4QM6A

Structure of bacterial polynucleotide kinase bound to gtp and rna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structures of bacterial polynucleotide kinase in a michaelis complex with nucleoside triphosphate (NTP)-Mg2+ and 5'-OH RNA and a mixed substrate-product complex with NTP-Mg2+ and a 5'-phosphorylated oligonucleotide.
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Transferase/rna
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qm6A00
2GBLA 4JLDA 2Q9AA 3U3JA 3RRZA 3K0FA 1J99A 2A5GA 5KNBA 1GP2A 3HJNA 4HI0E 4QOSA 1A4RA 3T1QA 2CE2X 3VX4A 3SYNA 4AKEA 5FR2A 1PLJA 1ZD8A 4IRUB 3O8BA 5TMPA 1KGDA 1GNQA 1IN4A 3EIHA 3G82C 4UNNA 2C9YA 1Z08A 2JIZD 1E2NA 3LQQA 3QI2A 1AK2A 2PH1A 5DISB 1PVOA 1AZSC 5DN6A 1CP2A 3FHOA 5B30A 3ADKA 2JA1A 1ZNZA 1TF2A 1HYQA 2B7BA 2PCLA 3Q72A 4TT3A 1P2VA 1OHHD 3D3QA 4JZKA 5FL7D 1Z2CA 4BASA 1OE0A 3AP2A 3IQWA 5DLQC 1CR2A 1P5ZB 1G3RA 2Q3HA 1SVMA 3KB1A 5BN4A 3C5HA 5AK0A 3B1WA 4JVNA 1KMHB 4GSYA 3QPWA 3MWJA 3GJ4A 4DT1B 4OHYA 1ZNYA 4QGGA 3W8RA 4BLSA 1KKMA 3FMOB 1QHIA 1SKYB 2P65A 5TVKA 5KU1A 4CF7A 4ITRC 2ZUBA 3EA0A 2WHXA 2WZQA 3GLFE 1F2UA 4W5HA 2FSFA 1XXHA 1QHSA 4KV9A 5FPKA 2OILA 2C5LA 4DCSA 3AKCA 3B2EA 721PA 2ZRMA 1M7GA 3T1TA 2E1RA 1EFHA 3HR7A 3IQXA 5FPTA 3VU9B 1G8YA 3MG9A 5SZJA 2FSIA 2CL6X 3PEUA 1CULC 4OJKA 4IOMA 4TLBA 1FTSA 1NN0A 5CDFA 5HKKA 4EPXA 5M04A 2WWXA 5JJIA 4NP6A 1HY3A 1EFTA 2XB2A 3T5GA 1UKYA 3E1SA 4DEXA 4PXAA 1E0SA 1A1VA 1ZCAA 4C0QC 4YONB 4XVUA 1GILA 1LTQA 1KY3A 4EJSA 3ZIAA 1G21E 4O25A 4OQFA 3BFVA 4BFTA 5G40A 3R9IA 2A5DA 5KOYA 2PX3A 1YJ5A 1XPRA 4BFUA 2WJGA 2UZIR 5LD2B 4CEIB 4JLBA 5BW8A 2P5SA 4TQAA 2F9MA 2XAUA 3DOFA 2FZLA 3RWOA 2HCJB 1VG1A 2VHCA 1OV4A 1A2KC 3W3ZB 3PIRA 1AN0A 2J3EA 3FGNA 2QAGB 1Q0UA 1BO6A 4Q7MB 4URYR 1WRBA 1TAGA 5DHAA 3SE0A 1OH8A 1TL7C 1KZ7B 3MWKA 1GKUB 4XVQA 3AKDA 4CDGA 3BB4A 3IDQA 2H17A 2ZR9A 5CM9C 4QBGB 1W36D 3CF2A 4FI3C 3KQLA 4DWJA 3Q7QA 3WNDA 5AUOB 2Z4SA 1O87A 5DN6D 1FPMA 3K9HA 3WYAA 2RH5A 4EPWA 4YMTA 4TT3D 4G5RA 1ZNXA 3ZGXA 1KHTA 2ZJYA 1L7VC 4OQXA 4ARZB 2G1JA 3NBFA 4MRPA 3NC0C 3QF4B 4JKYA 2ZS8A 2Q0HA 3R7WB 3AF1A 3AUYA 2ZIAA 4AG5A 3P1JA 1ZUNB 4GBMA 2J0UA 4RFSB 2V54A 1W4RA 2PZFA 4IDPA 2IYWA 4UJ3A 5E3HA 3CBQA 4WOPA 3TVDA 5HZHA 5GVSA 1SKQA 2VP6A 3C4JA 621PA 1S96A 4Q9IA 3C16C 2VYFA 4S2EA 4BE7B 5J47A 2XX3A 2ZJZA 1AS3A 1IXSB 1Z6XA 3BORA 4EQ6A 2CJWB 3TBKA 3ZD6A 4B74A 2GF0A 1F2TB 2B8WA 2P2LA 2QMOA 5FFMA 2GXQA 4H1UA 5JMTA 1IONA 1NLYA 2QPTA 1TU4A 2HT1A 2X8AA 3EPHA 2GK7A 3GJ5A 4JLMA 2B7CA 2WSSA 4ON9A 3K70D 1U98A 1W48A 4B6EA 2RGXA 2WWIA 1SVWA 3N5CA 4LJ7A 3PCRB 1JQJC 1KNXA 2J9RA 3NBZC 4I4LA 4PHGA 1NLFA 4PQRA 2F3RA 2EFCB 2XNSA 4HB2A 4EIWA 2GILA 5HKKD 4PO9A 4A8JC 4JBYA 1R8QA 3SEAA 1ZD1A 4KAXA 3QUSA 4M0LA 3J81k 5H70A 4BFWA 3E2IA 1R10A 4N0EA 4U7DA 1KJWA 1JR3A 3TUIC 2CCJA 2GXAA 2IEZA 1DE0A 1KJYA 2O52A 4G5SA 1GL6A 3VR3A 3DZDA 3SNHA 1U99A 4IVPA 4PPNA 4Q18A 2FF7A 3LVRE 1E4YA 4OK6A 3QXCA 5DGXA 1XCPA 2OG2A 1Z0IA 3UMSA 1Z0AA 3WYFA 4DBLC 4LJ6A 2G77B 3IEVA 3SS8A 2GNOA 5D3MB 1Z22A 1UAAA 1JQLB 4WXRA 1E2HA 2CLSA 3A37A 3WXMA 4OI2A 4AC9A 4Z1MD 5AUNB 1JPJA 1UDWA 1ZIPA 5EP2A 3TSWA 4TYNA 4CGZA 2FGJA 1ZCBA 2QQEA 3CPEA 1E98A 1FNNA 1Z0FA 5L3RA 3AV0B 4A92A 4CEJB 1W0JA 2V8OA 4ZCMA 3SI7A 5KNDA 4DKXA 2PT7A 4AI6A 1K8RA 1VMAA 2ZYWX 4Q4HB 3UANA 5JHGB 2GJKA 2AK3A 1ZUHA 4IOKA 4LV5B 4XWAA 1KY2A 1CR4A 3RS0A 1LVGA 1W0KA 3IO3A 1XEWX 2YYZA 4KFRA 4CYMA 3GLFA 3BFXA 3FFBA 1X1SA 4RSGA 4OQLA 2GDJA 2Z0MA 1E9CA 1ZM4A 1LY1A 1HEIA 1HE8B 3QEJA 4F92B 2UKDA 1CKEA 1VG0B 821PA 4MDEA 1CJKC 1ZC4A 3KKMA 5EP1A 3KFXA 1BYUA 2ZS7A 2IUSA 2VRWA 1E2DA 1E1QA 1KI4A 4B43A 3THYB 3AVPA 3MFYA 1VPLA 1Q1ZA 4RCYA 3LBHA 4XWOA 2D7DA 1ONBA 2V1XA 2OCBA 1FMJA 3ADBA 3LLMA 3A36A 3BIFA 1D6JA 1TQ2A 4DC9A 4Q1FA 3TE6A 1VIYA 4PPQA 4E07A 1NG9A 1ESNA 4PANA 2XXAA 2WSSD 3KQKA 4Y0AA 1U8YA 2F43B 1Q1QA 1AZTA 1XWIA 3EIEA 1I4DD 4NMMA 1G41A 3RC3A 2ZI5A 3LA6A 2BBWA 4W9MC 4XSGA 1XZPA 1N6KA 3LLUA 4NCHA 4XVRA 4B3GA 5FBLB 1Z0JA 4ACAA 1NMXA 4UXIA 1G5RA 1E32A 4LBVA 5EQTA 3MJHA 5AR1A 1IN7A 5F9HA 1JR3D 1GL9B 1UM8A 2OEPA 2Z43A 3B9PA 3RWMB 1QHHB 2J7KA 3A4MA 4Q9LA 5DIFA 1Q3TA 1N0VC 3ZLJA 2VO1A 4ZCIA 5DE3A 3GPLA 4B48A 1NVXQ 5DYGA 2JLZA 3MSXA 4B73A 5AJZA 4BECA 2OCAA 2V3CC 4CEHA 1G8PA 4TZ0A 4LHXA 5K8TA 3N70A 4P4SB 5CB6A 3QSYA 2BM0A 5JS8A 3IBYA 3DVLA 3WNBA 2VP4A 3GLIB 1E2EA 4NYMR 3B6EA 1RW4A 2WAYA 4WZAE 4TLCA 1W0JD 3RDPA 3A4NA 1NL3A 3EA5A 5FH9A 5KUTA 1MO3A 4MKIA 3SJAA 4H9GA 1PUIA 3RSLA 2GZHA 1IJFA 3EASA 4A0FA 2LKCA 1MT0A 3BERA 4K8OA 4C2UA 3B82A 2QMHA 1N0WA 1RC8A 1LS6A 2D4HA 4H1VA 1OW3B 5P21A 3F5FA 1W0KD 2OLJA 3AB3A 3OAAA 1JALA 1DO0A 3QKSA 2IF0A 5DI3A 1JEDA 2CVHA 4DDUA 1KO1A 1GRRA 3H84A 3IHWA 2O8EA 3GEHA 3WHLA 4FMDF 1ZM9A 4DDWA 4RZ2A 4DCVA 2QT1A 3NXSA 4B44A 3MAAC 4B47A 5BWMA 3E5HA 3QIAA 2OUKA 1E2GA 2ZRDA 4A8JB 4Q5IA 2VLIA 4JYCA 4YXWA 2JLRA 2R8RA 4PZLA 1CXZA 2EWVA 3EWSA 4MRRA 1E9DA 1E2QA 1E1QD 1RZ3A 3GFPA 5BQ5A 3U5ZB 4DRZA 2PMDA 1SXJC 4HEJA 2ZAMA 4JVSB 1G1MA 2GCOA 2WIAA 3FWYA 1ZM3A 1S8FA 1WP9A 4OK5A 2QGNA 4CIDA 3THXA 3LWNA 3QJYA 2ORVA 3ZDQA 2O8DA 1NVWQ 2D2EA 1J70A 4NZYA 1QG4A 