 1JIKA 4LF7B 3O8LA 2O52A 5EMLA 3IKJA 4IIDA 1C3XA 2ZSKA 4DLWA 4FFPA 2O3TA 2CV1A 2Y9PB 2J7PA 3V2IA 2QVYX 1RWMA 2KBEA 4TV8B 1QONA 2JGMA 1SC6A 3UYKA 9GPBA 2KBFA 1WEHA 3PU6A 5GPBA 4G0VA 4M55A 4RK1A 4DFDA 4JT8A 4HDKA 3AI2A 4UATA 3KG2A 3BZWA 1ZIXA 4MICA 3VGJA 3EVGA 5B3JC 1KO1A 1QV7A 3B13B 4JXKA 4LX0A 2B7CA 1G2OA 4IVRA 3TMYA 4RGBA 3UAOA 4EG1A 3QKTA 2VI5A 3OA0A 1KYXA 5K3FB 2I87A 3CLHA 3SYLA 5JNSA 2HUPA 2OXRA 5CFOA 4WN3A 4GL2A 4EEKA 1TCCA 2BFCB 4UTRA 2WDPA 2ACVA 2QVCA 3KL2A 5C5DA 2IEGA 3FXAA 4V24A 2KMLA 2IIVA 4AROA 2GK7A 4C0AC 4Z7NB 4HQRA 4F2PA 1E1CA 5IJZA 2PXXA 3B1ZA 3D7KA 3ICVA 4LWPA 3KB2A 2D3WA 1IZ9A 3S29A 5BWMA 2ZYSA 4R1MA 3LBYA 1CS0A 2PD4A 1XFDA 4TRMA 5GM1A 4BGVA 1NN0A 4AJ1A 4CFSA 4BTEA 3C8HA 3EW7A 3QVWA 4G36A 1Z18A 3GYGA 4PO3X 3FPCA 4EFLA 3EXIB 1VKHA 3EWSA 2FU5C 3IP6A 2QX9A 4FDMA 3JCZA 1KK0A 2NUAB 1JEEA 2WVJA 2A0YA 1GUBA 4MVJH 5LUBA 2GN8A 3ANTA 2MYUA 3RRZA 4OYRA 4W9MC 4XOIA 1YOBA 4EEXA 5JPCA 3W5SA 2R25B 3UAZA 2BFFA 3N39C 4R2IA 4D8XA 1EK0A 3D4BA 2ZJ5A 5LQCA 3IAM6 5CVTA 4C0SA 4ZYLA 1LDNA 1D6MA 1NKTA 3SS8A 2GXSA 1QP8A 3PL5A 2C7BA 1K3TA 1JEDA 1SD1A 1Y7PA 3N0WA 1CRQA 1GZ6A 4LUCA 1JBKA 5LOVA 1PZGA 3ESYA 1AGRA 3F3KA 1XZIA 4NJEB 4F72A 1AKNA 2FRDC 5HA5A 3VDRA 1AZLA 4FU0A 1VBKA 2DOKA 1UMBB 3LQ2A 1ND6A 3GARA 2X7HA 5A7GA 3MGGA 2DUJA 3LLMA 2QUIA 2DR0A 1YMQA 1SD2A 1TW2A 2VHZA 1YZNA 2VR1A 2YYSA 4GE3A 4Z2YA 2BUAA 1ZNWA 4DCUA 4BBPA 2FMHA 5CVUA 2JPDA 4W7SA 5EP2A 2OGZA 4CMBA 4F9EA 1NBOA 4BUCA 3IBFA 2AF4C 3OZUA 4O5OA 1UC9A 2AQIA 2QJOA 2PSHA 2RSLA 3KQPA 3BJZA 1NU6A 3FVVA 2B4KA 4FR0A 4QBTA 2G0NA 3C7DB 4EG7A 1NRWA 1BA3A 2WW8A 3OF2A 1V96A 4FE3A 4M1QA 4RF4A 4PC7A 4TMTA 1L1EA 3Q3EA 3BGSA 3BWCA 2ZPTX 3CCFA 1KVRA 1NYRA 3E15A 3G1UA 3R8FA 3DXFA 1BSVA 5B3JA 3A3PA 3DCJA 2YRWA 3M2TA 1MORA 1QOZA 1U0NA 2GZ2A 3FF4A 2IA5A 3FKQA 3M0EA 4JNKA 2K7FA 1G60A 3SQNA 2IZOA 1VL2A 5I9NA 4MWBA 2EDCA 4ARAA 4B43A 4PNZA 1QQBA 4PAMA 4C78A 2ZVPX 1OJ7A 4HXGA 3MILA 4RZUA 5BMVB 4JSYA 1HEYA 1UOOA 1YL7A 3OVMA 1NYTA 4WWHA 4BO7A 1YA6A 3CMCO 1T9GR 3W6ZA 2AG0A 2BGNA 2APJA 3GP5A 4C5AA 1SHLA 3DCIA 5I7WA 3S8MA 1HBJA 1QHFA 2VXOA 2ZBUA 2XB6A 1BN7A 2XBUA 3IUYA 4O4LF 4QJBA 1FDOA 5JLJA 3OKPA 5JDIA 5HGJA 4DR7B 1VJGA 3MOGA 3DMTC 1ZS9A 3B89A 3AXTA 1QAMA 1QQTA 4DL9A 3AOGA 3Q3GE 4DLPA 4F2HA 3QX9A 1Q15A 1TNDA 1EEXB 1CUGA 3RSCA 1Z36A 4U1RA 1RPNA 3TR0A 4DM3A 1GAXA 3ZCQA 5L8VA 2BKAA 4LSWA 2NMVA 3VC7A 3ODPA 5CD9A 1W8IA 4N7JA 2A1IA 1R8QA 2NXJA 3TNYA 1V0JA 1AHPA 4NBKA 3T41A 4MA5A 2PUGA 3NBMA 3B9RA 2AC2A 1E2EA 2WTEA 3CUKA 3SYNA 1P7CA 5CFLA 3F7TA 2HREA 3MRTA 4F91B 4HTAA 4L0MA 1GCUA 4DNFA 1MAHA 1Y9ZA 1H05A 3FCEA 3BHJA 3S1LA 721PA 1GL3A 3TPZA 1VZ2A 4AVYA 3NYRA 1E66A 1XAJA 2Y4OA 1DJPA 5C8XA 4Y9RA 1JDJA 3U1BA 3FHTA 1SB9A 3P5SA 3A6DA 3PNVA 3HN2A 4GG1A 5ALKA 4EJSB 1U8FO 2EIHA 1VRWA 1OLOA 3S70A 5DBIA 3OM0A 