1HRKA

Crystal structure of human ferrochelatase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A structure of human ferrochelatase, the terminal enzyme of heme biosynthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords FERROCHELATASE
total genus 137
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hrkA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hrkA01
2XWQA 1LBQA 3LYHA 2PNJA 1HRKA 3AQIA 4KLAA 1TJNA 2XVYA 3W1WA 4F4DA 2AC4A 2XWPA 3HCOA 4KLRA 4MK4A 2QD5A 4KMMA 2QD3A 1QGOA 3HCNA 2Q2OA 2Q3JA 1L8XA 2C8JA 1C1HA 2H1VA 2XWSA 1AK1A 2QD1A 2Q2NA 3HCRA 2HRCA 1LD3A 2QD4A 1C9EA 2JH3A 2QD2A 3M4ZA 4CCSA 2HREA 2XVXA 3GOQA 1N0IA 2PO5A 2AC2A 2H1WA 2DJ5A 2HK6A 2PO7A 3HCPA 4KLCA 2XVZA 1DOZA
chains in the Genus database with same CATH superfamily
4B3FX 3AKYA 4XYLA 2FW8A 4Y7CA 4I9NA 4ZT2A 3I5UA 1VL0A 4B48A 3STHA 4ZYVA 5IH3A 5LU8A 2HDHA 2VP3A 1E20A 5BN3A 4KMOA 5FAKA 1M74A 2PX0A 2QT1A 4KGDA 3C4QA 4KDCA 4JDUA 4WN3A 5FUBA 5BVGB 2BONA 4L4XA 4BO3A 3UUWA 1OBFO 2ZAMA 3EUWA 4IEIA 4KI7A 1SQ6A 1V47A 4C0SA 1UDXA 2OCLA 3WGUA 4ZI7A 4RNCA 4XJSA 3N28A 5CGQB 4NYIR 8GPBA 3GR6A 1CRLA 1ZOPA 4NK4A 4IX1A 4AY2A 4HQRA 5EHGA 1NR5A 5CH8A 1CE8A 3WSTA 3OH8A 1EXWA 2BI8A 3H1BA 3IP9A 5E38A 1BYIA 3FLMA 4LF6B 2PS9A 1XOIA 3FY4A 3ID6C 3RI3A 5A4IS 1OGYA 2B0CA 1OHHA 1UM8A 3DVAB 5FA8A 1BQ4A 2O2DA 3CYFA 3GGCA 4JC0A 1YXMA 4AFNA 2YMQA 3TYXA 1MO2A 2QY6A 4KUGA 3U13A 3M5CA 1VG9B 1NVFA 2TMDA 4C07A 1F2TA 3FYTA 1KSFX 3MWLA 4A03A 3ZIAA 1RJGA 5IM5A 4FM9A 1H8ED 5E1MA 3B13B 4F12A 4ZYYA 1SBYA 3ZDBA 1PG2A 5BMVF 1T6ZA 4EL5A 1YACA 2F4VB 1U04A 4S12A 4RQUA 4BTEA 5CCDA 1KO4A 3R6DA 1W88A 2IYEA 2HTFA 1SD5A 4K87A 4MWSA 5EJIA 1BD3A 2PFKA 1SD2A 3VR6H 3WBBA 1ZWKA 2XF2A 4U7WA 1YWGO 1Y8RB 5BW6B 5DW0A 1ZSVA 4ID3A 3UYLA 3ZOKA 3AEUB 1KYWA 1GU0A 2QE7A 5A4JA 5IZCC 2W9XA 3WQHA 5CT9A 3BRSA 5IC6A 1CLUA 3SR4A 4EITA 4ZCRA 1V4NA 1Y5RA 5AXBA 3OD5A 2P65A 2VHQA 1IM2A 4LDNA 1HPLA 2YC4C 4LZWA 1FW6A 2M98A 4W82A 2XB4A 3LBYA 3B89A 4R1LA 5AUQA 2EGGA 4ZVRA 4TGLA 1OT5A 3CBGA 3LVBA 4AP9A 1ZXBA 4G5HA 1UK8A 4I1UA 2RGGA 1NFRA 5IJAA 2DUWA 1J90A 2J1LA 3OZTA 3CVOA 4GPAA 1WF6A 2JI4A 2G1AA 2G04A 4DCSA 1GV1A 4M6WB 4PYKA 4JYCA 4C6RA 1PEYA 3SY8A 3H7IA 3U4QB 2P75A 1JSCA 2AHRA 2G0TA 4RD3A 3ESRA 3WRYA 3WOHA 5BWCA 2OXCA 4V1CA 1GT6A 2R2GA 3AF4A 3WK7A 1VPDA 3HKBB 2AG6A 5CXUA 4ICIA 5CD9A 5KPJA 1QH1B 4ZARA 3D0RA 2E48A 5T4FA 2VP6A 4D97A 5B30A 1QYCA 4F11A 1FTSA 2R79A 3BWVA 2P3SA 3O73A 3SMVA 3QXSA 4MKIA 4YRQA 5CJ2A 3KLOA 1EFUA 1V25A 3FSGD 1RLJA 2ATCA 2QXTA 4XWYA 4YIKA 3STXA 4CLEA 1N9KA 1CD5A 1PTKA 2HMUA 3LPDA 2BR4A 4KQ6A 2H65A 1KE2A 1B0UA 2XCRB 5AM4A 4KNVA 4CM4A 3DVAA 2ZJOA 2B35A 2HA5A 4XZ3A 1A5ZA 3REQB 5JDCC 2ZWPA 5CNJA 2IKQA 5ESWA 5JJ5A 3LM8A 3E58A 4EY6A 1W49A 4NR0A 1I94B 2C57A 2MSKA 1IWOA 1HMYA 4ZU3A 1J8VA 3K92A 2VXCA 5BNWA 1E7MA 2VZ8A 5C0OE 4DNQA 2VJYA 2J7KA 1JWAB 2VDOB 4CT4B 1TA9A 3NEYA 4OXIA 3WHIA 2C8KA 4A6DA 3K35A 4D9IA 4DDKA 2V7VA 2IODA 5ALXA 3H2BA 2XA1A 3L1UA 4HAVA 1JR4A 3M3PA 2XZOA 3GMSA 4AICA 1YI0A 4R9NA 2V74B 4WNYA 1M5UA 4CQMB 2K2QB 3W1VA 2QNRA 4UBOA 5A3JA 2NO6A 3D3JA 3KT8A 3C45A 3ZK7A 2UYCA 2QJOA 4LZAA 1HO3A 3MRTA 1D1PA 1EP2B 1JHAA 3I4LA 3VKWA 1S2LA 2P35A 2RGWA 3MJ4A 1R37A 2P90A 3ZWNA 4MYDA 3TRKA 1SK8A 1A98A 4AUNA 5CCEA 2QLLA 1WO8A 3QSGA 4HADA 1X92A 3BXXA 5BSHA 3PLAE 2F90A 5LZ7A 3VC7A 1R9NA 5D00A 3MSCA 3NETA 2O0KA 4XQ0A 1H42A 3NHLA 1KY2A 2VAMA 1B16A 4DSAA 1OZHA 2X0DA 5M29A 3IVGA 4WSOA 4BVEA 4QUEA 4LWOA 2ADOA 4M0EA 4B73A 4M88A 1FX0A 4A6PA 4OLBA 4ND8A 1R9MA 3D31A 1TAQA 2QN1A 3O2QB 1IY1A 2PGIA 1HI9A 4OHCA 1KXJA 2EDAA 5JANA 1TEVA 3A6PC 1QV9A 2J4CA 1YNOA 3M6IA 1P0FA 1YQ9A 4NFYA 5B5SA 2XMDA 1SVLA 2N46A 2VPYA 4TMVA 1VPTA 5I9BA 3T41A 2PXHA 3RGWS 3RODA 1CSEE 2A59A 9ABPA 4UTNA 1Y5MA 3ZGOA 2QIPA 3SJCA 4M8LA 4NNOA 3BT7A 3RC8A 2IYRA 1ONBA 3E18A 3AEKA 2B92A 3N6RA 2HWXA 4DT1B 1BDJA 3RTBA 3D2AA 3L84A 2C4TA 4GKKB 1ZH4A 1YZUA 5D7NA 4ZHQB 5AM0A 2X2OA 5B1SA 3CRNA 2HL6A 4YC7A 3PGVA 3PWTA 5FBVB 1J6UA 5JALA 2ZCJA 1U9JA 4BB6A 3E7DA 2NXEA 4KHPB 2RMKA 2LTAA 4JI7B 2E4WA 2WVAA 4FD2A 1PFUA 1RR6A 2C7OA 4HRYA 5EZYF 5KJ1A 3L01A 1RPJA 1ZIYA 1R3DA 3QE9Y 2VCYA 5HKBA 4P7GA 3FPFA 3ELDA 2BTQA 3L2OB 2OGWA 4U9UA 4UBJA 3BE6A 3W6PA 1O4VA 2QDXA 3AP2A 3GFVA 4C5BA 3ZGZA 1AXRA 1BKSB 4TSFA 3AO0B 5JSUA 3ZCPA 5MDHA 4RPJA 2BAGA 4S1VA 5H4GA 1QANA 2AQ8A 3HZZA 4NOKA 1Z3CA 4NCBA 1LI7A 4CQMD 4BP8A 4EB3A 3SVZA 5CA1F 1OLUB 2OORC 3L0IB 1U2DA 3WLLA 3U39A 2Y1KA 3EVBA 1Y42X 1OWMA 3RAPR 1RIFA 3WKCA 3NEAA 3BJIC 1OC4A 4WXMA 2NUAB 1I8TA 2D2IA 2CMKA 1XQ1A 3RROA 3TM4A 2Y0DA 3GVCA 2IDKA 4RMIA 1K4MA 1SUEA 1G6Q1 2AJ8A 2ZIXB 2IYTA 2NZVG 2OT3B 4BO5A 3R7SA 2EXXA 1WMSA 5AOVA 5EMKA 3ZJVA 2ETVA 5EE0A 5ADVA 2HHCA 2AWNA 2JLWA 2IHBA 4WI1A 1U7DA 3ZKAA 4X1KB 4PSAA 5JLAA 3T1OA 4YV2A 2VDLB 4XFJA 5JE8A 2H48A 3MCVA 4DHWA 1FP4A 1MX9A 2D7CA 2FOIA 1XA3A 2FXVA 1JLRA 4KLZA 2VPXA 4CR7A 5BPHA 5JTTA 4TN1A 1PHRA 4HS4A 3NP7A 4DXDA 4DDMA 2GQ0A 2IIQA 4G5RA 5JG7A 5AT1A 2QZJA 1CHNA 4W9MC 3DMRA 3F46A 4ZVKA 4CKBB 4JDPA 1XWIA 4NYMQ 3NTQA 2VYVD 4H31A 1G21A 2FW9A 1NSYA 1EVLA 1FP4B 3PSHA 3GK3A 4DMKA 