3HEMA

Structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
291
structure length
291
Chain Sequence
QLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETCDIYMHYLRGCSDLFRDKYTDVCQFTLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium tuberculosis Mycolic Acid Cyclopropane Synthase CmaA2 in Complex with Dioctylamine
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Cyclopropane-fatty-acyl-phospholipid synthase 2
total genus 115
structure length 291
sequence length 291
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hemA00
2ZVJA 1KYWA 1TW3A 3EGVA 4E31A 2P7HA 3ELWA 3EMBA 3GJYA 10MHA 5K0LA 2PY6A 3X0DA 3PVCA 3GRUA 4H0NA 5EVJA 1G6Q1 2G8NA 2OB2A 3DULA 4FSXA 4GEKA 3KPVA 5HIJA 2P8JA 3Q7EA 2YXDA 3FYDA 3PT9A 5CD1A 3FTFA 3PX2A 1XDSA 2BR3A 4U7PB 5HIMA 4AUKA 3B3GA 3TMAA 3FPEA 1X19A 3B3FA 1BOOA 3HNRA 3KR9A 2PWPA 1KPGA 2NXJA 4FT2A 4PYKA 1AV6A 1VP3A 5DSTA 4PYJA 3ER9A 3E23A 4PYNA 4POOA 1XXLA 3KQQA 3BWBA 1KPIA 4FR0A 5EMLA 1HMYA 5BW5A 1RI1A 1RI4A 3HCAA 2HWKA 2PBFA 5DX1A 2BR4A 2UYQA 3DLIA 5K0FA 4KWCA 2P35A 2FRXA 1UFKA 3KPYA 3UJ8A 2Z6AA 2FK8A 3PS9A 1BKYA 4F85A 2C7PA 3DXZA 4Z2YA 1G38A 1O54A 2R6ZA 5GIPE 2PJDA 2G71A 1N7JA 3G88A 1X1DA 3UJBA 3BZBA 3I53A 5K0CA 4PCAA 3CGGA 1NE2A 5D1HA 1M6YA 3OU2A 1JG4A 3FPFA 3MAGA 5DTMA 3IHTA 5FWDA 2UZ4A 2AVDA 3RIEA 1XDUA 4QPNA 3AXTA 3CBGA 3GRVA 5MHTA 2IIPA 4HH4A 4R6XA 4U7TB 1JSXA 3C6KA 1HNNA 2ZWAA 3HCDA 3ELUA 3GO4A 3LL7A 4MTLA 4EKIA 2B2CA 3B7PA 5K0JA 1X1BA 4XUCA 4CKEA 1KYZA 5EQJB 2DPMA 2IFTA 4C05A 3BGDA 4LG1A 5HEKA 4PONA 2XVMA 3EVGA 3M6XA 3NVMB 2XYVA 2HTEA 3HA5A 3UJAA 3FUTA 5C9ZA 2EG5A 4RVHA 2IDKA 5GM2A 2IH2A 2AVNA 5E1OA 3KQSA 3HA7A 4A6DA 5FA5A 2I9KA 2NP7A 4BP3A 1ZGAA 5DM2A 3KR1A 2GS9A 4YV0A 5ICCA 3BUSA 3QOWA 2PKWA 3I58A 5C1IA 2ESRA 1NKVA 2OY0A 3P2KA 1QAOA 2AOXA 3MTEA 1P1CA 1NW5A 1RJGA 1SUSA 5DM0A 3F4KA 3D2LA 3BXOA 1R00A 4GOMD 3NDIA 1UIRA 3KPJA 1WXXA 3OZSA 3BWCA 4IV0A 5GM1A 3NMUF 3THSA 3FUXA 3OZTA 3CC8A 4X41A 1F38A 4AZSA 1SKMA 4LWOA 5K0GA 2AOTA 2AN3A 1VPTA 3LKZA 3R6TA 2WA1A 3ANXA 2NNWB 4RTOA 3DTNA 3OCJA 3SSMA 5T64A 4GOND 3DR5A 4XUEA 2HNKA 2UYCA 3ERCA 1N7IA 3ORHA 3VYWA 4OQDA 1KIAA 3LDGA 3NW9A 5DTRA 4KIGA 5E2BA 3LKDA 4QDKA 1L3IA 2YUIA 3GWZA 5HZMA 5E1MA 4XCXA 5C0OE 1L1EA 2ADMA 1YB2A 1IXKA 5ICEA 3P9KA 3M6UA 1VE3A 2IH4A 3CCFA 4DM3A 4HSGA 4KIFA 5LQNA 2VP3A 1R8XA 3R24A 4PGHA 3PFHA 3BGIA 2OPBA 1FBNA 5FQNA 4C04A 5KQRA 4QQNA 1ZG3A 2VDUE 2PXCA 3G8AA 4YV1A 5EEHA 3LECA 5EMJA 2VS1A 1XVAA 1ZGJA 2I62A 2OB1A 3G2PA 4RVDA 4F86A 2C7RA 1Q0SA 3B5IA 4CXMA 1TPYA 3KQOA 4RX1A 1TW2A 4RTMA 2P41A 5EGSA 2EJUA 2C7OA 4GOLD 3A25A 5EMMA 4P7FA 4MHTA 2B3TA 2YXLA 2AS0A 2P7IA 4HRAA 5E9WA 4RTPA 3C3YA 4X63A 5EC8A 4YUZA 1VBFA 3IV6A 1FP1D 1L9KA 1I4WA 1PJZA 1VL5A 1Y8CA 3UA3A 3C3PA 3V97A 5KS2A 3TM4A 5FCDA 5CVVA 2PXAA 5IKMA 2Z6UA 4HGZA 4M37A 3UJDA 3M4XA 4CKBA 1NW6A 3GRYA 3I5UA 4HTFB 3TPZA 3NJRA 3EMDA 1AQIA 4DA4A 2JHAA 2YXEA 5FTWA 5BW4A 4RWZA 5HIIA 4YUYA 3HCBA 4R8SA 2BZGA 3DXXA 4RTJA 5D1NA 5F2KA 2N47A 3B89A 3KR0A 4DMGA 3AWIA 1QAQA 4P7GA 1QAMA 1YZ3A 3B3JA 2ZBPA 3JWJA 3LCCA 1MHTA 3ER8A 2ZCJA 1O9HA 3KQTA 3KQMA 5M5BA 1JG2A 2ZIFA 2QY6A 3NWBA 3MTIA 3OU6A 4UOEA 2I6GA 1KPHA 1SQFA 5LR6A 3AJDA 1M6EX 4RTNA 1DL5A 3SM3A 1XDZA 2PX5A 4PWYA 3TFWA 1VQ1A 3P2IA 3R3HA 4BLUA 5HIKA 2A14A 5DTQA 1P39A 2QRVA 5FQOA 2IH5A 2HV9A 3DLCA 1R8YA 5DXJA 3DXYA 2GH1A 2IDJA 3RW9A 2E5WA 4BLWA 5ICGA 2JG3A 3OPNA 5LQRA 3M33A 2AZTA 1QYRA 3NTVA 2PX2A 3LSTA 3P9CA 4PYQA 3QV2A 3KHKA 2P1DA 3EEOA 1PRYA 2ZBRA 4P7JA 1QANA 2PVCA 2GA9A 3OE5A 2XYRA 1L3CA 1RJFA 3SMQA 2ZIGA 2FPOA 3A27A 3EVCA 3DOUA 2BH2A 3QOXA 2G72A 3FTDA 3MCTA 3KQWA 5U4XA 1EJ6A 4FSDA 3TRKA 3UZUA 4YUWA 5GIOE 2ZBQA 3KR2A 2IPXA 2PX8A 3OE4A 5EMKA 1WZNA 3TQSA 2C7QA 1RI5A 2WA2A 3LBYA 4GOOD 2OKCA 1YUBA 4C07A 3LHDA 2PLWA 3EVBA 2OO3A 5T6BA 3MGGA 2NXCA 2ZZMA 2V74B 3M70A 4GF5A 1ORIA 2CMHA 3GXOA 5FWAA 5EKXA 1F3LA 2H1RA 3HCCA 4PIMA 4AX8A 2JH8A 1JG3A 4HC4A 2YQZA 3GU3A 1WS6A 3A7EA 4FZVA 5DWQA 3AY0A 1EIZA 2AOUB 1NBHA 3H2BA 3LDFA 4PYLA 2PT9A 3UBTA 2IBSA 5CM2Z 3SX0A 2VZ9A 4Y2HA 1D2CA 3GRZA 3REOA 3ME5A 1P91A 3G5LA 3EGIA 3P8ZA 5BP7A 4GQBA 5P8WA 3FTEA 2Q41A 2FYTA 3GNLA 3UA4A 4EMSA 7MHTA 3FYCA 3P9NA 2OYRA 5LQCA 4PYMA 3ID6C 5GP1A 2NXEA 2PSSA 3BWYA 3LBFA 4IKPA 4KW7A 3TKYA 5DXAA 2Y1WA 3FUWA 4ER7A 2EFJA 5HFJA 4AZVA 5KQSA 4RSRA 5B1SA 1FJXA 3G8BA 1NV8A 4IWNA 4ER5A 4LECA 3HEMA 1JSZA 2BM8A 4EQZA 3R9XB 3PLAE 3THRA 1RJDA 4BLVA 2ZW9A 2OXTA 3RODA 2YR0A 5CIYA 5E9QA 4KDRA 4QPPA 5K0EA 1G60A 3PTAA 3LGAA 1O9GA 3FPGA 5DSXA 2NYUA 2FCAA 3BKXA 1WXWA 4ISCA 3R0QA 5EEGA 1EQAA 3NWEA 3LX6A 1Q0TA 1IM8A 5DM1A 1INLA 1WY7A 4FGZA 4E70A 2G70A 5LQKA 4WXHA 1JG1A 3FPJA 2PWYA 5DLYA 4V0QA 5KVAA 1I9GA 4HGYA 3C6MA 3UFBA 3LDUA 5E8JA 4ER0A 1RI3A 2XVAA 2NXNA 3UJ6A 3P9IA 4MWZA 5K09A 2ZLBA 5ICFA 3T0IA 1JTEA 3PX3A 5LQAA 1BC5A 4OBWA 2AOWA 3L8DA 1JTFA 1JR4A 3HA3A 4BY9E 2F8LA 4RTLA 5CVEA 5KYGA 5K05A 2EX4A 5FADA 3A26A 3NDJA 4BP1A 1VP9A 1DUSA 2LD4A 3FTCA 3KKZA 2GLUA 2AOTB 3EPPA 3SSOA 3O31A 5F2NA 1KR5A 4DCGA 3S68A 1D2GA 4X61A 3TR6A 1ZQ9A 5DT2A 2GB4A 3T7TA 1B42A 2DULA 4YUVA 3GDHA 4KDCA 4O29A 4QTTB 1SVUA 3V8VA 