3HEMA

Structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
291
structure length
291
Chain Sequence
QLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETCDIYMHYLRGCSDLFRDKYTDVCQFTLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclopropane-fatty-acyl-phospholipid synthase 2
publication title Structure of Mycobacterium tuberculosis Mycolic Acid Cyclopropane Synthase CmaA2 in Complex with Dioctylamine
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 115
structure length 291
sequence length 291
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hemA00
3GRYA 3R0QA 1Q0TA 2JJQA 1JQEA 4OQDA 1VBFA 1JQ3A 2VDWA 4U7PB 2IH2A 3NWBA 2ZWAA 7MHTA 3EVBA 2VP3A 5F2KA 5CVDA 4E2YA 2C7OA 2OZVA 1NE2A 3OCJA 4QQKA 5EC8A 4E2ZA 1NBIA 4EQZA 4PYKA 5MHTA 2FYTA 1TPYA 1ZKDA 3X0DA 5EMMA 4C06A 2IDKA 3V8VA 3TR6A 4YUVA 3NVMB 2QM3A 1RI5A 3BGDA 3FPHA 3OFKA 1R8YA 1HNNA 5E1BA 2P1DA 3T7SA 4C04A 1V39A 3A27A 1L3CA 2GLUA 3BWMA 3OZSA 4HRAA 3PX2A 4QVKA 4BLWA 1D2HA 2P7HA 5G02A 4YUYA 1WS6A 2PVCA 3EGVA 2P3QA 5HEKA 3GGDA 2QE6A 3UJBA 2Z6QA 3MTEA 4HTFA 3U81A 1M0EA 8MHTA 4PINA 2CL5A 5LQUA 3CBGA 2IBSA 1N7JA 2GA9A 5D1HA 2P3LA 3E05A 3EVCA 3FPFA 1G38A 3ELWA 4FT2A 2UYCA 3HVKA 3UBTA 4YV2A 2YXLA 2YR0A 3LKZA 1PRYA 4GBED 5DT2A 1L1EA 3LGAA 3PVCA 2K4MA 3OZTA 3KQQA 3FUWA 4RV9A 2OB1A 1JG1A 5DWQA 10MHA 3EEOA 3NVKI 3LCVB 2EJUA 4BY9E 4LWOA 1EQAA 5FADA 2UYQA 4PYNA 3EMDA 3HVIA 3NDJA 3IEIA 3Q87B 4QPNA 4M36A 3G2MA 4PYJA 1KXZA 3DMHA 1WXXA 5LSAA 3GDHA 2C7QA 4BP1A 2AOTB 3G2PA 3NWEA 2AOWA 5EIWA 2PX5A 2ZULA 3HCDA 4PYIA 4MWZA 5GM1A 4RTOA 5CVVA 3IHTA 1RJGA 5CM2Z 1FP1D 1JG4A 3T0IA 1KP9A 3UJ9A 3P2KA 2F8LA 2EG5A 5LQCA 3GXOA 4QQNA 2PSSA 4QPPA 3BKWA 2GPYA 3DXZA 3FPJA 3OPNA 4LG1A 2JH9A 1P1BA 1R8XA 2CMGA 4HGZA 4QDKA 2PY6A 2G1PA 3HTXA 2OB2A 2ZIEA 2AN5A 2YVLA 3C6MA 4IV0A 3UZUA 3E8SA 5HZMA 3ID6C 5ICCA 4MTLA 3FPEA 4QVGA 3P8ZA 4DCGA 2IBTA 3HA5A 1QAOA 2OY0A 3BGVA 3HP7A 3GWZA 3NJRA 3PLAE 3OE5A 4Y30A 4MHTA 5HIKA 3FUVA 4P7KA 1ORIA 3A25A 2B2CA 1R18A 4Y2HA 3I53A 3A4TA 4P58A 1SQGA 5E9QA 4DKJA 4RTLA 4CKBA 4RTRA 3HM2A 4DMGA 3SXJA 3DR5A 1SQFA 3KQVA 3B3GA 4M38A 3KQTA 3ER9A 4PYQA 5BW4A 3MCZA 1R74A 5DXJA 2IGTA 2IP2A 3BZBA 3L8DA 3I5UA 3MGGA 5K09A 2I9KA 4HC4A 4A6EA 5ICGA 3CJTA 3P9KA 3BKXA 2ZZNA 4XUCA 3P2EA 5K03A 4QTTB 5FULA 2CKDA 2LD4A 3LCUA 2NP7A 2PXAA 4GOND 3O31A 2VDUE 2YXEA 1RI2A 2WA1A 4ISCA 5EMLA 2Z6UA 3THSA 3MHTA 3KR9A 4IV8A 4PCLA 1D2CA 1VPTA 1SG9A 1P91A 2OO3A 4DQ0A 1JQDA 4GUAA 2ZIFA 2ZLBA 3LX6A 5K0GA 5E9WA 4PCAA 4QTUB 2XYRA 3FRIA 4FSDA 2ADMA 1YZ3A 3GRUA 4C03A 4Z2YA 3SVZA 3TFWA 4OQEA 5K0LA 4F84A 3EEYA 5CVJA 3M6UA 4E2WA 3PFGA 2ZFUA 4PNEA 3CJQA 2ZW9A 5K0FA 1G60A 5EHGA 1G8SA 3DULA 3MCTA 1RI3A 1ZGAA 3KQYA 5DM1A 2B9EA 1OR8A 2V7EA 1VP9A 1O9GA 4JXJA 5CIYA 3G5LA 1Z3CA 5F2OA 1XVAA 3JWIA 4B17A 1QZZA 3G8BA 3KR0A 5M5BA 1WG8A 4KDRA 5U4XA 5KS2A 3FTEA 5T6BA 5E9JA 4C08A 4KWCA 5CVEA 1IY9A 3KQPA 1O9HA 3CJRA 2B3TA 1M6EX 1NW8A 3KR1A 1QYRA 4OBXA 1XXLA 5CUQA 5HIJA 4CTKA 3EVEA 5GINE 3CVOA 3ANXA 3GU3A 2HV9A 5DSTA 4PIMA 3KQOA 3IYLW 5JUWA 3UJDA 4FGZA 5FA5A 3SR4A 1KHHA 5LR6A 1XJ5A 3DLIA 1SKMA 1JG3A 2I62A 2BM8A 4C07A 3M4XA 4UOEA 4PYLA 3G88A 5CVUA 3OFJA 5EHIA 3SSMA 5GIPE 1YUBA 2R6ZA 3OE4A 4DCMA 2JHAA 1N7IA 1L3BA 1ZGJA 3NW9A 5HILA 4X41A 5B1SA 5C9ZA 5ICEA 4DZRA 2AS0A 5CCBA 2HR1A 3TMAA 2BZGA 4OX9Y 4HGYA 4EK9A 2YXDA 3LDGA 4G56A 4RYLA 4ZTBA 2KW5A 4XUDA 5E8JA 3DXYA 3ORHA 2AOUA 5GIOE 2JHPA 4HH4A 3C0KA 3M6WA 5HOQA 3ER8A 1MJFA 4E30A 2EX4A 2H1RA 4YMGA 1VIDA 3HEMA 2G70A 2Q41A 3E7PA 2IIPA 2ZZKA 4RTNA 1RJEA 3PX3A 1EIZA 3P9CA 4GOOD 1XDUA 5EZQA 1G8AA 3UJ6A 1F38A 2ZBQA 3FUXA 3GNLA 2JG3A 2ZTHA 3LDUA 3H2BA 1KPHA 5LQJA 3KPJA 1XCLA 2PT6A 2HNKA 3FUTA 1NW7A 5DLYA 5P8WA 4V0QA 4YUXA 5K0JA 4FZVA 1F3LA 4YUZA 2ESRA 3RW9A 3BT7A 5DTMA 3DH0A 2PWYA 3EVZA 3P71T 3B3JA 4ER3A 3HCAA 5EQJB 1XTPA 2QRVA 2ZVJA 4F86A 4R8SA 3ELUA 4R6XA 4AUKA 3OU7A 3PTAA 4X61A 5HFJA 3S68A 1NT2A 3K6RA 1RI4A 3TRKA 5T67A 2HTEA 4PWYA 1BKYA 2ONZA 2IPXA 1X1DA 4EVIA 4LWPA 4YV0A 4FT4A 3DMGA 5HIMA 2C7PA 2NP6A 2CWWA 4CTJA 4EKGA 3NDIA 2GS9A 3P9IA 5K0BA 4K6MA 5FQOA 5K05A 3DOUA 2B25A 3FTCA 3KPYA 2YX1A 4XUEA 2PT9A 3KPVA 1JTFA 4A6DA 5DTRA 5KVAA 3GO4A 2FCAA 3BWYA 1NV8A 2BR5A 2ERCA 1AQIA 3GCZA 1R6AA 5DM4A 3ME5A 2AOVA 5E2AA 4F85A 5LQRA 2AVNA 2UZ4A 3PFHA 3LDFA 3KQMA 4E32A 3MAGA 3MERA 5E1DA 1RJDA 2AVDA 3CC8A 3EVGA 3HNRA 2IDJA 5C1IA 3UJ7A 2PX8A 3O4FA 3UA4A 5CD1A 2BH2A 3FTFA 2PXXA 4FSXA 3WSTA 3SX0A 1FP2A 1YFLA 4E2XA 3GJYA 1I4WA 3I58A 4BLUA 2CMHA 4R05A 1QAQA 5IH3A 1RJFA 5EOVA 3KR2A 2ZSUA 1JSZA 1N2XA 2A14A 2PX2A 3NTVA 4C05A 5EKXA 3TLJA 4ER5A 3SM3A 3HA3A 1NKVA 3B5IA 2WA2A 4KIFA 1B42A 5DSXA 3GRVA 5DX8A 3AY0A 3Q7EA 2NXEA 3LKDA 3KPWA 3M6XA 2OBFA 3E23A 2JHCA 3SMQA 2O57A 4OBWA 3T7RA 1ORHA 3UWPA 4CKEA 2P35A 1I1NA 2ZIGA 3M33A 3HVHA 1DCTA 2PX4A 3HVJA 3VC1A 1IXKA 1X1CA 2AN3A 4HTFB 5H02A 3UFBA 3FZGA 3RIEA 1NW3A 1VP3A 4X60A 3TM5A 3VC2A 4YMHA 1Y8CA 2O07A 2XYQA 2N47A 3AXTA 3PT9A 4RVGA 1EG2A 2AOUB 3C6KA 4GC5A 3EVFA 5GOZA 2AR0A 3G2OA 2PJDA 4WXHA 1P1CA 3M70A 5KQSA 3B3FA 3BWBA 1H1DA 5DRTA 1NW6A 4H0NA 2P3OA 2G8NA 3B89A 3P9NA 3BWCA 5F2NA 2O05A 