3HEMA

Structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
291
structure length
291
Chain Sequence
QLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETCDIYMHYLRGCSDLFRDKYTDVCQFTLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclopropane-fatty-acyl-phospholipid synthase 2
publication title Structure of Mycobacterium tuberculosis Mycolic Acid Cyclopropane Synthase CmaA2 in Complex with Dioctylamine
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 115
structure length 291
sequence length 291
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hemA00
4GEKA 2Z6QA 3G2MA 4HH4A 4IV8A 3G2QA 2O07A 3UBTA 5FULA 5DT2A 2PJDA 2O57A 4ER7A 3GRUA 3T0IA 5K0EA 2PX4A 3E7PA 4HGYA 5EEHA 2XBMA 1YUBA 3A4TA 2ZZNA 1G6Q1 3R3HA 1BHJA 4AZSA 3BZBA 3NDIA 1YZ3A 5CVVA 5BW5A 2P8JA 4ISCA 5CVUA 4XCXA 1RI4A 2GLUA 4R6WA 1JG4A 2B2CA 4DA4A 3KR1A 3R24A 2QM3A 1SQGA 5DSXA 3PVCA 2PX2A 3OCJA 1IXKA 3A7DA 3GNLA 4GOMD 1RJFA 4MQ4A 2PWYA 1RI2A 1I9GA 5EQJB 2PLWA 1FJXA 5K03A 2AOTA 3O7WA 2PKWA 4LG1A 1WXWA 5GM2A 3LBYA 4CXMA 3FYCA 2I9KA 1KXZA 3VC1A 5KVAA 3LECA 3T7RA 4U7PB 2JG3A 2NYUA 3PFGA 4P7FA 2EFJA 3AY0A 4K6MA 1KYZA 4RVDA 2ZBRA 3EGVA 5EHIA 3ERCA 3HA5A 5EZSA 1HNNA 2IDKA 3LHDA 1KPHA 1O9HA 2YXDA 4PWYA 4Y30A 3AWIA 3HCFA 3BWCA 1OR8A 5FQOA 3UZUA 1G38A 4RVFA 2IBSA 3SSMA 3FPGA 3GRYA 5EKXA 3PFHA 2PGXA 1KP9A 5ICCA 4M37A 3SVZA 3HP7A 4X41A 2ZTHA 4KIFA 1MJFA 5F2OA 2G70A 1XCJA 2XYVA 3L8DA 1Y8CA 2FPOA 3P97A 1JQ3A 5K0NA 1YFLA 1T43A 2OYRA 3CCFA 3UA4A 5EG5A 1KR5A 2QE6A 3EGIA 5FA5A 5E1DA 2IGTA 3LCUA 3LX6A 3DH0A 3REOA 5GP1A 1ZHFA 1QAOA 2AOTB 2WA1A 4RSRA 3TMAA 5BW4A 1KPIA 1EQAA 3BGVA 5EEGA 3TM4A 4AZVA 4FR0A 2Q41A 1VPTA 3IHTA 5GWXA 5CIYA 3PB3A 3OU7A 3RIEA 3C3YA 4EK9A 1L3IA 2IBTA 2H1RA 4EKGA 3B3FA 2B25A 2QRVB 4PONA 1N7IA 2IH4A 2VDVE 4PYLA 3RW9A 5LQJA 1WXXA 4DQ0A 5CCXA 1I1NA 5T64A 1AF7A 3I53A 2ZFUA 3PLAE 2NXCA 5KQSA 3FTEA 3HVIA 4LECA 2WA2A 5CM2Z 5DM0A 2AN3A 4E33A 3A26A 3P2IA 3CJRA 3TKYA 5HEKA 4E32A 5DSTA 3E05A 3FPJA 1FP2A 3THSA 3TR6A 1RI3A 2GAFA 2H11A 4ZTBA 5E9WA 2I62A 1RI5A 3KHKA 2BZGA 3P9KA 3GRRA 4MTLA 5KQRA 5DTRA 3EVFA 1RJDA 3HVKA 2CWWA 1JR4A 3H2BA 4O29A 4QTTB 5FA8A 1D2HA 3TQSA 2IP2A 4UOEA 3I5UA 3ME5A 3FYDA 5C0OE 4AX8A 1TPYA 3EEOA 4Y2HA 4QQKA 3G8AA 5HFJA 1VBFA 1ZKDA 2PXXA 3G8BA 1ZG3A 2O0LA 3AXSA 3QV2A 3CJTA 4FS8A 2GB4A 4U7TB 4V0QA 1AV6A 3B5IA 3KQYA 1KPGA 2PVCA 1JG1A 3A7EA 4IKPA 4CTKA 5CVJA 4RTRA 5KYGA 1KHHA 1R00A 5EHGA 4CKEA 1X1AA 3IEIA 3IYLW 1TW2A 4G56A 3C6KA 3JWGA 4BLUA 3TM5A 3DLCA 3EVCA 2H00A 4FT2A 4WXHA 1FBNA 2PV0A 3PX2A 3BKWA 4P7GA 5E8JA 5IH3A 5BXYA 4YUZA 3FUUA 2G8NA 5K0JA 5LQAA 3B89A 1EJ6A 5EVJA 4HRAA 1VIDA 3LKDA 3B3GA 4GC9A 2CL5A 3CKKA 4RTSA 4AZWA 2OB2A 2P35A 4X60A 5EMKA 2BR3A 4RTOA 1NW7A 3EMDA 3DXYA 3JWJA 2FYTA 2AOWA 2NP7A 3DULA 3EMBA 3G5TA 4QPPA 4IV0A 2ZZKA 2UYOA 4QQNA 4C4AA 3HCAA 4YMHA 3OE4A 3SM3A 3GRVA 1EG2A 5GOZA 1PJZA 4DMGA 3O31A 2Y1WA 3GGDA 5DLYA 3SSNA 3OZTA 3PX3A 5LQNA 2ADMA 2ONYA 5EIWA 5DTQA 3KQMA 5EGSA 5FHQA 3C6MA 4A6DA 1N7JA 4R8RA 2FRXA 3P2EA 5LSAA 2IH5A 1D2GA 3AXTA 1WY7A 5MHTA 3DR5A 3S68A 5KS2A 3M70A 1AQJA 3EVGA 2VP3A 4R05A 3NTVA 2XYQA 3R6TA 3I9FA 3VYWA 3EVEA 2R6ZA 2ORED 2EG5A 2QYOA 1NW6A 4YUYA 3ORHA 5FQNA 5F2KA 2I6GA 4PCAA 4PNEA 1R8YA 3BGDA 2YUIA 4HTFB 4RTKA 2VZ9A 2ZIEA 4CWAA 4DM3A 3KPVA 3SXJA 5K8VA 2ZW9A 3LL7A 4R6XA 5LQRA 1DUSA 5DRYA 5ICEA 2PT9A 4BP3A 3FUWA 4GBED 3FUTA 2OO3A 2QRVA 4KDRA 4PGGA 2B78A 3LDFA 5EIFA 2UYQA 1G8AA 3LBFA 5GIOE 2AR0A 2KW5A 3G2OA 1X1BA 4LWPA 5HIIA 4C04A 2FK7A 4CKCA 3P9CA 2F8LA 3FTCA 1JTEA 5U4XA 3U81A 4CKBA 4F86A 5HZMA 1XVAA 1U2ZA 2K4MA 3HCCA 4GOOD 3ER8A 3C0KA 3EVDA 4DKJA 3UJ9A 4GC5A 3MHTA 2GH1A 2PX8A 4KW7A 1XTPA 4BLWA 4GF5A 4EMSA 3ER9A 2P3OA 1KYWA 4RWZA 3A27A 1UFKA 3HEMA 4RTLA 3LPMA 4PGHA 3EVAA 1NBIA 3GWZA 1EIZA 4F84A 4HSGA 5E9JA 4YV0A 2HV9A 2IDJA 2PWPA 5B1SA 1P91A 3WSTA 3HNRA 2V74B 1JQDA 1SQFA 4X61A 4E2YA 3HCEA 3OPNA 3UJ7A 4KRGA 2A14A 1Z3CA 3FPFA 4ER0A 1YFJA 3KR2A 1SUSA 3TFWA 2HWKA 4YV1A 2ERCA 1JG2A 1N2XA 3FTFA 9MHTA 1INLA 2ZULA 2IFTA 4OA5A 4M38A 3JWIA 5C1IA 5H02A 1WZNA 1VL5A 3GIWA 4PYQA 3VSEA 2B3TA 2JHCA 3EGEA 4P7KA 3BGIA 3B3JA 3DMHA 4GOLD 4FZVA 5E8RA 5EZQA 2C7OA 3KPYA 2ZSUA 5M5BA 3R9XB 3CGGA 2NP6A 5JUWA 2P7HA 3LKZA 4EKIA 2FHPA 4V0RA 4RVHA 5E1MA 5DX1A 3KPJA 4KDCA 3T7TA 3Q87B 2EJTA 1G60A 1JSXA 3K6RA 4PYKA 4OBXA 4YUWA 1RJGA 5E1BA 3C3PA 4HG2A 1XCLA 3KR0A 5EC8A 4PYOA 3V97A 3GXOA 3M6UA 3DXXA 4HC4A 1UWVA 1P1BA 4ER6A 2HNKA 3NDJA 2YXEA 3EVZA 3TKAA 3QOWA 1P1CA 2P3QA 2YR0A 3NVKI 1X1CA 3MERA 2AVNA 3KR9A 3NW9A 1EJ0A 1R6AA 4X63A 2XVMA 1ZGAA 3LDGA 2JH9A 3NMUF 1M6EX 5K0BA 5HIJA 1G55A 2XVAA 3GDHA 3ANXA 2HTEA 5FWDA 4FP9A 4M7RA 3CC8A 3FRIA 5EOVA 4FGZA 5DX0A 3M6XA 2OKCA 1YZHA 2IPXA 3FPEA 3FTDA 4PYMA 4LWOA 4PIPA 4X1OA 3DXZA 5E2BA 1ORIA 3FPHA 4E2WA 3LSTA 4P7JA 5HIKA 5LQCA 3EVBA 1QAQA 5D1NA 4E2ZA 2JH8A 1IM8A 2E5WA 1L9KA 3GCZA 3JWHA 4C05A 1UIRA 5FHRA 1NV9A 3BKXA 1O9GA 4HGZA 3SX0A 5CCBA 2EJUA 3ELYA 3IV6A 3X0DA 4DZRA 4HTFA 1SKMA 1FP1D 2HR1A 3BUSA 4GQBA 5ICGA 2ZCJA 2IIPA 2N47A 4QVKA 3BXOA 3KQOA 4PIMA 1B42A 5T6BA 2JHPA 2G1PA 3G88A 3GU3A 1DL5A 5FTWA 5JR3A 2ZZMA 3I64A 