3CRW1 4LJ8A 2REOA 3K09C 1KSFX 1T3HA 1Z0KA 1ZRHA 1A82A 1FNMA 3OHMA 3AF4A 1Z3IX 3NEJA 3KTAB 4PZZA 3IO5A 2WKRA 4M21A 1OXXK 1R5BA 3PUWA 2QM8A 2ZETA 1AQYA 1WF3A 2OCPA 2VL7A 4V02A 1GNPA 1GFIA 5FUVA 5GJVC 4NYJR 3ZQ6A 5JJKA 3OIVA 4QL3A 2A78A 3CRMA 4LWZA 4GP6A 1DG3A 1ZNWA 1JR6A 2ECKA 4DLVA 1GITA 1Q21A 4JT4A 2CK3A 2RAPA 5KTYA 3U7GA 4JJZA 3SU8A 2X2EA 1D2NA 3MCAA 1S3SA 5FBRB 3O47A 1XP8A 3AVUA 2G3YA 2HDNB 4R2IA 3G0HA 4RD4A 4QM7A 1JB1A 1YRBA 2KE5A 4X8MA 3GJ7A 4MKHA 2DY1A 3KJEA 3IHLA 1MABA 4QG7A 5F3WB 2OFWA 4IVQA 4HLUC 2WJIA 4Q01A 3WBKA 4DCUA 1DG1G 2ONJA 4P33A 5KSPA 3RS4A 4TN1A 3EXAA 5CB8A 2HUPA 3SFVA 3CZPA 5FTJA 3VR4A 1FX0A 5C1BA 2EYQA 1YZKA 3OAAD 3IIKA 4IDNA 1E2FA 1QG2A 1OF1A 2BKEA 4NCNA 3GLGE 3THWA 1KI6A 3U44A 2HXSA 1QDEA 2BVNA 2GCPA 1P2SA 1T3SA 1A7JA 3LBNA 1W4BA 3L82B 3KX2A 2YKGA 4RZXA 1ODFA 5AJXA 1G7TA 5TXGA 4OKSA 4V0ME 4FMCF 1SHZA 2A2ZA 4YXWD 2WTUA 3B1XA 4IKEA 3RANA 3RRNA 1D2EA 1OPXA 2X2FA 1U94A 3ZH9B 1U2RA 4V0KA 3D8BA 1KAGA 1FUUA 4DUGA 5F2EA 1BOFA 3CPHA 2OESA 2IYYA 1DAIA 2IUUA 1E9FA 2UZ3A 1T3LA 4EDHA 3Q9LA 1E2KA 3L8ZA 3R9XA 2LCFA 2YC4C 4EPTA 4AYWA 5L3QB 1XBTA 3DMNA 4D0GA 2WWFA 3SYKA 4C0JA 1FOEB 1KYIA 1H8HA 2WJVA 2XJ9A 2VP0A 3KFVA 1XJ0A 1FP7A 1U0LA 4A0HA 3D6TB 5CITA 2FEMA 5LDDC 4PSAA 2WV9A 2I4IA 3EZ7A 3SJZA 2BWJA 1G16A 1AM4D 4F91B 1N2CE 2AXPA 3GJ6A 3Q8XB 1G3QA 1E2MA 2ZJOA 1WDTA 2ODWA 1QVAA 2ZSFA 3TSOA 3KKOA 4I81A 3GD7A 3CNLA 3H0KA 1ZAKA 3UATA 2CK3D 1I2MA 2WWWA 1Z6AA 1KO5A 2PZEA 2QSZA 3M4YA 4JLJA 2YWEA 2GBLC 4D6PA 3P32A 1XCMA 4KSCA 4IOJA 3C14C 3PVSA 2VA8A 4KFUA 3CR7A 1R7RA 4KVGA 3RS2A 4EUNA 1N5IA 2P0EA 3BH0A 3NKVA 4C0LA 1CJMA 1W36C 1C1YA 3D7MA 1OYYA 1CIPA 1OFUX 4HAXA 5KDOA 3R8FA 3KQHA 4GI7A 2VIIA 4BFYA 1S0UA 3EZ9A 1AQUA 2C98A 1KSGA 2CLDX 1GM5A 1M2OB 3KKNA 2ORIA 2OV2A 4YMUA 2YNMA 4JLNA 4EFMA 3VR2A 2H92A 5JECA 1W44A 1ZU5A 1KDTA 3X1DA 4OHWA 1RYHA 2DR3A 1E9RA 4QHSA 2P3SA 4TZ6A 3BAFA 2ZRJA 4OI0A 1Z6YA 1HV8A 1UDXA 4N0DA 3K0SA 2O0HA 4ZDJA 2ANCA 1KKLA 1WBBA 3KQNA 2ZRCA 3F3YA 1A5TA 2FNAA 2FOLA 2IYUA 3UG6A 2GAAA 5JZVA 4ZPXA 3PR1A 2ZEJA 3KUCA 3K53A 4TTRA 3U61B 4E09A 4DUGD 3BD9A 2WMNB 1SVOA 3NBYC 3B1YA 4LZZA 3W34A 4BFZA 4BZXA 3Q7PA 5FUXA 4RY2A 1XDBA 4C0KA 2QTHA 5FOXA 4KODA 4P4UA 3HU1A 4JYBA 3EG5A 1IM2A 3HU2A 4Q1DA 4B3XA 2ZRPA 1H8HD 5IF9A 3IPYA 5HE8A 1VG8A 3Q85A 5ELXA 3IUYA 4NE2A 2W2TA 1UEIA 2PEZA 3H2YA 1WQ1R 4FD2A 2CCKA 1OKKA 2E87A 4FMDB 2LWIA 2WM9B 3HPRA 2QZ4A 5L3SB 1XPOA 2OBNA 1B0UA 1XFAA 1XRJA 2QAGC 1Q12A 4EJSC 4PC3A 4TLEA 4JSYA 3V9PA 4M8NE 3K0CA 3O8CA 3CW2A 2IYSA 4JKIA 4V03A 1XJCA 3SOPA 4Q4JB 3V00A 1KJZA 3EC2A 3LW7A 3LXXA 1SVKA 2NOAA 2R65A 3MLEA 2C9OA 4L4UA 1IN8A 1G4UR 1LF0A 3SZRA 3IBGA 3KJHA 2B21A 2FFHA 4LGMA 2D2FA 4LYJA 4DLTA 2ZRFA 4D4JA 3QXJA 4A9AA 4E5UA 1E9SA 1FFHA 4OK3A 3GLGA 4C7OA 3B60A 2NGRA 4NPHA 2JEOA 2CHQA 4DLUA 3VQTA 3ECCA 1GL7A 2PJRA 1V5WA 3TR0A 4Q00A 1R8SA 3CR8A 2WKQA 3EW9A 3DOEA 3RRMA 1HQYE 3EPJA 2OO7A 3DKVA 4V0MA 3AUXA 1XD2B 3V4FA 4LHYA 3X2SA 4B34A 4M1OA 4RJLA 4OI4A 2HYDA 3QKRB 1KSJA 4PC1A 2O8FB 4KYIB 2QBYB 1XF9A 2D3WA 3FPAA 2IYTA 3AGPA 2VSFA 3M6AA 4YLGA 2AXNA 3DM9B 2RKOA 4QHYA 1KI7A 4MA4A 1U81A 2OFOA 2EQBA 4JVLA 3A4LA 1OXSC 1OH6A 1TUEA 2CLCX 4BPBA 4M9XA 2O8BA 2OXRA 5TDHA 5J40A 1ZW6A 2ZSAA 2QTFA 1HQCA 1M7HA 3CUEF 3FE2A 2VF7A 5EP4A 1XU4A 4MITA 2VF8A 4DSTA 1VYVA 2CCGA 2H57A 3W6OA 2IBMA 2QA5A 4QGFA 1JAIA 5CJPA 3K0FB 3CKLA 4B33A 2Y8EA 2A5JA 1SZPA 1AA9A 2YWFA 2ASEA 3ZVRA 4MUAA 3H4MA 2ERXA 4LYAA 2IYRA 4JSTA 4YDHB 2EFGA 421PA 3LRPA 1OKKD 3DEFA 5DI9A 4TQUS 2GJAA 5JLJA 3FOZA 3MWLA 3OIUA 4UNPA 2WBLC 5J4KA 4GZMA 5KPDA 1T6NA 1W36B 2NPFA 4UQOA 6Q21A 3V4RA 4MRNA 4Q03A 4Q1AA 3U7EB 4FMCB 4WZ6A 5G53C 3HYRA 2DWPA 4ASUA 2ZSDA 3B7GA 1L4YA 2FPLA 2R62A 1D9XA 3W9YA 4PQFA 1Q57A 1N6RA 3PUXA 3FKQA 5E7IA 4US1R 3CF6R 3WMGA 1KK2A 1DAGA 3P4XA 1TQ6A 2CEAA 4FN5A 1G20E 4PR0A 2HCBA 2D62A 3SDZA 1NY5A 2BJWA 4MDFA 3SBEA 1Z0DA 4HUQA 2VH5R 1E0KA 1Z5ZA 4QGAA 4LPSA 1EFUA 2ZM5A 5EE1A 1T0HB 2GXUA 2WMOB 2EFHB 3U7FB 5AJVB 5AJYA 2QRZA 2PEYA 1F2UB 4CZ2A 1COWA 1XXHB 2OBMA 3VR6A 3LO5A 1W1WA 2HF9A 2WVJA 1VG9B 4L9WA 3K70B 3UWKA 1MO5A 2KJQA 4UXJA 1EX7A 3GLHE 4XOIA 4Z8YA 2YWGA 4IDHA 5JWHA 1RIFA 2W0SA 2V55B 4D0LB 2F7SA 1IXRC 3QXHA 1QZXA 2ODNA 3IPXA 1VCNA 1U9IA 4HB4A 4Z1MA 2YJTD 4BZPA 1G291 4RKEA 2GJ9A 1Q3HA 4Q9HA 1IN6A 4ZV4A 2O0JA 4M1WA 3W90A 4EJSB 4HZUA 1XTKA 4POAA 2QGZA 4TMZA 5KDDA 3LQRA 1KMQA 2NO9A 3HYTA 4GOJA 4D0NA 2F1IA 2XZPA 3TH5A 1M74A 2OLKA 4QBHA 5JFGA 1F3OA 1F6BA 1II8A 3NVAA 4G5QA 5JJLA 5IK2A 5C46F 3ZZTA 3GLIE 1NBME 2ZRGA 4LDJA 2JLWA 2AHOA 4RZ3A 2GZAA 4IEIA 3WHKA 2H5EA 2IXGA 2ZRNA 3GFTA 3CWQA 4URXR 1HE1C 4QNMA 2REBA 1E96A 2Q3MA 2ZXUA 3D31A 3R20A 2H1LA 3I1FA 3KXKA 3FFAA 4MGZR 4P3YA 4ASUD 3VNVA 3KJIA 3ETLA 3BH7A 1NLZA 2NMVA 1FQKA 3A8TA 2JJ1A 1G3IA 3LDAA 1FMLA 1EG7A 4GOXA 4D4LA 1TTTA 2FDCA 1FP6A 2RGNA 4NYIR 3WMFA 2J0UB 3W8NA 1OLOA 3M1IA 2XZLA 1ZUIA 3QVVA 4B6FA 3QPUA 2GHIA 4BLTA 3I8SA 2QPOA 4MYHA 4M22A 2BMEA 2GVDC 2Z6VA 4JLAA 1U8ZA 1GUAA 4LPKA 1ZINA 1CRQA 4EQ6B 3L43A 4LCBA 1XPUA 2BDTA 3BGWA 3RNLA 2JAQA 4LRWA 3EIQA 4DLSA 5C4GB 1Z29A 3U4QA 4Q1EA 1COWD 3DL0A 2QSYA 1KTVA 