3PS9A 2GH1A 2GB4A 4OA8A 5D1NA 4KIGA 4ATNA 1JSXA 1VE3A 3FPGA 4KDCA 3A7DA 2EFJA 1VLMA 2NXJA 2FK7A 2XVMA 3BXOA 2UYOA 3DUWA 3O7WA 2YUIA 2QYOA 2B78A 1ZG3A 2PV0A 4RTMA 3I64A 3QOWA 2PGXA 4O29A 5E8RA 3FYCA 2AZTA 1MHTA 2I7CA 2O0LA 4WVLA 3UA3A 1QANA 1X1BA 2OPBA 5E2BA 5EVJA 1EAMA 2EJTA 2R3SA 5KYGA 3A7EA 1FPQA 3G8AA 4U7TB 5K0NA 1KYZA 3EVDA 5EZSA 5CCXA 1WY7A 4PGGA 3LSTA 5EEHA 2QRVB 3LL7A 4XCXA 2HWKA 5GM2A 1NBHA 1NV9A 1WXWA 3TQSA 1AV6A 2H00A 2I6GA 4DM3A 1EJ0A 3SSOA 2VDVE 4QDJA 3FUUA 3UJ8A 3B7PA 2PWPA 3HCBA 5BXYA 2Y1XA 3G7UA 3LBFA 1RI1A 2OYRA 4V0RA 2V74B 3GRZA 1ZHFA 5K8VA 5E1OA 5FTWA 2P7IA 3R3HA 5FWDA 1SUIA 3EVAA 5K0CA 3FRHA 3DTNA 2FK8A 3OU2A 5BP7A 1P39A 3OU6A 4CWAA 3HA7A 4HG2A 1M6YA 3LHDA 1U2ZA 1L3IA 2XVAA 2ZWVA 3EGEA 4M7RA 4E70A 3TKAA 4E33A 3JWHA 3P2IA 4RSRA 4KVZA 5DM2A 5EG5A 5EGSA 5FCDA 4RTKA 3KHKA 2BR4A 2PLWA 1R00A 5E1MA 5JR3A 2WK1A 3REOA 3DMFA 5DX0A 3EGIA 3KPUA 4AZWA 1AQJA 5HIIA 2YTZA 5FA8A 3JWGA 4L7VA 2G71A 1KYWA 3DP7A 1O54A 1JR4A 3LBYA 5DXAA 3TOSA 2ZZMA 4R8RA 4PGHA 1ZQ9A 4EMSA 3ERCA 1NW5A 2E5WA 4GOLD 2YQZA 4AZTA 1HMYA 1KPIA 4GQBA 2VS1A 1UWVA 2Y1WA 2ZBPA 4MIKA 5IKMA 2VZ9A 3KKZA 1D2GA 4DF3A 4PONA 4RVDA 3T7TA 2AOXA 1AF7A 4C4AA 5FHRA 4X1OA 1DL5A 4IWNA 2ORED 2ZBRA 2PBFA 1FBNA 4EKIA 3A26A 4GC9A 5EKUA 4YV1A 2IH5A 2NXCA 3ELDA 4POOA 5BW5A 1YF3A 2BM9A 5EIFA 5LQNA 4ER0A 2IFTA 3HCEA 2P40A 5LQAA 2PKWA 1JTEA 3UJAA 3DLCA 2C7RA 4YUWA 3QV2A 4CKCA 3R9XB 4LECA 3GIWA 1KIAA 4PYMA 4MQ4A 1TW2A 4RVFA 1INLA 3C3PA 3FTDA 3MQ2A 3TPZA 4P7FA 1YB2A 3JWJA 4GOMD 4FS8A 2OXTA 4DA4A 1XCJA 1JG2A 3IV6A 2NNWB 5FWAA 1SVUA 3EPPA 3M6VA 5T64A 1Q0SA 1XDZA 2AN4A 2ZCJA 3VSEA 3KQSA 1FJXA 2GAFA 3K0BA 1KR5A 4GEKA 2O06A 3V97A 5DTQA 5DM0A 5EEGA 3CKKA 3AWIA 2NXNA 3C3YA 2OKCA 1UFKA 3AJDA 3HCCA 2DULA 3I9FA 3MTIA 4X63A 3LPMA 1DUSA 4RVHA 2NYUA 2P41A 5EMKA 1L9KA 3CGGA 3VYWA 5ICFA 3PB3A 4NECA 3GRRA 2UYHA 3DXXA 4AZSA 1SUSA 5DX1A 1UIRA 2BR3A 2AOTA 2DPMA 2HMYB 4IKPA 4OA5A 4E31A 2FRXA 5FQNA 3LCCA 3QOXA 3MB5A 4GF5A 3KQWA 3RODA 2JH8A 5GWXA 4KW7A 1TW3A 4KRGA 1X19A 2Z6AA 4PIPA 3KU1A 4FP9A 1WZNA 4ER6A 3F4KA 4HSGA 1I9GA 3LECA 3BUSA 3G2QA 4FR0A 1PJZA 3SGLA 3SSNA 1BHJA 4RTJA 2FPOA 3THRA 2G72A 1G55A 4M37A 1KPGA 4RTQA 3G89A 3AXSA 2P8JA 5FUBA 4BP3A 3OZRA 5DRYA 5K0EA 1VQ1A 5K01A 4RTSA 1T43A 4P7JA 2XYVA 3R6TA 5LQKA 5EMJA 5FHQA 3HCFA 3UJCA 4RWZA 1G6Q1 2IH4A 1BOOA 2QY6A 1X1AA 3TKYA 2FHPA 4AZVA 1EJ6A 3TM4A 5ERGB 4BLVA 4CXMA 3FYDA 3NMUF 2ONYA 1YZHA 4PYOA 3P97A 2XBMA 4AX8A 3R24A 3G5TA 5GP1A 5C0OE 1VL5A 1QAMA 3D2LA 1IM8A 4RX1A 5EPEA 2PXCA 2H11A 3EMBA 3ELYA 5DPMA 4R6WA 1YFJA 3BGIA 4RTPA 9MHTA 4P7GA 1BC5A 5KQRA 3CCFA 1XDSA 4ER7A
chains in the Genus database with same CATH superfamily
4HWGA 5FAXA 3IIKA 1E8DA 1VBFA 4RCYA 3OA0A 1HTTA 2OAP1 2XWJI 3FVRA 2HSGA 3EVBA 5KNCH 2BEVA 4OJNA 4LYYA 4XJVA 1V2HE 4EABA 1TK3A 1A2OA 1DT5A 1GKLA 2G4VA 4E2YA 1OLSB 4EWLA 2FE4A 1QG2A 3FSGD 3PG5A 4P53A 4Q02A 4EQZA 4LZOA 5JFOA 2G5TA 5EJ4A 5MHTA 5FLKA 4QKQA 2Q4OA 2FE1A 1X7ZB 5IYZF 1WDMA 1JQJC 3NVMB 4BCBA 1WRBA 1RS0A 3TECE 2P91A 1FFXA 1OV4A 2E4UA 2WYIA 3USCS 2OPHA 4TSFA 2XRZA 1GQYA 1SVOA 2NO4A 2J09A 4IUYA 1AH2A 5H3HA 4HPJB 3MRVA 1II0A 4URZR 5C46F 3CZAA 4JR2A 4B2PA 1LSUA 3ZOZA 3CNQS 4AXXA 3OKAA 3EVTA 3HCRA 5CMLA 3W1WA 1WHTA 3I6IA 3C3AA 1MW9X 3DR3A 4H6PA 4HTFA 3ROEA 4IHJA 3HCWA 4OQMA 2GUGA 1HYEA 2J6IA 2ZB7A 4L8YA 3UH1A 4F3RA 5LQUA 2QBYA 2EX1A 1SVNA 2BFFA 3OPQA 3Q72A 3ZGYA 3N9IA 1BJKA 1CNEA 1X0XA 2DUWA 3LS2A 1E0DA 1U0JA 4FT2A 5IAEA 5KSZA 5IJ0A 4AS2A 2H4FA 2I2WA 3A1WA 1U80A 1RYYA 3WGGA 3JQ9A 3UK2A 4QFDA 1XN1A 5EUCA 4WWHA 4KXWA 4BDTA 2KBFA 1V1MB 5DK6A 3JQGA 4ZC1A 3ITDA 2HSWA 3X1XA 1IY0A 1RYMA 4S1TA 3ZHUA 3M2TA 4TKVA 4W9RA 1B23P 3TMYA 1PD0A 1SCQA 3LUPA 4KYIB 2C0PA 2CE7A 1K97A 1C30B 2N1MA 1VPVA 3NEYA 1OFGA 4FEAA 5TQ2A 1QZXA 2Z30A 3H3FA 3A10A 2XDQA 4HZIA 1N33B 4OI4A 1UBUS 3J81A 3D54D 4L27A 3AERB 3K72B 4UUMA 3VI4B 2DUJA 4FMDF 4BO5A 1E3DA 2O1XA 3CLKA 4EJSA 2XT6A 3FPJA 5GONB 3W3AA 1W29A 5AW4A 1WP9A 2RC5A 1PFGA 3PHHA 1GPUA 2IYQA 4U5QA 4N39A 4XXHA 3VUFA 2Y4NA 1NNSA 1P1JA 2PZEA 1RXYA 4ZGWA 5HKOA 4AWBA 4ARUA 1IOLA 2ATEA 3TDNA 1HLDA 4IG4A 5FPSA 1KYIA 3AF3A 5ALGA 2FMKA 4KNVA 4TWAA 2DQSA 3KEMA 1XCMA 5T41A 3CX3A 3GWZA 5JAZA 5AWFC 1QX3A 5AVUA 4B46A 2PVSA 1K5PA 3A25A 5AICA 1ISPA 1BDIA 1R4NA 1WCV1 1AK9A 1ZH2A 2FOLA 3MJTA 3FGPA 4M1KA 3YASA 4HVLA 5IVKA 1RACA 5BMVB 1R0WA 1Y6ZA 4RD6A 5GVRA 5DGXA 4TSKA 4G26A 3WGMA 4FGSA 4B3HA 3KQNA 3B3GA 1RAEA 3UUFA 4AN4A 1KU6A 3ER9A 5PNTA 1VGVA 2E5LB 3USES 4ARVA 3DVAA 1RTKA 1GAQA 1ZH0A 2WIGA 4Q3CA 5AHKA 3DBIA 5BNIA 3SFTA 4YJ2A 4ANFA 2WJGA 4IJ6A 5ICSA 4Q1EA 3TLMA 3BD8A 1QM5A 4OP2A 3SKYA 1WHSB 1YI1A 1E2EA 1P1FA 2C2XA 4MR9B 3VKHA 2M6SA 5IFKA 4B3SB 4YASA 4A23A 5C51B 5FFFA 4TV9B 4CJXA 2ZREA 2D2FA 1ECPA 3GFFA 4JDUA 5KAPA 1X13A 3ILSA 3OZDA 4JOCA 1Z5OA 3LX6A 4PC6A 4KACA 4ZXPA 4HNUA 4AXBA 4RABA 1QVVA 2QUAA 4DRYA 1BX0A 1J23A 1WSAA 3RVJA 1FVXA 2Y71A 4Z2YA 5KC9A 1QO9A 3O1LA 1RPNA 5HWSA 2Q6LA 3EWSA 4CW7A 2BKUA 2I87A 5G53C 2F00A 2IP4A 4UCXA 3G0DA 1EUYA 4JJ4A 1QIJA 3QLJA 3KQYA 2MINA 4B45A 3ZEAA 2FMHA 3EH1A 1YC2A 3IUYA 1S8NA 3LU1A 3OIGA 2F90A 4Q1AA 3UB4A 