3HEMA

Structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
291
structure length
291
Chain Sequence
b'QLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETCDIYMHYLRGCSDLFRDKYTDVCQFTLVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclopropane-fatty-acyl-phospholipid synthase 2
publication title Structure of Mycobacterium tuberculosis Mycolic Acid Cyclopropane Synthase CmaA2 in Complex with Dioctylamine
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 115
structure length 291
sequence length 291
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2009-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hemA00
3A25A 1N2XA 3LHDA 3FPHA 3IYLW 1RI2A 3NWBA 1DL5A 3LDFA 3R24A 4YUZA 3HA7A 3FTEA 3CVOA 3P8ZA 3U81A 3HCBA 1F38A 2KW5A 3R6TA 4JXJA 5GOZA 3G88A 3UFBA 5LSAA 1D2CA 4R6XA 5K0FA 2O07A 5DSTA 5C1IA 3T7SA 4MWZA 5EZSA 3ME5A 2PT9A 3M6WA 3LKDA 5ICCA 5LQUA 5EEHA 3B5IA 3UA4A 4C08A 5C9ZA 1R00A 2YXLA 2BR4A 3BKXA 3G5TA 2R6ZA 2VDVE 3DULA 3NTVA 4X60A 1VP9A 3ORHA 3CGGA 5T6BA 3RODA 3SM3A 4YUYA 1Y8CA 3K0BA 4HTFB 1WG8A 3P71T 5DM1A 2PX2A 3G8BA 4UOEA 5F2KA 3TLJA 3PX3A 4PYKA 4IKPA 4XUEA 2ZBPA 5K0LA 3MCZA 3TM5A 1NV9A 3TFWA 5KQRA 1KPGA 3P9KA 5EQJB 1G60A 2GB4A 2ZWAA 3BUSA 3HCAA 4GBED 3JWJA 5FQNA 1MHTA 4E31A 1L3CA 1INLA 2WA1A 4C06A 5DX8A 1IXKA 1JG3A 1SQGA 1BKYA 1WXWA 3KPYA 3M4XA 2ONYA 1I4WA 3KPVA 3KR2A 4PGHA 2QRVB 2AN5A 2P7HA 3OU6A 5LQRA 4XUCA 1G8SA 4AX8A 4YMGA 1QANA 5K01A 2JHPA 4KRGA 2XVMA 4E30A 8MHTA 5CVUA 9MHTA 3UJAA 1NW6A 1NKVA 5EEGA 5IKMA 3HTXA 5CVVA 3OE4A 3GXOA 2GA9A 3A27A 4MTLA 5ICEA 5ERGB 2OO3A 4A6DA 2Z6QA 4RTNA 3UJCA 4GQBA 5DWQA 3Q7EA 3SR4A 3PTAA 5K8VA 4Y30A 3KHKA 4PGGA 2NP7A 3LBFA 3HP7A 4ISCA 5DRYA 3RIEA 5LQCA 1JQEA 2VZ9A 10MHA 3M70A 3PVCA 4CKBA 4F86A 1EAMA 2BZGA 2IIPA 2OKCA 2LD4A 1EQAA 1KYZA 1R8YA 3P9NA 4LWPA 2BM9A 3P2IA 4GEKA 4O29A 4P7FA 4PONA 1NW3A 4FR0A 1TPYA 2Q41A 2GLUA 2P41A 1P39A 4DA4A 5E9WA 5EZQA 3S68A 5GINE 3BWMA 2AS0A 4XUDA 3KQYA 2JHCA 2AZTA 3EVZA 5GM2A 5MHTA 2AOUB 2I7CA 3GU3A 5FWAA 1SUSA 3V97A 4YUXA 1RJGA 4C03A 4ER6A 4R05A 2NXCA 2ZW9A 4RTMA 4GOOD 1VIDA 2G8NA 1BC5A 3DP7A 4FGZA 1I9GA 2ZIGA 5KS2A 1NBIA 3KKZA 2P3LA 1AQJA 4HTFA 4QPPA 1ZKDA 2PV0A 4RYLA 4QTTB 5CCXA 2XVAA 5F2NA 4OBWA 2ONZA 2P3OA 4DQ0A 2NXEA 4FP9A 3BWBA 4PYIA 3HA3A 5KYGA 5D1HA 1ZQ9A 2VP3A 2C7OA 4RX1A 4AZVA 2WA2A 3SSNA 5F2OA 5E2AA 4X63A 3VYWA 1SQFA 5LQNA 5HIJA 2I62A 2YXEA 4GC5A 1FJXA 2FYTA 2AOWA 3HVKA 3LBYA 3OPNA 3OZSA 3G2MA 5T67A 4RTJA 3D2LA 3B7PA 1WZNA 2G1PA 4GOLD 2QRVA 3AXTA 2PGXA 3GRUA 2AN4A 4FT2A 3GO4A 4R6WA 2HR1A 3DH0A 4OQEA 3KR1A 4KDCA 3CJQA 3KR9A 1L1EA 3M6UA 4L7VA 4K6MA 3KPWA 4LWOA 1G38A 4OA5A 5G02A 3IHTA 3CCFA 4E70A 2AN3A 3MCTA 4PIPA 4MHTA 1UIRA 2CKDA 3EVFA 3E7PA 1DCTA 5E8RA 3EVEA 4HGYA 5EPEA 5FHQA 4KWCA 4QQNA 1RJDA 2P40A 3LX6A 4BP3A 5K0GA 5HIIA 4XCXA 2QM3A 4BP1A 2O06A 1X1CA 4E2XA 3I58A 4AZWA 1P91A 3R0QA 3C3PA 3C6KA 1RJFA 2P7IA 2FHPA 2XYVA 3FUXA 3G89A 2C7QA 3EGIA 3BT7A 2K4MA 3G2QA 3UJ6A 5CIYA 3ER8A 3GCZA 3R3HA 2EG5A 3B3GA 4ER5A 5E1DA 5HIMA 4DM3A 4ATNA 4YV0A 3MAGA 3LDGA 3DXYA 4R8SA 3MTIA 3GJYA 4KVZA 4RWZA 3X0DA 2AOUA 3SSOA 1XDZA 5EMMA 5EC8A 3Q87B 2HNKA 2B3TA 2GS9A 3E05A 5DX0A 3KU1A 2ZCJA 4RVGA 3SMQA 2BM8A 2UYQA 3EMBA 5DTRA 2EFJA 3SVZA 3A7EA 4OA8A 2YTZA 3ER9A 3DMGA 3HA5A 1R18A 1HNNA 1AV6A 1O9HA 2FRXA 3HEMA 5EIWA 4DZRA 4EMSA 4EQZA 2VDWA 3B89A 2UYOA 3CJRA 4U7TB 2ZIEA 2IH5A 3H2BA 5FHRA 3SSMA 5DTMA 3QOWA 4HC4A 3KQSA 5K0BA 2PY6A 3K6RA 3UBTA 1L3IA 2O57A 2PX5A 1NW5A 3NW9A 3FYDA 4FS8A 3P2KA 5E1OA 2YXDA 3QV2A 5GWXA 3TMAA 2JHAA 2PXAA 1N7IA 1R74A 3BWCA 1OR8A 3I64A 4DKJA 4EKGA 2IP2A 3LCCA 3AY0A 1F3LA 5K0JA 5KQSA 4CXMA 3TOSA 2VS1A 3LPMA 5DPMA 4GUAA 1XDUA 1VQ1A 3PT9A 1JG2A 3NWEA 3VSEA 3FTFA 3HNRA 2XYQA 3OZTA 3UJ9A 3THRA 3LGAA 4GC9A 3NDJA 4X41A 5LQAA 1X1AA 1AF7A 4RTQA 2XYRA 2OB1A 2IDKA 1MJFA 5EIFA 2V74B 5DRTA 1AQIA 4KDRA 2PX4A 3HVHA 5FADA 2AVNA 1VL5A 5ICFA 1H1DA 3EVBA 4E32A 4OX9Y 4DCMA 3FTCA 1R6AA 2GPYA 5FUBA 5E2BA 4GF5A 1M6EX 1SVUA 5FA8A 5P8WA 5D1NA 4MIKA 5DLYA 5LQJA 2ZTHA 3P2EA 1VLMA 5LQKA 3EGEA 5E1BA 2UZ4A 3OU7A 2CWWA 3QOXA 3C6MA 2NXNA 3TKYA 4A6EA 2NXJA 1WY7A 3MHTA 4BY9E 1NT2A 2JH8A 2IBTA 4E2YA 4PYMA 4PWYA 1G8AA 3AXSA 5CVEA 3G7UA 2B78A 2ZBQA 4QVGA 3RW9A 1XVAA 3PFHA 3LKZA 2OPBA 1X1BA 1JSXA 5BW4A 5EGSA 4RTKA 1IY9A 3UZUA 4C04A 4Z2YA 2PWPA 1TW2A 2G71A 2IFTA 1NW7A 3O4FA 5C0OE 3EGVA 3FTDA 3GWZA 4HH4A 1WS6A 3V8VA 1QAMA 5FA5A 2PT6A 3REOA 2A14A 2EJUA 5EMKA 2IPXA 3G5LA 5EKUA 2XBMA 5HILA 2AOVA 5CCBA 3NJRA 1JG1A 2AR0A 1UWVA 1KXZA 4P7JA 1T43A 2HMYB 4PCLA 5CVDA 5FULA 2GAFA 3DLCA 3ELYA 2AOTB 5JUWA 4Y2HA 2YVLA 3TKAA 3UJDA 2E5WA 2FK8A 1NE2A 1X19A 2OB2A 2H00A 3NVMB 3PFGA 3O31A 3ELWA 4YUVA 5LR6A 2PXXA 4ER7A 1VPTA 2OYRA 2CMGA 1ZGJA 1ZGAA 2N47A 2YR0A 3OE5A 1XDSA 5EHGA 3TPZA 5E9QA 4AZTA 2G72A 2PXCA 5BW5A 1NBHA 1BOOA 1KHHA 3UJ7A 1JTEA 4ER0A 4P58A 1FBNA 5K05A 1N7JA 3L8DA 1QZZA 3THSA 3TQSA 2PBFA 4F85A 2DULA 3T0IA 1L3BA 1BHJA 3KQTA 3GRVA 1YFJA 3KPUA 1ZG3A 4M7RA 4V0QA 2BH2A 1XCJA 1P1BA 1SG9A 4MQ4A 2Z6AA 3DR5A 3CJTA 5EKXA 3GGDA 4BLWA 1XJ5A 2ZLBA 1RI4A 3VC1A 3G2OA 4HSGA 1B42A 4PYQA 2P35A 5DX1A 4RSRA 3ELUA 