2B9EA 3E05A 4PIPA 2AN5A 4RV9A 5E2AA 3FPHA 4CWAA 3BGVA 2GPYA 1FP2A 2CWWA 4CTJA 1AF7A 2VDWA 3KPUA 5IH3A 4C06A 3LCUA 5DRTA 2ERCA 3OZRA 1RI2A 4FS8A 4OX9Y 3MHTA 1EAMA 3M6WA 1EG2A 4KRGA 4B17A 2JHCA 1R18A 1SG9A 2CKDA 3OFKA 3FRHA 3G7UA 5CCXA 5EIFA 5K0BA 5EIWA 2JHPA 5T67A 4P58A 4YV2A 4E2WA 1QZZA 2ZWVA 3DMFA 4ER3A 4RTKA 2O57A 3G5TA 1MJFA 3TOSA 4F84A 5K03A 2P3QA 2NP6A 2PV0A 5GINE 3EEYA 2P40A 5DPMA 3DUWA 1DCTA 3IYLW 4M38A 1SUIA 4OA5A 1UWVA 1WG8A 3MQ2A 2QM3A 3LCVB 4R8RA 4YUXA 1SQGA 2P3LA 3PB3A 2B25A 3ELYA 3I9FA 1G8AA 2AOVA 3KQVA 5K01A 3CJTA 1FPQA 3P71T 8MHTA 5K8VA 4AZTA 4RTRA 2Y1XA 5EZQA 5DRYA 2CMGA 4HG2A 3HVHA 3SVZA 3TM5A 4A6EA 2FHPA 4ER6A 1YFJA 3VC1A 1R74A 5BXYA 3FUVA 4Y30A 4QVKA 2O07A 2AOUA 3TKAA 3SSNA 3IEIA 4OA8A 5LSAA 2GAFA 2PGXA 5DX0A 3UJ9A 1N2XA 1NV9A 4R6WA 4AZWA 2PT6A 1VIDA 2XBMA 3K0BA 3T7SA 5LQUA 5ERGB 4OQEA 4RTQA 2EJTA 3DP7A 5FA8A 5EKUA 2O06A 4EVIA 4DCMA 3CJRA 5CVDA 3WSTA 2KW5A 4EKGA 2UYHA 2HMYB 3T7RA 3FZGA 4ZTBA 3CKKA 3G89A 4C4AA 2BR5A 4R05A 1AQJA 1G55A 3G2QA 4PNEA 4OBXA 5DX8A 4MQ4A 3SXJA 2G1PA 5EHGA 3ELDA 2ORED 3MB5A 2XYQA 2IGTA 4GUAA 3UJ7A 3O4FA 2K4MA 3PFGA 3U81A 2H00A 3SGLA 2ZZKA 2AR0A 2H11A 2V7EA 5DM4A 4E32A 2IBTA 4IV8A 1X1AA 1RJEA 3A7DA 4DF3A 3FRIA 2WK1A 1ZHFA 2VDVE 1KP9A 3E8SA 5FUBA 4RVGA 3JWIA 5GWXA 1BHJA 2ZTHA 3O7WA 5EZSA 3TLJA 1NBIA 2ZSUA 4DKJA 3KQPA 3MCZA 4PYOA 2YX1A 5FHQA 3HCFA 3VSEA 3K6RA 4GC5A 4MIKA 3OFJA 3OU7A 5E1DA 4E30A 1XJ5A 4HTFA 3GRRA 1L3BA 2QE6A 1G8SA 3EVDA 3HM2A 4PCLA 4E33A 3EVAA 3DMHA 5CUQA 4E2YA 1YF3A 2O05A 4C08A 1I1NA 5CVJA 4CTKA 3E7PA 4FP9A 4M7RA 4PGGA 4K6MA 2ZZNA 2R3SA 3DMGA 4G56A 2IP2A 1X1CA 5HOQA 1T43A 1NT2A 4PYIA 5E9JA 1M0EA 1Z3CA 3HTXA 2I7CA 2UYOA 3EVEA 4JXJA 1YFLA 1XCLA 5K0NA 1ZKDA 5FHRA 1NW3A 2YVLA 1IY9A 3GIWA 5E8RA 5CCBA 4WVLA 5EPEA 9MHTA 3GGDA 3P2EA 4C03A 3I64A 3JWHA 4CKCA 4YMHA 4X1OA 4YMGA 5LQJA 4EK9A 4NECA 3EGEA 4E2XA 3DH0A 5HILA 3EVFA 1V39A 2ZULA 3MERA 5JUWA 1NW8A 3P97A 4XUDA 3UWPA 4E2ZA 3UJCA 4RTSA 4QVGA 5EG5A 1D2HA 3HVKA 4KVZA 4RVFA 4QDJA 5H02A 4ATNA 4RYLA 2QRVB 3VC2A 2QYOA 3C0KA 5E1BA 5FULA 5GOZA 2ONYA 1KHHA 2FK7A 2YTZA 1U2ZA 2PX4A 2ZFUA 4PINA 3FUUA 1YZHA 3BKWA 2JJQA 1KXZA 1OR8A 1VLMA 3AXSA 1NW7A 3CVOA 4FT4A 1ORHA 1R6AA 3Q87B 4GC9A 4QQKA 4V0RA 3KU1A 2ONZA 3HCEA 2ZIEA 1XTPA 3LPMA 2OZVA 2PXXA 3EVZA 5G02A 2B78A 5JR3A 5F2OA 3NVKI 2BM9A 4LWPA 3BT7A 3G2OA 4GBED 4L7VA 2Z6QA 1P1BA 3KQYA 2HR1A 2OBFA 5EHIA 3JWGA 4M36A 5EOVA 2P3OA 4DZRA 2AN4A 3HVIA 5CVUA 1JQDA 2CL5A 4P7KA 1JQ3A 3HVJA 3M6VA 2O0LA 4X60A 3SR4A 4DQ0A 1JQEA 3A4TA 3KPWA 3G2MA 4QTUB 3BWMA 1H1DA 3GCZA 3CJQA 2JH9A 3HP7A 1EJ0A 1XCJA
chains in the Genus database with same CATH superfamily
2Q3BA 2QTMA 1T1IA 4D3XA 1UAGA 1XTKA 3MGKA 4FFRA 5I9TA 1BGWA 1SVSA 2VXOA 2EQAA 3GPDG 3KPVA 2ZB8A 2YXDA 3G68A 3PT9A 4U2BA 4C1BA 4FFLA 3KLOA 5HM8A 2HFJA 5CD1A 2X1HA 2GXAA 1KI9A 3ZXSA 1FP4A 2NXJA 4JZYA 2V3CC 1HE5A 3IRUA 2VQ6A 1SFRA 1R6BX 4KQKA 5BVGB 1JEQA 2FPIA 3L0IB 1ZSYA 5GV7A 3QBJA 4JMLA 3CNHA 4X3OA 1IBLB 3GI1A 2R7NA 2FEKA 4L6IA 1X74A 3C2QA 1G66A 1TJNA 3BMOA 4MB6A 2G25A 3OIUA 3UJ8A 1TAHA 3PS9A 4F85A 3GGSA 2IQIA 3GDGA 3O21A 4YVFA 5K3SA 4DM7A 3QEJA 1QFSA 5KCZA 3BFVA 2JIBA 5B7QA 3M1YA 3C3AA 5A05A 1UDWA 3ZD9A 1SXJB 4X97A 4D4HA 1JJBA 4DG8A 3HJNA 4ZV9A 5IZCC 1FNBA 1ODSA 4BNFA 3RIHA 5EYPB 5HPYB 3LP6A 4TYPA 3EN0A 4FR2A 2AUNA 4URWR 4ARZB 4BTLA 4DC1A 1J2YA 2O1EA 3NM6B 4WN9A 1KI6A 3ZG6A 4MCIA 1XU9A 3H87A 4A26A 3FCYA 2XJ4A 4J2TA 4RANA 2XVMA 3M6XA 3DOFA 3P27A 4MVJG 4PZYA 2O8FA 3QXXA 4IZ6A 2Y93A 4XE5A 1XP8A 5K3EA 3TIIA 3VZPA 4BXOA 2JGIA 3HA7A 5JAOA 4B7UA 3EJ6A 3MGAA 3RAPR 1BMFD 4BVHA 1DFGA 1PZGA 5C7YA 2VC2B 3NBMA 3QBVA 3QA3E 3UMGA 4NYIQ 1BCRA 5BSHA 1RXWA 2BFWA 1IATA 2PKWA 4JR1A 3B20A 3PJDA 4OL0A 3QNMA 1GRVA 2DX7A 2WZBA 1J07A 1NSFA 2HK6A 2QW0X 4Q7MB 4R2HA 4TXHA 2IHKA 4YJHB 5G4KB 2IV2X 2X2PA 3ZXIA 2YW2A 1CRWG 4F9EA 3B52X 4F60A 1M0TA 2BZSA 4JOBA 1WQ4A 1ZVMA 4YFVA 4CRWB 1V3VA 4ISBA 4QATA 5F33A 2RHJA 2Z43A 1RWXA 3U1TA 3HXLA 2RHLA 2PUJA 1Z6YA 4EELA 3EZNA 4G0UA 2MMGA 3AVYA 1WF3A 5JROA 4JYMA 3R09A 3RJZA 3CF2A 3O93A 1R4NB 3QFRA 2XD4A 4KE9A 1R10A 1RVDA 2FG7C 3VYWA 2GJ9A 4BB0A 4PRKA 5E2BA 3JPYA 1BN6A 3TFQA 5TB5A 2YUIA 3IJ5A 4K87A 4YAIA 1KJ8A 3QI7A 2PSEA 1E6WA 1SU4A 1L1EA 2QLNA 1JDBB 1R50A 4WKOA 4ZVOA 3BX1A 3M6UA 4OB7A 3S1LA 3SC2B 4IUBS 3W2FA 5KYWA 4DM3A 2VF5X 4FKMA 3K0CC 1AURA 1PQ4A 2E82A 3R7WB 4AO6A 1N32B 2VNKA 4R2MA 4DHWA 3PFHA 1N33B 4G89A 2VPQA 1GGEA 1T35A 1XRLA 2R2GA 3HDJA 3LUDA 3OUTA 3P4YA 3FJYA 4MV0A 1G21A 1MOPA 1RC0A 4DVJA 3MMZA 3TEJA 1W4RA 4HPJB 4ZO7A 1HMPA 1C30B 1L7XA 4KGVA 3G85A 2X3YA 2XIQA 1TW2A 3QFCA 4KH1A 2EJUA 3B60A 4ND6A 4RPCA 3PDJA 5JZOA 3BE5A 1VBKA 1EK2A 2ZYSA 1QGUA 3IT2A 4EG6A 4BVEA 4X1KB 1BE8A 5G1OA 4Y9UA 1WUIS 1MPTA 1WZCA 2P7IA 4RTPA 5ALJA 1GAXA 4LJKA 4JUIA 4MUBA 3IV6A 5CCBA 5KS2A 3BIWA 4H15A 1AXGA 2AJDA 5IYZF 5CDHA 1BEEA 3OJLA 2B5VA 4K1LA 2GD6A 5IAAA 3SE7A 3LI2A 1RCTE 9GPBA 5AVOA 1JKXA 4ZODA 5JOQA 1LLCA 1YC5A 5A3RA 1K8QA 4GI7A 2AQKA 4K2AA 3ZIAD 1PJSA 3NZEA 1PJTA 4MLZA 5FNVB 4HWSA 4JDUA 1GCOA 4XFKA 4YBRA 1RP1A 3R5FA 2OHGA 4HQOA 4C87A 3AWIA 5D7BA 4IX1A 2H2IA 3KVRA 1UINA 