2AS0A 2QY6A 3MQ2A 2PXAA 3HCBA 4QDKA 3G89A 5EMLA 5FUBA 1Q0TA 3G5LA 2ESRA 3TOSA 3KPUA 3OU6A 4RYLA 3P9IA 5FADA 3MCZA 4PYIA 1D2CA 4MWZA 3HM2A 2GA9A 1VE3A 4QDJA 3SR4A 4BLVA 5LR6A 4E70A 1NW5A 4RVGA 2AVDA 3KQTA 5BP7A 2UYHA 1IY9A 4RTQA 2BM8A 4PCLA 3OE5A 5DPMA 2IH2A 2FCAA 3DMFA 1NV8A 1O54A 4EQZA 1YF3A 4C06A 3FUXA 3P71T 5D1HA 3M33A 3EEYA 3P8ZA 3PS9A 1BKYA 4MIKA 5CVDA 1NW3A 4R8SA 3G7UA 4FSXA 2AN4A 4RX1A 5E1OA 3OFJA 4QPNA 4YV2A 3G2PA 2NXEA 1WG8A 2OPBA 5FCDA 1XDUA 5CD1A 4POOA 3UJDA 3THRA 5ERGB 3E23A 3PTAA 5CVEA 2OB1A 8MHTA 2P3LA 1F38A 4KWCA 5DX8A 2BR4A 1ZQ9A 2OBFA 2ONZA 1XDZA 1VQ1A 2PX5A 4RTNA 4E31A 1R18A 4YUVA 4YUXA 1ORHA 3UJ6A 2AN5A 3HA3A 5T67A 1NBHA 4KIGA 2YQZA 3M6WA 3NJRA 2PT6A 3ELUA 3MTIA 4L7VA 3MCTA 3NWBA 2UZ4A 2Z6UA 3KKZA 4RTPA 5EKUA 4E2XA 3V8VA 3UJ8A 3HA7A 3DP7A 2I7CA 1BC5A 4QVGA 1X1DA 4Z2YA 1M6YA 1NT2A 1WS6A 2R3SA 2YVLA 5K0GA 1NE2A 1RJEA 3LCVB 2NXJA 4OQDA 5G02A 7MHTA 1YB2A 3HVHA 2ZWVA 3KQVA 3BWYA 2PY6A 4M36A 1AQIA 3CJQA 3B7PA 5F2NA 3BWMA 1NKVA 4AUKA 1DCTA 1L3BA 3HCDA 3O4FA 4FT4A 5E2AA 4YMGA 1Q0SA 4XUDA 3D2LA 4OA8A 4QTUB 2VDWA 2EX4A 4B17A 2VDUE 3OU2A 1RI1A 1V39A 5C9ZA 1JG3A 2Y1XA 3MGGA 1QYRA 1G8SA 3KU1A 4E30A 1HMYA 4OX9Y 2AOXA 4EVIA 5K09A 4PINA 1M0EA 1JTFA 2BM9A 4C03A 3CBGA 5HOQA 4ER3A 3NWEA 3DLIA 4NECA 2OZVA 2ZLBA 3GJYA 5K0LA 3TPZA 10MHA 2WK1A 3UJCA 3K0BA 1I4WA 2ZWAA 5HIMA 3VC2A 3OZSA 1VP3A 3BWBA 1EAMA 5LQKA 2HMYB 4WVLA 3M4XA 2FK8A 2V7EA 4AZTA 5K05A 3P9NA 3T7SA 1R74A 3FZGA 4PYNA 4BY9E 2ZIGA 1MHTA 4F85A 5ICFA 5DRTA 2CMGA 2B9EA 3UWPA 2P7IA 3LGAA 3FRHA 3KQPA 5IKMA 1PRYA 2AOUA 2PBFA 5DM4A 2ZVJA 3MB5A 2XYRA 1BOOA 1VLMA 2ZBPA 2P40A 3KQSA 5DXAA 5DTMA 3ELDA 5E9QA 4OBWA 5EMJA 2C7RA 2VS1A 2PXCA 1H1DA 3KQWA 3LCCA 2PSSA 3UFBA 3ID6C 3AJDA 4MHTA 3KQQA 4XUEA 4IWNA 3ELWA 1FPQA 4BP1A 1ZGJA 1VP9A 2C7PA 4CTJA 3KPWA 3FUVA 4RV9A 1QAMA 3MTEA 3CVOA 2UYCA 3HTXA 2P1DA 4P58A 3TLJA 4GUAA 1XJ5A 3DUWA 2BR5A 4FSDA 2ZBQA 2GPYA 4H0NA 1P39A 2P41A 5CUQA 4XUCA 2CKDA 5DM1A 1L3CA 1JSZA 2YTZA 5DM2A 3UJAA 3E8SA 3MAGA 4A6EA 2Z6AA 3BT7A 1TW3A 4GOND 2ZIFA 2AOVA 2GS9A 3M6VA 5K0CA 2LD4A 1QANA 3HVJA 2G71A 4JXJA 3Q7EA 4C07A 1R8XA 3GRZA 3UJBA 5K0FA 2AOUB 3UA3A 1JQEA 2G72A 1SUIA 2YX1A 2NNWB 5EPEA 5FWAA 5P8WA 4RTJA 1QZZA 5GM1A 3QOXA 4DCGA 3TRKA 3OZRA 2O05A 1F3LA 5GIPE 4RTMA 2DPMA 5DWQA 5DXJA 3DMGA 4ER5A 2BH2A 3NVMB 4ATNA 5LQUA 3PT9A 1XDSA 2AZTA 2NXNA 4OQEA 5HILA 4C08A 5GINE 3I58A 1XXLA 2O06A 2JJQA 1SVUA 3EPPA 5EMMA 3F4KA 3A25A 2DULA 3OFKA 1NW8A 4PYJA 3SSOA 2YXLA 2OXTA 1KIAA 3LDUA 3SGLA 1SG9A 2C7QA 1L1EA 1X19A 3GO4A 3DOUA 2JHAA 2CMHA 3R0QA 3SMQA 3P2KA 3DTNA 4DF3A 2OY0A 3RODA 4DCMA 5K01A 4KVZA
chains in the Genus database with same CATH superfamily
1NNI1 1LRJA 1ORVA 4Z9FA 1UXOA 2NTYC 2OCGA 1HL7A 3GQBA 4N5IX 5ALPA 1C29B 4KXNA 3GWGA 3VC3A 1OLSA 3DM5A 1GL9B 1WLSA 5D87A 3WGHA 2F8TA 1XKTA 4HZUA 1ICIA 1YU6A 2I2BA 3KLNA 4QUGA 4CDNA 1GPNA 1T5DX 1L5OA 2FQQA 3OM9A 1BHJA 4UZFA 4QSHA 4Z2AA 3AHCA 4ZEVA 1ZM2A 1WQ1R 2P68A 4XB6B 4C5BA 2XTNA 5BSTA 3SYTA 3UHOA 1IY0A 1RC8A 4FNGA 4OUKX 3I6YA 1E7YA 2R7LA 1LBTA 1YJCA 2IHNA 1KYVA 4UJ3A 1GV0A 3OCJA 3C3KA 5KTKA 2V59A 2R1TA 2B7LA 4CV2A 4RCZA 1Y81A 1LDMA 2R8PA 4H3KB 1Q6ZA 4IH4A 4LG1A 1KDYA 2O8CB 2PH7A 2BHLA 1KERA 1PSWA 4S1OA 1EUYA 4LZOA 3U3XA 1E9SA 2YC2C 4YFYA 2BFWA 4QBHA 4F60A 1Q44A 4DMUB 1QFYA 3NUGA 1ORWA 1TEXA 1P8AA 3ZLTA 4QBGB 2WJZB 4KXXA 3V9AA 2XBLA 4D45A 1Y5LA 1K3TA 2WPDD 2BPOA 1PWHA 2YXDA 1M54A 2CEAA 2Y1FA 2VVTA 1O97D 1VG9B 4INPA 1DOAA 3BJMA 4ZXFA 3UZUA 5LOVF 2QE7D 1KMMA 5D3MB 2ZTHA 1GITA 3RUAA 1MJFA 1YS2X 1LSUA 3AHDA 5DHFA 4NHEA 4F3TA 1G8GA 4LXTA 5DULA 2CXUA 3BOSA 3DDHA 4O02B 1U4OA 4AX4A 1QK5A 1T2UA 1DGQA 5AW8A 3AB3A 3MWDB 1Z2DA 4KZKA 4KO4S 3U7GA 1FUEA 1Q1BA 2BLNA 3GEMA 3LK6A 1UXIA 2IF0A 1PNRA 4YRNA 1KQ3A 2X2EA 2ZYDA 1EGMB 1EVQA 1EXMA 1XAGA 1KFBB 1PJ3A 1T4CA 3IPAA 3KL2A 3DKRA 4NICA 4TTPA 4AWAA 1H0KA 1DQNA 1H23A 1O5TA 3PJDA 4JJGA 3PJGA 4E2XA 1QYCA 3N2ZB 1N1MA 3DEZA 2Q3CA 1L0BA 4B85A 4EM6A 3RWOA 3QMMA 1K7SN 1SVSA 2EJBA 2AYXA 4M89A 4CM9D 4MVJF 5MN4A 2B4RO 1NVBA 5DBEX 1ZOIA 3AEYA 2E4UA 3JQFA 3ZVMA 5I8PA 1K5PA 1SO8A 1YACA 2C57A 3HPRA 1FFCA 1N9GA 3M83A 3OZGA 4LDQA 4MUEA 1CFJA 4US0R 3TZHA 4ZKDA 1XKXA 3MOGA 1EM8B 3FE2A 2NVUB 2QP4A 1Z2PX 5EJ7A 3BE8A 1LJLA 5LWHA 2HRDA 3U4CA 2ODTX 3OF5A 1RI3A 2H11A 4MW7A 1E7SA 5HZKA 2PD6A 4AIIA 2QL7A 2GLTA 3GRRA 3FNHA 4ITUA 5ALTA 3V8PA 1N7HA 2CWWA 5IBQA 3C5EA 3KYCB 3OX2A 3K94A 4F97A 4M0DA 5LP6A 3VSCA 4ZT4A 1XJWA 2WJ4A 3LX5A 1E2DA 4J90A 2GXAA 2CYAA 3G8AA 5IW8A 4ZARA 5BT9A 2HF8A 1ZH6A 3QJ5A 4IMRA 4IJ6A 2QD2A 4IIVA 5G0TA 4J0EA 2RHGB 1KI3A 3VUFA 1RZUA 1IY1A 1KIMA 2P6MA 1EI9A 1TUBA 2GZ3A 1JG1A 3CLSD 3RPEA 3WYGA 2JEOA 2FUCA 2XUDA 1LWNA 2XKKA 3GG2A 1KHHA 2PL5A 4MS1B 3F9IA 3RK0A 1IWOA 3JD3A 3OC6A 3F7MA 4PZ9A 4H18A 5ALIA 1XDWA 4UUNA 5ALFA 2ZIAA 1W88A 3FZEA 4JLJA 4GQAA 2E9SA 4KIJA 4TMFA 1N8NA 1ZGGA 1ZOOA 3V1TC 1Q17A 3HSYA 3B3GA 3MJTA 4F0JA 2ZJOA 3K05A 1ZIOA 3G9TA 3HRHA 2Q4DA 2RARA 1CW2B 2BR3A 3MM4A 5EMKA 1WR8A 4AJEA 3EMBA 5F21A 2H5EA 4WNAB 3WOVA 3TLGA 1SXJB 2Z3ZA 4JI2B 2OGZA 3U6KA 2DWUA 2CVQA 4HGRA 2GHRA 5SZIA 1SEVA 2C82A 1Z6XA 4HLUC 4EP1A 