2G1KA 1TF7A 3FYHA 4P0TA 2NIPA 4TL9A 2H7VA 4NTZA 2IS1A 2WJYA 3SHFA 4Z51A 5J5CA 4C2TA 2H18A 3ZS8A 1U8AA 3GP8A 4R98A 4G5GA 4KO8A 4QHTA 5FUWA 1KI3A 3VHLB 2ONKA 2B6HA 3LD9A 4WBSA 2BBSA 3M0EA 3BS4A 4UJ5A 5H8WA 4UKDA 3KQUA 2BBOA 4JBXA 2RCNA 1VCOA 2W83A 1FUKA 2QE7D 5DYIA 2JCSA 4BZQA 4PC2A 4JLPA 3QENA 1HURA 1WA5A 4E03A 3QG1A 3W6PA 3REFA 4CW7A 1WBDA 1T4GA 3UG7A 4HAUA 4F4IA 3BH6A 1G6OA 3PUZA 4AKGA 1T91A 2VHTA 2IF2A 4Q4LA 2OT3B 4NYMQ 1EWRA 4HUTA 1UBFA 4ERNA 5JSZA 2GTPA 2QTVB 2RGCA 1XMVA 2W6JA 3WY9A 4QC2A 2HLDA 5E7MA 4IW3B 2EFEB 2IX3A 2EU8A 3I73A 5IK2D 1DPFA 4ILEA 4TQ9A 4I1VA 1TNDA 4FMBB 3S1AA 3NHBA 4RD3A 3RHFA 4B2IA 2KSQA 2BEKA 3QG5A 4LC0A 4A2PA 2QRNA 4KBGA 1BKDR 3MRSA 1WE2A 4KSBA 1ESMA 1YZGA 2GESA 1LV7A 2NZJA 1SVLA 2IL1A 3Q3JB 3WBJA 2ATXA 1SHKA 5JEEA 2FE4A 3FMFA 1DBSA 4OHZA 2UVQA 1U0HC 2J59A 4IXNA 4LC1A 4HAWA 2DPXA 2KBFA 5B64A 3TMKA 4KFSA 4DLZA 3OE7A 2HXYA 4C0BA 3RYTC 4M4SA 2ZI4A 3GLFB 4TL8A 4JL8A 2AWOA 2BJVA 2JJ1D 1DTSA 1CR0A 3LAWA 3P4YA 3U3MA 3I62A 3BFKA 3K0AA 3AM1A 2IYXA 1A2BA 4RKFA 3N2EA 2H8KA 5HR5A 2JLXA 4WW0A 3FKSA 4JLKA 1E2IA 5A5GA 1C9KA 3B13B 3PFIA 2XB4A 1LW7A 1UPTA 3GLHA 2AFHE 4LHVA 4LJ9A 3Q5EA 1G8HA 2ATVA 2HV8A 4DCNA 3WP0A 4P32A 4PC7A 2WOJA 1N6PA 2GF9A 3KB2A 5EUQB 5HCNA 3EX7C 1W5SA 1XTRA 1P9WA 4QRHA 4OQMA 4NBSA 1UBCA 3AP1A 2O8CA 3B5JA 2XXAB 4LSGA 3QXXA 1XTQA 4QM6A 1N6LA 4FXPA 3RAPR 3KL4A 3VHXA 2C2HA 4QKQA 2C03A 3L0OA 4JT2A 4NYJQ 4ZDWA 4HAZA 3AEZA 1G18A 5EE3A 2ZU0C 4BEBA 2W00A 3SR0A 2VP2A 1KI9A 1P61B 5HTKA 1XTSA 4PAOA 3FTQA 4LJ4A 5SZHB 2GRJA 1GIAA 4R71A 3I5XA 2QENA 2WIBA 2ZE7A 3L0IB 2IYVA 4OHXA 4TMXA 5TV2A 2OZEA 2GA8A 2ZE6A 1BS1A 3CX7A 1S9DA 2FGKA 2NZ8A 3AVOA 2WICA 3TNFA 1UKEA 1ZD9A 2C04A 1R4AA 5JWOA 1GVNB 5B58C 1YHNA 4HAYA 4CEHB 3GJ3A 4MYUA 4B3FX 2RGBA 5FI0B 5G3YA 1YKSA 1KIMA 2W6JD 4NH0A 1R5OA 2YVUA 4PSKA 4QFMA 2HLDD 4XJXA 5H68A 2IS6A 4WZBE 2ZYVX 4GMDA 4HATA 1YE8A 2WAXA 5J4HA 1P6XA 4CVNA 5B57C 4EPVA 1G19A 4F4CA 3U6BA 1RRPA 2FPMA 2NQ2C 1NJFA 2AL7A 2JASA 2WOOA 4ZO4A 2JJ8A 1DOAA 1TQ4A 4XIGS 1J8YF 2HYIC 1CJTC 3ND8A 4EAQA 1LS1A 3HDTA 1SXJE 2ZANA 3Q5DA 5SZIA 3VAAA 1AKEA 3MMPA 3K0EA 4US0R 3TRFA 2XSZA 1ZC3A 3OE7D 1OXVA 2QY9A 2CNWA 2QT0A 3QKSB 4NONA 5DI3B 2QUZA 1HTWA 4HZIA 4DSOA 2O8EB 1QVRA 4DDTA 4L9SA 3FDIA 4GL2A 1T8TA 2QEQA 2CDNA 4MH0R 3RABA 3FKSD 1PV4A 4OI1A 1HH4A 2G0TA 4DLYA 2ZJ8A 3MD0A 5CM8B 1S4QA 1UF9A 3PENA 4D4MA 1JI0A 2G9NA 1XEFA 5EJEA 3TJZA 2I3BA 1YZTA 1N6NA 2GCOB 2XITA 4TYYA 1QHYA 3K1JA 221PA 2KWIA 3THXB 4M9SA 3I72A 1YZNA 2O8DB 5HZKA 2A5YB 1DAKA 3SN6A 2J0QA 1QHXA 1LNZA 1I4TD 2ORWA 4TMWA 5EE9A 4P4TA 1I2DA 4QGHA 3SYLA 5CIWA 2FSHA 2FSGA 1Z6GA 2R6DA 5BN5A 3K9NA 4M2LA 4URVR 4PO1A 5KPJA 4L8GA 3CO5A 3CF0A 2GWHA 3TW8B 2IUTA 4DSNA 2WWYA 1NSTA 1JAHA 1MRNA 2AFIE 2V6JA 4I1OA 4ZI3A 5TY0A 1KAOA 3EC1A 3I5YA 3NDBB 1P2TA 4NHOA 1XB2A 1E6CA 2OFXA 1R5NA 1G7CA 1KK0A 1E9AA 3I4LA 2D7CA 3OIYA 3QKUA 2F3TA 4IFBA 3RS7A 4ZI2A 1XMSA 2C78A 1MABB 3KJGA 1D9ZA 2R6CA 1QF9A 2AKAB 3T61A 4FWIB 1T8UA 4U00A 1XTIA 2N42A 1DAMA 3P26A 3K0CC 1L4UA 1WB9A 3ADCA 1FX0B 5FOUA 1DVRA 4AYTA 1E94E 2XSZD 2VPPA 4PHHA 4QJ3A 2W2VA 3VKWA 2VHJA 2CNWD 1EK0A 1Z06A 2MSEB 2F6RA 1Z07A 2FX3A 5J4YA 3THWB 1KI6B 1U90A 1XD8A 1AKYA 3DDCA 1X3SA 4HAVA 2EFDB 1E1RA 3QBVA 4OQNA 1K5DA 1XNJA 4RFVA 3LBIA 5JCPA 1R0WA 1NP6A 1XCGB 1US8A 4IJMA 5DHFA 4Q1CA 4E22A 3CH5A 3EPKA 3NH9A 3IEUA 3ZVMA 1AJEA 4RD1A 4Q7LA 3AGQA 1OJLA 4U02A 1UKZA 2ZI6A 1F60A 2BOVA 1NRJB 3ZJYA 4MGKR 1XJQA 1Y3AA 1RJ9A 4F38A 2FZ4A 2QQ0A 2RMKA 1N6HA 1OSNA 1W2GA 4ZKDA 4AY2A 1W2HA 1M8PA 2DB3A 5E4FA 2R6GA 3LXRA 4LYHA 4PAQA 2FG5A 1HT1E 4V0OA 2IYLD 2XOKA 3G5UA 4MUBA 5FBVB 4RD0A 1RKBA 4N1AA 2J0VA 4JL6A 5J4VA 3BXZA 1HA3A 2Q9BA 4HSEA 5FBWB 1AS0A 2DYKA 1SKYE 2RHMA 3QE0A 3K9GA 3AVTA 1BYIA 4B35A 1Y63A 3QNUA 4AKHA 3TLXA 5E95A 4YQFA 3P27A 1MKYA 5FPSA 1SXJA 3VMFA 4URUR 5G41A 1G8GA 2DFNA 1MO4A 2BV3A 2R9VA 2W58A 5CJ2A 4XTCS 1OB5A 3NTUA 8OHMA 1CJUC 1BIFA 2AR7A 1YZLA 2HJVA 4KBFA 3WRXC 2IHBA 4Q9JA 1ANKA 2F9LA 1VECA 4Z54A 2AN9A 1Z2AA 4LBWA 4Q4AA 521PA 3B85A 3C8UA 2ZI3A 4LJAA 2CE7A 5DO9A 3F0TA 4LHZA 3SC3A 2FWRA 1XXHE 4MGYR 4KI0A 4AWXA 1ZYUA 5CYOA 1GAJA 1NG1A 3UMFA 1E9BA 3L2OB 4I1UA 2QNRA 2CHGA 4NCJA 3GJXC 2OE2A 4AIIA 3TSZA 4KU4A 1DEKA 1E1RD 3U60B 3K70C 1E2JA 2DFLA 1W4CA 2GETA 1F48A 3OEEA 5FI1B 5CDFE 4AK9A 1IBRA 2RHDA 1X1RA 1YU9A 5HE9A 4QJ5A 4TLAA 2QAJA 3B1ZA 5IRCD 1E0AA 3TK1A 2BCGY 2BEJA 3FHTA 1MH1A 3PITA 4NCIA 4HDOB 2ZE8A 5CLQA 1XEXA 1KK3A 4O0MA 2BM1A 1N3BA 2OXCA 5L3SA 3R9WA 2ERYA 1OB2A 1RE0A 2WJJA 2J7PA 5EXTA 2ANBA 4G0NA 1NKTA 1QHGA 4PZYA 4U5XA 2WJHA 1G7SA 1G6HA 3C5CA 4BFXA 4K81B 4EFNA 3CONA 3LX5A 3ZVNA 2IWHA 3HP1A 1SGWA 1U9IC 3CPJB 5GJBA 2GJ8A 2YZ2A 2QP9X 4EKDA 2IEYA 4PC6A 3LFUA 1KO7A 3WRYC 1SULA 2XOKD 3ASYA 2BMDA 4LI0A 3CX6A 3KKQA 4A36A 3WMEA 4BEJA 2Z4RA 3ZIAD 3ZZUA 4D25A 4C0AC 5LBIA 1OYWA 2LKDA 2ZR7A 1RFLA 2V6IA 4CT4B 5L8VA 5LB4A 5B2ZA 2CHVA 1SXJD 1XD9A 2R2AA 2CBZA 2VSXA 3LX8A 4Y0VA 3VR5A 5KO2A 1CRPA 2VP9A 4KVAA 2G88A 4TMKA 3F8TA 4C30A 2QP4A 4GMXA 2O0KA 2IA5A 4DDVA 2NTYC 3SJCA 5JRZA 1GSIA 2YOGA 1M7BA 2YV5A 4MQBA 3CRQA 4Q7JB 4YC7A 5FUYA 4ZIRA 3GLGB 4A15A 