3DTNA 1UFKA 1YFLA 2EX4A 2PWYA 3GRZA 2ORED 5ICGA 5JR3A 3HVIA 3ANXA 5EG5A 1KR5A 2H11A 3OFKA 3MGGA 5BXYA 1D2HA 5K0EA 2V7EA 2IH4A 1NV8A 4HGZA 4DMGA 5FWDA 5GIPE 3P9CA 1O54A 1RJEA 2IH2A 3KR0A 1JSZA 3OFJA 1X1DA 3LCUA 3I9FA 3P9IA 2P1DA 4HG2A 4PIMA 3E8SA 3FRHA 4EVIA 1P1CA 5EMJA 1VP3A 2QYOA 2IDJA 3LSTA 3LCVB 1EJ6A 3LECA 1ORIA 4GOMD 5EHIA 4M36A 5K0CA 4EK9A 3CKKA 3I53A 2EJTA 5K09A 4E33A 1VE3A 5KVAA 1XXLA 1KPIA 3F4KA 2B25A 3CBGA 2ZBRA 3A26A 2ZZKA 3B3JA 4RV9A 1M0EA 2AOXA 4NECA 2AOTA 3HCDA 1JG4A 1WXXA 3GIWA 4QTUB 3EVCA 1SKMA 2ZULA 2OY0A 3R9XB 2HTEA 3OZRA 1QAOA 4PINA 1QYRA 5B1SA 3UWPA 4CTKA 4GOND 5DXJA 3MTEA 4BLVA 4FSXA 4YV2A 1RI5A 4C4AA 5HOQA 4HRAA 5FTWA 5T64A 7MHTA 4OQDA 3TR6A 2G70A 2PSSA 3UJBA 5E9JA 5DM4A 2JH9A 3EEOA 3FZGA 1DUSA 2ZVJA 1EG2A 3KQQA 5IH3A 4FZVA 3T7RA 2FPOA 4FSDA 5HIKA 4QPNA 3BKWA 4PYLA 2CMHA 3EVGA 3FPGA 3KQWA 3GRRA 3NDIA 3OU2A 4M37A 4YUWA 2R3SA 1ZHFA 4F84A 5CM2Z 2JJQA 5E1MA 4RTRA 5DTQA 4E2ZA 5DSXA 1KPHA 3PX2A 1Q0TA 5M5BA 3KPJA 4PYNA 1FPQA 1G6Q1 3EMDA 3BGDA 4R8RA 4U7PB 5HFJA 3VC2A 2JG3A 3MQ2A 3GRYA 5EVJA 1JQDA 4X1OA 3GDHA 4RVHA 3I5UA 4IV0A 3FYCA 4EKIA 3NMUF 2Y1XA 3OCJA 3A4TA 2OZVA 3EEYA 1V39A 3DLIA 2YUIA 3JWHA 4KW7A 3SGLA 4DF3A 2AVDA 4ER3A 2QY6A 2O05A 2P3QA 3AJDA 4QVKA 3DMFA 4YMHA 1KYWA 1HMYA 3KQMA 2P8JA 4P7GA 4CKEA 3AWIA 2I6GA 3O7WA 1Q0SA 2Z6UA 2ZZMA 4OBXA 4RTSA 2PLWA 5GM1A 3FUUA 3KQPA 4DCGA 4X61A 3KQOA 2IBSA 3HM2A 4PCAA 3SXJA 3IV6A 5GP1A 3FPEA 3DOUA 4CKCA 1QAQA 1YB2A 4QDJA 2PX8A 4IWNA 3IEIA 3TRKA 5HEKA 1JQ3A 3BWYA 2YX1A 2PJDA 3JWGA 3HCEA 3P97A 4RVDA 3FUWA 4BLUA 2ERCA 3FPJA 3HCFA 3ELDA 3M6VA 4WXHA 5GIOE 4RTOA 5FQOA 4CTJA 3HVJA 3JWIA 3MB5A 2ADMA 1RI3A 4CWAA 2I9KA 3G2PA 1O9GA 3G8AA 3CC8A 3M6XA 3MERA 1U2ZA 4PYOA 3EVDA 4H0NA 3PLAE 1PRYA 4IV8A 2Y1WA 5DM0A 1SUIA 1RI1A 4POOA 2QE6A 5U4XA 3NVKI 1NW8A 2BR5A 3C3YA 2FCAA 4KIFA 4E2WA 5CVJA 2C7PA 4PYJA 3B3FA 5DM2A 2ZZNA 5HZMA 1FP2A 1TW3A 1XTPA 5CUQA 1ORHA 2GH1A 2B9EA 3EPPA 1YZ3A 5EMLA 2CL5A 2HV9A 1YF3A 1M6YA 2NYUA 5FCDA 3FRIA 4YV1A 1KP9A 2H1RA 3GNLA 5BP7A 2ZWVA 4AUKA 1G55A 1KIAA 5DT2A 4M38A 3DXZA 1PJZA 3BZBA 4RTLA 2VDUE 4QQKA 2ESRA 5K03A 3BGIA 4B17A 3E23A 5EOVA 3PS9A 4LECA 3WSTA 1FP1D 4RTPA 1YUBA 4G56A 1IM8A 1I1NA 3A7DA 3BGVA 1JTFA 4LG1A 5K0NA 1D2GA 2ZFUA 3EVAA 4RVFA 1YZHA 2PVCA 4V0RA 3HCCA 2UYHA 3PB3A 1R8XA 2ZSUA 3M33A 1EIZA 2FK7A 2C7RA 3FUVA 3UA3A 2HWKA 2PKWA 3C0KA 4AZSA 3T7TA 1JR4A 1Z3CA 2IGTA 3ID6C 2NNWB 2BR3A 3LDUA 2ZIFA 5DXAA 4ZTBA 3SX0A 1VBFA 2DPMA 1XCLA 3DUWA 3KQVA 3FPFA 4KIGA 2O0LA 2B2CA 3DXXA 5E8JA 4FT4A 3TM4A 3UJ8A 2F8LA 4QDKA 3ERCA 4WVLA 3DMHA 4C07A 1L9KA 3BXOA 5H02A 4PNEA 3FUTA 5CD1A 2YQZA 2OXTA 4C05A 2OBFA 2NP6A 2WK1A 3LL7A 1EJ0A 4P7KA 2UYCA
chains in the Genus database with same CATH superfamily
3IDAA 1RHQA 1EU1A 1Q3HA 3H5RA 2H07A 2VPPA 3LHDA 3LK7A 3LUHA 4XVRA 5KCMA 1IHDA 4D9MA 4PZLA 3R24A 4JBWA 4K2HA 5ALVA 3ESYA 3MSXA 1X1QA 2HYDA 2PL1A 3B70A 3GBPA 4JLPA 4JR0A 3OQVA 4PG7A 4RIIA 1DKUA 3L18A 1QK5A 1JE1A 2J6CA 3T7SA 1PEAA 3M9XA 1RXUA 1I4EB 3TNJA 2YXBA 3VVLA 1XWFA 2BFOA 4GT1A 3TEJA 4C08A 3K4HA 3ZDXB 1KS9A 3NEAA 2G1AA 3G5TA 4ETIA 1A5AB 2VDVE 5K6AC 1EHIA 1EM8B 3RODA 2BUAA 2LIVA 4YUYA 1QVWA 3OM1A 1NVFA 1OPXA 1OLXA 2JGKA 1YQGA 1MFZA 3O3CA 4JQSA 5CNMA 1H2ZA 1O89A 2W2VA 1SQ6A 1TX4B 4ZQGA 1YB5A 2FRDC 5IP5A 4IDBA 4WQMA 4BRSA 3PFNA 1T91A 3DMPA 5HKKA 2M98A 5MDHA 4I3GA 1H2XA 5A0VA 5EQJB 2AFRA 2GB4A 2GEKA 4IJVA 4MVJG 4UEWA 2BZ0A 3NHUA 4FBLA 3K5WA 2WA1A 3IFSA 1BX3A 3PLRA 1PDWA 3NETA 4EQ6A 1E1MA 1NDUA 2HJ9A 3BWVA 1BIFA 3NWPA 3TSAA 4YRAA 4YRNA 3SF0A 4DIBA 5BSGA 3C5EA 3N0WA 4M1OA 5ALWA 1YJ5A 5TQ2A 1W36C 1Y7IA 1KI6A 2J67A 2RGNC 3ASUA 4Q3DA 1TF2A 3CLUC 2GZAA 3ZBUA 1GGEA 1GV1A 2GXAA 1QB8A 2H52A 3GXOA 1APBA 2WYVA 4MTLA 3V1KA 2X8BA 1GFSA 4BVGA 3IE2A 1W0CA 2GFHA 3K1AB 3QH4A 5GGYA 3M6IA 4YJDA 3A6FA 1S89A 5EJEA 3D6MA 1CZOA 1GQQA 2VJLA 2ZJOA 3IVMA 4F4JA 2UKDA 1KQ3A 1DTWA 3COJA 3NJ4A 4PGGA 4EMUA 5BT9A 2JKVA 3M2TA 1L5VA 1ZD4A 3PVZA 4C0XA 1V5WA 4I1RA 4EECA 2BZGA 3M5WA 2IIPA 5KMGA 2ZE6A 4O29A 4R1OA 3VDMA 3TW8B 1LU9A 2EFDB 2RI0A 3GRPA 2C94A 1SU4A 4M9UA 3QP9A 4ZKEA 2K7FA 4QBHA 1S9HA 1YU9A 4YJHB 2EZ8A 2X0NA 2I7TA 3AHCA 4UVIA 4X8LA 3ILYA 1T3TA 4Q7JB 2G5GX 3BZWA 1MN6A 4BPRA 2JCYA 3VX3A 3WNZA 3GLFB 4FCWA 3NGLA 1WULS 2VT2A 4HUTA 3IMCA 2GBLA 2SCUB 3TVTA 1E9BA 2PX3A 2C59A 1JHRA 1ZW6A 3I8XA 4LHYA 3QVVA 3PNYA 4R8LA 1Z36A 1E2KA 3CUWA 4BNVA 4NEHB 1XTTA 5KYTA 4C7MA 1UMKA 2DECA 2XA1A 4HWPA 1ONOA 2B3DA 1IZYA 1FTWA 4R9SA 1DXQA 2EDCA 3QU4A 3USCS 2NW6A 4RX1A 4RZ3A 4M7WA 1P1HA 1Y89A 3DW1X 4PGAA 1I2DA 1Z6QA 4I9UA 4RK4A 721PA 4WINA 4XYGA 2EXXA 1A2QA 1G17A 5LQNA 3NTRA 1FJXA 1UKAA 1ZHOA 3AP1A 4KX3A 3FF4A 1C5KA 5AKIA 3TB4A 3WGVA 3VZSA 2ATIA 4PGFA 4YRJA 4BE7B 2G1PA 1GKLA 1VSQA 4KO8A 4LOJA 5JLAA 1ESMA 1GGVA 4R6WA 3QEAZ 4I9HA 3DH0A 4JUIA 5TY0A 2CUKA 4RQUA 1P17A 2O0JA 3R77A 5IM4A 4OU5A 1YHYA 1V25A 4TN5A 3UGQA 2FEAA 4F3NA 1CVLA 1HZZA 1B6SA 1BEUB 4GYYA 4J90A 4AF6A 4B2LA 3NOVA 4O0LA 3HP4A 3IOYA 5MFZA 3D0RA 3NXKA 5DLPA 1P2FA 1D04A 4RD3A 1NNEA 4BX9A 4WACA 1KAGA 2D5CA 3LK6A 3E70C 5CMLA 4EHKA 3U09A 5EPEA 2Y76A 4OOEA 2BMDA 1ZGGA 5I9NA 3GMSA 1ACJA 2P40A 2QTLA 