2YWRA 4YRKA 1UMDA 1JAXA 5EGSA 1RXYA 5BWCA 2OV6A 1N2CB 5GGXA 1IVNA 3BRCA 4DY6A 1ANKA 1MQ8B 5A9RA 1RQGA 4EYEA 3UJ3X 4ZVNA 4UASA 1QLJA 4DCSA 1GGFA 2VDQB 4JI0B 4TXNA 1C1XB 3VYWA 2HL6A 1ONNA 3RVSA 2QQEA 5HE9A 1R9GA 1KJIA 2Y1DA 3B1FA 4HP8A 4MW0A 4Q82A 4MH0R 2DBVO 3SQLA 1YU9A 2YIMA 5JISA 3C15C 1FDWA 1EINA 2R6R1 3CX3A 3WY9A 4JN6B 2M1ZA 1IG0A 2VF4X 2ZIEA 3N53A 5D51S 2IELA 5CVTA 3RVQA 1KXJA 4CL3A 1FC0A 4XEHA 1QIFA 4R9RA 5AM5A 3EQZA 1H2XA 3H87A 3OHPA 4AKTA 5AW0A 2RG7A 4KREA 4PLWA 2GYVA 2OO3A 1EDDA 2JFZA 4I14A 3FFWA 4RV5A 5HNKA 3K9QO 4W7HA 1IPHA 4AQYB 3DOHA 4YTEA 2L2QA 4CIVA 3VR4A 5CITA 4DOMA 4KK4A 4L0QA 3KT3A 3TQRA 1CIJA 2EKZA 2O3SA 2XUOA 2NWQA 1W87A 2XNJA 2J3EA 3FMGA 3GEHA 2X9LA 1QB8A 2CV1A 3ER9A 4EMSA 1AZTA 5IDVA 1ONSA 4ZYTA 4ZCPA 2JDID 2B8JA 1UZNA 4DMKA 3UKDA 4ZVVA 4FEGA 3AFIA 4WJKB 2D1FA 4BIMA 3NTUA 5E9JA 4NCNA 3IEPA 3PU6A 2ZYVX 3R3XA 1YR6A 4LQDA 1PHRA 2JHFA 3KP1A 1ECFA 2OCIA 1OXKB 2XZDA 3F6EX 1Q1NA 3IRUA 2F4NA 3D3QA 3QEJA 4IJVA 2A14A 1Z3CA 3B6IA 4N0DA 3HO1A 3FMVA 2FW7A 2YIVX 1KTVA 1WB6A 4G5SA 3THYA 4IUBS 4J9VA 3CUTA 2BE7A 1QQAA 3SF8B 4P7KA 2W2KA 4GOLD 3KSMA 3T7IA 5L3QA 3JQ6A 4B6RA 5LYJB 3EPKA 2RAFA 3F5QA 4WOKA 5C5EA 1XQXA 1GPLA 4TSFD 3ZVKA 1C8VB 1OWLA 3NHYA 4I8DA 2Q5HA 2J4CA 1DXYA 4NONA 3WLRA 3OZBA 5JTTA 4LJAA 2CNDA 3T06B 2V5AA 2Q5FA 3ZWAA 4Q19A 4GL4A 1OB2A 2NO0A 2VT7A 3JVVA 4DGSA 1MAWA 2HWYA 1P19A 2F1RA 4H1TA 4YASA 4MQEB 2BFDB 2GRAA 1IM2A 1LDNA 1HO3A 3R3WA 3CNLA 4EJ2A 2OUKA 3W5UA 2WM9B 3HKBB 4DRZA 5F7JA 4AS2A 1T0PA 1BE8A 1R4AA 3I6BA 4M4SA 4M53A 2ZTUA 4FMDB 5T3YA 4F2GA 1AKTA 5BR4A 1EUDB 3H9QA 3I39X 4IGKA 1DWPA 2FCRA 4IDDA 4KE6A 4RHYA 5DBIA 4LFBB 3F5DA 3OP4A 2FVXA 4B45A 4BRWA 2LTAA 4KIWA 3DPSA 4ZTZB 3CX6A 4W5RA 3M49A 3PNPA 1LD3A 3LOQA 2NQ8A 1U8UA 3NIGB 1JIUA 4LRWA 1OH8A 3A6GA 4L4SA 3ITDA 4IAOA 2GK4A 4JEHA 4YP9A 3A4LA 1RAFA 2F4VB 3LSTA 3GPDG 4P7JA 3SK0A 1NYTA 3S2YA 1IOZA 2Q21A 3RJ5A 4BLTA 1E8DA 4BE7B 2C5GA 2VNKA 1IPEA 5TPWA 2I67A 1EE9A 3LUBA 4L5AA 2V9PA 3NPMA 1OAAA 4J03A 3ZTYA 4ZFNA 4CKWA 2DB3A 1DBVO 1QVVA 3M5DA 2ZJ6A 4QVKA 2E21A 1OLXB 4PIMA 5T6BA 5KYXB 2QJRA 1FS4A 2CXXA 5KAMA 2FN9A 2KI5A 3K0KA 4GOKA 4RFSA 4D79A 5J2UF 4YRBA 1FDVA 1YI1A 4UXIA 1YA6A 4BB9A 2V3VA 2CB0A 3OU6A 2RI1A 3H5WA 3MCZA 4MLPA 3GDOA 4MWZA 4AECA 3FGZA 4DAOA 1IXYA 3IPRA 5KMGA 1RCFA 2UYHA 1GSHA 4AZ0A 5HBRA 4GLLA 3ZH2A 5JAHA 4LSGA 1JR6A 2VTEA 2H4XA 2ZRQA 5A0VA 2BBSA 3LSYA 3FUXA 4OLAA 2WYOA 3AM3A 2X5JO 3QVKA 1NY6A 3OCZA 3OQBA 2QSYA 1DB3A 2ZRPA 3FKQA 1IYZA 1CRZA 4E5UA 5AK4A 3LHSA 1XDUA 1MW9X 2QWXA 4HGNA 3HKDB 3B52X 2XNDA 3DFUA 3Q3EA 2P9JA 2D3WA 2J8ZA 2P2LA 2YJ3A 3NHBA 3O8OB 1R0WA 1FNDA 2FZWA 3QQ5A 4EYOA 4FM9A 2DGDA 1P62B 3BXHA 3RH0A 2NUAB 3KSUA 1P1IA 2HFKA 2VL7A 3HO6A 3T7CA 1X87A 2G40A 2L0XA 3JAWB 3K4QA 2QNBA 4DEYA 5HKKD 3HVRA 2ZYGA 1LSJA 2CDCA 3IIJA 3OO1A 4AKHA 2C8VA 1A76A 2X0JA 2XTAA 3UWMA 2WV7A 1NVUQ 4HWRA 2QD3A 3W77A 5AOAA 1UM9B 3KKZA 2XLCA 1XNJA 2OUIA 4D96A 2N42A 1RAIA 3EB9A 1MC4A 1DCMA 3T0FA 3T4UA 3B70A 3HA7A 5HJ2A 4DC0A 4RPGA 4DJEC 3U6BA 1LDGA 4MV6A 5LFAA 2Z8YM 3GGCA 1P0PA 3IODA 3L0YA 5ELLA 1RXVA 1DAHA 1QVRA 3OTOB 3UENA 4IJKA 4DMLA 5CURA 5GPBA 1AQIA 3HMKA 1J0DA 2AFIA 2DE0X 3HA2A 1MJ5A 4LXUA 4YMVA 1NMQA 1SXJE 2OC4A 4W4TA 4MI3A 5CTJA 2YOHA 5A1TA 3CTPA 1P73A 4NARA 1PL8A 1R5NA 4CV0A 1JG3A 4HNQA 1TAHA 5ALVA 2WQ6A 2GJSA 2JGIA 1I3OA 1N2CE 5K09A 3TCXB 3VOTA 1DTWB 3GD7A 4PG8A 5TJHA 1QHHA 3AT1A 3INGA 4LF5B 4TKUA 3TPZA 3W8DA 3HO8A 1ODFA 4JQSA 2BTQA 4PBRA 2O19A 1ZINA 1JSLA 1U7WA 2Y0EA 3ZLVA 4RD6A 1D1TA 2DEUA 1YR3A 1QE3A 1Y8QA 4JP5A 3ZGYA 2V7EA 2Z4RA 4G1UC 4A8PA 4JYPA 3GLRA 1F2TA 3GJRA 2AKAB 1UIMA 3MLBA 2WB2A 1Q12A 1S2OA 2Z1MA 4F5EA 5DDIP 1B2RA 2F9LA 2W2XA 4NBTA 5FLKA 3UQYS 1V11B 1PK7A 1T1IA 3QUTA 4MV1A 4A0FA 2QPTA 2PVPA 2ZUSA 3I9V6 4Y67A 3UHFA 4BFWA 5JAOA 3A4NA 4EJ0A 1DO8A 4LRTB 3RKUA 2LIPA 5FI3A 4PC2A 1XZBA 1YVUA 4AI6A 4IHJA 3PL1A 4EL5A 1U63A 4E5DA 3NI2A 4N0QA 4GPIB 4M98A 2DHRA 4WEOA 3LCCA 3M9LA 4XLLA 5DHQA 4F1JA 5J9FA 4POAA 4ZMBA 3GVPA 1Q0HA 3QVLA 3T4XA 1OJ7A 1C7JA 2MIIA 1R0KA 2WWXA 2X13A 4AJ9A 1WB9A 4AQDA 5BQ3A 1VYUA 2UYCA 1V8PA 3CVOA 1PEAA 3HTXA 2OK8A 1T6BY 1G59A 3ZJTA 2X2PA 3E7FA 1KMHA 1E64A 2F43A 4QJ5A 1D1QA 4RU1A 2J0EA 4K9QA 4TRMA 5BPHA 2DG2A 4G07A 2DWOA 3CF0A 5EUQB 4A6EA 1D04A 2ST1A 2XVZA 2WAAA 1JDTA 2Y1OA 5EIEA 5K0CA 3QBJA 4GD3Q 3F1LA 4E13A 1UC8A 3GRZA 5GONF 4HYQA 4BBAA 2VQ6A 1U2RA 2X1VA 2CXQA 1OJLA 5BQ5A 4JD5A 4X92A 3IBFA 3KJHA 2B5OA 4P82A 2C5FA 2PRSA 3N8DA 3P2OA 3PE4A 4F8EA 2AI1A 4O4IF 2G28A 4HS4A 3WKDA 2BFPA 2BH2A 4OYYA 1C8KA 1V43A 2J3LA 2CYBA 1D07A 2H0AA 3D0RA 1M6WA 5ER6A 1YA4A 3K0CC 1YQWA 3KT8A 3U1VA 1LK7A 3EPPA 4XWGA 5AXBA 4O4HA 1T9GS 2HY7A 1G6KA 3AHHA 4U5QA 2ZIXA 4ALJA 4AMYA 3ZCQA 3EUAA 3OPYA 1GD1O 4BLQA 4C88A 4D02A 3PSHA 1Z4OA 1NXTA 2Y0CA 1QRUA 3BTUA 5TXGA 3HB9A 2P0EA 1P4RA 3I2HA 4R2MA 3W9SA 3EXAA 4EZBA 3U4HA 5E2IA 4DF3A 2YCBA 2Q1WA 5LPNA 5BWOA 4DMRA 3EXIA 4DIOA 4E1BA 5I4IA 1DCFA 1JVSA 4QDXA 4YIKA 4ZT6A 3R7AA 4ASUA 3CINA 3IUNA 2C97A 2MYUA 2ZSIA 1W96A 3I2GA 5SZJA 2ZZNA 5M7EA 3LMKA 1AZSC 3QKUA 4UTOA 2EQBA 5IC5A 3CMCO 2I4NA 1GZHB 2YJGA 4MQFA 3JVIA 1L4LA 3CF6R 1Q84A 1Y6ZA 