3VZSA 2JGRA 3UAXA 4FDMA 4QWWA 3N7UA 1RRCA 2R1UA 3DC2A 4YPFA 5AI6A 4Q7MB 2F3UA 3WJ1A 2AEJA 1MV8A 1T25A 2B1IA 3TF5A 3RARA 4DUGD 2AMLA 3G1WA 5CEFA 4B8ZA 1U63A 2OQ2A 3H5RA 1IBSA 2EYUA 2VBFA 3FUVA 4XIJA 3QKSB 5JC8A 2NUAA 3CVWA 4R7GA 2ADFA 1KR2A 4AJJA 3AQ4A 3WWDA 3PGMA 8AT1A 4CM8A 5BUQA 1YL6A 4FR5A 4HSGA 2RGXA 2W4IA 5CT6A 1K68A 3HCFA 1QS0B 5KAMA 1U7WA 1Q6ZA 5AI9A 3L0BA 3J81k 1V1RA 1JFSA 3PQ7A 5DI3B 1K63A 1Z2NX 3R09A 1TTHA 1L4UA 3U37A 1GZHB 3IIJA 3KZOA 4DV6B 5DSXA 5FR1A 1GQRA 3N76A 4GMHA 3LNCA 1WCV1 4L7QA 4L2IA 1ZIXA 2WRZA 1HZZA 2WHQA 2X23A 3AHCA 3GJTA 4GX1A 4MV8A 4RKFA 4Y9RA 3T3DA 1CERA 1LBQA 4AKTA 4MRRA 1EVJA 4UE3S 1Q2XA 2HCJB 4RSMA 4YRCA 4YQFA 3I2GA 3NHYA 4FLEA 4RY8A 3R7WA 3A6HA 1U0GA 3K09A 3KYCB 4FBLA 4FS8A 5HTOA 1KMCA 2CVHA 4I8DA 1WD7A 2GN1A 4AJ2A 2PT5A 2W2MA 3WK9A 1E2NA 2VDNB 3BXFA 1K2VN 4DC0A 3CMMA 4TPKA 4UEJA 5KI6A 5A9RA 3L93A 5K0JA 5FOVA 2RG7A 3ESCA 1KPHA 3LHDA 3LPMA 5EJMA 3SQOA 2GWRA 3ERCA 1TT5B 1C80A 1V8OA 4N8SA 2IS2A 1FNDA 5JQWA 2V7PA 4YMVA 4BYGA 5DMXA 3AKCA 5KDLA 2AG5A 4E5MA 1FEZA 4CMAA 1R0XA 1KEPA 5DCWA 5IKPA 5L7YA 3HDJA 2I2XB 4B87A 3ZC3A 3LLSA 1FQJA 3ELBA 5F77A 1NVWQ 4QUHA 2OYRA 3VPBA 4Z1MD 5HVNA 1ETHA 5A02A 1M2OB 4QRIA 2GM9A 4MKGA 2QTLA 3KFVA 3VDNB 2V6FA 4LJKA 5LQKA 1AKNA 2ATVA 1U0NA 3EZFA 2PUWA 2OLJA 1X42A 1Q0PA 2ZEJA 3IMCA 1JBEA 3M4NA 2DFPA 2DR0A 4FGUA 3QEBZ 2ZCUA 3KFXA 2CLMB 3DE7X 3AXTA 3PT5A 4DG5A 3LQ4A 3P97A 4WCFC 4WZBB 1HLPA 5BMOA 3T7KA 2E4XA 2WIJA 3CEPB 5IJ9B 4JEMA 1PYGA 1Z7YA 2XVXA 4X71A 1N4AA 1E6MA 4MDHA 3INNA 4MVCA 1V41E 4GC5A 5T5QA 1UKCA 2ZVPX 3E9DA 3EXFA 4U0KA 1M67A 3HA5A 1T2FA 5JAZA 1ABFA 3W6UA 1PYDA 2QDKA 5AJYA 2A0WA 2BL4A 2O8CB 1XQWA 2FSPA 4TSRA 1KP2A 5TQ0A 4HF7A 2VRNA 4WZZA 4W5QA 3BUSA 3BMOA 3VTAA 4FN4A 3MSXA 2JJ1D 2E49A 1E1MA 1GNSA 3V4LA 4P9NA 4KREA 2ORVA 2WFLB 3LDHA 3LLCA 4E5SA 3FM9A 4TQ9A 4K9LA 5B6PA 1ZUWA 4MVXA 2REQA 4KIUA 1VJ5A 1KDZA 3UBMA 2I66A 3WL8A 4KGZA 1YL7A 4OF4A 2FJUA 2V58A 2XQVA 3C1OA 1GZ5A 1SKQA 2JC3A 3V1YA 2WF9A 5U1PA 4KHZA 2Q1TA 3GLQA 4M7RA 5BV7A 3LDFA 4Q7LA 4G5QA 2PAAA 1P45A 4W8HA 2HJ9A 2WOJA 2J5BA 1Z0JA 2JIPA 2XA2A 2WW8A 1PHPA 5BN5B 4W99A 1GA6A 1II9A 3C7CB 5KC9A 2BH9A 1KVTA 3KE9A 3P52A 4MR9A 1P1CA 4EJ6A 4EPXA 1TNDA 3K9WA 4PSDA 3BD6A 2ZYHA 3R7DA 4F71A 1XK6A 2ZUUA 2UYHA 1KYTA 1FC0A 1H8HA 4B3MB 1NJ6A 1NIPA 4NFLA 3NHUA 1BWQA 4EHIA 1P62B 5BWMA 4C0HA 2EF1A 3LT1A 1U9YA 1UPAA 2QVLA 3M6UA 4PNEA 3KR0A 3LO8A 3PKZA 5B7QA 1P2SA 1X7WA 2YXBA 4UVDA 4ZAGA 5LMNB 1QKKA 4KV9A 2AJTA 3AJ9A 5CVJA 2NQTA 3L6UA 3KXPA 2DE0X 4B7CA 1C8KA 1E69A 2J30A 5DKFA 4FMDB 2YMPA 4N9QA 5I7RA 2QVGA 1P44A 2K4MA 1ODLA 3B1JA 4W5OA 3VPFA 4PU0A 2C7VA 3TW8B 1CHDA 1PZGA 1T5HX 2EL7A 4JD5A 2ZRJA 4MGZR 3HY6A 3OKCA 3W5VA 1O9HA 2ZBVA 4RFSA 5EXTA 4BVHA 1LNSA 1AV6A 2P9EA 3WYDA 1JWLA 1ZK1A 1ZAYA 4QPJC 2CNWA 4RAQA 3H9BA 2NP6A 2X76A 1JEEA 3HYCA 4RK0A 1CDDA 1ICIA 3K6JA 1KC1A 3PV0A 4MV7A 2MMCA 1FSSA 4PGGA 1E2HA 3CEHA 4YWJA 1ZW1A 1YZQA 3UHOA 1O6FA 2DBRA 1YU9A 3QV2A 3H5NA 3L4KA 1TMGE 5L40A 3FBWA 4FC7A 2A67A 2ZIEA 3S2FA 4KQWA 5KQLA 2XR1A 3ZXYA 4X20B 4QUBA 2HZBA 4DC9A 5F7ZA 5ADUS 3ZJUA 1T9DA 1FNBA 5HMLA 3QI7A 3UOAB 2I6FA 4W1PA 3AUAA 3TBHA 2RGEA 3QMVA 4P98A 2XB9A 1J8YF 1UBTS 4K46A 1YR7A 3KZVA 3Q8XB 3U62A 3TZKA 1KYIA 3PEFA 4B71A 2WWIA 3NHWA 2C1EA 3CRW1 4RK5A 1WUJS 2CT8A 4A36A 4GXTA 3SHVA 3KYBA 3VR0A 5KNDD 1Y1TA 2ZRLA 4QICA 2G5CA 4R3UC 4XD2A 5FIUA 1SC6A 4B8YA 1SHKA 5JZBA 3WP0A 1WKBA 4YDHB 2D3TA 3RFCA 9ATCA 1NKSA 4JP2A 1AKMA 2CVPA 4DSOA 4ZRNA 3BS4A 2ONJA 3RYHA 5BT9A 3BTSA 3R3YA 3NBXX 4TZKA 5F4ZA 3H9EO 3T9FA 2IXBA 1TGVA 3CN7A 1WUTA 2QB5A 4M1SA 4RETA 1T9AA 1TUBA 2HRCA 2ZBRA 2IXAA 3CH7A 4C2BA 4C88A 5CFRA 3PB3A 2XUHA 3L4EA 1ODKA 2WP0A 4TVOA 2OXTA 3C14C 2GMWA 4DY4A 1KJQA 2PSFA 3GRCA 6PFKA 2R0QC 3JSXA 5EUBA 1JDUA 5ITZB 3C5CA 3A6JA 4W8GA 5HQTA 1WB5A 4AM8A 3ZLUA 4DA8A 4JKOA 1T3SA 3UA4A 3SIXA 3MT7A 2BGNA 4RDIA 3T1QA 4RSGA 4CTKA 2KMLA 1JYFA 5BV0A 4N5NA 4N5DA 5G4KA 1NL3A 4DR1B 4AZ3B 4DV3B 3Q8LA 2OXEA 1RQXA 4B3HA 4JYPA 1L2TA 3MEQA 3RASA 3TLAA 4E3WA 2XUFA 4OMDA 2ZTLA 2WM3A 2X6TA 4MI9A 1D03A 2OB1A 4PXSA 3FNEA 1U1GA 2VQ6A 4AJ9A 3AIOA 1EK5A 3EVEA 4AK9A 1QPZA 4LF9B 5AJZA 1CS0B 2B8JA 3ZDFA 1NONA 4KR0A 4Z7QB 1ZOLA 2P2SA 3WIEA 1FY2A 3IUJA 1JL3A 5BSGA 2AR7A 3E70C 2HA7A 2M32A 3KEMA 3D9QX 1R66A 4O3FA 1C81A 1QIKA 2X5OA 4Q4HB 5B1IA 1ZU5A 3U3XA 5JAMA 5MFZA 3RLFA 2HN9A 1K97A 1TU4A 4I9UA 4KDFA 5ECYA 3MJEA 2AF4C 1LQUA 1ESNA 4G0UA 2P2CA 1RRGA 1BOOA 4GU5A 3R8FA 5FYQA 4N9WA 1H66A 5ER9A 3HUFA 1KPGA 4O1MA 1VLZA 4IDNA 5LP6C 2JFPA 1GDDA 4RPIA 5J1SB 1XZMA 1YZ3A 3FVVA 4GVLA 1H2ZA 2VJQA 2F48A 2QAIA 2ZREA 4I4CA 3I9FA 5K0CA 2D2EA 3C6KA 3DZGA 3K6RA 1GHTA 2OCDA 1YIAA 2VK8A 3IIMA 4UQOA 2HCRA 5BOVA 4I3HA 4XLLA 2XYQA 3GUYA 3U26A 3E61A 2G7MC 1OE0A 4P3PA 1RI5A 1IZZA 2HNKA 3A0RB 1QQTA 3HS3A 3ZX4A 1RRVA 3L6CA 4KWIA 1P74A 5EPOA 5DTMA 4TMWA 1KXZA 2G70A 1USIA 1H2XA 1Z4JA 3GPBA 3S7ZA 3ND9A 2IP2A 1JHYA 1K06A 4K6KA 3D5TA 3TLGA 1FS4A 4JVOA 4JC4A 5JVDA 5ALQA 5EA2A 4NL4H 2ID4A 4U7TB 1TJPB 5F3DA 1NW6A 3I9JA 3K05A 1DKQA 5KTMA 4D9KA 2NTYC 3TFOA 1PV1A 3JARA 5IVKA 1B0AA 5JRZA 1B4DA 1N8NA 1NXWA 