4AMYA 5CIYA 2XA2A 4IJVA 2A5DA 3SEFA 2AXPA 4OFBA 3STVA 4L2IA 1I30A 1NPTO 5ITVA 3AKZA 3B53X 2WIAA 4XDGA 1XVIA 3W9BA 4M8KA 4F9FA 5J2TA 1FJGB 3AFHA 1QYDA 3GCGA 3KJNA 4QOFA 5DBIA 2C9CA 3FMGA 3KR1A 4MVJM 5F7ZA 4BO3A 5M29A 1UKZA 2VYFA 3CVOA 4LSGA 1T5IA 2DX7A 2H63A 5JCJD 1P44A 1VBKA 2HPZA 1GNQA 2C3YA 4UAUA 2H8GA 2WKWA 1L5RA 2FKNA 1M1ZA 1H3EA 3ZHQA 3M4XA 3FTNA 4DSZA 1YJXA 3NHPA 3E3NA 1RXVA 2ODAA 1CY8A 4LYFA 1II8B 3JARB 2ZJ1A 4Q82A 2JFHA 3WK5A 1OBOA 1NPYA 2A2ZA 3MLEA 2R65A 1CJUC 1L4BA 4X90A 4RJKA 3N86A 3S2FA 2G9VA 1RYBA 1YL6A 4RD0A 4PVDA 3NYRA 3AESA 2O3QA 2PJRA 4CI9A 5BUCA 3EUAA 4O4LB 4L3WA 3ZEIA 1Z7WA 1E4OA 1LTQA 3LTEA 3M6WA 5HOQA 2Q07A 4O2BA 5B37A 4H9GA 4YMGA 1TX4B 3MF4A 4MPPA 1ZK4A 4EKEA 3RO7A 1DC8A 2GJ4A 2L69A 5CIQA 1SKQA 2JI9A 3WJAA 3LCMA 2XCIA 4NV3A 1TQ2A 5ABPA 4DV4B 2Q6IA 3L7BA 1JKMA 2H1LA 3FWNA 5D5HA 3TUJC 1F2TA 1MH1A 2JJYA 3HUDA 2C5FA 3ROFA 3TLGB 4LZLA 1WW3A 1RKVA 3AFGA 2ESRA 2HQRA 1EXMA 3A6HA 3T3PB 1P3Y1 2PWYA 2WVGA 3AM4A 4FJ0A 2PRYA 4TMWA 1OLUA 2I33A 3GDFA 3IA7A 2Q3BA 3HCAA 2G6TA 1O97C 5A9RA 3AI2A 4PC1A 2EIHA 4XD2A 4EHHA 3NBQA 3KEQA 3OU7A 5FI3A 2CHEA 3A4LA 4HNGA 4L7QA 2C57A 2JCXA 4O0MA 2IPXA 4OMFG 4YRZA 2O8FB 1LTKA 2ZJAA 4XYEA 3TCNA 2AKYA 2NU7B 3UM9A 3O94A 3KETA 3JPYA 1BZYA 1P0QA 5LP6F 4HPWA 1UZMA 1XXHE 3WGLA 5IDXA 5IXJA 1RXWA 6AT1A 2OXEA 2PG3A 4HZUA 1EX1A 3DHVA 1U65A 4FYMA 2HMTA 1C3EA 1TT5A 2G9RA 5HE8A 2YHUA 1PHRA 2Q1YA 3LC0A 4IIBA 3UHAA 2OSVA 1R6AA 4JFAA 1ZRHA 3ME5A 3ZWDA 1A1VA 5AR1A 1I80A 1ZI9A 3BN3A 3ZZTA 2YZGA 2ID9A 1RJDA 3G17A 1K98A 2FVYA 2AXEA 3JD0A 4G0XA 4LDRA 1A5ZA 4AW9A 5LPNA 4DLXA 2WUWE 1WLSA 3P4XA 3RSZA 1XMVA 3WSTA 5HW0A 3ODGA 1C9MA 4PQRA 2WMOB 4ZEXA 4AJJA 1GCAA 4FYXA 3H0EA 3DKPA 4Q3BA 2WLTA 2EXXA 1DTSA 2JVIA 1SOUA 4G5XA 2A14A 5F3DA 1WMAA 1RU3A 2H5LA 2YWCA 4POAA 2UXBB 4PS1A 3QX7A 1GGKA 4GGMX 2QTNA 4MS1A 3OHPA 3O4GA 3QU7A 3DTVD 3H2ZA 5DNAA 3TBHA 3UOGA 4AIIA 1P8JA 4BTEA 3DT8A 2CXQA 4TTAA 2RD2A 4L5IA 4CG2A 4FFSA 1HFKA 3CUTA 4EHJA 3HI4A 3VR6A 4CG0A 2ZB4A 1A1SA 4H7EA 4AKHA 4GH5A 1UZNA 4LSWA 4YQYA 1N2BA 2DY0A 4R9VA 3RIEA 4DW8A 1KJIA 2RSLA 3CNNA 1WVGA 4NU5A 2QMZA 5K8LA 3DMYA 2PKEA 1HETA 3LBNA 2EFEB 2XYQA 1U0SY 4F5DA 3VZSA 4B44A 5K0SA 1FQWA 1CEYA 2IV7A 5BYAA 2BSAA 3SJUA 1RLMA 1DIBA 5JS7A 1JHQA 3AVOA 1M5UA 1YB5A 1U7XA 1GPYA 1LTHR 1ZY2A 2Q3JA 4EVRA 3GUUA 3GAAA 4QU0A 3I5AA 2Y77A 1RHUA 1NJ2A 2BGGA 4CEIA 3KV3O 5C7LO 3KM0A 3BMNA 4DLAA 1BYIA 1QTNA 4HDNA 3UATA 3WKEA 1C4KA 3I2KA 5EMHA 1PGOA 2HXGA 2VYND 1U1GA 2AI2A 3H5WA 3OMXA 3PXBA 3KYJB 4BNZA 5JNUA 2NPFA 3IXMA 2E4AA 1W2GA 2PS0A 3O7WA 4W9NC 5EP4A 2GN2A 3OLWA 2AE1A 2IC5A 2FSGA 2PV0A 4XFKA 4RTMA 2HLDD 4J0KA 1ECCA 1K75A 2NZ2A 4MYDA 1CUWA 4BNKA 2G1KA 2VXYA 4D0RA 2Z5GA 4MR8B 3UHJA 4DR2B 1G8HA 1ZS9A 1COWD 3RRNA 3IVCA 1EM8B 1WY7A 3LSTA 2LKCA 4U00A 5D2CA 2GZRA 3WFZA 3H5TA 1HQKA 1OYYA 1VG1A 3TQSA 1P3JA 4S0XA 1GTZA 2H00A 1SCUB 4DEVA 1JA0A 1MXFA 4F8EA 3PQDA 3UXHA 1USUA 1RWXA 3HB7A 4L75A 3ZVKA 4UCQA 2YIVX 1T2CA 4GRIA 3SLGA 2ALJA 3KXLA 3Q3GE 1XF9A 4CKWB 4NAUA 3DZKA 1XGKA 2A7XA 3FRHA 2GYUA 1WM1A 3EPRA 3W6NA 1I4EB 4Q47A 3EX7C 1WOMA 4B7UA 4O4IB 3BAFA 4OY3A 3CLRC 3LT2A 4G89A 1T5BA 3IX7A 4XPIA 2FX5A 5DM2A 3JYHA 4ARBA 1AKEA 3SDBA 4BFYA 2VQEB 1CTQA 3DGEC 4D98A 1FU8A 1KZ4A 3T7DA 4DLLA 1KH3A 1ZM4A 2A33A 2WK1A 5AOVA 1XRQA 3CVXA 1WB6A 2IA5A 3UIEA 1YQUA 1OASA 4G1BA 3CVYA 4I5GA 5LP6C 1VKNA 3TI7A 1MDBA 1ZW6A 3KJHA 3TVYA 2VPQA 3SQXA 1XFAA 2WY2D 4NFSA 1DWQA 3QVGA 4K8RB 2QVZX 1ATIA 3HN2A 2HU8A 4MV4A 1QE5A 2H3HA 4ZQFA 4HMOA 1JMKC 3NM4A 3P2OA 1SC1A 1WSWA 3Q5DA 2X23A 2H7VA 2W83A 3KUUA 4MQMA 4A91A 4M8SA 1X9IA 4EELA 3M7IA 1KK0A 4CKEB 1QVZA 1AY0A 3IDFA 4U2BA 3MLBA 4LKOA 4NDNE 4Z3KA 4OMDA 4L9WA 1XZKA 3MOGA 2IYPA 3ZCUA 5LL6P 1QHFA 1CUHA 1E6CA 3H1GA 3BIFA 3MWDA 4V0MA 2RHMA 5JFGA 2WB2A 2FUKA 4II3A 4DV3B 4NATA 3SLRA 4HWPA 1WF3A 2G17A 5AM3A 1HTBA 3R9KA 1NHWA 1BS1A 4LMAA 2QMEA 4H0CA 4BBAA 2Y0CA 4GM4A 4RD2A 4YNBA 2O7VA 3PCRB 3R3XA 3LJKA 5KHAA 4JQZA 2F8MA 3O75A 3EK2A 1R5NA 3ETNA 4YAOA 3U2QA 2HYIC 2J3EA 2UKDA 2AMJA 5DJ5A 4L85A 1NVGA 2NU9A 4LCBA 2X58A 3RAPR 4DLZA 1XZCA 2XRFA 4GEKA 5I47A 5ISMA 4NENA 3E7FA 4ZFNA 2C2ZA 1H4VB 2PRIA 5TJ9A 2AGVA 4HNTA 4UTPA 2I1WA 1J0CA 1FNDA 2YMMA 4Q7QA 1G9XA 4QBKA 3KL4A 2D1TA 3A3PA 3SZUA 4YO8A 2HF9A 1D5CA 1D2AA 2DFTA 3AQ4A 4B7AA 1U3CA 1ZLYA 3HGQA 5HZKA 1VKZA 2OAQ1 3EFHA 3OTIA 4AYWA 1PNVA 4JBNA 1XAGA 5EZYF 3FUCA 4RVNA 4IYJA 3SC3A 5KJ1A 3F4KA 1LPNA 1PR3A 3PD7A 1CV2A 1DQSA 2ZXEA 1TL7C 4DIFA 1T9BA 2VQ6A 2WIBA 1QQ7A 5LFAA 3ICQB 3NUGA 1TO2E 1OYWA 5DRYA 2KQUA 2MT9A 4EB6B 1BS9A 4NZYA 1T0HB 2XLCA 3A4YA 3D8UA 1Z13A 1ZWLA 3FWZA 3GMTA 5JY1A 2WTBA 3EWIA 4DTIA 2Y1CA 5B7NA 2J9FB 1X1AA 1JALA 5T4BA 1RR6A 4NBVA 1E8NA 4DHWA 3HYLA 2CNWA 1KFKB 3C8DA 2GRAA 5KNDH 4JHLA 4KRFA 2OCXA 1VLJA 4PSDA 3X1YA 3GGSA 3DMTA 2FHSA 3OPYI 4GP6A 4NX2A 2B7CA 4BFUA 1IM8A 4JGIA 4G4GA 4GYJA 3U60B 4E2FA 5AQ1A 4AP9A 2ZQYA 9MHTA 4HWOA 1IN4A 4NYMQ 4KO1S 4DR4B 1N6PA 2FOIA 5EJGA 1XDSA 2DFPA 4NMWA 2C9OA 4GWGA 3R0QA 1V8ZA 1UJ5A 2GT1A 3TOVA 2B1GA 1AOXA 3VPSA 5J3JA 1RTTA 1P2SA 5C5CA 4XRGA 4UUPA 3N87A 4QOSA 5E7JA 4NFHA 3DDUA 2C4TA 1NBIA 1XELA 1DLIA 3O4RA 2XOXA 