4QM6A

Structure of bacterial polynucleotide kinase bound to gtp and rna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of bacterial polynucleotide kinase in a michaelis complex with nucleoside triphosphate (NTP)-Mg2+ and 5'-OH RNA and a mixed substrate-product complex with NTP-Mg2+ and a 5'-phosphorylated oligonucleotide.
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Transferase/rna
molecule keywords Metallophosphoesterase
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qm6A00
5IHPA 4XD7A 1EFHA 1XBTA 1D2NA 1L7VC 1OXXK 1Z06A 3A58B 2FMXA 4IVQA 3TLXA 4LJYA 2ZM5A 4Q1FA 1XD9A 1E6CA 1KK2A 2R44A 2WMOB 3ZIAA 1J8YF 3RS5A 3HJNA 3K8YA 1U9IC 2YWEA 3L0PA 1R7RA 1W47A 2GEVA 2GRJA 4XTCS 3SR0A 3C5HA 2ZYWX 2X8AA 2WJGA 1XNJA 3CZQA 3GLHB 4A9AA 1CR0A 3W3ZB 4ZI2A 1UKVY 1Z29A 2A7QA 4JVLA 3ZVLA 2ZREA 4Q9IA 1Q57A 1T8UA 1DAEA 2QNRA 4FI3C 5HE9A 1QVAA 4KVAA 1CR2A 1R5NA 4LHXA 3RRZA 1KDOA 3SJBA 3QQ5A 3SFZA 3TVDA 4HUQB 2BEJA 1VPLA 3L0OA 1DO0A 1FNMA 2V6JA 4AKIA 1KKMA 3QF4B 1WXQA 1S0UA 5AK0A 3BH6A 1G7TA 2QU8A 5CB8A 2A9KA 1GILA 2KBEA 4RKEA 4HLUC 1D2MA 1RW4A 3B1WA 3KKMA 1NNEA 3QIAA 1OYWA 2B7CA 3IO5A 4LDJA 4OQNA 1EESA 3WYGA 1KO7A 1NLZA 3ZJYA 1GNQA 1DELA 5H68A 3FMOB 3R7WA 4LJAA 4IDNA 2Q3HA 4O2LA 1XPUA 2CL6X 6Q21A 3VHLB 3Q3JB 3I73A 3EPHA 4JL8A 5SZIA 1G4UR 3TE6A 4URVR 3K0FB 1RKBA 2YZ2A 2ZE6A 4OI2A 1E0AA 1HTWA 1P2VA 2MSDB 5FUVA 1O3YA 1Q1QA 3QKTA 4OQXA 4QGGA 4F92B 1R0ZA 4N0EA 2Q0HA 4EPTA 3R20A 3AP3A 1GZSA 4FMDF 4EQ6B 2J7PA 4WXPA 2WPDD 2WSMA 4O2RA 1G41A 4W5JA 2VP2A 1KI9A 2BM1A 5CM8B 1W4CA 3T5GA 3TW4A 3MRSA 3RRMA 3JZMA 3LXXA 4US2R 2Z0MA 1TMKA 4YLGA 2FOLA 3QKUA 2HYIC 1RE0A 2D06A 3BK7A 2P67A 4TQUS 3KJHA 1IY2A 3M1IA 4RJLA 5L3QB 1GVNB 4BFVA 2EQBA 2L0XA 3QPWA 4RSGA 1R4AA 4MRSA 