2P0EA 3KUUA 4TLDA 2ODEA 3OOYA 5DTJA 1GKLA 2WI8A 4A2PA 2QU8A 4C22A 4LSMA 1JZQA 1M1YE 4B6QA 1PF7E 4N7RA 4OQQA 3ZK8A 2RHLA 1CW2B 3OA2A 4JI1B 1RJEA 4L75A 3KVRA 2HCTA 1UFVA 2PQ6A 2ZIWB 4ZI7B 1TVMA 3EEFA 1UMBB 2KS6A 3BIJA 3EAQA 4MLCA 3TLXA 4BVKA 3FVRA 3NEJA 1FBNA 3A4MA 4Z1MA 3VNVA 3SK0A 1EHYA 3ZTTA 3SDSA 2ZDQA 1MENA 2YQZA 3PNKA 3CZ5A 2ZXFA 4O3MA 1E1CB 1T8WA 3HJHA 1Z0SA 4G25A 4IOKA 3B7WA 3RBZA 2RB5A 2V3CC 1E1QD 1BWRA 4QVGA 2F00A 3B2EA 4F93B 3TSAA 3F9IA 5C32A 2RGBA 3PLRA 1EQUA 1T4BA 2EJVA 2IIPA 3A9WA 4UHKA 2Z6QA 5CFLA 3ZGLA 3O83A 3ZCTA 3QEOA 1CVRA 5DEIA 4S1WA 2ASVA 1JG3A 3LCMA 4WZAB 3RJMA 3OZSA 1DCTA 1JUDA 3ENZA 2XUAA 4ESEA 3PP8A 2F8SA 4TT3D 3KKMA 1TU3A 3EN0A 4ETIA 1JHZA 5FFFA 1ESEA 1UM9B 2YNMD 2FJPA 4YQYA 5C51B 3ORRA 4ZHQF 5KYUA 2XSZA 4FYJA 1S8NA 2DFVA 2G9QA 1E3SA 1EXNA 1P1JA 2PRSA 3B6KA 1ZCJA 5DX0A 1Y5IA 5GJBA 1NF9A 1U1CA 1Z6QA 4Z4GA 2XZPA 3KYDB 4J7AA 3W3ZB 3R1IA 1Y5LA 4WLFA 3MTIA 3P9IA 3OMLA 4IUYA 1JVSA 4S35A 5EGNA 5BW8A 5JSHA 1AKUA 5EZYB 1N0WA 5KPDA 1XZQA 4K5QA 1A9ZA 1UEIA 1GUZA 4XDGA 2ZUWA 3FOAA 4HRXA 1WCWA 1XZDA 4BLUA 5BN3B 4JLOA 4BXOA 3BIFA 2G17A 1KMHB 3BTUA 3UC5A 1OLXB 4UKDA 5IAOA 3C48A 1QP0A 1E2GA 4B6JA 4OK3A 1UQUA 2YY7A 2O2SA 2FR1A 4YRGA 4NEGA 2Y2UA 2A84A 3IOCA 1HORA 4DV7B 5LBIA 3H5AA 3WRXA 3KJHA 5C1PA 4LF7B 4DUGA 3BMXA 2XQJA 1XB2A 3B53X 3PU6A 5CA1B 3VO8A 3ZD6A 1JW9B 4WNAA 3GFOA 1BHSA 3PDIA 3VC3A 1RD4A 1LI5A 3VPXA 3K0CC 4OHXA 4LNUA 1J33A 1KZ7B 3DLAA 3ZX5A 5BUCA 2BKLA 1VE9A 1YJCA 3B5EA 4PS1A 3V2GA 5CURA 1E0DA 2JAOA 4TTSA 1TPZA 2HQBA 1GNTA 3OPNA 4HAYA 3ZHBA 3F6BX 2B2XA 3TN7A 1EIWA 1OF1A 1U0JA 3OHSX 1CJVC 2CKMA 4C9BA 5JNVA 2IVZA 1OQAA 3M89A 4JBLA 5ALEA 2E87A 1HLDA 2PGNA 2NXCA 5CLLA 3ZU6A 2FZVA 3CLUC 3IAS6 4E94A 2HF7A 1H4SA 4BJ6A 2R85A 1AN0A 2QJWA 4IIGA 2GM4A 1DTEA 4I4TB 5EIBC 2ZI5A 1XU9A 4UAGA 3H9JA 1XP5A 3DVLA 2ZR9A 4FQ7A 2DBQA 1W88B 3RVLA 2GHTA 2P77A 3FFBA 5AKGA 3H04A 1E7RA 3P9YA 4WZAA 2Q0HA 1NDHA 4L50A 3GH1A 2V0CA 1GNRA 2FWPA 1JR3D 3DWGA 4FDUA 4BLTA 4CIDA 5JWRA 2QIOA 2JLUA 5H3CA 1AMUA 1SVWA 2QD4A 1KSJA 2HH9A 1G38A 1FFHA 2GT1A 4PS0A 4A0GA 5T6MA 4L3WA 2GDJA 1RHMA 1WCIB 2Q6TA 4IDDA 1GCIA 1Z4IA 3NIFB 3P27A 1L7QA 3OLQA 3J81A 2VAWA 4JYZA 4DQDA 5TIIA 1DQNA 1FSFA 1GL9B 3E22B 1LJ8A 1N3BA 3B3GA 3GJ4A 3PZRA 2FPLA 4BKOA 2ZBFA 5DI9A 5DYYA 2DTEA 5TS3A 2GZAA 1VE6A 3KJGA 5TEWA 2ZTSA 1HH4A 2AS0A 1KMQA 2DR2A 2EOAA 2ODQA 1QFZA 1VKOA 1ESCA 2FKAA 3I2JA 3KAPA 4QJBA 3FAZA 3L8GA 4XIIA 3QG5A 4KO4S 4YPVA 1X1QA 1QVRA 4JXJA 4PTYA 4Z3DA 5HRAA 4X7BA 3S2YA 1Q50A 2PSDA 2AQIA 4UNSA 4ANFA 1TRKA 2A1TR 3GJXC 5JRDS 2XD9A 3TQRA 3V6MA 1E5XA 4EHJA 4MIEA 3S2IA 1CKEA 3QXCA 3ZWKA 3SICE 2ACEA 4QSHA 3WOVA 1CP3A 2BEKA 3W78A 1P1HA 1KEKA 3MHPA 3OQ1A 4ZA2A 3IDOA 2XMGA 3BD7A 1RMTA 3IJ5A 3WWYA 4IIJB 4UM8B 1A7UA 2X0EA 3HEMA 1ORTA 2HSWA 4I66A 4ZYWA 3JAKB 4IWXA 2BKVA 1DAMA 3GCXA 1K7FB 2HBQA 2OFOA 5IRCD 2J7PA 4L72A 3F5MA 1XP8A 3AI7A 4RJIA 2JAXA 1COWA 2W70A 3SBXA 1PL0A 1QXSA 2HJRA 2VDQB 1KFJB 4V0RA 4GPZA 1J2RA 2EQAA 4MNTA 3WO1A 4MWBA 4NYJQ 4PAOA 3TZEA 4AIRA 2RBEA 3CUUA 8ADHA 3I9LA 1IUKA 4HO1X 1YQUA 7YASA 3VSAA 5BN4B 4YBZA 3VDMA 4HNGA 1JAHA 2Q5LA 1T0HB 2BELA 1U2TA 1JG4A 4I1SA 1HG0A 1XJCA 4Q9JA 4EI9A 3W3AA 5HF5A 1BVUA 1L6IA 1TK3A 5J40A 4D3XA 2FPGA 2JD2A 5GQSA 4M99A 3TRHA 2PH1A 3S2GA 1P8JA 4JYBA 4X3PA 1PTJA 2GUWA 1A7KA 1VG1A 1XELA 3HWX1 3KKKA 1G4HA 2N3ZA 2G3YA 1VLLA 2PSHA 4JITA 1MJHA 4OCZA 3T3HA 2GN6A 4B9EA 2QG4A 4F4HA 4RM3A 4J76A 4IF4A 2QN8A 4TLEA 4TOIA 1B1CA 1QZXA 3V48A 4DKJA 3L0YA 2WHXA 4YJFB 1HNWB 5DT9A 4EX6A 3O26A 2AYXA 2VHEA 3GGDA 5GP1A 1ZI8A 3T9EA 2P30A 3AB3A 4AUMA 2JVKA 5B36A 3OETA 1O8BA 1ZHOA 4XASA 2IC5A 4XFKA 3U1BA 1LPMA 1MR3F 2EKZA 2DFLA 3NBKA 3NUZA 3DTNA 5A2QA 2MSWA 4YECA 5THXA 3F9RA 1FTGA 1GIAA 1GY8A 4LJ7A 2AK3A 3RUDA 1XRQA 1YV9A 3F6SA 3UMJA 2WWGA 4BRWA 4XM1A 3PGJA 4NI5A 2GRUA 2PX4A 4K6GA 2HHAA 4FFNA 1NBMA 5BORA 1HYQA 2NU7A 2PZGA 3BSWA 3A9UA 4EELA 4NBUA 1URPA 2CXTA 2GARA 2XZTA 3H1EA 5HBRA 4PC3A 3QE4A 3PC7A 4IV5A 5AVTA 2WE7A 1YB4A 2PS3A 3E9NA 5HUHA 5B37A 5MGBA 3WMWA 4HDSA 1PSZA 1WUKS 1W4CA 5TPZD 1TYDE 1XTPA 4W4TA 5BW4A 1P0PA 4K9DA 1IMJA 3HZOA 1T1SA 3MBKA 4CTJA 1E2BA 4A2QA 5CCBA 1MGOA 2JIDA 2Q2QA 1QFJA 4RPLA 2Q0QA 5KKAA 1XVVA 1H0SA 2FW0A 1QLJA 1VSBA 4FINA 4ZVOA 3UTCA 4LVCA 4B5KA 3KZNA 5KYYB 1DEKA 3I5MA 2LZ0A 4GE0A 1IN1A 4U00A 4EKYA 1D07A 1DV2A 3OF3A 4EMBA 4KMMA 3TZBA 5EJ8A 3FYCA 1G59A 4WY2A 1ZCAA 1WMAA 1LPAB 3LX4A 3IRVA 3QWHA 3TTUA 2W93A 2G83A 3BB3A 4D8WA 1KH2A 2AXNA 3P71T 4UVIA 3WNDA 4H60A 1TMKA 4BKQA 1VGQA 1E1KA 1Q7RA 3HR8A 1FYFA 3QU7A 1QO7A 1GM5A 4BN4A 1T8YA 5L6LB 2YVKA 1S4MA 2RHGB 4JGIA 2Q5JA 2FPIB 3K6KA 4ZGGA 2OV4A 3RSGA 4WAUA 1NQ5A 1HTBA 1OBVA 3KR9A 4E2WA 2VKTA 4BX2A 1TZMA 2MOKA 4RFLA 4D25A 3I9V1 4YMTA 4HDMB 5DNCA 2IXGA 3ZHZA 1AT1A 4DJJA 4QSMA 3IVCA 4EKNB 2RCYA 4YAOA 4U7DA 1Y1RA 1T1IA 4REQA 4PLGA 3VU8A 4UFNA 1W4ZA 1CT9A 1Y1KE 1IXSB 1OA0A 1P2FA 2BZ0A 4G2NA 4JIMA 1XMQB 1YS2X 1BS1A 1P31A 3CWZA 2YZMA 4GSKA 2YV3A 3P9QA 1DRJA 2AL7A 3SZGA 5CIQA 2ZYVX 2GO1A 1GPJA 5H70A 2JZOA 2RG1A 1X8KA 1YD7A 3LU1A 3UT5B 4RVFA 1NDQA 2WNIA 2YJ4A 4DZZA 5JUWA 4E31A 3PC8C 