2LV8A 3H83A 1UEIA 3O92A 3R24A 4G26A 3PX7A 4DCOA 1PK9A 4I50A 4YI5A 3SJUA 5K3FB 4ZV7A 3KETA 1SBTA 3VO1A 3U5ZB 4OLFA 3IR6A 4RTSA 3QLUC 1VLQA 5EJ4A 3E9DA 1FNSA 4BTEA 4UAJA 1PR3A 1RZVA 2ZI3A 1RPAA 3JQGB 2W90A 3Q15C 4C0XA 4FNMA 1SD1A 2O7RA 2NACA 3DA8A 3H97A 5KYYA 3AL0C 1ESCA 4H7HA 5FP0A 4CR8A 1HTWA 3L40A 5IHXA 2QTMA 5FR2A 4DV6B 2RHDA 2ZBRA 3EFOA 4B7CA 5HUQA 3O8QA 4C4RA 1XO1A 4OLHA 2H7XA 2G9RA 5ESDA 1JDBC 4TMVA 2C95A 3F9RA 1QC5B 3TLGB 1DC6A 3GRYA 2PGXA 2QR3A 3O8NA 5EXXA 1U9CA 1ZN9A 1XVTA 1R3DA 1PYOA 4XJVA 1O58A 3RASA 3S1SA 3FDFA 5BSFA 4FFSA 4KIFA 5F2OA 2SNIE 3TAUA 2VHVA 3ACCA 1UPXA 1XZQA 1NOIA 2NV6A 3L8DA 4PSUA 1OASA 3P97A 2X0EA 3ZDBA 1J2JA 4FDAA 1JPUA 4G85A 2PAFA 2VYND 3UMBA 4FEYA 2C5EA 2QTGA 2BT4A 5LZ2A 2FP3A 4MUKA 4RS4A 3WLHA 3ZWNA 1JDVA 3LCUA 5T4FA 1K88A 3NIBA 1BYUA 3ML1A 5FFMA 4EUEA 3UMYA 4CGYA 1EFVB 5KKNB 1BHO1 4C89A 1A2OA 1P7VA 2XA2A 2XMDA 5DNCA 2INGX 1FXWF 3ETJA 1KI2A 4HPWA 5JW6A 1D2EA 3T1OA 3T9FA 1T2AA 4EG7A 2O2CA 1WXXA 5CCXA 1RWWA 2HLDD 3QPVA 4V03A 5KQLA 2CNWD 5TVKA 1GTMA 3FHCB 2JNWA 1IY2A 4OQXA 5EGNA 2J08A 4RZQA 3ESYA 1BMFD 3L8YA 3LXMA 3TBFA 3VNBA 1C14A 4F72A 5FTLA 4DR5B 3W5DA 3DDZX 3O2JA 4P5EA 4YFVA 4BZWA 5BORA 1C7RA 4P4TA 4HQOA 4MGZR 1J5XA 1PE0A 1TE2A 4O2RA 1DBIA 1YQUA 3PWZA 4NE7A 5EXPA 3VGPA 1YJQA 2AXNA 1Y6GA 3VJMA 3BL6A 1WDTA 4ZREA 5G4KA 4PXAA 4HQ6A 4EW2A 1JR4A 1U9ZA 3A31A 3QX3A 4GXNA 5KNCA 3R5JA 5AXCA 4MRSA 1QCDA 2G6BA 2X42A 4BNXA 1GQRA 2FEOA 2HQ1A 2I76A 3CH7A 3Q5GA 5AP9A 3TW0A 2J67A 5I51A 3CX7A 2OZLB 3HVUA 3K1TA 4YJGA 1SURA 3RVNA 1TLFA 3G8BA 4HWPA 1DRJA 3QV2A 2H63A 4MUBA 2FMFA 4K03A 4TVOA 3C7TA 1TLTA 4ODIA 2FA9A 5AKGA 4UTZA 5AVKA 4B4DA 1S02A 2J33A 4H1VA 2PHZA 3IHKA 3GR6A 2JIMA 1TJ4A 2B1GA 1TW2A 4G56A 4BAZA 1ZNQO 1QQTA 3D3JA 1J4AA 1KEEA 2C99A 2I5PO 3DLCA 3OE7A 3NHFA 1KK2A 1NU6A 5KVCA 1IK6A 4P7GA 3P0FA 3MRTA 5FTKA 4TPKA 3RFUA 2AD5A 1WETA 2O4UX 2H5LA 4HHEA 4UE2A 4D8XA 3QVJA 4TROA 1FDIA 4MR7B 2LP4Y 5CYOA 4QYTA 1FSSA 3TJRA 1DNPA 1O95D 1TQ2A 4RLFA 4TMKA 1M2KA 1X7WA 4R2KA 4DLYA 1NW7A 3BFKA 1PT6A 3DCYA 3EMDA 4OUDA 1FTWA 4PSKA 4ZHQA 3G5TA 2UYOA 1I4TD 3PC2A 3UCEA 4ARUA 3K4HA 5K8TA 2GBLC 4WLUA 3KSAC 4XQCA 2XHEA 2GRUA 1KE2A 1Z2AA 2J3MA 5F1KA 4CG1A 1CUFA 2J5XA 4JUBA 2ONYA 3HGTA 1CB7A 4L1KA 1WZ2A 1ZR2A 5H83A 1OT3A 4DPMA 3T5AA 3T7DA 3G5AA 2IH5A 1D5WA 4FGSA 5DYWA 5G0SA 3B8EA 2P1RA 1I0ZA 3P9XA 3R6TA 3ZYZA 2XGOA 4I1YA 3T3OA 3PF9A 3O2NA 4AUNA 3UK7A 4ZEWA 4QREA 2HA2A 3ED5A 1YBFA 3HH8A 4CYMA 5JVDA 2I6XA 1C7IA 1GRVA 1A4IA 1R9NA 1UJNA 3DAPA 3FTNA 4HTFB 4QM6A 2OESA 5BN4A 1IVYA 2VJOA 2FPSA 4FLEA 4CWAA 4YJHB 1G0NA 3OEWA 4Q4DA 3IQWA 5JWHA 1VMAA 4ZK2A 1D0SA 3H2IA 1M7BA 3GCXA 4X8MA 1PX2A 3UPDA 1C9DB 3WL8A 2VI5A 2YWEA 4KQ1A 4CEIB 5ICEA 2GUWA 2IIBA 1CR0A 1ZONA 2NTJA 2P2SA 5CDTA 4P32A 1QX3A 3PYLA 3WV4A 4JT8A 2ZR7A 2DUJA 2FKAA 1J8YF 3PIIA 1IRXA 3RV3A 4I9NA 4JL8A 2K4MA 5KTOA 4DKJA 3UJ9A 4XX1A 3IAM1 4QYIA 3K1JA 4B3CA 1L5MA 3E5MA 3NS7A 1CJCA 1L4EA 3BH7A 4OMFG 5CVCA 5J5AA 1D2AA 1LSOA 3DV0B 1XJ0A 2RK4A 5B6JA 4CG0A 1Z6TA 3DFIA 1EIZA 3O4JA 4ABTA 2IZ6A 3SD7A 4C6HA 5AW2A 4C2BA 3GV0A 1MOQA 1Y80A 2IU6A 3TNJA 5JH7F 1YS6A 2G76A 4ND8A 3H9UA 3M4NA 3T5MA 3UIEA 3HJUA 4MVYA 4JU9A 1U0FA 4QFMA 2XCTB 1T0BA 1SG0A 4HB2A 4RZUA 4KHPB 3UFXA 2JGJA 2XA1A 1XKLA 2H1LA 1G21A 4JH0A 4O2BB 1E2MA 4KAXA 4J4BA 4TL9A 4BX3A 4F5WA 3DO6A 3I6QA 2RAVA 2RH4A 5I01A 3PXXA 5HUJA 1CIPA 3EXEA 4PYQA 1R6UA 4UTXA 5AHKA 4F3CA 3NWPA 4XQ9A 3LTNC 4IH1A 1JJ7A 4DAEA 1EX1A 4FDMA 2Z5VA 3FUCA 1FCJA 3FXAA 1BVYF 3I32A 3P52A 3QKWA 5ALEA 4UNIA 5F7ZA 3DZGA 2YRXA 4BNGA 4DLSA 1NP6A 4DR1B 5T4HA 4FILA 1D9XA 2EF1A 1CQIA 5E6SB 3C85A 4NU6A 2Y0BA 4PZDA 5EJGA 4YYEA 3ZIAA 1DC8A 1ZI8A 1ZRSA 1ZW1A 3UT6A 5AVWA 1BN6A 1E94E 2PEYA 3NZEA 2CJWB 1Z2CA 2PSJA 3HP4A 3NBXX 4V0KA 4ZI5A 3ZN2A 4HG2A 3KKKA 1B43A 1CERA 2GPBA 1IXZA 2F9FA 4BNKA 2WFLB 4KXFB 5KVQA 1JSRA 1UWVA 2JI7A 2XUIA 5DNVA 3HB5X 3CUVA 4N7RA 4NENB 1ZUWA 1G9TA 1GA4A 2P3QA 5CK5A 3NVKI 2VAMA 4IXWA 3WI7A 3ET5A 2G0NA 5JDIC 2ADOA 1F60A 2HHJA 2WF5A 5D5HA 1C3VA 1M6EX 5K0BA 5CHYA 2QLJA 4GAEA 4P4SA 3ROFA 1UL1X 4KO2S 1ST2A 3K8QA 2BYTA 4BMDA 3TZBA 2PA3A 4F21A 4QLOA 1U2GC 5HGXA 5BVGB 5ITWA 3CW8X 4ZCRA 1GADO 4GMFA 1BMQA 1TDJA 1M1YA 3AL3A 1PS9A 5E0OA 5B5SA 2O5EA 2PUCA 5HQJA 1JE0A 1GAEO 3QP9A 3BMOA 2B30A 4OATA 3Q3GE 2XXAB 3HCPA 5CX1B 3L7AA 2PFSA 3AFGA 2WF9A 4EL0A 3CNNA 4DLBA 2CLHB 4PG7A 3W6OA 2H7VA 5JSZB 2Z2KA 4O1IA 2YVKA 2ZYSA 1USGA 1ZD5A 4H9GA 5JCOA 3L7NA 4DZRA 3ENVA 2XEXA 3KS9A 4I9FA 4EYKA 1AKUA 2G1PA 3AZPA 4O2AF 2FSVC 3T34A 1ISIA 2OXRA 3A4YA 5FNZA 3UGQA 3USZA 5J1SB 1EUZA 3ZWVA 3G5MA 2H5IA 2QY6A 5BNWA 5EJIA 2PS0A 1V47A 1H4TA 3FVRA 4LJYA 4RIFA 1PUJA 4IVQA 3RT7A 3WK5A 4FOTA 2D7DA 4PYIA 2GFIA 1D2CA 3QH4A 4K9SA 3L7OA 4O08A 4G0VA 3E2IA 5GONB 3I01A 4ZV4A 4RL6A 1II8A 1EVLA 2IYFA 3R0VA 1ZGHA 2OHGA 2QW1A 2VJMA 3D1LA 4MV0A 1FYFA 2BUCA 4LGYA 5EZ6B 1IMOA 1XL1A 4JJAA 3OA0A 4L8FA 4ZOCA 3U3ZA 1ODSA 3ILSA 1JAHA 3AVTA 1E62A 3AERA 2C31A 2LUOA 5FCDA 3RU2A 4U2GA 1E3MA 2CMDA 3L4BC 3DT6A 3O4RA 5K6RA 5TEWA 3O3NB 1W35A 2X86A 4G89A 3ZWOA 4D42A 1GNSA 4NABA 4PSCA 2G1AA 4YP5A 3D0KA 1BA3A 3MT0A 3LZCA 1PSDA 5B57C 4RA9B 3ABZA 