1E99A 5J4YA 2IS6A 2VLIA 2JCSA 4A0GA 4WA7A 4B48A 2IWHA 2IBMA 5JRZA 2VSXA 4IVPA 1E4YA 1A2KC 2AK3A 3LVQE 4E5UA 1M7GA 3K9GA 4JLDA 1R6BX 2VHCA 3I1FA 3T12A 1OH5A 4CEHA 3R9XA 1W48A 1U94A 2GJ8A 2KI5A 1KGDA 1Y63A 3L0IB 1HV8A 2VQSA 3UK6A 2WWYA 1KMHA 5KPJA 3PVSA 3MCAA 1F3OA 1ZM2A 2H16A 2AX4A 4E22A 5KTYA 5ELXA 1VECA 4NU0A 2IYLD 5EXTA 1NBMD 4NYJR 4FMBB 5JS8A 3QPUA 1SVSA 1DAMA 2WJHA 3AVQA 3U7GA 2QT1A 1IOZA 3ZS8A 1P75A 2CNWA 1VCMA 1VG1A 1E2MA 1XPOA 4D4LA 1KJYA 1G8YA 3W8NA 2GXSA 1OXSC 3O47A 4B76A 1OIWA 4JMPA 2P65A 2BVNA 3BERA 3U7FB 1OYYA 1ZD9A 2PMKA 1E9EA 2IC5A 3UWKA 2GK6A 1SVWA 1WF3A 2CCKA 5FOSA 1G7SA 4BFYA 3WRXC 4KLNA 2JLQA 3WNBA 3RRYA 4DCUA 2N1BA 3EPLA 1GTVA 1Z28A 2HJGA 2WSSA 3U3MA 1IAQA 4L16A 5AUOB 4ON9A 1II8A 3NEYA 2Q3MA 3D6TB 4NBSA 4EJSB 1RC8A 3TR5A 2REBA 3BD9A 1KTVA 2IF0A 4JVSB 2OLKA 3G0HA 1OXTA 2OHFA 5E4FA 4BEBA 2H1LA 4IOMA 2B8TA 2X77A 4BZQA 4LV5B 2GILA 3GFTA 1TF5A 4MH0R 1MO5A 2IHBA 4JT2A 4V0NA 1NI3A 4BE7B 1QHHA 2ZJOA 3VX4A 1OSNA 2G3YA 4BQSA 2GBLA 2RGBA 1XEXA 2ZS7A 3U6KA 5EE3A 1W0JA 1AKEA 3ZIAD 2IW3A 1OHHA 4MUAA 2GAOA 1KSGA 2O8DA 2DY1A 3VR2A 4DB2A 4YQFA 2F6RA 2WJJA 5CK5A 4PHHA 3F8TA 2GA8A 1AS0A 5CYOA 3AF1A 3RS2A 4QM7A 2KB0A 3SE0A 1GFIA 1BYIA 5AUPB 1E79A 3RS4A 5BQ5A 1ANKA 5HCIA 3MAAC 4TLDA 1LTQA 4TLAA 4V0ME 3ND9A 4FWTA 2W2XA 2W6ID 2G9NA 2BBOA 3OIWA 1A5TA 1YRBA 1DS6A 3CF2A 4DSUA 4OHVA 3ECCA 5CYPA 1Z22A 3IILA 1SKYE 1N0UA 2ATXA 3HWSA 3V00A 5JSZB 1SGWA 3U6BA 4A0HA 1E2IA 4POAA 3AVVA 3VKGA 5K8LA 1LVGA 4GZMA 3TRFA 1F2UB 4RVCA 4B33A 2O8FB 3SN6A 3PITA 4C0QC 4BFZA 3K0AB 5G3YA 1OB5A 2FPLA 1NMYA 1FP6A 5FBVB 1JXOA 3SBDA 4WW0A 2HEIA 4JL6A 1J99A 2ZQ5A 4PSAA 1Q1BA 4HAUA 2C9CA 2OBMA 1CJUC 5EXPA 1TPZA 3M4YA 4G5QA 4D0LB 4DDWA 1VIYA 2XAUA 1GM5A 1AZSC 5JECA 1NRJB 2FG5A 3CONA 5JI2E 