3F2IA 3PTZA 5CR9A 5H59A 2CJFA 4CIAA 4V2IA 3GHYA 1QGUB 4MHOA 3PC7A 1QJCA 3HBLA 3MRSA 1P2BA 4X0EA 4XR9A 3NBKA 4DXHA 1IHOA 3AJDA 5C51B 2BUCA 2Q6OA 1PBNA 3TGWA 1DHRA 1K4KA 4DUPA 2HNBA 4FIZA 4LF6B 3CWZA 1ZGBA 3GN2A 4IOMA 4O2AF 4QYWA 5LUBA 3V4ZA 3WB9A 1TA9A 1CUAA 1M8FA 3ILYA 3L0PA 3ZLBA 1MIOB 3KEOA 3PDIA 3DKVA 1ESZA 5LQRA 4H16A 1GPBA 1TVEA 4JU9A 2H1CA 4WFJA 2CFIA 3OZFA 2H4YA 3RF7A 1R0LA 2XOKA 3OCVA 1Z4NA 2VJYA 4WK0B 2V58A 2WIJA 3IXLA 3OLYA 4P7JA 3OT1A 3VPFA 5HE9A 9LDBA 4JIGA 3CH4B 2ASEA 1V25A 1KH2A 4E0BA 1KMCA 2NTNA 2Y66A 1Z4QA 2NOAA 4HEQA 2PTGA 4HLDA 2OILA 3IAFA 4HK4A 2Q5JA 4TKUA 3D1JA 3OE4A 1V3QE 3H18A 5JWHA 2HBQA 2GNPA 2WJ4A 2WA2A 3LBYA 3EC7A 4GOOD 3HU2A 2C88A 4H08A 3EB9A 2EYUA 4QGSA 3INGA 2BWJA 1FDTA 3BSSA 1GG9A 4H7DA 2O7QA 4BB9A 3PNPA 3BWVA 4RLHA 1PWHA 3G5UA 4CU5A 1HH4A 4EYOA 1I7PA 5L3SB 4PIMA 3SXUA 2XAUA 4Y1FA 1MCZA 5EP1A 4IDQA 5G40A 1LBEA 3ESZA 1FYDA 2C1XA 4XIYA 1ZR4A 4YRDA 3H2BA 1E2MA 1NBHA 1W4CA 3MINA 1LXCA 2PT9A 3RNLA 3UAZA 3DLPX 3E3AA 3HP1A 1TK2A 2QIOA 4DYHA 1RZVA 3G5LA 4G1UC 1CRLA 3SICE 1MABB 3NOOA 4GQBA 5BUQA 2YJ5A 3GNLA 1WMEA 1S8FA 1RYFA 3BGWA 1E3MA 2WM3A 3L8FA 2QGZA 1A98A 1EQUA 2PRJA 1AB6A 3NHFA 4Q4DA 4S05A 5EIAA 5C8ZA 1FW8A 4RETA 3FFXA 3LBFA 3IPXA 2YJ6A 3K0FA 5IN5A 3VR5A 3VU8A 5E9AA 5HFJA 4DANA 4JI2B 1UMKA 1V1JA 2EV9A 2P9EA 1AKNA 3G8BA 4ZEWA 3U3OA 3KKPA 2WJ6A 3HEMA 3A1DA 1AH2A 2JKZA 1XMPA 3DDNA 1KSGA 2FF7A 1LC0A 2O2GA 2QJRA 1E0SA 2G9RA 4MV5A 1VSUA 5DP1A 3O8QA 1UPBA 2VTEA 2EFDB 3FYUC 4GGMX 1WMFA 4MIYA 4OH1A 1QYWA 5JFTA 4JYAB 3T1HB 3F49S 4Z8XA 5FORA 1EVIA 3U7QB 1OB5A 3D8BA 4ISCA 1KJZA 5B6IA 5IEJA 3ZI7A 2WD7B 2F64A 2F9FA 2X23A 1ZMXA 5G0VA 4TWAA 1OZHA 1Z88A 3TLAA 5CBPB 4OI0A 4QNNA 1J42A 2XNSA 3U31A 1T5LA 4DPKA 3C6MA 4IHJF 4WOCA 4I50F 1TX4B 1SZJG 3ZJUA 3JCZA 1IN8A 1S2MA 2DCMA 2R8YA 3GT0A 1IWPB 3BXXA 3HG7A 2TS1A 1JTEA 1MFZA 5EKDA 3G1UA 3I04M 2LR0A 4QOIA 5E7MA 3IOYA 4PQRA 5ERXA 4GR9A 3B9RA 1DAFA 1M1NB 1N9GB 5FOWA 4O4IA 2IPOA 4BP1A 5LD2B 1IPFA 1GT91 3NC1C 4XX0B 1YB7A 4YPOA 1EB9A 2ZJFA 4F3RA 2FUEA 4FE3A 3WNVA 5CFLA 3OEED 2IV3A 4DWWA 1GRCA 2H65A 3CH6A 1XZLA 3EGDA 4KPUB 2VT6A 2NUPB 5J63A 3ZYCA 2ZPTX 4YCJA 2AZDA 4WTOA 1KQFA 1XR3A 2FPSA 2J45A 3I3OA 1QHFA 1R9NA 4DCCA 2MSEB 3UTCA 2Z9DA 4FFPA 2BFBB 1EZ1A 4I1OA 5DI3A 2WD8A 3G7SA 1JMYA 4HGPA 4MINA 1DAEA 2GAIA 1JAHA 1MD9A 1BE0A 1NT4A 1T5TA 1TZJA 1J8DA 1KI3A 3OX1A 4KK3A 1Z5PA 5H80A 4K9LA 2LUOA 5KAPA 4U3JA 1BYIA 3EASA 5AHWA 4DV4B 2Q9UA 4OFBA 3OPYI 2VRCD 4U8GA 4DV5B 1DDIA 4NMWA 2NT3A 2RAVA 2RIRA 3FMFA 2FPGB 1G2PA 3FRHA 5EIFA 2XUKA 5ENDA 1E2KA 5JSHA 4URFA 3U7GA 2EHJA 2I8AA 3OZWA 1HLGA 1K4YA 1U0SY 4GPIB 5E0OA 1AQ6A 5ICSA 3AEYA 3AVOA 4LY0A 3WQSB 2A9JA 4G4SP 4F84A 2OO5C 2WAXA 1EAYA 2VOEA 2HRBA 2A84A 3LZDA 2PV0A 1MN6A 1I1OA 3NLLA 3PEWA 1EEHA 1OGJA 1CS0B 3QFSA 1SUIA 2ZJBA 1RRKA 3UWSA 1RHJA 1P0FA 1W35A 2GLXA 2WMYA 4LZJA 3T1VA 4BECA 1QB7A 4IP0A 1KYQA 3RJ9A 1D7AA 1A7JA 3RUEA 1OFIA 3WP0A 5AM3A 4X71A 1YA4A 3UANA 2R1ZA 1PJ2A 2Y0PA 1OBFO 1RW4A 2X6TA 4NJMB 4MVJI 3R7FA 2YIMA 3TZLA 5I7OA 3LVQE 3NHKA 3IEIA 3M3DA 1UEIA 5J4HA 1FDWA 4JYCA 1AKUA 4YROA 3RKRA 2WVGA 4EVRA 1S2GA 4BFYA 4G5HA 4V0NA 4CFYA 4Z4IA 1VBNA 1EXMA 2VLIA 1U9JA 1OXMA 2HU7A 4NBSA 4EY7A 2HMYB 1BEUB 2J0UB 3PQ6A 2R66A 3RRMA 3G89A 4NG5A 1M5RA 3GLIA 4KQ9A 1PFGA 4MRRA 2RC5A 5TVKA 3K0AA 4JODA 3CX3A 3CZ5A 5IKEA 1D1QA 2JD2A 3N7AA 5HK9A 3PXGA 4OJTA 3SIXA 3WWEA 4DA0A 2IVZA 3DFMA 3DTYA 3HJCA 1OYVA 3PJEA 4IJQA 4IHKA 4J2HA 4J03A 5SZIA 1RHUA 4AIRA 2G1UA 3ETCA 1XI2A 3HBJA 1Z4KA 4MDFA 1IIRA 1V5WA 1X1AA 2AN1A 3ZY6A 2NU7B 5F9MA 3IELA 3ZQ4A 3H5WA 3TW4A 4LYJA 3EDCA 2Q1TA 1BA2A 1F4LA 1GV0A 1ZIOA 4FMBB 1PQWA 5JHGB 2W42A 3MCZA 4FCTA 4HDKA 4H4CA 2H0RA 2WOOA 1U0FA 1ONOA 3GJ7A 5KTPA 3H5AA 5KSYA 3MWKA 4B1FA 3WAJA 3HCFA 4NE2A 3K6RA 4HLQB 4ZT4A 4UVDA 4PCLA 1R9MA 5HWSA 2AL7A 1X7XA 4KRYA 3M4ZA 4WKCA 1I1NA 2H1WA 4M7RA 1KRWA 2JFUA 4Q6BA 4PLGA 3FJOA 1NT2A 1W30A 1N5IA 5BSUA 3SZUA 2UUOA 1IEQA 2AYZA 3B1FA 1P2SA 4WI1A 3T12A 5A5EA 1Z5NA 4WBNF 4CKCA 1U80A 5B64A 4QG3A 2WJVA 5FBLB 1Q19A 3STWA 3EGEA 1J0CA 4MHSA 1UF9A 2IY9A 4MR8B 5TRTA 1D0VA 1E79A 1V39A 2WKPA 1ESEA 3NI2A 4Y9DA 4AJ4A 2HCTA 5LIPA 5AJHA 3L8ZA 4WBXC 2R1VB 1Z0DA 1N5LA 3T5DA 3WKEA 5BSEA 5I7UA 2Z2ZA 3GNTA 1E5TA 4ZU1X 1JIKA 1HXHA 4BLSA 4DG9A 3OKAA 4JP8A 3MTJA 2PJUA 1H0HA 2MU1A 4YXWD 1HX7A 3ONFA 4BNNA 4CLXA 1DKUA 3WOHA 3PFIA 4IFEA 1B73A 1C1XB 1PEDA 3B5EA 4YLGA 4MKFA 3BMCB 1VLZA 2ZIEA 2WSIA 1XAJA 4FHEA 4I1RA 3T61A 5JR3A 5F2OA 3KZOA 2QAGB 4JGGA 4OLFA 5I8ZA 4X45A 2VRCA 2A9QA 1MFPA 3ETHA 3K70B 3M6LA 1LKZA 2Z6QA 5JJCA 2HR1A 4PHTA 4DZRA 5A5GA 1EIWA 2JZOA 2I2DA 2VWHA 3X1KA 3RVPA 4B3XA 2YHIA 1U28C 2RH5A 1JQ3A 3HDHA 1DAPA 2O0LA 1BDJA 2GCOA 3QYPA 2PMEA 3FYUB 4Q1AA 2J85A 2JIPA 2W11A 3P0FA 5JZ9A 3ESRA 2O7SA 4JJKA 1NSTA 4M76B 3CJQA 1X1QA 4BFCA 2I34A 1WKCA 7ADHA 4P34A 2WP0A 2PUEA 4ZYXA 4E31A 4D4MA 1MDBA 1ND6A 3WGIA 5EVJA 1JWLA 3NG1A 1ISMA 4HBZA 4IR7A 2IJGX 4OHFA 3NIFB 2X4IA 2BFFA 2M6SA 2QZ9A 2YQ5A 4QGBA 4ZQBA 4JL8A 2QAGA 3OPQA 2EKBA 4WGGA 1Y1LA 2HBYA 5AVSA 4L3VA 2F1HA 3JZMA 3C70A 3C3XA 2DUUA 1E3EA 4LHWA 2Q1WA 2P9JA 1CUXA 3GZNB 5KHOC 1E3SA 2HPZA 3IEPA 