4C7OB 3O8DA 1NVVR 4IDOA 2MMGA 3K9LA 5CYPA 1EFCA 2BC9A 1AIPA 1S1CA 2JJ2A 2ZVPX 3IILA 3L0SA 4R2HA 1NI3A 4ESVA 1L2TA 1X8KA 1LFDB 3FB4A 4BQSA 1R0XA 2JDIA 2R6FA 2AKYA 3U2QA 1NY6A 1G3MA 2QMEA 5CK4A 3VKGA 4M1MA 3RVBA 3JZMA 4Q21A 4MYCA 3U3KA 1G9XA 2VBCA 2I1VB 3FVQA 2QG6A 4DIDA 1GZSA 2DFTA 2DHRA 2ZRIA 3PEVA 4YMVA 2RGNC 4C3ZA 1ZU4A 1DO2A 4DHEA 1RRCA 1S9HA 2CMKA 3OEED 2VEDA 1GRNA 2QN6A 4AYXA 5BXQC 2ZJ2A 3CM0A 3B1VA 5FTKA 2O8BB 5A4JA 2C8VA 5EXXA 1JR3E 4LV6A 4EFLA 1Q1BA 1W4AA 4BUJA 1IQPA 1VCIA 2V9PA 1VCMA 4L16A 2CXXA 4O2RA 2ZRBA 4MYTA 2ODEA 2JLQA 4M1SA 1E0JA 1KMHA 2J7PD 1KI2A 2GEVA 4D4KA 1YQTA 4DT1A 1UEJA 2J87A 3IIMA 5H1YA 4XSHA 1KI1A 2ZYUX 1TQDA 4D82A 3BOSA 3PUYA 2IXEA 3SQXA 3PXGA 3DO6A 2PMKA 3R8CA 3X1ZA 4C9BA 2J46A 3BK7A 4KCGA 3AVVA 3EAQA 5A0FA 1D2MA 2B92A 3NG1A 1T5IA 1JJVA 1EESA 3T34A 3QXSA 3VU9A 2G0NA 3UK6A 3PJRA 4W7SA 3U3RA 1E2LA 5LPNA 4NYIQ 1CEEA 1JECA 3TW4A 1G5TA 4XD7A 2QL6A 2AD5A 1RYFA 5AUQA 4B75A 4YMWA 2J5XA 3ZQJA 5C4MA 3CH4B 1WMSA 1CF4A 4HLCA 2ZSEA 2ZS9A 3QKTA 1OIXA 4LJYA 3FMIA 3A6PC 3RC8A 4F93B 4B2LA 4PHTA 2XTNA 4HDQB 1CR1A 1IAQA 3REGA 4HUQB 5K8UA 1P73A 4URWR 3OIWA 2JJ2D 4CEIA 2WKPA 2FFAA 3B9QA 4UNSA 1FQJA 2QE7A 2ZRAA 1YR8A 2C9CA 5FPHA 3EPLA 3K8YA 3NEYA 2ZQ5A 2JDID 1MO6A 1WXQA 1ZVQA 2PLRA 1IY1A 4B3DA 2JLSA 4G1UC 4NU0A 1GG2A 1E3MA 2F1RA 4CT5A 2H16A 3A58B 2QAGA 5C18A 3VFDA 4R7ZA 4BLOA 2A9KA 2NO1A 2V1UA 3L8YA 1R2QA 3A1VA 2JGNA 1BH2A 1EX6A 4M1YA 4DLRA 2FH5B 4ACBA 1OH5A 4G5OA 3T1VA 3TQCA 3ZD7A 4UXHA 3T12A 1X86B 2IK8A 2DBYA 2GKSA 3I3SR 4URZR 4A82A 3CB4A 2ZUCA 3T35A 4WAUA 1IOZA 4FWTA 2DFKB 3ADDA 2JLUA 1XZQA 4QBFA 2GEDA 4ARZA 3TUJC 1BMFA 1G7RA 3QF4A 1VYTA 4HZUB 3R7WA 4PFSA 4MRVA 2OSBA 4M1TA 2D06A 4D80A 1VYUA 4TTQA 4RFSA 3UMRA 2AX4A 3LVQE 2PX0A 4DXAA 1KNQA 3ASZA 2A3RA 3NBXX 1TMKA 1YZUA 3ND9A 4IFEA 4B32A 2IS2A 5EUMA 2QORA 2QU8A 2G83A 4C0HA 3GMTA 4BFVA 3CRRA 5HPYB 1CJVC 4CRWB 1KSHA 2CJWA 1II8B 2PT5A 4DLXA 4IEEA 1F2TA 2P6UA 1O3YA 3GCGA 2VTKA 2ZREA 3DZ8A 4BFSA 3CNOA 2ZJAA 4Q47A 3X1WA 3UKDA 3P20A 2QROA 3ZVLA 1CTQA 1XEWY 4PQYA 4HB0A 5JS7A 3HR8A 3W3AA 1P2UA 1NMZA 4BLPA 3I61A 4FCTA 1MRSA 1F5NA 1TX4B 5JBQA 4XD7D 3X1YA 2OHFA 2I1QA 2C77A 2J0SA 3OFNA 4ZDIA 1AS2A 5AJWA 2XGJA 3ZS9A 1P7CA 1EGAA 2YHSA 1YR7A 1FW6A 2C96A 4A6PA 2GZDA 4XH9B 4ESHA 2NO6A 5EZ6B 4MKGA 1EWQA 2N46A 2FV8A 4G01B 1RPZA 1Z83A 5D3MA 4ZDKA 2DCUA 2GJSA 5C2JB 2PCJA 1ZM7A 1TADA 1T5LA 3E70C 3QOFA 1JXOA 1M1YE 2YC2C 3QQ5A 4PSVA 3RLFA 2WWHA 1AGPA 4KLNA 3U4QB 1E69A 3AF0A 3T15A 3NDPA 2PLFA 2ZJBA 3UXMA 1HT2E 4A6XA 4LHWA 3CWZA 4CEJA 2BIFA 2IT1A 1G4AE 4JLVA 3RSOA 4TMVA 2YWHA 3ONWA 3THOA 2KI5A 3KZ1E 4Q4HA 4A2QA 3AP3A 3HPQA 1KOFA 4BRUA 3AKEA 1W7AA 3TQFA 4A0GA 4F4JA 2OAP1 1GOTA 2WPDA 3N2IA 3QEOA 1P9RA 1KK1A 4FW9A 1AGRA 2FA9A 4KYUA 1Z63A 1P60A 1W5TA 5DSZA 1BMFD 3DMDA 3RRYA 2F55A 3CRVA 5FTNA 2KBEA 3BBPA 1W47A 4Q02A 2BBTA 3RS3A 5EE0A 5BN3A 1V43A 2PZGA 2IXFA 5FOWA 5UKDA 4YMSA 4D2IA 5AUPB 3FHCB 4BGDA 1FL9A 3I32A 5FPYA 2VP5A 5JSZB 2HT6A 4Q66C 1II0A 121PA 1WCV1 2QPAA 3AF2A 4DCTA 2ZU6A 3MJRA 3THYA 2CVFA 2O5VA 3GFOA 4DLWA 5JEDA 2J1LA 2PBRA 2GXSA 3BB1A 4K46A 2X77A 2OM2A 3TVTA 3S1AB 4F7WA 2OBLA 1JNYA 1IN5A 1R0ZA 5FR1A 4HDCA 1Q44A 3MUFA 2QM7A 4NCKA 4TL6A 1OT3A 1J2JA 2PJZA 3B8HA 2GK6A 2VSOA 2X1VA 2ZRHA 4DEYA 2XZOA 4O2LA 2JLYA 1YRAA 2FMXA 2F43A 4M9ZA 2CL7X 2IYQA 1DAEA 3DPUA 4DJTA 1RRFA 5KSYA 4GFDA 2EYUA 4KJZA 3LY5A 4WIAA 3SBDA 1JEEA 3NH6A 2TMKA 1PZNA 1PLLA 1VTKA 4L5BA 1XTJA 4LJ5A 3OFND 4M9QA 5IT5A 3EARA 4KITB 1PUJA 5F98A 5E7JA 1P3JA 1LB1B 3K0AB 5GVRA 2RGGA 1QHHA 1DARA 1JXMA 1EFRA 4OHVA 4RCZA 1UJ2A 2ZPTX 2ZVQX 5BYKA 1ZBDA 4V0LA 1K5GA 2XTMA 1Z47A 3TAHA 2HEIA 2MSCB 1TF5A 2ZUDA 5KNCA 1OXUA 1PLKA 1UFQA 1ZMXA 3GLHB 4TYWA 5FTLA 2MSDB 1ETUA 2C95A 5KSZA 3TAUA 4P4SA 1N25A 3KXLA 4LUCA 2FFBA 2RGAA 3CZQA 1N6OA 3VX3A 1YR6A 3GLIA 1NBMA 2O8CB 1KO8A 4JBWA 5DNYB 3AVXA 2W2XA 4QNRA 2IS4A 4GPTA 4B3BA 4BRWA 3AH8A 1UBEA 1NF3A 3NC1C 1P75A 1NMYA 4PPFA 1DAHA 4O3MA 4GNKA 1N5LA 2SHKA 2VHUA 3UIEA 4LX0A 2ZTSA 1SVSA 4X8OA 2WPDD 3CNNA 3GQBA 4XTRA 3LH5A 1KDOA 4OJQA 2PL3A 3WNCA 2X19A 1L8QA 1IY2A 1P62B 1E4VA 2CL0X 5EXPA 1T9HA 2BKUA 5JHHB 1GWNA 1ZM2A 4Q9KA 2NPIA 3QBTA 1GNRA 2Q3FA 3SFZA 1NNEA 2K5UA 1W49A 4AKIA 1E79A 3PUVA 4A8JA 1OIWA 3JZAA 1NN1A 1KDRA 1G64A 1Z6TA 1II9A 2D74A 4IVRA 4NDZA 4Q1BA 1G3UA 4KLZA 2BHRA 5D3QA 2W0MA 2IWRA 2ZJ5A 1P72A 2ZRKA 2ODBA 2EWWA 4TSFA 2IHYA 4LY6A 1MOZA 4PHFA 4TTPA 4LBZA 5TB5A 4TWZA 1VHTA 3ZYCA 3CX8A 3QF7A 4WA7A 1S1MA 3KTAA 2P6NA 4A0RA 2RGEA 1MR3F 1P4SA 3U6KA 3U7HB 1RVDA 1TU3A 2GAOA 2R44A 3KKPA 2OCYC 4IDQA 5CLLA 1NIJA 4ABYA 3DKPA 2XEXA 5JCZA 4LK2A 1ELOA 3AF3A 4DB4A 1EFRD 3OZXA 2IC5A 2YOFA 1X6VA 3W5IA 4B3CA 2OAQ1 3GJ8A 3AQ4A 4GP7A 5JI3E 1N5KA 1QRAA 2P6RA 4D81A 2AD1A 1KZGB 3TGPA 5TARA 4L15A 4DZZA 1JPNA 1NBMD 4TLDA 4WXPA 1ZP6A 4NL4H 4ZCLA 4WVFA 4FINA 1TEXA 3T06B 1R0YA 3EWAA 2L0XA 2P5TB 2ZYTX 2FJUA 1C4OA 3HWSA 2F1JA 4PPGA 5G3ZA 4B2PA 3NWJA 5IHPA 4QJ4A 5GADl 4KFTA 4LOAA 3NHAA 4NKRA 3T5DA 4A2WA 3FMPB 1N5JA 4AURA 1Z28A 4ZKEA 4DVGA 3LV8A 1J8MF 1G17A 1YZQA 4IHQA 4RZUA 1IY0A 4JJKA 5JRJA 4B76A 4Z8XA 1NVUQ 1E79D 2MMCA 1OH7A 