1FMLA 1NJFA 2ZI5A 3W5IA 4GDFA 4EPXA 5TXGA 1TNDA 3IUYA 3O8DA 1HT1E 3Q8XB 2BEKA 3VNVA 1NVWQ 1Z08A 2NGRA 1HH4A 3Q72A 3QEOA 2ZRFA 2GF9A 3PEUA 4MRVA 3MFYA 2WIAA 1M7BA 3CPHA 3BXZA 2BMFA 1HEIA 1P7CA 2QGNA 3W5JA 1N6NA 5FPYA 2P5SA 2ZSBA 4JL5A 4JYBA 3U44A 1YR9A 3THYB 1SKYB 5FOUA 2NO1A 4Q02A 4TMKA 2GDJA 4Q48A 3FPAA 3CWZA 3Q5DA 1IN8A 1XEWY 4CW7A 3QJYA 2FE4A 3R8CA 3CB4A 4RD4A 1RJ9A 1XCGB 3AVWA 1ZNYA 3FB4A 2JGNA 3P1JA 1D5CA 5J4HA 2O0JA 2OILA 4JZKA 4DSTA 1GL9B 2VP4A 1ZU4A 2IYVA 4RD0A 1TAGA 2ZRKA 1I4DD 3AKCA 1EFCA 3QXHA 1QZXA 5E7JA 1AGPA 1QHXA 4ACBA 1LS1A 4DDUA 1J90A 4DLXA 4DUGD 1COWA 1KI6B 4I1VA 2QEQA 2FNAA 3VR1A 4OI0A 1BMFD 3U3JA 5CDFE 3DM5A 2A5YB 2OCYC 4UJ5A 4B3DA 621PA 1NBME 4I81A 4LPKA 2IUUA 3K9NA 5FR2A 2V55B 3KKPA 4LYHA 3BFKA 3MG9A 3QNUA 3VU9B 3W34A 4B3CA 5CK4A 4F91B 4A92A 2GF0A 4DSOA 5JS7A 5FUXA 1N25A 2RMKA 2HV8A 2ZVQX 3OEHD 2GBLC 3GEHA 5AJZA 1GG2A 4F7WA 4CT5A 5JEDA 4MKFA 4Q9HA 4TTQA 2IYZA 3EZ9A 1LW7A 1E2QA 4B6EA 1OT3A 2GEDA 2C04A 2J0UA 4PANA 1EFRA 4QBFA 4WAUA 4V02A 3KKOA 2XXAA 1KI7A 2IEYA 2XNDD 2ATVA 2FJUA 3EXAA 1L8QA 2KWIA 4AKGA 2O8EA 2FZ4A 3PUWA 1ZP6A 3LY5A 1AQUA 1WE2A 1DG1G 3IIJA 1R0YA 3QEJA 3NKVA 1F2TA 4B75A 2GCOB 2XJ9A 1FTNA 1RYHA 2AXPA 4KU4A 3DDCA 4NONA 1OF1A 2FGKA 4A36A 3L8ZA 4ZIRB 5KSZA 1GRRA 2WJVA 4C0HA 4W7SA 1W4BA 2Q6TA 1T0HB 4PAMA 4BLPA 4ERNA 2O8BA 2QAGB 1J2JA 4TT3D 4QGHA 1G4AE 1T3HA 3H0KA 1XEXB 1ZW6A 3LQQA 2D2FA 3SOPA 4Q4HA 4D4MA 3CNLA 2QM7A 3PEVA 4QXAA 3A36A 1N5JA 2YWGA 4NL4H 3THXB 4QHTA 1G8PA 3AEZA 1Q21A 4UJ3A 1NIJA 2F43A 4L9SA 5FTJA 3KXIA 2V7QD 3B13B 4I1SA 1Q0UA 1US8A 1XTSA 2HCBA 2JLXA 4DIEA 2WKPA 2G1JA 2XTMA 3AGQA 4A8JA 4ZDIA 4B32A 2R6AA 5FTLA 4C0KA 2ZS9A 3B9QA 2OAP1 3KQLA 1E9RA 4PHGA 4NE2A 2ZS8A 3A1SA 3VAAA 1E9SA 4EQ6A 4Z54A 3T35A 1KI6A 3KXKA 