1SGWA 4MR7B 3Q4GA 3V2GA 3TSYA 3CO5A 2XUPA 5LJLA 1E9EA 5FFFA 4KX3A 3VHRA 2IXAA 3VVCA 4CM9A 3QKUA 2FRXA 1UFKA 3KJHA 4HP8A 1BXGA 4EGJA 3N05A 3C98A 3EZGA 4Y18A 3NS7A 4M0PA 4QGHA 4UM9D 2XUFA 3V6MA 2CL6X 1YE8A 3G88A 2NUAB 4XASA 4LJRA 1EGQA 1GU7A 1NULA 3W8FA 1T9GS 4OHOA 4Z9XA 4BZZA 3OZAA 1HDGO 4Y2PA 3I53A 1TYCA 3M6MD 5JECA 1JE0A 5JDIA 1SCAA 4CQMA 1G4UR 4OH7A 1J2UA 4W5HA 2MYNA 3IAUA 1NBOA 2P9HA 3E3MA 4JP1A 1YRAA 1EUDA 2H17A 4MGZR 4KV9A 1NUPA 5EJ7A 4Q18A 1DXHA 2EATA 3SEAA 1Z5WA 2R7LA 2YMPA 5HW0A 3SLKA 2DPMA 5KYWB 1HYBA 3WGQA 5F3WB 4FEAA 3TQTA 2E21A 2CXXA 3QVSA 1NU8A 3A6DA 1GAWA 3C1TA 5JSFA 4CL0A 4ZJYA 1N0VC 3JW8A 1R15A 5AVZA 1ODCA 5KX5B 4XYMA 1EVYA 4DNQA 2F3QA 1BMFA 3WBBA 3TL6A 4IDFA 5JXGA 1NC1A 2JFVA 2VNIA 4GG1A 4C4XA 2J1LA 5DM2A 1ZNYA 3KR1A 2BUAA 4RHEA 5C8VA 3HPRA 1QHNA 2OHVA 3S2UA 3TO5A 1VA5A 1I7QB 3JQFC 3OF2A 1R64A 1WB5A 5SY4A 4EYKA 4IZIA 2FVXA 2GZSA 2CLLB 4G9GA 3O75A 2GZDA 1Z08A 1QKIA 2Y67A 3N6RA 1UIRA 4Q05A 4TZTA 3SZGA 3ZC3A 2IS1A 3R5JA 1TCCA 4Q93A 3MYRA 4J1SA 1EE1A 4ARSA 4Q24A 5AVYA 3LVFO 1EA7A 2OESA 3IRVA 1P0PA 4QYSA 3A1EA 5BQ5A 2ZTMA 4LWOA 3Q8MA 5LPNA 3TRDA 3BSFA 4L73A 2XNHA 3FIJA 3QHAA 4L76A 5G1NA 4F12A 4GOND 3DR5A 3HR4A 2XQGA 2ECOA 3H84A 4JCOA 4L6CA 1KEVA 4L8WB 4ND5A 4RQBA 5F5LA 5HDBB 1VDZA 4EI2A 4O4LF 1ENZA 1YOVB 4KIGA 3DB1A 2AFIB 1RXVA 1D8AA 4M88A 3PP8A 2RHTA 2QY9A 5HZMA 2IWHA 2X5NA 4L74A 2W2LA 5A3VA 4XDHA 4D42A 2V03A 1QPBA 1EFPA 4J8PA 3P9ZA 1HWYA 1RMQA 4XEUA 1HKUA 3OCZA 4YAKA 3W2EA 3B1YA 2VHCA 3M49A 1CJTC 1JGTA 2C9ZA 1H8ED 1QBKC 4CV3A 1NQOA 5KMGB 2P75A 1B8NA 4PW0A 2A5YB 2O2EA 1JDVA 1UKEA 2R7MA 2P1ZA 3LECA 5EUQB 3RIYA 2NAPA 1HF3A 1UKAA 3D3WA 3H0KA 4W1RA 5B58T 4OHZA 3GLIE 3O8QB 3AM1A 2FR8C 1O5TA 1R6TA 2XQIA 3VR4H 3WZLA 4C2AA 3OMLA 1E1RA 2QTBA 4BKQA 4KXVA 2CZQA 1P3Y1 3SVTA 1T29A 4A27A 5LP6C 1G8YA 2R1VA 4UCFA 5CFMA 1G0OA 2E9SA 1YOVA 4E5KA 3V7YA 2CLEB 2B3TA 2NV2B 1R1DA 2OGSA 3HUDA 4F92B 4M7PA 3HZZA 1EBBA 3F4LA 4LZNA 3H4MA 1QM5A 3H6GA 1QQTA 3VJMA 1A82A 1ZD3A 2R8XA 1GGVA 1LPAB 1P0QA 1IK6A 1Z74A 3B9QA 4DG5A 2VHTA 3C3PA 1JLKA 4IHJA 5AVTA 2PXAA 3DZKA 5DGTA 3UJDA 4S1VA 1TMKA 4D82A 5JVDA 3UPDA 4M8KA 3GELA 2HU5A 1PJ4A 4URHA 2OHXA 4D99A 3C1UA 3JVDA 1MB4A 1J90A 1JHAA 4P33A 3TFOA 3U1BA 2FGJA 3COPA 3RR2A 2G77B 2GTPA 3T5MA 3VPXA 3GFSA 3HCBA 4R8SA 4UPEA 3J7AC 1XVIA 3DXXA 2CVQA 2KPOA 2OV3A 1FTWA 1L5SA 1L5VA 4UU8A 2WFLB 4DMGA 2OMEA 1KS2A 5AVWA 4NCJA 1LH0A 1YRHA 2D62A 1MHTA 1ZK4A 2WWHA 3H42B 2MSDB 3CX7A 4J0FA 4Q3DA 4IDGA 3N6VA 3OU6A 4UOEA 1II8A 4MV6A 4WFIA 3S28A 2H06A 5KBYA 3R5KA 4YGXB 2H85A 3FVRA 1Q2UA 5KTKA 1PLKA 1P75A 1QIJA 1E1CB 1JF8A 2VATA 4P83A 3I5MA 4B32A 4FGKA 4YH1A 3ICWA 3W8EA 3DLCA 3TCXB 3L7JA 5C7OO 3LX8A 5BNIA 2GTHA 2LVBA 4WZAE 4DABA 3F4BA 5HKAA 3GLIB 5A0TA 2Q3LA 5B7PA 2GM9A 2D1SA 2CGEA 1QOPB 3GP5A 3NBAA 1W88B 3ZZNA 5JNTA 4F4JA 1E2HA 2G0NA 4NV1A 1MOQA 1SKYE 3GZTB 4IMPA 3RABA 2UXDB 3EVCA 4MWOA 4HEHA 2PL3A 2I3BA 3ANSA 4CMKA 4ZI7B 2ERYA 1MR3F 2LE0A 2OEPA 4BCCA 4ZOEA 5DNEA 3RYHA 2VRNA 3JZFA 4LYFA 2ZYUX 5B12A 4HAXA 3QEAZ 4YC7A 3OQBA 1C9JA 2BMWA 4O08A 2OSBA 3H9UA 1FQKA 2OP1A 3J7TA 2PGNA 2F1OA 3CKMA 1HFJA 4AUMA 4BO7A 4M1TA 5H4HA 1ADCA 1BDMA 3K2EA 4PAQA 2HBRA 3NANA 2ZYAA 1WS6A 3GA7A 4OXXA 4ONEA 4LQLA 3WGNA 2Z3VA 4BFZA 3WJ7A 4M98A 4O2BB 3CLUC 3ZHRA 2Y1LA 3TLKA 3DC7A 4HAWA 4BWFB 3DEIA 3NJ8A 2DFPA 1M1YB 4I9HA 2X2FA 2VQFB 4CGYA 3H13A 5ALYA 1V9CA 1ORVA 2AG1A 4XKJA 1P9WA 2X0KA 3I1JA 5DNDA 3CF4G 3MSXA 4IIEA 3DWFA 4LBYA 3MWEA 1K27A 3LPDA 4PANA 3AR3A 1T0IA 3L4BA 1GV1A 1NMYA 1AS0A 2B6NA 2V4ZA 2JAPA 2VPWA 2QRMA 4KODA 3UHAA 2Y9MB 3RJ5A 2FPWA 2BHNA 4LXQA 3EUWA 4ASUA 1H85A 2RCNA 2FZLA 3IPCA 2D3WA 4ZOAA 1M6WA 3HA2A 1PG0A 3FMOB 5DCYA 3GUUA 3F5DA 2L42A 3MRVA 1A9OA 4H17A 1GFIA 1N4DA 2GI4A 2NYUA 5HFAA 1KC3A 4KLNA 1OI7A 9LDTA 4RK5A 1KAHA 1NBME 5IM4A 4KI7A 1SA0A 2XAAA 3GCDA 4NE7A 2OFWA 4RFSA 5I45A 3QF4A 3PYMA 2G70A 4W63A 1JG1A 2P6OA 4V0QA 4B35A 3JD0A 3ZR4B 1J0XO 3GT7A 3I9KA 2GPAA 4LZZA 2REXB 3UKOA 2O9JA 5BPFA 4PLVA 3FFBA 3AZPA 5EIHA 3A6HA 2ZT8A 4DWOA 2D1RA 2K2WA 4HS4A 4X54A 1JG7A 3A70A 3L3BA 3UKDA 5LA6B 3TIXB 2P69A 1NKSA 2QT1A 3HA3A 4D98A 5I9MA 1G8MA 1MQSA 1JHMA 2QPTA 3V32A 2C07A 2H1LA 5A03A 1H5QA 1W73A 5J5AA 3FTCA 5F2NA 2HIHA 3BDAA 3KWJA 1KR5A 4HFRA 5BVHA 4H35A 1ARZA 4OLJA 1GLGA 4NESA 3NB0A 4XM0A 1Q12A 1XA3A 2CXPA 3EIHA 4TTRA 3T7TA 4G9EA 3RKSA 1GRRA 2C7GA 4J6EA 1XZAA 3TLCA 4JBLA 2C5HA 5ALMA 4O29A 2VXBA 4D0LB 3U9TA 3VYVA 3BTOA 5CH8A 1OFVA 2E89A 2HHLA 3CT4A 1NX6A 1Y3AA 2R84A 2VWGA 3BGVA 5J4VA 5MN6A 2CWWA 1OZ0A 2AYYA 1OPXA 3HZRA 3AX6A 4PZPA 4DV2B 3O1LA 3IR6A 2DBYA 4G8BA 2ERCA 4QPCA 5HCUA 3TTXA 3VSBA 5KNCD 4U2EA 4QYTA 1D6SA 5JCJA 1ZNXA 2NYRA 3AVPA 1EAMA 3DOCA 3UK0A 4B6GA 4IGAA 1E0DA 1QX4A 3I05A 4FI3F 4LXXA 5DI9A 2F00A 3DAYA 3CNLA 1QNLA 2LBPA 2MYPA 1BFKA 2PRSA 3KZNA 2XSZA 1YQTA 4O25A 5DIFA 1Y5IA 4P58A 3U4DA 3VAYA 2ZYGA 1D1PA 4KAFA 3TMYA 4DC9A 4QA9A 1TNDA 3GH1A 2OGUA 5DDIP 2WEKA 1WXDA 1VXRA 2Y2VA 3PV0A 1XU4A 2GO7A 1HFKA 3DSRA 4NOLA 4ZAZA 1DCTA 2IYEA 1OX5A 1RP7A 3SZMA 1BH2A 3ELYA 2QF7A 3B1ZA 3KQVA 3PC4A 2Z58A 5AXAA 5IUJC 3TRIA 3N0WA 3FW1A 5ADHA 4P36A 3W8RA 4A6EA 4OBBA 