4DSUA 2XJ4A 3AVWA 4FIDA 4DIEA 5FBQB 1CU1A 3PG5A 4LV8B 1VIAA 4OBEA 4GDFA 3AKYA 4YDSA 1G8FA 1DADA 4Q7KA 3U44B 5KYKA 1OFIA 1VDZA 1J90A 4LBYA 1B23P 1JBKA 4D26A 3I92A 2C99A 3PEWA 2ZITA 2HJGA 2NO7A 2Q9CA 4TSFD 4JIMA 5L3QA 3VKHA 4II7A 3A1TA 3RS5A 4MRSA 5GJWC 3WYGA 4MKFA 2AK2A 1Z8FA 3H1TA 2WSMA 4KHZA 4PX9A 5SZKB 1E9EA 3IKJA 2ZR0A 2FEOA 4XWKA 5JI2E 3TIFA 1D5CA 3UPUA 4X8HA 3SJBA 3WP1B 2ZI9A 2ZAOA 1UADA 1Q20A 2J41A 2EW1A 4BWYA 4GT1A 1UBGA 4HYYA 2EVWX 1US8B 3U3OA 4AD8A 3OESA 3EZFA 3W6NA 1E2PA 3ICEA 1NKSA 1XMIA 4GRAA 4OL0A 3TR5A 1CS4C 2YOHA 1JJ7A 5J4LA 2XNDA 5KSOA 2V4ZA 2V7QA 4Q48A 2A30A 1OFHA 4S35A 1MV5A 2JLVA 3AVYA 3LNCA 4I99A 1GRQA 5BYJA 3TKLA 2W6IA 4A4DA 1X8LA 1J7KA 1ZJ6A 5EXSA 1E99A 1G5PA 1H8EA 1NSFA 1RJ9B 1W46A 3X1XA 4BLRA 5KHOC 2HF8A 2BCJQ 1NN3A 1GDDA 2Z5FA 1P9NA 3A1UA 5CK5A 4I1SA 3C41J 1GTVA 4AG6A 3MGCA 1FZQA 2ZSBA 4W5WA 1CLUA 3PV0A 2RGDA 5CIQA 4PTLA 2ZI7A 2FPKA 3EZ6A 1I4LD 1OXTA 2VQSA 4QXAA 3B78A 2E9SA 2YINC 5KDLA 3HU3A 3AVQA 1VHLA 4FCWA 4RD2A 3K09A 4HLQB 3OF5A 1RRGA 2AWNA 5EP3A 4PO8A 4MGIR 4EPYA 4LYFA 2F1HA 1NVVQ 1SXJB 1KO4A 2BMJA 1NN5A 1S2MA 4Q19A 3OEHA 1OIVA 1CBUA 5JWRA 4JVMA 1IXZA 2FU5C 1LF5A 2Q6TA 3ZZ0A 3BB3A 4R9UC 4Q4AB 3W5JA 1H65A 4EPRA 2ZROA 2G6BA 4HB3A 1TUIA 4C4PA 1DS6A 3GEEA 1EXMA 5L3VA 2DWOA 1TEVA 2J45A 3C7KA 3VNUA 4IOLA 1T0JB 4GOKA 4V0NA 1SQ5A 3IGFA 4RVCA 1X8JA 2KB0A 3SQWA 3ICQB 5K8IA 3PQCA 4GZLA 3DHWC 4HLDA 4HLUA 3SHWA 2ZE5A 3DM5A 3C15C 4C0SA 3IIJA 1K6MA 2Z83A 2JIZA 2QP3A 2GEUA 2IYZA 1N0UA 3BE4A 5K8LA 4Q4JA 2XTZA 1OFTA 3GJ0A 3NIBA 4G3XA 2NG1A 3UWOA 5LD2C 1OHHA 1QHNA 1YR9A 2R6AA 4KXFB 2BMFA 2QI9C 4W5JA 5FL7A 3T1OA 1KDPA 3QVUA 4RD6A 5LB2A 4US2R 3A1WA 4TYPA 2XNDD 3VTKA 4M53A 2V7QD 4B71A 2B8TA 1UKVY 1U0JA 1XEXB 4JS0A 1R6BX 3O8RA 2WWGA 3TUZC 1TPZA 5FL3A 3KXIA 3JVUA 2W6ID 3CIOA 2REXB 3QY0A 5DH9A 1YVDA 4A1FA 1H8ED 4FCVA 2Q21A 1M34E 1IHUA 3EZ2A 3BJIC 3I8XA 1N6IA 3QPVA 4BLQA 3PEYA 1S3GA 5F9FA 1Q22A 1ZIOA 1SVIA 1IJEA 1XX6A 3A1SA 4JLOA 2FN4A 1DELA 2GCNA 4DB2A 1XD2A 4N3NA 3LW8A 3VR1A 1M6NA 4X8LA 2VHQA 3BWDD 3CLVA 3BC1A 3QKRA 2N1BA 1PJRA 3H86A 5EE5B 3KUDA 1QBKC 5ANRB 4JL5A 4TYQA 2O8FA 2ZRLA 3GEIA 4UNQA 1GKIA 2NO0A 3KDSE 3MWYW 4IXMA 1NJGA 2QBYA 5FOSA 1Q1EA 2P67A 5FOVA 1XMJA 1GKYA 3JVVA 2RB4A 5GJCA 2IW3A 1D8TA 5FTMA 5FOTA 2FFQA 3OEHD 2DWQA 4QBIA 4P31A 1NIPA 1DAFA 4M1KA 4TMTA 5IDVA 4J0QA 2A5FA 4JMPA 1KI8A 1VKJA 4OYHA 1FTNA 2A7QA 1HUQA 4TL7A 5EZ5A 5AWFC 4UNRA 4ZIRB 3BRWD 2GVZC 5HCIA 4PAMA 2JATA 2QMUA 3L0PA
chains in the Genus database with same CATH superfamily
1SIWA 4CLXA 1JSCA 5LQKA 2X7HA 2Q9AA 3FRJA 1A9YA 4YALA 3WC4A 5CG2A 1J99A 1JDPA 3N87A 4EELA 1O08A 1UWVA 3HJNA 4F56A 3I2YX 4HI0E 3PXDA 1GGJA 2LTAA 3KHUA 4AKEA 3SYNA 3UW3A 3TSAA 4KAAA 5JBIA 2VNIA 2GAIA 1WWKA 2O20A 2X9NA 3T94A 1DBQA 2H4JA 4QOGA 3HN6A 3IHTA 1YB2A 1YOVB 1ZJ5A 3G82C 3W77A 2FUG1 3E9EA 1W1UA 3TVYA 1WZ2A 1Y1LA 4JASB 1NXQA 3BUSA 1SC4A 4Y6OA 2A57A 2GYYA 2OLEA 5CW1A 3N2KB 2JA1A 1QYXA 1P8JA 1ZNZA 2KYRA 1X9HA 3BJRA 3E81A 3N76A 3Q72A 5AI0A 4YIKA 5JRDS 4RTSA 1JSZA 1OHHD 1NV9A 2HQOA 3AC0A 4JZKA 3H5NA 4MPDA 1N2IA 3AP2A 5EUBA 1TK3A 4UE2A 2I4MA 4YIHA 2DQZA 3IQWA 3UV3A 5DLQC 5EIOA 2OGWA 1CR2A 1P5ZB 5B1SA 4PR3A 3KB1A 2BW0A 3BYZA 1ULZA 1QR2A 5AK0A 1PL8A 4CM1A 4CLEA 3RC7A 4JVNA 1A0OA 3FUWA 2BSAA 3MWJA 2P4UA 5DYNA 1ESZA 3DKRA 1KMMA 4QGGA 2QTTA 5IULC 4G8CA 5J2UA 2MHCA 3PGXA 2WT8A 3PDCA 4QGBA 2B8NA 3CEJA 3ZWOA 1FRQA 3G2LA 5BV0A 2DCMA 3KALA 2F17A 3T3MB 1M2HA 2WHXA 4KIFA 1SN7A 4X45A 3UUWA 3ZJ5A 2FSFA 1M66A 3UJCA 5FPKA 2C5LA 3AKCA 1UL1X 3JAKB 721PA 3KU1A 2Q3DA 2ZRMA 2FWMX 2NACA 4D3FA 2C31A 4EG8A 2IH2A 3WL3A 3T1TA 2E1RA 7YASA 1T1GA 3A32A 1G8YA 2NAFA 5SZJA 1CUBA 3IRVA 2FMFA 1CULC 2PGJA 3N8HA 1LRKA 5KYXB 4TLBA 4JK3A 1NQ5A 2Q4OA 4BUCA 4K6KA 1NN0A 2I2DA 1JG6A 3DHEA 1HNXB 1PD0A 2XB2A 1H22A 2ZIXB 4R84A 1ZCAA 4C0QC 2R5FA 5ICMA 4X65B 5E1MA 4HQRA 4PE5B 1F3LA 1SCUB 1U1IA 2DGDA 4O25A 4OQFA 4MI3A 4WLVA 3V4FA 3ZHXA 4ALIA 4BFTA 4G4IA 1JJFA 5D01A 3IULA 4YPOA 3OZSA 4L0MA 4R3UC 5ELLA 3R9IA 2V8BA 2VG8A 3OWOA 3W8FA 5KJ6A 1YJ5A 2GPYA 2JFBA 4CG3A 3OEWA 3REQB 2WJGA 4EHBA 2UZIR 1WF6A 1GUFA 2AEFA 2G5GX 1GLGA 4HGZA 4UBJA 1P17A 2AVDA 2LVBA 1HT3A 3LY7A 2X0EA 3ZX5A 5KNBD 2XAUA 4PM4A 4WCDA 3WWPA 1VG1A 3K9BA 1JPUA 3W3ZB 3DC7A 3PIRA 4M49A 3I9OA 3PI6A 4GGOA 3W5HA 2YV3A 4P54A 3Q0EA 2XHEA 1MTZA 2GN6A 3GZJA 3N75A 5DHAA 3MWKA 1LW6E 4I9NA 1ZGHA 1Q84A 3WWOA 3BB4A 4YAEA 1GNLA 2H17A 2ID4A 3OJOA 4B7CA 5L6MB 3CF2A 4FI3C 4G63A 3BX1A 4A23A 3ENWA 4XM1A 2OMKA 5NULA 4E32A 4GX2A 1D6NA 3A7DA 1O87A 2I22A 4AP5A 4HJXA 4ZEVA 3ND6A 1EUQA 1ZOSA 4TT3D 4JP1A 3GUUA 4LJSA 3QPCA 4CFZA 4OFZA 3K2IA 4GKJB 2H1HA 1BTOA 3QF4B 4JKYA 2Q0HA 1OQAA 3AF1A 1RM0A 3U1VA 2GASA 3F3MA 1Y1RA 1L5YA 3I1JA 3P1JA 1ZUNB 3KKEA 2E4XA 2GNPA 3EB9A 1Y0BA 2PZFA 3L6RA 4IDPA 1ZCJA 1DDOA 2IYWA 4UJ3A 3ZC3A 1CLEA 1EJ0A 3QLEA 4LTDA 3SMQA 3A9WA 2VP6A 3EFHA 3C4JA 3WK7A 4IQ8A 621PA 1ZLYA 1PV2A 1VLJA 1V71A 2VYFA 2ZJZA 4I9FA 4X1OA 1I9GA 4EQ6A 1KE1A 4QICA 3TBKA 1EU1A 4B74A 3H17A 2XLCA 1J06A 3FGPA 3K1AA 2IH5A 1JIKA 4IQ4A 2FZVA 2V5UA 4PTZA 5JMTA 3SSMA 3MTGA 1GUZA 2QPTA 4ZEOA 1TU4A 2X8AA 