1BE0A 1JEOA 1XDZA 5EY5B 2YS6A 3H6GA 3S1LA 1WUYA 3EZYA 3QBVA 1ORHA 1VDZA 3E3MA 2AN5A 3LBNA 4PZAA 2SCUB 5C8YA 2HYIC 4G2TA 1S5PA 4F3NA 1CQPA 1NWHA 1HYBA 3VR4D 4RSGA 3K0EA 2AG8A 1RWMA 3IAHA 4FHFA 2F59A 1CUVA 1IATA 2CLLB 3D1VA 3WBJA 4LQLA 4EY4A 4R1TA 3TE7A 4HQLA 2E4ZA 2W83A 1X1DA 1TAUA 4IFIA 2DQZA 3OQNA 1NE2A 1JQBA 4RHCA 5IAEA 4XVCA 3KNZA 3U3OA 2V9ZA 5AVYA 1JDNA 1SUAA 1HFKA 4I3HA 2WZDA 4WCVA 3MTQA 4QPJC 4ADSG 5I47A 3MW8A 4XPIA 5JAQA 5DGDA 4R51A 3RAJA 3BWMA 2QAJA 3V8RA 1L3BA 4KXWA 3D2LA 2CV0A 4GH5A 5GJVC 1MU0A 2JFBA 2PGAA 1I80A 4MHOA 1DQYA 4B5LA 2AOXA 4JJZA 4ND2A 5IVIA 3A6LA 4CIWA 3ZWXA 2CF5A 1NQUA 4J0FA 1J9EA 1F8FA 2D6FA 4F2DA 5JD6A 4MRMB 3UWDA 3GJYA 2VSXA 4GBJA 1FUYB 3RBVA 3ZGNA 5IT4A 4HFJA 1DV2A 1CEQA 3DBRB 3JD2A 3NQ41 2QZZA 1OOEA 3OPYI 2HRZA 1NVWQ 1M2GA 1OY1A 1QFSA 4WOJA 5DIZA 4QHSA 4EPWA 1HFJA 3GH1A 4X20A 1W36B 3FZGA 4FIDA 4Q1BA 5JXGA 4MCIA 3IAS6 4QOHA 2J0QA 1US8B 1E3WA 4I1IA 4D4LA 1JFRA 3W3ZB 2EEZA 4G97A 2CNLA 3RIHA 4HWGA 3DBLB 4NBLA 5MGBA 2AOUA 2AN9A 3LBIA 3LGSA 5BVHA 1OLOA 4EF5A 1T4MA 2ZBPA 3V2IA 2IYQA 3C48A 3I9LA 3BXFA 3LUHA 1YFZA 1RM3A 3ELDA 4IGFA 1NOKA 3E6AA 2PU5A 5A62A 2VDRB 1JHMA 5FLYA 4E3WA 1P4HA 2VHTA 3CEAA 3CQ9A 2VF5X 1SXJC 2ZBDA 3BDAA 5IUNC 3WADA 2QRUA 1K7EB 4Q4AB 2A9RA 3NASA 2ZR8A 3FUVA 5JV5A 4L5JA 3CB4A 1ZX1A 3W2EA 4GUAA 5DN6A 3GFPA 5H1YA 4YJKA 1LC0A 4YAGA 1YL7A 3RF6A 4Y1GA 3WIVA 1SU4A 2VNSA 4HSEA 2EZ8A 3LW7A 3MT9A 1P3JA 4XR4A 3DLAA 4UTRA 2YV3A 2ZJ4A 2JW5A 3ASYA 4LDZA 1JBKA 3JZIA 3E8SA 3MAGA 4C01A 1UWKA 5JY1A 2NUBA 4KKVA 1L5HA 2P0YA 4W6ZA 1N6HA 2BKEA 2C42A 1D4ZA 4JEIA 4TRJA 4RTJA 4HMQA 2IJGX 2PLAA 3RUPA 1OUMA 2V9CA 3OZFA 4FE7A 1VGVA 1CZLA 2LCFA 3DWFA 4HPJB 4UEOA 3ZNQA 1QBKC 2LGJA 4ND1A 5AJHA 4US2R 4R0MA 1DPGA 4IJWA 3AP1A 1N2BA 3JQQA 1O1YA 4B0OA 4CLXA 1KZ4A 5REQA 3W3AA 1YDEA 2FJPA 4MP8A 4FJ2A 3ETLA 3IR5A 4LHZA 2W4IA 4ZO6A 4ECEA 3N0VA 1XALA 3KZKA 2O7SA 3C6QA 4XXHA 3MAJA 3C5VA 1P9RA 3WGMA 1SXHA 4A0HA 2G5PA 5TV2A 1DDOA 2C4WA 2CSUA 4QG7A 3PWKA 2D1SA 2HCBA 2GZHA 4RD2A 3KXIA 3EQ2A 4BV3A 4C0SA 4C29A 2ZBEA 4KQMA 3WLOA 2AGVA 4BB5A 4EY7A 1MB2A 4KVZA 2BISA 1II0A 5DASA 2A9PA 4IV8A 3G2QA 3KCNA 2QS9A 3AHEA 2P9ZA 5A1JA 1DBWA 2O57A 4ECAA 4Y9TA 3SQOA 1CVRA 3D2CA 3GGJA 1UPBA 1GTRA 1GTZA 1ORRA 1SHJA 2XNDD 4HQRA 5B64A 5HMMA 3K5WA 2GPNA 1OYOA 4BZXA 4Q9HA 2V5VA 3RYCB 3SLGA 1VSUA 3BCUA 3MEQA 5B2EA 3C7KA 1UK6A 4XCXA 1KEPA 3JVUA 3KU4A 3U48A 1MNQA 1W52X 1TYEB 2FPXA 2G7MC 2QM3A 2YASA 3ODGA 3ONNA 5FOTA 1XAJA 3AEXA 4MAMA 1IXKA 1X80A 1Q1QA 3WK9A 1W8IA 4GOMD 4P6VF 4BO8A 2NO7A 1EDOA 2NQ2C 3H05A 1FJXA 3WWDA 2DWCA 5K03A 1JIQA 4GYKA 4NMWA 4C0AC 4CXMA 4Y2PA 2I9KA 4R8VA 1HZZA 3DB2A 4NG5A 5KVAA 2F7SA 3P2YA 4LBWA 2A0YA 4WE3A 1NL3A 5DI3B 3EPJA 3ASVA 2Z98A 2CVHA 3SYKA 3TW8A 3UKOA 4KODA 4RJIA 1XA3A 1J2RA 1ARZA 3HCFA 4F6CA 1K98A 3I9NA 4W5JA 4OFWA 2HA6A 3HBLA 4ZDIA 4V0OA 4TS4A 1TIPA 3Q2KA 2Q6KA 1SIBE 4YCJA 3WGVA 2ZM6B 3HXMA 4FQ7A 3ZR4B 2VH2A 2JLQA 3F73A 2PMWB 5E7JA 2FPPB 3VRHA 2MYNA 1E2LA 4W1QA 1IMJA 1WM1A 3E22A 2AH5A 3IDZA 3OJFA 2X8JA 1BJKA 4W5HA 1T91A 1ABBA 3B2QA 4LHXA 4CMCA 3AYZB 3IUBA 3U1BA 3LPDA 4RA6B 4YPFA 4DFDA 1KPIA 1IU9A 5EEGA 3RVDA 4H7KA 4CL0A 5IYZF 1WDKA 2G04A 3KTDA 2VJKA 1ODKA 2F6RA 1L3IA 3I73A 4AQ7A 1F7VA 4E6EA 3S5UA 2HSEA 1N7IA 2X22A 1JEDA 2EBUA 1ML3A 3RW9A 2DFLA 3OCVA 3QSGA 1EBBA 3GGOA 4LPKA 3TE6A 1U8ZA 4RH0A 5AMXA 2ZSJA 5J4VA 3WJ2A 1MA3A 2ATVA 2DHCA 3MFQA 4HD8A 3LDHA 1W25A 3DDUA 4TS1A 4IQ0A 1H8EA 3JALA 1E6KA 1QO9A 3S1AB 3N7UA 3E05A 5MN5A 5J3JA 1WEKA 4Y6QA 3F2IA 3HQ4O 3RJTA 1FS5A 2J9YB 1RI5A 2AFHB 2G4LA 2BZGA 3PDWA 1O0BA 3I62A 5CLFA 2HIHA 2QAIA 4JSTA 1RJDA 5CG1A 2H06A 5BW4A 3WIOA 1FLVA 4KQIA 5ER9A 3S7TA 4L4RA 3ZUPA 1UP7A 5FOQA 3D1JA 3OURA 4DR4B 2MTBA 1QIHA 3GZ4A 2I1WA 2HLHA 3I37X 1ZSYA 4W1RA 1AS3A 1TO1E 3W5VA 4A82A 2H6EA 4NRDA 3A6EA 3PGVA 5IVDA 3T4EA 4E21A 4L6CA 3MINA 2YMPA 3CH4B 3CJTA 3EZGA 4NFYA 1ZK1A 3T9EA 1A8HA 2V5UA 3A3PA 4IDQA 2WSMA 2V1XA 2C4VA 1FIUA 4BQEA 1TQ4A 1XRJA 4ZGBA 1TO2E 1X1AA 1VL1A 1P1KA 1FYWA 1P7WA 1QTNA 1SUDA 2NSDA 2P67A 1LWOA 2X7JA 3IUMA 2I54A 4ILEA 5JJLA 4HXYA 2F9MA 3L6CA 1A8UA 5SY9A 1P2SA 1LLFA 2J41A 3BXGA 1V8ZA 2Z95A 1DRVA 1SU7A 3TGPA 4YUZA 3ZQKA 1DJMA 1G2QA 2WJVA 4KC0A 3L6EA 4WASA 3QSYA 3RVBA 4C3VA 2ZI6A 4QSMA 3LLCA 1D09A 1IFXA 1O96B 1N2GA 3PHJA 2BI4A 5CLHA 2ONJA 4C0QC 2G67A 2P35A 1JA0A 2QUBA 3UBTA 2BWJA 2C9ZA 3DXYA 2VIIA 4RJKA 1HDCA 1BN7A 1HFWA 3PCRB 2WTMA 4A7PA 1U3GA 2EFEB 3N58A 3SM3A 4AUMA 4BXOA 4LOLA 2CNBA 3GEGA 4LMBA 4P2BA 2JS7A 3BFPA 2IPLA 4DQDA 2GAOA 1M34B 4L02A 3AEQA 5EIWA 1ENPA 2IUTA 1Y63A 1Y42X 1V3VA 4OL0A 3HWX1 1XB2A 4ASUD 3U13A 4CUZA 4EX6A 4CEHA 1WY7A 4UU8A 3M89A 5KS2A 1LRLA 4IZHA 2OCPA 1UXJA 3Q8WA 4PHHA 4R05A 2CBXA 2PBZA 3C7DB 3HHEA 7YASA 1DBRA 2NU9B 5CB6A 3VR5A 3GXBA 3N5KA 1LTQA 1YC5A 3KHTA 2IHYA 2PIDA 4TMXA 4UEJA 5D6NA 4IHKA 4H7FA 1RYYA 2P2CA 2WHPA 5DU2A 4QPDA 5JC8A 1GU1A 2D7CA 4BIIA 2FFRA 3EMVA 3EW9A 3L0BA 1MRNA 3O1JC 4FMBB 1S8AA 4I2NA 4J0CA 4RK4A 4YGXB 4BWYA 4HDNB 4X00A 1L4MA 5AVZA 1VJ1A 3EIUA 4MIEA 4NPAA 4ZPXA 2WWHA 4DLTA 2ZYUX 1RRCA 2J3HA 3AR2A 3G2OA 1I13A 1ZIYA 1P7ZA 1D0IA 3Q5EA 4I4LA 5HZMA 4AJ4A 2FSPA 1JIKA 