4ER6A 1VSTA 4JQZA 1W88A 3OOWA 4LYGA 4PWZA 4JUDX 1CQWA 1EYZA 1QCZA 3ND9A 1N5RA 4LYYA 5D2CA 3G02A 4N9QA 2O07A 3Q0TA 5CYGA 5C52B 4J6FA 1U8CB 1BS2A 4Z6KA 3KUUA 4RL6A 1K63A 4R6WA 3DFZA 1B6GA 4GIBA 2VK2A 4KQXA 4MX8A 2OZEA 2WU0A 4OKSA 5J59A 2JKYA 1J1UA 3AF5A 3ZN2A 3I37X 2EJTA 4EBBA 3DP7A 3UV3A 5J1SB 3RS5A 4CMHA 4RSGA 2BOVA 2ZVDA 1W47A 4Q1VA 3QUQA 1J0BA 3KB8A 4Y2UA 4DQDA 4US2R 2FZKA 2CXTA 1RNLA 1JBQA 3AG5A 4QBFA 1IAQA 5DM60 2CFSA 4MARA 1KE2A 1DNPA 4IIHA 3ED1A 5AJXA 2JFZA 2A86A 3AJ9A 4AKEA 1YZNA 3COJA 3N2YA 4KSCA 3UUFA 1EP1B 2Q2WA 5EXDA 4XYEA 1EK5A 1CD5A 1CIPA 4ZPJA 4XRGA 5I8WA 1CZUA 3MMNA 4GM1A 3GLGA 3D6UA 4RDHA 2ACKA 5EJ2A 5HF9A 2Y1DA 1E4VA 2EEPA 4I1IA 4BDTA 3O73A 3NKFA 2AR0A 4CL3A 3AERB 2XWPA 4K6CA 5ALXA 3GFFA 6ABPA 4BWYA 5P21A 1YDGA 4RKWA 4AJOA 4YDSA 1RJEA 2YV3A 2BGNA 3AQIA 1ZR2A 3K9HA 2G9ZA 1T5OA 2FPLA 4IH4A 2BGKA 3ETNA 1O6ZA 3O7WA 4EG8A 1T6BY 4MUHA 2QTRA 2QTGA 1ZVQA 2HPVA 1ADBA 1HDRA 4M9RA 3SVLA 4PYOA 5K45A 3U4GA 3PQFA 4IMIB 1JE1A 3KKKA 1I4EB 2QX4A 3M8KA 4GC5A 2IYUA 3JRXA 3FUCA 3NVAA 5C8XA 3S1AA 1C2YA 1GIAA 1NYRA 3ZDDA 1CULC 2FSUA 5K9ZA 3M3PA 2ZZNA 5FIUA 3F5SA 2IL1A 3GJRA 1W87A 2GARA 4FP9A 5G3YA 2YINC 2YMMA 3R5HA 6AT1A 5KNDA 1TD1A 3QIAA 3ZHCA 4H4DA 4LSZA 3HTXA 2PMBA 3EW9A 1RYEA 4MAMA 5FAXA 3VOBA 1KC1A 4D9CA 4K6HA 2GZ2A 1Y6ZA 2WE8A 2AWOA 3A4YA 3R2JA 3R3SA 1R9JA 1GXSA 3ND6A 3QU5A 4IOJA 1XRNA 4AI6A 3KHUA 2X8BA 3NNNA 1E0JA 5AW9A 4YMHA 3LA8A 4BMCA 3VJKA 4OKNA 2OHFA 2P5UA 4GX1A 3WMXA 5FFMA 2X7HA 1RPNA 4RDXA 2WG1A 2WZDA 4BS9A 1GSHA 4JNCA 1IQUA 3AKEA 2IYNA 2DBZA 5E1BA 3DBHA 1KHHA 5TJ9A 2HA7A 1HDOA 2GEFA 5B1HA 4CLHA 4IH1A 4DQXA 3FKJA 1SEPA 1JHUA 4KHZA 1IVNA 3V1YA 3M5DA 3AXSA 2B94A 4B2IA 1ORHA 2F6RA 1P18A 1AGXA 4BZQA 1ZFNA 2A0FA 4AM8A 3LPMA 1QOZA 4D3SA 5G0TA 1OFUX 4M86A 2C3YA 3EXIB 4M1ZA 1J6UA 1K7YA 1E1YA 2VN8A 1SOAA 3NEAA 2OQRA 2Q9CA 3Q98A 2PSFA 4Q9DA 2VFAA 3KC2A 4ZOCA 5DEOA 4FLFA 5CXUA 1AGPA 5INTA 2G5PA 4MI3A 4CM4B 3MJRA 5BR4A 4O5OA 3TJRA 5C35A 1P1BA 2H5IA 1N0IA 1T9HA 2Q1XA 1SY7A 3OIDA 2F1IA 4DMCA 3M6VA 1II8B 4Q48A 2QOEA 1E9BA 2ACVA 2Y8EA 1Y4AE 1G20A 1M54A 2Z09A 4Q01A 3P4XA 3EH1A 4G0XA 2WHPB 3AUTA 4RE6A 1P9LA 3DHVA 3QWAA 2DFNA 1XCJA 1KYWA 1BRMA 1QR6A 2W7TA 3ZE1B 4LXGA 4EEKA 1MQ8B 1PFWA 2FKNA 5A5VA 5LIRA 3OECA 4HZGA 4H0NA 2C7BA 2OB2A 4AJ9A 2C0QA 3H86A 1X87A 2YJGA 3FX2A 4QHYA 3Q8XB 2HLPA 4QUAA 4YP6A 2VJDA 2ZRGA 1V1RB 4NENB 4AUNA 4GDMA 3O47A 2ZUTA 2VF7A 5I4CA 1X19A 1D9XA 4Q12A 1GQFA 2VAPA 3GRFA 2WNSA 1YTUA 1PR4A 2A92A 2O0KA 1CB7A 1KO4A 2QMYA 3B9BA 1Y1RA 3HSSA 2EBUA 3KQQA 4PYNA 4V0OA 3WRWA 1FSFA 3LQRA 3VR5D 5IVIA 2A9PA 1KYVA 5BW5A 3PXXA 2GWHA 4HRVA 1Y3DE 4P35A 5KWJA 2VDMB 3IIJA 1TM2A 1SQ5A 2DT8A 4DOMA 1KZGB 4BMOB 2Z6AA 3ZDEA 3W5BA 3X1ZA 4YLEA 2X1VA 3HSKA 1NVWQ 3L4JA 5FBHA 4A7PA 3HNPA 4Q7QA 1XL1A 3UPTA 2CJPA 2GM4A 2Y1FA 4ALMA 1QYIA 4Q47A 3HL4A 4H0FA 2QAIA 4WBSA 4UNIA 3L4EA 4MS1B 1JG4A 2KB0A 2NZVG 3GAFA 3HACA 4CG3A 5IF3A 2AVDA 3L0ZA 4EABA 4LXIA 1T13A 1LDEA 3K70D 1L5KA 1EXNA 4P4GA 4U7TB 3CUKA 4DCPA 4YP7A 1C3VA 3GO4A 2B2CA 3LPNA 4I4TA 2BN4A 4XD7D 1HK7A 4BPBA 4OYLA 2ECKA 1CW2B 2WINI 4Y2GA 3EPRA 5KSOA 4LG1A 3VUFA 2ZS8A 3FFWA 2ZCVA 3EQ8A 3MS2A 1TM1E 4BBAA 2NU8B 3E48A 3TSZA 2V0NA 2GPBA 3PJFA 5EN4A 1FDUA 3D8NA 4K9SA 1CG6A 3UUEA 3ZHOA 2HBZA 2RCYA 5DKFA 4LJ5A 5K99A 4GMFA 1H2RS 1G2QA 4W4TA 3V1UA 3RADC 3IKVA 1BDHA 1ZMBA 1GD1O 1RC1A 2PPVA 2EFGA 2Q6LA 4HPXB 4IOLA 5CNMA 3U39A 1DWOA 3OEEA 4B4DA 1QAOA 4Y67A 2AOXA 1IHYA 5EIEA 4CEHB 4OLHA 2PG3A 4NXNB 3ZD7A 4GPZA 1C1DB 1R00A 3URMA 3WFZA 5IZCA 4XVUA 2HDOA 2XNDA 4F9FA 4L8LA 2X3UA 3UATA 1UXHA 1O9BA 1MGOA 2CLHB 3A1WA 4J3NA 4L2IA 4H6PA 2NSLA 4NDNE 2YJ3A 3MCUA 1QLJA 1U8UA 2HHJA 2XMDA 4ZOBA 2OHJA 5ALVA 2BTQA 3PE6A 4TWRA 1NN5A 1PX0A 1N2HA 1YTLA 1Z7YA 4EA8A 1Q15A 3C7DB 1STOA 1W25A 5CB0A 2D7DA 4C6TA 4DNPA 4BEVA 2NUPA 5ESXA 4J16C 3F98A 2ZB4A 1U8XX 3JQPA 3VNRA 3WGLA 4EP1A 3MJSA 1YRQA 5JV5A 4IIVA 4IQ8A 1IN6A 2ZAIA 1OJ7A 4FCCA 2PEZA 1FIUA 3RRJA 3U2QA 1PK9A 4TLMB 3LT2A 1YB4A 3F1LA 3LFTA 5ITWA 4CT4B 4FJ0A 4OXQA 1OHHD 1PT6A 5CDUA 4M1WA 1QV6A 1OAOC 2ZDGA 1G64A 4X00A 4C2TA 4M9QA 2I1QA 2G5CA 3OZIA 3PXBA 1ADYA 1IULA 1GQRA 1W0JA 3E15A 3ITDA 1PZEA 4CLDA 2ILTA 3IUQA 4JBWA 4MMYB 1DO0A 2AMYA 4N49A 4UMDA 4OAQA 3ZBQA 1E63A 1IUNA 1VJCA 4YXFA 5CITA 4ZYTA 5DNYB 2V65A 3PHGA 5JSKA 4YI5A 3DR3A 3ZWXA 1JLRA 1I3MA 1MX3A 4GOLD 4QC2A 4TGLA 4LC1A 3PCXA 1KZ6A 1SO8A 3EBOA 2Q2QA 3NOVA 2YXLA 2WBLC 4ZHQF 2I4MA 2WTXA 5AKZA 5G4LA 4N3BA 1D1SA 3JQQA 1VL5A 2JATA 3KZMA 5AUNB 3CLRC 3I01A 1WX1A 1RQNA 1GZ3A 4CL2A 1J22A 3AR9A 1R4ZA 2J5XA 4FGLA 3NJRA 4UNQA 2ZI6A 1V2HE 2XUDA 3GUVA 5ITZA 2BJWA 4AC9A 4YUYA 1C9KA 2WSLA 2BZGA 3RSHA 4KVAA 2RGRA 1FFEA 2QPLA 1RJ9A 1CV2A 1ZRMA 1TGVA 4L07A 1AK1A 5TPWA 3CXUA 3VI4B 5I7HA 3L93A 1PR1A 4R3NA 3IJEB 3JD2A 1WMSA 1OKKD 1T1RA 1VL1A 2EC5A 1ACMA 4GOJA 4UUOA 2XI4A 5HF8A 1OB2A 4LV8B 2XPCA 2DLDA 2GETA 4B83A 5K3OA 2QLBA 3GYGA 3UMYA 3CLTC 1JHOA 2E87A 1KEZA 3B3QA 3QSGA 1COZA 1UXKA 3TFWA 5AKKA 4WRRA 2GAJA 1PW5A 3EGOA 4KLAA 2QRVA 1E2FA 3KYDB 3EFHA 5KWEA 4Y6PA 1R8YA 1Y8QB 3H3FA 3GC6A 1EWTA 5CD9A 1C0LA 2QXUA 5B30A 1EFUA 5HKKD 1IVYA 4O5AA 4IJUA 1C1XA 