2FYTA 2H6EA 3M3HA 3FGOA 4HAXA 9LDTA 3SXUB 4EIWA 4YUVA 1VKRA 4EDHA 5KWIA 5L53A 1YVPA 4IDPA 3RSCA 1UT5A 1FDWA 1HE8B 2C4KA 4HAZA 2FP4B 3GLGA 1XL0A 2W0SA 3CS3A 1P5ZB 2X1LA 3H4MA 2O9JA 2UVDA 4N0DA 3RIGA 1K92A 3QUCA 4IJ5A 4NK4A 1SJ9A 4QT0A 4MCJA 4XQ0A 3B6JA 3CKLA 3PC7A 4G4SP 4U1RA 3TI9A 3U3OA 1ZQ1A 1FXWA 5E6UA 1RCUA 5FTLA 1FYDA 1NG9A 4I50F 3UJBA 5JRJA 3LPNA 1K8RA 1XZGA 3S70A 1R4ZA 1ODFA 4MP3A 3IQHX 2XUJA 2OV4A 5HJ2A 4XVCA 4PN3A 1NBAA 5KSPA 1F1JA 1VSTA 2FR0A 1UADA 2CF5A 2X42A 5D1HA 1OIXA 4F3KA 2B5VA 2ETVA 4IUBS 1I2AA 2OCLA 2AFIB 4QATA 1XTJA 2VF5X 2ZRPA 3O3NB 5AJXA 1KKLA 1ZUNA 2GTIA 3HKEA 4HN2A 3LY8A 1LZLA 1CR4A 2K4MA 1BQ4A 4R7ZA 4Z1MA 5CT8A 4MLPA 2VNJA 3QTTA 3A0UA 3EEOA 1VRVA 1U99A 4U9HS 4N47A 5HUJA 3GBSA 2AC2A 2VWGA 2GD6A 2J67A 2YMQA 2A1IA 3EARA 5LVAA 1GPDG 2Q3LA 2UZ1A 4QPNA 4Y6OA 5LYYA 1SBYA 3SHWA 5K45A 1QH1A 4X7BA 1W96A 4LF5B 3G2PA 4INAA 2WJWA 3RRFA 1XAJA 3ZV6A 1NNEA 3AVVA 4WBNA 1XYVA 1RJ9A 4IQFA 4Q03A 1WTCA 1C7JA 2BCGY 2HA0A 2VTVA 4HRYA 4JOSA 1JLLB 3H1TA 3GXOA 3LIIA 3NHAA 4UDNA 4FFLA 3LP5A 3T5PA 3NWOA 1BX3A 1W2WB 1D03A 1O57A 4X1YB 4C7MA 2ZJ4A 5HQJA 1KQGA 5BWBA 1L7NA 4FW9A 4REQB 4DXDA 4Q5IA 1D5WA 3AP3A 2I3AA 5J5AA 3LD9A 5JWHA 4EGFA 4K7JA 2WUFA 4F60A 5HSGA 4N41A 2HU2A 4NBKA 4CN8A 4GQAA 2BP7A 4J0CA 1PUJA 3OFNA 4YC7A 5BNTA 3BGWA 4EO7A 5BSTA 4BMSA 5JYEA 3FPEA 1KYQA 4JB2A 4Z49A 1ETHA 3ED5A 4GLLA 1G8FA 4WERA 2ZI6A 1GQQA 4DT1B 3T5TA 4CYMA 1ABBA 1YZKA 3I4FA 1VIAA 5EE9A 4BNLA 4YRSA 1G20B 4IOJA 1E5DA 2VQDA 3D3WB 3DV0B 3Q8XB 2NUAA 3CZ5A 1SQGA 3R3ZA 4HO1X 3TKLA 2F6RA 1ILWA 3QE9Y 3KYIB 3DO6A 4JROA 4AUMA 4JIGA 4NMLA 4M1TA 1OI4A 3LW8A 3ITNA 1KVSA 2DPLA 2GEUA 1BTOA 3IBTA 1W1IA 4PYQA 3ZCPA 4BNVA 2W2LD 3R0JA 3QOYA 5ADHA 4KN5A 4EMUA 3L8DA 3KYCA 2I4OA 1CQZA 3L7MA 5K09A 3TLZA 1PJ4A 2PPLA 5CK4A 4WJLA 2JHGA 4D8XA 3PQ4A 1S02A 1SIBE 2PGDA 1XZLA 2MDTA 3LCUA 4MQFA 4N9QA 4R2MA 1ZUD1 4IIDA 4X85A 4GOND 3O31A 3PUWA 1V6AA 3HZRA 3TRDA 5JZSA 3QF4A 3B6MA 3GCXA 4IXTA 1YHYA 4Y6PA 1CEEA 3K6JA 1XNHA 2DBVO 4N0PA 5IKXA 3B6ZA 2DR0A 4QQRA 4UTVA 5KNBA 3FR8A 3L7KA 4G07A 3I3SR 4XWGA 3JQAD 4RXMA 4YRFA 4BJ1A 5E9WA 2BJWA 4WK6A 4KI7A 4QAQA 3LDHA 1PFUA 3GA5A 5AHRA 2BHRA 2ADMA 2JGMA 3FHLA 4FD2A 4MWGA 5ECDA 5SZIA 3TFWA 1E9VA 3KJQA 3EYAA 1PSZA 2H4WA 2C92A 3IQDB 4NU6A 2PA0A 3M6UA 3DQPA 5T4HA 4NOLA 2XE7A 3EFOB 3VO9A 3VZRA 1QGED 1E2IA 5INTA 4PNEA 5J1SB 5I7AA 4YR9A 4MYHA 121PA 3TSYA 2DAPA 2H4YA 5EHGA 1J24A 2B9EA 3ZNOA 3MWYW 1DG1G 1J90A 4P93A 3VTAA 3CSUA 1H65A 1XXHB 2QZJA 5FAKA 3C7AA 1M67A 2B8TA 3HG7A 4P31A 2ACVA 1Z0DA 4RTNA 1T8UA 3KVVA 2OK8A 3WKCA 1Z4MA 3MW8A 1GCIA 4JUCA 2XXBA 4OBXA 1CDZA 1Y1QA 3EVEA 4EVQA 3GU3A 4N8SA 5DTEA 1RRMA 1E7SA 1VJRA 2PZKA 5FTKA 4H7DA 4W5WA 4UDYX 2YFQA 3TH5A 4F9GA 4A0HA 1D1TA 1NWCA 5I7SA 4WOCA 5BVHA 2I62A 1XB2A 1TTHA 1AXEA 3NOOA 4PYLA 5EHIA 1IFXA 4EW6A 5LU8A 1P9WA 3DBLB 4CQMB 5IT5A 1YR9A 1ZGJA 3WO1A 1JV2B 3EGWA 2C96A 4TL6A 4MI1A 4V3CA 2X6TA 3NBYC 4HGYA 2AF3C 4Q3AA 2W6ZA 3TIXB 4OHXA 4MH0R 1A96A 2IHTA 4L5YA 4NYJR 3VPXA 1TRHA 1XTBA 1V7ZA 3D02A 1BWQA 1PR5A 3N2YA 4X3PA 1W9HA 3VR2D 5K51A 3ZCVA 4CLHA 2CNOA 1U1EA 2G7ZA 2HDHA 4HBZA 3AQIA 3I6ZA 4O59O 4MCHA 2G70A 2WPDD 1NN3A 2YZ2A 1OI2A 2ZT8A 4XOIA 3ZY5A 4LVUA 2F59A 2PL3A 3RWOA 4OXXA 4DYVA 1SBNE 5DLDA 1KL7A 1QTRA 2LKDA 2B83A 3IDOA 3B48A 3AKDA 4QO7A 5CJJA 5L3VA 3LT5A 4BLRA 1NRXA 4D4HA 3AEYA 2PX6A 4M60A 2BPOA 2IOYA 3GAZA 3O47A 1UJ2A 3A3KA 3K0SA 2OBBA 2C8LA 2QN3A 4X92A 2D0OB 4FX2A 4YHHB 2VHUA 1YBMA 4GOKA 3TFQA 3DLHA 3OWOA 4KTTE 2D7JA 1QIEA 4UBIA 2OOSA 3LQKA 4GU5A 5FNVB 5GAJA 7AT1A 1H6AA 1EE2A 1N6HA 1GM5A 2QRVA 1SAYA 3PDIB 5FOSA 2AR7A 2HWUA 3RAEC 4ENWA 3WHKA 1X3SA 3OSZA 1MRNA 1T9ZA 2PTGA 4P5DA 2FY8A 1XTIA 3BTUA 1GPNA 4BVHA 1BKYA 4X8LA 4XVUA 4F93B 4J0JA 1ZRSA 4OP1A 3R7SA 1TMGE 4NBUA 3R0VA 1GQ2A 1ZVMA 1YE3A 1A3CA 3WJ2A 4TTIA 2NP6A 3KXKA 3ZJ4A 2RKOA 2XUOA 3QA3E 1FFSA 1X8KA 2VHXA 2VZ0A 2PKCA 3EZFA 2Z2JA 2ZRNA 1SO8A 3LLMA 3CUEF 1TJNA 1QK4A 1X7WA 3L06A 5KVAA 5T7BA 2OKGA 3DV2A 1NUQA 5CXSA 1U9JA 2I2DA 1E1DA 2O8CB 3VH4A 3BA1A 4LDNA 3QMMA 3MERA 1NP3A 1JAHA 2HLNA 4HLUA 3TPCA 4FMBB 5JNRA 3JV7A 4O8ZA 2DH6A 4RKYA 1B8UA 3KJIA 4YRNA 1EMDA 2VP6A 2VO1A 1X77A 4X6LA 1KJ9A 3K1ZA 3CLUC 5H9VA 1ZLXA 4B4OA 2Y99A 4R05A 1WMBA 4BNXA 5IH3A 1E3WB 4E5MA 3U56A 3RG2A 1UFVA 1OHHA 3LE8A 4RBNA 5CIWA 3F6SA 3TX6A 3VOAA 1Z4LA 2QTGA 5L3SA 1GA4A 3VSDA 4C1BA 2QZSA 3V5NA 2GO7A 3HKCB 2RGDA 4B2LA 5JJIA 1XHLA 3MILA 4BWGA 2WUVA 4MYRA 1Y7LA 4OGGA 4F3YA 1GQFA 2Q0HA 3KUKA 1BXRA 1AD2A 3BDVA 3MT8A 1QV9A 1ZL0A 5DVZA 1V48A 2JGIA 2VRCA 3M33A 3P2JA 4L8GA 1TEHA 2GRUA 5AVQA 5IF3A 2ZSKA 4JVOA 2XIJA 4ZAXA 4E22A 3FTPA 1F06A 2LCQA 1IXKA 2YNMD 2BD0A 1JHVA 2QUBA 2B1QA 4Q4JA 3SQDA 3VC2A 1E5LA 1ZD2P 3S1AA 1EXDA 1JMYA 1QHGA 1E1RA 1Y8CA 2FPPA 3CF0A 3I1JA 5ES4B 1C9EA 5JTTA 3D4IA 1U28C 1QS0A 2NYVA 1ZEMA 3GJ3A 1T9GS 2XYGA 3EVFA 2QE7D 1M5TA 3NO4A 1NDHA 4MI6A 4ZT5A 2UVPB 4BO9A 1P17A 4YACA 3L8EA 1LBQA 2GM9A 3UPDA 3SVLA 3BWBA 2O54A 3OBBA 3D8HA 3ROZA 1Q0RA 5CLGA 4Z0TA 2G0AA 3DLPX 2W4MA 3K1AB 2UYYA 4NESA 4HNRA 1UINA 3NNNA 5TDHA 1T1JA 4Y3UA 1JSXA 1LBSA 3HLKA 3ZV5A 1O8BA 1VLMA 3O7MA 1QYVA 2V0CA 1FTWA 2XDYA 2YUIA 