3HEMA

Structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
291
structure length
291
Chain Sequence
QLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETCDIYMHYLRGCSDLFRDKYTDVCQFTLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cyclopropane-fatty-acyl-phospholipid synthase 2
publication title Structure of Mycobacterium tuberculosis Mycolic Acid Cyclopropane Synthase CmaA2 in Complex with Dioctylamine
rcsb
source organism Mycobacterium tuberculosis
total genus 115
structure length 291
sequence length 291
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hemA00
2H1RA 2O06A 3ELDA 2FHPA 2GS9A 2BR4A 2ZIFA 3M6WA 4GUAA 3HA5A 5LR6A 3NJRA 4QPPA 4DA4A 3EEYA 4R6WA 3B89A 5DX0A 3HTXA 5HEKA 5F2NA 4EKGA 1KYWA 1F3LA 1PRYA 4C07A 4RVHA 2IPXA 5U4XA 1SQGA 1KYZA 3FTCA 3T0IA 3GJYA 2OXTA 1FPQA 1H1DA 1V39A 4E2WA 4C04A 1QANA 3GU3A 3O7WA 2JH9A 2GB4A 3VC1A 3HNRA 3P9IA 5DTMA 4C08A 3OFJA 1NW3A 2PV0A 2PX5A 3KPYA 4GOMD 2G70A 4CTKA 4M38A 1JQDA 2PBFA 3EMBA 5FADA 1SKMA 1XDSA 2ZLBA 1RJGA 3EVCA 3OCJA 2N47A 1NW5A 3CBGA 3UJ7A 2P35A 3LL7A 1VL5A 1HNNA 2P3QA 2XYQA 4IV0A 2EX4A 3SSOA 1O9HA 2PGXA 1X1AA 1AV6A 1VQ1A 3MB5A 2IIPA 4HSGA 2NXJA 1RJFA 1P1BA 3P2EA 3R0QA 2ORED 4XUEA 4RTRA 2ZWAA 2XBMA 3GRUA 5T64A 3P2KA 3BWBA 5GM1A 3DP7A 5K0LA 4DMGA 1M0EA 4R05A 3LDGA 3EVDA 4OQEA 3HCDA 2PLWA 3THRA 2Y1WA 4K6MA 3HVJA 5DX8A 4KW7A 1JSXA 1L9KA 2I6GA 4MTLA 4YUXA 2UYCA 1MHTA 1QAMA 2YR0A 3BZBA 5FTWA 3OFKA 5DM2A 2C7QA 3KR9A 3FTDA 5EIFA 1YF3A 2OBFA 1NBHA 2AOXA 1VE3A 2QM3A 5DM4A 3DH0A 2UYOA 5E8JA 3PTAA 1R00A 2OO3A 5DTRA 1NW7A 1AF7A 5HOQA 4A6EA 3DUWA 3ER8A 4RTSA 3RW9A 4PYIA 4Z2YA 5KQRA 3ELYA 2C7OA 4H0NA 5GIPE 1D2CA 3AXSA 1JTEA 1M6EX 3M6UA 4RV9A 3CKKA 4BLUA 1Q0TA 3A7DA 4A6DA 4FP9A 3FPFA 4QQKA 2UYQA 5DM0A 1RI5A 3HCAA 2I62A 3LDFA 5FQNA 4GOLD 1DL5A 1EQAA 1VLMA 2R3SA 3G8AA 3VC2A 3V97A 3P9KA 3PT9A 1KR5A 4KVZA 3FPJA 5GWXA 2I7CA 5GOZA 4RTOA 3JWGA 5CVEA 4CWAA 3UBTA 2AOTB 2CMGA 5BP7A 1RJEA 3CGGA 3MAGA 3EVFA 3EEOA 2DULA 2PWPA 1D2GA 3B7PA 3GRZA 3M6XA 4HTFB 3MTIA 4P7FA 2IP2A 5FULA 2AOUB 3NMUF 5LQRA 3C3YA 5CVJA 4P7KA 5FWDA 3CVOA 4PYQA 4XCXA 4R8RA 2JHAA 2CL5A 3LGAA 4RTJA 4HRAA 2JG3A 2GAFA 3FYDA 1BHJA 1INLA 2PX4A 3A7EA 1ZGAA 4HC4A 3BUSA 3NWEA 5EKUA 2BM8A 3R9XB 5ICEA 4X1OA 2FPOA 2PX2A 1DCTA 2AVNA 3RIEA 4RYLA 5K0NA 3ERCA 2ZSUA 3BWMA 3JWJA 1WG8A 3PX3A 5DXAA 2AN4A 3E8SA 3TLJA 2ZZMA 3WSTA 1G55A 2NP6A 1JG1A 1VIDA 2JHCA 5EEHA 2G8NA 3GWZA 4YV1A 2YXLA 5K8VA 1T43A 2QYOA 1X1CA 3BXOA 2HNKA 3EPPA 5K0JA 2YUIA 2CMHA 3G88A 5EZSA 3A25A 3OU7A 3P71T 2AOWA 2QRVB 3KHKA 3GGDA 1G6Q1 4PGGA 3GNLA 3HM2A 3MGGA 2VP3A 3CC8A 3TOSA 5FHRA 5KS2A 2ZBQA 4BLWA 3GRVA 2CKDA 1SUSA 2UZ4A 4O29A 3MHTA 4ER5A 3DLIA 3HCEA 2NNWB 1JQEA 4POOA 4OX9Y 2JHPA 2P7IA 4RSRA 5DXJA 2ZZNA 1Z3CA 1EAMA 5DM1A 5DX1A 4GBED 2BR3A 4RVFA 1FP1D 4FT2A 2PT9A 1B42A 3BKWA 3ANXA 3JWIA 5EEGA 3X0DA 3C3PA 3GCZA 3NTVA 3TKYA 3NW9A 5EMJA 1P1CA 4X60A 3TR6A 4CKEA 5LQCA 5CCBA 3PB3A 2H11A 5EQJB 3OPNA 2ESRA 1R74A 3M6VA 2O05A 5G02A 2ADMA 1PJZA 3SXJA 3BWCA 2AN3A 5HIMA 4PYJA 4YUYA 3IV6A 2R6ZA 3NWBA 2B2CA 3B5IA 3P8ZA 1NV9A 4P7GA 1NV8A 1YB2A 3FTEA 5DRTA 3SSMA 3LX6A 5FCDA 1QAQA 3HA7A 1YUBA 1KXZA 3QV2A 4AZVA 4DCGA 5K0GA 2EJUA 5EGSA 5HFJA 3PLAE 5DTQA 4YUZA 3E7PA 4OBXA 5CVUA 5DWQA 2O57A 3ELWA 2JJQA 3KQVA 4Y30A 2B78A 4M36A 5LQJA 5GIOE 3KQOA 4ZTBA 3UA4A 3PFGA 1XJ5A 1SG9A 2PKWA 2AOTA 3BWYA 3HVIA 4OBWA 1NE2A 3SM3A 2P3LA 2F8LA 3U81A 4YV2A 5CUQA 5CVVA 4HTFA 2P40A 2YQZA 5CCXA 3ER9A 4X63A 1Q0SA 4YUVA 3LCCA 5EIWA 3MERA 3NDIA 5E1OA 3DR5A 1L1EA 1ORIA 1X1DA 3AXTA 3BGDA 3C0KA 4QQNA 4QVGA 5FQOA 3OU2A 3HCCA 4FSXA 5K01A 1VP3A 2ZCJA 3KR0A 4E32A 3UZUA 3G2PA 9MHTA 4BP1A 4B17A 5MHTA 1VBFA 3AWIA 4PIPA 2Z6UA 5EMLA 3THSA 5EKXA 5BXYA 1EJ6A 1G8SA 4RTMA 5E1BA 1NKVA 1ZHFA 5K0BA 1XTPA 3P9NA 4V0RA 4OQDA 5EVJA 1NT2A 3MTEA 3NVMB 1U2ZA 3TFWA 3KQYA 4E33A 5HIKA 4PWYA 2QY6A 1HMYA 1BOOA 3KPWA 5E9QA 1SQFA 5H02A 3M33A 5EZQA 2QRVA 1ZQ9A 4PCAA 3SX0A 4FZVA 4AZSA 5BW4A 5KVAA 3G89A 3DULA 1X1BA 4RWZA 5HIJA 2OB2A 3MCTA 5E9WA 4HGYA 2A14A 2ZW9A 5DT2A 2K4MA 1R6AA 4E2ZA 5FHQA 1G38A 1Y8CA 4WXHA 3V8VA 3IEIA 1XCLA 4RTQA 3EMDA 3OZTA 4IWNA 5P8WA 4YUWA 2BH2A 1JR4A 3L8DA 3UJ8A 3LSTA 1ZG3A 3B3GA 3DXYA 3FRHA 5DSXA 4KDCA 1ZGJA 5KYGA 1I9GA 1KIAA 4LG1A 1IY9A 3FUVA 4QDKA 3EVBA 4CTJA 1IM8A 2YX1A 3LKDA 3KQSA 2IH4A 1L3BA 1JSZA 3FYCA 3KPVA 4PGHA 4RTLA 2OB1A 4ER6A 5LQKA 2OZVA 3GO4A 4GOOD 5IH3A 4PONA 3LBYA 4PYOA 5HILA 3CCFA 2FK8A 3A4TA 3EGVA 1FBNA 4DQ0A 2UYHA 1XXLA 2PJDA 5EG5A 1OR8A 2OYRA 3SVZA 4DCMA 4C03A 2LD4A 5K05A 4M7RA 1I4WA 3LECA 3NDJA 2XVAA 3DMGA 4CXMA 3UJCA 3OU6A 3F4KA 1WXXA 4FR0A 5LQAA 2FCAA 3HA3A 1JG2A 5DSTA 1N7IA 3RODA 3KQWA 3FPHA 5ICGA 5K03A 3DXZA 4GQBA 1UFKA 3KQQA 5EHGA 4KRGA 2ZFUA 2PT6A 5E1DA 3IYLW 2Y1XA 3UFBA 4GEKA 3D2LA 2NXCA 3GRYA 2IH5A 4EK9A 3BKXA 2G1PA 4OA5A 4LECA 1G8AA 3O4FA 4GOND 4PCLA 5EPEA 4R8SA 3TM4A 1L3IA 3EGIA 3FUXA 1KPGA 2P7HA 4YMHA 4LWOA 2PXCA 3KQMA 3B3JA 1JG3A 5F2KA 1NW8A 2PWYA 7MHTA 5T6BA 2YXDA 4E31A 2IGTA 3FPGA 2ZBPA 1RI4A 3G7UA 3A26A 3LCUA 4QTUB 5FWAA 3HVHA 3G5TA 2GPYA 2ZVJA 3E05A 4KIGA 5C9ZA 3A27A 3Q87B 2EG5A 3TMAA 3QOWA 5DLYA 