2B83A 1I1OA 1KETA 1XHFA 2IQ5A 2QQEA 3FSJX 1V11A 4HQNA 1JHRA 4ZVTA 3REFA 3ABOB 2G7ZA 3QUAA 4KN9S 3TB4A 3AV0B 4YJGA 2WLSA 1DQSA 4KODA 2QAIA 3A05A 4QOJA 3X1JA 1LTHR 5H83A 3HB4X 4TLLB 3U0VA 3OY2A 3LHSA 3QV2A 4OHVA 3L1IA 1DKMA 1NLZA 1UK8A 5BYBA 3EUAA 3BL5A 3ZGYA 5L3RA 2BJHA 1KSJA 1UT8A 2IP2A 3OZGA 2OXIA 2WU1A 4TMYA 5C7OO 5LWQA 2GM9A 1EXDA 3H1TA 1CQJB 1M1YA 3V6MA 1ISRA 3AHJA 3FSGD 3GUZA 2DHCA 2R7KA 4JH0A 4OHXA 1ML3A 1KTIA 1KFCB 3WYCA 5E6RB 2E18A 1DTWA 3I4LA 2O3SA 3C3CA 2C2HA 2WSBA 2PAAA 2RAVA 3U16A 3WIBA 4DBLE 5LMUB 4Y6RA 1LQ2A 3RS8A 1Y6JA 3UJDA 1M2OA 2HT6A 4I1SA 4JGBA 1AUPA 3A9SA 4ASUA 1MVNA 1Z5PA 3KB8A 3ROMA 3ZBQA 2PU5A 3NT2A 1W581 4X6LA 3VZRA 5T8KA 4MQFA 5DF1A 3O4FA 1CJUC 3K2BA 3L7CA 2VJCA 2XKAA 4B7UA 4F93B 4RFSB 4BN0A 2NPIA 2GN9A 3IPYA 2Q2OA 5CW1A 1ZLXA 5KNBD 4OYHA 4FILA 4ZYWA 1DG9A 2G36A 3JX9A 4R2MA 2YDYA 3PCXA 5DDIP 1JEOA 1G20A 1MJHA 3INNA 4HN4B 1CUXA 4CHTA 1F06A 4C5BA 2EC5A 1JA9A 1Y9JA 2ODQA 2AR7A 2ZSEA 2YBDA 1Y4DE 4H3SA 4JLUA 3WGUA 4EA6A 3FZGA 3ETJA 2PSFA 3IIIA 2Y99A 3ESRA 3N6RA 4W5QA 2FWJA 2P91A 5H9VA 4OHOA 4DR2B 2OCKA 2PLRA 3JQ8A 3OJWA 4LBYA 1Q0SA 2XADA 3N76A 5JAQA 2IELA 2I6TA 5DOZA 3Q6NA 1KF0A 3CLVA 4QTUB 1Z6ZA 4J43A 3D81A 3R9XA 4IJQA 4WOBA 4BMNA 2JFZA 3ITEA 3ZHCA 1XFAA 2B9VA 2F1IA 3RIHA 3RBVA 2HQBA 4Q3KA 5DWQA 2FDXA 4RHCA 2D2EA 4ZQCB 3R8XA 3ZH2A 1P2FA 2OQRA 1IEWA 1OQAA 1DDOA 1XJQA 1NQOA 1FDVA 1V16B 5KSPA 1MDFA 4D1YA 3ADKA 2CLMB 3GFVA 3DDWA 4PLPA 1FNBA 3RQIA 3T3DA 3W8NA 1QS0B 1A5SB 4HLNA 3VPHA 4KQ2A 3IAHA 3PHHA 3LXRA 2YUTA 4PCAA 3EXFB 5FBHA 3IEKA 3PCRB 1SFRA 3VU9B 2VDPB 4NNOA 2X2PA 2RH9B 4PFQA 4Y1RA 2REBA 3HKCB 5HWSA 2VOEA 1XK6A 2VPWA 5ITSA 4DDTA 4RZSA 1SHZA 2MSNA 1QGAA 2BBTA 3Q2IA 2O8CB 1WUTA 1B6GA 4FKMA 5C8DA 1FIUA 2PGLA 2C03A 5M3BA 4RULA 1HH4A 5J47A 5C3UA 5IFKA 5HQ3B 1INLA 2YWCA 3QX8A 1KYIA 2ZVQX 5HE8A 5HJ2A 3UFXB 3VU8A 2X9LA 3OCWA 1XK7A 4JLVA 4WK0B 2C04A 1H9CA 1Q3KA 4QYMA 1T9KA 3E18A 2QVXX 3S1SA 1KARA 2RCNA 4LPKA 1ZVVA 1MG5A 1X15A 2V59A 3KWMA 4E14A 4MAMA 3VSAA 5AK5A 4QLBA 3P0JA 2I22A 4IJUA 2HMSA 4R5HA 3BPSA 2V7QA 5DHAA 5I3ZA 3P20A 1FRVA 5JZ9A 2NU9A 4EPYA 5DMXA 2XNDA 3GQBA 4M9SA 2EV9A 3UAYA 2QNBA 1R18A 3AVQA 4Y6OA 4DRXB 1U3VA 3NRJA 2XNHA 2QD5A 4WADA 2UYHA 3D4OA 3MLBA 1TYEB 1C7QA 3TAHA 2JCBA 2YJ4A 1JB9A 4Q01A 2CY0A 2O2DA 2H9AA 1XDDA 4GPTA 3RAJA 1A9XB 4I1YA 4WLFA 4I55B 1X8XA 2NO9A 4YRRA 5G0WA 1L5GB 3B6ZA 2XMZA 4IP0A 4H6PA 2R68A 1PWXA 5LP6C 4BU1A 5CLJA 2D06A 2Z83A 2HA3A 1T9AA 5EL0A 3FMGA 2PWBA 4ZAYA 3T7EA 1THMA 3IEXA 5F98A 1B41A 1TXGA 2RHRA 2C54A 1Z13A 3AM4A 3QTTA 4FWIB 4ND3A 5DEIA 1RI1A 4KO8A 4M36A 4NY1A 4MITA 2QK4A 5LZ9A 2Q1UA 4H4DA 4YDRA 4WEQA 5JD5A 1OXBB 4KQGA 2NTVA 1Z39A 1TAGA 3IIEA 3HWWA 1UBFA 3O03A 4AJIA 4M37A 3FGZA 1YC2A 1DXQA 1P77A 2QX8A 4KACA 3G8DA 1OZAA 4MUHA 1E79A 3KQTA 3BWMA 3E1KA 3QXJA 1SCUB 3WNCA 