2E4ZA 2NXJA 2RKOA 1PS8A 1L5ZA 2CDAA 2XE7A 4XE5A 5TSDA 2H1OA 4P0PB 3KPYA 5IEJA 2JA2A 3GLHA 2GVNA 2PR7A 3ND7A 4JYMA 4PZYA 1X13A 3DMNA 4IQ0A 4BO9A 1D5CA 4BRUA 4A5OA 2GAJA 5F23A 5DBEX 1Q84A 1HDZA 1NNEA 4A9AA 4J7UA 1G8MA 1U0SY 4NU0A 1YDGA 3NHFA 4R71A 1DTSA 3SXPA 5EZ6B 5A0VA 4J0FA 3ONNA 5F7JA 1FZQA 3RV3A 4FEEA 4J49A 2HC9A 4ZZ3A 4JUIA 3W5CA 1LNQA 1ENZA 2C99A 1BRTA 1I7PA 2WTMA 5DP2A 3EW7A 3RJ9A 2VP5A 5JH7F 2IEYA 3RTAA 1WJGA 4HNAA 3STVA 3IV9A 2HU5A 3UJ6A 5C1DA 2GEJA 1H6AA 4IW3B 3S40A 4M0KA 5B4UA 4TRNA 1Y1QA 2D13A 1FFXA 1W87A 2VPQA 3QE2A 3I4CA 4R2JA 3BOSA 4PGAA 4U6QA 3F4KA 3FJ1A 5ALYA 5AVKA 3QF7A 4BGDA 1I3NA 1EUCB 1Y3HA 2RBKA 3JQ8A 3KL2A 1JHPA 3KOYA 3WA7A 1IYZA 2FPPA 4R2XA 1VRWA 3HFGA 3QEAZ 1GTJ1 2FPKA 2Q6VA 1VECA 1FXUA 1MN6A 1Z5PA 3RYTC 1WR8A 3WGYA 4JLDA 5ESDA 2ONZA 2VH1A 5EVCA 1TC1A 1JTFA 2ZROA 2H1IA 4ZEVA 5A3QA 5IASA 2IUUA 1N3IA 2VP9A 4GPEA 3I3OA 3AG6A 3EGCA 1FFXB 5DCUA 1GN9A 2DT8A 4Z0PA 5B64A 4X54A 4BFLA 3O8OA 1FYEA 2PZBA 1COZA 1KRXA 4QOEA 4ZHSA 4X92A 3HEBA 3SBDA 4KFRA 1P7PA 2WV7A 2Y1GA 1N0UA 3UV7A 1FDOA 1GYPA 1D7AA 1HQDA 1NAHA 2HMSA 2XIJA 1I2ZA 1Y9JA 3B12A 3IMGA 4ESOA 5J4KA 3KKEA 5AW2A 1CEYA 2SKEA 1LPOA 1NV9A 2H07A 3OE7A 5K4HA 2QN7A 1FXWF 4N49A 1DL5A 3V1NA 4KIJA 1XLTA 4I6EA 2Q7XA 3BMNB 2L42A 2G9VA 4IDBA 5CX1B 5TEVA 5TS2A 3ROTA 1SN7A 2DKFA 4H0CA 2XODA 5IAKA 3N2GB 4UJ5A 5D8DA 1BRMA 4ABTA 3C43A 1P3DA 2IPMA 2IU6A 4PNPA 4R41A 3T4EA 1YHNA 3G9XA 1NLYA 3ZWOA 4BN0A 1C4KA 2BMWA 4Y1FA 2FVXA 1FMJA 3RF7A 1XTKA 1QOQB 4CLDA 4UATA 5JDIA 1KEEA 3DLHA 1KRHA 3LGXA 4Q37A 4BQSA 4EGQA 4LECA 3FOFC 4ON9A 3Q41A 3WSWA 1DTWB 4B2PA 2A0YA 3MWYW 3FSJX 4G0VA 5A03A 5AW0A 1UKZA 3W5HA 1W85A 1KFEB 5IXYA 1ULZA 4RH0A 3AUFA 3QELB 1EDDA 3CT4A 3A4YA 3WRVA 5DYWA 2JFUA 2FSUA 3CUSA 3ITNA 5FPSA 2R68A 2NUTA 3S8EA 1RC8A 1KJYA 4C3ZA 1HRDA 4LCBA 3V7NA 3OD1A 5FV7A 1NVTA 3CW2A 5DHQA 2ZU6A 4EVIA 2PZLA 1Y37A 5AW7A 3T0FA 1YMUA 1UP6A 3NHBA 5BT8A 4H4CA 4UEQA 4RK1A 2D06A 4Y2UA 5DM60 1X1TA 4NQRA 4ZU6X 1ULBA 4GOND 1VFPA 1XZNA 3F6RA 4OLAA 2CKDA 2AUNA 1ZM9A 2WU3A 3BGSA 4P4LA 3UG7A 3ZCXA 2DBYA 5BUSA 4XWKA 1ZRSA 2HPHA 4C2UA 3BQMB 1E4EA 5HQJA 4UE2A 1WBJB 1X39A 4QJIA 3O3NB 4PZCA 3I4FA 2II6A 4JNKA 4DV5B 4BX3A 2J3EA 4HWGA 2GYVA 2OTCA 1LBSA 2FQWA 3NYRA 4EZIA 3OC6A 1US8B 1MT3A 4QXRA 3ZZMA 1NNSA 1OVMA 1I5EA 1NJSA 2CXNA 3WGIA 4NFSA 3RSZA 1R8JA 3OO0A 4F92B 2JH9A 3HCWA 1SOMA 2P2LA 3EY4A 4R16A 2V7WA 3L7NA 4UZFA 4LXTA 2CC2A 3Q0EA 4D0LB 3I9OA 5H1YA 3VNAA 1E7SA 2WSSA 1YBHA 4BN5A 3R0QA 3EY9A 1NULA 1PQUA 3O4RA 1P1KA 4IIYA 5EJGA 1OIXA 3D7KA 4PRLA 4RO0A 4XX1A 1IHOA 5TR9A 5KX5B 1TZKA 1MAVA 4RSHA 1R4NA 2BP7B 4B83A 2XIQA 3KM0A 3QP9A 5ADWA 2R62A 3TG8A 3ANXA 2EKQA 3CB2A 3KQUA 3EHEA 2F4NA 3CHYA 2BDUA 3ZV4A 1PL8A 4YMWA 3OIWA 4X41A 3FGZA 3QW4B 3TCXB 3O0TA 3BL5A 3EYWA 2XOEA 1AV7A 1MX1A 2JANA 4BNKA 3GG2A 3PR3A 1XF9A 1GTSA 1W52X 2VJMA 2H7YA 1JA1A 2W2QA 2BGWA 3AUXA 3FPKA 3I1JA 4PXAA 4TM7A 3HK2A 1WVIA 3X44A 2B99A 1FA9A 1GTG1 3KKOA 4WKPA 4OI2A 2RKWA 2ZZMA 2FPOA 2NO0A 5DULA 3IOEA 1ZGAA 2R5NA 3BVPA 2BZSA 3NHZA 3QKSA 3TQIA 2IH2A 4TT3A 1X7GA 4JLVA 4TYMA 3FPJA 5H4HA 4JKYA 3RC3A 5K0EA 1TECE 2IYFA 1TL7C 4EDFA 2Z4RA 3DMTA 3UK0A 4C4RA 1DJMA 3JSAA 4RF2A 4L4RA 3FWHA 4BOYA 3UOGA 3M4JA 1X15A 1THZA 1Q74A 4F2WA 4NTZA 2GNOA 3ZZ0A 4UEWA 2QT9A 3AHFA 1BJTA 2PBLA 4GE3A 3D3WA 3PJFA 3W5UA 4KK3A 3DMFA 1CCWA 1IZ9A 4XSVA 5AK0A 3H2GA 5J9FA 4BFVA 4CM7A 3I8SA 4YV7A 1ZJWA 5CHEA 4OA5A 1A0OA 5M34A 4OI0A 4CTOA 1LWNA 1QSGA 1Y9DA 3KBOA 5ARCA 3I32A 5A3RA 4RTPA 5TNXA 3ZVNA 2VF5X 3HFJA 2A5LA 4LOJA 4O4HF 3DYBA 2R65A 4JC5A 3S55A 2BISA 3EXAA 1NVXQ 4EX7A 1N0VC 5AJTA 2C2BA 4HS9A 1BCRA 3MC1A 1YS6A 3MGKA 2QAGC 2CE7A 5DNDA 2Y0CA 4K05A 4HNQA 4CEIB 4FLMA 1BE1A 1C0PA 2BM0A 3IALA 2G80A 3M0EA 4A8TA 1E89A 1RJFA 2L0XA 2P6MA 2W8ZA 4A0HA 3CEAA 1JFLA 3ZQUA 3BGOS 3IESA 1AXEA 4WBNA 1AUOA 3GCWA 1PJCA 1GTL1 4M1EA 4S0ZA 8ABPA 3IURA 2F55A 4WMLA 1T10A 3NG1A 1UZLA 3NC1C 1E8NA 4LDQA 4G85A 1X8LA 3IVXA 1RM5A 1YC2A 3JD1A 4Q3EA 4RVUA 3GD7A 1DI0A 4U9IS 5CPFA 5BSEA 5C8YF 5CDUA 2VYVA 3WAKA 2FSVA 1CIVA 3TKAA 4EZEA 2VAXA 2C5BA 1YRAA 4ALKA 2ZM6B 4XIFA 5LOVF 5EIAA 1GTRA 5IDYA 1K3UB 1BYUA 1DQSA 3Q72A 1YFLA 1Q21A 4RD0A 1H85A 3OZBA 4LJAA 1ORIA 2FTKE 2Z5VA 4N39A 4C6TB 2A9VA 4CDRA 2BCJQ 3HKCA 1KETA 1LLQA 2IEIA 1DOAA 4UAUA 2G5TA 1FNMA 4NXMB 3TOZA 3VZCA 3EXHC 3E05A 4QQRA 4YAKA 4KLRA 3GLHE 5HZMA 3H8VA 3WKBA 5JCZA 3QBVA 3O47A 5ITZA 3DULA 1RLIA 1CUJA 1RQPA 4ARCA 4YRNA 4LRXA 4I4TA 1JLMA 1R6UA 4YCLA 1EINA 3CKMA 3TNDA 1UP7A 1K7YA 1K98A 1OPRA 1PUJA 3HM2A 3QPBA 4AJHA 3DT8A 2E6UX 2PD3A 1DKMA 2IHVA 3U61B 3QBJA 3AYZB 2WVHA 2DBZA 4WXHA 3SBOA 2G07A 3Q87B 4DR4B 2AZTA 4DIEA 1HK7A 3DOHA 4NMHA 5B53A 4Q4LA 4E07A 1A9QA 1GN8A 2WU4A 3GEGA 3IERA 2WWVD 1OTXA 1LU9A 4YCDA 3IBFA 4OX9Y 1M2GA 1PGJA 2ZWVA 4XIGS 1N5KA 4BO2A 1Z0AA 3LBHA 3OBBA 1O7JA 4ZQEA 1I7NA 1WXHA 1X9GA 3M6LA 4P7FA 1A5AB 2NTVA 7ABPA 2P4UA 1PWHA 2FMHA 2AZDA 4NMLA 3HRHA 4WEQA 4YJ2B 2VT3A 3EODA 3PD7A 4GD3Q 1G0OA 2YVAA 2AX3A 3GDWA 4JY7A 4L6IA 1GUFA 2VDJA 3K9GA 3DFZA 3COWA 3ZQKA 2P6UA 3ESQA 1CVIA 3F6YA 1Y6JA 1ANKA 4BJ3A 5BNTA 2DETA 3I9V6 1I0LA 3TPFA 