1FP2A 3I58A 3G2OA 4E70A 1O9GA 1D2HA 1O54A 4FS8A 5GP1A 1YFLA 3I5UA 5K0CA 5ERGB 3JWHA 3KPUA 3HEMA 2P8JA 4OA8A 4C4AA 1KP9A 3EVAA 4PYMA 1SVUA 3FUWA 3EVEA 4BP3A 1SUIA 3Q7EA 2V74B 1WY7A 5E9JA 3FTFA 2B3TA 3C6MA 4WVLA 1MJFA 3G2MA 1IXKA 3FPEA 4GF5A 3S68A 5E8RA 5LQNA 3E23A 3LDUA 3GDHA 4ER3A 3HCBA 3HP7A 5LSAA 4V0QA 4U7TB 2CWWA 4IKPA 3EVZA 8MHTA 2VS1A 2I9KA 3OE5A 5T67A 4X41A 2KW5A 2IBSA 1NW6A 5BW5A 5B1SA 3KU1A 3UJBA 1KPHA 4FSDA 3MQ2A 3FZGA 3OZSA 4P7JA 1QZZA 2OPBA 3AJDA 5EC8A 5GINE 4Y2HA 4HG2A 4RTNA 1G60A 3ID6C 2FK7A 3G8BA 3G2QA 2H00A 4ATNA 5FA5A 4JXJA 2PVCA 2FRXA 4F86A 1YZHA 2B9EA 2GLUA 2IDJA 4P58A 5ICCA 3CJQA 2AOUA 3KKZA 5ICFA 4C05A 2ONZA 4XUDA 4PNEA 3QOXA 2EFJA 2HWKA 3P2IA 4AZTA 3FRIA 4KWCA 4ER0A 3K6RA 2IBTA 3ME5A 1JG4A 3UWPA 4QVKA 3R3HA 5K0EA 3M70A 2AOVA 1P39A 2E5WA 5JUWA 1KPIA 4X61A 4DZRA 3UJAA 2EJTA 2ZZKA 2XVMA 3DOUA 3OE4A 3TQSA 4QTTB 2AN5A 3B3FA 2G72A 3LCVB 4RTKA 4G56A 3K0BA 3HCFA 3KPJA 4GC5A 2BZGA 4PYLA 4LWPA 2IH2A 4QPNA 2G71A 1TW3A 4RTPA 2AR0A 2O07A 2AZTA 1TPYA 2XYRA 1EJ0A 1R8YA 5EOVA 1BKYA 1RI2A 1XDZA 2ZBRA 3PX2A 3PVCA 4ER7A 5E2BA 2Z6QA 2Q41A 5K09A 4AX8A 1N7JA 2PY6A 2YTZA 3R24A 3TPZA 2HTEA 5KQSA 5E2AA 3UA3A 2B25A 2V7EA 5FA8A 5DRYA 2PXXA 3T7TA 4R6XA 4IV8A 3HVKA 3KR2A 3UJDA 1WXWA 2P3OA 1I1NA 5K0FA 2XYVA 2PX8A 2BR5A 3R6TA 5CD1A 1WS6A 4QDJA 1XCJA 3EVGA 2Z6AA 4RVDA 3PS9A 3ELUA 2C7RA 2ZTHA 3DMFA 2GH1A 3GIWA 4FGZA 4EQZA 3I53A 3KQPA 1F38A 5F2OA 2VDUE 2WK1A 3ORHA 1TW2A 1QAOA 1XDUA 4L7VA 1ZKDA 2WA1A 1QYRA 2ONYA 3AY0A 4PYNA 1JQ3A 3G5LA 4U7PB 1P91A 2ZIGA 4AUKA 4DF3A 3VYWA 4NECA 5CIYA 3KR1A 1FJXA 1EG2A 5D1NA 4MWZA 1VP9A 5HZMA 2IDKA 5C0OE 3P97A 3T7RA 2IFTA 3SR4A 3T7SA 4DM3A 3FUTA 1RI1A 2VDVE 3M4XA 4GC9A 4YV0A 1R18A 3CJTA 4CKBA 5JR3A 2NYUA 1JTFA 5E1MA 2AVDA 4FT4A 4EMSA 5CVDA 3DMHA 2JH8A 3UJ6A 5EHIA 4E2YA 5IKMA 1RJDA 2HV9A 3BT7A 4MIKA 2NXEA 4CKCA 3DLCA 2WA2A 2YXEA 3VSEA 2PSSA 2ZULA 4BLVA 4E30A 1EIZA 3LPMA 3LHDA 2O0LA 3FUUA 2HMYB 3TM5A 3BGVA 3DTNA 5D1HA 1BC5A 1XVAA 2AS0A 4PIMA 4BY9E 4HH4A 4DKJA 2NP7A 5M5BA 1X19A 4KIFA 1YFJA 1R8XA 1UWVA 1YZ3A 3NVKI 3PFHA 3C6KA 2ERCA 3I64A 5DPMA 2DPMA 2OKCA 3I9FA 3TRKA 1M6YA 5HIIA 1RI3A 3SMQA 5FUBA 1VPTA 4F85A 1NBIA 2P41A 4RVGA 3SGLA 3GRRA 3MCZA 2ZWVA 5CM2Z 4UOEA 4PINA 1AQIA 4C06A 10MHA 5LQUA 3O31A 4KDRA 1N2XA 4XUCA 4YMGA 1KHHA 3TKAA 2FYTA 4ISCA 5EMMA 2P1DA 3H2BA 3REOA 3P9CA 3BGIA 4AZWA 3KQTA 3GXOA 2BM9A 4E2XA 2HR1A 2VDWA 3UJ9A 5C1IA 4F84A 5EMKA 4EVIA 3EGEA 2NXNA 3DXXA 1WZNA 4RX1A 3LKZA 1L3CA 4HGZA 3CJRA 2YVLA 4M37A 4PYKA 2C7PA 2PXAA 1DUSA 5GM2A 3SSNA 2GA9A 1ORHA 2QE6A 3LBFA 2VZ9A 4MQ4A 4EKIA 3IHTA 1AQJA 2ZIEA 4MHTA 3OZRA 2OY0A 1UIRA
chains in the Genus database with same CATH superfamily
2GS9A 4KQCA 3WDMA 3DZBA 1B0ZA 2GBLC 4B4VA 2OCXA 3EQ8A 4W5JA 4B6SA 4UTXA 2D4AA 1I7DA 3U44B 3GCDA 4HWGA 2E4WA 1AF4A 1YRYE 2IPXA 2PR2A 1TRKA 2FLVA 3IO5A 4ZCTA 1Y3BE 1FTGA 1Q7CA 4QFDA 2EDAA 3T38A 1B76A 1LGYA 4CUZA 5EL0A 5AUQA 1NMEA 3E0XA 3VKFA 3PXAA 3EDMA 1B0AA 2BGWA 3QI7A 2ZR0A 1DAMA 3X3HA 1DELA 2H8GA 4Z9YA 2RGWA 3PFCA 5JDIC 1Q84A 3TN7A 1S2DA 3MUNA 4BLQA 1JLRA 4I2NA 1EEHA 1ORRA 1QHSA 2VPQA 2ZLBA 4Z0HO 3QSGA 5JSFA 4IDQA 2I3ZA 4JI8B 2P35A 2P91A 4UZSA 3ZDBA 3Q0EA 1G66A 3HS3A 3IE2A 1W7AA 1GRCA 3UMBA 2X4GA 4O59O 1AH2A 3SSOA 1HFJA 1VPLA 4M22A 4EG4A 4OIMA 3F98A 3O03A 1XE3A 1GPWB 1Y48E 1AZSC 3GRUA 2OTCA 1M8PA 5I4BA 5K3EA 1G59A 4WA7A 1Q7EA 1IOVA 3JQAA 4CEHB 1V6SA 3O9VA 3B38A 4M99A 2PL9A 3HVJA 3TGWA 1UMBA 2JIRA 4CV0A 4NOJA 3C3CA 3W5VA 1L5MA 4PRLA 5C8YB 4UUQA 4YACA 4HGPA 1G20B 1XMJA 3WGGA 1QTRA 3RFXA 4XZ3A 3B8HA 3JTEA 5DM4A 5SY6A 1X7ZB 1E9RA 4YT5A 2YINC 2VUIB 3LFUA 2G5GX 1DWUA 4RTSA 5JXJA 2B98A 4DSUA 4EY8A 3RSLA 2O3UA 4EI7A 2HGZA 3EBLA 1KMIY 2CW5A 3COZA 3HC7A 4JBLA 3GYBA 4TQ9A 3TINA 2J9FA 5U9CA 5K6TA 1PK7A 2FPWA 4WKCA 5AJVB 5K8LA 2HJGA 3W3AD 4ALNA 1P1RA 1WMAA 4ZZ3A 4EHHA 4IL5A 1Z4LA 3VC2A 1R0ZA 5C5DA 2YMQA 1KR5A 1Q19A 2ZIVB 4LS3A 5AVOA 3A3KA 4B83A 1YAJA 4KMOA 4HVAA 2GDJA 1A5AB 1YJCA 3ANNA 3DCNA 3C5CA 3DV2A 3NGLA 4XGNA 4FIDA 2WAMA 2DAPA 4GL2A 3EVFA 3H2KA 4PBTA 4ZANA 4V1CI 1RYHA 3C4QA 4RK5A 4IZ6A 5L4SA 3HL4A 4OQZA 5K2MA 2CSUA 4NLLA 3M6IA 4MWTA 3NQ41 1G8GA 4O3FA 4A23A 1PGJA 2NTVA 4L6CA 4ND3A 2WU8A 4LIPD 5LLDA 3SIWA 3ENZA 2GAFA 1FYXA 3F46A 3FYDA 4JI6B 4OF4A 4G1CA 3IP6A 3LQKA 4YONB 2I1LA 4KK3A 3NTLA 2ZVPX 3AQ4A 3SQNA 2FSGA 2AJCA 4MIEA 4ZVMA 1W47A 1YA8A 2BM8A 2GBCA 3D8BA 4Q18A 5EKUA 1G8HA 5AM4A 5CDFA 4FKBA 4X20B 1A71A 2O3QA 5ICEA 4UBJA 3D81A 1PQ4A 3TZBA 2ZSUA 5HQ3B 5JZOA 1UINA 1NI4B 3ZIAA 1GGVA 4X90A 4KEAA 2D0IA 1GU7A 1D2EA 3O2SB 4F8EA 1U31A 1ENPA 1M83A 3GGGA 3T7EA 3SWWA 4W9NC 2TECE 1T8RA 1LK7A 5ELMA 3U62A 1WXQA 5EZSA 2CEAA 2QXYA 1FVXA 1LSUA 3BL6A 5KCZA 3KYIB 1CB7A 1XTQA 1RCTE 3T5PA 1FTQA 4YP9A 4WZZA 5FL7A 4LDNA 4ZAXA 5HJ2A 1GZ5A 3UFXB 4ND6A 3ZKWB 3U80A 3DAHA 5CDGA 1IN7A 5AW1A 1NYLA 1D6MA 4EGCB 5DEIA 3TIGA 3WZ2A 4EY6A 3C3DA 1H05A 4FQ8A 4TMKA 5CA0F 3SEFA 2BR3A 4N5MA 1SURA 2FN8A 3FKSD 4N40A 3VFDA 3LPAA 2HK7A 3H2IA 1GEEA 2YVKA 1D7OA 5GY7A 2VL7A 3U31A 2ZE6A 1YZYA 1TTPB 3KV1A 1GITA 2GFHA 2AG0A 5EGNA 1AV7A 1IEXA 1C0EA 1E9VA 5TMBA 3TOZA 2FPRA 1OLUB 5LQCA 5BSVA 