3G2IA 4YRJA 2B99A 4C01A 1ZXLA 5KNBA 2WZCA 3JQDA 4Q37A 3WGKA 4DLBA 1NRWA 3DE7X 2XKKA 4GD3Q 1Q2XA 1QS0A 3UWDA 2D06A 3BM5A 4CW7A 3NP9A 4EW3A 3HWWA 1ZX1A 4P2BA 1DBSA 2FWMX 2GHQA 1A4UA 3DT8A 4DFDA 1N5KA 2CNDA 1ODKA 4WCFA 5K8TA 1T9KA 4DL9A 1RLTA 2B8TA 1Y89A 4P53A 3E9NA 1O95A 3FNGA 4OI2A 4LIPD 5IDYA 4HAYA 2OQVA 3T5GA 3R8FA 1BQEA 1WUJS 4NFHA 4QQFA 4N5NA 2BJHA 2GYYA 5T6BA 1NAHA 3DFFA 4Q66C 1QP4A 3PFKA 2MR5A 3CXRA 3HB4X 4JB0A 2WWWA 1VIMA 1QGDA 3GD7A 5FWAA 4GSLA 1JU4A 2BEVB 2DH6A 3DE4X 4QUGA 3DWGA 4BNGA 2CXRA 1DEXA 2W6NA 2VUIB 3A7EA 4FHDA 4DMFA 4JLAA 2O0JA 2B1IA 3U7JA 4AN4A 5SYMA 2JZNA 3H2IA 1QNFA 3U4IA 1N25A 4LA4A 3TQIA 5DBEX 3QFTA 3OOSA 1J0DA 4ABTA 3FF1A 3PR1A 4NH0A 4DQLA 3GLGE 3VU0A 4ED9A 2W43A 2XOKD 3U48A 3ZGNA 5ARBA 2COEA 4CUJA 3A9SA 3N6XA 1MC5A 2PMFA 4HDSA 2NXEA 3BF8A 4KC0A 4KACA 4K9OA 4LKRA 4N6OA 3C7KA 5ALIA 3TYXA 1Z07A 1DRJA 4JIMA 5DXAA 3TLGB 3TW8B 4HEA1 2BSAA 2ISQA 3LCMA 1H3NA 1PGOA 1ZH2A 5B1SA 1Z0SA 5JCZA 5EPUA 2X41A 4ZD6A 5GGXA 3HKCA 5BN1A 2DWOA 1T36B 2C20A 5T4HA 3UUGA 3U60B 5F76A 5EJEA 1KWKA 2XYHA 1QO0D 2F4NA 1E3WA 2VPZA 1SUBA 4FDLA 4PNZA 3CN7A 4A4DA 1RACA 1V4NA 4BBZA 3OMWA 2ZJ1A 4XH9B 4G41A 3OJ0A 4HZUA 5E3JA 4B31A 2ID9A 3MXTA 1IM8A 3IBYA 1INLA 1GT6A 2I0FA 2O5EA 2WZQA 4UBIA 2O3RA 3P94A 5GTDA 3WGOA 4JITA 1EDZA 4YRZA 2OFOA 4L0DA 1VPDA 2I4TA 2OV1A 2E37A 3DLHA 2CVHA 3LDUA 3T7CA 3WP1B 2BGWA 3N8KA 4RUKA 3GJ8A 3F74A 3DPIA 1EH5A 4ER0A 4ALKA 5T6MA 5CFZA 1BWPA 3BN3A 1PJAA 1YE3A 2I2FA 2NSHA 3CRVA 2O7VA 2P9TA 4MEAA 4OFZA 4EF4A 4ENTA 3BD9A 4GAEA 2OM6A 2OMKA 2ZWOA 5KX5A 1EVKA 4V24A 5L3RA 1JLMA 4DPMA 4TYQA 4RTLA 1HE8B 3BXHA 3AESA 3OZXA 4Y6OA 3N07A 3NP7A 1B6SA 3VYTB 3T7DA 2IUEA 2WUWE 1JA0A 3AI1A 3D3JA 3KALA 4F06A 1HT1E 3LE8A 4YJFA 3GAMA 1C0KA 1L0BA 1N8TA 3EBLA 4LBWA 4LGMA 4ICIA 3S68A 3SQNA 3T54A 3ZCSA 5C8YB 4M49A 3GIDA 3ZU2A 3JD3A 4QU9A 4AKIA 2ZROA 4PPQA 2YY7A 3SD7A 3VGPA 2H4ZA 2I6FA 1JIXA 1E94E 1DDGA 2E4UA 4I1UA 2QVXX 4KGXA 3HRIA 5HMMA 1K6JA 3GF4A 1Q0ZA 1XAIA 3TJMA 1MB2A 3JQ9C 3KELA 3MCVA 4HQRA 1PK7A 3RSLA 1JDJA 1RM5A 3SIPA 1V45E 2R44A 1P81A 3ABIA 3L01A 3X1XA 4L57A 4NZPA 3H1BA 4HXEB 4ERXA 1S89A 1QIHA 2R6AA 2CXHA 2HIGA 3HFSA 1PDVA 2WUDA 2JKVA 1H2WA 1A9XA 2ZAMA 4C0WA 2VQDA 3ZYZA 1SVWA 5B1YA 3NUGA 4I4NA 1ZNWA 4TYNA 1T1GA 3BICA 5EIBC 5KYXB 3KZ1E 1E3LA 2DBQA 5EERA 1WR8A 3N5KA 5K3FA 5T67A 3P2OA 2O57A 3ADDA 3BZWA 2YJNA 5BRNA 1P2GA 3BJZA 3GX1A 1K8ZB 2FPRA 3K6SB 2ZKLA 2GXQA 3MNFA 1Y7HA 2JA1A 3OZ7A 4PZDA 5FDFA 3TBFA 1D7OA 1CY4A 5ADVA 1M2WA 5HQJA 2CJWB 4F45A 2B25A 4KOAA 8MHTA 1THMA 2JB9A 1UJNA 3AF4A 4AWXA 4AZ3A 1CJBA 4RTRA 2BBWA 3D3WB 3HVHA 4PLZA 4QOFA 5FYDA 1XQWA 4DV1B 4RK7A 4QVKA 4HNGA 4UEOA 3D64A 1IJFA 1IMJA 1EGHA 1K0FA 2PBRA 3CISA 1CIVA 2X76A 3FZEA 5TSDA 2OXRA 1JI0A 1EWKA 1KYIA 1MO3A 2XRZA 1Y7IA 3PZRA 1CSEE 1DJQA 4P0QB 2Z30A 5AKLA 2O5CA 3R40A 5EWMB 3I6MA 3P52A 4RH3A 3SU8A 1TQ4A 3TZBA 1E9RA 3OIWA 1D8TA 4BE9A 1NIPA 2PMCA 3E0XA 4DCMA 4EVIA 1FTNA 2O8DA 1YRLA 2KI5A 2DKOA 2POQX 2ZYIA 3B7WA 1IUOA 3F5MA 1ULZA 1KOJA 2VPTA 1ZN7A 2Y4OA 3HKDB 3LK7A 2QM0A 4L72A 4Y9SA 5BXQC 4PNEA 1VLHA 2F48A 3CRZA 5EZ5A 2C2BA 2B0JA 2P9YA 3O91A 1A2BA 1QO0A 3BD6A 4MVYA 5ESWA 3DBRA 3QYJA 1X70A 4IDOA 2XUZA 1H1LA 1Q14A 3K96A 4JJGA 4EA7A 3L7KA 4TL9A 4QE3A 1C9NA 4RD0A 4AUEA 1REQA 3B51X 2C4UA 5DM4A 3R75A 1QWOA 1A2KC 4YCDA 5DHFA 2FN9A 3HDVA 2E3JA 4U6QA 3PDHA 1WXQA 1K4MA 4BMNA 1F0PA 4EPRA 3VI3B 1C14A 2JHGA 3E2MA 1S3FA 3LT1A 5AJTA 5FUBA 4J75A 1DRVA 3D2CA 1JDNA 3FPLA 3H1FA 3INNA 3NXSA 1XVTA 2F3TA 2YZKA 2ZK7A 1MB3A 1O6GA 1JBEA 2XGGA 2XHEA 4PFKA 4RAQA 5BYAA 1AHNA 3U4QB 5IJ0A 3KKQA 1VKNA 4P0TA 2CLCX 2PQMA 1ZUHA 3ZS8A 1XK7A 3KVYA 2I8LA 4E30A 1CEQA 1L3BA 4P3OA 3ETJA 4GLBA 4AFNA 1URPA 3CF0A 1W8DA 2PGOA 5CUQA 3I6BA 5EFOA 5H7XA 4US1R 3RNOA 2WHYA 3FWPA 1JV2B 5MFZA 3DEFA 4GI3A 3AIKA 3M7IA 2DQKA 3PUWA 1Y0BA 3ZHTA 1Y9AA 2I5PO 1QTRA 4DLUA 5JLAA 4AY4A 4UD6A 1XTJA 1DVRA 2AQHA 3I8SA 4IFIA 4ITRC 3W2GA 1V8DA 4FHZA 1AJEA 2VSYA 5JQGB 5D86A 3DE0X 3O8RA 3KTFA 2VWPA 3H83A 3WIOA 1H1TA 3IIKA 4DR2B 4GT1A 1BH6A 3SBEA 1SQSA 4YMGA 1H4QA 1JSRA 2FX5A 3FBGA 1WO8A 2VOJA 4JJ7A 2MSNA 2RAUA 3DDCA 4JI3B 2FWNA 1TJ4A 1AD2A 4DAEA 2PZGA 4BKMA 3EXEB 5T4EA 1N9KA 2BEKA 5E6SA 3UXEA 4NFLA 1N5JA 1WSDA 2J46A 4LY9A 1PLJA 4YMIA 3RVJA 5C3MA 1KNQA 2R6HA 3U80A 2YTZA 3EC1A 4ND4A 4NCAA 3GMIA 1DT3A 2CZGA 4D6XA 4RK4A 1NW7A 1K9SA 1UP6A 1NW4A 1PDWA 4R1UA 3WGJA 1T8TA 4OB8A 2A67A 3B1KA 5DBGA 4YJ2F 2OZVA 1XTUA 2WF7A 2WWGA 3L8HA 4QEZA 2E0IA 3BK2A 4MGEA 4D44A 4AJEA 5AI4A 5LDDC 3WL5A 3OZCA 4Z1MD 2FZWA 3K70C 2EIHA 1U99A 3UV7A 1QFMA 1B14A 1TA4A 3I92A 3Q2OA 4J4TA 4OJNA 4P93A 1MW8X 1IDN1 1KDRA 5NULA 1YNSA 2SNIE 4BZXA 3RUHA 4MAAA 4X1IB 1Y6GA 1JQDA 2CL5A 3JQFA 4WBNA 3EAQA 3WLFA 5CIQA 5F3DA 1Q7EA 4XVRA 1YZGA 4JENA 1NBEA 5EP2A 5DCUA 1GU1A 2WYIA 1OREA 4DAOA 4LVCA 1U6JA 3FPFA 3P2JA 4BZWA 3WK9A 2BFDA 2BI4A 3ELWA 3W3ZB 5CB6A 1NRIA 2HT6A 1NPDA 1FJ2A 5IAGA 2VJPA 3DA8A 3QF4B 4ENSA 4CV1A 3LF1A 1T6NA 1Z6AA 4XSGA 4JEUA 4NBUA 1NLFA 4XD7A 1GTSA 3ZDQA 4NV0A 1OROA 1JR3A 1KPGA 1FUKA 5AIAA 4E1BA 5DSTA 4EJFA 5DO9A 3QTLA 1FFXA 4R9UC 1IK4A 2WT4A 4O8ZA 1TYDE 4BKPA 1J20A 1RYHA 2HWKA 1M2NA 