4IVNA 4BP3A 1VGVA 4P54A 3ED5A 2CLFB 2JLRA 3U7FB 5JARA 1PS8A 3KO8A 4UXIA 4MUBA 4YALA 3D02A 1U1GA 3AG6A 4AZWA 3VJLA 1QQAA 4N8DA 1IE3A 1CS0B 3BT7A 4Z54A 1N6NA 6PFKA 1S1CA 3SF8B 3COPA 4NV3A 5B53A 4EATA 3K2QA 1N33B 4JYCA 3L0SA 4EPRA 1HRKA 4BAZA 1MENA 5B36A 2BYTA 1NX6A 2BCJQ 3QGMA 5FI5A 4NOMA 2Q46A 5DZSA 3RBVA 1RXVA 2HNKA 4ARVA 2Y2UA 1CE8B 3KU1A 1YB7A 5IARA 3WRWA 5KYKA 3A6EA 1T1JA 1VKZA 2XKBA 3EXG2 1P0QA 1RXYA 2I3DA 2V45A 4G8JA 1UJCA 1WKVA 2WU0A 3HA5A 4JB3A 1R37A 4F9GA 5C8VA 2PBLA 3PUHA 4OQMA 4Y3UA 5GONF 2Z8YM 4PPYA 1O0SA 3OQOA 3DMTA 3ZNNA 2RHJA 1FB5A 3KIPA 4JBHA 4LRWA 3USZA 3SAJA 2JFQA 2RJOA 3GLIE 4U7TB 1JMVA 2RHMA 4ALJA 2AR7A 5LQDA 2BEVB 3SSMA 3EZXA 4TMXA 1Z4NA 4ZREA 3VPAA 3OOEA 2ZI6A 5KNDA 1L5WA 1PG0A 2RH9B 3OSZA 4MITA 3TGWA 4TLAA 4CCYA 3VO8A 1N3IA 3QEJA 1ELOA 3RS8A 4BLQA 1KK1A 2PXAA 1N7IA 2FQXA 3I64A 4MR8B 4QG7A 4ESHA 2ZRKA 3LCCA 4LBYA 4BFWA 3MELA 4KITB 4N5IX 4DRYA 2NNLD 3EC2A 2EATA 3OJXA 1RAGA 4PVCA 1UEIA 2EGHA 4TRRA 4AFNA 3ACBA 1R4ZA 1CC1S 2OP1A 2OZLB 4N49A 3G9XA 3K92A 1N6IA 1R4NA 3RG8A 3RSQA 3SEQA 5LPNA 3OFNA 1P4GA 5EINA 2ILVA 3KJHA 4H18A 4IHJA 4L8LA 1PGPA 1ZITA 2EQ5A 5DRTA 4FE7A 4DSTA 5B12A 4ALKA 1CIVA 3EVBA 4J0GA 4Y18A 3C7CB 3AILA 4V3CA 2YC2C 1WDKA 2QMEA 4PEVA 2UAGA 5A5VA 1QH1A 2CT8A 1I3MA 3Q40A 2G09A 5DLYA 2RD2A 4X7PA 3N2GB 5BT8A 2H0QA 5F5NA 1LLCA 4YCDA 4CUJA 2VTVA 2EYUA 3AZOA 3D1LA 1IAVA 3ELBA 2BBOA 2NUTB 4LXQA 1U9ZA 3FDZB 2CWWA 2HDOA 5E1BA 3CZ5A 5KINB 1WXIA 1NJFA 1XI2A 1G4AE 5HA5A 1DJMA 4X8HA 1V11B 1XBTA 2WT9A 2UUOA 4PFKA 3HCOA 4CG0A 2DHQA 1V9SA 3CT4A 3HGQA 1XSEA 3GVPA 4LI0A 4LJ7A 5EL0A 2JRLA 1YE5A 2D74A 2C5FA 5ERXA 1MOZA 2HXGA 2Z57A 1FP6A 2YW9A 3L05A 4GP7A 2QZZA 3DGEC 4OKSA 4DUZB 4B8WA 3UIEA 2WIKA 2A14A 3VR2A 2IPXA 4CM8B 2TMYA 2NU8A 2V3VA 4LY6A 4X3CA 3GHYA 4ND8B 4WLVA 3M81A 5LN1A 2XDQA 4FYXA 2HHAA 4KQFA 4DIOA 2VTBB 4B6PA 4QJ5A 4EI2A 1KE1A 4Y2HA 4OPMA 2YVLA 1HEUA 1QBGA 4Y9SA 2ZJAA 1EBFA 3ANSA 2YJTD 1LNQA 2OYRA 3VI3B 3LYHA 2B94A 1PI3A 2DU8A 5K0SA 1L4EA 2LNDA 3CZ4A 4O3FA 3ZE9A 4DIDA 1UDRA 2G17A 2A94A 1E3QA 1IIBA 3ZWDA 1A71A 2FF5A 4M9QA 3CUVA 2YZGA 2Z0MA 3UJ7A 2I67A 4YDHB 1FBNA 2BBWA 5ULLA 3O2SB 4OFXA 5FI3A 3THSA 4F5YA 2IZ6A 3SVLA 5FI1B 1J5XA 2DULA 2EZTA 2O59A 1BHJA 4J0QA 3TMYA 4C0LA 2PQ0A 3SZLA 2XLBA 3PXXA 2GZDA 2WM9B 1Q6ZA 3UICA 3THWB 4B40A 2PWBA 2ZWPA 1Z4KA 3W7BA 4CKXA 2QVBA 1MJ5A 2FNAA 4P2BA 4TKMA 2WWGA 1BDHA 3DDUA 4EGQA 4PX5A 4BBPA 3AF5A 3ZLJA 1M72A 4PO1A 5IN4A 5E6UA 3O8NA 1FSZA 2ZSIA 2JLVA 2WM3A 5JQWA 2QMZA 1J8DA 2XIJA 1AHPA 3AEKA 1PLLA 3TAUA 1KO8A 4BQPA 4B3BA 1RKXA 4I1PA 3OP4A 2ZUTA 1YVRA 3U1VA 1UAAA 1Z37A 2QUBA 1BS9A 3IAAA 4TWRA 1Q0HA 1D2HA 3VR1A 2EKZA 4JOBA 1LS6A 1H0SA 4LXHA 2H7CA 1L7BA 3TNLA 3H6KA 1QHHA 4MARA 4XGKA 3S1LA 5IUJC 2R44A 1L7RA 1VYHA 1ZSYA 4EF6A 4EI9A 5KSWB 1ZA2A 1FJHA 1S01A 1P2UA 2A59A 2FRVA 1O2DA 5JOQA 1Z9BA 2QYOA 2MJLA 2OAQ1 3H7AA 3P0EA 4O1IA 2ZYWX 3HG7A 1KI9A 3MG9A 3EQ7A 3ANMA 1QS0A 2GBLC 1G8GA 2FZWA 4N0PA 4RJTA 2XUKA 3FCCA 1NA5A 1E1QA 2Q1XA 1U28A 3TLZA 3AVVA 3MT8A 4I1IA 1YWGO 1C30A 3GPCA 1JZSA 2QLBA 2GRJA 5DFAA 1YIDA 1FE8A 3FY4A 5JAIA 1HO3A 2NUBA 5SICE 1BQEA 4GX1A 2NO9A 2NU7A 3LXRA 3RM3A 1QYWA 1K8YB 1J99A 4TV9A 4B9AA 5JD6A 1MIOA 4KPEC 1P1KA 3WWCA 4CLDA 1LQTA 3LDHA 4L15A 4MI9A 2CYCA 3RS7A 3F3MA 3LA6A 4HEQA 4TXJA 1Q0RA 4YRLA 2G25A 4KO3S 4D9FA 3LA8A 1WDTA 4E4TA 1I51A 4JJGA 1OXKB 1HLGA 1SD1A 1U6JA 2Y9PB 1EFPB 3RABA 3HJGA 3ZQ4A 1T4MA 1E61A 1FK8A 5MN4A 2WNIA 4KQ1A 2ASVA 3R7FA 3EBOA 1TJ3A 3UO8B 3P0RA 5HX7A 3KQWA 5CEFA 2OESA 3A9UA 2A5YB 4RZ2A 2Z43A 4RTRA 1R6XA 4YTEA 1Q1NA 2CJWA 3RC9A 4BMOB 2RKBA 3AR2A 2WHYA 1CETA 2EW8A 2CV0A 3BWXA 5AJTA 5AW8A 4J1SA 1E2MA 3WGUA 2AFHA 4EKIA 3I5UA 3KZMA 3MWFA 4IV0A 3TXAA 2BGNA 1LSSA 3M5PA 3O5AA 4FD3A 2QRGA 3GNSA 5A3RA 4JQZA 3WGJA 2H1SA 2P3QA 2W11A 4RIEA 1S2IA 1T25A 2OSBA 5AHXA 1BU8A 1O6FA 3D81A 3ROMA 3AWIA 3TJZA 4CKEA 2XOKD 4G4JA 4GQAA 1Z6PA 4ZYVA 1KE2A 2OC9A 3ZCSA 4AJJA 1F2TB 3K8YA 4JMPA 2WM8A 1YQTA 4UTRA 4W1SA 1GQYA 1F17A 2GCPA 2QTWB 4PCAA 3ROXA 5EP4A 2G82A 4UBOA 1QH8B 2J4CA 3DOUA 4QDJA 1FDOA 1V26A 3PPIA 4BMVA 3VNRA 2NZXA 3HLYA 4NMHA 3FWNA 4UHBA 4KJXA 4QVIA 1Z0ZA 2VTKA 2F1JA 1AKTA 4OYRA 1B74A 4UMVA 2D13A 4WXHA 3CG0A 4FKBA 5FLYA 3U4QB 4M55A 4JA2A 4UNNA 3L9XA 2Y1CA 4H0NA 4TMVA 2DEUA 1CT9A 1PRYA 1XQVA 3G9UA 5LZ5A 2Y1WA 3PF8A 3KWJA 1EFDN 2DTEA 4UUOA 4RQBA 3MUOA 2ONJA 3NVKI 4RACA 1WMEA 1NW8A 1NPYA 1SCKA 2CXSA 3OMXA 5K2OA 3OICA 2G6TA 2JHGA 5CGZA 2JGMA 1YVEI 2CNNA 3ES9A 5DM2A 4J9UE 4BFXA 1NAHA 1LV8A 2AXEA 2X1VA 2WUWE 3H9EO 4EUHA 5EKSA 2CL5A 1H2WA 4KR2A 3IELA 3BXZA 2CXNA 1ZI8A 5IK2D 3LPLA 5K01A 4MPTA 1G55A 3NCHA 3ZXYA 2NO0A 3HVRA 1FMLA 4RIGA 4QQKA 2J9XB 4PR0A 1L9XA 4UHHA 3HJHA 2R1VB 4R3WA 5E4YA 3SICE 4L08A 3PS9A 5JZ9A 1PQ4A 1XZGA 4QXMA 1MABB 4NBRA 3GCDA 4BECA 1CZLA 2HGZA 1DC5A 1UOPA 1YD7A 1YQUA 4M0FA 4TMTA 1FW8A 2CF6A 3R4CA 4JJAA 1QGOA 3ZQUA 3INRA 5DYYA 2UYHA 2PG3A 1DWQA 2JLZA 3UC5A 4TM7A 1IEXA 3R40A 1V1JA 4GMGA 5EQFA 1JIUA 4N6GA 4PQGA 1XWIA 2JK0A 2HRZA 3GGSA 3TR0A 4TLDA 4R0MA 5CBPB 4J9VA 3BWEA 4ZO7A 3T7KA 2HKIA 1EGMB 4BNKA 4WUTA 1FPMA 1LI4A 1Y0BA 5TQ0A 4TQGA 4XOIA 2DFPA 1T36B 2VQFB 1NONA 1O58A 