3H3JA 1EWKA 1S2OA 2JCBA 1GEEA 2BDEA 3IVRA 5GZ6A 2GM3A 3UJ3X 3U7QA 3VU9B 5KYWB 3ZS8A 3SI7A 3EFOB 3ZEAA 4QEZA 4NBTA 2DULA 4R1UA 4WXRA 4EJ0A 1MQSA 1QCDA 2FNAA 3EC1A 3JQQA 2C2OA 4HQFA 3I04A 3OQJA 3DTVD 2YWDA 3LCJA 4XVRA 3IE1A 5IWCA 4BFCA 1LX6A 4YYZA 3KE8A 4JL5A 1SZCA 4U6SA 3ND6A 4FE3A 4YMGA 3FDIA 3MUFA 1JGTA 1SCNE 2ETXA 2P9CA 4PHTA 2P9GA 2ZYTX 4F8EA 1RC1A 4IJUA 1QU3A 4NYIQ 1AG9A 1KARA 3KVOA 1A1SA 3Q2IA 1FIUA 4ND7A 3JQ9A 3KFLA 1JXOA 4K3UA 1ZUD1 1Z36A 2ZB8A 3A9SA 2BKEA 4MS4A 3VA7A 4WFJA 5A05A 3UCFA 3PTZA 3C1UA 1F48A 1NUSA 2IUYA 1G18A 2P2DA 4JU8A 4QDXA 4NDAA 1JFVA 4E11A 3L0ZA 4MJ7A 1UOPA 2FLKA 2FX2A 1GADO 1QDLB 2CF5A 1PJ8A 2QTMA 5EC8A 4MYCA 3R0IA 3Q7EA 4ARUA 1OTYA 1YJXA 1IEQA 1F4PA 2XTJA 4DJTA 1UWLA 3PKIA 1QIEA 1I2DA 2JI6A 3CE9A 3QPDA 1QBKC 4NRDA 5IM4A 4JLAA 5IT4A 3SIWA 5HKAA 3CQ9A 2ORYA 3HSYA 5CVVA 2R8EA 1R27A 3MOGA 3HCBA 1DARA 1JKXA 2QX4A 3PUKA 4U2DA 3ZCUA 1PW5A 5DBHX 4LOAA 3ILVA 4FN5A 5A06A 2WFLA 2CEAA 2VAVA 4FONA 3B5JA 3IBSA 3QOFA 5F9HA 3TD9A 1ULAA 1XMJA 4Q1BA 1N6RA 3UPUA 4Z5XA 1KKLA 3RIEA 5L8VA 3CTPA 1NN5A 5DM0A 1PJSA 1M6YA 1Q2UA 1KI6A 1MB3A 1RJ9B 2FK8A 2I1QA 2I55A 1BNCA 3HYSA 2B98A 3HBLA 3OE4A 3NVKI 1V95A 3KQYA 3OSUA 2XUIA 1JKFA 2WWXA 3Q7TA 1QKJA 3VHXB 4KR3A 5EMLA 2ZANA 3QOYA 3KKLA 2LVBA 2OCKA 2E4UA 1UUFA 2B3DA 1OWLA 2YIMA 4HZUB 3B8HA 1OOEA 1BX1A 5ENVA 2PD4A 3D8SA 3QIVA 4B7ZA 2YFQA 1XDSA 2AD1A 1JHQA 4CHTA 4IIDA 4HTFB 3RTGA 4U7GA 2FUEA 1F6BA 1N6IA 2P9FA 3D0QA 3F98A 3MBIA 2HUPA 3QK7A 3NT4A 4Q19A 4YXFA 5B1EA 4RA6A 1PJRA 3ITDA 3UK2A 3VZRA 4RHUA 3FJOA 3ZNNA 5HWSA 1G1AA 4KO8A 3K0HA 1A8QA 3T3EA 4PLWA 3VAAA 1S8FA 1L3BA 4HGPA 5ERYA 3UANA 3MWDA 1Q0ZA 2BBSA 3O38A 5T4HA 3Q8WA 1BH6A 3WGHA 1C9YA 1PR5A 5HX7A 5UKDA 4EFLA 1IB0A 1TYEB 4PGHA 4Z9AA 2WD7A 4ZGWA 4YRBA 1VCHA 5AI8A 3D2LA 2PVCA 4FFPA 4ZANA 2YJGA 5SYNA 5FUWA 2ODWA 1WZCA 1TQ8A 4G81A 5HFJA 5ULLA 1E79A 1K5HA 1FU8A 2PR2A 3DL0A 3A14A 2PL3A 1QYVA 3PPYA 2VSFA 3JV7A 4GOJA 4QU0A 1EPUA 3B20A 1SHJA 1KDVA 3S5JA 4CFZA 1V5EA 1DC4A 4DNPA 5C35A 5BRNA 1KQ3A 1QG2A 2BI4A 3UJPA 4TRMA 1GGJA 1WNTA 3INRA 4XUDA 5BQFA 2MSDB 3RIGA 3DEHA 5JD4A 5C31A 2QX9A 4JVNA 4LY0A 1D3AA 2ATXA 3AUKA 3IEKA 3LTEA 5HMMA 1FS5A 2Q45A 4RTMA 1GFZA 4TWBA 3GJZA 4EYQA 1JI0A 4RS3A 3MGCA 4XQCA 3V2HA 1LX7A 3CVXA 2HA0A 3TLJA 4DCUA 2YXNA 2ZJYA 2ZJAA 4NCXA 3HPQA 2WAMA 3KQQA 2IW1A 1XVAA 3I05A 3GLVA 2N42A 3NM6B 2HV9A 3VPHA 3UWOA 4PYMA 3PYMA 3QFFA 5LQSA 4L4UA 3AB8A 4RC9A 4C7JA 5IDVA 1L7MA 2JAWA 3OQBA 4Q02A 2AMYA 2GETA 4ZZIA 2FE4A 1FJGB 5TMPA 1CRQA 3GT0A 2B6NA 3FZNA 1Q1AA 2YY5A 3Q7SA 1P0IA 3OAAD 5FUQA 3ZU4A 5JBQA 4MVWA 1CEQA 3C3KA 4FSHA 4BO4A 1NHWA 2Y6VA 2ZVQX 1EXVA 1XDGA 3GT3A 4J1SA 2FWAA 1XL0A 2FKNA 2P1RA 2VSQA 1ZAKA 2EKBA 2FUG6 2BFOA 3G2LA 3SIPA 2IBMA 3HBJA 3SGLA 1SA0B 2GS9A 2NV0A 2QYSA 3C6XA 4RIHA 1RAIA 1VBKA 1FXWA 3A6KA 4XPIB 4PLFA 5HJ7A 5FI0B 3VR3A 1DXHA 1XCBA 4AJ4A 5CA0B 3ZD7A 3MCAA 3CGGA 3UPDA 2BCGY 4ZZ0A 3HJGA 3PDUA 4Y0NA 4OLHA 2AWOA 1KPIA 1W581 5EQFA 2F62A 3T7DA 4GBJA 4DQXA 4LF5B 1P7CA 2G8NA 5HW0A 4BKMA 3OJFA 2QUZA 3N2IA 5EPUA 4C5CA 1XDDA 4PYQA 2QJFA 2XMRA 3K72B 5C53B 3VJRA 4IILA 4BBJA 4EW1A 5FEUA 2BRUA 3TJZA 3UKOA 3IR5A 4C0LA 5ITWA 3QLUA 3O74A 1R4MA 3GEDA 2PVPA 3G5TA 1GVHA 1FVOA 2ZJFA 3KPVA 3W8DA 2AOTA 3VR5H 1OTHA 1JAZA 4LXXA 4Y9UA 4PN7A 2QUJA 4OQMA 2I71A 3D8TA 4A16A 5FWXA 4ZYLA 3WWCA 5KU1A 2DWPA 3PPXA 2P67A 3O6VA 4G5SA 4QJ3A 4JMLA 4RZ2A 4PV7A 4M9XA 3QPWA 3JWGA 4RVNA 3R5JA 3T9CA 4CWAA 2FY8A 4CIXA 1HL7A 1MO6A 1S8OA 1T0UA 3FNGA 5P8WA 5HR5A 1QRSA 3DD5A 1ITZA 1H3FA 1ZLXA 2FWNA 4K9NA 3V9PA 3W04A 4TYQA 4AMYA 1C7QA 4MQUA 2WY2D 3ICOA 1UT6A 2HK6A 2ZWOA 1XF1A 3VR4H 1GDTA 3D3KA 1SVKA 1CR6A 4YN3A 3B3FA 1VL6A 2SNIE 4I5DA 5K3OA 3EC7A 3AFOA 2ZYRA 3MN1A 1XMVA 3PGKA 3RUPA 2BFEA 3FTPA 4L4YA 1SAYA 4UM9B 1JFTA 1E1RA 1KGDA 3BULA 1J2TA 2IOHA 2PGDA 2VTDA 3PWSA 3ZV3A 3NDBB 3BMQB 1RZVA 1QGOA 2JIQA 2O05A 3P9RA 4MLDA 2BSQA 1E0KA 2GPJA 3BERA 1RWKA 3JAKA 2XB2A 4FP9A 1SPXA 3QPVA 3DAFA 1R4ZA 2ZWIA 3N5CA 3PFFA 4WKGA 3T7CA 1BDHA 3RG2A 3GU3A 2V98A 3LF1A 1V2HE 3DLPX 1GL6A 5T4BA 2R7LA 1B0PA 4HLCA 4OHPA 721PA 2YUTA 4YUAA 1PTJC 2FPRA 2XAAA 4NZZA 2X5JO 2GPNA 3I28A 1MJFA 3DUFA 3PNYA 1UKVY 1QV7A 2G82A 1UOQA 2C5SA 4HB0A 5KVVA 1TVCA 2B94A 2IY7A 1MBZA 1LJLA 2I6TA 4HB4A 4HGRA 3HLYA 4MWEA 4WINA 1R8YA 2ZPUA 1V7PC 2AEFA 2PUTA 4GLFA 4OXRA 3CIOA 3L6DA 3TEJA 3ASUA 1O9BA 4ESHA 1W73A 3I2FA 4F9GA 1BTOA 4PAQA 1PS0A 2V7BA 4GICA 2G08A 4GWLA 1XTBA 1VDMA 2I8CA 4P5DA 3RU3A 3TSYA 2WF5A 1Y1LA 4L0CA 1T2CA 2UZAA 4GOKA 2OECA 4NV3A 1OLSB 3LA6A 1CULC 1M1YA 1Z25A 2XBLA 3O2JA 3W2IA 3WHLA 3K31A 4ZVPA 2FPXA 4DG8A 1ODIA 1PX2A 3LTNC 2GZMA 3P9XA 4B40A 1WULS 4TROA 3WYGA 4NX2A 3VH2A 2JLSA 4MUMA 2DFKB 2Q5OA 3T7AA 1VP3A 1QVWA 2PT6A 1TPYA 4L1KA 1ZGZA 1B2LA 1T1EA 1Z35A 4J2OA 5LC1A 5JCOC 2ZAOA 1V3VA 1E9BA 1FJXA 2OGTA 1DKNA 2OFWA 1Q19A 1UT5A 4RADA 2GN0A 1T3GA 3ZNOA 4ER3A 1OX4A 3DHVA 5KTRA 4MO2A 3KQKA 3PC6A 4JCOA 1DPGA 3RBXA 4YYEA 1PUIA 3EDCA 2GBLC 3L7MA 5B2FA 1LLUA 3TSWA 3VNRA 3WIBA 1UBEA 3UK6A 2VP2A 3H97A 4YIHA 1RXVA 4PXYA 4K2HA 5DYGA 3U0VA 1JIVA 4KN5A 4L8FA 1S01A 1LRJA 4X6LA 4YRDA 4DPMA 1THMA 