1WXFA 1CDDA 2QR5A 4F5YA 2UUCB 3EZ6A 3D5EA 2X5JO 5JZMA 4LXTA 1NP3A 3V00A 5D3ZA 4YMWA 2LNDA 2WWRA 4G07A 3ZWKA 4DLKA 5KWSA 4BMPB 1S2OA 4QPJC 1G8KA 1TF2A 1L7AA 1PR0A 3BZBA 1JXQA 1P5HA 3IS3A 3ZWBA 4CIBA 5DK6A 1VZ3A 3EHDA 1ZH6A 2IU4A 4L16A 1X3LA 5JAZA 4ENVA 2IHTA 4BQSA 4RFSB 2P6UA 3LZ6A 1T5BA 5B3AA 3GRVA 3K4PA 4R6XA 4MJLA 1NF3A 1HNNA 2HA0A 2KYRA 2XMGA 2ZWAA 2QT0A 2IWRA 2QAGC 4MV1A 2R8PA 1Q16A 4MKZA 1N0UA 2B8WA 1QC5B 3T15A 3LAWA 5CJJA 3BGDA 3EDOA 4R9VA 3UJPA 1NGSA 4F71A 1NBAA 2RMKA 1TQ6A 2QX8A 1A4XA 3DVRX 5C9ZA 5JH7B 1ZD4A 1PWEA 4BKOA 4G5RA 5HQTA 1DOZA 1Y3IA 5C5CA 1Q0HA 1RSZA 4U2GA 2O3TA 1QPZA 3D59A 2O8DB 1KK0A 1GGFA 3LQKA 2XCTB 4CJXA 1G2IA 4LW8A 3BUSA 3VVMA 4LGCA 3DDWA 3X2SA 3A1CA 3ITNA 3U3KA 1ZVKA 1CP3A 3LWDA 5HKBA 4HR7A 5CEFA 4I46A 1OH8A 1E2NA 3AFHA 4JOSA 2JFPA 4NNOA 2J31A 4FN4A 3JR7A 2A8YA 4G23A 3ND5A 1ISRA 2XD9A 1M76A 3IQGX 1G42A 3WGYA 1FSGA 4ZOQI 4HRXA 1QS0B 3R6TA 3ZDCA 3OVMA 3ANXA 2OUKA 2XQFA 1PR2A 1WHTB 5DJ5A 3DPSA 3QLVC 2OGWA 4R2LA 4DCNA 4S1NA 4R0MA 3D8RA 1BQ4A 3KE9A 3K0CA 5CTJA 3RREA 3GLFB 3TE6A 2CT8A 1IONA 3IIIA 1PO7A 5EE3A 2A9FA 2OXCA 1ZQ1A 1SCJA 2ZIXA 1GLNA 1R4MB 1TTHA 2FETA 2PZAA 3EIEA 1JIJA 3LQQA 1VG9B 2RGGA 3A37A 1GO2A 1R6XA 3OHSX 1JKFA 3Q2KA 4JC8A 4G26A 1I7LA 4UHJA 3RLIA 2DPLA 4N1AA 2Q7DA 1ES9A 2J9RA 1MEEA 1IEXA 1Q84A 2VXCA 3L6BA 4AD8A 3GHHA 1KRXA 3K15A 5EZYF 3VV3A 3NM4A 5COQA 3PPYA 1XQ9A 2EZ9A 4XDGA 4QTYA 2IZ0A 2G9VA 3KLPX 4LSGA 1USIA 4LJSA 1E3WB 5KVVA 3X1JA 3JQ7B 5JTUA 3HK2A 4D6PA 5KYYB 3QH4A 2GD2A 2WWYA 4XYLA 4IY1A 4M0MA 1B1AA 3E3LA 4TWBA 5ALRA 3G5MA 2A57A 3ZI0A 5BOSA 2VH2A 3KYCA 2G9UA 5BRJA 1FP1D 2I6SA 3L7OA 3F6YA 5CDTA 2KWIA 1ICIA 4NAHA 3ZTTA 1PIWA 2I8CA 1T8PA 1HA3A 2XTMA 3O90A 3N3AC 3QX3A 3N87A 4KEAA 4AG3A 4JKIA 5SY9A 4MICA 4QPZA 2NYAA 3IT0A 2CC2A 1DG1G 2X0RA 4FYHA 4BQNA 1MIHA 1L5LA 1NQXA 3R9KA 2WFAA 1M1ZA 2PDAA 1Z4IA 2DPGA 2FP4A 5D1NA 2Z57A 5E3HA 2BEVA 2JCXA 1ZL0A 4BVFA 3B3JA 1G63A 3DM5A 4O4JB 3TSOA 2QTNA 2F4VB 1ENYA 1J21A 2V9PA 4ND2A 2VTBB 3ER8A 4N5IX 4Q15A 1CR4A 3KQMA 2QPAA 1RJWA 1V1MA 3PPIA 2PQ6A 4J9UE 4PLCA 2CV2A 3DAPA 4CR8A 1N2SA 5TLSA 2WHRA 3E6AA 3OP4A 2XWJI 4N3NA 1V7QA 4R16A 1TJPB 4MVJD 2ZUBA 5L6MB 4CEHA 4QSMA 4WVFA 1J99A 3A1FA 1EDBA 2N9UA 4K5QA 4UUBA 4DXAA 3B1WA 1KQ3A 1OLSA 3AYZB 3DAFA 3GFQA 4B6JA 2QRLA 1X7GA 3QI2A 1CUIA 2DGDA 3DYIA 2NZ2A 2Z4SA 5ICGA 4AJNA 2FSIA 3CUSA 4ZQHA 4F2WA 2X14A 4OK3A 5AKEA 3H4VA 4O0MA 1BW9B 2O1WA 2SKCA 1YZQA 4D8XA 3R3UA 3Q8LA 1OXXK 5CMLA 3MCTA 2ZKIA 3Q3JB 2HF2A 4WOBA 1H9CA 1M5TA 1R0BA 3GGOA 3HN7A 2ZYVX 3IVCA 1FFYA 3PL1A 2GBPA 2P6MA 1QHSA 3RBXA 2AEMA 1NRJB 4Z51A 3RS2A 4MRMA 3LHDA 1K0UA 2OO3A 3B48A 1MA0A 2JGRA 4J4HA 4GHWA 5KHLB 3AKCA 2V74B 5CB4B 1JDPA 2IDMA 3LLCA 2ZUWA 2IELA 4PG6A 3JAMA 1L4EA 2HF9A 3FMGA 1B0PA 1XD2B 1Z4LA 3GU3A 3ETLA 4FGJA 4MZXA 5DWQA 1KZ1A 3EF0A 4WKNA 5B37A 3N0TA 1AN0A 1DAHA 1E2QA 1X7WB 1YQGA 4HAOA 1XLUA 4I1SA 4D8WA 2A7XA 2IBSA 1I5RA 5CM2Z 1UQUA 2VZ9A 4YRPA 2A0YA 3KYBA 4ZKEA 3ZDRA 1CUCA 1RM3A 1A9ZA 2XRFA 4MITA 4PV7A 3WWPA 1KTIA 4HVTA 4C0LA 3D8TA 4A0HA 3Q5EA 4UJ5A 5LQCA 5GP1A 4WSOA 3U0BA 1VRWA 1NNEA 1S01A 5ILOA 3AVWA 3D6MA 5DMHA 1HUQA 4XUGB 3KKNA 3WLSA 2BP7B 3PR2B 3EZ9A 2DERA 3OMXA 1L5MA 2J9XB 4FVTA 5A9TA 4AMVA 4MV7A 4A0FA 5CLJA 2ZIUB 1VG0B 2DECA 4IBOA 1B7GO 1JW9B 2DY1A 3DT6A 6ADHA 2JRCA 1JFFB 3THRA 1E9FA 1I0LA 1W4LA 2G4CA 5IARA 1X42A 4XLZA 3ZU6A 5C4GB 1ODLA 3PJGA 3E5RA 2P2SA 5BWCA 1R0SA 3ZPXA 5K0EA 3ACDA 1Z6GA 2QTZA 4L4YA 2Q0HA 5EEGA 1E98A 3BKXA 2X5XA 3K1JA 5A4JA 4F2PA 3LTNC 2EWWA 4EHKA 3GL9A 1RLUA 1LF0A 3PUZA 1H2AS 1WCIA 1BVUA 5LQKA 1JXOA 3FXAA 5LWQA 1GNQA 1T1JA 2HWWA 5KVAA 1FSSA 1ZK1A 3BSWA 4RDIA 3KOZA 3HFGA 1LDYA 3NHSA 4BO5A 3EZ2A 2PHZA 3IMKA 4MWTA 3QY0A 4BO4A 1AUXA 3BERA 3DW1X 5CX4A 1VYHA 2CYCA 5F52A 1ZMTA 1ZP6A 4QGGA 4A23A 5A02A 4JP5A 5BQ3A 2XTNA 5A0VA 2AZ4A 5KOHB 3CTPA 2WTMA 3N3BC 3VSCA 2DR2A 3A26A 3CONA 4OK6A 4B3BA 1B2RA 1YFKA 2C97A 4ZT7A 5C4IA 2D00A 3OG9A 3NYRA 2AOTB 5CURA 3OICA 3CT6A 4NFSA 1DC3A 1KXJA 1LX7A 2H9AA 4AJIA 1N2EA 4Z3DA 1PGJA 4ESHA 1JMVA 4DIBA 2ODQA 3GDHA 4A73A 1XLVA 3I6ZA 1HLDA 1ZHHA 3DE1X 2P5YA 1SVUA 1WEHA 3IUEA 1UP4A 1U4NA 2D1YA 2FMKA 1YR9A 4LDAA 4BNWA 3W79A 4DRYA 2YV2A 2GPYA 2FFBA 3MTDA 2JARA 4UNPA 3RYFA 4QOEA 4YRTA 1F12A 1U3UA 1U7OA 2IITA 3EXEA 3EZYA 1YOBA 4HWRA 3ITEA 3RUFA 1VJTA 2B35A 1RADA 3GVXA 1RFGE 1KQNA 1ZGCA 2QUHA 3FYUA 1D07A 4XFDA 5HZGA 4B17A 1A71A 1BXZA 1X0XA 4KQFA 4DIFA 5LXTB 3P19A 4CMEA 4MVJE 3TZQA 1RCUA 2IZ5A 4MH0R 1UBRS 1H3EA 4YP9A 1XOIA 2AC4A 3I0MA 3R7DA 5C7LO 5B3JC 2IOFA 4YB8A 1XN1A 1IWOA 2VUSA 2C92A 4RVOA 1NVKA 1BXGB 4EPWA 5A3QA 6NULA 3PA6A 3AT1A 5C31A 4BO6A 1MX5A 4QXAA 2IKQA 3MUOA 4YQZA 5DPMA 5FBZA 3ZHSA 1QH9A 1YKFA 2HCBA 2E4WA 2BONA 1Q77A 3F96A 5KOIA 3M6IA 2AOVA 3HCOA 3QVXA 4IFBA 1TDJA 1XKXA 5K8VA 4TRJA 1YKSA 3RSCA 2Q3MA 1S4QA 1I1HA 2BPOA 2E4YA 4E21A 1I10A 3SOZA 3LG2A 1EM6A 2VEDA 4FYXA 1VE9A 3LPCA 2XADA 1FA9A 4UEQA 4K3UA 2X7JA 2AOUA 3BXGA 4DLZA 2PUDA 4OUKX 2C4TA 1P4JA 5LA6F 1IHXA 2NX2A 4KREA 1PYOA 4EY6A 4DJEC 1UFVA 2RAFA 4DN6A 4O02B 4H60A 2RE8A 1OF1A 3VYUB 1O94C 4OQEA 1XEXB 2RKOA 4NOKA 3FHCB 3QK7A 1ZUWA 3VBCA 1FRVA 1M8PA 