4EG3A 3BYZA 3FPJA 1N2CE 2PEYA 1RJWA 3HY6A 1NXSA 4TTAA 1OX4B 2QGFA 4YR9A 4GDFA 2FN3A 2Q6VA 1YB7A 1EM8A 1JVBA 2YVLA 3OFSA 2XITA 4G56A 5HRCA 1QIJA 1MW9X 1Z37A 5IJ9A 4NQRA 1OPRA 3CZ9A 3NASA 4ES6A 3GIWA 3OZXA 5EJEA 1G8KA 4K03A 5K99A 2B35A 5HHTA 1SIWA 3VZQA 3LY5A 1SBZA 3L6DA 4JLWA 2JKZA 1Q44A 1MUUA 3PSHA 3RM3A 3K1YA 3DWFA 2ZXEA 4HP8A 5CJJA 1T4CA 3I2JA 4I50A 1G64A 1JPNA 1LLUA 1PGNA 2FW6A 3FIJA 3R5JA 4TLCA 2GUGA 4XYLA 2QQFA 4RZXA 3QKSA 1U4OA 4EY4A 4F5YA 4OCZA 6REQA 4M49A 3DT6A 3M6LA 4HO1X 1RVV1 4FDLA 4B6EA 4BV3A 1EIZA 1DX9A 2P5TB 1V9LA 2VXBA 4U9UA 4CMHA 1UPXA 1FNMA 4HC4A 2YN0A 4JAVC 3JXEA 1TQ4A 4OUKX 4WY5A 4TYWA 5BURA 2Z8YM 4PF1A 1NTOA 1TUGA 2BZSA 4BNJA 1H1DA 4YLGA 3VPSA 1N5LA 1WJGA 2H65A 2JGRA 3A3KA 4KVGA 5HCUA 2FE4A 2YNMD 5H70A 3RANA 2GWRA 3N2YA 2HA2A 3LY8A 3SZOA 1CUHA 3T1OA 4Z4QA 2I55A 1EUQA 4OI4A 4RTLA 1JSRA 1XT6A 5TQ2B 3U4AA 3NU1A 3HU1A 1E2FA 4KV9A 3K0FA 1X1AA 3R7SA 3IB6A 3WLQA 3ZCTA 5JU6A 3I83A 3EZYA 1GN9A 2H7YA 2WICA 3I4CA 2G09A 3IIJA 3ELUA 2QTBA 2XSZD 2P2ZA 2C7OA 2JIZA 1C50A 2QTRA 3HA2A 5D86A 4X8LA 5KYVA 4GPAA 3WXMA 4AI6A 3FCYA 5DBEX 2I33A 2JH9A 5DGTA 2WZCA 2DR2A 1W5BA 2FEWB 4P92A 1L5FA 1HE3A 2VNSA 3LXUX 3FHOA 2FOXA 3EG9B 3EQ2A 5AW7A 3DOIA 1VG1A 4QYIB 1BMFD 1RMTA 4RD2A 2OCLA 3G2KA 3HYCA 3JD4A 3T4UA 2DAPA 4CUJA 4EKIA 2YFQA 5CIYA 1E92A 1RSZA 4EY8A 3QOYA 4F8JA 2F9MA 4TV8A 2GCNA 4KRXA 3A9CA 4MINA 5E4JA 5ELLA 5CA1B 1W75A 2I4TA 3IJRA 4RD3A 4R4JA 3IQFA 4MGZR 4MS1B 1ZW6A 3RAEC 4FSHA 1G6Q1 3B5JA 3HJBA 1RJ9B 3G2QA 3UWOA 3WKDA 4EG6A 1FS4A 4RK0A 2D54A 3JVUA 4O4HB 4PCVA 3Q7RA 4JFAA 4WK2B 5DULA 4CIVA 5K3FA 4M1WA 1NXXA 3ZK9A 3AKZA 3IUPA 2SECE 1ZI8A 4IM7A 2BMEA 2ZULA 5H68A 3L46A 2UYQA 5LQKA 2BFCA 2AFHE 2VYCA 1L4MA 3OPYI 1I5OA 2BFDB 2OAEA 2Q3BA 3PQEA 4O63O 4EKNB 5DGIA 2XD4A 2E4ZA 1WBJB 3DOHA 1CY2A 2A78A 3SBEA 4XQGA 1M66A 5HCNA 3P71T 4JBYA 1ZHOA 3W5DA 1XO1A 2WOJA 3BIXA 5EINA 4CZ2A 4RD0A 4IVPA 4XX1A 5KSOA 4Z7QB 2PIDA 4F1KA 3PHJA 1ZGCA 4BGUA 1T6NA 2WEKA 2BP7B 3EXIA 1EXVA 1R0CA 4C22A 4QBHA 2R7MA 2FR0A 2NUAA 4Q4CA 3B9QA 1XRRA 4MRVA 3WQSB 2A84A 3CTMA 1ZH6A 3KVOA 4JY7A 4GEKA 4TQGA 4OQEA 2P6MA 2B21A 2EQBA 2GZAA 2J5XA 4AZTA 4HEJA 4B2LA 4EHKA 3DOCA 3ZNOA 3SXUB 1KDVA 1NVXQ 4ID9A 5D1NA 1VZ3A 3GVIA 1U3WA 5AW8A 2RONA 3HXQA 4DV6B 3BK7A 5FUVA 2CLFB 4RQUA 4GR9A 1J22A 2BW0A 3B5EA 4S1OA 1EBUA 1EDBA 1M75A 1R6UA 2WQZA 1UKAA 4Z8XA 2B0JA 1OAKA 4MI3A 4OM7A 4PONA 1T8TA 2BV3A 2QE7D 1R0WA 4QQKA 2JVJA 1SCDA 1L5VA 4LIPD 5CDYA 3ZV6A 1NN1A 5E1MA 3ZKWB 4QARA 4I1UA 3RYFB 1P9OA 1WXEA 3FTPA 5EP4A 4G1UC 4ZJUA 1TAQA 1X70A 4J0QA 4TQUS 3A9RA 4NJEA 1HNZB 1I01A 2W2NA 3CTPA 1VBNA 1E1NA 1WHTA 3WDKA 5LYYA 3S5JA 3U3KA 1L5NA 1Z8NA 1V2HE 3AUTA 4DBVO 4BY9E 1RJFA 2ZAIA 3KLOA 3TI9A 4GE0A 4WD3A 3HUTA 1KIAA 1P62B 2GRUA 3AETB 3HCBA 3L84A 4DV4B 3B82A 3F5QA 4CMIB 4PIPA 2EZUA 1GP2A 1WUJS 