3A4VA 3AVWA 3GEPA 1JR3D 5CDFE 3D3EA 3DW3X 5EWLA 3RS2A 3QVVA 2AN3A 4LZZA 3HGQA 4R2IA 5CRIA 4YUYA 4GP6A 5JS6A 3NWBA 2AZXA 2B2CA 4HT3B 5JLJA 3SC6A 3NANA 4UNPA 1LSSA 2QSZA 1VZ2A 3CBQA 1J1IA 3LX6A 1A82A 1RXIA 2GM9A 2IXDA 2QMOA 3O2QB 2C5LA 5K0GA 5HFJA 5DWQA 2QMYA 2PVPA 2J41A 3TBFA 3AUFA 4Q4DA 2QR5A 3ZBQA 4F5WA 1U7TA 1XAHA 3W34A 3JQFA 1F2UB 1R5NA 1PDWA 1V3TA 2E48A 2XTAA 1DX4A 1DIGA 2QUHA 2WIJA 3MJDA 1E8DA 4ZWNA 4OU5A 2ZB8A 5FTKA 2BBWA 4NS4A 5LA6B 3B3QA 2H2DA 4NBLA 3T9EA 3SVLA 1CQJB 1OC2A 1ZD1A 2W98A 3IMFA 1ZCZA 4AO6A 1R6VA 1VP3A 3DAYA 5IANA 2ZXFA 1M34A 4HDOB 3RK4A 5AW7A 2FMXA 2YXNA 2ZSFA 1CS0A 1L4KA 1NP3A 2JI8A 4BQOA 3O8CA 2NSLA 3T95A 5FWXA 4JN6B 1QS0A 3BTSA 4B8ZA 4DIDA 3NBMA 3THSA 5IF9A 3Q7IA 1JFLA 2PKQO 5B2ZA 5BXYA 2WB2A 4FM9A 1FW6A 1FP4A 2V58A 3GXBA 1ESCA 1SXJC 2VA9A 1GU0A 3I2KA 3MAJA 1E96A 4YCBA 4IDGA 1CUFA 4MVJH 1MX3A 1E5TA 1HFEL 2FMKA 2AFHB 2FP3A 3BDAA 3UXEA 4AMGA 1W44A 3KQYA 2HDNB 3AJ8A 3QJGA 3RADC 4UUAA 2Q5EA 1ZI8A 1MBZA 4JLPA 4AWBA 4L2IA 4WZBE 1AKUA 5LOVB 1ZIXA 3RHTA 2GHTA 1CUHA 3QWIA 1CETA 3RVNA 1NNI1 4OGWA 3VTAA 4HWSA 1N6IA 3O38A 1P29A 2GPJA 2ZUTA 2DR3A 5FHQA 4CQMA 2R00A 3A2MA 4WXHA 3NX4A 4U5XA 4GKBA 1K6IA 4IGAA 3B5JA 3L07A 4LZAA 3D8UA 2F3SA 4M9UA 4V0SA 3CEMA 4Q1BA 2WJAA 3V7WA 1IM8A 1MB4A 2GJ9A 4GZ5A 1IN4A 1Z6YA 3F6RA 1T6NA 1L3BA 3FYCA 5IVPA 3BTOA 4B0PA 3JVEA 4GXNA 4ZYWA 1I3KA 5LXTB 1Z6AA 1KMQA 1WSAA 2Q4DA 1C29B 2ZVDA 4D92A 4JKYA 1B0UA 4ME6A 2OYSA 1JI0A 2H06A 3HB1A 1Y3HA 2EW1A 4RK7A 3ABOB 1NIJA 1KAEA 1RE0A 2WWIA 3LECA 3L79A 3QLTA 5FTLA 5LUAA 2GDZA 4I9GA 2HWXA 3I39X 3ZK9A 4DV3B 1U2QA 3EUFA 1C2TA 1MEOA 3QA3E 3TPCA 2YWJA 4AJ9A 3OAAD 4EO7A 3AOGA 4ZJZA 1RQ7A 2WSSD 1F9AA 3BDIA 3EY9A 4OHUA 4YXWD 4ZK2A 3ECSA 2Z5LA 3IYLW 3PQ4A 4ALLA 4OYYA 3CX3A 3AEXA 3LC1O 4P4UA 1OB5A 4QT4A 2YC2C 2HY7A 2VF8A 1DRJA 2JAHA 1GKUB 5EI5A 1QVAA 4FWTA 5BR4A 5F77A 3K4HA 4LC9A 5FV7A 2QW1A 4UUOA 4OXKA 4EYOA 3VPHA 4EBFA 5IYZF 3S28A 1TM7E 3QWBA 1Q0LA 3CNNA 2E4UA 4G5YA 4J8PA 5HVNA 1V7ZA 5LD2C 3DCYA 2IHNA 2HQBA 3B12A 4K9OA 4REOA 1WUYA 4O5OA 3SFTA 3TW6A 5JEDA 4KFCA 3ZWKA 1C7FA 1RI4A 2IK8A 1ESDA 3GDFA 3VOBA 2P69A 2V5UA 3X1YA 2D59A 1WR8A 2NZVG 1F17A 1T8UA 2WPDD 3K5WA 1TUGA 4HD8A 4ERNA 3TLKA 1XD2A 1DZ3A 2F3UA 1N2GA 4H27A 2O4CA 1ODTC 3HJUA 5B1DA 4HCJA 1D2HA 2WMOB 4WXPA 3VR4H 2BT4A 2X0EA 2JNWA 1ONBA 5CT9A 2QTZA 1OIVA 4AXBA 4C4AA 3R40A 2BCEA 4DA7A 1NNSA 3CMCO 1HX7A 3WLPA 2FSVA 4G4SP 4Y9DA 2V6IA 1MC5A 4U0KA 3RUHA 1EFRD 4J4HA 1AKYA 4WOBA 3QTBA 3B1VA 5IUNC 2QN2A 1GUZA 4G67A 3HU5A 1RPJA 4QUIA 1G5QA 1BXRA 1GPJA 3FPEA 4YALA 3C97A 1AGPA 2Q0SA 1JFSA 1GL7A 8ATCA 2VT6A 4IRUB 1XKLA 3D6MA 3MBKA 3PD7A 5BOVA 2W6CX 3ZZMA 1VSTA 4TV9F 4CIVA 6ADHA 8MHTA 4W1SA 2I65A 1BJKA 1GO2A 2I9KA 3THXB 1ZHHA 1TF7A 1BCSA 3KQHA 3LWBA 2V6GA 3DUFB 3PLNA 4ZXFA 1MG0A 3FZGA 5B58C 3CUTA 1ODSA 4XTRA 3LHKA 2EC5A 3W6OA 4M7WA 1ODIA 1NKSA 2G3YA 4J07A 3QKSB 3R3WA 2NZ8A 3V8MA 2J9ZB 2FRXA 4FDAA 3PF9A 1PGOA 2J87A 1M7GA 3AIOA 3USZA 2IUFA 2XSZA 5J23A 3VPCA 2BZ0A 4QLBA 1JBQA 2HWKA 3QBJA 1YBVA 1DCKA 4JS0A 4XASA 4FYXA 3PZRA 2PH7A 3CKMA 3HFGA 2Y1EA 3AHGA 3JAWB 4QVKA 5C7IO 3O8RA 3RS3A 2E5WA 2VRNA 3WGKA 3GP5A 3LUBA 2EP7A 2IS1A 3VVCA 2AX3A 5LYJF 2BMEA 1ACMA 3E35A 1JZSA 3R3SA 1GKKA 1LJUA 1P5HA 2FMFA 3GFPA 3K8OE 5H9VA 5BRNA 1N4AA 1QIGA 4Q9LA 1T36B 4O3MA 4XLZA 1XCGB 4QJIA 3GAMA 4D9CA 2GEKA 5TVKA 2BZGA 4DYHA 3UATA 1GUFA 2A0YA 4ZN6A 4QKQA 2PKCA 1A4UA 2J1LA 2XITA 2XQKA 3GWGA 3LK6A 3RR2A 3HDTA 1UZAA 3II6X 2WJ3A 2ODWA 4X71A 2JBAA 1PFQA 4ZGWA 1KS9A 3FWYA 4RH0A 5KHLB 3KB8A 1ZW6A 1BTOA 2GFIA 2AE1A 2I8CA 2J6CA 1QVWA 2RGAA 3ED1A 1NC1A 4J7UA 1OBHA 2HI0A 1A50B 4JK3A 4OSEA 5JAUA 2A7QA 2B1JA 3N6XA 2KLBA 1FU4A 1M2JA 4MMXB 1ML3A 2EKQA 3AOEC 5DMXA 1HT1E 4AAYA 2R7MA 2CZCA 4M88A 1MQ9A 1KF0A 1XCJA 2B61A 1GRVA 4HN9A 4D6XA 2QAGA 2FKAA 1QKJA 3TZQA 2XCSB 5FDFA 1TIBA 3G82C 3MWEB 4N39A 1WKCA 4FGZA 4UMVA 5TE9A 2VDUE 2WD7A 2XTJA 3INTA 3KOXA 3SC2B 1FTSA 1K3UB 3LWZA 1SHZA 1IN6A 3JQAD 2WA1A 4JJEA 4LJYA 3U3MA 2G80A 2J3LA 3E48A 2DUUA 4HAWA 4GYYA 1P91A 1HT0A 2W6QA 1SBNE 1T3ZA 4G1VA 5CIYA 4I4TF 2X4DA 4B09A 2BW0A 2JVJA 5M3BA 4JR1A 4X8HA 5FWNA 2BZSA 1SQ6A 2VG8A 4YY3B 3T7SA 4JDPA 1G63A 4EB8A 1TVEA 1TZKA 3AJ9A 1L9XA 2GBGA 2VQEB 5E2IA 5FOSA 3TAHA 3ADOA 3MOIA 3AETA 3LPLA 2AVDA 2QXTA 2ZB2A 4QUDA 2X0DA 3TAXA 2UXDB 4TX1A 3TF5A 1VFNA 3DXFA 4IUYA 4LXQA 4PU0A 4F5EA 5IT5A 1G6HA 1JDTA 1AQLA 1NVGA 1C50A 1BO6A 4MZXA 4B3JA 4GSLA 5KYTA 5ALUA 2JW5A 5F33A 4CLDA 4ZGBA 1MB0A 4E30A 5B3JC 5BNZA 3VXKA 4LGMA 4UD6A 1RMQA 3H5RA 4G4GA 4OP1A 1O95A 2AS0A 4X84A 1A3CA 1VHDA 1UP7A 4E07A 4NPHA 5JNRA 1MJGA 1DKUA 1YXMA 3A36A 4WLEA 3WB0A 3N05A 3JVIA 3GEMA 3KJHA 2WWVD 4ZHSA 5K0TA 3TR5A 1E3IA 4I81A 4NBKA 1YHYA 1KORA 1O87A 2OKCA 2R68A 2P2LA 1T9HA 3H7AA 4E5MA 4JKOA 4J0QA 1GXSB 3VU9B 3DFUA 2W6NA 2GWRA 4FB5A 4KYIB 2B2XA 3EDCA 4WCVA 5F73A 1EG7A 2ZUUA 4ND8A 1V25A 3CRMA 3DMTC 2OCAA 3VO1A 4F3TA 1R2QA 4Q34A 2ZJ6A 3ZQKA 2HC9A 2Z2ZA 4GWGA 1T34A 3T94A 4C0SA 3ON5A 2BCGY 1PEDA 4OQ4A 2RI1A 3KFXA 3BK7A 2Q9BA 2A2ZA 1PSDA 1YQXA 2VP6A 3KELA 1KXJA 3ILSA 3PR2B 1WULS 2VJYA 4CF6A 4YT8A 2X8JB 4JBHA 4UTNA 1YZKA 5F1KA 1KMMA 1L3CA 2RGNA 