4K46A 3C7CB 1S7CA 2IS2A 4TPKA 1AGNA 1FK8A 1SM4A 3I6QA 3L93A 1XEWY 1SXJC 3LX8A 4O29A 1MHTA 2QM0A 2RGBA 4DXAA 5ER9A 5KYGA 1OJLA 2EJTA 3A7EA 2H9YA 4FYHA 2WV7A 4M4SA 2L19A 2XNJA 3HHEA 1F60A 3L49A 1N9ZA 3IDZA 3PCTA 2I6GA 3EFBA 1PT8A 4NIMA 1VXOA 1DPGA 5G41A 2J46A 2CSXA 3RS8A 4MV6A 5BXYA 4PNZA 4PHFA 4W8HA 4HS4A 2FUCA 2GCIA 1M1XB 3LNCA 4UHFA 3BDIA 3UMRA 1GLNA 3ABSB 3RTAA 4OGLA 3P1JA 5ALHA 1CQWA 1W1WA 2P3SA 2R97A 3SYRA 3EFEA 2XMCA 1IMJA 2QRKA 3RVOA 4L8FA 3OPVA 4D7AA 2AI1A 5DF1A 1KO1A 3GJTA 1E69A 4N3BA 4AJ4A 2Q4RA 1OFUA 2ZUCA 2Q45A 2ZWVA 3K0FA 1GYRA 1L6IA 2RHDA 3OX2A 4PAQA 5CG1A 3BMOA 3DAPA 1UEIA 3P2IA 1YJAA 1DBIA 3GEGA 3K5WA 4G65A 4R41A 5K8UA 4FI3F 4I36A 2GSDA 2FAXA 5FUWA 4Z4HA 2BR4A 3HDQA 4D1YA 5C1DA 3E7DA 1W46A 5EPUA 1JNYA 1TLFA 1U2DA 2X3FA 4MJ7A 4QM6A 2R7NA 4NE7A 4E88A 5CLJA 4L7VA 3RQSA 4TV8B 1BA3A 1JR4A 1O54A 2WE7A 3PT5A 1ZIXA 4KSBA 2XEXA 4GGPA 5CRIA 3TRFA 3E5NA 3W0LB 5C3MA 5KSYA 5JTUA 4P4UA 4OXIA 1Z28A 5G0SA 5KTRA 3GLIA 1E32A 4TT3A 4GL2A 4X62B 4NEGA 3QBVA 1ZD8A 1DJNA 1VL2A 4UNRA 1Q50A 3I2HA 3WGIA 4Z54A 2QRZA 4TWJA 1B3RA 4Z4FA 2G08A 3BZWA 1OLSA 4YHBA 1GRQA 4LWQA 4RDHA 4Q3KA 3WIEA 3KWMA 2IYEA 1MEEA 4YV1A 1D7AA 1X7ZA 1YF3A 3AH8A 3KJGA 5JAPA 1ARZA 2CMFA 2KYRA 4QU8A 5EIFA 4AD8A 4MW6A 3R7DA 1NSTA 4MIOA 2C98A 2HHHB 2A4MA 2P40A 3RC3A 4CF6A 4KE8A 1NW4A 3E18A 5ALPA 3N6VA 3UJAA 3S1SA 4FBMA 1XZDA 3MCAA 2DQKA 3HKDB 1Z25A 2ZT7A 4YMVA 1TOAA 4RMGA 1ZK0A 1J6UA 1DUVG 1Z34A 3A4IA 3QBEA 4CEHB 4HEA6 2WOJA 1R27A 4IW3B 1ULTA 1YA4A 2F43B 2ILTA 4KR9A 3VHLB 1DJOA 5EINA 1TZ2A 3MQ2A 1LK7A 3G7NA 4NDAA 2IEYA 1YB2A 1QIKA 2P6PA 1V8BA 1VE1A 4WZAE 2ZUWA 3KJFA 4RE6A 4M1SA 5BSKA 1II9A 3EDMA 2VG8A 4D9NA 1L5QA 1PLJA 1YASA 5E7QA 4Q16A 4YRLA 4LXUA 3THWB 1FJXA 3U39A 2D3WA 3OOYA 2AEMA 3ZHYA 2QRQA 4HZGA 4ED9A 1BU8A 1V1MA 3B5JA 3GJZA 5IH7A 3MTIA 3NJ4A 2NYUA 2REXB 4RVHA 5IAGA 3TL3A 4FD3A 3W2TA 1VE7A 1ZZGA 4BNTA 4KO4S 1XZNA 1UQRA 3DXXA 5CVCA 3TTUA 2GM5A 3O9ZA 1WKCA 1UIRA 1FNBA 2DPMA 4OA5A 2NO1A 4XJTA 1U5BB 2Q6VA 4EAAA 3LCCA 2QSJA 2OWEA 4JFRA 2E6KA 3KQWA 4PPNA 2QTZA 1QPBA 4MI9A 2P65A 2CN1A 2AJTA 3NDRA 2BISA 1OU4A 4JSTA 1LUAA 4MKXA 1YB4A 3DB2A 3KHTA 2BI4A 3NP7A 4KTVE 3S8MA 1QV7A 1U11A 2VRWA 1KOLA 1NVMB 2WHRA 4RTJA 3D6VA 4MKIA 1Y3CE 1JP7A 1DAIA 4B83A 1WL8A 3S55A 3G1UA 4UHKA 1GXSB 5ALIA 5MFPA 1EGVB 1Y1KE 3CN9A 1UIMA 1SQ6A 2C2MA 5K8IA 4YCNA 1P3DA 3IELA 4GWKA 3UANA 2FWRA 3ZW7A 3B2EA 2QSYA 1FCJA 1KZ1A 1SD5A 2O8BB 1DO8A 1YFJA 1D04A 1HC7A 2P4SA 5HE9A 5BMVA 5GADl 4FXPA 1NN1A 1WTAA 2Q5JA 1ZRNA 2O1WA 5TPZD 3LLVA 4E5VA 3WK9A 1QO7A 3AV3A 2I03A 3MUNA 2JDIA 2B2NA 1JEDA 4OAPA 1YRHA 3K7EA 5CVDA 5DWDA 4KZPA 2KE5A 5DWVA 1JPUA 2C5EA 2ZDGA 1ZN9A 4S1NA 4A16A 1G8GA 2QG4A 3NWJA 4FI3C 4P34A 2ZUTA 4YJFB 5D6NA 3OLXA 3G5MA 4JMPA 1H4TA 2X0FA 3MMPA 5CDTA 1WHSA 1B73A 4M8NE 5HDQA 1NTOA 3CUVA 4MR9A 3JD1A 1ELOA 1HK7A 4Z0NA 1GCGA 4KODA 1ZPDA 4WGFA 2RHHA 1ZNQO 1LNSA 2M32A 5JMTA 2GLUA 4EB0A 4QVKA 3I4CA 1CG6A 3RT7A 5LQDA 2WLSA 4OI1A 1K6EA 4QZVA 1X1RA 2BWJA 4IV5A 1WS6A 3OH8A 2YJ3A 3JQPA 2PD3A 4XX0B 3VZQA 3OD1A 2MSNA 2Z4RA 3LXXA 3WSVA 4E5YA 2FETA 1AHNA 1T15A 4COOA 4QODA 4RIFA 2ZSHA 2IWRA 4LQCA 1PI3A 1ZC4A 3E2IA 3KYDB 4B48A 4A73A 2Y6UA 3HVKA 2N46A 4YAJA 3K30A 4YCCA 2CDCA 4YPOA 2YR0A 3TZKA 3OIYA 1FU7A 1AUXA 1L1EA 3KT6A 3OQIB 2I29A 1RWQA 2ODNA 4Q1BA 4QRIA 5F5LA 2FZEA 1WPGA 4I5FA 4MITA 2J45A 1GL7A 3TW8B 2C7GA 2PRKA 4QWMA 1UPXA 4G1VA 2VATA 3DCNA 3V9PA 5JPDA 3NP9A 1Q92A 1VMEA 2XPCA 2WHPA 1ZI8A 2HU7A 2X3UA 2ZYDA 3I2YX 3NWEA 4QDOA 5EIWA 3ZV4A 4RTOA 3HQ4O 2Z0MA 5GM1A 2IUTA 3OURA 2R7AA 1Z4OA 1S7GA 2MSCB 4GVXA 4HLDA 3WRYC 2VTBA 1A71A 4IR7A 1SR8A 4BEWA 4K88A 4W6QA 2ZJBA 4EG3A 3A1SA 4BYGA 5HKAA 1II8A 1GADO 1C3LA 1JQKA 2EEZA 4ZAGA 2VNIA 5KOIA 1E4EB 3L02A 3TUZC 2DWUA 2IPNA 1CR2A 2BMDA 4P4NA 4XJSA 5FTNA 5TPWB 5JZMA 3TNJA 1L7XA 1WXFA 5F23A 5JXGA 4LXGA 4PHGA 2G83A 5CFQA 4Y67A 3RUEA 4Y2VA 3UMYA 1Y5MA 5HZMA 3WADA 3B7WA 2FZ4A 4PAGA 5ICCA 5CW1A 2SHKA 4RKWA 3GEMA 5CH5A 4AVYA 4JI0B 4CCSA 2ZRAA 2JGJA 1VB3A 4BNFA 3KB1A 5BNZA 3OM1A 3D6MA 1BQEA 1ZK3A 4K2HA 3LLUA 1SHLA 3BULA 4LHVA 4LPKA 1QVWA 5CFZA 4MPTA 5DE3A 1OB5A 3UT0A 3UN1A 3ZIUA 1ADCA 1YIOA 5I7OA 4WA8A 4AL4A 1XRLA 2O50A 2XNKA 3SJAA 4TRMA 4ZN6A 5IJWA 3COVA 3FWYA 2BFMA 3NTRA 2XDAA 4BHTA 2HHLA 1LX7A 3O82A 4GLFA 1Q1NA 2PUAA 3AM1A 1JXOA 2CXRA 2HDWA 3MGKA 1JU9A 1KFBB 1PFKA 3TLGA 2WIFA 3DOHA 2AX4A 3TWOA 4YX9A 5AQEA 3OE7A 1DAPA 2ZYVX 3GRKA 5FULA 2J3QA 3RIMA 2JAUA 1N0HA 1BCRA 4JNCA 1FE8A 1FW8A 1PLKA 4R84A 3C7DB 5EJEA 4UTXA 5TVGA 4YIHA 2O8FA 1OBVA 3K5IA 4NBTA 1JQDA 3WGYA 2NU7A 4KR3A 4RA9A 3GFOA 4OXQA 1WUKS 4J1TA 5K0GA 2OEPA 5KNCD 1AQUA 2XECA 4JX8A 3SZLA 1RQ7A 2QPTA 4CGYA 1YR6A 1WXQA 3WNBA 4OQXA 4TTJA 5JXWA 4Z8XA 3F73A 4DCNA 5D51S 4Q4CA 2XUGA 4WE3A 5K0LA 2XGSA 9GPBA 5EXDA 2V6FA 3WICA 3PA6A 1FRNA 4A5OA 3S81A 2VAMA 1FYFA 1QJCA 2G1AA 2JFQA 1PZEA 3PJGA 4OPMA 3CLTC 4M83A 1VJCA 1YDMA 2JVJA 1SXIA 2IYZA 3AI3A 2E4ZA 2G9NA 2AJ8A 3OE1A 3WQRA 3KE8A 1PQWA 3TZHA 1DKNA 2P77A 3EZNA 1EA5A 4YRPA 4YT5A 4J29A 4ALMA 3Q8KA 3BCSA 3G8BA 1WG8A 4KDRA 4TTPA 5B7PA 5KS2A 1WZ2A 3D6UA 1HT1E 1P2FA 1QKJA 4QTYA 1ZRMA 4DDTA 1BWPA 2C1EA 1KZ7B 