3N3AC 1M2EA 4HDOB 5FLYA 2C8KA 1Y48E 1AMOA 3CY6A 4IXWA 3VHXB 2Y1CA 3R7AA 1D2NA 2DFVA 3AZQA 5K9ZA 5B12A 2HHJA 1Q77A 3ID6C 3MHPA 4R1SA 2NUTB 2BAGA 4REMA 1LV8A 1U90A 1XZMA 5EJ5A 2JLVA 3QXGA 1LDBA 3VVMA 3GZJA 3G2OA 3T52A 1KY4A 1NNSA 1V95A 1L1FA 3WMRA 2KHZA 2NO0A 3VR0A 3WS7A 3C87A 3VJLA 3RK4A 5J4YA 1XD9A 2OSBA 1K98A 5AOAA 4PYOA 2WM3A 1DFIA 2OWEA 1J8QA 2ZRJA 3L7OA 5DTQA 1GFZA 3H4TA 4B2PA 4TVBA 1WZCA 3AINA 3MELA 4BO3A 3PGA1 1MRSA 3QJGA 1IZYA 4P5EA 1OV4A 3D2AA 4K9RA 4GUAA 4KQWA 4U7WA 5EP1A 5BMVA 5IF9A 4KNVA 1V5IA 1WO8A 2HIGA 3MIZA 1AHIA 5FCDA 5IARA 3K6SB 2JFNA 3ZGZA 4IXTA 2W8BB 3WLMA 4RV4A 2KPOA 5CDSA 1GYRA 2QJRA 4BYMA 4F2DA 3O2QB 5CYGA 1C29B 3FM9A 1EFUA 1QYWA 2AI2A 2IYVA 3LVQE 4PO1A 3AVUA 3ETLA 3MAJA 4HLUA 1J90A 3TEJA 1EHCA 2Q8PA 3H1GA 1WPRA 4RJ2A 3D8NA 1GV0A 2Y1OA 3QHQA 3ZQJA 5CB4B 1YZQA 1HDYA 3HBLA 1J8MF 2OCDA 3I2KA 3KOUA 4XWGA 3TZBA 4CR6A 2HRDA 1P2SA 1B14A 2A8YA 2G9RA 3BA6A 3AM3A 2C1EA 4MQ6A 5DH9A 4UPEA 4DV2B 1JXMA 3PC8A 2JB9A 2NSYA 3Q3CA 3KTAB 4B6JA 2PNFA 2YV1A 3K9GA 1D7OA 2GF9A 1QB8A 4WZ6A 3W5HA 3KZNA 2CGEA 4B47A 1XU9A 1EX9A 3ZNNA 4UOQA 1NX6A 2GOYA 2FSHA 4TXJA 3SS9X 5C7IO 1ZMOA 3SHOA 4DQ0A 1V5EA 3NTVA 5EMJA 2WTUA 3ZXXA 1VXOA 1UXGA 3OQBA 4G25A 4L4XA 2D59A 1ORWA 2ZFUA 4QUGA 3F8WA 4PNPA 1K5DA 1YKGA 3L7LA 4YO8A 4D98A 5JSZB 1BO6A 2CXTA 1JUDA 2PZKA 2ZROA 5FYDA 4BVJA 4PW0A 3QKWA 3CUYA 3GGOA 4LFAB 3ZY4A 2DUNA 4AUEA 3DZKA 3QWBA 4UZEA 1YFLA 1YL5A 4M86A 4E21A 2BMWA 1TO2E 1GPJA 3Q10A 4JLMA 4X1YB 4V0KA 4I08A 1V8FA 2Z95A 4QNMA 5AKLA 3D3JA 4D92A 1EK6A 3C16C 2VHQA 1FY2A 2WUFA 5FT9A 3I9OA 2BR5A 3I28A 4BMDA 3DBIA 4JUFA 5K0EA 3KVYA 4RTMA 4TXNA 3GY0A 4URWR 5T3UA 1TTQB 1CQJA 4R2LA 2C31A 4DTCA 4PM4A 3DC7A 2AMFA 4F8EA 4DV1B 1FFHA 2RB4A 2JJQA 1R6TA 1E2NA 2DCUA 2XCIA 3PICA 1QTNA 1LXCA 5K45A 2AOWA 1EVLA 2XOKD 4QXRA 4JI5B 1WW2A 3TVYA 1YS2X 2XMCA 3BRQA 1O5OA 3QX7A 4L85A 5DSZA 2FH5B 4PXAA 3RRNA 1YTUA 2BKVA 2FFQA 1W1UA 3PTAA 3GYBA 4C6RA 2HC9A 2QN6A 1PR5A 1MCZA 4A1OA 2XKKA 1YZVA 3CWQA 4M0DA 4EF4A 1YDHA 1VPLA 3JQEA 4MUNA 3L0PA 4AXXA 4BLTA 1DB3A 2HUNA 3Q85A 4GPEA 4E3ZA 2D3TA 2JJ2A 1GQYA 1N8SA 1FDSA 3EQ8A 4MWGA 4BS9A 3KPVA 3LYHA 3RIGA 1Y42X 3T7IA 4F7WA 3E82A 3P94A 2C07A 2QB5A 4QHSA 4RLSA 5IFLA 5L3SB 4ZEOA 1P1IA 5EIBC 2XZDA 2PV0A 3P2OA 1JSZA 4DE5A 4KLAA 2QQ5A 3Q2KA 4UNNA 10MHA 2N75A 4FGKA 1SC4A 2HJWA 4F12A 2P9HA 3QV1A 2WLTA 4DJEC 4RLHA 3VYSB 4CM1A 2ZATA 5C0OE 1K7SN 4D9FA 4KC0A 4KX5A 1JR3E 5CD1A 3KETA 4DREA 2IEYA 4ZP1A 3ZR4B 3I5XA 4DDVA 3ABQB 1QVAA 4N6GA 5CVJA 3RREA 5TPWA 4PC2A 1CERA 2C1XA 4G3XA 1Z2AA 5AW4A 4OHUA 3BQ9A 2IY7A 1EWKA 4XGKA 2AT1A 1HZJA 3RJTA 3IMCA 4MAAA 2EP5A 1PJBA 4ND4A 1ZA2A 3QEAZ 5CB8A 4WPGA 4TT3D 5LPNA 3OBBA 1ZMRA 3I2IA 1KDOA 1OXKB 4RPHA 4N01A 5AM4A 3W1VA 3RU9A 1DAIA 1GA4A 1MTOA 1NUSA 5GTDA 3MK31 2A0XA 4XSGA 4G4SO 1LFAA 4XJTA 3IOCA 