2IX9A 3H18A 4G5XA 5FYDA 3UH1A 2UU9B 4Z4IA 1QMPA 3AM4A 1Z2EA 3CLSC 4QGBA 4YJDA 1PT5A 2J67A 1AKTA 3OZIA 4FKBA 4MK4A 4PCUA 3R74A 4D81A 4J3FA 3REFA 4MUFA 1YVDA 3DDZX 2FSFA 3SZMA 1SQGA 1G2OA 2JLCA 3QMMA 4ML3A 4CF3A 4Q82A 1CUGA 2PTGA 5AKXA 5TGZA 1MEOA 3TTVA 4JENA 1U2ZA 2YN4A 2JFXA 4HXFB 5GOZA 3RVMA 4AIIA 3KLMX 3TH5A 4MUYA 4BS9A 1T6YA 4DLNA 4BNLA 3ZY2A 3WR5A 3ZQJA 3CKKA 3PNOA 1GKYA 3BCSA 3GGSA 1I1OA 1D4ZA 4H6PA 4O8ZA 2W6JA 5F9MA 2OK8A 4N48A 1YDFA 2BSXA 3H5IA 1F2TB 1XUOA 3ZBPA 3NPMA 2UYYA 1RCFA 3QX7A 3AP3A 3QVGA 4TLBA 3UFXB 1VZ3A 4BWFB 1X2EA 4X6YA 2FPPB 1B15A 1U2GA 2NO5A 5DHRA 4ZVSA 4OQNA 1T6BY 1J39A 3CNOA 4KZPA 1TADA 2PS0A 5FTWA 2HBZA 2XV1A 1WPXA 4ND3A 3WHKA 5J58A 1QH8A 4FEYA 3VR1A 3KXIA 4V0SA 1X7ZB 1QGYA 2QRVB 2IY8A 4WERA 1F20A 3G0OA 4PINA 2PNJA 4KBYA 5LYJF 3V4FA 1AKEA 4H7PA 3EA5A 2GLUA 3OX2A 1C3VA 4TMFA 4PZLA 4XQ9A 1KYVA 4LRSB 1AB5A 4DC1A 2L17A 1TVEA 3L0DA 2XF8A 1YCHA 3OZVA 2X5NA 4I3FA 1ILEA 5A4KA 4LPSA 1YH3A 3SE7A 1W0CA 4LC0A 3E3MA 4ZALA 2BOVA 1RKBA 1L7DA 2PT7A 2JDID 4DSNA 4ERNA 2RD2A 2Q6IA 3ZVMA 1NVKA 2PL9A 4HAZA 4LZJA 4PHCA 3IQHX 2I4IA 2JIMA 1YAHA 1IE3A 1FX1A 2OFPA 1KH3A 3AHIA 1N8TA 2AMVA 2RC5A 3HA2A 4OYLA 3L9XA 1I4OA 1NBAA 3CJQA 1V96A 4HV4A 5JJCA 3H5OA 1XLUA 2P69A 2RI6A 3R5XA 2CYAA 5JXWA 1Z17A 1G8GA 3IQDB 4X1YA 3THSA 4YMSA 1GNQA 3W7AA 1R9JA 1DWUA 1ML3A 3TNLA 4PLCA 3WP1B 1GKKA 3R5FA 1NMSA 4MSUA 1N6KA 4WOPA 5ILQA 2YMMA 1IQUA 3DF9A 3UENA 1SCIA 4F06A 4F8YA 4MUBA 2NV6A 4G9GA 3PRJA 1JLKA 4AG3A 3ONDA 4M49A 2CDRA 1KOGA 1SO8A 2W2NA 5FCDA 2FSSA 1ZI9A 4O25A 3BMCA 4Z0HO 4H1WA 4XWTA 3Q3IA 3TPCA 3ILYA 2JASA 2AW5A 4HDOB 4ZTZB 1FNSA 2BLNA 3BSYA 4RF4A 5C1OA 1MIHA 1J8MF 1XMXA 1CVLA 1PE0A 1GEGA 1D1QA 2PHZA 4JP1A 4NPAA 3S3TA 2R5FA 4E5YA 3T1HB 3GWZA 3ADCA 1D4AA 4Q1CA 1U98A 3V1TC 4ZVNA 1RTTA 1GPUA 3GO4A 3KHKA 1OKKA 3E7FA 3FKJA 1WQ1R 3ROEA 2R84A 4Y9DA 3R3SA 1LA2A 4DZRA 4I50A 2Z98A 1YS1X 1RWMA 4YK7A 2YHUA 3N07A 4IGIA 1N9GB 4HMQA 1XJQA 3FRIA 4TXMA 2FB9A 1GXSA 4LTDA 1Y6QA 2F1RA 3ON5A 4PYLA 4NULA 3TRIA 2C4UA 2O8FB 3EH1A 3CJTA 2ZJ7A 3A25A 4DV0B 4PC7A 1N2SA 1NQXA 1Q22A 1ZVQA 4QYIB 1RWBA 3RGGA 3SNHA 1EJ6A 4TKZA 5HIKA 3U5TA 3L8HA 1TM2A 4MWGA 4JNCA 4S2UA 1D6JA 2XNHA 3B51X 1XLTC 3GFFA 1M54A 5EIHA 3EDQA 4GDFA 2ZZNA 1EX1A 1Y89A 1E9RA 3QUCA 4A1OA 4H08A 1U3UA 1R0BA 2Q62A 4FFMA 1DBRA 4MUHA 1L1RA 2W2OA 4WUTA 3RKUA 4JV5B 4WY8A 2PLAA 3LWZA 3N1UA 5AM5A 1V9CA 1GAWA 2IA5A 1AKWA 2Z09A 5SY4A 3ZGYA 4AZWA 5F35A 3ROXA 3HACA 3EVGA 3FJYA 1OYYA 2OHFA 4MPTA 4K9PA 2BEUA 4TKLA 5TMBA 4C89A 5CB0A 5K6AA 1ELOA 2CWDA 2M2IA 2HBRA 4O1IA 4R4JA 3OOWA 5EZSA 5AVWA 1HYGA 2N75A 1RMYA 1GR1A 3KELA 4OLFA 4X6UA 3PRYA 3FLBA 4OQFA 1A1VA 4A8JA 1J0EA 4HH0A 4ENTA 4D5EA 1YCGA 3W4IA 1OXUA 4JBWA 4MLPA 1VCIA 4C0AC 2R1TA 3THWA 3RS9A 1E3JA 3GWGA 4M9CA 4TSKA 4ZQGA 4IQ4A 4JL8A 4K6CA 2GFIA 5K8VA 3ABQB 1A88A 1CUDA 1C0KA 1X7XB 3BRCA 4RY0A 4PEVA 1AGPA 1G41A 5TPWA 3AGQA 2ALJA 3R7LA 4RPHA 4E1VA 4FU0A 3G5AA 1OYVA 1T8UA 2Y71A 4OUDB 4EG8A 1A76A 2IE8A 2R3SA 2VSOA 5HDQA 4C43A 1XNJA 5D51S 1FRQA 2NT4A 3BHMA 4FOTA 5C1BA 3FMOB 2G36A 1FRNA 3MGAA 5E8JA 2EYQA 3ODGA 2CLIB 5CW1A 1ICEA 4KDEA 1G3UA 2C97A 3GJRA 1USGA 2D0PB 4JUCA 1VJTA 1GG8A 4UARA 2PEYA 4YROA 4RIEA 2PVSA 2PY6A 5EE9A 1SVSA 5TV2A 4BE7B 5AW8A 3CY6A 3LP6A 2BM8A 3WLTA 3CZ9A 1QH0A 1WD5A 3EB9A 1QRRA 4MW9A 1EDEA 3YASA 3G0DA 2FDRA 3I1IA 5DTEA 4RV5A 1U81A 2UZ4A 2AEEA 4RYLA 1TI7A 4DABA 1J2UA 5LZ9A 3BK2A 4KX5A 3HE3A 3W06A 4LYEA 3AFNA 1R4MB 3FHJA 1JU9A 2FEWB 2NLOA 3DHYA 4GXNA 1MAHA 2DUJA 1PFVA 2HI0A 3ASZA 3K20A 5B57C 2PUEA 2YCLA 1E63A 4FE4A 5G41A 2O8NA 3CW9A 3IPCA 1G8SA 5IN5A 1B93A 3HVJA 2B36A 3R0XA 4KQCA 3GDFA 3OIDA 1QHXA 4ZODA 4CODB 1L5RA 4L08A 1TJYA 3BQNB 3ZE8A 1AF4A 3U7EB 3RW9A 4AJLA 5J2TB 2A6PA 3PWZA 3LZ6A 3NWJA 4AS1A 2C2MA 2QMZA 2Q4TA 4N4AA 1KO7A 1JDZA 1IXZA 4HC4A 3O4HA 5B3KA 1EK6A 1IM8A 2OHIA 2Q5HA 2HXYA 3AFGA 3DCNA 3HM9A 1E7QA 5EI5A 5IUKC 4RENA 4AWXA 1IL0A 3GPCA 3K9LA 3TAHA 3TL6A 2Y8EA 1B73A 3ZDXB 4HGQA 5C5CA 2J9ZB 1AE1A 1DQZA 1YZHA 1DUVG 3BE8A 4N5MA 4DLSA 4EUNA 4BXOB 4WA8A 2CZQA 3IAEA 1U0BB 2NPIA 3JZAA 1RBMA 3TG2A 2H08A 2G9RA 4L74A 5G1NA 5B3LA 1L5NA 4KYVA 4AMUA 1R18A 5DWVA 4EFMA 1T15A 3DW3X 4H7FA 2KE5A 4K3VA 1DBIA 4YWHA 4P33A 1U2DC 3NGMA 4F2HA 2IDMA 2IHZA 4UU0A 2HQSA 4P3YA 2Q46A 4I9HA 4YT5A 1GG2A 4X45A 1Z6GA 1HZJA 1KK3A 1AF7A 1MD9A 1U8XX 2QRUA 4IVNA 4Z3OA 3UJDA 4Q9NA 5HRUA 3FHOA 5IABA 1XTVA 1ZN8A 1EXDA 4O6VA 2JVJA 4FCVA 4ZKDA 4F72A 1IDOA 1GAXA 1H2EA 2C2XA 4RGQA 2H1LA 1RRKA 4KPUA 1UAGA 3SC2B 2YHBA 1Y6FA 2JD0A 1FUUA 3T12A 2CLKB 1E77A 3IBGA 1D9XA 2F43A 2DZDA 4B4DA 4BNTA 2YYAA 4A0FA 4IDPA 4X1IB 1MB9A 1XEFA 1YMQA 1ZC3A 3NT2A 5H7XA 4AJKA 4ARIA 3OZEA 3UYKA 4J1TC 3ML1A 1HYBA 2AK2A 1NXVA 1MCZA 3HRIA 3HDHA 2NZYA 2PPLA 4PCVA 3VNQA 1RQRA 2QBYB 1JE1A 1EUDA 4LGYA 1I9GA 4XIYA 5H16A 3FLAA 2D1TA 2G0NA 3MRSA 3VTZA 3RLIA 4QX6A 1POXA 1KZ9A 1ZN9A 2OO5A 1FUEA 3OLYA 2ZXEA 3OC0A 4NJOA 1K75A 5M04A 3U44A 3HBAA 1K1EA 4H77A 4K88A 3UJAA 2NSYA 4MRMB 3I58A 5FORA 1YDHA 4QQKA 1S3SA 5BQXA 2DKNA 2YJ6A 1O1YA 4RNDB 3W05A 1IQ0A 1E2FA 3DB1A 1HGXA 1UXGA 3G9ZA 4GZ5A 4Q34A 2WB4A 5AJVB 