2QPOA 3PQ7A 4OHVA 4LE2A 2W6CX 3AM5A 3WLJA 3O3CA 4BQSA 1X7GA 2IX3A 4QUEA 3JALA 1C0IA 1Z7YA 4EMTA 2XMZA 3OJ0A 4CIXA 4EPWA 4PQYA 1BGWA 1IXYA 4ZQBA 4AG3A 2A0YA 2RH8A 3IVRA 5FA5A 1VLVA 1P80A 3KAQA 1AJEA 3DTVB 1W19A 1RW4A 3BH7A 3Q1KA 1KBQA 3GJ5A 2Q0QA 4KVFA 4D43A 3VDMA 3ZWXA 3ZI7A 5CVUA 5HQ3B 4LJLA 3LO8A 4FR2A 3OY2A 3DLAA 3CUYA 2JD2A 1Z33A 3I73A 3M6IA 4YAIA 4NK5A 3ZHXA 4K9OA 1ZH8A 3ASZA 3FB1A 3CZMA 1V4NA 2OGZA 4ZT2A 3F6CA 4HYYA 4WKGA 4XYGA 4KAJA 3QVMA 4FCTA 4ZIRA 2O3JA 2QM8A 3V8EA 2JL1A 2J9GA 1QQTA 3IP9A 1Z8DA 4RLHA 3I04A 1YOVB 4Q05A 3W1VA 2C5HA 3U4QB 1K5HA 3OM0A 3I34X 2QI9C 3QMWA 4CTOA 4MVYA 5DHRA 1XTUA 1KDYA 4HQLA 5LZ5A 5IZCA 4JI4B 1W0KD 3JR3A 1JECA 4NJEB 2JJ1D 1VZ3A 2FPIB 3M3PA 1UKBA 4YRIA 2ZRBA 2RGUA 1FYEA 3UJ6A 3JD3A 3KCQA 4G4SO 2WICA 1AUVA 3GROA 1AG9A 1KPHA 3KPJA 4KO2S 1FZTA 4BWFB 5M04A 4R2WA 4IMPA 1QFZA 4MR8A 4YCDA 4GDFA 3E3OA 3ORYA 4CEJA 4J16A 3D7NA 1EM8A 1JR3A 3K2QA 1GOTA 2XI4A 4WL0A 1ZSNA 4LV6A 3T95A 1NLUA 4R6XA 5BO5A 2OE2A 3TF5A 4LZZA 4KVGA 4R1OA 3VHRA 4MP8A 2A0XA 5AKLA 4ARSA 3TO5A 4OKNA 4IMJB 2ONZA 3T1QA 4QYMA 5I8WA 4EG0A 4L72A 7GPBA 4AS1A 1Q3TA 3EXAA 3GLVA 1C7QA 3PNQA 1U8AA 1VJ1A 4LDJA 3U3XA 1R0KA 5CCDA 2Q2NA 2CWWA 2ZAMA 4URVR 3DTYA 4CKWA 2H2FA 3MZ0A 1DQNA 2X8JB 1TLTA 4W1PA 1XPUA 1M8GA 1FX0B 2JA1A 1C9NA 2QROA 1UZAA 3IDSA 2R7LA 4YMLA 1R2QA 1UDWA 2BFPA 5L3QA 3H6HA 1LGYA 3DAGA 1SWVA 4XTCS 3TRIA 2WU0A 4O4IA 2CLKB 1UBLS 3ZK9A 1YD7A 4MMYB 4S05A 4ILEA 3PC4A 1O6FA 3FTFA 4I4IA 1KIFA 2BH2A 4PC7A 2M6KA 1P5FA 5EWJB 3AB7A 1DEHA 4Z7OB 5MDHA 4ZJYA 2JJ2D 2GN1A 1NYLA 3M3DA 3F9CA 3IPXA 3CT4A 3GJYA 3ESYA 4RL6A 4Z9AA 1W8DA 2GEDA 3VPAA 2HJ9A 4CU2A 5BVGA 5FL3A 1FSZA 3F2VA 4ZQEA 3WHIA 1PVOA 1OI3A 2OOKA 5HZHA 4D4GA 3IKMB 2I55A 1GWNA 1NKVA 3B82A 3R0ZA 4ON9A 4PHCA 4DSOA 1B42A 2RE8A 4HXEB 5F1OA 4L5CA 5J47A 3LZ6A 1EKXA 4PX9A 4GP9A 5JNVA 2A0FA 3RH0A 4CKEA 4JDPA 3F49S 4EGCB 4C7XA 4MVJP 1KMHB 1IQUA 4RVSA 2D1FA 2WZBA 1HY3A 1O97D 1GL9B 1R0LA 1US8B 1T2EA 1ZYUA 4LXQA 4MPRA 3GEPA 2A6PA 1P7ZA 4J0FA 4MRPA 3KSAC 4GZMA 4ZI3A 3UFBA 3R3VA 2YCBA 4ZWNA 4HGNA 3A9VA 3R9IA 1IPHA 4RCVA 4UNSA 1J00A 1ZNXA 4QICA 4QUHA 3WXMA 2PSEA 4OGKA 1UOEA 3W8NA 5IJZA 5C7IO 2C9ZA 3WZMA 3IOYA 3W5BA 4UMFA 3ZD7A 2IVFA 4ADSG 1R12A 4H17A 2E4YA 4V1CA 3WIDA 3UMFA 3MA0A 4EKDA 3BWCA 5F1PA 1B2RA 2ODTX 1J2RA 4HEA1 1P29A 2NXJA 1IBCA 4LAFA 1SVMA 3RKRA 5JAIA 4QELA 3ZKWA 2PHZA 2BGIA 3O5AA 1Q7CA 2R8PA 1HE3A 4YAGA 2VDJA 3F47A 2ZPUA 4X20A 5IRCD 3FYCA 2YHIA 2WD7A 4GEGA 2EBFX 3H97A 3ASVA 3PGLA 2QN2A 4KOAA 3QVXA 4WZAB 1YCFA 1G8PA 2X0KA 1IDN1 3ZOKA 3ZD9A 1PR6A 1FFGA 2OVBA 5ETJA 4FB5A 5KTYA 3RV3A 1WXWA 3TMKA 4BGVA 1JA9A 1GVNB 3ES9A 2IOHA 5ALNA 3WE7A 3DO5A 2A30A 4B4DA 3LRPA 1Q7BA 4QD3A 3TTTA 1QDUA 1SGWA 4NCHA 1GKKA 5F51A 2HHJA 3H65A 4V0RA 2C4VA 1MB9A 5JIBA 2XV1A 4PEVA 3UYKA 5H4GA 1ULSA 5IABA 2DPXA 5CNIA 4Z0HO 1WZUA 3IMGA 4Q4HB 3EVAA 5TNXA 3DTNA 2DP4E 1P39A 1O94A 1RVV1 2X7HA 4JOBA 1IATA 4PLVA 4PXYA 3BB3A 3C3MA 4BCCA 4CTNA 4EB6A 5FUQA 1P6QA 1WKVA 4IQ0A 3U9SA 2GDZA 5CX1B 2F55A 1G19A 1RYNA 3JWHA 5ALQA 5KCMA 4MP6A 4CDGA 5BRAA 4YCMA 5KEIA 3CF4A 3NTUA 4KRYA 4O4HF 3EAFA 3U1TA 1OREA 4NE2A 1OXKB 2CJWA 2J4FA 3RWBA 4I5EA 4DCJA 5LUBA 2RK6A 3JWGA 3DP7A 3JASA 3GNTA 3RGWS 4UXJA 221PA 2IXDA 4GM1A 1G41A 5AW7A 2ZROA 4REOA 4IQ8A 4CF5A 3QUSA 2QD5A 3KKZA 4H6WA 4L3VA 4MB0A 4C21A 2XZDA 1KO5A 5BW6B 2R6DA 5DMXA 3SR3A 1U94A 1YR3A 2P67A 5IK2D 1ZNWA 3WO0A 2YINC 2CLEB 1WCYA 3F5MA 1T4MA 3ZE9A 1TXGA 4AU1A 3HR4A 1R0XA 2FP4A 5KYUB 4BECA 1ZM7A 1JTEA 4BNWA 3C45A 2YMLA 3LKBA 2PEYA 3G7SA 4O1IA 4FMPA 1XV5A 2JFWA 2IYVA 4RDIA 4LGVA 2JK0A 1QH8B 1BVYF 4JCCA 4AY4A 1JTVA 3UQYS 4F6CA 1EXNA 3D0OA 1YZFA 2JIRA 1OWOA 3F98A 2C2BA 4Q01A 1KDTA 1CY2A 5IF9A 5EZ6B 3GLSA 2EFYA 4FOPA 4PQGA 1CHNA 1I32A 2RHBA 3CLRD 4R9SA 4U63A 5AKHA 2AFIA 5JOQA 1MV5A 4PZPA 2GAFA 3N3AC 4PO8A 1P9LA 3AP1A 4LTNA 4F96A 4MYTA 5C5DA 3WC4A 3UA4A 1QC5B 3I9FA 5EMKA 4RV4A 1ZJYA 3BFPA 5JATA 1L9KA 1PQUA 2OFFA 3WY9A 3VR4H 2JIZA 1W52X 5HNKA 5FBQB 3O0DA 2JW5A 2R1ZA 1YA6A 1Z62A 421PA 1XD9A 2WHYA 3DV9A 4JLNA 3VDQA 4E31A 3NPMA 5L95A 1N1MA 1R5OA 5FQNA 2X5KO 5IDYA 1OLXA 3DE1X 1XTVA 1F1BA 3MEQA 4GIBA 2VNSA 1SD2A 2ECPA 3NCTA 3Q0EA 3BXHA 2X4IA 2IV3A 1QP7A 4I4TB 1FDRA 1GPAA 3R40A 1AKTA 5K6AC 2ARKA 1FSGA 3HADA 1M8PA 4S1VA 4UDOA 3SGLA 4X1YA 4QTZA 4B1FA 1FDTA 4U0JA 1D1PA 4HQ6A 1G55A 4A0QA 1YIAA 2FEWB 5K01A 4GT1A 3T7AA 5HKKA 1JI0A 3LVFO 2VDQB 4ZAYA 5FHQA 1E63A 1M0SA 1UQTA 2HJHA 3VZDA 1L5ZA 5CBPB 1RQ2A 4DT1A 5HK8A 2ERYA 3ZY3A 1G20A 3V7YA 2J87A 3D3WA 3SIRA 3BD6A 5JNTA 2VP0A 4FMCF 4TYNA 2P5SA 1E3SA 1BYUA 2F17A 5IKPA 4MK4A 3VU1A 3CO0S 4YP1A 1PJQA 4I19A 3D4OA 2WTMA 2AWNA 4D9FA 2XADA 1JQEA 5A5EA 3ZU5A 3TGPA 2FSFA 1QRAA 1AV7A 4UEKA 5D7NA 5A3SA 3PEVA 1PR2A 2JIBA 3B5EA 4B3RB 3VZPA 4TXMA 1KXJA 5M3BA 4OQLA 3ZHTA 1M1YB 2PD6A 3B9BA 1Z5UA 4XOUA 1QQBA 1SZJG 4IIYA 2H7XA 2GR9A 3MG9A 3OFKA 2AZMA 5IKEA 5JS1A 4MJLA 1HNNA 1EX7A 2XOKA 5G0TA 4I1PA 2UUCB 2HPVA 1RXCA 4HB2A 1GPBA 3SKXA 2GM4A 3IERA 1VI2A 1XZEA 3IKJA 1JFFB 2V4ZA 5DN6A 4JLVA 5AW2A 1DV2A 4LSMA 5DN9A 1O58A 3CVVA 4BLTA 1J22A 3JQAB 4UHHA 2K7FA 3EGVA 5D3QA 4OV6B 1BDJA 4FYYA 4G67A 3ADPA 