1L4NA 2GK7A 2R6HA 3H99A 2PT9A 3HBMA 1VPEA 1SKUA 4M54A 5JFOA 4P86A 3K70D 1IWBB 3H0EA 1OY1A 4JMLA 5JMWA 5CFRA 4D6XA 2HH9A 4LJ7A 1JQJC 1KNXA 3OU6A 3PQEA 5CFNA 2C9ZA 1CUIA 2F3RA 2EFCB 3MW8A 3LCUA 3OOYA 1MTOA 5TGDA 1J25A 3IAXA 4Y6LA 2N3ZA 4O4HF 1FFCA 1ZD1A 4M0LA 3SEAA 3TL2A 2QLTA 3HJRA 3E3MA 3E2IA 1R10A 3M6MD 3X43A 2XMGA 4BFWA 4U7DA 1KRHA 3AFHA 2CCJA 2IEZA 2ZQZA 3VR3A 2XCRB 3RV4A 1X13A 4Q18A 3NVMB 1LFAA 4OK6A 4E13A 3UMSA 5E9AA 2OG2A 4DBLC 1KPGA 4H4CA 1DOHA 4LJ6A 1G59A 3SS8A 4YAOA 2EATA 2ZTMA 1LBIA 1N5RA 1QE3A 1WXHA 4IUCS 1QUEA 5D3MB 4ZEMA 1SKMA 1SK8A 1J9EA 3AM5A 4HWRA 4BMVA 1E2HA 2CLSA 2H8GA 2QTVA 1EM6A 3A37A 4LN1A 4OI2A 4F11A 5AUNB 1JPJA 3ZNNA 2BFAA 5EP2A 1VE7A 3L9WA 4IH4A 1ZIDA 4EKYA 4BMCA 4A92A 3V6MA 1RQXA 5ED0A 3GFRA 4ZCMA 4LGCA 3W04A 1E3QA 4X60A 3OUTA 5DNDA 5KNDA 1NUAA 2BL4A 1XCJA 3CLRD 4E7PA 3A9VA 1XKQA 5ADVA 2A1IA 1K8RA 1QAOA 1OC2A 2PGAA 3RVKA 5IJ0A 4U8GA 4I3HA 3LLCA 4OSPA 5J63A 3E9YA 1NATA 3OM8A 1IJKA 4JQSA 4RA6A 4LQCA 4ROTA 3AKZA 2WLSA 1NXSA 3DE7X 2UUPA 5E4JA 1RTTA 2IHZA 1KYWA 2IIQA 1B1CA 4KFRA 3FFBA 4DARA 1X1SA 2RGYA 2B4QA 1BE1A 3KWMA 3PVCA 1XDDA 2JAUA 4JI7B 1MVNA 1E9CA 3MBOA 1I4WA 4Y2SA 3A6ZA 3CISA 3IBCA 1NULA 2C57A 1JUDA 4AW9A 4BQRA 2DWCA 4CMIA 4ZFNA 4HQKA 1LPNA 4MDEA 3IQZA 2C7OA 1DJPA 4GKVA 4NOJA 3TRDA 5BVGB 1DRUA 4Z7QB 3DWEX 3PRJA 4CFYA 4XWWA 4E15A 2E4ZA 1LPSA 1E2DA 1KI4A 4L78A 4EI9A 1FXUA 2JAOA 3UXHA 1NE7A 1CNFA 1VPLA 2EC5A 3OOHA 2H1VA 1V9LA 2D7DA 5DPMA 1QKKA 4CI0B 2B30A 2W90A 3FNBA 3USES 4JFAA 5D3KA 3HMKA 1L5MA 1U2TA 4Q1FA 5JQGA 2GRAA 4PGFA 4EA8A 1U02A 2ORYA 4IWXA 3VYWA 1W88A 4F6CA 2HRDA 4MDHA 1L7MA 2B20A 4XPIA 3KQKA 2G80A 1L6RA 3GRKA 2A1UA 4ZREA 2FN3A 2Q99A 3B12A 1Q1QA 2OK7A 4QTTB 1I4DD 3IH5A 1U31A 3GJZA 4RL4A 5C5CA 1NVKA 1TMYA 3MJEA 3WZ2A 1QP4A 1EDDA 2L19A 4XSGA 4NULA 3LLUA 1N6KA 3VH4A 5JAHA 3UMYA 4NMHA 3BZBA 3SZUA 2ZBDA 4CMAA 4LBVA 1OT5A 1XN4A 3MJHA 2ZGVA 1K68A 5EQTA 1WETA 1KQNA 1OFUA 1JR3D 4TVBA 4CODB 4CNBA 1XAIA 1RC0A 3SSAA 3S1SA 2IFTA 3JPYA 3V1MA 5BYBA 5DIFA 4F2HA 3R0VA 3DYIA 3C8MA 1N9GB 5HRCA 2J5BA 1H0KA 5B1YA 4MKXA 3MSXA 3WP0A 4B73A 5MN5A 4R1MA 5AJZA 1SC9A 5A5VA 5I9LA 1G8PA 3INGA 4ZCRA 2OB2A 1VMEA 1WMBA 4LHXA 3N70A 3SC2B 1YCDA 1LDYA 4G41A 1O5IA 2VCYA 2BM0A 3LU1A 3CZCA 5AM4A 2ID7A 5JS2A 3KL2A 5EIBD 4OAQA 1ENZA 2JNWA 3E23A 2WAYA 4WZAE 5TQ2A 2PKXA 4BE4A 3EA5A 3TXYA 3GUVA 2ZJ1A 1Z18A 3BF7A 4UDXX 4ZJZA 3W78A 1NQUA 1Y3BE 4C7JA 3PJGA 4JR0A 3O03A 3EASA 5KJEA 4OHUA 1P0QA 2LKCA 3H1PA 3ZHQA 4MQEA 5MN4A 3B82A 5ER6A 1CUUA 2QMHA 2QY6A 3MCTA 1N0WA 4UVHA 3DF9A 2A33A 2D4HA 2WTNA 3ZI7A 1TGYA 2CNNA 3A1FA 2R86A 3E5RA 4AT1A 2OLJA 3OLQA 4OHFA 3TTSA 1LUAA 1V6SA 1Z8HA 2IF0A 4DDUA 3HRKA 3L7AA 3H84A 3IHWA 3JATB 4MUYA 5LC1A 4FMDF 3HKDB 2OYCA 2VXOA 3OCWA 5KWVA 2CFSA 1TXGA 4A8JB 2ZRDA 4NDNE 3RFCA 2J3MA 4R69A 5EKSA 4PZLA 3SXPA 2GGSA 4MRRA 1D07A 1N92A 4O59O 2VT6A 1OBVA 2F1KA 3BSSA 3GFPA 2O07A 4ENWA 3R5JA 2RHHA 2BGLA 3VDMA 5C1IA 2CDRA 5EI5A 4HEJA 3E7DA 4K5QA 4JVSB 1CY6A 3LG2A 3FWYA 5U9CA 1WKCA 3DGFC 1WP9A 4P2BA 4CL2A 1EP3B 3NCHA 3THXA 3KJZA 3VVBA 2D6FA 4RV4A 1QG0A 2ORVA 1CW2B 3D4BA 3ZDQA 4TYMA 1S4MA 1QK4A 3CCCA 4NZYA 2GPJA 3K09C 4QFCA 4QOHA 1KSFX 1T3HA 3ROGA 1E63A 1T15A 1A82A 4NOMA 2AG1A 3OHMA 4KZKA 4OGWA 3NEJA 4NZNA 1K27A 3KTAB 4PZZA 2C2MA 4IDBA 4Q9AA 2WKRA 2J5RA 5LYJF 3UHAA 1JH9A 1R5BA 2IZOA 3ETGA 1QH8B 1OU0A 3UH1A 1JWLA 1TO6A 3EXHC 4G36A 1Q14A 5FUVA 3FNFA 5GJVC 3A26A 3TW8A 4E08A 1GFSA 1PQWA 5AVRA 4CIXA 5JJKA 3O38A 3LVFO 4DADA 4C4RA 1X9GA 3B9RA 4GP6A 4FE3A 4GMFA 4ZYWA 1ZNWA 1QP7A 2HMAA 3O3CA 4DLVA 3RW9A 3L1IA 3V80A 2CK3A 4Y9UA 1THZA 3OCJA 4QRIA 3RSSA 2F8MA 4JJZA 5JISA 2X2EA 1S3SA 5A4AA 4WXEA 1M75A 2H0RA 1Y7LA 2W8ZA 4UVDA 1XP8A 2CF5A 1SR8A 2JGIA 2Q28A 3H9UA 3IT3A 4X1YA 3V4LA 2VJPA 3I42A 3G0HA 4RAOA 4RD4A 1GG9A 2SICE 3RYHA 3WZMA 4N6OA 4JUBA 3HO6A 3QNWA 5LKAA 3RVMA 3GJ7A 4MKHA 4Z7NB 1SQ0A 4D41A 4DNFA 2ZJ7A 3HUFA 4ETWA 2D54A 5JZSA 4JEIA 4IVQA 4HLUC 3W6ZA 5AJHA 4CTMA 2G06A 5C8DA 4BB0A 4MJ3A 3AHJA 4P33A 4TN1A 5DEOA 1VIMA 4E12A 1TUGA 1VJ1A 5BOVA 5DT9A 1W87A 2VBIA 1KEZA 4KSYA 3MMSA 2EYQA 2O5RA 1VGQA 2AT1A 4IDNA 4EP1A 5BWOA 3W5UA 2BKEA 3GLGE 3DV0A 4FNGA 1KI6A 1FYXA 1QDEA 1U80A 3P2JA 3LBNA 4X9XA 2YKGA 1OGJA 3KZMA 4EARA 4ZOQI 2DR2A 1G7TA 2VK8A 1VE9A 1R0RE 2AYXA 2WU8A 4L0CA 2BSXA 2NU6A 4FMCF 4NFLA 4JB0A 5EEHA 4R6XA 5HCUA 5L7YA 4IKEA 1UT5A 3RYFA 3ZE6A 4YXWD 1D2EA 1QLJA 2V3VA 2GVNA 3AFIA 4MEBA 4CQJA 1UQRA 2CDBA 4OM8A 3WQRA 3IIIA 3SIXA 1U94A 4XWYA 4C20A 4V0KA 5ALHA 4YK7A 4X24A 1FUUA 4ZGGA 1JU3A 2L18A 2OESA 5D86A 5K0SA 3JD3A 4PV7A 1T3LA 3VYSB 4TV8A 3IJRA 3R9XA 4EPTA 2YC4C 5L3QB 1L8XA 1XBTA 3DMNA 5DK4A 2FAXA 1TJNA 4MI1A 4RLFA 4C0JA 2WJVA 2WIFA 5HF8A 2YCBA 3PC7A 4XASA 4A0HA 1XJ0A 1LJ8A 5A7GA 3OU2A 3SS7X 2F3UA 5G1OA 2OG1A 3EZ7A 1FYEA 2I4IA 2HDOA 5ERYA 4ZZ0A 1C30A 1U0GA 4EECA 2BWJA 3OLWA 4F91B 1N2CE 3OWXA 4ARAA 2BUCA 4AY5A 3GJ6A 1SO8A 2H4FA 1ZCFA 5FJJA 2O3SA 2QVCA 1DJOA 1E2MA 1UPUA 2ZSFA 2VPXA 4O3FA 3ZU2A 4R3WA 4I81A 4GX1A 2VXBA 5A1TA 2QK4A 1B6TA 3LKDA 1ZAKA 3HE3A 5HUJA 3UATA 2M1ZA 3H04A 2QSZA 1KO5A 1A7KA 3FTFA 4UMEA 1FP1D 4RU1A 2FQXA 2XMCA 4Q7EA 4A0QA 