4OHFA 4OV6B 1U2PA 5T6BA 1T4MA 1W2HA 3H7AA 4CM7A 4B09A 5IM5A 1L4KA 4EHDA 1QS0A 1KFJB 3C43A 5ALQA 3QFFA 3VU9A 4GI2A 1ZCJA 1HA3A 4X6XA 4OJNA 5KX5F 1ZCAA 2E4UA 3HKCA 3EFHA 3EMBA 3KJZA 2J07A 2G40A 4L5BA 4RV9A 5LSAA 2O8CA 1POXA 4L7VA 1T5TA 1XZLA 2YY5A 4Y2QA 1W25A 4UNQA 4EX6A 3HU2A 3BOSA 4G9EA 1N7JA 1UK7A 4QREA 3SKXA 1LPAB 1PZNA 5HQ3A 3PVSA 3GLQA 1WDWB 3W8DA 3TCKA 1ZISA 3OIYA 1BYUA 5KSZA 3NAQA 2BZ0A 3GEPA 4HGYA 3UFBA 1JQ3A 1YCDA 4E4YA 1PGOA 1GCGA 2FMFA 4B34A 2X9QA 1WTCA 1U3GA 1CBUA 2QMHA 3WV5A 5MFPA 2OQ2A 5ALMA 4DA7A 4MJLA 4DXAA 1R50A 4P53A 4N0QA 1I7DA 5BYJA 2GKSA 2EKBA 1USIA 3F96A 1DINA 4UULA 2JEZA 1CB7A 3I34X 1ZJ5A 2AG8A 3OZVA 4KIGA 4CV3A 1IJKA 2I4MA 3S99A 1AZSC 1QIHA 4LRQA 2PKQP 3NDPA 4GBED 1LQTA 2EHDA 2HTEA 4KZKA 5TX7A 1CUUA 2C61A 4UFPA 1OBVA 1XEWX 4GPZA 3G2MA 2AH5A 1M1YE 4RPCA 5KQMA 4HY3A 5AM3A 1N25A 1A9XA 1EFDN 1PYDA 2F8SA 3SPXA 1QH8A 2B25A 4WMLA 3NXSA 3E2MA 1VJTA 4U5XA 5I9TA 1X94A 2O06A 3H05A 4I5IA 2Z2ZA 4ZVSA 5AJYA 1HYQA 1KI4A 2Q2QA 4FR2A 3E9QA 2MR5A 4P3NA 1Z82A 3HY4A 2DWQA 3EF1A 1KWGA 1QRTA 4CI9A 3GVPA 4F85A 2IYLD 3KYIB 4LXTA 3R0VA 4E4TA 4W6ZA 5J59A 3BEOA 1I51A 2B8WA 2I0FA 1EE2A 4MYSA 3BERA 3ZDAA 3IQGX 3Q9UA 4BEJA 3LIPA 1G3IA 4RKYA 3CLSC 4LHEA 1GIAA 3OIDA 3LY9A 2ORWA 1WTAA 2P4QA 4BO2A 3KLPX 4D41A 1WUYA 5IPFA 1SCUA 1DQYA 1BXGB 2E21A 1ZGJA 2VYVA 5LMCA 3LU1A 1FPQA 1U7HA 3N6XA 4YCJA 1DIBA 4ZI5A 3UC5A 5DGCA 2WKQA 2X40A 3CBQA 1Y6GA 5AK4A 1MGOA 1OX4A 1WUHS 3E0XA 3HLKA 4IXDA 2Q2WA 4QRHA 1O03A 4HMQA 1GJRA 4V2IA 3DDHA 4UAJA 1XKXA 2GN2A 4NCXA 3K9QO 1TADA 1TJPB 4OH1A 5EY5B 1KVSA 5ADVA 2ODBA 3PF9A 3GK3A 3QUTA 3GDOA 3D6HA 3TO5A 1O89A 2UKDA 2KW5A 2Q49A 4RDXA 5BXYA 2VAXA 3D6NB 5DP2A 2PRZA 3DQQA 2Z8YA 4XRRA 2R7LA 1SIOA 3HDYA 2O7NA 5L95A 2V97A 3VHLB 1OA1A 3UMYA 3AF0A 3SFZA 4CF7A 3IHLA 4YH1A 4GC9A 2BL4A 1I7PA 3LT1A 5M29A 3WWZA 5FWAA 4NU6A 1QBGA 3E53A 4RZHA 4MYDA 3LX8A 4ZEVA 3FCCA 4AMZA 1QK4A 2Y6VA 2HHAA 1GGJA 2GGSA 3IERA 4JIMA 4MVJI 4FBMA 2Z8XA 1KR5A 2VNJA 1PFGA 1Z0DA 4Y7DA 4DIUA 5TQ2A 4CE6A 1OI7A 3LRXA 3SQMA 2L18A 3LGSA 3G2PA 4NK4A 5LLDA 2C83A 2EOAA 3CNBA 3T4EA 3WIUA 3P97A 5BRAA 4GO1A 3B9PA 2Q8QA 4R9VA 6NULA 4NONA 4BBAA 4AKIA 2BGWA 4RCZA 2P5SA 3UV6A 5AI5A 3ZJ4A 4WK4B 2RK4A 2G06A 1VE7A 2PS3A 2HIHA 4JUAA 2HD4A 1R5BA 16PKA 3RTCA 3B2NA 2XWJI 4YMWA 3TE7A 4PTYA 1VJDA 4UKDA 2FWIA 2HJRA 2I2AA 2VAMA 3EG9A 5B36A 3TTWA 2IYFA 2XXJA 2Q5CA 2XUKA 2R4QA 3EVFA 3I5MA 4QYIA 2OMEA 4W1PA 4D5EA 2DRIA 2G4VA 4D96A 1Q16A 1B6RA 1WOYA 4KKXB 5E6SA 4AFNA 4BQRA 4R8MA 5EVCA 1V3VA 3WHLA 4LJ5A 2M6LA 1I5EA 3LP6A 5BUQA 1ONPA 4NBSA 4CKYA 5CA1A 5AW0A 2AKEA 1Q57A 4A36A 3KJGA 4HAIA 1RWPA 3LGXA 2W6OA 4MS1A 1QDUA 2YYZA 4R5MA 2ZRKA 2FSGA 2VDMB 4MA4A 4XVQA 4ZOLB 1JWBB 1FYDA 1RJ9A 1T0PA 4G1FA 1PJ8A 4GLOA 4PX9A 2DE0X 2CXOA 4M9CA 5CIWA 3TKYA 1NVMB 2Q4OA 4LK2A 3GA0A 4PVCA 3NKFA 