3C4QA 1QCDA 2XGSA 3PITA 1TTTA 2H1OA 1LWOA 1P72A 3MGBA 1Y63A 2GEVA 2NUAB 3S1SA 1P1JA 2H2GA 4JT4A 2C8VA 1JR3D 2VJYA 1ZMBA 4L95C 2ZJYA 3AJRA 3WLRA 1P7VA 1N2XA 1P1IA 2OCAA 1F8XA 1U1DA 4HHEA 4NDNE 4JJ4A 1Y82A 3ZW9A 3ZUGA 4C7OB 3C87A 3VPSA 3R75A 1KJYA 4JXJA 1M73E 3GLQA 1X74A 2OCPA 2MT9A 1ILEA 1IXRC 4HQ0A 3ICEA 4ND6A 1S02A 3H9CA 4URZR 5E4FA 3TSOA 1RPZA 1FUEA 2EL9A 1VJRA 3ECSA 4X44A 3OUZA 2PQ6A 5H3CA 3L6UA 1XMVA 2JBAB 1WHSB 3SC2B 4IUCS 5F5XA 2O2IA 1Y8CA 4HTFB 5CB8A 2YFHA 1PQUA 1L5NA 3SR3A 4R2KA 4KVAA 3PC7A 2XRZA 1Y5NA 2XT6A 5AVZA 1WQ1R 1BO6A 4H0FA 2O1EA 4YT4A 2AUTA 3GPLA 5KAMA 3G5MA 3QHPA 4OI1A 1GGHA 4BNNA 3UCEA 1H05A 1PS0A 1S4QA 4DUYB 3RYHB 4HFJA 1EK2A 4DM4A 1DXOA 2C9MA 3JD4A 1GRRA 2P9BA 4C9BA 3KKQA 5MN6A 2EZ4A 4KO2S 4D9NA 4O02B 1WB4A 3R5XA 4X71A 1PL8A 4QGSA 3ZC3A 4KRXA 4R2XA 3H0EA 1UMDA 3RHTA 3M3PA 4BKPA 4LNUB 5CVUA 4TS1A 1A88A 1TE2A 2VO1A 2OMEA 1RHJA 2SKDA 4N12A 1QPZA 1CDDA 1QIHA 1LWNA 1U6KA 2HWYA 4NU8X 5PNTA 4LF6B 5JYDA 3VMFA 3OX4A 4LZLA 3N2ZB 1NQUA 4D74A 2Q28A 2WJAA 3OEED 4GQBA 5LXTA 1DLJA 2ICAA 4B4WA 2FUEA 2X86A 1JDNA 1A9ZA 1CV2A 1UADA 1GNQA 4N4AA 4XQ0A 1VPWA 2PSEA 5HS6A 3WYNA 4EO9A 4FFBA 1QVZA 1XEWX 3MXTA 5KNBA 3SG0A 1EQAA 2LD4A 3KXIA 4LWPA 4PONA 3DE6X 1ZS9A 3NKLA 4U9HS 4A2WA 2AX3A 2HIGA 2GLUA 4M86A 3WK7A 2FDCA 1B6GA 3NTOA 3ZHRA 2FPIA 5C7IO 1XZEA 3JASA 1PT6A 3RC1A 1A9QA 1A8HA 5KQPA 4F96A 1T2DA 1GU0A 3TEFA 5LP6A 1K7CA 1QP4A 4A10A 3VPGA 5EJ2A 3MHPA 3AF2A 4HVLA 4EEKA 5EQDA 4YPVA 3VV3A 4EEZA 1MKYA 1NOJA 2ZPTX 3O94A 1F8FA 3WE7A 3BGWA 1JEQB 2UUBB 1Y8RB 4BVHA 4QTTB 2WVGA 5FO0A 1QV9A 2B9VA 2QX8A 2VDWB 3I52A 4YFYA 1MFPA 1U2SA 4B3FX 1JIJA 5CLFA 3N0TA 3NTQA 5AW5A 2C7OA 3W4KA 5TMPA 3T1OA 2QUAA 4EDHA 4B4UA 4E4YA 1USGA 2AMYA 2P9FA 4D9BA 2FU5C 1NAIA 4GWGA 3A3YA 1NXOA 3N1UA 4CLRB 3A04A 1TI7A 3OZSA 3G2MA 1QBKC 4D97A 2DHCA 2CGEA 5CT4A 1YVUA 2ZJ5A 3ZQ6A 3GRUA 2QP4A 3I9LA 3SNHA 1EKXA 1E1YA 3IP6A 4WCVA 2XOKA 4AJ1A 3LE8A 2XCQA 5KI6A 1KGSA 3TZCA 1M1NB 3UK1A 1H4SA 2IL1A 4GR4A 1XQYA 5J40A 2Z1NA 1BXGB 2PS9A 3T1VA 1HOTA 3IHTA 3KSZO 2AN3A 2OD2A 1RADA 4NS1A 3UK2A 3V32A 4ZOQI 3FOZA 2NT4A 1ZMXA 5TQJA 1IVYA 4UNRA 3N2KB 3S6JA 3OLVA 2PKQP 4FZ5A 3T5TA 4BO0A 5JY1A 1NP3A 3WFZA 1P44A 2Q1UA 3CLTC 4TKZA 2B0CA 3EUAA 1JIQA 1GUFA 1X1CA 1B0UA 3BJEA 3MOGA 3DDHA 3RDPA 4B3XA 2NM0A 1P91A 1J42A 3HZHA 4Q3OA 3C6KA 4XJVA 4MV7A 1U31A 1GV0A 4FMBB 3A05A 5TLSA 5BQXA 2FEMA 4XFKA 3UJ6A 3DEYX 2P4SA 1E0SA 2UYYA 4AN4A 5BNTA 4C87A 3RTBA 3FKQA 3GJSA 2F2TA 4MWGA 5JFGA 1EX6A 3EXHC 1XDZA 2JAWA 3O4GA 2B4YA 3HBLA 4JA0A 3WL7A 3H8WA 2HA4A 1CUWA 1TVEA 2RHWA 4E5SA 3L7BA 2X6RA 2B4TO 3EMBA 4KUEA 3RSSA 1P9LA 4MA4A 4B32A 1R18A 3GEGA 5IK2A 1HNNA 2OCBA 4CIXA 1DINA 3H75A 5EGNA 4C5BA 3I76A 3TEMA 1J0DA 4OK5A 1Y7LA 3GGPA 3HKBA 4P3YA 4I9NA 5DB4A 3WDLA 4B47A 4CLXA 2GVZC 4CZ2A 2Q2WA 1VE5A 2PZBA 5FHRA 2VSOA 4LOAA 2JVIA 3F5MA 3KQSA 2EBUA 1QGUA 2FP3A 2QW1A 3HYTA 4G63A 1SVWA 4LPKA 4QYIB 4NU5A 3ZVLA 2B6NA 3FYDA 3NBZC 1Q1ZA 4UNPA 2XD9A 1LPNA 2H1LA 3DGFC 2C07A 3PC8A 3FMFA 3N8HA 1JEOA 2Q29A 4LTDA 3VO9A 4HB2A 1KAOA 1QOPB 1K6MA 2Y1LA 3F4BA 4XJTA 3DAPA 4ZD6A 1YMUA 3LHKA 4CQMB 3C16C 4EFMA 2P9GA 3ZQJA 1K8XB 4LNAA 4MMZB 4UVDA 3LPMA 4W4TA 3RU2A 1WY5A 3FFAA 1NNI1 1I6MA 2CUZA 3G59A 3PV0A 4JP3A 4BGUA 4D0SA 3D64A 5IUNC 2FPUA 3GV0A 3ZDRA 4BV8A 4HXYA 4UASA 2VHTA 2ZR8A 4ZHSA 2XWPA 1JLMA 2EIHA 2QTVB 4ZGGA 2JZCA 1E3TA 1JR3A 2WMOB 1MG0A 4KDRA 4DBZA 2FFRA 2EEZA 3R74A 1H1DA 3IOMA 1CUZA 1RJ9A 2EL7A 1NQ5A 2ZIXA 4Z4FA 1RRVA 4WI1A 3EZLA 5ALUA 1SOMA 4MW0A 3HJFA 3CH5A 5G41A 1QG6A 3FHJA 5KWVA 1UKEA 4DV5B 4QEKA 3QF7A 1FX0A 4DDMA 4MVJH 4OGKA 2VWGA 3I72A 2IWRA 1LUAA 5BVHA 4GMDA 1U3FA 1WY7A 2OA0A 1N6KA 4MV6A 5DP2A 3AV0B 4BRZA 3HZZA 4R16A 1E60A 1XFAA 2AFHE 2XUIA 3QXSA 3NH6A 2HUPA 3QF4A 3NBQA 2OPBA 2YJNA 2G9UA 1QH0A 2WIAA 2IPLA 1FDUA 1JBQA 1MIHA 2YWDA 4BC0A 4GL4A 3O92A 4AJLA 4PV7A 2HT1A 3QWAA 2PH5A 1PV1A 2PUHA 4FVTA 3C3EA 4WZAA 1PNVA 2PT6A 3E6AA 4BN0A 5KTKA 2QOEA 3QFFA 1E94E 2QXUA 4JUFA 4H7EA 1ESZA 4E09A 3PSHA 1AGYA 1V8OA 2IYWA 3LF1A 5JRDS 2WAMA 5JJIA 3WSWA 1MR3F 4FYJA 4EL0A 1FMTA 2I76A 3KKPA 4MX8A 5E0OA 4BBJA 5MGBA 1JBEA 1YE3A 3EW7A 4AY4A 2CMGA 2FZGA 4O4LA 4HY3A 2YIJA 1D6NA 4NOKA 4XM2A 4D1YA 1H3FA 1W48A 1Y6QA 2PMBA 1QB7A 4DT1B 3HCNA 1JTEA 2J0UB 5EZYA 4FFLA 1ZKMA 1Z06A 1RHKA 3WB0A 2D1TA 3GEPA 2EW1A 2YBDA 3F74A 2W8BA 4TV8F 1Y1TA 1Q0LA 2OLEA 3HR8A 3N0RA 4GDMA 4RJLA 3V1UA 4IM7A 4QPZA 5DHFA 1Y3CE 2H85A 1HORA 4CETA 4BMSA 3KQTA 1E2GA 1T6XA 2BPOA 2QGNA 5CXXA 2J0SA 4ZEXA 3SDBA 3AB3A 1G21A 4LHWA 2HI0A 3O38A 3FTQA 2ZAIA 4L3VA 4WXPA 3RIHA 4B6QA 3KQHA 5TJHA 2CLHB 3ZIAD 3RJ9A 4AP6A 3DPSA 4RXMA 1DQZA 2JIBA 5BN3A 3N8NA 2C95A 3RC8A 3K5PA 4O4HB 2O52A 5JY6A 3W1EA 1D3AA 1H9AA 4XI9A 1AKVA 1ZUIA 3B7GA 5BWBA 4JBLA 3ZBTA 3LBAA 3Q9UA 1ABFA 2GXSA 3FNBA 4ZEWA 1EGHA 2CEKA 1Z2OX 2PGLA 4F2WA 3QKRB 1AS0A 5EN4A 1YBVA 3CCBA 5BXYA 2B20A 4Q4CA 2IH4A 3OUUA 4EYGA 1Z0DA 3J80A 1TM1E 3DHWC 4X1YA 4BL5A 4HVAA 4RPLA 2J31A 1ODFA 1PWZA 4QM7A 1RR6A 1X1DA 4U2BA 1L5YA 4F97A 3QXGA 4BNDB 3CNNA 5AW6A 3CG4A 3JQGA 4YT8A 1XELA 4KKVA 5C8YA 1KDRA 5EMJA 2OBMA 3C15C 4IEEA 5IAAA 5LP6C 2O0MA 5CTJA 5EHIA 2KYRA 3WLEA 3MJSA 