1PR6A 2BM0A 5CVDA 4EKGA 3HY6A 3NHMA 5JHHB 2CE7A 5JJBA 4ZTBA 4KGZA 1A2OA 2QNBA 2QP3A 2ZRJA 4Z0NA 2C00A 5JXJA 5LLTA 3K09A 3T4XA 3O9VA 3K92A 1SCNE 3HYRA 3T7AA 4KJZA 4LJLA 4JELA 4H1VA 4L95C 2JFHA 4Z9BA 1VKRA 4AY2A 3HSYA 4IV5A 1JQKA 5DV9A 1W52X 1QHHB 2V0GA 1BCSA 2C98A 1KAEA 3Q10A 4P86A 1XTVA 3AGQA 4KFTA 3HYTA 2WG2A 2O3JA 4Y2VA 3TLMA 4BNMA 1E5DA 1ZD9A 3GW8A 3V1KA 3MPUA 1SWWA 1X7XB 4WOKA 3NVKI 3R7LA 4DMLA 3CVWA 2B4QA 4RA9B 4XM1A 1KOFA 3ZH2A 3GJQA 1HRKA 4MKXA 4MWSA 3IV7A 4E6PA 4DKJA 2WV7A 4TMFA 1RAGA 3Q6MA 1VM6A 5L6LB 4EG0A 3CRW1 4Y6GB 4WHMA 5BORA 2ZUDA 3TH5A 4CKXA 4W7HA 4MIKA 1FUUA 1Y8RA 4PPGA 4QL3A 2G36A 2NPOA 4E2YA 1PT5A 2ID7A 2RG7A 3DMHA 1TMOA 4BNTA 5ED4A 4O2BF 5BN5B 2OXIA 4UTZA 1U04A 1H8HD 3QLVA 2B7CA 4EJ0A 3O3CA 1E0KA 3SXPA 3GZJA 4UZFA 3WTBA 1XLTC 4I55B 4BQEA 3RANA 2JHFA 5FKJA 3TLBA 3D5TA 2VDWB 5CA1A 4ZJPA 2P30A 4JXJA 2P68A 5JO0A 2GCNA 2R25B 5EA2A 4UD2A 1V1RA 1XSEA 4NENA 1XVLA 5E8RA 2ZPAA 1Y4SA 3V7WA 2JDIA 1E58A 1C8KA 1L7RA 3A36A 3KSAC 2WIGA 2Q62A 4ZDWA 1Y5NA 5LQJA 3K1AB 1IVSA 4D1YA 1LBIA 1OSNA 3IAM6 5DYGA 3GLHB 3DO8A 4MWGA 1UXGA 2Y99A 3PDIB 2Q50A 3GLKA 1OTXA 5BQFA 2WQZA 1JBKA 2OQ2A 3MK31 5D51S 1TMGE 4RVFA 1JWAB 4ZQFA 5CT4A 5ELLA 3UK1A 1WU8A 2H52A 1E2DA 1B41A 2WYHA 2R1TB 2FK7A 3G6KA 3OEYA 4QJ4A 4DJJA 4A0RA 2W2KB 2PA3A 4ZQCB 1H0RA 2JJQA 2X0IA 2RH8A 2VA8A 3K9GA 4YJGA 4Y1RA 1FYEA 3CVOA 4MW2A 4P5PA 3G79A 2FEPA 2AUMA 1JT9A 2BFFB 1UKYA 2ZI9A 3K1YA 4FTWA 4QQKA 3WLEA 4CHTA 4FK8A 1ZOOA 1PFYA 3I5YA 1RPZA 1XKLA 2H59A 1II9A 2C95A 4CLRB 4UDXX 2WOJA 3BHJA 3OWHA 4E51A 4ZJZA 2YWRA 1VB3A 3G2NA 2Q6IA 3I2IA 3NC4A 4LY6A 4NCIA 3WY9A 2FUCA 4J0CA 5T5QA 3WKAA 4C6RA 3U37A 1OW3B 2OZPA 5CK5A 1ABEA 4EIWA 1RBYA 4WLFA 2WPNA 3DHWC 1XRJA 4CG2A 3U6BA 1G41A 2B82A 3OY7A 4PSVA 3H17A 4QJ5A 2O8CA 2ZVJA 1N2CB 1QK5A 4P3PA 5IEBA 2JI4A 4EZEA 1GOTA 3N7TA 2ZQYA 3IULA 3UG7A 1OIWA 1E6UA 4Q4LA 1VA4A 3PHIA 4D9BA 1GSIA 1X39A 3PL5A 4L4ZA 1OIVA 4EM6A 4HDOB 2KLBA 4X1KA 3LCJA 3EULA 3ENVA 4F5EA 4HUTA 4Q7LA 3U7HB 2PWPA 3D9QX 4YRCA 4A36A 1FXWA 3U6KA 1EP9A 2ZWIA 3DUFA 3O0DA 3A1NA 1SKUA 4DSUA 1NF2A 5EMLA 1HMYA 4OIMA 3HCAA 1RI4A 4EGAA 1ODJA 1JDSA 1Z16A 2XB4A 3HBAA 3EXG2 3WQBA 2UXCB 3DLTA 4IDPA 3C8UA 2FSVC 2Q45A 3ZY4A 1K8XB 1YBHA 5JG7A 2XSZD 2C3OA 2JJYA 1FLAA 4IGKA 1LA2A 2CLFB 1I4TD 1U8ZA 3IDZA 3LXRA 4NMXB 3PWSA 5GVRA 3IDAA 3ZU4A 4HRYA 4HV4A 4L5AA 1FDIA 4X3PA 4R5HA 3R23A 3PPVA 2FPUA 4Z9YA 1Y42X 4P7BA 1M7GA 4P81A 3A6GA 2XV1A 3ZE7A 1DJOA 1M6YA 2HREA 4R7ZA 1N36B 4UZSA 3L04A 1ZBDA 4MVJF 4DR5B 2CBGA 2FV8A 3K1ZA 3RRZA 2VZEA 1W59A 4MJ3A 3UYKA 1JLLB 1JSXA 1E6MA 3O4JA 3HFRA 4V2UA 1XZFA 2D7JA 3C5WP 1TAUA 1QIIA 4NS4A 1GKUB 1T2CA 4HLNA 5EQJB 2QNIA 1TXGA 1VL2A 2EP8A 2P8SA 3WRYC 2PGLA 2HWXA 1H2EA 5SYNA 4B76A 4HDMA 4AP9A 1R5OA 2PL9A 5IC5A 4L4UA 3S1AB 3DWIA 3Q15C 4L27A 2CFRA 4MP8A 1OLXA 2EARA 2B0CA 2FPMA 1P0IA 3ITKA 1G5RA 2H1IA 3ZLUA 2EIXA 4IIUA 3UY4A 4MW4A 2L18A 4X6XA 3RAGA 1BD4A 5CM9C 3EUFA 3QOWA 5TT0A 3KJEA 1KDOA 2BC9A 4X6LA 1FDVA 1RE0A 4RA9A 3RBAA 3WYEA 1WCYA 1D1TA 2AK3A 1JU9A 1JS1X 1W6RA 4F2DA 4TLLB 1XE3A 3Q11A 3UWMA 1WBBA 2IHYA 2B7BA 1XP5A 3ZZTA 1KKLA 1L5OA 1ML4A 1V6CA 2V6JA 3L6RA 3OZTA 5CFPA 5TMBA 2WIFA 1F38A 1ND5A 2VSOA 1UCFA 4LTMA 3GLGB 5AD1A 2RI1A 3KCQA 1SXGA 2UZ3A 4A91A 1HOTA 3AJRA 4AJHA 4HUQA 3ILSA 1G5HA 1LV8A 1X77A 3W4JA 2ZSKA 1GQOA 1YJCA 2NUBA 4DY4A 2QXTA 4ML3A 2Z83A 3V4OA 1M2EA 5A62A 3RS0A 4WDRA 3BFPA 1WULS 1SOUA 2E5FA 3GLUA 2SHKA 1JWBB 3W90A 2EJCA 5KJ6A 1OBVA 5IT9A 2WICA 1QTIA 1XCPA 5E1MA 1JALA 4NYMR 2A4KA 3W8DA 1SUWA 4G0PA 4UW9A 5L3SA 2QN8A 3P9KA 2ZJYA 4ZGGA 5C81A 1ZI9A 2DH5A 3L92A 4AG5A 1P8AA 3W4KA 1J1ZA 1G5IA 2HRDA 2VP3A 3L6UA 2GYWA 4C14A 3ROFA 5FQNA 2WU1A 2IU0A 1FNCA 1V96A 2BE9A 5KQRA 2QR3A 1GGKA 1YBFA 4TS3A 4QXPA 3R8XA 1UDRA 3NKLA 3G7NA 3PZBA 2AC2A 3V4PB 2IOHA 5LDGA 4G4SO 3PHHA 3RYTC 1Y3CE 1LPMA 2QVLA 2JLWA 1Y7PA 4KWIA 4PS0A 3SX2A 1J24A 3FHTA 3EXFB 5KQMA 5AJUA 4C3VA 1W7AA 2JANA 1AUOA 4BCBA 5DN9A 1DMSA 5C1BA 3F90A 4R01A 4UTOA 2J5KA 1Q0PA 1SXJA 1UADA 3C6YA 2B69A 2X8LA 2C9MA 2GPTA 2OAQ1 3REFA 4EI7A 1CJCA 1ZMRA 4TT8A 1MP0A 1NHGA 1RWNA 4YRNA 2A1UA 3IVMA 3K20A 4RIFA 2GD1O 3DG9A 5JQGA 3BRWD 3SC6A 5BT8A 4C88A 3EMDA 3G1TA 3PKZA 1E18A 4HVAA 2EL9A 2W37A 4P22A 4RYDA 4PAGA 4FINA 5LXTF 2BGMA 3L49A 4N0EA 4N7BA 3ZZ1A 4DR4B 1P72A 1PG2A 4TYYA 2MR6A 5M34A 3O1JC 3R3JA 3E9MA 3K9FC 4PPYA 3OWXA 1O97C 3OQIB 2PS9A 3CZCA 4BKRA 4YHHB 4D9HA 1HV8A 4M6WA 2JLRA 3EDYA 3BL6A 2YVQA 3T6KA 4LQCA 4UEWA 3V6LA 1JVNA 3ZWPA 2QY6A 4U5XA 1S0UA 1ONBA 1RRPA 3JSXA 4PZ0A 4UM9B 4YMLA 3L40A 1LF5A 1Y8QA 3U7EB 2W58A 1DL5A 1YI8A 1MJ5A 2PX5A 2BFBA 3RTAA 1B3RA 1EZZA 1S2IA 4O6VA 5JS8A 3PVSA 3ER6A 3OSUA 4Y0NA 4EPTA 1RQLA 4TVSA 3STTA 3BQNB 2G06A 1H6BA 1FEZA 2AX4A 1EP2B 1K6XA 3MIIA 4KPUA 5ES3A 2AZTA 4HVCA 1U31A 3EA4A 3WYBA 3JQBA 2PKEA 3PHJA 1C7QA 2Y9PB 4E4TA 7MDHA 3AF3A 3B82A 4G0MA 3UOAB 1N1GA 2ZIGA 2VHYA 1C7EA 1MG5A 1PN3A 1WCWA 1Y7LA 3DOUA 2BBSA 2IE8A 2WWIA 2DKNA 4UASA 5KJ1A 1N4AA 2VQ3A 3K5WA 3LKBA 4M4SA 3B6ZA 3AZOA 5IZ4A 5FBQB 3WK5A 1HDZA 1P33A 2II6A 5HK8A 1QHGA 1YONA 4I8IA 1YUBA 1GR0A 1P7YA 4WBNB 5DNVA 3VRHA 3E58A 2EBHX 2A9VA 2XB6A 3EIQA 2R751