3BGSA 4G0NA 1S0UA 1W581 4JB2A 4IIJA 3ZIAD 4DJDC 3EFOA 5FBZA 4MQ4A 4YT2A 4ZGGA 1FZQA 3HTXA 1NOIA 1PWZA 1YQ9A 4BMZA 4A2WA 5GZ3A 3VTFA 3AEQB 4UOZA 5BNWA 5KNDA 5F3WB 5F1PA 1U0SY 2CVPA 1PYDA 1ZSVA 4DSNA 5IVIA 1ZMOA 3A32A 5BSKA 1GQQA 5IT4A 1F3LA 1P2BA 4RV5A 1CJMA 2NAPA 5FL7D 3AB8A 3UICA 1BE0A 2FZCA 2PWAA 4R2HA 2UXCB 1YWGO 4GLLA 4PFQA 2FGKA 1XLUA 4XCQA 5BQ5A 3O7WA 2JH9A 3RC3A 4ETMA 3C45A 4QBGB 2HF7A 4R9NA 3PNKA 1QRUA 3EDOA 1LSOA 4PX5A 4F4HA 1XAGA 4R1TA 4BAGA 1DAPA 4CBVA 4LRYA 3L7IA 1KVTA 1O57A 3I0MA 3Q3HA 3RTCA 3WIVA 2CB0A 3CN9A 1TFRA 3MJCA 4IM7A 3ANMA 1ZW1A 4MV8A 3FWZA 1GZ7A 4PAMA 1G18A 2QY9A 4QG3A 3EWIA 1RJGA 1V37A 4MJ3A 1J90A 4OHXA 4OV6B 5C1PA 3CBGA 3KXLA 3ZZ1A 2IXBA 1GNLA 1Q3KA 3ZZUA 3T3NA 1VA5A 5SYMA 2P3QA 2QDKA 1QH1A 1E5LA 4GHWA 3BXGA 1SUAA 3LX8A 2ZRNA 1IFXA 5EJGA 4O4LB 5CNMA 3HI4A 2HU7A 4HSGA 4X6UA 5JLAA 1BROA 2GPNA 4OATA 4K05A 3GGCA 1PR5A 1KJJA 3KUKA 2X2PA 3ZDDA 1QCDA 3JQ7B 4WW0A 1LPPA 3AM4A 3OZFA 2FZKA 1R0YA 2DWOA 3LLCA 1GG5A 2ATVA 1PNVA 3RV3A 4FE7A 3VYVA 4A6XA 2QJOA 3JARA 1JWBB 2QVGA 1PG2A 2HCRA 5HUHA 2WM9B 4EB6B 3N2LA 1NXQA 1R15A 3MCAA 4OVKA 1XF9A 2PQ2A 3WNCA 4BZXA 1L5VA 2QVXX 4MAAA 3SF8A 1VBNA 3LVQE 4D8VA 2ACWA 1GVNB 4KQ6A 4PF1A 1U2GC 1SHJA 1XZDA 1Z2OX 2FQXA 3RJMA 3U4QA 4J0EA 5DYNA 3ESRA 3HEBA 1YOVB 1RTTA 5BYBA 3RHZA 2JBWA 3MFYA 1MIHA 4YRZA 1RM5A 2NU6B 2KYRA 3H8VA 3L84A 2A5GA 3IQZA 2GN6A 1DX6A 4BLUA 1OVGA 2H3EA 3K70B 2I54A 2VJBA 2X7XA 2CUZA 3OMWA 4ALMA 2VHQA 3RRXA 1FNBA 4D0GA 5I7UA 3LDFA 3G9QA 5ALWA 4C0XA 2R48A 5JSHA 3U09A 4EFKA 2I7TA 4YCDA 1Z5OA 1JEQB 3VZRA 1HOTA 4WLUA 3MB8A 4DB2A 5GWXA 2ZWMA 2QG4A 1L5OA 3M1LA 4MR7A 1C4XA 1K66A 2OVFA 4FOTA 5DCWA 1DC4A 4KQFA 3UBTA 4GKVA 1X2BA 3FBTA 4NE9A 1KMNA 2I4NA 4YMSA 1E2KA 3WLEA 4CQMD 4QYWA 1Z13A 2BEVA 4C6TB 4RE6A 4C89A 5I9TA 2AEEA 5BVHA 1CUBA 1W5SA 1DHRA 1DTWB 2QZZA 3IDAA 3GLGA 1UBEA 1YRHA 4XCXA 1NMSA 3N2YA 4B3HA 2JDIA 2RJOA 4CKYA 1ECCA 1GQYA 2GF2A 2OBBA 3GJ3A 3VVBA 5HA5A 1A8IA 3U3RA 2IPNA 2X8BA 3C3AA 1TCAA 2Z4TA 3NBZC 4I4NA 3OLWA 2XRFA 2I1QA 5HFAA 2RFLA 5KTSA 1PJ4A 3HXKA 3GT3A 4YMTA 4M8NE 1MRSA 2HQOA 2YYYA 3IPXA 1WD7A 1Q5PA 5LJLA 4DR7B 4U6QA 3OIVA 1N7GA 1UKYA 3ZI0A 2I66A 1PK8A 3O3NB 1GZUA 1Z0KA 3OT5A 1UZMA 4B2LA 2OO7A 4RHUA 3OZ7A 2QYOA 2IT1A 3HLKA 3U4MA 5LP6B 4EKNB 1A04A 4RADA 2Z57A 1W75A 2B20A 3S55A 1QLJA 4PGGA 3ZY5A 4BJ1A 1A5ZA 1EXDA 3CC8A 4HS4A 4RELA 2OBLA 1K68A 4R0NA 2Y0EA 1D8TA 4NAVA 4YMIA 1MFPA 2CKDA 1EWQA 2UZ4A 3KEGA 3OESA 3CPHA 3H5WA 3MCVA 5AHKA 1YK1A 2IYXA 2WINI 3A0RB 2JHPA 1KERA 2ZS8A 3JSAA 1ATZA 2Y9MB 3MZ0A 4LVNA 5DTEA 1FQKA 1YL5A 4B3CA 2ZWIA 1GGEA 1V0JA 2J9GA 1VRWA 2OGUA 3LC7O 4E03A 3GLGE 2PSEA 1GKYA 1H2RS 3NTVA 3W9UA 2CLSA 1QYDA 2IYYA 2P0YA 2FPSA 2GX6A 1P1CA 4J6EA 3RTAA 5CG1A 2Z43A 5TGTA 6GPBA 5BRAA 2IYNA 1MVLA 2VWHA 1U6KA 2GD6A 3OPNA 3F47A 3RRJA 1TQ2A 3PI6A 5DEOA 2SICE 1PJZA 1GQOA 4L50A 4HJXA 1E6LA 4PLWA 5FBVB 2QAJA 2Q45A 5KYWB 1TA9A 1AN9A 2K5UA 3P8ZA 5FOXA 4RDCA 2AEJA 3B1ZA 2AWOA 4P98A 4PYRA 3L7NA 5AQEA 1G4HA 1Q20A 1Y1PA 3KLPX 2F3QA 4J1NA 4N9QA 2VKQA 1ZNQO 2FP4A 5EGSA 5EJAA 1KDOA 2JD2A 1J99A 2IV2X 2EF1A 3KUXA 2PUGA 2H5LA 2Q1WA 4MAMA 1EP1B 4Q01A 1RPNA 4ZTBA 4LOKA 3UA4A 5F2NA 3KZCA 1N36B 3BWYA 1RIFA 2P3LA 2HU8A 3WGYA 3ZIUA 3QU5A 2XH8A 4LW8A 1XRRA 5C4GB 4CT5A 2WAYA 1D2RA 1Q0SA 4QUAA 1LWNA 2XR1A 1V6AA 2D7DA 1HE8B 3HJAA 4WCFB 3KWMA 3ZUGA 1QZXA 1VL1A 3IAS1 3T5GA 2J0EA 4DJ5X 1M8GA 3NASA 3N2GB 1YI1A 3ML1A 4I50F 5DGDA 4B17A 4MWDA 1N78A 4PIPA 1KYVA 3ZHBA 2YXBA 2WVJA 4ZQGA 1ZBQA 3C1TA 3RLIA 4HKTA 3H6GA 4R98A 4YJGA 3CPJB 3WC4A 1NAIA 1Z26A 2XSZD 3AP3A 3VHRA 3VZDA 5C7LO 1VB3A 1UQRA 1FSZA 3IOMA 5J43A 4V3CA 3VYUB 4FEGA 3CR3C 3L8CA 4MI3A 4ZYUA 2O2ZA 1ZK4A 3LY8A 3ZXXA 3TJRA 1P4AA 2O1EA 3AEUB 1X7YB 3TI9A 4W7SA 2HHLA 4DYDA 4B6EA 4ZOLA 5F21A 4P86A 4P3YA 4EY3A 4KE8A 3LBIA 3L49A 1R0WA 5ESRA 3V4RA 4FZVA 4Z1MA 3U7JA 1OI3A 3HQ4O 2C20A 2G17A 4OTZA 1Z56C 5FTNA 2BFEA 1P5RA 1QZ3A 4YJ3A 4YRDA 3B9BA 5DCLA 4G0UA 3VPFA 4TTTS 1MT3A 5P8WA 2H4WA 2XQGA 2BKVA 2Z4RA 4XSGA 3X2SA 3LU1A 1XUOA 2XQVA 3G1TA 3LL4A 1OFUX 2A1TS 3C1OA 3EIOA 3GY0A 1HL3A 1ZNXA 2XE7A 1CUJA 3MS7A 2GQ0A 3RC7A 1V45E 2ORVA 3AHIA 3EJWA 4MP6A 3RSSA 1G2IA 2HT6A 3INRA 4RVUA 2Z3VA 4E1AA 3NTRA 3ZV6A 2RMKA 3EZ2A 5EE1A 5K9ZA 2EZ9A 3QYAA 1DFIA 1R8QA 2D1SA 4PC7A 5HMLA 2OB1A 2OZVA 2Z8YA 4GOOD 1O4WA 4BFVA 1VHTA 3ECAA 1KRXA 1FBNA 4NMMA 4WHMA 3AMVA 2BOVA 3JWPA 3RIMA 1U1FA 4DV7B 4RK6A 2BLNA 3LQFA 1K6MA 2B34A 2CUTA 3EAGA 1CVRA 4XB1A 1DI0A 3UM9A 1I4WA 1C8BA 4JI3B 4B7UA 4CXMA 2KB0A 4FFBA 4CIDA 5BQ3A 4JA2A 2FCAA 1A9TA 1J6UA 1EEXB 2JHGA 1GDTA 4EUKA 2DVMA 2PO5A 4R1LA 2GT1A 4MS1B 5AYVA 1YDWA 3G8DA 1LK0A 3LJKA 4GX0A 4NESA 3VPXA 4LOHA 1OYOA 1N5DA 3LZDA 5KU7A 3QPVA 3QZUA 4EI2A 4YLEA 4R8MA 2QR3A 4EK9A 5EERA 4Z4CA 3QBTA 1QO0A 2GR9A 1NLYA 1MJNA 5CJPA 1YUNA 1CZOA 5G1NA 4MW5A 5J4KA 1N32B 3STXA 4RPLA 1L3IA 3JASB 1P0PA 3FPCA 1Y3IA 4ENQA 5HSGA 1C0IA 3EE6A 3CRQA 3EYWA 4QU5A 4N5HX 2FMTA 2BFBA 3ER6A 4H4EA 1SHTX 2B2NA 3DVLA 2W6PA 1K27A 2GPYA 3MPOA 2HRRA 3PHIA 2FZEA 1U3WA 3WDSA 1O95D 2GO7A 4NV3A 4LQDA 3TPFA 4RH1A 4BS9A 2EYQA 4TS3A 1ESNA 5LJIA 1NFQA 3LCRA 1KHTA 2B7LA 3OCXA 4FHFA 2F3TA 