1Z6YA 1PD1A 3WMGA 1CF9A 1FS5A 3FIUA 4BN4A 1VE3A 3H2KA 4N8EA 1HRDA 3FHCB 3VHXA 4JNCA 4X1IA 3A26A 1BHO1 3RF7A 3QEOA 4FHZA 4OLFA 5IASA 1SKMA 5KYUB 3R9XB 4YLYA 5B1SA 3DFIA 5G0VA 1ML4A 1V71A 2COEA 3C74A 3RTAA 1XNJA 4M6WA 1NBAA 1H4VB 4Z4GA 4MINA 5T64A 1UT8A 4TLBA 4QUEA 1UP4A 1DBPA 4EG6A 1Z2DA 4HNUA 4OHMA 2FGJA 3L04A 1VSUA 1DGQA 4YIKA 4Z8YA 1DUSA 2EERA 2FE4A 4NVRA 4YI5A 3V4PB 4V1CA 4R9RA 2UUAB 4C29A 3AR5A 4M8IA 1PW5A 5DK6A 3GPIA 3GLIA 3QBDA 3ROEA 4M9SA 2BP7B 2P11A 3H3JA 4NFSA 1CUGA 1TVKA 1GFZA 4Q39A 2QD5A 2CKMA 4KWIA 4RZHA 1PWYE 4S05A 1KPHA 4KLNA 3NBMA 4UTXA 2IF0A 4UE6A 3UAXA 4MULA 3UB3A 4FDAA 2KQUA 4O4JA 4KRYA 1XA4A 3W2IA 5IDXA 3ADBA 5EVJA 1NLFA 4TYYA 3TVYA 3VO2A 3WY9A 1L4FA 3NBUA 3IQFA 2IE8A 2RGRA 4UEOA 2Y1XA 3IBYA 4S35A 1RBMA 4BO4A 3H5IA 2YUIA 5BOVA 3ZZMA 3O75A 3OQ1A 3Q0TA 1E3LA 4ABTA 4R40A 2C29D 5CU7A 4AN1A 2JVKA 5AJXA 2TSYB 4Q7QA 5FWXB 4G0QA 1B6TA 3ZDCA 3NBFA 1XT6A 3JYLA 1HYEA 2D3WA 2VSYA 4CPDA 2G1KA 2PLWA 4O4HF 1OV4A 2PZAA 3OM8A 3T12A 1JJIA 1QF6A 1H9BA 1Q1QA 2V7GA 1H6CA 2X8LA 4GP9A 1QAQA 5TXGA 3TZQA 1HT3A 3WHKA 4I4IA 5TV2A 2H2IA 4CW7A 1J20A 1G20A 4PBRA 2V7WA 5B3AA 3JWGA 2NGRA 2GF2A 4HEA1 5AW4A 2IQIA 2WP0A 4A73A 3P26A 4KPUB 5ALTA 1WVGA 3FVTA 2HWWA 4XIJA 1HL7A 4LHZA 4PYOA 4AWXA 5JXGA 2PYIA 1QTRA 3VKWA 1ZESA 3F3KA 2VZ0A 3VJMA 3VVMA 3GJ0A 4R7ZA 3DHEA 1RHMA 5E3JA 3ZHQA 2YY6A 3NUZA 4MQUA 5CLLA 3K2EA 4J3NA 4NE7A 5G1NA 1TK3A 3KB8A 2Z4RA 1OVMA 3FCEA 5E95A 3W3AA 3ETDA 3UG6A 2WR8A 1UOQA 2ZZNA 5ALZA 1F06A 4HQLA 2AI3A 1XTPA 4DPLA 4UFNA 2V9PA 3EFBA 5C8DA 3BE8A 5C4GB 3WQHA 1H8ED 2HU5A 1ZD8A 4NRDA 4B7AA 4C4TA 4CTNA 4Y98A 2H1RA 1V43A 3GNLA 4HNAB 4X3PA 1WV1A 2FHSA 1NVXQ 3NP7A 1II8A 2BGMA 3AIMA 3DNPA 1PFYA 3HJTA 4RTPA 5C1OA 3GBVA 2XNJA 5LVAA 1WPQA 4HVCA 1J9GA 4NY1A 4F21A 3TTXA 1LLUA 2PVCA 4FE3A 3BAZA 4RJKA 1TCAA 3RVQA 1XP5A 2C5LA 1EVLA 2F00A 4Q6WA 4F71A 3NTXA 2QORA 1ZUNB 3CB4A 1J39A 1SELA 3JYHA 3R1IA 4GI5A 4TXHA 3ZLUA 4TL8A 1PNRA 2PGDA 5LL6P 2JLUA 1UBKS 3VU8A 4WLOA 4A5SA 3ZGZA 2OHXA 4JZKA 4X65B 6YASA 3ERCA 1H3EA 3I5MA 1RMTA 2R7MA 2HEGA 3RVSA 3Q41A 1A8PA 2VSQA 3B3AA 2NP6A 3HB7A 4C05A 4Q3BA 4K6FA 4ZU6X 3HZRA 1QFSA 3L6CA 1TT5B 5FL7A 3RQSA 3BVPA 1FVOA 4ZZIA 5JBNA 3HSYA 3GYGA 2BHLA 1VPEA 2ZRIA 1OJLA 2H0AA 2LDBA 4EA9A 2XUHA 5F7ZA 3UFBA 3PC6A 2Q8PA 1IZ7A 2IY7A 3E4CA 1GRCA 3F5DA 3L0CA 2ZI3A 3MTDA 4NQRA 4ZOCA 3TH5A 2ZRFA 1EK5A 2QU8A 4ZZ0A 4KIJA 4ERNA 3TVDA 5CPBA 1E5VA 2BR4A 3JAKB 4J0CA 3FLMA 4IIHA 1G8JA 5T6BA 1VP9A 4ODIA 2E4WA 4OQXA 3VBEA 3K0BA 4R1NA 3WA7A 4CL0A 3DL0A 5D3QA 1JVNA 2F3QA 3BIXA 2C4TA 4QXPA 4ZXPA 3BHMA 4UM9D 3ZIAA 4H17A 2EWMA 2Q5EA 2J46A 4K3VA 4C01A 1E9AA 1SB8A 4K9QA 4LJKA 2E3JA 1XMPA 3FOAA 4M8KA 2PE5A 5EPOA 2XCRB 2AE1A 3LFTA 4C06A 4ZV7A 4DRZA 2TMKA 5KVSA 3R5SA 2DR2A 3AF1A 1CU1A 1NI4A 3EAGA 3ONEA 3C1AA 5ELMA 4K6CA 2VXYA 1Y81A 3H5WA 1K5PA 1G8SA 3I9OA 4RMNA 1Z12A 4NONA 5GVRA 4MQFA 2ODQA 3A3NA 1XKTA 5FOSA 4D6YA 1ZCFA 1RLOA 1ICEA 1AMUA 5AVKA 2XQKA 4Z1MD 5CH3A 2FH5B 4RENA 1WUJS 2W0MA 4F4CA 5F35A 1SA0B 3ZZ1A 1EUZA 2JFYA 4BZZA 1S2GA 2HJHA 4K6HA 2AQ8A 3K32A 2YWCA 4MQ6A 4RY8A 1QIMA 3D4LA 1LDYA 3TOCA 1P8JA 3ZCXA 3QXCA 2GK6A 1JR3E 1P9WA 2H7VA 2M6RA 4MVWA 2JGDA 4GM1A 2JFOA 4TYMA 4C14A 4R1PA 1OI3A 4GHWA 5HRCA 5HXAA 1YZFA 2EWVA 3FYHA 1GTMA 3WO1A 2HV8A 2Q7OE 4BUZA 5ALYA 3QE2A 3M4JA 1A9XA 1QG0A 1XN4A 1YJBA 2P41A 1I13A 2CE7A 2VRWA 3EF1A 5E9WA 1DRWA 2N42A 4CM1A 3Q8KA 3PZBA 2AZTA 3EVZA 2IUUA 4AAYA 5ITWA 5BV2P 1EP1B 3EDOA 1DXHA 4KCGA 5ESWA 3RADC 2PGAA 1C8KA 1Z16A 4KE6A 4HO1X 1V6AA 3MD9A 1A95A 1GY8A 1E96A 2RH4A 1GDDA 4ZI7A 4ROSA 2R84A 1XTJA 1M9NA 4JQCA 4XUGB 3S2YA 3OJFA 1LDMA 3DP7A 1Z74A 4FGZA 4M9RA 4OHXA 3UMGA 2PGJA 2OBNA 3QY0A 3UWMA 1G291 3FVVA 5EJ8A 4BLSA 3H11A 2QRUA 2XX3A 1YBHA 4H7PA 4D0GA 4XLZA 1Y6FA 5F9HA 4HOYA 4EHIA 1U2RA 4MS4B 1KYTA 3GC6A 4TVKA 4Y1GA 1NF8A 3RYIA 3I0MA 2WU8A 4HDNA 3IEKA 4LIPD 1L1FA 1QKIA 4Y1RA 1NXVA 3R7BA 3JQEA 3LP5A 4LCEA 2OBYA 2V3CC 3S7TA 4MW6A 5JJ5A 3CF4G 5JXIA 1VPLA 4ZOLA 3LBYA 4GYJA 3TLAA 2JEYA 2OG2A 3T5MA 1PT8A 2BT4A 3ORSA 4GOLD 1QRTA 2Z1MA 3LUFA 4JB2A 5KWSA 1QYIA 2DWUA 4AB1A 3G0OA 3F1KA 1GNTA 2BGRA 3OY2A 4XSVA 1N6OA 4X97A 2HK6A 5TB5A 1NRIA 4RGVA 1SKUA 1BW9A 2EFEB 3X1YA 1ZGHA 3NBKA 4EUEA 4WKGA 1TIBA 1QZUA 3FF1A 1UP7A 3AEUB 1RM5A 1NVBA 3SP1A 4J1NA 4MZXA 4KGZA 3IBGA 2YJ3A 3WYAA 4KQGA 1NKTA 1DFGA 1DIAA 2A2ZA 2CCKA 3FIJA 5A2QA 5A02A 2ZJBA 5IVDA 1V1MB 2R5WA 2WINI 3L01A 1USKA 4OHKA 1WPGA 4HAUA 5AI0A 2HLNA 2IXGA 1ZBDA 2OK7A 1G21E 3M89A 4E2XA 1QNLA 2Y1GA 3H2SA 3S3TA 2G7ZA 4R9VA 2WJVA 3D3NA 3MWGA 1OPRA 3EGIA 2K4MA 3G2QA 3HY3A 1N1GA 1Z6TA 2O6HA 1WKCA 3Q6NA 1PVVA 3FROA 3K20A 4LUCA 2QX7A 2WICA 5NULA 4OX9Y 4JLAA 3GOQA 1T2CA 3MMNA 3L43A 4BYGA 3M3DA 2B3TA 2QSZA 2R9VA 1TYZA 4A36A 5HCNA 1H8EA 3A7EA 2GO7A 5K6TA 2QUZA 5FUYA 4LYYA 3DAHA 3IIJA 4BEWA 2QRKA 3LY5A 3QENA 2VQ6A 2WF7A 1FFDA 2O3RA 3JAWB 4FCVA 4G01B 4PSVA 2RC6A 2XZOA 4G8DA 3U40A 2D00A 3P9YA 2UYOA 3BTVA 3F7OA 1ORTA 3VX4A 4LYDA 3NHSA 4OL9A 4U6QA 2VNHA 3KZOA 2J87A 1N0HA 4UVEA 1U6IA 3JYPA 4IIXA 4TVBA 2UZ0A 3V46A 1TU0A 2MSDB 1QPBA 3CF4A 2HREA 1E8NA 2N3ZA 1SXIA 1S4MA 2QROA 3QV2A 1C4OA 5AHKA 4NH0A 4PAGA 1XEXA 4QOSA 