2MSWA 2GBLC 3GFVA 4OX9B 4Z1OA 1UXGA 2O50A 2W2OA 4OHRA 5LP6B 1VIVA 3BHIA 3OJLA 1QGUA 3OY7A 3JQ8B 2VA8A 4MWDA 3D4OA 3GVHA 1MLDA 1XMPA 1F0YA 4GH5A 5K6AC 4RTQA 1MB2A 1HTBA 3RS2A 4FJ0A 2DG2A 1VA5A 2P0EA 2F2TA 4UBKA 3KT8A 4KQEA 3NKVA 3WHKA 1YFZA 3FPHA 4P08A 5CVJA 4FYHA 3D7MA 1Y3DE 3EHDA 4O1MA 3TDNA 2ASVA 4TMYA 5T3UA 3O84A 4LHEA 2VIIA 2D2XA 2VJMB 4W8GA 2G5TA 4MB6A 3VVMA 3EZ9A 1AQUA 4IEFB 3VR4D 2C98A 3ZHRA 4I5GA 4XR9A 4LGYA 4D98A 4CMGA 2RE8A 4JLNA 3ULKA 4CTOA 3VR2A 5JECA 1ONNA 3LCJA 3X1DA 4GC9A 4MUFA 1RI2A 1XU7A 1RYHA 2DR3A 1D1QA 4IF6A 1NOKA 1RADA 4LRQA 1N5DA 4J1SA 5JASA 5JY6A 4BC0A 5BSFA 4YT2A 4UQLA 4XQ0A 4QVIA 1WBBA 1KKLA 3GGCA 5FBKA 3HY4A 1IYZA 4AICA 4LNHA 3H3FA 4FOSA 4HPXB 4IQFA 3S8MA 1Y8AA 4RMHA 2ZWOA 3IOCA 3DLIA 4ZVQA 3PR1A 4CG1A 2EFYA 3WK8A 2VYQA 1J4AA 1EGHA 4DUGD 3BD9A 3PNOA 5IAKA 2WMNB 1SVOA 3DEYX 3QE4A 1STOA 5E9QA 3W34A 5LU9A 3PT5A 2D5IA 4RZIA 1Y48E 5KMGA 4JYPA 5JR3A 2QTHA 1JA1A 2AQHA 1CY4A 4UVEA 4P4UA 1WJGA 1I0LA 2FW8A 3HV2A 1IM2A 3OSZA 4Q1DA 3RBAA 3V7YA 1FP2A 1H8HD 4UPDA 1Y6GA 2Y0PA 4IY1A 3HLTA 3SJUA 5K0FA 1N1EA 5HQTA 1MD9A 3OOSA 2B98A 4U7WA 1WQ1R 3EQ8A 1QIGA 2YXEA 2ZDHA 3MMXA 3N8IA 4O2BB 4F7DA 4FMDB 5IDQA 2JCVA 1W4LA 1SC1A 3C7DB 2OBNA 1XRJA 1QQ6A 4JIGA 1JG4A 3QEMB 1BNCA 4EJSC 3MB8A 2G0AA 2I2AA 4Z9FA 2YHIB 3CS3A 3F5MA 4RHEA 2Z2KA 3EIXA 5DWDA 1MAAA 2QTBA 2JFYA 2GK4A 2JL1A 3KB8A 3O8CA 4KRYA 3QW4B 5F73A 4Q4JB 1ZY2A 4DRXA 3LW7A 4IIEA 4UUQA 2R65A 3DXXA 1KERA 2C9OA 4JBLA 4IG9A 1IN8A 1G4UR 1LF0A 4K6FA 3W8EA 1H6AA 2B21A 4LGMA 4LYJA 2EERA 3IUMA 3NPAA 4I4NA 3HJUA 3QE9Y 3MOGA 1RKQA 1DRWA 4DCCA 1E9SA 4YAUA 2JEOA 3QOYA 5JFTA 3LZ6A 1O9HA 3UPTA 1G2OA 3ECCA 1GL7A 4UNIA 5JD5A 4UCWA 5I7AA 3UCXA 1M2NA 3QELA 1J8QA 3JYOA 5DTRA 5JSYA 5JCXA 1AXEA 3HVIA 3JQGB 3EPJA 3HS3A 1UM9B 2JZCA 2HCRA 3CBGA 1GA1A 3AUXA 2CZQA 3MERA 5LYJB 4OBBA 3F4LA 2ZPUA 1WOMA 3C3DA 4CM9A 4RJLA 4PCAA 3K3PA 3TOZA 4O4IF 3NZEA 5FPQA 2G9VA 3MMZA 4QXRA 2ZBUA 1P1KA 1O94D 2V7PA 3N2GB 4FUTA 1O89A 2FW7A 2NXEA 5G0TA 5EJ8A 1K6XA 1XQ9A 2GM4A 1DOZA 1UK6A 1S01A 3K94A 2IYTA 5DKFA 3AGPA 1JA0A 1W1IA 3PFGA 1AKRA 2GKOA 2AXNA 4YLGA 5LJLA 1NE2A 5BORA 3WGOA 3EOBI 4OXRA 3ZHYA 3ZHUA 4CMEA 3WB9A 1Z68A 2W2PA 3CZ4A 1IM5A 2DTEA 3AZPA 3GZ4A 2O8BA 2CLCX 1HYGA 4M9XA 5DF1A 4H7IA 3E8XA 1C1XB 1ZW6A 1MIOB 4UOZA 2VOJA 1HQCA 4IHKA 5EWLA 5CGQB 2C1ZA 2EX0A 2FR8A 4NZPA 3KHTA 4PAGA 3Q3CA 5EP4A 5HGXA 2JFHA 1F8GA 1X80B 4REQA 3QYPA 4Y9TA 5F5NA 5G0UA 4ZEXA 1L5KA 4RTOA 4IQ0A 2C42A 2I3DA 4FZ5A 5C81A 3DTYA 4WJLA 2ZG6A 1SG0A 4B8ZA 5F33A 1M2EA 4QGFA 1JAIA 3TLGA 2PQ2A 1T0BA 1ZGCA 2AB0A 3KVOA 3AL0C 3K0FB 1ZR2A 3FTNA 3R5KA 4N48A 4M6WB 4JROA 1WNTA 3ZVRA 2OXIA 3OE5A 3P2OA 1LV8A 2TMYA 3IXLA 1U0EA 3RRXA 4ML3A 5A04A 3B3QA 1W5FA 3QVGB 1NQAO 2QJFA 3HP4A 4UREA 2CNDA 2QN2A 2NU7B 4BLWA 3GOQA 1KEKA 4LF5B 4P5EA 5KX5B 1DGQA 5KPDA 1O0BA 4C21A 2D5LA 4B40A 2EHJA 4MW1A 5BUZA 3V4RA 4FMCB 3MIZA 1U2SA 5G53C 2Z8ZA 3JS5A 3DOUA 2FSSA 3PJFA 3IPAA 3FYUA 3I1YA 4PZEA 4WK0B 3DL2A 2ZSDA 4LTNA 1W581 2AKEA 4H18A 4FFVA 5EJMA 2IV3A 1UJ4A 3AJAA 4NBUA 3MQ2A 3WR5A 2PIAA 1N6RA 1JDZA 3FKQA 3PUXA 5EGSA 4BMZA 1U9YA 1LSSA 2G5PA 3KEFA 5M29A 1GQQA 2QDKA 1KS9A 5DM60 1G20E 3UKJA 5IT4A 2I6TA 2EKQA 3NDJA 3L6BA 4YV0A 1YB1A 3ZWVA 4MINA 3H6GA 4DA9A 2VH5R 2I6XA 2ZM5A 2LIVA 3RFTA 3AY6A 1T0HB 2O19A 2LXNA 4KE7A 3II6X 1CQJA 4EYKA 2QRZA 2PEYA 2VLBA 3F78A 4R9SA 2Q27A 3GT3A 4ZJPA 2OBMA 4ZVPA 4NV3A 1XA4A 4X61A 3NWEA 4CE6A 3FYCA 2Z4TA 3KSUA 4BNDB 1JMKC 4L9WA 3K70B 3DONA 1YUMA 5LJIA 3AQIA 3W6UA 5LQJA 3NV9A 3KJXA 5G4LA 4LNAA 2YWGA 4O08A 4MV0A 2CXSA 5E0OA 2RK3A 2DT8A 4C87A 1PWEA 3U4GA 1LH0A 2AOTB 3EGVA 4B5KA 3QXHA 1QZXA 1RS0A 2D1YA 2CB0A 4LCEA 4Z1MA 1U9IA 3WK6A 2OV1A 1QH9A 1ZN7A 1WO8A 4RKEA 4J16C 1Q3HA 4Q9HA 2W37A 4QT4A 4M1WA 2X0KA 3DOHA 2FZKA 4R05A 3JZFA 4POAA 1B6RA 4DSAA 4AJPA 2QGZA 2I2WA 2W4IA 5J9FA 5COAA 3PFWO 5CDHA 1REQB 1X7XB 3OPNA 1OV6A 3C43A 4WNYA 4D0NA 3EQZA 2F1IA 1SUFA 3FDJA 2XZPA 4IF4A 3O9ZA 4QBHA 4PGMA 1ULTA 4BCDA 3SG0A 3D1LA 5JAZA 1PR3A 2WUFA 1II8A 2VH1A 2IITA 2OGTA 1I2BA 2ECOA 5IK2A 3R0XA 1NBME 2R8PA 2H4YA 3TLYA 4EG6A 2NO5A 1VB5A 1SVUA 2GZAA 3PHCA 4HP8A 5E6UB 4IEIA 1E3WA 1A69A 1CG6A 1SOVA 2IXGA 1RNLA 3F6BX 2BTOA 1LBEA 3IV7A 1U6JA 3OE1A 4TROA 4CGYA 5B4VA 3RK0A 3HJHA 4MUHA 2BHSA 3STTA 3SKXA 2P2ZA 2REBA 2WAOA 3CUKA 1JQEA 2DHEA 2Q3MA 4EMUA 5C7OO 3T5AA 5BW5A 2X3FA 2XECA 1ZK4A 2BZSA 3CEAA 3D31A 3R20A 4I4TB 4ZC8A 4B3IA 4RIGA 1EFDN 1GUDA 3UW1A 4P3YA 4ASUD 4AMVA 2ZATA 3ETLA 3D4LA 4DDKA 5KVVA 2JFOA 4WCFA 3C6YA 1H2YA 5IXJA 1GPUA 3FJ1A 4Z4IA 2ZWMA 3A8TA 5CT6A 4MWCA 1M76A 3LDAA 2G70A 1EG7A 3G8CA 3RK1A 4D4LA 1ZI8A 1FP6A 2RGNA 3LP8A 4AXBA 1FQWA 2XOEA 3W8NA 4B6OA 3QPUA 2FPWA 2GHIA 4AJKA 4BLTA 1HDZA 4MYHA 4JNKA 2KPOA 4TKVA 3UGJA 3TQTA 1ZINA 2Q8QA 3DCJA 1SH7A 1XPUA 3T4XA 3BGWA 4B8YA 3EIQA 3L8EA 2AR9A 2R48A 4DBLE 1COWD 1JFRA 4W5OA 2WZCA 3GD5A 2HIMA 1BMTA 4P0TA 3PHGA 4XJVA 4E31A 5B1IA 2IS1A 2X6RA 3SHFA 2GPBA 2QL5A 3OTHA 3ZS8A 4HDRA 4G5GA 4QHTA 4R98A 3VHLB 1KI3A 4EMSA 4F9EA 5JZVA 3PPYA 2B6HA 3QLUC 4FPXA 3B8EA 3MTEA 4QSMA 4WBSA 2BBSA 4PLVA 5H16A 1ZL0A 3WIBA 3BS4A 4UJ5A 1YRLA 5DFAA 4JI3B 