1E6EA 1GZVA 5K9ZA 2ZKLA 2R66A 1QE3A 3BERA 2CVQA 5F9FA 3ZN2A 1K4KA 1M0EA 3ZDRA 3F71A 1TEVA 1YQQA 1U4SA 3EFOA 4JL5A 4YAKA 3UJNA 2QVBA 4WDRA 3GLFE 3E05A 2PH5A 1ZD3A 3FPFA 3NKVA 1Y3IA 1CZLA 1VYTA 2G4LA 5EIAA 3WL6A 3ZS9A 1QRTA 2ZUUA 1EFPA 3BE4A 3X1WA 2Z8ZA 4R2KA 1DAOA 3L0PA 4ISBA 2VNHA 4M1EA 5JH7F 1W5BA 3HR7A 2JFXA 5EPOA 1FW6A 1KA9H 1BW9B 2EJUA 1TKRA 5EFZA 2Q8PA 3NONA 2UYQA 4LYJA 4EJ2A 3E9RA 4ZALA 1YK1A 3PUHA 4PX2A 1KXZA 1TAGA 5KUTA 5LSAA 1NXVA 4LEIA 3ZWOA 1H4SA 3T3OA 2V7QA 4NSNA 4C0HA 2MSKA 2ZBEA 1CNFA 2J33A 1LWOA 1R9NA 4JXZA 3L7CA 2VUTA 2ZR9A 1V26A 1W4CA 4I4CA 1HDIA 3UQZA 1WV0A 5DGTA 1PYDA 1Z18A 2GPYA 3IIEA 4GO1A 4KIWA 4LG1A 1R8XA 2W4QA 3KZXA 3CZCA 2VZ8A 4YROA 1G291 1AB5A 4LCJA 2AN5A 3MPUA 1K9SA 3CTPA 4NV1A 1EUDB 1PDOA 2EBWA 4JR0A 3QK7A 4RK0A 3U6KA 3PI7A 1AQLA 3IR6A 4G1UC 4F2WA 1SBZA 1TK9A 3P8ZA 3A4MA 2CMDA 1KJZA 3BB4A 4TTQA 1KFJB 3Q7PA 1PEAA 4BUJA 2UUOA 1TKBA 1WXDA 1WZCA 3D6JA 3RREA 5HOEA 1YRBA 3FCYA 4YALA 3DDWA 1U31A 2EYQA 2YN2A 3BIOA 3BK1A 3FM9A 1CXZA 3QLVC 3ROKA 4I9UA 1B00A 2NVWA 3MGAA 4KQIA 3B9QA 3VUEA 5BSWA 5LZ2A 2E89A 6LDHA 2V58A 3VPCA 1W36D 3D81A 5M34A 1D3AA 2HADA 1R0YA 2K5UA 2JKYA 4GS5A 4M54A 4B8YA 1Z75A 1TYZA 2VDWB 2XNDA 3F5SA 1R74A 5L7WA 2IP2A 2IX9A 4DMUB 1RADA 2XGGA 1NKSA 1YE8A 5ALYA 3OZEA 3PHGA 4RHUA 3HYNA 5KNDD 4HQNA 4MW4A 1VMIA 1SB8A 1FC0A 3BKXA 5DCUA 1U7ZA 1TA9A 1J9GA 5A2GA 3WR5A 3FDJA 2XMSA 3PDIA 4D2IA 4PX3A 2IELA 3TVDA 3BB1A 2LBPA 1M1NA 2KMLA 2R5FA 4PG4A 4JLWA 1DKOA 2XCOA 3PZBA 4UASA 1L8LA 3R6GA 1F4PA 4P22A 3ZUGA 2IUFA 2XZTA 4MS4A 1BX1A 2IPOA 4GUAA 4HDCA 3WLIA 1ZGCA 3LRTA 4O2AA 3V7FA 4TVSA 3IUSA 2ORVA 4NBSA 3TLBA 3S0JA 3C39A 4QTXA 4AKEA 3N39C 1MO6A 4O3MA 2NO5A 4JXKA 4PR3A 4YY3B 5G3ZA 2OFXA 2C5BA 1PN3A 4E7PA 1RZRD 2D0DA 4CF4A 3HEAA 2O8CA 1RKBA 1EFVB 1AKYA 1ZGAA 1OR8A 2B4YA 3OKFA 3G1WA 1S8AA 3G5LA 4ID9A 2WWTA 1Z3CA 1Y6QA 2AFHE 1G8MA 1YONA 1H2AS 5AVRA 1EG7A 3WK4A 3PNBA 1NRJB 4IIFA 1SUEA 1ZJZA 3CJRA 1N1DA 1XZAA 3EZ7A 3PDJA 3M1YA 3HNOA 2HMAA 3CR3C 4CTMA 3A3OA 3LWZA 3RC8A 3HLTA 4C0SA 5F12A 4ACAA 2WILA 4XLLA 5AXAA 5F5XA 5B30A 4TGLA 1UBRS 3AIKA 3UWKA 4C78A 3C3WA 3WQBA 5LR6A 1FP4A 1LS6A 1H0HA 2OO5C 3O0TA 3H86A 3LBHA 1JG3A 1NF3A 5T6MA 5DO9A 1WCIB 2PS1A 3EIFA 3V48A 2BYTA 5IYZA 4KAAA 3LCRA 2GCOB 4LBZA 4ZHQB 2R6ZA 4OH1A 5A2QA 5JT1A 1C3VA 1QTQA 1U0TA 1E20A 3TK1A 1OH5A 4PSUA 1KVTA 2JATA 1BN6A 1KBOA 3GDWA 3PCXA 4MS3B 3UC5A 2BZGA 5B3LA 4ND2A 1A9SA 2YXDA 2GEKA 3QEMB 2WM2A 4G56A 4Z99A 4KG7A 4PAWA 2XAAA 4Q48A 5C35A 1RXUA 1PJTA 5KYXA 2QJTA 3U3JA 2AHOA 1MJFA 1C1DB 3GD7A 1NRWA 2TS1A 3HY4A 1L7OA 2Q41A 1UXKA 1F6DA 1I2CA 8OHMA 3VKWA 4GKBA 5JBQA 4UHJA 2P9QA 3K1AA 3L43A 3LUAA 3PDHA 4QX6A 1PEKE 3ZTTA 3HFSA 3L0SA 1W581 5JWOA 3KD3A 1UOOA 2WKSA 4ZOBA 3VYRB 3ZWNA 2GI4A 3H2BA 4RF4A 4DLPA 1S6YA 1M8FA 3MWKA 4FDMA 1CIPA 1B0AA 3F97A 4O1HA 5K0JA 4YUXA 2HRZA 2B3DA 1GL6A 3AR9A 3ND9A 1PFVA 1V8PA 4KWHA 4YRTA 1Q3HA 1JLKA 3HO8A 2XMQA 4AJKA 1RAFA 2O8DB 1JBKA 4I6GA 5NLLA 3JATA 3GX1A 1JA1A 4KE7A 5BQOA 4LRTB 9LDBA 4D25A 1I3NA 4RPJA 3B1VA 1RQPA 1F2DA 4AUKA 1QKKA 5HFJA 4IIGA 2AW3A 4B84A 1LDBA 2C4UA 2OZEA 2R7MA 3BWDD 3OOSA 4HYTA 4ZMBA 4R1LA 1Y8QA 4E5KA 4D8TA 3HXPA 1H2ZA 5CHEA 1SB9A 2VHTA 3PC6A 5SICE 1YBVA 4QDTA 2IYSA 4C4TA 3DYIA 2CNLA 2BFDA 3NHJA 1LI7A 3TVTA 1W4RA 5B57C 4QJ3A 5JSFA 1GARA 1DEKA 5MN5A 2I4NA 4MOWA 2WW8A 1FUKA 2O20A 1FSFA 2VYCA 5EP2A 4AN0A 2X0RA 2X77A 2Y93A 2ERCA 5EL0A 2IZOA 3SZGA 3E9EA 3OY7A 3KQMA 3GK3A 4NR0A 4QGFA 4F3NA 3UJ7A 5K3EA 1E98A 4AQYB 2PX8A 3ZTYA 4EA8A 3PVSA 1RLUA 4M9QA 2FW8A 2V98A 3EDQA 4E2XA 3R7LA 3RQIA 3WDLA 1E1CA 4WNYA 5H16A 1F8XA 1FTGA 3KR2A 3IRVA 4GI7A 2DCMA 3OEHA 2SNIE 1CUDA 3Q3EA 3VHQA 5AM2A 1OT5A 3AEQB 5JI2E 1C1XB 4Y6RA 4NZZA 3HA3A 1N78A 3T1NA 3ESBA 5DCYA 1JEEA 1X8XA 3VRHA 3WWPA 2PCJA 1T29A 1DRKA 3T1VA 3H8VA 3UMVA 1T9DA 2GFHA 4DZTA 3UWPA 3PFKA 3FCOA 4YMWA 2R00A 3C1OA 5AT1A 2A88A 4YJ2F 4QRHA 2YWDA 4FDUA 4LDPA 1OB2A 3T54A 5CT5A 1TB4A 2JFGA 3OCUA 1E5TA 1U98A 4M86A 4KREA 1YS2X 3CNLA 1OJ7A 3PPXA 4Q0MA 4BMNA 2P6NA 3RHSA 1NWHA 2X3YA 5B2EA 5GGYA 1WXHA 2VN8A 4ZI5A 1I7NA 4EI2A 1PZGA 4GI5A 3TQIA 4EYOA 3H8WA 2H06A 1KKUA 3HWX1 1GD1O 3RU7A 1JKXA 1ZU4A 2BEUB 2X13A 4XE5A 2F43A 3V9AA 3ZXUB 1KZ6A 4EO4A 1E3IA 1Q2XA 4XVQA 5KAMA 3SHFA 1ML4A 2EW8A 2CXTA 2FP3A 3RKUA 3W3AH 2G8NA 3D2CA 4B4UA 1UPUA 2XBUA 2H1VA 2B8JA 1LW6E 3CHYA 4OA8A 3FPGA 1Z7BA 2FN7A 4PGFA 4H2DA 2VBFA 1P2TA 4WJKB 1E2LA 3THWA 3PI6A 3A6DA 2B78A 3DAYA 1IQRA 3LAWA 5CTJA 4Y2XA 1LI5A 1Z88A 4TOIA 4WVLA 2BGUA 2J9ZB 3CLUD 1S2GA 5J2TF 5F3WB 3BGOS 5CJ2A 1V4VA 3CG0A 4J7UA 1BWSA 2IS1A 3ZBPA 1JSRA 3DMNA 1KY2A 2VXBA 1EBUA 1NONA 4YQZA 2FLVA 3R3YA 3THOA 3HU1A 1EFHA 2YY5A 4L9RA 5CNKA 2N1BA 4P54A 1U5BA 2ZI5A 3ABQB 1IK4A 2H07A 2O6LA 5A5GA 1Y63A 1TIKA 3B7PA 4JY7A 5BQFA 1EBFA 4BUZA 1ZMTA 3TQOA 4GUDA 3G7UA 1E79A 1UBFA 2AMYA 2PZBA 5EKSA 1YBFA 3FYHA 5AM5A 3ZIAA 3A6PC 3AEZA 4ZAWA 5K8VA 1Z29A 4EUNA 4II2A 3H0CA 1Z6XA 3HP1A 3UAVA 3UK1A 2E85A 4CMAA 4MARA 2JGFA 3H04A 2V0NA 3O90A 3ILVA 3PJDA 4LF4B 1X1QA 1ZKMA 1M6YA 1SWWA 3G02A 3JAWA 3ESDA 5M5BA 3SLKA 4C7OB 4E33A 1DELA 4KVZA 3WMRA 5FCDA 4CFZA 2V4UA 3EC2A 3U3DA 5ALVA 1IPFA 4ZU3A 