1M0TA 1MB9A 3PZRA 4GR5A 3Q1LA 2OILA 4O2AB 4OKNA 1QQ5A 4HWOA 1EXMA 2AEMA 2JA2A 4PZZA 1CDEA 3O92A 3P4XA 5DGHA 4HNQA 4KUGA 2PBRA 2P3QA 5BSMA 3L06A 1TZMA 4H6XA 1PEDA 3C8UA 2BFDA 4HATA 3CX6A 4HH0A 1W59A 1WQ3A 3CPSA 1A9RA 3FROA 1R8XA 1A4XA 4G5QA 4PO8A 2D0OB 4B6GA 4B73A 2OECA 4K6KA 1M6WA 1YWGO 3PDHA 2BBSA 3L02A 3EGXB 3ZU5A 4QYWA 4FCCA 4DLBA 2QJWA 1ZUHA 3VO1A 3EEIA 3WLKX 8MHTA 4JYMA 1XN4A 2LUOA 2RGUA 3E2PA 4HAZA 4XR4A 3N7AA 1FFEA 2P11A 3A28A 3OEHD 3KSRA 3QE3A 4KXQA 2GI4A 2IHJA 3T95A 4M1YA 1OKKD 3ZHXA 1HE2A 2QM8A 3FOAA 3QUSA 4MNTA 3A4IA 3DHWC 4D02A 3EGDB 4FGLA 4EY3A 2JZCA 1YC5A 5H3LA 3UHFA 5I9LA 4LK3A 2R6JA 3T1HB 2OT3B 3COWA 2WHYA 1EXWA 3DC2A 3SXUA 2I66A 1GRRA 3KYCB 3NM5A 2AFIB 4KYIB 3SC2B 3MWYW 3AY3A 2C3YA 2E4VA 2VJMB 1R88A 4QELA 1YK0A 2IOFK 4MW5A 2UUBB 1MH9A 3MMXA 3MIIA 1L8QA 1UJ6A 3WADA 5KNBA 3GHHA 3BMNB 3NDRA 3VR6A 3GMDA 5LDGA 4JEIA 1I3MA 1VLQA 3B3QA 3DBVO 2REOA 1CRPA 2R7NA 3NBKA 3ZKWA 2G08A 5FI3A 3E4DA 3N58A 1MNAA 3T34A 1U0FA 3SQOA 1V48A 3BS4A 3IIMA 1JQAA 4WK6A 5EFZA 3PKJA 4RM3A 1GUYA 1QLWA 3FBGA 3WFIA 3STXA 3KUCA 4CUZA 2MJLA 1TUIA 2G5GX 4FYPA 1SCQA 3OC6A 1PSDA 1LVGA 2HK8A 4IDCA 3TRKA 1P8JA 1AS2A 2V0CA 5AUOB 3KQNA 2VPIA 2NUPA 1Y6ZA 4KAJA 4PE5B 4RD6A 4O5AA 5T4FA 4JYCA 3AETA 3VU3A 2JD0A 3W7BA 2JKYA 4YY3B 3R7LA 4C4RA 4F3KA 1VL6A 5K8IA 1P2UA 3N2GB 2HW8A 4CR8A 1EGHA 1EUDB 3V8MA 1QKJA 4J03A 2JFGA 3F6YA 2FX3A 2FMKA 1ES9A 3BSSA 4MO2A 3DGFC 1AMUA 1YACA 1Z4IA 3VHXA 5CHYA 1Z33A 2W2LD 4K26A 3L6CA 4FCVA 4QDXA 3N8HA 3T3EA 4HX2A 1IXKA 2B5VA 2BHSA 3AHCA 4N8EA 2NUTA 4BNDA 1HOTA 1PJRA 1CUSA 5A7HA 1K88A 4Q7QA 4IQ0A 2VJYA 3NBAA 1B1AA 4OQQA 5CG2A 1GOTA 3HJGA 2ISSD 5HKOA 2PWYA 4TVOA 4OA5A 1GTRA 3KHUA 1LBSA 4QJ4A 3FE2A 3R7FA 2XTAA 4Z4FA 3TKAA 3WGHA 2FPSA 4GF5A 2XYHA 1Q50A 4PRKA 4K9LA 1M7HA 3ZCSA 1SIUA 4CV2A 3FKJA 4DNPA 4M6WA 3ZJYA 1HPLA 1K5GA 3IODA 4K2HA 4BCCA 5DHSA 4YP9A 2IXFA 3M6XA 4M0PA 4QGFA 3AH8A 3PGMA 4DJ5X 2H85A 2Y1GA 4OFWA 4WKGA 2FJUA 1OASA 3K6SA 4O2BB 4OK6A 4JGGA 2GCPA 3RAGA 5I9IA 3QSYA 1LGYA 4B3SB 3WRWA 3LO8A 4KRFA 1I2ZA 1D4AA 2TECE 1E9SA 3O95A 2PWPA 3CNHA 3PFCA 4YFVA 3PC3A 4II7A 2XZLA 2PTGA 3K70B 4LNAA 1A2KC 2F3QA 2H57A 2H5EA 3TZQA 1UZAA 4YP0A 1NDQA 2O07A 4NU8X 1JLSA 1OA0A 4TV9F 5CB4A 7AT1A 4V39A 1MO5A 5E6UB 3JAMA 2WWFA 3IMEA 2DSNA 2XOXA 1AG9A 1W9HA 3QEMB 4EBBA 5I7EA 3CLTC 1NM5A 5KYXA 3ADBA 3HYRA 5LQSA 1ZRHA 3DMYA 4CG1A 5C7LO 1WL8A 1FNCA 1CUIA 2DYKA 3A6GA 1SVMA 3KTAA 4MCJA 3M3PA 4NP6A 3NONA 3AI3A 3E2IA 5EPOA 2YIDA 3D3EA 3P9SA 2IEDA 4A2QA 2GPBA 2VUSA 2DPGA 3UT5B 1N4AA 3RB8A 1B2RA 1RXIA 4U4AA 4W8GA 1RXUA 4IIJF 5CVCA 1V7ZA 2ADMA 2CV2A 3ZDQA 4RANA 1JIIA 2Z1NA 2C4HA 4GMHA 3K4PA 2AL7A 5K0NA 4DCJA 3D43A 1HORA 1AQLA 1K9VF 2BE9A 4II2A 2I3AA 4R84A 1LPBB 1QDLB 2C4NA 2ZE8A 4N5HX 4MDYA 1LRJA 5AKKA 4EKEA 3JQAA 4PINA 1ZGZA 5AIAA 1GXSB 1PR1A 3C97A 