2I1VB 3LKBA 5BUQA 5KNBH 1ODCA 4GVXA 1BGWA 3ZU4A 1CIPA 5DLEA 3H13A 2A1IA 3H05A 4CIVA 2DBRA 2H1IA 1K1EA 1PP4A 1FRVA 1QHGA 2NT3A 4NXNB 2Q2OA 2PWAA 2VT7A 2W2KB 3OKCA 5COQA 3RUCA 3ZV6A 3Q3VA 2Q9UA 4ES6A 2ZYGA 5CDTA 4Q3KA 3RNOA 4DLNA 1I80A 3HU3A 4I81A 1DC7A 4NBTA 4PRLA 1F9AA 4V0SA 4EB6B 1HWYA 4L07A 1OOEA 2P9HA 5LDGA 4Q03A 2R1TB 2WSLA 4GO1A 1M2OA 2WKQA 2QQFA 2ZANA 2Z8XA 4G1VA 3C6XA 4Y9TA 4XARA 4ZT7A 2A86A 1O95A 1WP4A 1YA8A 2DWOA 2FW1A 3I3OA 4BATA 5AOVA 3WGIA 3QI2A 3OF2A 3SDZA 4DGQA 1FYWA 5LQJA 4ERXA 3GLGB 3KXPA 2CFRA 2V03A 4RHEA 4CE6A 1FJGB 5JVDA 1LJ8A 2Q3FA 1KFKB 1T8RA 4WZBB 3KYBA 3NYWA 4A5OA 2VP6A 4F5DA 5L3SB 3G2LA 5ELLA 5HKOA 4QOGA 4X7BA 2YOFA 5EJFA 4E08A 5JT1A 1S2DA 2H2AA 1L4MA 1YBAA 4X64B 3FAKA 4MH0R 2BFCB 3C24A 3KCQA 2PRKA 4YP1A 3P4YA 5IHXA 2QQ5A 2QF7A 3QLTA 3H1PA 5LIPA 5LOVB 3DG9A 4U7DA 2J7PD 1PK9A 4U2GA 1J0EA 1CUFA 4F2DA 5B2FA 1NG9A 4YRZA 1TNDA 5H83A 2QIPA 3GWZA 4U8HA 4D9EA 3AR9A 2IKQA 3REOA 4WBNF 2A9FA 1JSRA 5EMKA 3G5LA 3AJAA 3LHFA 2XBMA 4I4TA 1E79D 2AR9A 3QKSB 4O2LA 3W7AA 1J1ZA 3GG9A 3VHRA 1EE1A 1W1IA 4LJRA 2NSJA 4D4GA 3CRZA 2G04A 3PA6A 1G20E 2A0XA 2JKYA 3M6MD 4K9SA 5CIQA 3RHSA 3DYVA 2E4UA 3L46A 1ZONA 2W9XA 3N87A 1D2NA 4HUQA 4I5GA 3HEAA 4EI8A 1PGJA 1THGA 5LR6A 2L82A 3CTPA 4HDKB 5DHSA 4Z1MA 3WGGA 4MB2A 5B4TA 2X22A 4Y9UA 3IBTA 5KB3A 1ZK2A 2P9JA 4FUTA 2REBA 5KDDA 1VA4A 2FFQA 2YR0A 1Z88A 4ZCLA 5KJCA 3CSDA 2P1RA 1NBHA 1U11A 1Q1EA 1YSCA 2Y77A 4DG9A 3K1YA 5CDSA 4BB6A 4HRXA 5CLHA 3JQ8A 2ZRHA 4MJ3A 4G5XA 3TQSA 3RRNA 3KBBA 3L2OB 2AKYA 2JIPA 2C58A 2X4DA 4HMPA 1T34A 1MA3A 1VFPA 4AZ3A 1G7CA 1XAGA 2YHSA 2DSNA 1QJ4A 2Z6VA 1M2VB 3DOHA 1HQDA 4LXXA 3KYIB 3LRPA 4E88A 4ZFNA 1TMOA 2YMLA 1C7ZA 3ADCA 3GEIA 3K0KA 2PTHA 4GLOA 1XLWA 1Y48E 2KM1A 4RW0A 5AKKA 3VAYA 1T5TA 3W9BA 3ZXIA 2AQKA 4Q9LA 5KVQA 5E7QA 5EKXA 3ZE7A 1QKJA 4PC6A 2IEIA 3NIWA 4PO3X 1X9HA 3EMVA 1AKWA 1BEZA 2GJSA 3G2OA 2H51A 4JYBA 1B42A 4PYQA 4R69A 5E9AA 3U37A 1WXFA 1S96A 3WLAA 5B57C 1RWXA 2BKAA 1E2BA 3ELUA 2GN9A 1ISMA 2ZSAA 3IKTA 1YFLA 4UQPA 2WTXA 1VGRA 2REOA 3BQNB 4N7RA 4HWKA 3UHPA 2IUYA 1LX6A 4MIEA 5K3SA 3ACCA 5A9SB 1WW2A 1YC5A 3ROKA 3Q12A 5THKA 1QH9A 2WJWA 3ZHXA 2PA0A 1JFRA 3PK0A 1X77A 5FWDA 4ZVKA 2H54A 4NZMA 1I5RA 1SQ0A 1EQUA 3CLVA 3HBNA 3UM9A 2ENWA 3U62A 3GVCA 3GGJA 3L9WA 4WASA 4BFVA 4BRWA 2J3LA 1BTOA 1DJOA 2P9EA 4KBYA 3R76A 2QTRA 1W59A 1R0KA 4UM7A 2IDJA 4YEDA 2A5FA 2Q62A 1GWNA 3LECA 1Z82A 2Q0HA 2VOJA 2JFZA 3Q8MA 3EIFA 3I53A 3GJ6A 3P9QA 3QELA 4XZ3A 5JH7B 4CKWB 5DISB 1HT1E 2DM6A 3BX1A 2QIOA 2OV4A 1JFFA 3O7MA 2AOXA 3OOYA 3BD9A 4QNRA 5LOVF 2W4IA 3CEHA 2I3AA 1XTVA 2RSLA 3HV0A 4P4TA 5J4HA 4GPEA 1VKHA 3ICVA 1C3OB 2R6GA 2WD7A 5MF6A 5JNSA 1DI0A 2TECE 3NRBA 1CP3A 4MRMB 4AJKA 1B8UA 1R16A 3LW7A 4YV2A 1RI5A 4P36A 2V7UA 3O1LA 1KQPA 4H3KB 2YIVX 3WO0A 5I45A 2PSSA 3R09A 1I2MA 2OWDA 3JYOA 3MWKA 1IN8A 3W1WA 4H31A 1A7AA 5EE0A 2M6LA 3GOHA 3WNVA 1KJQA 3V4FA 5IH3A 2GEUA 3GLSA 2QQEA 5HJ5A 4JI2B 1IM5A 4NX2A 3AGPA 2FPOA 5B7GA 3ZCRA 2OD9A 1U0NA 4FSDA 1EVIA 2WFZA 2JGLA 3WK8A 3P0JA 3WDSA 2YWEA 4MAMA 3MCAA 4B35A 4C76A 3E2MA 2JB9A 3TDMA 2Z5FA 1JEYA 4PZZA 5LA6B 1GG8A 3SJZA 1JTVA 1UMBB 3DAOA 4MKFA 3WWYA 3GUZA 2I2WA 2SKEA 3DWIA 4IL5A 1ZISA 3FOCA 1PLJA 4J07A 1K6XA 2R8EA 4RQTA 4X1OA 5IC4A 2IHVA 1UAGA 2J3EA 2O1XA 1TJ4A 2AFIB 4ARIA 1J6UA 2HT6A 4JLKA 3NT4A 2II6A 2Q2NA 1QTQA 3HU2A 1M2NA 3BDAA 4PC2A 4WJLA 3R3VA 1YVPA 4QWWA 2PGNA 3ANLA 4O1HA 1US8B 4U02A 5TJ9A 2ID9A 1BDMA 1YAJA 2FZVA 5C4MA 1VRWA 5GM1A 3GIDA 3JZMA 4TTSA 3WICA 3KEOA 3CKYA 4YO8A 3RV3A 4DLWA 2FZCA 4UVHA 1KEUA 1XQ1A 3A4IA 2FSPA 2H16A 2NZVG 4BDSA 2Q5FA 5BQFA 4CG2A 1SM4A 4K28A 4FNGA 3K09C 1B1AA 2OFXA 2H63A 4R31A 4M76B 2GD2A 5BSVA 4LJ9A 4Q3EA 3M9WA 3IERA 3PQ6A 1LZKA 4XD7D 2WJYA 3RSGA 4GLLA 3RWMB 1K3UB 3IESA 4G5OA 3G2PA 3STXA 1SXGA 4U7GA 4R2WA 1KI8A 5K3DA 1TM5E 3G2NA 1D2EA 3L7CA 3SY8A 3MVEA 3NWJA 5K8IA 3AGQA 1RPNA 2AMVA 1MB9A 1HV8A 5KYXA 4H1HA 5LM3A 5FFNA 1KWKA 2PMDA 5AWFC 1HT0A 2AI1A 4YLEA 4AC9A 2HQSA 3OE7D 5JH7F 1XWWA 1M8PA 1MXFA 1W19A 3TXXA 2F8MA 4AJNA 4L8WB 4B46A 5B4VA 2IX9A 4XIYA 2OGWA 1LXCA 4JL8A 4QLAA 4DLUA 3AM3A 4QU5A 1ZI6A 4J0FA 1Z4PX 5A0TA 1OT3A 4PC3A 4B17A 4FNAA 3DE5X 1GPWB 1T35A 4S1TA 1FP1D 4GXQA 4OIMA 3OTIA 1U1CA 2Z04A 2DKFA 4WJKB 5DGXA 4NYMQ 4RPCA 4YRMA 4YT2A 3THXA 4D9HA 2QTBA 2R68A 3HWWA 4GPZA 4PZ0A 1IK6A 4TTJA 2ZSUA 3GGCA 2BFBB 3B2NA 1O95C 2IS1A 4M89A 3CURA 4JKYA 2CFIA 2VQEB 3L8MA 4QQRA 5AR1A 5EIBD 1JPUA 4I7EA 2YUTA 5DXAA 1W5BA 4EMTA 4FYIA 4E32A 2QBYB 2DPMA 3T9FA 5KOHA 2GEFA 1L4BA 2XUFA 4HN9A 3OKAA 2G5PA 1KYIA 2ZP1A 5LA6F 3L7KA 4WVLA 1U3GA 4JHLA 4NCIA 2PVPA 3AR6A 4L9WA 3K0EA 3Q8XB 4B2YA 4WNAB 5KOYA 3C45A 4B7ZA 4M9ZA 3UB4A 4GG1A 4NNOA 5ALSA 2EZUA 1M6HA 1F6DA 2QYTA 5FPPA 4EKYA 5G4KB 1P2SA 3MS2A 3HJCA 1M7BA 2I34A 3U1TA 1W47A 2WY2D 4M9CA 2XMBA 2DCUA 3F6BX 1T1IA 5FPSA 4BNTA 5JNLA 3CZQA 4OSEA 3GP5A 3VR5H 1T2FA 5C4IA 3SR4A 1HDOA 3QE9Y 1USVA 1SXHA 3QMMA 3SQLA 2WF8A 4KOEC 4BKQA 1QZ3A 2MHCA 1RRGA 1TECE 2P2CA 1LS1A 4HSEA 4HWSA 5BSRA 2EAUA 1H5QA 1LVUA 4HDQB 1VLQA 3LCMA 5SY6A 4HADA 1MDFA 1G3RA 2WHEA 4KN8A 1K08A 4XUEA 1J00A 2GM4A 3BERA 3A2KA 2ZT5A 3MJEA 3MRSA 1TM3E 4BGVA 3OKPA 