3UMMA 1T8TA 3IBFA 3TXAA 5CITA 2XDAA 2RK4A 3N70A 3AESA 5JFGA 4Q02A 3L8FA 1BW9A 3O3MB 5D3QA 2LW7A 4ZYYA 3HADA 1DCFA 1Q91A 1V8BA 4JKIA 2QL7A 5GONA 3SX4A 3I34X 3RKRA 2WUVA 4DQVA 4ZVNA 2NUPA 3NCTA 1DC6A 4V0OA 4WGGA 1P0CA 3S68A 2WMNB 5FNZA 1CB0A 1TFUA 1EWVA 1YVDA 2FX2A 1XTBA 1SKUA 2V97A 3MRVA 4HNGA 3F74A 3U7RA 4EO9A 1RBQA 5JVDB 2V96A 3PK0A 2Z58A 3GLHB 3T41A 3Q5DA 4B6PA 1HQYE 4TMFA 4CKCB 1AD2A 3MQ2A 3RAFC 1LXCA 1L5WA 3GGPA 3OC0A 4U3JA 4WOPA 2QG6A 1X1SA 4CI0B 4I19A 1DOHA 3Q6IA 2R7AA 4ZRMA 3RYCA 1AUPA 5M2QA 2Q0QA 4YRIA 3IAM6 1UP4A 4II7A 1PLLA 3QYFA 4M9CA 1SA0B 4BZQA 1DQRA 3CJQA 3HKCA 5BSRA 3IUJA 3VBEA 3PCTA 1UBSB 3VC7A 3WYDA 4RQAA 3ZNNA 4C29A 4E4RA 2I4TA 2Q2QA 3WGHA 2A5YB 3LX5A 3OQNA 1HPLA 2C9OA 3H9QA 2UUPA 5H3LA 1EFVB 5A5VA 3C4VA 1LX7A 5K0EA 1T91A 1ZIYA 1XYVA 2A33A 3G9ZA 4FYMA 1CG6A 1Q22A 3KKKA 3TOSA 2EWVA 1BEEA 1JSCA 1TZJA 1XN1A 4IICA 4M53A 4CLEA 4WBNF 3OX1A 1A77A 1JEYA 1Q6YA 4UAJA 3D8SA 1B16A 2IOQA 2O2XA 5ICSA 1DXOA 4G8BA 3LCVB 1HE3A 3HA2A 1LPNA 4YRGA 1A97A 1NONA 5JI3E 1IPEA 4D4HA 2QAIA 4QATA 4RGQA 5C1OA 6NULA 3VR0A 5BOSB 3ICCA 5J2TA 2VXCA 2G6BA 4RMHA 1T1RA 1C3EA 2PA0A 4JP2A 1R9GA 2HW8A 5FR1A 4F2PA 2Z6QA 2F1RA 1ZCFA 2G5PA 1N7JA 4QU9A 1HDZA 5DBHX 3CKLA 4AG3A 1C7IA 3NAQA 4DRYA 2Q3MA 1RZUA 2VWQA 2OD7A 5JD6A 3L41A 2D74A 2JI7A 1W25A 3X1ZA 4CMCA 1ZKMA 5KYKA 3SYNA 3KFVA 3M1YA 1VIYA 3EVGA 3OQPA 4Q7KA 3PS9A 4LXYA 4HB0A 5CYFA 1M74A 3DEYX 4GKAA 3T5CA 1M5UA 4CEJA 4XVHA 3ZWMA 1M72A 1P8JA 4LQLA 2C2WA 1G8KA 4KKVA 2I1VB 2P9FA 1XDBA 1ZKDA 4U7GA 3ZY3A 4AMUA 2JLXA 3AHHA 4HHEA 2GZMA 2R9VA 4UTVA 1ZEMA 2DTDA 3QLUA 2EZTA 3DMYA 3P0RA 4YCAA 3CRRA 1E18A 5KTRA 1SG6A 1YRLA 1IHYA 4MS3A 4UQPA 1PV1A 1A9ZA 1Z7WA 1SEVA 3ETNA 1MTOA 4MRSA 2NYUA 2NO5A 4BTEA 3L6DA 1QP0A 3M89A 1HLPA 1N5RA 3PXCX 3O47A 1KDZA 3UB3A 3DMHA 1HOXA 3RS8A 1PL8A 4BCBA 4B32A 1E66A 1GTSA 1F51E 2ZJ8A 3DLCA 4CL8A 4KPFC 4R3NA 2C9DA 3OOJA 2WV9A 1U0OC 2C29D 3AI1A 4HQRA 4CM8A 3R8FA 4FD2A 1EXVA 1HA3A 2W0SA 5FBRB 4COOA 2ERXA 2IYRA 4GBJA 3MK31 3WJAA 4DA6A 4JR2A 2QVLA 3E7XA 3CTPA 1E2QA 4PIMA 3FSRA 4P4GA 5C31A 3U48A 4AZ3B 1QTIA 3HBNA 5M5BA 1SGWA 2XWSA 3PFHA 4EA9A 4BKQA 3ZN2A 1J7JA 2G76A 4OFZA 3ZBUA 5C8ZA 2GXQA 2AC7A 2J9XB 1JHYA 4RGBA 5F4BA 4WZAA 5HJ5A 1MAUA 1P3Y1 3I0NA 4KQIA 2YNMC 2W2VA 2W5UA 3HSSA 3SMQA 3P27A 4QGHA 2G1UA 4N41A 2JCXA 3WGZA 3OEWA 2ORWA 3P9PA 4MDYA 5CJJA 1SXJB 4B34A 5IKXA 2WAXA 3QU4A 2JDID 5FI0B 3C41J 2NSHA 1PHPA 5HBRA 1T5BA 3IEVA 5EIOA 1H85A 2ET6A 3EXHA 4EVSA 4NJMB 4K8OA 1B6TA 5COAA 3A2LA 5CURA 3QKRA 1E1CB 1WAMA 3L0PA 3WYCA 4EG3A 1W8DA 5B5SA 3CJRA 4MHTA 3U4GA 4DIFA 5IMBA 4DR2B 4FGJA 4TSKA 5HJEA 1TQDA 3IXMA 1T35A 4JOCA 4MUMA 5LBUA 3VOTA 4KZPA 4UTZA 3E3AA 3AI3A 1C1XB 3IHKA 2PZFA 3HUFA 4KR6A 4R68A 3FTNA 1YE8A 2QRLA 4PO9A 2UZ0A 1GWNA 4IDNA 5KUTA 2VHCA 4IDHA 3B89A 3BN3A 4C0BA 1SCIA 1MB9A 3IGFA 2XKKA 1U9CA 1EK5A 3HBFA 1B6RA 1EUCB 3RRNA 5BSFA 3ROQA 1ISPA 1XRQA 4UPEA 2J4DA 2BHLA 4RE5A 1UBUS 2VDKB 3R6WA 1C7QA 1RJ9A 1VMKA 2YJZA 2AG5A 4YIHA 1U2SA 4KR2A 2R1UA 3NRBA 2PS3A 3GUYA 1L5LA 1PQPA 3AI7A 2ODNA 3PDUA 4Y9TA 5DTMA 4XJVA 5J4LA 2OD9A 3LLVA 3PJFA 4AJIA 1JBKA 3K53A 5CIQA 3TLYA 3GPLA 1UQUA 5AIBA 2XMDA 2RK6A 5FADA 3D6FA 3NR2A 2YW2A 3OCVA 1RVDA 3ZI7A 4N7BA 1OSNA 5TRTA 4C0AC 2QTLA 3RO7A 2CL7X 4Y9SA 4MPJA 2NO4A 3PG5A 4IMIB 5C8YF 4NYMR 3N2IA 2O7SA 1OZGA 2HWYA 3AK4A 3VSCA 3SX2A 5D7NA 3H5LA 1EDBA 1O9HA 1TOAA 4HMQA 3OCUA 3RK0A 3K35A 3ZWQA 4A5OA 4PVCA 4C2BA 1EUYA 5G0SA 3P2EA 1ZICA 2NZUG 1RWOA 5BQPA 5TQ0A 3ZJYA 4F6RB 4GI5A 2GK3A 3A06A 2QX8A 3MG9A 4FZ5A 3O8BA 1DEHA 2V7TA 4YWJA 4RTRA 1CC1S 3DVSX 3BSWA 5GM1A 4WEOA 5CB4B 3IKTA 4K86A 3W5AA 4HY3A 1I0IA 5AJZA 1ONPA 3THRA 2VHJA 2Y1WA 2L82A 3MNFA 3JYNA 1WKVA 4R8VA 3FWNA 1P4GA 3EBOA 3OFKA 4Y2UA 5DM2A 4TKLA 1O8CA 3MT7A 4LN1A 5EKSA 3RSHA 3PICA 1A8HA 4URVR 2XCUA 2Y93A 2JLVA 2UYOA 3QKTA 3RVBA 5ITWA 4D3SA 3V1MA 5EHNA 2EZUA 3ZGLA 2WJYA 1UJ5A 2HLNA 4D9HA 2WWFA 3OP1A 3RW9A 4K87A 1M2GA 5DT9A 2FSFA 3BA1A 1VA4A 2R1VB 4XR4A 1YH3A 2BHTA 3D2BA 4FIZA 4QGAA 5LZ8A 3CKKA 4ZAYA 2I5PO 5HHTA 3VGPA 1KEVA 5JUWA 2R5WA 4G24A 1IRXA 4OU4A 4P4LA 4ZFNA 1OC4A 4MVYA 1RXCA 5TDHA 2R3SA 4RW0A 2H2HA 4CM7A 1C4OA 3QU9A 4FNGA 3T5AA 2I2WA 2LR0A 2V0NA 3K0AB 4X3CA 1YVPA 4N5LA 5EPOA 1PWXA 5IU6A 4RTOA 2GBIA 2CNBA 2BISA 1QGZA 2QMQA 3GZNB 3K4QA 4Z1MD 2GCIA 2QL9A 4R1UA 4XKJA 1IWOA 3S1AA 3N07A 3MTIA 5CJ2A 5LB4A 1IPFA 4R7ZA 1PYOA 2HRQA 2JGFA 2XNJA 5B3KA 1CE8A 4PYQA 4KGVA 4C0LA 1N2ZA 5HTKA 5JECA 3ZHQA 5BWBA 2EBFX 4HRAA 3KP1A 5BUSA 1EDDA 3ZE6A 1D5WA 3B85A 2J08A 4AJ1A 3ORRA 2CNLA 2GCGA 1ZR4A 4DSAA 2XDQB 1SO8A 4DV4B 4ZVSA 4AWXA 3LBAA 1SMKA 1TF2A 2Q6TA 3VYTB 4CUJA 5AKLA 3PIIA 2R4TA 3QVUA 1E3WA 2JGMA 4IJVA 2XXAB 4AVYA 2WTMA 2EIHA 3G2HA 2X9VA 4CIWA 2CNKA 4XB2A 5HOEA 4HWPA 2MMCA 4HWOA 4M1KA 4U5QA 4DWVA 3BK1A 1AMOA 3TBKA 4PWZA 1J0CA 1KQGA 1R64A 3FNRA 3GNLA 3SFVA 3HM2A 3ADDA 2VP3A 4LYDA 4EELA 1SBQA 2XBLA 2FI1A 5IJXA 1P74A 2DHEA 1JMKC 4G26A 2QM7A 5A6SA 2MR5A 1FFXA 4D9IA 1QO0D 4BJ3A 3GPIA 4QUBA 3S81A 3U4HA 2WYHA 4GBED 2R6HA 1Z75A 5JSKA 2Y67A 3O92A 2J4FA 5JXGA 4OXIA 1DQSA 1N0UA 1SOWA 1EZZA 4GXTA 3RNOA 1FFGA 2G25A 3P0HA 3WWDA 4PLHA 2LUOA 3JQBA 3MTJA 