1Q22A 2FZGA 3E58A 3OKCA 3B7GA 3NFRA 3PJFA 1AQJA 3R8FA 1UCFA 4AJ2A 3H2SA 3QVSA 1FFDA 3QPUA 5FA6A 3LBYA 2P9BA 4EJSC 1XE3A 5HBGA 3PJEA 1GV1A 1KERA 4ARIA 4RY8A 4DA7A 2R8XA 2HCJB 3GHYA 3DVLA 1GN8A 1HA3A 2C4NA 3AJRA 1NVXQ 2RDMA 4G0OA 4NRDA 4PONA 4QC2A 5K7SA 1LCIA 2ZS9A 2LRHA 4IIJF 2CUTA 4PO9A 3FYSA 3RRYA 2BEKA 2V8OA 3TBKA 5ALJA 1HLPA 1GRVA 4TLEA 3MGCA 2PSDA 4KXLA 5IW8A 2IH5A 2R48A 3ELBA 3CY6A 3DF7A 4R2JA 4Q21A 3IKVA 2FQWA 2HC9A 2NX2A 4O3FA 3LF1A 4X1IB 3LHKA 1HFJA 1IXSB 3WHPA 4JBIA 1EQUA 2JCBA 1CS0B 5HUQA 1G59A 4L95C 3C4JA 4YUWA 4HQKA 3DQZA 3OZ7A 1TM3E 4TXHA 2L0XA 4NQRA 3ABOB 2CXOA 2VBIA 4XX0A 1KSJA 1F2VA 4KR2A 5LA6F 2MIIA 2A84A 4P7FA 2QVXX 4F38A 3GXBA 1UBOS 4G5RA 5GVSA 2A59A 1E2BA 2WTUA 3E9CA 4DBLC 4DR3B 3D7RA 5AUOB 8LDHA 1SA0A 2BE7A 3TAUA 4HD8A 1M2HA 1XDZA 2PGJA 3VNUA 1D0SA 4YA6A 2OTCA 5DHTA 5F4BA 1DCKA 3WZLA 1PLLA 2A0KA 2DG2A 3X43A 1JIXA 3CKKA 2YJ5A 3IBCA 2Y1KA 2VYVD 3AJDA 3C24A 4PCUA 5CDGA 6REQA 3K20A 4J9UE 3RBAA 3TW8A 5HP4A 3VAAA 4JKYA 2QJFA 4XQCA 4OBEA 4R3UC 1FXSA 4RMHA 3NIBA 3GWGA 3FNIA 3MJHA 4L0CA 1MLDA 1M2GA 1TGYA 1GTG1 3FHTA 2C97A 3BH0A 3T99A 1QH0A 2AEEA 4LW8A 2G07A 3V1MA 4BO6A 1MOSA 5K8CA 3BMQB 3B51X 4ZP1A 4GLBA 5IANA 1GEEA 3FOWA 1KEZA 3MCUA 4DKJA 1RYZA 5KYYB 3R5JA 3BUSA 3U7FB 1UBGA 5IZ4A 2D59A 1KOJA 1W5SA 1KPGA 1XU4A 2XJ4A 1NXPA 4LC0A 5BN4B 4DR1B 1T6NA 5JADA 3RUFA 5ERYA 1N5RA 1OTHA 1I2ZA 4CLRB 4RWZA 1QFSA 1G6Q1 1URPA 1M76A 2HA5A 3EG9B 4RZ2A 2PKQP 5KKNB 1KOGA 2GHRA 2R1VB 2BF4A 2ONYA 1W2HA 2GZSA 2VZLA 2CMKA 1X87A 3G5TA 3AOEA 4YCBA 1Q6YA 1CFZA 3K1YA 1QAMA 1E3JA 1TCCA 2JB9A 2D8MA 2WFAA 3NIGB 4LHXA 3ZZUA 1MVLA 1DNPA 5HRUA 2DMRA 3HJHA 4TYWA 1E3QA 2C5AA 3H1EA 1Q6ZA 3PQFA 4RZXA 3LUJA 1HL3A 3A6GA 3SC4A 2OV1A 1JHPA 2XB6A 2FW9A 1JQ3A 5A4AA 1Q7RA 4QG7A 2WAYA 4M3NA 3M1LA 4A3SA 3SKVA 3DL2A 2I8LA 4CVNA 1W94A 4JEUA 1NE2A 2WJ4A 2CLDX 1QLWA 1YKGA 2BE9A 3U62A 3MELA 3JD4A 2PM8A 3X0DA 4D9MA 5B1YA 1MTZA 2YRFA 3IDAA 3PNMA 3N2LA 4E13A 1QX4A 2CHUA 3OEED 3PDWA 5E7MA 3WJ7A 1EB8A 2J59A 2P5UA 5E1BA 4P80A 4AS3A 3ZU6A 4C04A 4C89A 3IRUA 4A4DA 3RJMA 3QJ5A 1O6GA 1SK8A 4G09A 4HRAA 5HMMA 4P0QB 1BXZA 1XMPA 1XWWA 2BHSA 4UTOA 3U0BA 4YUYA 3EXG1 2ZJ7A 4V3BA 5KYKA 1ISRA 1P4HA 1YDGA 3CNEA 4I1YA 4PSAA 2QGNA 5IHPA 4WDQA 1T4GA 4KGVA 1MB4A 1R8JA 3ZE1B 1RWOA 5I9SA 1ZXXA 2GZAA 3VR6H 1W88B 2A9OA 2LW7A 3IQGX 2ZSJA 3AKYA 1X7XB 1MABA 4IJQA 4LE1A 3U5ZB 1CFJA 3WQSB 3VNBA 1TCUA 4WNAB 1Z0AA 2CCGA 2CDRA 1IUPA 2YXLA 3EC7A 1WW8A 2X41A 2ZUEA 1PRYA 1PX2A 3OCCA 4EF5A 2J9YB 4ZPJA 3ZNPA 1VDMA 2UVQA 1ES9A 3L7LA 1BGXT 1V5EA 3IKTA 5C8ZA 4B09A 1KYXA 4YT2A 2DPYA 5BWMA 1MU0A 2IRWA 1WUHS 2WU1A 5GZ6A 3IFSA 2B7LA 2X5XA 2WHEA 3WYCA 1OGIA 5IWCA 1AMOA 2QMYA 3HCDA 4NH0A 2W2VA 2WDZA 3BFJA 2AFHB 1E77A 1IM2A 3X3HA 4PZ0A 3S5JA 4CLOA 5EWLA 4BZPA 4BX0A 3KFLA 4H60A 3LX4A 3MMSA 5DYIA 2EG5A 3RM3A 1H66A 2HMUA 4IO0A 5EYPA 2GKGA 1PVDA 4G5SA 1WDTA 4N40A 4X94A 1TM7E 3TLEA 1S4MA 2R9VA 5KCZA 4KXQA 5JEEA 5J4YA 4Q9HA 1QNFA 1R4MB 4C0AC 5LBIA 2WTNA 1UPFA 1D9XA 2X0NA 3FE2A 1GN9A 3JX9A 2VRBA 1Y3BE 3O84A 4CG3A 3CRVA 4C9BA 1F20A 3V4LA 1YOVA 3U4QA 1M34E 4WEOA 1XT6A 1L8XA 4DSUA 1E62A 1P6XA 5CG2A 3GN1A 4Q7JB 4Y2HA 1OAOA 1LRLA 1H93A 2JPDA 2WSSD 3PHCA 3PP8A 4RPGA 4P58A 2HFJA 4NY1A 1C2YA 3F2IA 1U8EA 1W87A 1HV8A 3FGZA 2JAPA 2XSZD 4KAXA 4CLDA 4QGHA 8ATCA 2W0MA 3P9ZA 2G9UA 3DR5A 2QN1A 4FUTA 2JAWA 3RTEA 1V35A 5CW2A 2UZIR 5LJIA 3WGNA 1ULAA 2QLJA 2Z3WA 3FD8A 3LOUA 1KDOA 1NVVQ 4GSLA 4UE2A 4HSEA 4A03A 4L5AA 1MQ8B 5EGNA 2HLDA 4C29A 3PR3A 1NKTA 2A92A 4ECEA 4EX7A 3K8QA 2CKDA 2LD4A 4HHEA 1Q95A 2C88A 1VECA 3OQPA 3SIPA 1GZ7A 1XRPA 5CP8A 4IICA 5EMLA 3HVRA 1ESDA 4Q19A 2HO5A 3V1NA 3K31A 2EOAA 5D5QA 5DLPA 3A70A 2I2CA 1N3IA 3D6HA 4ID3A 3UAOA 3VNRA 5EZYA 5EHQA 4DEXA 4H31A 4U3JB 2NV6A 1NUHA 1Y33E 1P5JA 4CM5A 2CL6X 1JNXX 1BKDR 1F2UB 1IE3A 1C41A 3PKJA 4ZREA 4PCAA 1RKXA 2GWHA 1EDBA 2Z9CA 3FMFA 4L8VA 4C03A 1XJWA 1YZ3A 4CLXA 4D4MA 4AMBA 4CM4B 3D0KA 2FMFA 1ODCA 1FX0A 4E2WA 2UXCB 1XFDA 3RPEA 4RFSB 4M89A 2ZFUA 3PTZA 3OOHA 1N8SA 1QO0D 2WNHA 1HZZA 1TYDE 2RCNA 1W93A 3BIJA 5KBYA 1QZUA 1R6BX 1TUGA 1WOYA 1JIQA 2MYTA 4CMIB 3CUWA 1NLZA 1S4QA 2P9TA 3LOQA 4MKGA 4Q4AA 1RBMA 4RK4A 1P45A 1RCTE 1N6OA 1VB5A 1YRLA 2YYZA 1NNLA 1X70A 2C94A 1JKFA 4Q93A 1LDYA 2GJKA 2Y0BA 3GJ6A 1WP4A 4ND1A 5AM1A 2YICA 5IBRA 1I2DA 5DHFA 2RHWA 2CLCX 1BHSA 3EXFB 4FBGA 4ITVA 4PFQA 4D6PA 1EHIA 3ANXA 3EWAA 3LIPA 3PNSA 1QKIA 4F4CA 2I0FA 1XF1A 1DRVA 4B71A 1M6HA 2RI6A 3IJPA 5JVDB 3A9TA 1XRJA 1OAAA 1U7TA 1XJ5A 3AB3A 2KLBA 1DV1A 3EC1A 1SC6A 4LC9A 4NULA 2ZIVB 1LNZA 4OU4A 2W6IA 3T9BA 4JGGA 4CKCB 3KELA 3HPRA 3SSMA 1K0UA 4DCMA 4UFPA 4M7PA 1KMHA 4RZSA 2VJCA 1I4TD 1T6BY 4RCZA 1US8A 6GPBA 5CCBA 1F8FA 2HQOA 2VC2B 5LIRA 4WUTA 4WK2B 4EK9A 5B12A 3HXLA 2HCBA 4FU0A 2HUPA 2PO5A 2JLBA 2Z2ZA 3MQFA 3N0TA 5A7GA 3SNKA 3O83A 5HS6A 1UP7A 1JHDA 3B2QA 4D8YA 2O2XA 3KSZO 1P0CA 3ZX5A 4DEYA 2JHPA 5COQA 3NEAA 3ER8A 4HH1A 4R1SA 4LRSB 1VIVA 4QXQA 4XGRA 3QI7A 4BXOB 3JQ7A 3ET5A 3JZIA 5AD1A 2OHHA 3C3BA 1Y4DE 2WF9A 3P9CA 3LL4A 1UK7A 2HSEA 3SYNA 1IL0A 3QX8A 2CW5A 2R60A 3CLTD 5EZQA 4YJDA 4J0GA 3UAGA 2ZBQA 4NBRA 4QXOA 4V24A 5JLJA 2IIQA 3STHA 3TTVA