5JIBA 1Z8NA 2QN6A 4HHEA 2JLZA 1NC3A 1T2NA 3PR2B 3RUFA 3H86A 1DSSG 4BAGA 3SKVA 4I1RA 2H4WA 5DVZA 3ZHRA 1TO2E 3WWPA 2HF2A 4P6VF 2BH2A 4LHVA 3BEDA 4J03A 3NR2A 1VPVA 2XD4A 3II6X 3L7OA 4FMCB 3UWKA 4BASA 2C9OA 2ZQZA 3HVKA 1LDBA 2R4UA 2AFRA 4PAWA 5JPIA 2PMEA 4RORA 1LDGA 2X7HA 3FMPB 2SCUB 5L4SA 1N2ZA 2CHFA 2PV7A 4V0QA 3ILXA 1T0IA 3CUWA 4R0VA 3T3MB 2HR1A 2ACVA 4BNMA 4E4YA 2ZSBA 3QU5A 4UHDA 4ZEWA 1EGHA 3E3AA 2IUSA 2XGJA 3H16A 5CAEB 1OGJA 3JY6A 3T7IA 4RTJA 3IV6A 3NKVA 1F12A 3CE6A 3GUHA 3RVPA 1XYYA 3T7SA 1NYRA 3LYAA 1SGWA 5FI3A 4B3GA 3SJ7A 2CMDA 2QD3A 1DC3A 1X87A 1L5QA 2CNBA 3N2LA 4IKOA 3R5SA 2D4AA 5CLFA 3H87A 1U2EA 5FBWB 3V7FA 4A5SA 1MZPA 3HYTA 3RIXA 5C7YA 1GCGA 1V5IA 2WMOB 3W34A 2PUBA 1SBTA 2OGZA 4H59A 5F5LA 5HG0A 3MW8A 2ZE5A 3GQVA 4QAJA 4QFMA 1OAAA 3QYAA 3EXHB 4AKEA 5A4FS 5EQDA 1VPWA 3ADPA 1S3FA 1T26A 2H1SA 2B1JA 3H4TA 4Q9DA 2OG2A 3HVUA 3P8ZA 4FYXA 1N32B 1T5TA 4YACA 5K03A 3SSNA 5JFOA 1BD4A 2RK4A 5T4EA 5EIFA 3CRRA 4HRVA 4GEGA 5G40A 2N1MA 4B6SA 4EMTA 1X7DA 1R0SA 3HCEA 3PC4A 5AUPB 3NHKA 3GLIE 1BDIA 1W0KD 4KPFC 1SCDA 1XPOA 3I92A 1KEWA 1IULA 1PX0A 1PK9A 4I2VA 3JVDA 3TGWA 4KNWA 1KTVA 3V3TA 2EFDB 2OV3A 4ISBA 3ETLA 4KMSA 1U8ZA 4BYMA 3LQYA 4KOAA 3HP7A 1ZBDA 2O5RA 3AVOA 4TL6A 1GUAA 1K7CA 2ARKA 3D6UA 5T8KA 3VSBA 4C5AA 3U16A 3D59A 1T0JB 1FZTA 2GA8A 1SUDA 1XEXA 1QFXA 1N1GA 1GGMA 1U5CA 3GNTA 4FUTA 5AH0A 3PCTA 3TJMA 2JZNA 2RHWA 4IS2A 3BRWD 4KMRA 2P8SA 3THOA 4KXXA 1K5DA 3V4OA 2FX5A 4MS3B 4QG7A 2I5PO 3EWAA 2RGNC 4CL2A 2FZ5A 4URVR 1GARA 2IHTA 5AOAA 4UXJA 5D85A 5A5FA 1P4JA 1M83A 2HU7A 2P9TA 2J7PD 5TQVA 2IPNA 1O96A 2AEMA 3MWJA 3PXUA 4BQIA 3ISVA 4ROTA 2YWEA 3U1VA 3O4VA 3ONFA 4EFKA 4N47A 4FFBA 3M34A 2HRQA 2CY0A 3DUFB 3FGNA 4IFEA 1MVLA 3RTCA 3MMXA 3W79A 3UZUA 4JSRA 2VQFB 4X93A 4R1SA 2IXDA 2YX1A 3F74A 1TX4B 1U9ZA 3DE0X 2H2AA 4EUKA 1GLNA 1FCJA 1XQYA 1ZUNB 1I9CA 2ZJ3A 4Q4JA 2IUFA 2CL6X 2ZU0C 4GI3A 5ED0A 5EJFA 3BSSA 4DR2B 5B2ZA 3FZYA 4R3WA 5FT9A 1JDBC 3VYRB 4OYHA 3G2PA 3L4BC 1O9GA 4CG2A 2B6HA 3ZIDA 4LXYA 1U9IA 3IUBA 3PNQA 3L8EA 3DDOA 3K53A 4KAFA 4CMBA 3R8XA 4ZZ2A 1VL2A 1IVYA 2FK7A 4Y1RA 3BH6A 3RVSA 4A1FA 4B4WA 2Q1WA 4DMMA 4P7KA 5FO1A 2XYRA 3V7YA 4C7KA 3S70A 1U3FA 1KI8A 1NVAA 2FFJA 3GQBA 3H1FA 4DVJA 2GKOA 4DR7B 5D3KA 1HDXA 1SXJE 5F21A 1DKPA 2AIRA 3SJUA 3PUYA 3ZN2A 3K70B 1W2HA 4BU1A 1RXEA 3QHQA 4PIPA 4R1TA 1VMKA 2EZ4A 1L5MA 3BK1A 2O7SA 3UIEA 4ZT5A 1GYQA 3W5IA 4E5UA 1Y8ZA 1G4UR 1UANA 1C0IA 2PYIA 4MAAA 3ZWVA 4DSTA 1QU2A 4ZT4A 1A7JA 1AUVA 1OBHA 3A70A 2P0AA 3M1LA 3WBJA 2FZLA 5CB6A 3H6KA 2PJDA 4GX5A 1AO0A 4MQBA 3NBQA 3HB1A 1KEVA 3U09A 3H4MA 4HEQA 2G4LA 2W2KB 4NG4A 3FTEA 4JHXA 3P9CA 2OCPA 1M72A 4AJEA 1FX0B 3TFWA 1L4YA 2NO7A 2OBBA 3IAM1 1H8EA 1NRJB 4RJJA 1JXQA 4M9SA 3TTTA 5DSTA 4QASA 4PC2A 2A8YA 3E3OA 3WC4A 2GCOA 1Z6ZA 3ENWA 3K1JA 1NUPA 2BFWA 2ZATA 2TS1A 4EQ6A 4B43A 2XMSA 1NRIA 1ZM7A 3WGNA 3ZVKA 1PW7A 3G88A 5LA6F 3BILA 4DDTA 3W8NA 2Z56A 4C04A 4IG4A 3DKPA 2PCJA 4C06A 3T99A 1S0UA 5KNBA 1S9DA 1YRQA 1WG8A 3QUAA 3C8DA 3S5UA 4IFTA 1SC4A 3AQIA 4MHOA 3MILA 4U2BA 5FTMA 3RC2A 3H65A 3VZQA 2RHOA 2ZJ6A 5TY0A 3HHPA 3RYIA 1GZ4A 3SS9X 4HYQA 2BZ1A 4AU1A 3WBFA 5JAUA 3LGSA 1SB9A 1U5BB 2JZCA 2P7HA 3KDSE 4ZV4A 3TNFA 4AURA 1RAEA 4XR4A 2DUUA 4EY7A 1NM5A 3DAHA 4K9MA 3R0JA 2J0UA 3EVNA 5JBIA 1JFFB 2RHJA 2YRFA 4H7EA 3TKYA 1F7UA 4UAJA 2PZMA 2WAXA 3OT5A 3GP5A 3N0WA 4DEXA 2IUTA 1OB2A 3FFAA 1PV4A 3RVNA 3M6XA 4KUHA 1KVQA 3FBTA 2FPGB 3B5IA 2FGJA 2KPOA 1L5HA 2PO7A 3AWDA 4F2DA 5HF8A 2EFCB 4EG5A 4TKMA 1XXHB 3IAHA 2OQIA 4Q00A 5IWAB 2PQMA 4KLAA 1QGZA 1DIAA 4NOLA 3FN4A 4WTOA 3WV4A 4X9XA 1XD2A 4GO1A 1KZYC 4DHEA 2F59A 2H11A 4FJ0A 3OPYI 2Y1WA 1ECLA 4DYVA 1CUIA 1KNXA 5K0FA 4E4TA 4DEVA 2GPTA 2V7QA 4JK3A 1SU8A 3P0EA 3EW9A 1N2CA 3ED5A 2QM3A 3BZWA 3OPVA 4MVJM 4I5IA 5FWYB 1BMFD 4LQLA 5I6DA 2HNAA 1A9OA 3U3OA 3JQ7A 1X0VA 3VO9A 1FFSA 2YNMC 2C2WA 4BMSA 2DTXA 5LP1A 2H4HA 4MI1A 3TDKA 3TW4A 2WMNB 1KFCB 3I73A 3BL6A 3BZUA 4R01A 1TZBA 2GKGA 3UQYS 4BHTA 2GCGA 1DOHA 4DSZA 4K9SA 4DUYB 4FOSA 1M33A 2Y9PB 3C3JA 1B6GA 1BU8A 3IGFA 3P0JA 4DLKA 1Y4SA 4HBZA 4IWYA 3CLKA 3PI7A 4FFOA 3OQPA 4B82A 3OJXA 4DJ5X 3ZDAA 4G2TA 5BV8A 4H1VA 3LQFA 3R7NA 3VMFA 3DOEA 4QGSA 3QH4A 1RYEA 2QHXA 4IIFA 5EJ2A 3VU1A 4CM6A 4IJ6A 4D4GA 1VJDA 4D9NA 1H3NA 3B6EA 1HDCA 1SIBE 3RUAA 2B61A 3FTQA 3HR4A 1JFFA 4NCAA 4CKWA 1USVA 1V8DA 3C8MA 4XD7A 4F3YA 5M5BA 1I6KA 1HYEA 1Q5PA 2A7QA 1V5FA 1ORWA 3MIIA 3VSCA 3GLKA 2CLSA 5JHGB 3DHEA 3X1JA 5L95A 4JUFA 2A1TS 1PR4A 3NO4A 5CEEA 2UVPA 4LRQA 4L78A 5HIMA 4YRMA 5JQGB 2OCYC 1NE7A 1C1DA 1G6HA 4MV4A 2AG0A 3P0FA 1L5WA 1S4QA 3C85A 3TR0A 3PZBA 2GBIA 3KB1A 4OVKA 3KB8A 3IXQA 2DR3A 1N2JA 2JBAA 3N2YA 4Y2QA 3OQHA 5L3QB 5LJLA 4WCFB 1WU7A 4LBYA 3ZUGA 1FDSA 1K6EA 1NF8A 2WJHA 3VHXA 2P4QA 3VHQA 4TKVA 3T61A 4C0JA 5EIXA 4NVRA 3D0OA 3CR7A 5G0WA 3FRJA 3S1LA 1N2OA 3I76A 4RV9A 3NUGA 3U3ZA 4CNBA 1Z5UA 3LX8A 4Z9XA 4BNJA 2GXUA 1PZXA 1JVBA 1Q11A 4JUAA 2CNLA 3MS7A 1U65A 3LT2A 2UKDA 3ECSA 2Q8NA 2WPNA 2YIDA 4YUVA 2AFHE 4KRYA 3RVRA 4AZ0A 2AH5A 2JBAB 4IQ8A 1F7VA 1KWGA 1TYBE 1ILWA 5DX8A 2PWBA 3QOXA 5EIBD 4E22A 3EQ8A 3V8MA 4S0XA 1WBBA 1H2FA 3OX1A 