4J0JA 1RYFA 2AKEA 1Y4AE 3GELA 4DABA 3SXJA 4D96A 1V11B 1CUSA 3W4IA 4RJLA 3UAVA 2QRQA 4O4JA 1JIUA 5JOQA 3DLAA 1CVLA 3RF7A 1Z2AA 3P2OA 2P27A 4NH0A 4CIBA 1C14A 4AZVA 1YQDA 1NJ6A 1Q1GA 3MWJA 2RCYA 3HG7A 1QPZA 4YRMA 3QWAA 1IUNA 4LI0A 3FLMA 4YUZA 2CJXA 1HTBA 2JJQA 4BGUA 2WSLA 2B78A 1HT2E 1CUYA 4E5KA 4LF7B 1I4LD 2E82A 3DBVO 1NY6A 1SG9A 2Q4EA 4M98A 4RYDA 3U81A 3ZWAA 4Y2SA 4D0RA 4EPTA 4DR1B 5CX1B 3FFWA 5DBIA 4DPKA 2HK9A 5IAOA 2ZAMA 1QCCA 5HE9A 3VU8A 4AM8A 1IBKB 4YP6A 5LOVF 5B53A 4JT4A 2KBFA 2L69A 3DAGA 5JQGA 3WYAA 2C3UA 2X77A 2C9MA 4D5GA 1VI6A 2MINB 3KEOA 1X7XB 3ZOKA 5MHTA 2E55A 2C8KA 1K97A 1S6YA 2VIIA 3C16C 3MJSA 1XB2A 1TMKA 3AF5A 4IG9A 1PS9A 2FW7A 4E32A 3USCS 1PS0A 3RNLA 2Q5IA 3U40A 4A8JA 2WWHA 4F9EA 4TKVA 1OH5A 1MMFB 3B13B 4Y9RA 2CXUA 3G85A 4OQFA 2BFWA 5JV5A 1DDIA 2HJSA 3FYUC 2XUOA 4IDFA 1FSPA 2ZUVA 4F96A 3DBRB 3GMSA 1T5LA 3H1FA 2G9RA 4JOBA 4FNOA 1KS2A 3VYRB 4H7DA 5JCPA 1J2RA 1KETA 4GH5A 4E33A 1ZM3A 5G0VA 4NBTA 1BOOA 1ZUWA 2P6PA 3N7TA 5EE5B 3ZHXA 2OECA 4EFMA 4P38A 4P0QB 3U9SA 4AZSA 4GD3Q 4EG5A 1HMPA 1IZZA 5JRJA 5JWRA 5JE8A 2GF0A 4TYNA 3U7GA 2HNAA 2HEIA 3L8EA 1J2UA 2IXGA 3MCTA 3CVXA 1QV7A 3I8SA 2NUTA 4TRNA 3V8VA 3WLJA 4GMGA 4PLCA 3ZJ4A 4DQXA 4ARUA 2Q99A 1RYBA 3L0YA 5BQFA 3HCNA 4RMNA 3L8DA 4FDTA 1EUDA 1AQNA 3EZGA 1P7PA 3CE6A 4MKFA 2Y9PB 3K9WA 3PHLA 2QRGA 2FWAA 3H5IA 2QTMA 4YCNA 4HUTA 4GVXA 3J80A 3KKQA 4NMWA 1P44A 3AUSA 2UVDA 3M1AA 1E9CA 2B5WA 3CF4A 3KZMA 1Y42X 3GO4A 2FLKA 3V1LA 4B3RB 1E4YA 2WG2A 2R751 3EZ9A 1D03A 1L1QA 2J7KA 2UYHA 1B7GO 4RMIA 3CNBA 4OL9A 3AFIA 4RNDB 3V6MA 4EPWA 4B81A 4XIFA 3JD4A 4BO6A 1U9JA 4HXYA 3FYHA 4XOUA 2VTKA 1CZNA 3PHJA 2FWPA 3VDMA 2PIDA 3B1JA 3FPHA 3G0BA 4XA8A 5IJ0A 5KZMB 4RD1A 3R20A 4H7KA 2ZBGA 4QBKA 4UHFA 2XUGA 2RGXA 2GHRA 3O91A 4WACA 4ZVPA 3UFBA 2DR0A 1JI3A 3G49A 4BKPA 1JRLA 3TL2A 4LF4B 1L4LA 2FLWA 4FFSA 4DEVA 2ATIA 3MLAA 4FCVA 1RYDA 2QTFA 2KHZA 3TM4A 4C5BA 1ESEA 1TK9A 4CTNA 1JH8A 3Q10A 2ZJAA 4OOEA 1KC3A 1KDRA 1L5HB 2D06A 3K6KA 1NF2A 4TKUA 3WBJA 4C87A 4ENUA 1PNRA 4DCSA 4DR4B 2IYZA 3K9QO 4UNSA 2QJTA 3NWPA 5DSZA 5D3MA 3IC5A 2WJZB 3IAUA 3G5TA 3QMVA 4L1KA 5TS3A 2V7WA 3TD6A 4F93B 1W5BA 1L4YA 2F43B 4S2UA 3DYBA 2EG5A 3DE2X 1R6BX 2P6NA 3NNSA 3WB1A 3WDLA 4US0R 2H4XA 1VYUA 2A3NA 2DT5A 4GO1A 3RU3A 5L3VA 2FR8A 3KT0A 5EWMB 3I01M 5FT9A 3JQDA 4BKOA 1N33B 2EWMA 3JWHA 3WOHA 2Y27A 1LLDA 2AI1A 2PMFA 3WRXA 1NHGA 1U7HA 4H4CA 4LZWA 3ZQ6A 1LRKA 1XSEA 1SUIA 3O4JA 4G2TA 3E8XA 1UZUA 4U2CA 5I7EA 1DAKA 4IOJA 3TCNA 3R7SA 4PG4A 3L01A 2E9SA 1N2HA 3GVIA 3LDUA 1P3JA 2WVGA 2PKEA 4HDRA 4M9QA 5IM4F 2NV0A 3NETA 1YDFA 5LQMA 5JATA 3BD9A 3GEIA 1YVEI 1UXIA 3L4BA 1BMDA 1H2XA 3F2IA 4G5GA 1W36D 1X7DA 2VS1A 5KYUA 3OE5A 4P83A 1U3FA 2WIAA 5HS6A 5JBQA 1NW6A 4AKTA 5J4HA 4EHFA 2QR2A 4M1TA 2X3YA 1AMUA 1Z4JA 2O20A 4OEHA 1D2MA 3ADBA 1CJBA 1QF7A 1G60A 3ZS9A 4QWMA 3KYBA 3GH3A 2PG3A 2H1FA 2MYUA 4CNQA 5FA5A 1J49A 1HEUA 2C4WA 2WDZA 4O63O 5SYAA 4D43A 1JLLA 3AHDA 4B3IA 4PTYA 1ATIA 3QSYA 4YRCA 5ICFA 2XUIA 1IHOA 3BMCA 4M1OA 2E5LB 3A6ZA 3CLUC 4CF5A 2DBZA 3RQSA 1R5JA 1MX1A 2FZVA 1EX1A 1PCXA 4GBMA 5EP3A 2WSBA 3LF1A 4DDKA 1ZVVA 3EUEA 5FUQA 4U2DA 3LNCA 4V38A 4OHPA 4QQ8A 3TTVA 2GEDA 3BD7A 3K0EA 3D02A 3RBZA 1T8SA 2P4SA 1L5QA 4RPIA 2B30A 4C5CA 4ZI7B 3BMNB 1BHSA 2IHTA 4NBUA 1XRNA 1CV2A 1R9MA 2JFOA 4KI0A 4PLPA 3UK7A 4HR7A 5GJWC 1GA6A 2VDWB 4CR6A 4AFNA 1JTVA 4BMPB 3W3AH 1BKYA 2AMJA 1NXSA 3FDJA 2ZJ1A 3PVCA 4KB5A 4ER7A 3NJ4A 3AZQA 2P5SA 2VNKA 5KSWB 3NB0A 3ICQB 4UFPA 4YAWA 4ZYLA 2PXXA 5HRUA 2MR6A 4GPD1 1SIWA 4NJEA 1IXZA 1I1NA 4M86A 3ONWA 1GJRA 4Z0PA 4Z2AA 3M4YA 1G5IA 4AG5A 4W5NA 4U7HA 1Q0ZA 3IJPA 4KXXA 3JR7A 3F3KA 3I53A 3NHAA 1CYEA 4K9LA 1CTQA 4G5RA 1AXEA 1XDUA 2CZGA 1K8XB 1KR2A 3WLKX 2JFFA 4AZ0A 4CHGA 4MR8A 1S96A 3L0ZA 3LT4A 4DLUA 4NQRA 3UMVA 5IK2A 1SIBE 4UZFA 4GLBA 2E5FA 4PHCA 4X85A 5MN5A 1FJXA 4R01A 4YJFB 1ECJA 2VWPA 4DN6A 2VNIA 4HVTA 3P97A 5C0OE 5ADUS 1Z5GA 1M1NA 2XA9A 3H9UA 4NMHA 2HHJA 3R74A 4WZBB 4KHZA 2R8YA 4F60A 2NU8A 4RKFA 1NVKA 2BKEA 3DEHA 3ZU3A 2QPOA 4JJZA 4OMDA 3BT7A 5IKMA 4KLAA 3LF2A 2GYVA 3K5PA 5ADWA 1NXPA 4YRSA 2HJHA 2QJFA 3Q6NA 4OHMA 3PFFA 4K9SA 3AUYA 3BGVA 1QV9A 4M3NA 4INJA 1QOQB 2ETXA 2P5YA 3IS3A 1DKNA 1QVZA 4KIFA 2FA9A 3CZMA 1N2CE 3C6KA 1QTNA 2QOEA 2HFKA 2V6FA 4MX8A 5D2CA 1G1MA 1NJ2A 3RYIA 1O5OA 2O0KA 3TOXA 3W5UA 1QS0B 3IURA 4BVEA 3DD5A 3WNZA 2CXPA 3CLKA 4HRYA 4Q7QA 3I9FA 4IIGA 1NTOA 5CNIA 3TRKA 4EF4A 1Z7YA 4UDXX 2I03A 1UXKA 4FEAA 1TZ2A 4K1XA 4JQCA 1W4AA 1GPBA 2ZWVA 3F8SA 1ISGA 1CR1A 2XXJA 3AILA 4M8LA 5AHRA 2PRKA 2P8SA 3RS4A 3ROFA 1Y8ZA 4C76A 1Z4IA 1QQAA 5DZSA 3EC1A 3ZD6A 2FKNA 1HSOA 3DW1X 1TJ5A 3TKAA 1JLKA 4GQIA 4TOIA 4F1JA 2Q07A 1GFWA 2Y1FA 3BGIA 1O0SA 5EQFA 4YXWA 3L4EA 4AUNA 4HDMB 1F8UA 4PNHA 5T41A 5C1DA 4A92A 5KSOA 2EGHA 2IYSA 4Q3KA 4C2TA 1ZN9A 1P9NA 2JC3A 2NAFA 1IDN1 1ORHA 5J59A 4AURA 4HAZA 2HN9A 1IHDA 4FHZA 1UH5A 3C87A 1UIRA 1QMGA 3KKEA 1SOMA 1SVOA 4TXNA 4L4ZA 1E6MA 5EIXA 3ZEIA 2ADFA 1SBZA 1I3MA 4A0FA 3PTLA 3HL0A 3L0SA 5ALSA 5E6SA 1QXSA 2Q2NA 1ML4A 4G81A 4I5EA 3SAJA 2CDAA 2NTNA 3R5XA 3BE4A 3RVRA 2HX1A 3HB7A 2FWMX 3RCBA 1PT8A 5DV9A 1JMYA 2F9FA 4Q12A 4HLCA 1Z2DA 4D9EA 