5DE3A 1KR2A 3NV7A 2X2FA 2R87A 3P7MA 3WL4A 1P45A 2R1UA 5JHHB 4TMWA 3Q7RA 2SICE 2VJKA 1V16A 1YA6A 2MR5A 3FPKA 4MW2A 3WL3A 3AONB 1DO2A 1RTKA 2ONKA 4LTMA 3BEDA 4TS3A 1SULA 3SYNA 1ZGCA 5I7AA 3SX4A 3GELA 5LQRA 2HH9A 1O77A 2IYOA 3LP8A 4KR3A 4AX8A 5EJGA 3W5CA 4KZPA 4L4SA 3AB8A 4TMYA 1SHKA 4DMKA 5BSTA 1YCDA 2QRHA 1ACLA 5BQ5A 2OV3A 1SOVA 1FBTA 5JALA 3WGOA 2PZGA 5K20A 2A35A 5ERGB 1BXRB 2PKQO 3I9JA 4RA6B 5A71A 1NXXA 3HADA 5DWQA 4F60A 4ACAA 4UVGA 3W3AH 1WQ3A 4XQCA 1U2DC 4TSFD 1DC6A 4Y30A 2QB5A 3OA2A 3OEHA 3KKMA 5IMSA 2AZXA 3U26A 3Q1KA 2F55A 1ICIA 3TSZA 4E51A 2OKCA 4RZSA 2YHBA 3TLCA 2YY7A 2XZDA 1T8PA 3QFTA 5DW0A 4Z51A 5AUOB 4FR0A 4ED9A 1J06A 2DFKB 2XGOA 3LZDA 1XTIA 3S68A 3AUFA 5I9LA 1JA1A 1TZMA 5DBGA 2YHAA 2FCRA 4IIFA 5F9MA 1Z47A 1OH6A 2HCJB 4MP6A 4K6GA 5C1PA 2GBIA 2QD4A 4RJ2A 1O94D 1Q74A 2I55A 1GVHA 4ER6A 4MS1B 1KOGA 2FSGA 1X14A 5E3IA 4LDZA 2PX0A 4BHTA 1QV6A 1EM8A 4JLSA 1XEFA 2ISCA 4ZC1A 4EAQA 3A6PC 1Y34E 1F20A 4OHYA 4FB4A 1MO3A 4GS5A 2HQOA 2ZB8A 4HPXB 3UWSA 4YR7A 4A9AA 1J0BA 3VOTA 3LZ6A 1RBQA 3OD1A 1YZNA 3PGVA 4CM9D 1WDLA 2B7CA 3TIXB 3Q5EA 3S81A 3E8XA 4GMKA 2DPLA 2H9IA 4C0WA 1U7TA 4V0OA 2ORYA 1XHEA 1GD1O 1EB9A 1QDLB 1EZ1A 2BGKA 2C00A 1MJGA 2I71A 1TPZA 1F3OA 3D6HA 1E7RA 1TF5A 2J5QA 3ETCA 1U3UA 5HK8A 3ZE0B 4WOBA 2FFHA 1KP2A 2W2MA 2X5JO 2NXWA 2FYTA 3KELA 3E9QA 1A5TA 3OPNA 3I1JA 1Z7BA 1YIOA 1C0LA 1E6KA 2GT1A 3CPSA 3B7PA 2F3UA 3ESCA 5HKLA 3TBHA 1F5SA 4ZTUB 4WVFA 2AN1A 2Q99A 5CJPA 2VHJA 1RZUA 4GPBA 1KHTA 4P0QB 4Y2RA 3OQBA 2ZYVX 1PFKA 5CYFA 3QPDA 4KE8A 5REQB 4RY2A 3MMXA 5KWEA 1V2HE 5DOVA 2LZ0A 3R3SA 2R8OA 2K5UA 4II7A 4S24A 2WT4A 5FXMA 5L7WA 3K1AA 3DUFB 3GPBA 4G1CA 4OQQA 3V8QA 3C8DA 1ISGA 3JVUA 4KQWA 4WA7A 2HCFA 4RY9A 4CF4A 1ZSNA 5AQEA 2ZDHA 5TX7A 3WNQA 3ZNQA 3DO8A 2E89A 4MKXA 1N9ZA 3D8UA 3ETNA 3ETLA 4GOXA 5IH7A 2WKPA 3IJEB 2JF0A 5AIAA 3D0KA 2Y2VA 3TINA 5B30A 3G2JA 4IQGA 2WYIA 3IBFA 3TW8A 3A6JA 3K30A 1MT3A 4FU0A 4NBVA 4GIBA 1R0LA 3Q11A 4Y2VA 1W88B 2HK9A 4E0BA 4QX6A 3ZDBA 1E63A 3T5PA 4YJHA 4C5AA 9LDBA 3AHFA 2OHVA 3DXYA 4IJMA 4O08A 1P73A 3X0DA 4QZVA 3P9RA 1HDRA 3V4ZA 3WGLA 4JVMA 2Q5IA 4G97A 3GLFA 4MVXA 5CJ2A 3RS3A 3WLSA 3ZS8A 2ZROA 4Y7CA 1NXWA 1QUEA 1MAWA 1UK9A 1ECGA 4WUVA 3ASZA 1GCOA 2SCUA 2FEKA 5IT5A 1F4VA 1KRXA 1LKZA 1BD3A 1SC4A 4NNPA 2VUHB 3NBXX 3ZU3A 1JB9A 3BQMB 1ZVQA 3FGOA 4GKKB 3DOIA 2B4QA 4XR4A 3RYTC 3SQXA 2DCMA 1UPFA 5I47A 5EHZA 2FR1A 4AMVA 5K0BA 5JXWA 2HHLA 2MMCA 4FXPA 3ZXUB 1X7XB 1MB0A 2CYAA 3DNFA 3FTPA 5EZ6B 1SVMA 1M1YB 4DA7A 4DB4A 1U8CB 5IVHA 2HPAA 1JHZA 1AN9A 1I6KA 1I2BA 4FGKA 2BSAA 1A98A 1UBRS 2BISA 2IYUA 2R47A 3N8GA 3P2YA 4P9NA 3W5VA 6AT1A 5I48A 2Q5HA 2M1ZA 3URMA 2C4KA 2YIMA 3B5EA 2EOAA 1J1IA 3PKIA 4XWKA 1GDTA 1MQ9A 5ALRA 2D0PB 2BRUA 2BWJA 3LUJA 4W8GA 3LHIA 3D7SA 1Y4ZA 3TPCA 1NBMD 2ECOA 3OIFA 1KDPA 2ZUWA 4A8TA 1ZD9A 5CT5A 1T2AA 4BZWA 3LGAA 3NDJA 4ASUD 1TIPA 4BO6A 2AW5A 1G66A 3L4BA 1SNYA 1DDGA 3ND7A 4J7XA 4MVJM 3SS9X 4PFSA 1AQIA 1N92A 3FCSB 4H1VA 3VI4B 1VL5A 2CSUA 3A70A 5ESXA 4TPKA 4TYNA 1XDGA 1WOYA 1C1DB 4RHCA 2XQFA 2SBTA 2Q5QA 5I8ZA 2UZ4A 3GW8A 3M49A 1YR3A 3SF8A 3DXFA 2B8WA 2IYSA 2JH8A 3EIXA 3N58A 4PYMA 1ZJZA 5H9WA 1YGYA 4DCTA 5DGIA 3SSAA 4DBVO 1XVAA 3KVOA 5AKEA 3UHFA 4XGQA 5EGSA 1CE8A 2QN6A 4LVUA 1ZXLA 1A2OA 5E7MA 1XGKA 2UUPA 1H23A 2O20A 3EGVA 1UINA 3MMZA 1WS6A 3U3KA 3WZLA 5HG0A 1I14A 2B1QA 5AVXA 2HRRA 3FHLA 1GZ6A 1N8TA 1GN8A 3ZX4A 2WPDD 3OWXA 1USIA 5K8LA 2BEVA 2AR0A 1K5HA 3ZJVA 1X39A 5FULA 3VTAA 2YYSA 2QJWA 2VXBA 3P4UA 4ZYWA 2G1UA 3ABQB 4LKRA 3NPMA 2R48A 3AW9A 3Q7QA 1WA5A 5AM1A 3RGWS 5HYVA 2AT1A 3JYQA 4AN0A 4ZMBA 3SFTA 4IJ5A 3WIVA 3LLMA 2XPCA 4OYHA 1L4KA 1M0TA 1EVYA 4MR8A 4QBKA 5CHYA 5K7SA 1EGAA 1JLSA 3HKEB 3WGNA 3NAZA 1R50A 1XDSA 5EHGA 3WIUA 2AA3A 1P7WA 3MAAC 3QJGA 1E59A 4FYKA 2CE2X 3EQ6A 2C92A 1TJNA 3E81A 2GM5A 3I6BA 3L8CA 1QZZA 5DTIA 3H4TA 4TSFA 5K05A 1JIVA 1IK4A 2FUG1 2OZLA 2QLJA 4D92A 3D4OA 4HYQA 3TZHA 1LSOA 5L53A 3GDGA 1T10A 2GZHA 2X58A 1C7RA 1U8FO 3ZNPA 1F2UB 1Z4LA 3L02A 5E38A 1G19A 1P1BA 3F8SA 3V2UA 4CV0A 2CV1A 1SVOA 2Z95A 4KQKA 2YHIB 1F0NA 1OFTA 1W4RA 4WBSA 3UJ3X 3BXHA 3GG2A 3VC1A 1B6RA 3WS7A 3N2GA 9LDTA 3PF9A 1BJKA 2NUTA 5JQGB 2F9MA 2ORED 3FDZA 1R15A 3U3XA 1UXHA 4D57A 2X9NA 4GI7A 4ZYZA 2P6RA 4E94A 5BSWA 1KJ8A 2DT8A 4DADA 3VXKA 1TUBB 4ZVQA 3KUKA 4G89A 3SS7X 1V11A 1QHEA 4KTVE 1PR2A 4YC7A 4BWVA 2O2HA 3I5AA 4KXFB 1FS6A 5EHNA 4F6CA 2G3YA 3CNLA 1N1DA 1VIVA 2E82A 3PR2B 4MMYB 1IXYA 4YO7A 3QUQA 2P8SA 5AK4A 4ZVVA 1R66A 2EWWA 3I2HA 4WDRA 4IQ0A 4ZN6A 1MEOA 5EJ5A 2FXVA 2O5EA 4J2OA 4OXNA 4CM8A 4D80A 1ONPA 4GOMD 1U9CA 3U13A 2EJTA 1TJPB 4ND8A 4WHMA 5C5CA 1SG6A 2PU5A 1UIMA 2HDWA 3G1WA 4JI6B 3B3JA 3I6MA 2VTBA 4BUJA 1DKRA 5D3MB 1ZL2A 2GM3A 2XBLA 4XYMA 1FUUA 3EVCA 4ZAXA 3OZRA 3V7FA 4PINA 2AHRA 4EY8A 1RC0A 3T95A 4GL2A 2OM2A 1VL8A 3CXUA 2HZ7A 4N39A 4L9SA 2ZAOA 3KWLA 1KH1A 1DEHA 2G70A 2P2GA 1UOEA 4NPCA 3SJCA 2ZRJA 3U3DA 4D3DA 1MBZA 4NFYA 4FZVA 2MU1A 421PA 1IVNA 1UBJS 3THWA 1IJKA 2OXFA 2ZSEA 3EVGA 4O2BB 1RXSA 4UC0A 3P0HA 1Z5VA 4EB0A 1UDBA 1ZHFA 4GVLA 4S04A 1MA0A 4QOEA 4BQIA 3ZVMA 1JRLA 2VIIA 2ODAA 3I83A 3KE8A 3KPJA 1SUWA 3N2NA 4HEJA 4OG2A 1HFJA 1CRLA 1UBHS 3DEIA 