5FYDA 1NIPA 2CVZA 4LXHA 2JZOA 4O4JB 5ESWA 1ZD3A 1F4PA 2CY0A 3MUOA 2FZVA 5ICSA 2BEVA 3OAAA 1KYWA 3PUYA 3SZRA 1UFKA 4Z4QA 2IZOA 1ZOPA 1EKXA 2JJ1A 2WMOB 2XTMA 3PUZA 4IMJB 2ZWPA 2QJTA 5FNVA 3IEMA 2WF8A 1WDWB 3HXLA 1Z5ZA 3DVSX 4DXAA 1Z0AA 1IZ7A 1SQFA 3BMQA 3FCOA 3R0JA 2NSYA 1CR6A 4KH1A 2NN3C 3AOEC 4TUYA 1FLDA 1BGXT 1FYVA 1W73A 3LIIA 1KI1A 3PPXA 4URWR 1NQ5A 4KVAA 5FBQB 2BHTA 5AESA 2H2HA 1E2UA 4LF8B 3FTFA 3R2JA 4PU0A 2FI1A 3WLLA 3IP1A 1XCPA 3KOUA 3SFZA 2EWMA 1VRWA 3O0TA 2YHAA 3PDCA 1G7SA 2JHCA 4J7XA 3BGIA 2NXWA 1G291 3GT3A 3BORA 2AJTA 2XB9A 4GO1A 1XA0A 4WJLA 4R3WA 4EB3A 4Z3OA 1XPJA 4HNRA 1Z06A 3T99A 1MOSA 1KHTA 4PSDA 2C5SA 4I1OA 1RHKA 3E48A 4IDGA 3TD6A 3B2NA 5E1MA 2D8AA 4HEJA 1XGKA 3WGZA 4PY2A 4MR9A 1N5RA 1CEEA 4LWZA 4UW9A 3I34X 1ISSA 3RYFA 4V0ME 3UB4A 1TM7E 3OUZA 4URUR 2GOYA 3KR0A 2DFPA 3DHEA 5KWIA 1VE5A 1L5RA 1U0NA 3SQDA 1N0HA 4Z7NB 1ZJYA 4LDAA 4D0NA 1EFHA 1Y7TA 1HDIA 2XI4A 4L6AA 4O59O 5KNCD 3UMSA 1V16A 4ACAA 3ZW9A 2XVMA 4U4AA 4B3HA 4U7DA 5CA1F 3WGQA 3N0WA 4BVEA 4L75A 1YS4A 2M2IA 3DTVA 5HHTA 1G5RA 3BMCA 3FTDA 4PYMA 3KSRA 1Z8HA 4IIEA 3ROTA 4MVCA 2PTGA 4NBWA 3RLFA 3OJEA 1G5IA 2PPLA 2F90A 3UJNA 3MWJA 2AXPA 2RGAA 3FKJA 5F23A 5BN5A 3C1UA 2R7AA 3WISA 1ZVVA 1HWYA 3QUCA 4XVQA 4M99A 5IFLA 1MV5A 1NV9A 3OE7D 4GWLA 5FBZA 4JVMA 1K7XB 1L5VA 2YZ7A 1W34A 4FFLA 3X0DA 4JR1A 1CG6A 3DOFA 2ZCJA 4GQBA 2CK3A 2ZI4A 1TK3A 1FP6A 2GJ9A 4HGQA 4ZVPA 2CLKB 2JLCA 4CCSA 2RHMA 1H4SA 1H05A 2A1UA 4TT8A 3WL7A 1OA1A 2RHHA 4M0UA 2Y66A 4MVJM 3CR3C 3WDLA 3B6MA 2AG5A 4YRCA 4A0RA 4DC9A 2IYZA 1GPUA 1U2DA 1WD5A 2ESRA 5BOSB 4R1PA 3OZVA 4IEIA 2PYDA 3P9IA 5THQA 4EI8A 1J06A 1RRMA 1U04A 2A0XA 3D8NA 3P26A 4Q7MB 3B78A 1G42A 1NW5A 5AIAA 2KS6A 1TJPB 4GXQA 1KZ7B 3GGGA 3LXXA 3AR3A 3KLBA 3P2MA 4N6GA 3L7CA 1ESZA 3ZTWA 1PEDA 2B82A 4MWCA 4BKUA 3L7IA 4KYTA 1XTJA 4FX2A 5ARDA 2AFHE 2FQYA 2JL1A 5AW5A 3W6NA 3ES9A 3F3MA 4M83A 4QA9A 5CJ2A 3SQWA 1OI7A 3UGJA 1TA0A 4WK0B 4ZMSA 3FM9A 5C7OO 1CF2O 1OTHA 2IPAB 4UDYX 3OZXA 2IY9A 2ETXA 4MQLA 2Y27A 3WLIA 3TAXA 4E46A 1FTGA 4N7MA 3GZJA 3E23A 1E60A 3ECCA 3EF3A 2JRCA 3FFTA 4FUQA 5KTMA 2PZKA 3ESCA 3QLEA 3WA7A 2XYHA 3RBZA 3GNQA 5MF6A 1KQOA 2Y68A 1YZFA 1IRIA 5C80A 4J1TC 3LK7A 3ADKA 2HCFA 4G0MA 3A6PC 3FDXA 3IAXA 5AJYA 3UJ6A 3OJLA 3HA3A 2OV3A 3NU1A 2JF0A 3IJEB 3BD8A 1DAIA 2WJPA 4I1PA 3KEQA 3RVKA 4QXOA 4RE5A 2JFFA 1QVAA 2UZ4A 1FSZA 1KAEA 1Z8DA 4QBFA 4CHGA 1E1CA 5EKUA 5EE3A 4CHTA 2F1HA 1FTSA 1Y8RA 1ZJJA 3DZIA 1B7GO 2WC1A 2ZB2A 3WLJA 3U39A 4Z99A 4AJJA 4FCCA 1N3YA 2IZZA 4HQNA 1BW9B 4Z2YA 4EA7A 2W2NA 3BREA 3KHSA 5HUHA 2NXJA 2GSDA 3MGBA 4QT0A 4WXYB 1ZDMA 2ZWVA 5H80A 5A2GA 4U6QA 1E9CA 3SX4A 5HX7A 3BS4A 5DWVA 3BGSA 2EWWA 1GZUA 5I7AA 2ZRCA 4FT4A 1D4AA 3SICE 3MQFA 2OGUA 4GKBA 4RHEA 3OFVA 1T8WA 3LLUA 3T3GA 5K8UA 4TMTA 1M34E 1UH5A 2REQA 2W5UA 1U99A 3D02A 3DE7X 1QZUA 4BC0A 1M0EA 1RWNA 4PQGA 4I1SA 5EVCA 4XR9A 1BWPA 4N3CA 3K30A 2FMXA 3P0HA 4ER3A 3I5XA 4XLTA 3RDPA 3BGWA 4QC2A 4D4HA 3GMTA 3QWBA 5J2TB 1A96A 2FSIA 2W6QA 3H9JA 4IBOA 4N3BA 4M9XA 4DMMA 4NOJA 3LX4A 2PM8A 3O26A 4AZTA 5JRDS 4D4MA 5K8LA 1TIBA 3O4VA 4HNAB 2Q7OE 2R751 3K1ZA 4FI3C 4I0WB 2B9EA 4PLVA 3L8CA 4TXHA 3ZIAD 3ZQ6A 2B4QA 4IG4A 1KARA 4QICA 4QHYA 1QWOA 2OAQ1 2RHLA 3R7FA 2RIRA 3FNFA 1PUIA 4K46A 4CETA 1T5LA 5FWNA 1E1MA 1SJ9A 2QRKA 2ZUVA 2W2QA 4FC7A 4LJ5A 4QGGA 4L78A 4XIGS 3KXDA 1V6CA 3H2HA 4WDQA 1XV5A 3STUA 2VXYA 3ISTA 2FQWA 2ILVA 1W0KA 5TGZA 1XTUA 3T9BA 4AF8A 1W4AA 1AKWA 4FFNA 4G8DA 4W1SA 4MHTA 4L15A 1YRYE 4U2EA 1VP9A 1L7NA 2IP1A 4CTJA 3UG6A 5B1EA 1QAMA 3PC6A 4UUQA 2GZSA 4NJOA 5JSKA 3OPQA 1ZVKA 2PUHA 3GDGA 3RSSA 3TTVA 5EJ2A 1L3CA 2QW0X 4CV3A 1CP3A 4GR4A 3NJ4A 4FB4A 4QXRA 5AKYA 3R9WA 4CJXA 2OFPA 1TW3A 2XJ4A 1X8JA 5KINB 1QV7A 1Q3KA 3MJDA 4GWGA 4W7IA 2B5VA 3VU9A 4RKQA 1ZKMA 1NJ2A 1JEEA 2C0QA 3R7WB 1RHQA 3ZJ5A 1SUIA 2NNWB 2HWUA 4K0RA 3N39C 4Q1CA 5A4FS 2JD0A 2OFXA 4R81A 2HRRA 2PVSA 3SCZA 3GZTB 2GPSA 5I48A 4NYIQ 3EHDA 2D2IA 4QRIA 2G9VA 3CUKA 1XLTA 4Q9IA 1VB3A 1E4EB 2YMQA 3KVNA 3PF8A 2FFHA 2RJOA 1RJWA 2W71A 3KEOA 4HBZA 1GAQA 3E7WA 2Z2ZA 1M2OB 1NP3A 2QSJA 1IDOA 4IR7A 3IEVA 4PXYA 1NC3A 3ZK8A 1GUZA 1SVUA 4WXPA 1UBOS 3TOZA 5JT1A 4LYFA 4JGIA 3ICOA 3JARA 5HXAA 2OGSA 1Z08A 2R5FA 4BQRA 1UJMA 2JBWA 1L1EA 2XWQA 2HU8A 5TMEA 5FOSA 3I2IA 4H08A 3R0ZA 3DTNA 5THKA 1FQWA 2P9YA 3ENWA 2WWTA 4I08A 4Y2GA 1JF8A 4WZAA 4JLAA 4K26A 4C0KA 3L05A 3I72A 4DWJA 3IFSA 4E07A 4AKEA 1U7DA 2UV8A 1HT2E 4YJ3B 3T5BA 2VUHB 1FYDA 1MCZA 1GZSA 1JDZA 1V1MA 2QTLA 3D4BA 3GJTA 3HN7A 1XMXA 4M8LA 4QG3A 4ZIRA 3LJKA 3I83A 4LY9A 3R3HA 4EVSA 2ZITA 4Z49A 5C5DA 1JS1X 4BAGA 2VNAA 3TZ6A 2R9VA 5JI2E 3NOOA 4RK6A 5LBIA 2IX9A 1S2IA 3DE5X 4TYQA 4D9CA 2WWFA 4ML3A 4MJ7A 2B8NA 1SQ6A 4MVJH 3VJKA 3KX2A 1V48A 1ZITA 2FP4A 4MS4B 4UXJA 4L4YA 1JLLB 5A05A 3HUFA 3QVSA 4MYCA 1ZU5A 3GNLA 3AJAA 4FXOA 2AYYA 3O3OB 4QLBA 1I9GA 4FCVA 5IAGA 3VX3A 3W8FA 4BFXA 3O7WA 5EE9A 2GPJA 3LBYA 2AKEA 1V5FA 2X58A 4TLEA 3TRHA 4UHHA 1RWBA 2JBHA 5FTJA 3JX9A 1GVHA 1R6DA 5C52B 3UW3A 4L9RA 4N3GA 2H1HA 3ERCA 3UQZA 1I7SB 5CLQA 3BTOA 4FDTA 4DDMA 4P2GA 2NUTA 3IAUA 2C92A 5KU7A 4FYIA 3EXHB 2CDBA 2GR9A 1NZDA 2AZMA 8OHMA 2IHVA 2Z08A 1ZN8A 5JPCA 