4GRIA 1UPAA 2QNRA 4LJ5A 4NNOA 3NBAA 5L45A 2JEYA 5SY4A 4M0LA 4D0LB 3JQGB 3SN6A 2ZS7A 1Z0FA 5NLLA 2DSNA 1JQKA 2YHIB 2FRVA 1PJQA 2NVUA 5DTJA 5LCXA 4INOA 3BIWA 2WF9A 3UW1A 2HA4A 1OVMA 4J7CA 4M1EA 5DO9A 1DV2A 3SXUB 3TAUA 2BTOA 1SKMA 2BEWB 3P0FA 4PR0A 3PDJA 1XDSA 2GNPA 1HZZC 3HUUA 2N47A 1P73A 3IUYA 4BMSA 4BP9A 2Z2YA 1AQUA 4XQ0A 4OK3A 2XGSA 2QTGA 4CCAA 1TCVA 1L6RA 1XZKA 4OG2A 3OLXA 2YZ2A 5A5FA 3GVXA 2JLWA 1VTKA 2LKDA 2W4IA 3L1HA 4K28A 4R54A 1F2VA 1P61B 3WDKA 1GTRA 1BCRA 4RPJA 3W78A 1FTWA 3GJQA 3AV0B 3SE7A 4E0BA 2YYAA 4E2FA 2FEWB 2J8ZA 3DBHA 4EMTA 3HYRA 2FSUA 4EQ6A 1MXHA 4N3AA 3N28A 1IBCA 4H0CA 4M9RA 5HG0A 4ARAA 4JEIA 1NX9A 3C8UA 3M6MD 2Q21A 1UKBA 5A03A 1Z29A 3VNVA 4FXPA 3OG9A 2QP4A 3OM9A 5DYGA 2AF3C 2Q1XA 1E1RA 3THWB 2BFDB 4JB8A 1GUAA 1EM6A 1PFYA 2ROQA 4JLNA 1TT5A 3QTLA 4L0MA 4QEZA 5HDQA 2ZKIA 3KOMA 5E8JA 4H1TA 1CQZA 4D5EA 3QBEA 1OAOC 3PYLA 3ISVA 4NCXA 4INZA 5DTRA 2AB0A 4KJZA 4KR9A 4GUDA 4DBZA 1FUEA 5AKIA 4MW4A 3PUVA 4MINA 3RU2A 3WHIA 1ZH4A 4B85A 5JY6A 1LF0A 3TX6A 4BX9A 1FVFA 2N3ZA 4RV9A 1NG9A 2Q50A 2X0NA 2I34A 3FHCB 2PYZA 1J70A 5EINA 2G1KA 2PQMA 1KU0A 2COUA 2J3JA 2UYQA 3WKEA 4FQ7A 3DT8A 2QK4A 2D2XA 1CF2O 2IUUA 5CA1B 4AF7A 1VLMA 1EQAA 3EVNA 4HL6A 3UMJA 1ECPA 1UC4B 3QPBA 1P4JA 2ZR7A 3NBKA 5I4IA 3RAEC 4IIHA 4ZAGA 4V39A 1K88A 3JZAA 4KVZA 5A02A 2YV2A 5FB3A 3IE0A 4F11A 3CNQS 4OL0A 1ZN2A 2ZU6A 4G37A 2LP4Y 4FGLA 4UW9A 5BP7A 3IPCA 3U56A 3EEOA 3M6XA 3BEOA 3ORSA 3IV9A 4P7FA 3T52A 4EHBA 4PSDA 1KI8A 3QLVA 2XKJE 3WLHA 5LKRA 1YI0A 2PNFA 4J49A 1Z37A 5FPHA 1RRVA 3CVOA 3IERA 4LYFA 1V71A 5KNCA 2I7XA 3C74A 4OI2A 1UWCA 4F3RA 4G0OA 1TDJA 3WGIA 5JZBA 4OM8A 4RPHA 3JQ8A 2FPLA 5FBWB 3PR3A 4E21A 1MRZA 3NM5A 3TLGA 3M5WA 2UAGA 1WW2A 2IYUA 4GI2A 3G0IA 3NDRA 4HDCA 1R3UA 3KYCA 1JHMA 3TMKA 4NOMA 3UT0A 3VZQA 4TV8F 3MVEA 4QPJC 4CT0A 2GM3A 4ZOBA 3CLRC 2ETVA 3K73O 3R44A 4TSFA 5H4HA 2W70A 2CCKA 6AT1A 2WE8A 4O8ZA 1YCGA 1A88A 1ZMBA 5C53B 2QM0A 1J97A 2F62A 1MGOA 2ODQA 3CGWA 1CEXA 1LWOA 1BYIA 1IC6A 3B78A 1KKUA 3P71T 2GAAA 4H60A 4W5HA 4WX2B 3JQRA 2P5TB 5DLEA 2HT1A 4B2PA 3QUTA 1KMCA 1GQSA 4A73A 2RH5A 3MTGA 4BCDA 2QMEA 3GGJA 1HDRA 1ZFNA 3C5VA 4MPTA 1QFJA 3ZE0B 4JQZA 4XFDA 3V42A 1YHZA 2A67A 2CYCA 2P7IA 4UQOA 4DDUA 3B53X 4P3NA 3TXYA 1F6DA 4JA0A 4CNBA 1XZHA 1UDBA 1SBHA 1WTAA 1JU3A 1KAGA 1THTA 3OPMA 3U61B 4QHYA 2GCPA 3GEGA 3WBFA 4JUCA 1HNXB 2C4NA 2I1WA 3E9DA 3KT8A 2BGMA 1GYPA 5EFOA 4XM2A 5F5XA 2H17A 1XA4A 2CNDA 1E3TA 3DCJA 1I6KA 4ZVOA 3BE6A 1KZHA 3KIPA 3PWTA 4PYJA 5AVVA 4ZA2A 1YUMA 1VSQA 3KTDA 1BGWA 3EHEA 1K6JA 3FDZB 1N6OA 4HH0A 2BP7A 2DECA 5FCDA 4R9RA 4U39A 1H5QA 3QE4A 2QRMA 3PVSA 4FYHA 3ETGA 4OFXA 3TD9A 1GR0A 1IQUA 2GEFA 4ABTA 5GV7A 1OASA 4J0GA 3DPIA 2GAOA 1K0FA 1ZOSA 1LBQA 2NZXA 2C9ZA 2WIDA 3N5CA 5ENVA 3WNQA 3ZK7A 1FFHA 2AOTA 2R1TA 5GV8A 4YV2A 5KVCA 4AECA 3DE7X 4J2OA 4AJKA 2Z3WA 4HP8A 3PEEA 3LCCA 3FMPB 1YR2A 5JC1A 1BQEA 5F7ZA 3UAXA 1Z8NA 3AR7A 3WAGA 3UC5A 4IFBA 1CUXA 2XI4A 2PS1A 1MGPA 1QMPA 4OLHA 3UMRA 1GD1O 3CLVA 1Z34A 1OV4A 3BOSA 3WS7A 1U2EA 4MV0A 4EOGA 1I2ZA 2QA5A 3ZE9A 1PR3A 1H6CA 1MA3A 1C1DA 2HIGA 3KETA 2XZOA 3S40A 3PE3A 1EJ6A 3IT0A 3IDQA 1DG3A 1MIOA 1M0SA 3QEOA 2PUFA 3FB4A 1NPTO 3K0CA 2C3MA 1CJCA 3QEMB 1HGXA 4DJAA 4YYZA 1XMQB 4TL9A 3NDBB 3RK1A 3UO8B 2L2QA 3D4BA 4EKDA 3DTVA 5HIKA 2QD1A 2UUAB 2EX1A 1XIVA 1ZP6A 5YASA 1BH2A 1I2CA 3NGMA 4H3KB 4MKXA 2CY0A 4L51A 2VF2A 1NOJA 1SCAA 1DO0A 2HF9A 3CWQA 1G38A 1TEXA 2EFEB 4ZU6X 1S8FA 1GUDA 1UMCA 3WAJA 1JHXA 5AVRA 4IDDA 5TF0A 4H1WA 3E84A 2YWEA 1ZGJA 3AB7A 4JC4A 1W1UA 4D1YA 3K0KA 2PQ6A 3V7UA 4MPDA 1IY9A 1RWXA 4RL6A 3EXIA 4TZ6A 2AMLA 4IFIA 2ZUBA 3M2PA 1NN1A 2M98A 3RSZA 4X95A 2Y0BA 3LRXA 2OV6A 5BMVA 2PSHA 3ND5A 3RWMB 1U0NA 1XK7A 5BV2P 2WE7A 1DFHA 1M2OA 4A8HA 3A3NA 3EIUA 3H87A 1R8SA 3NFRA 1XXLA 3QLJA 3Q9SA 3D2AA 3QXSA 4MVJM 3STVA 3OX3A 3SVZA 3V8BA 4ZCIA 5BW8A 4AY2A 2CV0A 1HFKA 1Z15A 5CNJA 1HFWA 3DNMA 5BR7A 1AK9A 4JYZA 3V8EA 1JG2A 4II2A 1JE0A 3DLBA 5IK2D 1OT3A 4YQYA 5KTYA 3L40A 1BX0A 1R4AA 4WZ6A 4ZTZB 4NI5A 1DB3A 1D4ZA 4KXQA 4D82A 1DBVO 1KQPA 3CIFA 5FP0A 1QGUA 2WJGA 3G8YA 5A0VA 4K9QA 1T8YA 4X7BA 3O2NA 4MEAA 5A4KA 2H5JA 1AZWA 4RD6A 4ND7A 4DCVA 3IL2A 4DV2B 1HR0B 1UEIA 3Q3CA 4A10A 4C7KA 5C8VA 1VYTA 2RAUA 3PA8A 4BGEA 1YA6A 1AZTA 1Z4OA 2HQRA 1GRNA 2P7HA 1EAYA 3JALA 3B3JA 3TQFA 4A36A 2HH9A 4A7PA 2B5OA 3H83A 3TOVA 1RMYA 3IAXA 2WDPA 4Q0MA 4P92A 1Z06A 3KE9A 4DJJA 5EP2A 5TXGA 4ARBA 3PEFA 2ZVJA 5JU6A 3E05A 4EUEA 2W2TA 4OBBA 3RJ9A 4P2GA 4H7JA 5DGIA 5FA6A 2COKA 4DWWA 5K0SA 4QVIA 1NRWA 4KLRA 2VBIA 4N3BA 4DNOA 1T2DA 1RAGA 2Q3FA 1NE7A 3ABZA 1BFKA 1HORA 2CF6A 4MQBA 4RAQA 4QAJA 2A84A 1SVUA 5GTDA 3OSUA 3L7MA 2NX2A 2ZYGA 1V9CA 3AQIA 4KNWA 2BRUC 2WIKA 1M75A 2GCOA 4FOLA 2B3TA 4C3VA 5DHSA 1UODA 1OIXA 1LBHA 1KY4A 2A9VA 4GF5A 4REQB 1OXBB 2WC1A 1IMJA 3E23A 5F3RA 1AXRA 2ZB4A 3BRWA 4O2AF 4X3OA 2IS4A 1Q2UA 4MWBA 4PCUA 3GEBA 2ZBVA 1NVVQ 4G63A 3Q8LA 3W6ZA 2I2CA 5B36A 1Z4KA 2G63A 1X1TA 1XMXA 4JYBA 3NYRA 1JIIA 2ICAA 2GETA 2R6CA 1PW7A 4OM7A 4WOJA 5EXPA 1VKOA 5MN4A 4TVKA 4IRMA 4NFSA 4DA0A 2DKNA 2V4UA 2DERA 3ZUPA 1PW5A 5ESXA 1XX6A 3AZOA 2FK7A 1DXHA 3AUXA 2HDHA 4OHWA 3EOAI 2XMQA 1WZ2A 