4PYNA 2HD4A 4QE3A 3TKLA 2FV8A 1U3WA 2I8AA 4E15A 1NBWB 3A4TA 2WFAA 2GHQA 1YRLA 1PG5A 4DF3A 3NLLA 2ILTA 2MSWA 4P4GA 2V7QD 1GR1A 2REXB 3OAAD 3DMFA 3ODPA 4WLFA 1HMYA 1KYWA 4P7GA 2ZETA 4P4LA 4DNOA 1J56A 3CT6A 4J1TA 1BWQA 1AQLA 1J0AA 3EWSA 4BKMA 4B75A 3U3ZA 3KSAC 3LOUA 1D2MA 1RWBA 2OECA 4JT2A 4DEVA 5F98A 3OZ7A 1E20A 2HBRA 3U31A 4DR6B 3DB2A 1E0KA 5JQGF 1A7KA 3EDCA 3PXUA 2CNDA 1J8FA 2JIZD 2PXHA 2XMZA 4TMKA 4X45A 4YAEA 5AKHA 4ITRC 2XITA 3Q3JB 5F7OA 5AHWA 4FYMA 2HLPA 3ABZA 3H83A 3PLAE 1HQCA 2ZYUX 1CR4A 1E3WB 1X8KA 4V0MA 4WH0A 2YVKA 4IF4A 3LQYA 4AKGA 2KE5A 2WVHA 3DFUA 1T13A 2JI4A 1POWA 1LI5A 2RJNA 3ROFA 1OMOA 3WHIA 2WQ6A 3CY6A 2YJGA 4A03A 1JLRA 4ASUA 4G0PA 1R0WA 1VECA 2LPMA 3P2OA 4BLOA 4E2WA 3A6LA 4OXXA 1QO7A 3TW6A 2XB2A 2IS2A 2VXOA 3HR7A 1TW3A 1ZM4A 4AQDA 1KQNA 1TYEB 3BMXA 3VDNB 1RLUA 1XZLA 3IMFA 2FG6C 2H18A 2ZWVA 3FFTA 3I6ZA 4KLZA 3CINA 3FOFC 5IAEA 1OI4A 1BGVA 3G5UA 2L17A 4GMFA 4UM5A 5LP1A 2GCIA 2WMNB 3KYDB 4DNXA 2Y6UA 3I61A 1OX4B 1M2FA 3A10A 4HN4B 3DM9B 3PUZA 1GPJA 1A1SA 1Q2UA 2GXUA 4XGIA 1PS9A 3WRYA 4ARUA 3L7MA 1FVFA 3FPSA 3V1LA 3IR7A 3V1NA 3F6YA 4B3RB 1EX9A 4JOSA 7ADHA 2BF7A 2A92A 1N2IA 1H22A 2DX7A 3DEFA 1ECCA 3Q15C 2PMWB 3UW1A 5TIIA 2BHNA 4FOSA 4LJ4A 5KOIA 4O2BF 1ADYA 4BNLA 1XXHA 5DCWA 1NJSA 3VR5D 4GPTA 3F1LA 4S1OA 5EWJA 3T7AA 4KI0A 4RGYA 5IN5A 3V4RA 4BVFA 4AQYB 1DQPA 2D7JA 2FQQA 5EAIA 1SVIA 3CSSA 3RSOA 4QYMA 4D9JA 4ZDIA 1ECBA 4UBIA 3OJ0A 5AM2A 1WWKA 2GNPA 1QH8A 4Z7QB 1CWUA 1ZRNA 2YN2A 8MHTA 3NYRA 1I4OA 3PGKA 3IAHA 5JS1A 1LW7A 1M5UA 2B92A 3HCWA 1MAAA 1TA9A 1UJBA 1UPBA 2IHTA 2OE2A 3JATB 4PU0A 3X1JA 3TUIC 1I3OA 2KW5A 3EFEA 3R6TA 1Y9ZA 4QICA 3G88A 3V8EA 3WLKX 3RSHA 3U4QA 1X94A 1IN7A 2BGJA 2HRBA 3CWQA 1RRMA 3BEOA 4IV5A 1J8VA 3CE6A 3GD5A 5EEHA 4DRXB 1PUJA 3HUUA 4RK7A 2OHHA 4UTZA 3ODGA 4OU4A 2PAFA 4F46A 4MGKR 3A9CA 3LCJA 3OTHA 1QO0A 2ATCA 2HGSA 2R7AA 1WX1A 1TQDA 2VPTA 3CGGA 5FB3A 3SM3A 4FGUA 4FZ3A 4WOJA 5ICMA 3WLHA 3P71T 4ID9A 5BMVB 4FKMA 3RVPA 3G8BA 2X2PA 1JQBA 3RTCA 2DVMA 4EY7A 3PTLA 2D5BA 3Q85A 1BZYA 3NKFA 3VC3A 3ZN2A 5D7NA 1PX2A 4KC0A 1XLTA 2CB0A 1GZ4A 3KSUA 4YUAA 5KQRA 1DOHA 4II3A 3TPFA 3TB6A 3PYLA 2B1RA 4IHAA 5DGTA 2ZIUB 2ZIWB 3AKDA 2X4LA 3CCCA 4HH1A 4BX8A 5EJ6A 2R1VA 1JG3A 2CHFA 1EVJA 4LNHA 1NRWA 3WNBA 3KPYA 4MUAA 3HPQA 2HLDA 3O21A 1T2UA 1MABA 1P6UA 2FX3A 2WSSA 2ZSDA 3P52A 4PLWA 4RA9B 5HDBB 4Z3DA 2WU1A 4J7AA 3WYDA 5K9ZA 3AERB 2XVMA 2JAXA 1ABBA 5I4BA 1QK4A 4R41A 3U60B 2H2WA 1ZOIA 4IVPA 2CDNA 1JKXA 2DPYA 4E13A 4YHHB 2IZ1A 3OE4A 2CL6X 5GADl 3WI7A 1T5BA 3K94A 3ONWA 4NJMB 5CBPA 4Y6GB 2WIJA 3T6KA 4EF4A 4EZIA 3L0IB 5JPIA 3B6MA 4HX2A 1VBMA 5IBRA 5IZCA 3T3IA 1JHQA 1Y4AE 3NVAA 4Z4QA 2GD0A 1T36A 1YDFA 1BCRB 1RRPA 1N75A 3ABRB 5JNWA 5JEEA 2F1KA 1UANA 5AVOA 3RVMA 2NUAA 3ZEAA 5B7NA 1MW8X 4A0HA 2H5EA 2PM8A 1DBIA 1RFGE 2GDZA 3CUYA 3UMYA 1Y6JA 4C7OA 3G85A 3PEEA 3TQFA 1YZLA 2D5IA 2V4MA 4IHJF 2IHBA 1BJRE 5JZBA 4FJ2A 4PPGA 4C7JA 5JTUA 1WJGA 5HZHA 4K1LA 1I2AA 1SUSA 2AQHA 2I99A 2NTEA 5IKEA 2M32A 4G0MA 2JAPA 3OMLA 5K3BA 5JXHA 4QNMA 5IT9A 4MGYR 2O8EB 2PL9A 2C3YA 1EWRA 3M1AA 2V7BA 2JBAA 1WHSA 5JJLA 3SC2A 4OBBA 3NHLA 4EABA 1Q17A 3KKZA 5DHQA 3SLRA 2HX1A 3AY6A 3C3BA 4HTFA 4QPPA 1P2BA 2PV0A 3T4PA 1DT5A 3G82C 3UV7A 5D6NA 1XTQA 2EQBA 5CDFA 2WW8A 3IQHX 3VISA 5LMUB 5IZ4A 1GCAA 3N0XA 2XHEA 3C85A 2JFBA 4HJRA 2POCA 1EUYA 1XZFA 4AXXA 2K2WA 4I1UA 1DXYA 3CA8A 3G2HA 2ZAMA 2J3DA 3MT0A 1XRMA 3MOSA 4F9EA 3SSNA 4M87A 2I7DA 4YAOA 3NATA 1UPUA 2PD4A 3PHBE 4CMCA 2J9GA 2JLQA 2R00C 5HIJA 2I62A 2FJUA 4BQEA 4NBWA 2F17A 3OTGA 5T67A 2Q3JA 4WAUA 3SFVA 5CFMA 1SHLA 3V34A 4BU0A 5IJ9B 1IN5A 4Q7MB 2V7QA 4MUHA 1KYXA 4OM7A 5BMVF 5K2MA 2IC5A 3PFKA 2KLBA 1W94A 4LNUA 1HLDA 3D6UA 3QV1A 5K1ZA 1Q19A 3OQHA 3LXXA 1L1EA 2VNKA 4XWAA 4MQMA 4U63A 5D87A 1AG9A 5C37A 4U8GA 3AG5A 3L0OA 3PHGA 4JP1A 1R6VA 3E3LA 5C52B 3ZD6A 1ONBA 1H8HD 1Q12A 1XIVA 2YASA 3ZHVA 5I8WA 4EHHA 1SBNE 3TRIA 4BP1A 1PJ8A 5DYTA 4ZDWA 1YASA 1A9PA 4DMCA 2Z1DA 3FBGA 2HSZA 4TLEA 4BV9A 3UAWA 1E2EA 1S2NA 1WDMA 2P2YA 3V8PA 4BIMA 4XLTA 4C4RA 1ENPA 5LZ4A 3ZVRA 4B3HA 3B3GA 4RHXA 3H04A 1KO5A 4ZAYA 2G1JA 4YJFA 2I33A 2OKGA 1C1XB 4YCMA 4MVJI 4NARA 2B8JA 1KMQA 4PLYA 1AA6A 2B35A 3AOEC 2EARA 3P19A 1JFTA 4QOJA 1HC7A 1PR9A 2RGDA 4NFHA 2CV2A 2E6KA 4MW9A 3DMGA 1JHMA 1AV6A 2Z4TA 2IV2X 1TZKA 2AB0A 3IPYA 4IDGA 1JEQA 4LHEA 1Y8RA 4ZT5A 3TNDA 1L5RA 4RKQA 2VDWA 5MN5A 1E3JA 2VRCA 1L7XA 4ZZ1A 1Z0FA 2QL5A 1K66A 1NULA 4MYTA 3EASA 3CBQA 4RLQA 2COUA 3LWDA 2PY6A 3B3QA 1YBFA 3QE4A 4QPCA 1WAMA 4YMIA 5JJKA 1CEYA 3DKKA 3FVRA 4HDCA 1G5TA 3LQRA 2I3GA 4ZC8A 4AY6A 1J7JA 1MJHA 4CLRA 4MLZA 5KSZA 1ZWKA 3C70A 1WSBA 3DVSX 3FNEA 4KVFA 3X1ZA 3DCJA 1CUSA 3IPLA 5AK0A 4DIMA 1JKJB 1I1OA 2GJAA 3DTTA 8ATCA 3TQQA 4CTMA 5LMZA 2OBBA 3AY0A 5EIOA 1WVIA 2WSBA 3MWDB 3NIFB 2A84A 1NQVA 2XJ9A 1K8ZB 1Y1LA 1Y1RA 3DD1A 4DCOA 9GPBA 3OLXA 4PO8A 2IY9A 4E1AA 4KRFA 5FD8A 2P5YA 4RDIA 3NWEA 1M1NA 3A1DA 4L8GA 1VZ3A 2D06A 4N6OA 4EG8A 2NAFA 2R6CA 1R4AA 3WRYC 1BXGA 4CIDA 3Q1LA 1TJYA 5JYEA 3TCKA 2XY4A 5JNTA 3OCZA 1IWBB 2V74B 4URWR 3L8GA 4I50B 2WJ6A 3KVVA 3N2KA 4FX2A 4MPDA 4TV9F 3JRXA 2JGNA 4YRQA 3FTCA 5LWHA 2JI8A 5E2BA 4YCJA 4IBOA