3QE9Y 2F00A 1TVKB 1PBNA 4OK3A 3SVZA 1MQ9A 4YRMA 2D5CA 3ANLA 1F48A 1XCJA 5B4VA 2IHTA 1HOTA 4OKIA 2V7QA 2VWGA 3T3HA 2PWZA 3EZFA 4MGIR 1A98A 3UA4A 4L0DA 1M67A 4G81A 3SZUA 5FD8A 3LT2A 1XMSA 3HYSA 5LU9A 3FD8A 3KWMA 2HWWA 2OHOA 4JU8A 1VRCA 4N39A 4QOFA 4K9PA 2WF6A 3LPLA 4Q3AA 1YL6A 5EYPB 2G83A 4AJ2A 4N40A 2PL3A 4V0LA 2MYPA 5F5LA 3H9EO 1QO0A 3TGLA 4TXLA 2DCUA 1F2UA 1E2QA 2UYYA 3ADOA 3DGEC 4IDCA 4QOIA 3W78A 1WCYA 3T1TA 1E6WA 3L8EA 1CRWG 1ZCJA 2VDVE 3ECAA 3PUHA 4CF7A 1Z63A 4K9MA 1VLVA 1BCSA 1BH2A 3FBWA 1NNLA 3OCCA 3T95A 4TWRA 2TSYB 4BVJA 1T2FA 1T1SA 3PEEA 1T9CA 2QT9A 3LM8A 4X93A 1QTQA 4ZI7A 1WKBA 3DUFA 4KR3A 4UCFA 1X1EA 3AI2A 1UOPA 3N59A 4UM8B 1B26A 5H9VA 4C6SA 4KAAA 5JE8A 2YFYA 5E4TA 5EP3A 1X7XB 4KK3A 4GMHA 3TQQA 4YNBA 3AI1A 2VJLA 1WP9A 2I62A 3QEOA 1YZYA 1JH8A 5DTRA 3PVZA 4HDMB 3C7CB 3FYUA 1H2AS 4E11A 1HEUA 4NJEB 5DN6D 2EJWA 1RWXA 1RU3A 4ACBA 1L7DA 1YAJA 4PWZA 1RWVA 3D5TA 3UTDA 2CL7X 3PEVA 1C3OA 1OZHA 3D8UA 4BN5A 3FSJX 1KOFA 2DTDA 1J21A 2R6DA 4KUEA 4RLHA 1QS0B 2FFBA 5JDCA 2VXCA 3RSCA 3C4JA 3WWEA 1PNTA 1XTVA 4DLRA 3HYLA 4OXQA 2IYRA 1TZ2A 1FFSA 2VYQA 3TPCA 4GPZA 4CTKA 2Z8YA 4XA8A 1X7YB 3CV3A 3IMKA 5JLAA 1CDZA 3OP1A 4R68A 1YDGA 4QXPA 3S2GA 1GM5A 2GAAA 4KQHA 4BMNA 4FQ8A 2A6PA 1YQEA 1J5PA 5F9MA 2GAJA 2N75A 5LZ7A 1VPEA 3EWSA 4FT2A 5BYAA 1QMPA 2AFVA 1R50A 1YB5A 2ZJBA 4JMLA 3W3AD 1AO0A 1BH6A 4PLYA 4LRSB 1T36B 4HRYA 5A3SA 1N6RA 1KI6B 2WDPA 3ZWPA 4DWOA 1N36B 1M10A 1CUEA 4IJUA 2Z6VA 4GC9A 5ALYA 1UT6A 1LF0A 1UKEA 2DPYA 5ENZA 5L7YA 5IASA 1NF8A 3QMWA 1YB7A 2Y71A 4X60A 4RTOA 1ZR4A 2G17A 1AG9A 3ESBA 2AOWA 1JVBA 2JFGA 2WICA 4ICIA 4IIGA 4MAFA 1SG6A 4INZA 1WUHS 1X38A 2B5WA 2MMGA 3OE4A 4L3VA 4LDJA 5LNK6 1EG2A 2I9PA 2IF2A 2NU8A 521PA 1TOAA 2QSZA 3RB8A 5LQNA 2GCGA 3FW1A 3PDIA 2Q1UA 4Q9JA 1H8HA 5FHQA 2PUVA 1QTIA 4E1AA 2W4MA 4KQ2A 5ALZA 4RULA 2EW1A 2I55A 5BSGA 4ESVA 2EKQA 2KSQA 3C8UA 4KFUA 3VPFA 3WLKX 5MHTA 1Q50A 5JHGB 2XYQA 2GCNA 4ZOLB 5JXJA 1IOVA 2ZTVA 3WLNA 2WOJA 2C2OA 3HU1A 3HV0A 4MGHA 5DK4A 2YWDA 3DDOA 4YV7A 4LF7B 1PU2A 3EHEA 4NS4A 2OBMA 3OSUA 2FFAA 2WKRA 3DAFA 2XBUA 3ANSA 4QATA 1RRVA 1JJAA 2VKTA 5AR1A 2I6SA 1OFUA 1GNVA 4DM3A 4FNOA 3NUZA 1GZ3A 3WYEA 1XJCA 1GRQA 2X15A 3AEUA 4QDOA 2XQKA 1W36C 4JHLA 1XPOA 4Q12A 1LBQA 3CRQA 3RHFA 2WJWA 4CIDA 1UBMS 2QRVA 2FF7A 5K2MA 5KWSA 1GDHA 3DO8A 5CT6A 1PFVA 2X9GA 3PHGA 4E4TA 4KTTE 2AYZA 2WOOA 2WT8A 4Q24A 3U81A 1KJZA 4XQ0A 1JIXA 2GGSA 2FPIA 1LVUA 1USUA 1PKEA 1Z0UA 1IQ0A 1U0OC 4MO2A 2DYKA 1I5OA 3OOWA 2EBWA 4BPRA 3D3KA 2BFEB 3T0GA 4KAJA 2I3ZA 4K2HA 1B8NA 2GEFA 2QV0A 4FFBB 4WT7A 5TY0A 1XLVA 3SHTA 1E0DA 4Q1VA 1GA1A 2PKQP 3F96A 4K86A 1Q1GA 4W6QA 3JU3A 4YRQA 1CVLA 1U6IA 1XXHB 3OETA 4GGOA 2GPAA 3TTTA 1MDFA 4EF6A 1IULA 1JFLA 1KGSA 3T5PA 1NXPA 3MRSA 2P69A 4Q1EA 5DLQC 3RIGA 1ZQ1A 1VJDA 4HKTA 1Y1TA 5SZKB 3VPHA 2NZXA 2GA8A 3T7EA 3N8HA 2JK1A 5KREA 4HLCA 4KBFA 1NDQA 3GFBA 3W2GA 2O8EA 1CJMA 1W48A 2RGNC 3QQPA 2N1BA 1TECE 3QWHA 1M72A 1NW9B 1UXKA 3F8SA 4GP9A 4O2LA 3IVAA 3E1GA 5TQ0A 1OLUB 4KVFA 4Z9AA 4B0PA 1G8HA 4PHFA 5CT5A 5CDHA 1JIIA 2NOAA 3OTHA 2B8TA 1UEJA 3GLQA 2QTVA 3DE2X 4UUOA 3ZHXA 1PR6A 3OT5A 3ZZUA 3CR8A 4TMZA 4E5NA 4DTCA 1YIDA 1C41A 3MNFA 4K9LA 4O0MA 1R6TA 3VVBA 1Z29A 2XKAA 3WXMA 1UBCA 4OP1A 3QKSA 4R69A 1VHWA 2IPMA 1D6SA 3A04A 3BSSA 3DVQX 2GCOB 3IJ5A 4HS9A 3U3KA 1WTAA 1RBZA 4AG6A 1ECJA 4Z86A 1N0WA 1JSXA 3PR3A 1H8ED 3PK0A 4QPCA 1D6JA 1MOZA 4PX3A 1B23P 1Y9EA 1YQ9A 3L1UA 3UC9A 4Z3DA 1XZ8A 2C2HA 5LP1A 1RTKA 2OHHA 4HXEB 4YACA 3IDAA 1H69A 3EY9A 3ZZ0A 5LXTF 1J2TA 5AKZA 4ER6A 3OWHA 4DIFA 2VXOA 2WM2A 2ZAOA 2PFGA 5CDFE 4OJQA 3GJ4A 3HDQA 2O8DB 3ZI7A 1V9SA 1EJ0A 3ZNNA 3OQIB 2VDNB 3LQQA 1D2NA 2XQFA 4Q01A 2NM0A 2WABA 5BR1A 4PANA 4FYXA 2QBYB 3EK2A 5T6MA 4Y2QA 3WGTA 3P5SA 2G63A 2Q3MA 1X42A 4M8SA 4YP6A 3AVYA 1K9SA 3N87A 3ONEA 3M6XA 3SDSA 5IVKA 4ARCA 4LW8A 1Q3HA 1UFRA 4BNFA 3ULKA 1OD6A 1QGOA 1DFIA 3EFHA 3WHKA 5LN1A 2IC5A 4PGAA 3IP9A 3KE8A 3W4JA 2JASA 1YE5A 2P9TA 2HEIA 1T2NA 2QVYX 4BV2A 1L9KA 3BSYA 3JWHA 2Z8ZA 4C05A 3MD0A 3DEJA 2CD7A 2HSGA 3KOZA 1L7EA 2B21A 1GQOA 3L1HA 5ALMA 5DYIA 3TXXA 2BEJA 3OCUA 3N5CA 4D4GA 3K0SA 1T34A 2HREA 4G4GA 3GUVA 4HOYA 3GU3A 1NQXA 1S6YA 2D5LA 4RDHA 3GJ7A 4I2VA 3RADC 2HPVA 4UREA 5KDDA 1F06A 4D80A 1JIJA 2GXSA 4F5DA 1DX9A 3CPSA 1N3BA 3R7LA 2IQIA 1W75A 3O9MA 4NC9A 3M4JA 4BLVA 2WKWA 3I6MA 4EEXA 1LLCA 2B20A 3RSZA 3QEMA 2EBFX 3HUEA 4LKOA 5BUZA 1PR1A 1EWYA 4TTAA 1IN8A 4CR6A 4PCLA 4ZQEA 3L92A 3PC7A 1SCKA 1L7QA 4CKXA 1ID8A 4HNVA 4BUCA 5A9SB 3NPAA 4AT1A 3TSOA 3KEFA 4LYYA 4J94A 5CVDA 3ICEA 2P78A 3V7NA 3VAAA 3ROZA 4DNPA 4M6WB 2JKVA 3FLMA 3FJYA 1XMPA 4G5HA 5FAXA 2E1RA 2X0DA 4DIMA 2VWPA 2WF7A 3UJDA 4POOA 3THXB 3GJ5A 3UMFA 5IDXA 1WZCA 1P4SA 2JKZA 3VR5D 1G8YA 4U9HS 1GYQA 4U2KA 3ZKWA 3Q40A 4ZTUB 3LNTA 4QEKA 4EH1A 2BOVA 1QG2A 3OJ0A 1BMDA 3A10A 3DFKA 5JADA 3JSAA 4CMJA 3EUWA 4YUXA 2CVFA 2QQGA 1VKRA 5CAEB 2YZNA 4HT3B 3UCFA 3ZY2A 4YPVA 2HPHA 4KIGA 4RS3A 1E1KA 3U4QA 4TTQA 3A9UA 3PZRA 1SUBA 5NLLA 2NU6A 4NDAA 4EGFA 2DTXA 3Q4GA 1MX5A 4MQ5A 5KOHB 3WK8A 1J0XO 5JAUA 3U5TA 1XR3A 1SHTX 1Y3BE 1HFEL 2XVYA 2AK2A 2X5KO 4X0EA 2X19A 4MV5A 3UK0A 2IXEA 4AG3A 2LWIA 3PLNA 