2UUOA 1R6XA 1W85A 4UZSA 1P18A 2V74B 4JBXA 1B3BA 4JQCA 1H9AA 3GRAA 2RSLA 2HRBA 4E21A 4PC2A 3W1VA 4JLPA 4ENRA 4HFMA 5IARA 4ZYZA 1L4FA 4HC4A 4E03A 8ADHA 2XB6A 4EZIA 3H9QA 4Z53A 3EDOA 2AMFA 3QG1A 3W6PA 3REFA 4KMMA 1NZFA 4FGUA 5EOVA 4C1NA 4KJXA 2HMWA 4KMSA 3A6EA 4WWHA 3TMAA 1RQNA 3U56A 4QU8A 5AKZA 2DUNA 1T6BY 3JYPA 2FB9A 3HHEA 1QNLA 2OT3B 3DYBA 2HTFA 5F1YA 1LK0A 5K45A 2K87A 1Z5PA 1PAUA 3PUJA 2C2ZA 1JLKA 2FUKA 1NQXA 4E11A 4HDNA 2I87A 4KO4S 3I58A 1CUEA 4JY7A 4HLNA 4BB5A 4G0ZA 4OYYA 5E7MA 3NUQA 2G04A 4BEWA 1DWQA 1UBOS 2HN9A 4KDCA 3I73A 2P6PA 3KAPA 2P40A 4N6NA 4LZPA 2BHTA 3OJFA 1U2EA 4IS3A 4RD3A 1BGXT 5GINE 3NIGB 2QRNA 4KBGA 1YGYA 3OSUA 4BNLA 3MRSA 9LDBA 4KSBA 3HWWA 3IAS1 4J7XA 2FJPA 5E2IA 4D5GA 2AVNA 2K2WA 3FSEA 5DHPA 3G2IA 3TNLA 4DQLA 2IL1A 3PF9A 4BMOB 2VJKA 1J0EA 2OYRA 2PN1A 2JD0A 2PD4A 1VHJA 2O9JA 2CF6A 1IUPA 2ZUVA 3Q7SA 2J59A 4JJ4A 4LC1A 4HAWA 3ZEAA 3BMNA 2CY0A 3FZGA 4KFSA 4JI2B 2HXYA 4C0BA 2FE1A 3PEEA 1IMJA 3GLFB 1H94A 3HCCA 4LXUA 4TL8A 4JL8A 2Y1XA 1CY8A 4UBNA 2OP1A 5EHGA 1XYYA 3MXOA 1C0LA 3AM1A 1IM8A 4M37A 3KWLA 1O95C 2GQ0A 2GHRA 3B70A 3CF4A 4ZYLA 4WW0A 1GTG1 3FKSA 4JLKA 1E2IA 3BGOS 1LWOA 5HF9A 3IEPA 2AC4A 3PFIA 4OPMA 1ST2A 1VLQA 3GLHA 4ALLA 5HBRA 4WFJA 5K0NA 1AV7A 3H2JA 4DIBA 3U4AA 2BUAA 3OP1A 3C45A 1YL5A 3Q6NA 1NNUA 4UFOA 1RAEA 1P1FA 2GF9A 1NVBA 3KB2A 4JUAA 4NS1A 2P2CA 5BR1A 2E4YA 4QRHA 1HKHA 4OQMA 1J8FA 3Q6MA 4LYEA 1ORHA 3ONVA 2CZGA 3CLKA 1MV8A 1ICIA 5CEEA 1GLNA 4U7GA 1U2ZA 3RAPR 3VHXA 2W2MA 4QKQA 3COPA 2C03A 3FGZA 3LUPA 4LF9B 1LDEA 3AJ9A 2F90A 4HAZA 1NW6A 1SU8A 2D1SA 1E60A 4FVTA 4XIIA 1K88A 1MCZA 1CJSA 1P61B 2VP2A 2WHEA 3AUFA 3SR0A 4NDAA 1LSOA 3EGCA 3V2GA 3MGBA 4PAOA 4N8EA 3VDQA 2Y9PB 1XQXA 1B0ZA 1GIAA 1ZGJA 3HVUA 4JC0A 1MRZA 3RSZA 4R71A 5KTNA 2X15A 3H4IA 4I2NA 1FFDA 3OM9A 2I03A 4TMXA 5TV2A 3HYLA 4Q3LA 3QLVA 1S9DA 4AF6A 5BT8A 1DQNA 3R0ZA 2C04A 1IHYA 5AM5A 1HTTA 3DHNA 5JWOA 1SBZA 1JKJB 1UJMA 3N53A 2PGOA 4ZOCA 1XTUA 1B2LA 1C9NA 4HAYA 1G6Q1 3GJ3A 4MIOA 3DS8A 3C3MA 1ZR4A 2W6JD 3SKVA 2YVUA 4XJXA 2F00A 5H68A 1FFAA 4IFTA 1U11A 1I6KA 1GU1A 3R3XA 1DXQA 2C82A 1ZH6A 3I9LA 4KLAA 1NASA 4GMDA 5CB4F 1CNEA 4CVNA 4JODA 2ZKLA 1G19A 1GPWB 1XWWA 1JJAA 1RRPA 4RK1A 1NQTA 2FPMA 2CMDA 2NQ2C 3GAAA 1MENA 1VP3A 3IAM6 2WOOA 1KC1A 3VPSA 3M2TA 4N0PA 5HKAA 2QLFA 3A3NA 5KNCH 1TQ4A 4BVKA 4E5PA 3ND8A 5KCZA 1LS1A 3BGDA 4YJFB 3WI7A 1APBA 2XQVA 4A3SA 3K0EA 4BVFA 4PX2A 3TRFA 4ENSA 4U2KA 3CT4A 1M0TA 1OXVA 2YJ4A 4NESA 5B58T 3WK9A 1NP3A 2DBZA 2QY9A 3OT1A 5DXFA 2J30A 2JIDA 1HTWA 3T9EA 2OSVA 1B8OA 1FBNA 2OHOA 1G66A 4M87A 3EG9A 3SR3A 1S8NA 1T8TA 1LBHA 4LXQA 5D5PA 3VSBA 4QG3A 4WJKB 2KLHA 2O06A 5A03A 2PQ6A 4XGNA 1X14A 3GT4A 3RVRA 2GEFA 2ZJ8A 3QFTA 5BSVA 3C6XA 1V4BA 4Z6KA 5CM8B 1MB3A 1BG6A 4TWRA 2QYSA 1BVRA 1U0TA 4D4MA 4M7OA 2DQYA 4L9RA 5EJEA 2XRMA 1YZTA 1V1RA 1DT5A 3H9GA 2XITA 1GO2A 1QFZA 3C70A 221PA 3PNBA 3OQOA 3DFFA 4YT4A 4M9SA 3AOEC 2SKEA 3D4PA 2O8DB 2BEVA 5K0ZA 3MT9A 3HABA 2JVKA 4FUQA 3SN6A 4Z49A 1QHXA 2ORWA 3D3NA 4TMWA 5EE9A 3AB7A 4R1TA 4PBRA 4BN5A 5HVNA 1T8SA 3MJFA 1B8UA 1JIQA 1RZRD 4EF4A 1N4DA 1FJ2A 4K05A 3VR0A 2PUFA 1UJCA 4OL9A 4XX0B 1ZHFA 2I6FA 3NVKI 3QEBZ 2R6DA 3EXG1 3KCNA 2EKBA 3PPXA 3R6DA 1YRHA 4HNRA 4DLKA 4URVR 1R27A 1NX6A 2E4UA 2PFKA 3MCVA 1ISJA 2FRDC 4HS4A 3CO5A 1SRRA 1PDWA 2VBFA 2BHNA 4MAAA 3WFIA 4YH1A 3LBAA 1NI5A 3RSGA 1KEUA 4V39A 3AM4A 1YF3A 1NSTA 3ONDA 1PKEA 1U5AA 2XKBA 5ETJA 3LHFA 3UB4A 4P81A 2UYGA 3I5YA 3IP3A 1JSXA 1KAOA 5TY0A 4A7PA 2G82A 4ZI3A 4ZEWA 3GDWA 3PR3A 3NDBB 3BMCA 4YJ3A 3SKYA 1NZJA 1E6CA 2OFXA 2PR7A 2J48A 3L8HA 2B4TO 4TZKA 1G7CA 1GNSA 3DULA 4PZDA 1ZWKA 3OBIA 3RBVA 5K7SA 1F12A 2QTCA 3TQRA 3D6FA 2H2DA 3OIYA 5JNWA 5DMHA 5AIAA 2QD1A 4FD3A 1JSRA 4CF3A 2C78A 5I7SA 13PKA 3FPSA 2G1PA 4BU1A 1V1JA 3KJGA 1T5BA 3C7TA 2RB5A 4RMJA 2R1ZA 3T61A 3CVXA 3PA8A 4G0XA 3EJWA 2XNHA 1PJBA 2WFLB 4X3CA 1FFXA 1VJRA 3HMQA 3JSXA 3P26A 3K0CC 5DRTA 1QIDA 1T9CA 4YV1A 4ZVSA 2GZ3A 2VSQA 1DVRA 1XYGA 4AYTA 1E94E 1M83A 2VYVA 2RHGB 2XSZD 4XR4A 2EARA 5EJ9A 1OXMA 2YX1A 3GRFA 2YMQA 2CNWD 3K5IA 4B17A 3LP6A 2HHCA 3D4IA 4GO1A 2NT4A 2A5LA 2P4EA 2VP3A 3KOWA 1U90A 4OHMA 3W8DA 3DDCA 2CW5A 3THWB 1X3SA 3N2YA 5FNVA 4OQNA 3OM0A 2G4VA 2H00A 2OCDA 3Q0TA 3W9BA 5GAJA 1G6KA 4MV3A 1IBCA 4JB2A 4NFSA 4RQTA 1XCGB 5DHFA 3TL3A 3UJ3X 5LQAA 4DWVA 1WW8A 3EPKA 3E2PA 3NH9A 3ZVMA 4XAQA 1W76A 3HLYA 3BMOB 4Q7LA 5FQNA 4DCPA 4U02A 4EYGA 3QM1A 1YCFA 5JV5A 1V11B 5KQMA 3I6BA 3CUYA 4FYXA 2WVGA 1EUDA 4NBWA 5HF5A 5LZ4A 1F9AA 3M6WA 2WYHA 2V0CA 3VPCA 1DDIA 1YU6A 4QD3A 2C88A 2DUMA 4H7KA 3IMCA 4BDTA 3FUTA 4EVIA 4F38A 3OX4A 5DVZA 1XCOA 1UXJA 2Q1SA 3K72B 4FBLA 3WQSB 4FFPA 3KAQA 1W2GA 5CT4A 4LRTB 2W2LD 2FZGA 1KDVA 4EJMA 4D9EA 4ZKDA 3K0KA 4AY2A 2B1IA 4KN5A 2OCXA 3NANA 5G2OA 3TRIA 4KUEA 1FE8A 1OBOA 2JGMA 1OZFA 1H6DA 3LXMA 3RKUA 2X6QA 3F6CA 5IC4A 5CVEA 2H1OA 3FUVA 4KXVA 3DTVD 1E1CA 2YHAA 3WLPA 5FBVB 1PFQA 2PBLA 1XZAA 3EMKA 1E3JA 3GRVA 4HDKA 1A5ZA 2J0VA 4HYEA 5J4VA 1BKYA 2R25B 4DV1B 2HL6A 1HA3A 4HSEA 5BMOA 5LNK1 2JB9A 3R5HA 1JG1A 4FFBA 2DYKA 3OCUA 2GRUA 1ATIA 3QE0A 4R0NA 3ZIDA 3B6KA 3EVZA 1Y63A 1J5EB 3AVTA 1MKYA 3IALA </