2QXUA 2J9RA 4J4BA 3QJYA 5ICCA 2GLUA 2AOUA 1KKLA 3D1LA 1YJAA 3E9ZA 3KXIA 2H1HA 3IH5A 1LQUA 1YB7A 2GZDA 3TSYA 1DKLA 1S5PA 3PR1A 1UKVY 2MSDB 3F7OA 1O7JA 2BFFA 1RHRA 4KIWA 3SSAA 4DDVA 1NXVA 3M70A 3GP8A 2AOVA 2PJRA 1UPTA 4HH1A 4X3PA 5T8KC 1I1OA 4Q3NA 5F52A 3SIPA 2MCFA 1N5MA 3OE4A 1E2UA 4JUFA 2FQQA 3TBHA 4DPLA 5CEEA 3BYZA 1L7RA 4IGKA 4JLWA 1TYAE 2PTHA 3KYDB 4NONA 4RF3A 3REQA 1GPYA 2AHRA 4BMYA 4DEYA 3V1UA 1A4RA 3NOQA 4RTPA 4O02B 3K09A 2PIAA 2AZTA 2RHDA 2GARA 3R77A 1R8YA 1BX3A 4PPGA 2UVPB 3W77A 3WSWA 4JBYA 1DJLA 4P82A 2CLIB 1XZBA 3RGGA 4AX8A 1TEVA 2SNIE 1XRLA 3H2SA 3OTIA 3FPKA 2J0UA 5A3RA 2PFKA 4RETA 4UM7A 3OM1A 2B8NA 4XGKA 5HW0A 1CPYA 2HV8A 1CFJA 2PX8A 1FFYA 3LZCA 3KSDO 8OHMA 4RY9A 4A5SA 3LIPA 4QDXA 2FN4A 2OORC 3BJMA 3NHZA 2YYSA 1U98A 1RBMA 3KS9A 1QR6A 4FJ0A 1S4MA 1QCYA 1M1UA 1U9IC 2YWFA 3I5AA 2YS6A 4QBTA 4TQUS 3ZE8A 4JELA 4ANFA 4D9MA 4I5DA 2XIJA 3J7TA 1OFGA 1SZJG 2AN1A 2VPZA 3M9WA 3FPLA 1WQ4A 2X2OA 1C2YA 3MMSA 4LDRA 1X1RA 4WY2A 3DMNA 1ZXLA 1GUBA 1XEFA 3KG2A 4HX2A 2ZIGA 1MAVA 4YDRA 5EJFA 3HWX1 3VYWA 3LPDA 1CIPA 2EEZA 1XD9A 1C9DB 4GX1A 4RF5A 4BIMA 5A3SA 4TTSA 1X9HA 2JASA 1E1RD 4L3OA 5JFTA 2FUG6 3ESAA 1I30A 5BSWA 3R7LA 2FFRA 1R18A 2VHXA 1OA0A 3U6KA 1H2BA 4JZYA 5ITSA 3BHIA 3D9QX 2EU8A 2GN9A 4WBXC 4PLFA 2VRBA 2XKBA 4V2IA 1WZEA 2J5RA 3HCRA 4H16A 3VYSB 5B7QA 1OU4A 1HT3A 5LZ7A 4BNDA 1ZY2A 5ALTA 3LPMA 4XYEA 4YJHA 2QDXA 2YIVX 4MKZA 1Q0RA 5BY2A 5IBCA 4FVTA 4BVLA 4UM9D 2O8FB 5FO1A 3NVKI 1AS0A 1Z7EA 3IT3A 2RHWA 4FFVA 5IAGA 3NBFA 1BNCA 3LY7A 2V1UA 4MDFA 3W05A 1XJCA 5KWVA 3ND6A 4X00A 4ZT3A 5DPMA 5AVKA 3FZEA 1V5IA 1NUTA 2ZDQA 1NVTA 3EDYA 3GB9A 3UXYA 5LKAA 4KLCA 5D00A 4F85A 2RHRA 3G5AA 2AI2A 4RVGA 3MCZA 4HYEA 1LSJA 2XWBF 3TIXB 4BZWA 5KNCD 4KVAA 5EYPB 1UXOA 2MSLA 5T6MA 1N2XA 1REQA 2GUWA 3NHMA 3A9RA 1EE1A 2AN9A 3FYUB 2H5EA 4PS0A 2D2FA 3H1AA 4MROA 2OENG 1XZLA 3H2BA 3O8QA 3T1QA 4DCJA 5ABPA 5KWSA 3IMCA 1T5IA 4HNRA 5BN4A 2IEYA 2Z9DA 3SQMA 5HMMA 3DXXA 4UOQA 1WZNA 2RH9B 1Y4SA 2ZCUA 1JJFA 3NXKA 1UQTA 4F92B 4BNHA 4URZR 1GAWA 2XNDA 3ZV5A 1QC5B 3C7TA 3FPBA 4KXNA 3OJEA 4TSFD 3OZRA 2YV4A 1L1FA 1PR0A 1HKUA 2REQB 5JH7B 2PBLA 1NDHA 3EVTA 5I4KA 1DFGA 1P5ZB 1WABA 1OV6A 1XELA 4LOJA 4RQUA 5JYDA 4JVOA 5HTOA 3ZWWA 4Q6BA 3ZD8A 5IXYA 3ZDFA 2BFCB 5JAPA 4EDHA 4RVHA 1UBCA 4DUPA 1BXZA 1N8NA 1T10A 2FRDC 3A1EA 3A9SA 3DMDA 3JW8A 2G5CA 2CB9A 4LMPA 3TD2A 2P77A 2XT0A 3QYPA 4MS4B 1UXHA 1Z6XA 3HU2A 4BXOB 1P4RA 2F9MA 1QANA 3RH0A 4DLRA 1EFTA 3W0LB 3KSAC 5TPWB 2D1QA 1PN3A 4EHIA 5TX7A 2QSJA 1B0PA 1DIRA 2DBYA 3QQ5A 1NMZA 1UPFA 4O4HF 4UCQA 3KPYA 2CXSA 4TLBA 5J4YA 1XA0A 4MRPA 4ZCRA 1IXSB 1CKEA 4ZKDA 1EWKA 4MCJA 3Q3EA 1JQDA 2J5BA 5LM3A 2F1JA 4B84A 2IOHA 4TLCA 3SKVA 3K71B 2Q8QA 1FP6A 1RYZA 3FTQA 3PDHA 2VJMA 4FBLA 1Y3FE 3GLIA 1VL5A 1S2MA 1ZIOA 2I4RA 3AR4A 4DDWA 5F35A 2JIBA 3SHTA 4ZHQB 2VAMA 1IQ0A 3OFSA 4KV7A 5DN6A 2KBEA 1DRKA 4I55B 2H0QA 1OZHA 3C3KA 4B6QA 1ISJA 2QLLA 1CLEA 1XFAA 2EP5A 1OTHA 4RGYA 3M82A 3NYWA 3IO3A 1FNSA 2ZWAA 3GJZA 2H2AA 2XUJA 4E3WA 4KQ2A 1T2EA 4DCOA 1ADGA 2ZATA 1O1YA 3ESYA 1M0EA 4Y0AA 2A5FA 3LDGA 2XTMA 2Y4NA 3NYIA 3P0IA 4KN5A 2JHFA 2X1HA 4G84A 4KW7A 1JSXA 1L9KA 2FOXA 1I6LA 3LBHA 1KIMA 2JD1A 2OK8A 2QVCA 1Z38A 2DY1A 2QU8A 2Y4OA 5FTWA 2EHJA 3ZHYA 1SBTA 4CGZA 1W8IA 2AOXA 1RAEA 4OMFG 5CAEB 1QYCA 3NTUA 4BGIA 4FTWA 3AVXA 4KQGA 5EWJA 4OX9B 1RMTA 3BICA 3QUAA 5L3QA 2ZTMA 1V1MA 2D8AA 2YYZA 5C7YA 1NW7A 5JAMA 1WPGA 2IX9A 5ALNA 3EXG2 3AM3A 5KSPA 4FDMA 5KQRA 2C7OA 3VZPA 1I36A 2OFWA 4MUBA 5A3QA 5GVRA 3ILXA 1AHHA 3NHLA 1GYQA 1YR1A 1Q7GA 2YBEA 3FPFA 4IHJF 2OL4A 3ZWVA 2X7JA 3HN6A 4UEKA 3GLIE 3ZGNA 3ZW9A 2PEZA 4UDNA 1J24A 1KAQA 3KDSE 3O83A 2AEFA 4J2TA 3BSYA 3OUZA 1JP7A 2Z08A 3DTVD 4BZPA 2OV3A 3QUQA 5A1TA 3OIDA 5IN5A 1V16B 4LRWA 3BL8A 3PFWO 1KAOA 3S2GA 5COQA 4M1QA 1KQNA 3U44A 2QMUA 1ACJA 5A1JA 3E3NA 3VR5A 2B37A 2J6BA 5LQRA 4I6EA 4LBZA 4P7KA 4TRMA 5CCDA 2FR0A 2IY9A 2FZ5A 4TL6A 1J1UA 1RXEA 2P9BA 6PFKA 2GPTA 2JHAA 2G6TA 3D7LA 4A03A 3PUIA 3RREA 1ETUA 2GILA 3B70A 4WGFA 4A1OA 4EO4A 1U0TA 2GERA 1GPKA 3A7EA 3QVKA 1XI2A 4G1MB 2KQUA 1O0CA 2H0RA 1JIXA 5DULA 3WLFA 4EEXA 1VLQA 4JIGA 4WCDA 1CVIA 1BXKA 4DGSA 1F7UA 3CYFA 5CFRA 2NZJA 4BX3A 3V6LA 5D6NA 2C1XA 1E2HA 1T29A 2R25B 3AVQA 1QG2A 4J2HA 2XUHA 1FFDA 3EULA 2ZRDA 1UBTS 1NXXA 2FSVC 2GXSA 3D0RA 5CYOA 1UAAA 3L2OB 1T25A 3PGLA 3VSAA 2ZK7A 1AHNA 4QZVA 2RGRA 1CQXA 1X1CA 2J9YB 3EPPA 4ZC1A 2YMPA 3HBJA 1FMTA 4MH0R 4Q7EA 2IXEA 3DFIA 2AOWA 2WT9A 3GW8A 1OU0A 3V7FA 2RAPA 2JKYA 1RWVA 3LY5A 1KO7A 3TH5A 5KS2A 3FCOA 4JC0A 4QPZA 3BJIC 4QNMA 1OWNA 4Z4EA 4LTDA 4CEHA 4QU0A 4UD2A 1JQEA 4JT2A 3GEHA 4RSRA 3ZNPA 2OV8A 2ZZNA 1Z3CA 3FDIA 5DM1A 3D4NA 1CRWG 2DFLA 2WYIA 1FP1D 1OJ7A 4UM5A 4X62B 2JJ2A 3ROXA 3ZY4A 2G7ZA 2QYTA 5C8YA 5KNDH 2UXBB 1G20A 3X0DA 1EHYA 1X7ZA 1NZDA 1Y1LA 3OJ0A 2VT3A 3VH3A 5FTMA 5DNYB 4LVCA 4QOGA 3WP0A 4D4LA 2RHLA 3OD1A 3C85A 3V7YA 2E21A 5G02A 4N82A 5LZ2A 1RPAA 2LE0A 4QA9A 3VJMA 3OHSX 1IEWA 4YAJA 3V4SA 3VISA 1R4NB 1NW9B 4Z7QB 5E4YA 2X0JA 4Y0NA 3PD0A 5C32A 1RPTA 4U7WA 4LDPA 3RVOA 4OP3A 4ZVUA 2H2FA 3UMFA 2RCNA 1ZSNA 2RJNA 4Q16A 3N8KA 3TSOA 1GL9B 2C92A 1CUWA 1XU7A 2TMGA 1NP7A 5L7YA