4LGMA 5EKXA 4ZYTA 3VPGA 2OBFA 4FHDA 3OQHA 3GPCA 2KLBA 3O4GA 4R69A 3TW4A 1L5SA 3O21A 2VJPA 4MVJD 3JRWA 5BN5B 3LPDA 4FGWA 1F3LA 4F6LA 3HYSA 4LJLA 1J2TA 5DI9A 4X1YA 3DL7A 1UP4A 3MWFA 4P80A 5LQNA 2HF7A 1UDAA 1IRXA 1J2JA 1OCEA 3JWIA 5EQTA 5THQA 3RTBA 4Y8VA 1Y1LA 2QSZA 3I45A 1M6VA 1I6MA 3PJGA 2OCBA 4GMXA 5AKGA 5DFAA 4G8DA 3ZG6A 2WNSA 3U1VA 3P9NA 4QM7A 4I8XA 1ZYUA 3AJEA 4CLOB 2H31A 4YCDA 1DBPA 4IQFA 4LY6A 3WQQA 5AM2A 2ZUEA 2ZI7A 3GDWA 5DASA 3W7AA 1RIFA 3WE7A 4BOYA 3U26A 2CLOB 3P4YA 4NFLA 4YRJA 2AZDA 1Q21A 5LJIA 3HVRA 1JMVA 1VE6A 2VRNA 3O90A 2WTAA 4GZMA 4TKUB 3RIXA 4ADSG 1YJCA 3IDQA 3HWX1 1M2JA 2QHXA 1P29A 5EUQB 5BOVA 1NJGA 1D4ZA 4YT5A 1JVSA 5H0IA 4LJKA 2CDAA 5FLEX 3BHNA 4C4TA 5BNWA 1SKUA 1HDRA 1NSFA 4ZN6A 1B0ZA 1WCYA 3E7FA 3WLRA 3I9NA 4I9HA 4UD2A 1GFIA 1L4BA 1CIPA 3RPEA 1IPHA 1K63A 3UHOA 4DLRA 3OHMA 1W4BA 2GILA 3AF2A 4F5WA 4NABA 5JBNA 1Q12A 3TM5A 1ZGGA 3EFBA 4MMXB 4CM6A 1T34A 3VPFA 2OLJA 2Y71A 1U98A 4GBMA 3U3DA 4C87A 2PRKA 2OXCA 3SI7A 1OI3A 2QT9A 1Z5GA 1J09A 3EZ9A 5FYQA 5CFNA 1G4UR 2H52A 1M34A 2I4RA 2BF4A 4B3FX 5K0GA 1WU7A 2FFBA 2Q27A 3SYRA 1SKYE 3KR2A 1LBEA 2W6ID 3FYSA 3SSAA 3SSMA 3DXZA 2QT0A 5I9BA 1IWOA 5FEUA 2OUIA 2HIAA 3CVUA 3DJYA 2ZW9A 3EB9A 4OTZA 1F38A 1PWHA 5EXEA 3VHRA 4DIEA 4MGKR 5EJ8A 4I5DA 1PIWA 2ZE5A 3U7QB 2JJ1D 3DHVA 5IKEA 1MVOA 4CIBA 5L6LB 4RU1A 2WIFA 2FEPA 3LRTA 4GMDA 1TM2A 4C4AA 5ALYA 4FYKA 4RGQA 1EU1A 1X7GA 4U7JA 3VAAA 3BK2A 3HJTA 4J16C 5LDHA 1GTSA 4CQNA 4RYLA 2H7CA 2XZPA 2P2NA 2R7AA 4B4WA 4QGAA 2B4YA 4KWTA 4V1CB 2JFPA 2PR2A 3C3WA 3EASA 1YS1X 4NEGA 3R0ZA 1E6KA 5TEVA 4DB2A 5ARBA 4XGNA 2VDWA 4MDHA 5JARA 1KVTA 1JJIA 1FXWA 1MT3A 1NUAA 2LDBA 2QAJA 2Y9MB 2K5UA 4FQ7A 3ZD9A 4YMUA 4F06A 3Q6IA 3QBTA 4P2BA 2C3UA 1OU4A 3Q98A 4AY6A 3FUTA 5JJ5A 5SYNA 4RHYA 2ORED 3LW7A 4AXBA 4BVHA 5TQ0B 1E3WA 3WL3A 2ZYVX 4ZXPA 1KK1A 3CR8A 3M81A 4ND8B 3WTCA 4CQMD 2EU8A 1N6KA 1FK8A 3C15C 1NI3A 1YHZA 2ABWA 4BKOA 3WBFA 1IY9A 5CG1A 5CGQB 1AOXA 4K6OA 4IS3A 1PD1A 2VSNA 3FRJA 4J9UE 1TYAE 4RS4A 4L07A 4YJ3A 1U2SA 2CXQA 2IOYA 3AUKA 5HILA 2VJDA 4ZDKA 2BSXA 1G8HA 1OB5A 1BJTA 1OLSB 3L7KA 4NBLA 3STTA 1SUEA 3IT1A 3IR6A 4LJSA 2EJCA 2KYRA 3UA3A 2XMGA 3Q9LA 4L9RA 2PYZA 3JQRA 3UXYA 4DCVA 2VHJA 4MWCA 1KQPA 5IJ0B 2B99A 4Q9KA 1CJCA 1EWYA 5E4TA 2AJCA 4E88A 3IBCA 5JROA 2ZJBA 3Q7SA 5H59A 2GCGA 5LJLA 1GNVA 3DNMA 5IMBA 4JI6B 4ALNA 4LZPA 3SVLA 1ATZA 1GPAA 5ALXA 1H6CA 4YQFA 1N0HA 1S9DA 4AJOA 2C2YA 4MKIA 1OXMA 2I6SA 3BAFA 3DP9A 1KMQA 3ZW7A 2H1HA 2IT1A 5JPDA 2V4UA 1HNNA 3U4CA 1DHTA 2QR5A 1DO0A 8AT1A 3NW9A 4EPXA 2VQDA 1QFMA 5FI1B 4LKRA 1MV8A 1PWZA 1ZL0A 2DFNA 4WZAB 1LPMA 2AHOA 4L3OA 1GG8A 3SQLA 2QXYA 2HT1A 1V8DA 3L8ZA 3EEOA 1JPUA 3ROTA 1N2JA 1ZPDA 1E3DA 2X2EA 1FQWA 2FW7A 2J6HA 1Y3IA 2RKOA 3SIWA 4H7IA 4PPYA 4QPZA 4BO1A 4ZAZA 1AX9A 1ESZA 4I9FA 4HQFA 4GKAA 1DT5A 3HRIA 