3OAAD 4IL5A 4M8NE 3KRTA 3FA2A 3VO2A 2ZXUA 1QK4A 2FEXA 2JJ1D 4ESOA 4G6ZA 2HBZA 1DIAA 1VZ2A 3CNOA 3LX8A 4IRMA 1CD5A 1C7ZA 1ND6A 3EC1A 1R66A 3PDUA 4V1CB 2WSLA 4TL8A 2PKQO 4YMGA 2FW1A 5CA0A 4ZO8A 3WKCA 4F3YA 2XDYA 2ZSDA 2OSVA 3B13B 1RAAA 4Y9RA 5AFSA 3HB7A 3K4PA 1UBEA 5ISMA 4L28A 1CY8A 2BM9A 2JGAA 2OQIA 2V6FA 4QXQA 2OA0A 5L7WA 3H16A 3I9KA 4REOA 1NRWA 3D8BA 4NCJA 5AVTA 3ICPA 4KXQA 4XOIA 1Y1PA 1VKZA 3JAMA 3UJCA 1GA6A 2I2FA 5HIMA 2WWVD 1Y1KE 3S70A 1TT5B 5GJWC 2W6ZA 4NJMB 3UN1A 1PGJA 2AWNA 5K05A 2UUPA 3DWIA 4IF4A 1P61B 5J4HA 1RT9A 3OZAA 4UMEA 4M1QA 1Z17A 1J8VA 2WIKA 1MFZA 3BF7A 4MKIA 4YJFA 4CDGA 1BVHA 1E7RA 1LFDB 1I0IA 3UT5B 3NHAA 4XDGA 1L6IA 4BU1A 3BB3A 3HBAA 1LUAA 3BH0A 3ISVA 4JI4B 3IUYA 2F3UA 2BKXA 4ARZA 1RQXA 2R1VB 2YWXA 2YXBA 2G5TA 3HKEB 5DHUA 1G16A 2H1IA 4OY3A 2I78A 1Q0UA 2HQOA 1J09A 1GR0A 4YVFA 2VDWB 5DXAA 3USES 4D2IA 1GPBA 2FX2A 2UKDA 3NV7A 3VMMA 1GXSA 1XN4A 2D5AA 3B1WA 3X3HA 1T6XA 2GBGA 4C0BA 4AF7A 2EKPA 3U31A 4KFRA 2G80A 3E61A 3ELWA 3HGQA 4ZYXA 2R47A 2C7PA 3MD9A 2ZJ8A 1UBSB 3JZAA 3UWKA 1H65A 3CZMA 5BMVF 5IPFA 2C77A 2DQSA 2OPHA 2FW9A 1A4RA 4HI0E 5BY2A 2FR0A 1MO6A 3DTVD 3GROA 1XXHE 3QKRB 4AS1A 3K2EA 4XWYA 4CI0B 1UK7A 1XDBA 4RD1A 4XB1A 2FDRA 2FMKA 3SZGA 3B36A 3P9SA 3ND7A 2WQZA 3SR0A 1JQJC 1JSZA 2QUKA 1UM8A 4K88A 1JKXA 4KQCA 3OQMA 2Z6AA 3BT7A 3RKRA 3IEKA 1NBEA 5B2FA 1SKQA 5MGNA 3H11B 3QA3E 4LI3X 4MO9A 3SZOA 3WQSB 3NEPX 4RABA 1LLQA 3CZCA 1EX6A 2BAGA 2G72A 3D7SA 3NBYC 3OEHA 3Q88A 3K0FB 3DCNA 4GZLA 4PAMA 3FDZA 5IJAA 4DLWA 3G0HA 3C8DA 1WXDA 1V5EA 2VJYA 3UAWA 2CK3D 2FTKE 2AF3C 4UULA 1PWYE 5K45A 1E6CA 3GAZA 4RTMA 4CCAA 3L02A 1JEYA 3DMGA 4UM7A 1H5NA 1MO4A 3NBZC 5FFNA 1WHSB 3CZPA 1RADA 1ULAA 2I6UA 1IWBB 4JGBA 5D3KA 5EERA 3ORSA 1SY7A 2XD4A 3BXZA 4FYYA 4KZPA 2CFCA 4OQEA 4QOGA 2Z09A 3WB0A 3R3ZA 5U9CA 2B35A 1GUDA 1OREA 2HGZA 3FFXA 3NYIA 1NPTO 5JZVA 2ZJZA 3AETA 1X70A 2EKLA 2LR0A 3F6YA 3OOSA 2R0QC 4DV7B 2VP5A 4KKXB 1OYWA 1SC6A 4Z8XA 1GQFA 5K3AA 3SY8A 3WB9A 1NW8A 1U8FO 4IQ4A 4MW9A 1Z12A 4KR6A 2UVPB 3IBSA 3JR3A 6ABPA 5DE3A 1TKCA 4JL5A 3BXPA 1O0SA 2OY0A 4GVXA 3RODA 1SWVA 5A2QA 1RTTA 1JH9A 2ZBGA 4GEKA 2Z6QA 1V2HE 3G68A 1JA1A 4TWJA 3DMPA 2YVUA 3V34A 3VXKA 4ER7A 3KQNA 3AKDA 3I0MA 1KVTA 1R15A 4KSBA 1KNQA 1O8BA 1CQJA 1HTBA 2NZJA 2ID4A 3REQA 1U2EA 3KBOA 2IE0A 2FDCA 2UU9B 2P8JA 1MOPA 2YJ4A 2BKVA 3IHWA 5IAOA 2V7UA 5IMBA 3V4OA 2PKCA 3IT3A 4TSKA 4PX2A 4ZGWA 4ZDJA 1BOFA 1YMQA 3KKOA 2H3HA 4KR2A 3CKLA 4B82A 3VOSA 2JFNA 2L18A 2NYRA 3K16A 2QTTA 2BM1A 1GG5A 1ZNXA 4D8TA 4D9NA 3QUQA 2FGKA 2AOTA 4D0SA 3HS3A 3WLFA 3UYLA 1SHLA 3N2NA 4HWOA 4GPEA 5GJCA 2XXJA 4LZNA 3OTWA 2DHQA 3M1LA 4U7PB 5E6RB 3Q72A 1G5FA 4DA9A 2P62A 2XNKA 1DI0A 3U61B 1UODA 4GZ5A 1EX9A 3RTDA 2V45A 2VPIA 1CETA 3QUBA 1N3IA 1YTLA 2ROQA 3A1DA 1LQTA 2A1TR 3EC2A 1RJ9A 4E14A 1ZVJA 4LJKA 1E4OA 1GPAA 3CN7A 2C54A 3PXAA 1QZ3A 3CVXA 1ODIA 1XU7A 3DBHB 2TMKA 4OQYA 3GUHA 4YCBA 5AJVB 5KU1A 1ZXXA 1HUQA 2CV2A 4C4YA 1GPMA 2VO1A 1YFLA 1EK2A 3NIWA 4RVNA 1DJOA 3IA2A 4LY3A 4A4DA 3Q7IA 2QD4A 1KEUA 2JPDA 3E0QA 1Z7BA 3AP3A 4AF6A 1SCDA 2QE6A 3A6HA 4M8IA 4A8JC 4QT4A 1RVV1 3PDJA 2Q2OA 1P72A 1UQTA 4PZLA 5JD5A 1CJUC 4FZRA 2A7XA 3D64A 4Y9UA 3DH0A 4RSRA 5FI1B 3BK2A 4B48A 4PTYA 1QMGA 3GW8A 1SUWA 4GLJA 2CHGA 5BOVA 1QQ7A 1NLMA 1UKYA 1WCIB 4NV1A 1PW7A 2Z5LA 3GP3A 1T9BA 2BFNA 4HL6A 1E5VA 2F17A 5AJTA 2CFSA 1TIKA 1I1NA 5D5QA 2H08A 1XZPA 4ZU6X 2X8BA 2RB4A 2VJBA 5KSYA 4CM7A 1BXRB 4HX5A 2OBBA 5FPTA 2NTNA 2ZE5A 2IXAA 2WA2A 3ZXUB 4UVEA 2EXXA 1W0KD 1Z37A 1M0TA 1U3VA 3CJRA 3FWNA 2BKUA 4D7AA 1SCJA 1GUYA 1VI6A 2BEWB 4M54A 4IXTA 5ABPA 1VLHA 4LZLA 4Z7QB 5BWBA 5JS8A 1Y7PA 4H27A 4GRDA 3TR5A 1GKKA 3VYUB 4ZQCB 4Q9LA 4BN4A 1FFXB 4DSAA 1PVVA 3BMXA 3CSUA 1UBTS 2A30A 4DN6A 2A8YA 5GQSA 1E2NA 1PCXA 5DVZA 4YQYA 2EERA 4BE9A 4QEZA 2JLUA 2QXYA 1CP2A 4DBLE 1E6UA 4UEWA 4MGEA 4DLXA 3K7EA 1BDMA 1UPTA 2C1EA 1CNEA 1RVDA 2C83A 3IR7A 4J0QA 1YNOA 2HC9A 1H93A 1HSOA 1J0EA 2X1MA 4PXSA 3DMNA 1SBNE 3FX2A 1EUCB 4UM9D 2WVHA 5TQ2A 1WXEA 2WJ6A 5LXTB 3ORQA 2JGDB 5IAAA 4AD8A 1C3LA 4OHWA 2IOHA 1BD3A 1QXSA 3MTAA 3TM5A 3WB1A 3FTPA 3OM1A 3ZHQA 2R96A 2EFGA 3K8OE 2DLDA 3IGFA 3FCEA 2JIRA 4C43A 5HSGA 3MUFA 5CTAA 1FE8A 3FUUA 2W70A 2O59A 1W1WA 3PKZA 5LQAA 3JYLA 2Y77A 2DETA 2LKDA 1MJGM 5LA6F 3UWOA 2O8CA 1G4UR 3OQHA 3I6IA 1MNAA 5ALUA 3EPRA 1CX9B 2IUYA 1ZNZA 1OX4B 4BFUA 1MENA 3NKVA 1KKLA 2XXBA 3U3DA 3EA5A 3EIEA 5A5EA 3CVWA 2R00C 3DYIA 5HWSA 4NV0A 2ZE7A 1FFAA 3JQCA 4I55F 2VBCA 2QGFA 3E4DA 5EQFA 2OO7A 4H2DA 5CW1A 2IXGA 3AIMA 3I92A 3OMXA 4L2IB 5D3MA 4ZCMA 4IMIB 4Q9DA 4TN5A 4EOGA 4PAWA 3VPCA 5ALGA 3RUFA 2W6IA 1ECLA 2ECKA 2ZQZA 1PL7A 2PUJA 3UF0A 1DOHA 1KDPA 1XEXB 4OYRA 5CYGA 5AVXA 3FSEA 4NK5A 2VP3A 3RFCA 3CISA 1O94C 4LTMA 4F1KA 3S8EA 3V4PB 1VCNA 3WJ1A 1RYZA 5M04A 3O3CA 1U1IA 1B8VA 1WVMA 4QBTA 1OFGA 4TGLA 4RNDB 1PJLA 1M73E 2I71A 3I9V1 1H1LA 4HN4B 5DWDA 4S1PA 5G2OA 2B4YA 2PSFA 4O6VA 4P81A 4FGJA 5DGCA 2OM2A 4DV5B 3LL7A 1QOPB 1ADCA 2Q4RA 4LOJA 2Y2UA 4JVLA 4E5KA 6AT1A 1Z5PA 5KOJA 2H5JA 4I36A 1KO5A 2OENG 2PZ8A 5L53A 3V8EA 1D8TA 4KDRA 4LRUA 1KFEB 2D62A 4B44A 2X0NA 1YB1A 2I2DA 2GNPA 3MA0A 2HK7A 2FK7A 4XJXA 4DTIA 4EJFA