3LPCA 1CEXA 2HLPA 5KOIA 4RZSA 3L07A 1DJLA 4RESA 1QQAA 2G9UA 2HRDA 1O6GA 3VVMA 4KVGA 3TD2A 1CY4A 3FKSA 4WKCA 4MV1A 1N5IA 2BFAA 1G291 1YUBA 1IVNA 2POQX 2QRJA 3ONEA 3VOBA 4EUEA 3TZ6A 3O91A 4UBNA 3AI3A 3FMVA 4WBNF 5JECA 1FRVA 1QUFA 2E55A 3ULKA 4NC9A 5CBPB 3DEIA 3WV5A 1HSZA 1N5MA 3ETHA 1QHIA 1WXDA 4JS0A 2QV7A 4C1BA 4D8TA 4DWJA 3NDRA 3D1VA 4Y1RB 1CUUA 5HE8A 5D3MB 3WICA 5LJIA 1IJBA 1LFAA 2FHSA 3QI2A 4L9AA 1BA3A 2A57A 2CCGA 4DPLA 3VZBA 4DF3A 2ONYA 1NVUQ 4X3OA 1FVHA 4DMLA 3RIYA 4AUKA 4QGAA 2NTEA 1RSZA 3K8YA 1BCRB 3H2YA 2QAGA 4MQFB 2H59A 3D6TB 4ZGBA 1GRVA 1J1ZA 1DS6A 2YR0A 3DJFA 3EZ2A 3VDQA 4AMVA 1KOJA 5FKJA 2IIVA 4BMDA 3GBPA 4IMIB 1HDYA 4ZOLB 4YO8A 5ALTA 4DA0A 5GTDA 4YX9A 5AM2A 5KKNB 4DANA 1QF6A 2FZCA 1NVGA 2X1MA 3A2LA 4LHXA 2XYHA 3ER8A 1XU7A 1DBVO 1KDRA 1F6WA 4QGFA 3AR5A 3EA4A 1SM4A 3LUGA 2B25A 3GAZA 1FFAA 2YYZA 3TNJA 1VFNA 5ALHA 3JQEA 1M8FA 1X6VA 2YZKA 2C4WA 4U7JA 4YS6A 5J3JA 2WJGA 4II3A 3IQGX 3DFIA 1GQSA 3NAQA 4Z8XA 3WLMA 1B3BA 1VB3A 3DB2A 3VTFA 4CM4B 5LU9A 2IE0A 3DZJA 3IQZA 2ZSFA 1TCAA 2IEBA 4O2AB 4WBXC 3RJTA 4G0MA 1EFVB 4N7JA 2ZIVB 3OZXA 1YB1A 4Z9BA 1X7YB 3R3JA 2EF0A 1K7EB 4Y2HA 4XPIA 3ZWDA 1XDBA 4FB4A 1DCKA 2X1HA 2ZYSA 1DBSA 1VG8A 2JKVA 1T9CA 2X0IA 5EUQB 5GMOA 1Q0LA 1E2PA 4H27A 2C4NA 1JE0A 4XRGA 4PPYA 2GF0A 4ZN6A 2XMBA 1P29A 5FL3A 2HJSA 3BF8A 4N0EA 4MUGA 1CV2A 4AWBA 2JEYA 2WWTA 4NAVA 4EJMA 2EG5A 4DR3B 3EWSA 2ES4A 3PJEA 2H4YA 4V0KA 3FVQA 1N3LA 4FT2A 2ZCVA 1GRCA 4J0DA 2QU7A 1KO1A 1UAYA 1AS0A 2C0PA 3L41A 2XOKA 3G7SA 2UXDB 1RE1A 1OROA 2W6ZA 1WBDA 1DHRA 1DO8A 3BDIA 1KBOA 3DO5A 3MELA 4W7HA 5AMXA 4CTNA 3EEYA 3L0SA 1QGUB 5BMVA 3AVPA 2X22A 5E0KB 2CLLB 4KXYA 1Y3IA 3GFSA 4LY3A 1PJAA 4WLUA 3TVTA 4ARSA 1ZUHA 3B6IA 4MUIA 4RWZA 1DCFA 1LVUA 2ONCA 4MW5A 2O59A 2AE1A 2O8BA 1FLVA 1RM0A 4JQZA 2YZGA 4M1MA 4OP3A 1U8CB 2DJIA 4LXUA 4HXEB 3FZQA 1BWSA 4QTTB 3OQVA 4OTZA 4K7JA 3SF8B 1MABB 3TMYA 3JWPA 4F9TA 2OQVA 5TMDA 3A1SA 4NJEB 4AKIA 1IJKA 3C5VA 3V55A 1WUHS 2DT5A 1HR0B 2C4HA 3GPDG 1NTRA 5A4DA 4YT4A 1HURA 2Z2IA 2PG3A 2TMYA 4X97A 2GN2A 4JQYA 1NURA 1WMEA 2WTEA 1PR3A 1YASA 3L4SO 3Q4GA 1STOA 3SMQA 1EVZA 1R6VA 2KWIA 4PYJA 2JJMA 2W2XA 1V35A 2QVXX 3WNCA 3BN3A 2JFWA 1G8JA 1R00A 2IZOA 3ZZUA 2Z3ZA 4MHSA 5CDTA 2DBVO 2YN2A 3KUDA 2W83A 3PXBA 1CJSA 3COYA 3ER9A 1OXKB 3MUEA 3HTXA 2LIVA 2GXSA 2QUKA 4MIYA 4KSCA 4I6JA 1W59A 4KAJA 4UHHA 2I8AA 4D4MA 3VSEA 1UBCA 2H1CA 2R1VA 2IITA 2QW1A 1QTNA 2X42A 3GRKA 5GGXA 4OK5A 3DJYA 2B4AA 2R6JA 2ODBA 2VTEA 4Q1FA 1WXXA 3WWZA 4A73A 3SVTA 1NN3A 1A50B 1Q0QA 3Q6IA 2LR0A 4HTFA 2PYDA 3A3KA 3OEEA 5ESRA 2Q27A 3GN2A 1A2OA 4JT8A 4YRTA 2F1IA 5J63A 2CJWB 4HNSA 3K9FC 2C2HA 1SBCA 3ZZTA 4FNMA 2SBTA 2H7XA 3MINB 2IHYA 1ZX1A 3PE4A 1XX6A 1ZJZA 1EFRD 2P78A 3RCBA 3CUTA 5EMHA 3R3UA 1NA5A 1B74A 3RVQA 4ISCA 1M73E 2JGDB 4N76A 4UUPA 4JLNA 4RKWA 1EUDB 4LJ4A 4TL8A 1Z34A 4LY6A 4G1FA 2QRGA 4MYUA 4G4SP 4I08A 3KJEA 4CKEB 4HQ0A 2I3BA 1L4NA 3IEIA 4N65A 5KOYA 2V8OA 3GEBA 5KHOC 1NYQA 1J8QA 1PCXA 1CIJA 1XQ6A 2I22A 1ZGGA 5I4KA 4QECA 2C2GA 3PENA 9GPBA 1E3TA 3EWNA 4DN6A 3TGLA 2NOAA 3A6LA 5IDQA 3T9AA 1X86B 4OXXA 3QMPA 4P34A 2A86A 1FQWA 2BJWA 2XJ4A 3I6YA 3V46A 2H0RA 1Q91A 1ADBA 4I5FA 3RAFC 5EHNA 5EIEA 4FX5A 2X15A 2R4TA 3LT4A 1NTOA 3PXCX 1TCVA 2BMVA 3PC3A 1COWD 3H8SA 4B47A 1LDEA 1MB2A 1MEJA 1GU1A 1OBCA 3BE4A 4JI8B 2DF8A 2P5SA 3AVYA 3EX7C 1FFWA 3RVDA 1H5QA 1EP3B 2Q4EA 2CL0X 1EUZA 1QIMA 3GRUA 4XGNA 5DFAA 3REQA 3TQCA 1EFPB 3UV6A 1TYAE 5L3RA 3HGQA 1KS9A 1UBLS 2BVNA 3BWYA 3G2QA 3R5HA 4PQFA 2JKZA 1UZAA 2VCHA 3IPXA 3K0KA 4OYYA 4BWGA 2ZSJA 4CV1A 4BO0A 4EHKA 5JS6A 1YVRA 4OH1A 2NAPA 3DFMA 3K71B 5JMOA 5FLXA 1E4EB 3HL4A 5HA5A 3GGOA 3USES 3IC5A 4YI3A 4MLZA 5KVCA 1Y4ZA 2ZIGA 1JR2A 3A6GA 3DPSA 2Q4BA 2ZPAA 2R7AA 1RQ7A 1UDWA 2AXEA 2CXHA 5KNCH 3SLKA 1QIGA 1ZN2A 2M6RA 1VSVA 4LI3X 1XAHA 5AD1A 3Q3EA 1UXHA 1IHPA 1EU1A 5D3MA 2IZ1A 5MN6A 1LRKA 2GZDA 3VZPA 4B9AA 3GEMA 3IOYA 1RRMA 2PJUA 4B6RA 4FFVA 3UMMA 1WB9A 2OEPA 3BTVA 4A92A 3NB0A 1L7NA 3BZBA 2Y05A 3JWEA 4P53A 1HRKA 4IL5A 3O7WA 3L6EA 4CXMA 2GTPA 5DEOA 1P18A 3JQFA 3QZUA 1FMFA 4UBMA 5CR9A 4ZI7F 3MRXA 3SX0A 1CF4A 4HPJB 3MS4A 4M1YA 3HDYA 2FGKA 4B3IA 4DLWA 4V3CA 3WLFA 4EY8A 3MERA 1E0JA 1TM1E 3GFPA 4QBTA 1Q95A 1J5PA 3P4YA 4AO8A 5I9TA 2TSYB 5FHRA 3E5NA 4PF1A 1D1SA 4U2EA 1I01A 1EWTA 4D5GA 1UJ4A 1PJ3A 5BSRA 1DP4A 3RD5A 2OSBA 3SU8A 1SG0A 1BQEA 2ZAIA 3QX3A 3SIRA 1WABA 4TV9F 1IOLA 3CX8A 1IY9A 2WC1A 5EE3A 3SAJA 2UUCB 4Q18A 1L5OA 3B48A 3QFHA 3K0EA 3AYXB 3HWRA 1UBSB 4UJ3A 5CFQA 3MXOA 3AW9A 1WNFA 3DOIA 3KNZA 2OCXA 2G09A 2XWPA 1W85B 4DYHA 1P1IA 1VIAA 1MW8X 5JROA 5HIJA 1IOWA 3F71A 1SXPA 2OC4A 1UBGA 4MA0A 4DIBA 3LNTA 4CMGA 5DLYA 1VE5A 2BMJA 4GMFA 3SR0A 5IT0A 1E9DA 1I2MA 3PXGA 4FFLA 5SV2A 4GWGA 4PHHA 2WHEA 2GX6A 1TA0A 2GN4A 3G8BA 1PD0A 3U7HB 2JS7A 5AXAA 4FSDA 4UMDA 4D3DA 3SC2A 2EFYA 3T5MA 6AT1A 4XPZA 1TEZA 2CUKA 3OLVA 1OH5A 1G5QA 1LSSA 3O82A 3EPJA 1CBUA 2PX8A 3G2NA 4FLFA 1JT9A 1YQQA 4QLBA 1CY7A 3QVLA 2WSIA 3CCCA 5JSYA 3UAVA 1EFAA 3VJLA 1WXWA 4R6WA 2WSBA 4IX9A 1VOTA 4XSHA 1L0BA 5FOTA 1ZD5A 1LW6E 2GO7A 1VYHA 2XE6A 4LCEA 1A3CA 3K32A 2ZXUA 2M9MA 2GPWA 1QC5B <