2QP4A 1EJ2A 3IMKA 4Y9SA 1N1EA 3NYIA 4LMAA 4AY4A 3AR8A 3RODA 3SC6A 2WM8A 2ZT6A 3LF2A 3MMPA 4J0CA 4OB7A 2WA1A 1WR8A 4PC6A 3HBJA 4RZ3A 5EGSA 1NONA 4BNIA 1BXGA 5ECYA 1EFVA 2Y76A 4KDCA 1SCNE 2BMFA 2UVQA 3QZUA 3W5CA 1H2EA 1JHPA 1GTZA 2JCXA 2TRSB 2VJQA 1NR7A 5IJWA 2Q9BA 2HA6A 2ZQZA 3IXMA 4C9BA 2ANBA 1P6XA 3M82A 1N6NA 1KK3A 4HQ6A 4RLFA 1QJCA 3HA3A 1MB2A 2SKCA 3M4ZA 3OWHA 3KDPA 1I2CA 1EX7A 1QHEA 1W52X 4ME6A 1Z0UA 2Z30A 1PNTA 2XQKA 4WKOA 5GVRA 4AF7A 1ZN8A 4WXRA 4CN9A 1PU2A 2C42A 2ODTX 4JLAA 4QECA 2ZIZA 3DT9A 3THSA 4IEEA 5IZ4A 3EDCA 1VYTA 5CCDA 1YE5A 2D62A 4WXMA 1LLQA 4B48A 5DNUA 1IAQA 1W2WB 1WUIS 3IPXA 4D42A 4RZIA 3BRWA 1ENPA 2VATA 1F6DA 3OE1A 4BATA 4KR3A 3TQSA 2GO1A 4HH3C 3GH1A 3R3HA 1NXVA 4WINA 4KPGA 1VFPA 1A5AB 2DG2A 3WGZA 5LMNB 1NN5A 3P19A 4QOSA 5JMPA 4B2IA 3N2EA 4OFZA 1KYVA 4M0UA 1R9NA 4L5AA 1QNFA 4WN9B 5LP1A 1YRHA 4YASA 3G1TA 5MDHA 2H06A 4NLLA 2K7ZA 4ZKDA 4OBBA 3WB0A 5FUXA 2UYYA 4F96A 2CXSA 1GNRA 1P4JA 3GLIB 2ENUA 1RCUA 1WZNA 2BFPA 3IT0A 3P8ZA 1G5FA 1YVDA 1T2AA 3JAWB 4GQAA 4O8ZA 2RIPA 3RSQA 4JCCA 1KNQA 2DBVO 2ZLBA 4BGIA 1MHPA 2FUG1 2Q8NA 3B38A 1UDRA 2VNAA 2ZB3A 3DTVB 3JQ6A 3IP9A 2GSDA 5CDFA 1T24A 2GWHA 3VR3D 4LEIA 3ZC3A 1XBTA 2W2QA 3BXFA 5KNBH 2QLMA 2FF5A 1FSPA 1QOQB 3VR6H 2F00A 1J2YA 1QV9A 5D7NA 4BLVA 3AJAA 2QTMA 2X19A 5FOXA 1GNQA 4NMWA 3DM5A 1I30A 4WNIA 4ENQA 4ZOLA 1CJTC 2YICA 4TZ6A 2WPDA 3QVGA 4ODIA 2RHGB 3LKBA 1ZVMA 2FP4B 3L93A 4AN4A 4KXXA 4TTVA 3I5AA 2ZS8A 1S1MA 1C9MA 3I5YA 1TLTA 4X45A 2VPZA 3D6JA 2A5JA 1L7AA 2HSZA 4JP2A 5HRAA 1Y4SA 2GPJA 2BFBA 1GPWB 3EE6A 2PGXA 4FKBA 1E32A 4HDAA 4KQHA 2W98A 1KU6A 2VHVA 1JQKA 1ZFNA 5AJHA 5HK8A 2A9PA 1WDTA 3U37A 1W36C 1OSNA 5IZCC 3Q0IA 1SXPA 4S1NA 4D4JA 3PDUA 3D5QA 3EGXA 2EBWA 3ACCA 4TVKA 2VHTA 4BMYA 3EK2A 2TMDA 4BVKA 3E5NA 1K4KA 2C5EA 4CCSA 1K3FA 2R1ZA 4GOND 5BR1A 1ANKA 2HY7A 4ND7A 4D3ZA 2QNRA 4IZ6A 4KXNA 1GQRA 1PT7A 3FYUC 4NBWA 5IVIA 3TSAA 3BXPA 3DVQX 3ADOA 3QM1A 4R1NA 4L27A 4YECA 3EGDA 3H5IA 4RUKA 3GJ8A 5CLIA 3SY8A 2R65A 5GOZA 2C3OA 3KYCA 4JK3A 4JT2A 3A7DA 4G67A 4LS3A 1RM5A 4L5JA 4MRMB 5CW2A 2F1JA 3RROA 2WSSA 1GQQA 3WWPA 2CL0X 2PGOA 3K96A 1W96A 1WY5A 2JLSA 4NVRA 5SYAA 3CUVA 3R5TA 1LW7A 2QUZA 1V8BA 3BMNA 1NOIA 4BP3A 5BSKA 3PT9A 1MW8X 1R00A 3OM8A 4P32A 2IYYA 1G2PA 2ESRA 1P1FA 4R3WA 5F21A 3ICWA 3BH7A 5FWYB 3KR1A 2J7PD 1FU8A 1T0UA 1TLFA 5DM2A 4URVR 1XDUA 3EX7C 1OIXA 4MGHA 1DAMA 2VF5X 1UDXA 3EF0A 1R6BX 2FFAA 3K0EA 2OGUA 1UOEA 5BUCA 4KWIA 1DT3A 3DAHA 2QTCA 3V8EA 5KREA 2FXIA 4B5KA 5DIFA 3QF4B 4O29A 3BFXA 3NTUA 3RASA 5IHPA 5CEFA 5CVDA 3ABIA 4JR0A 5JSQA 1R3UA 3CONA 4O2LA 4QDTA 5F76A 3S40A 3D6AA 3SVZA 1SB8A 3N2GA 2Q0QA 5IKMA 1NYQA 5D87A 5K3CA 1EUDA 1N75A 1P0QA 1O7JA 2FW8A 3ZHRA 3NT4A 1VP9A 5T57A 3TLAA 2D5IA 1F0PA 3ANMA 1HR0B 1Q14A 5D3KA 4N9QA 2PZAA 2HSDA 1XTPA 1MH1A 5EKDA 2GHRA 1PVDA 3INRA