2XOKD 3AQ4A 4MA4A 1ZCBA 1DAIA 1E2DA 2IYWA 4L8GA 1K6MA 5A4JA 2GZHA 4PZYA 3FHCB 1T6NA 4C0JA 1RVDA 1ESMA 1JR6A 1GKUB 1MRNA 1XMSA 1Z6AA 4Z51A 3A6PC 2ODWA 2C9OA 1FPMA 1P4SA 3BJIC 1US8B 1WP9A 2BC9A 4UNNA 4TSFD 2ZETA 4GZLA 4JVMA 3ADCA 1KK3A 2XSZD 1OH6A 1T4GA 2Q9AA 1SVKA 3CF0A 2V3CC 3AVXA 1QHGA 4EJSC 2B6HA 2OCBA 1Z0IA 4PPNA 4Z8XA 3AKDA 1GITA 1YRAA 4NYMR 1Z3IX 4QJ3A 5EUMA 3I62A 3IIKA 5BN4A 4LC0A 3T5DA 2ZJZA 2UVQA 1W46A 1KO4A 3KJGA 4PQFA 2XTNA 4IHQA 4Q7JB 2FSIA 3AP1A 2HLDD 2IK8A 1EGAA 2ZI3A 2PCLA 1ZMXA 3SJCA 4YMWA 1NKTA 421PA 1ZRHA 1VIAA 1S3SA 1WQ1R 2QM8A 4D2IA 2NPFA 1X86B 2F43B 3VMFA 3KQUA 4QGFA 2ZIAA 3J81k 1U0JA 2AFHE 2GJSA 2MMCA 4MYCA 3FHTA 3VFDA 5FL3A 3WBKA 5AUNB 4PO8A 2H5EA 1TX4B 1YR8A 2GJAA 4KV9A 2WHXA 4JJZA 1ZYUA 3RC3A 2B21A 1G8HA 2RGCA 4JLNA 2J5XA 1UBCA 3LWNA 4LBZA 2FA9A 3W6OA 2NMVA 4LYJA 2F1IA 3GFOA 5FOVA 2XSZA 1FQJA 5KU1A 5E7MA 3T61A 1G6HA 4JVNA 2IS1A 5HZHA 3BOSA 1YR7A 2VO1A 4PO9A 2IL1A 3GMTA 1HQYE 4JYCA 1NG1A 4RKFA 4I99A 2IS4A 2ORWA 2ZJYA 4LSGA 2VF7A 2OESA 5TARA 3SNHA 4AWXA 3ASYA 4Q9LA 1DAFA 4MKHA 5DYIA 2BMEA 4HAVA 4HZUA 5D3QA 4RFVA 3OF5A 4B2PA 2QA5A 4DBLC 3EC1A 2EWVA 2UZ3A 1ESNA 2QZ4A 3B6EA 2CE7A 5M04A 1QDEA 2FZLA 3MD0A 2ANCA 4GRAA 1H8EA 3DPUA 1F5NA 3HPRA 1G20E 3LLUA 3IQXA 4EFLA 1OIVA 2F9LA 2RGDA 3NHAA 4DJTA 3EASA 1S1MA 2YHSA 4ZV4A 4P4SB 2YINC 1T5IA 2BBWA 3DZDA 3W8RA 2YOGA 1KO8A 3WP1B 1LS6A 5F98A 5EQTA 2ZI6A 3ADBA 1Z0FA 1SVIA 3LBIA 1HA3A 1VKJA 3DVLA 1R5BA 2EFCB 2V54A 3OEED 1U99A 4DLTA 3GLFA 1FL9A 2ZSAA 1MH1A 2WWFA 4MUBA 3KQNA 1S3GA 1CRPA 1N6LA 2ZRPA 3LX5A 1ZUNB 1XF9A 4D0GA 3V4RA 1XB2A 2D7CA 4V0MA 3A1WA 3RANA 5BYKA 3CM0A 4B3GA 3QXCA 5FI0B 3ZVRA 3EZ7A 5BYJA 1NMZA 2IYRA 4EPRA 3UG7A 5EP2A 1W36D 4LPSA 5J40A 3R9WA 1KSJA 3GJ5A 2FPMA 1M8PA 1U8AA 4AURA 1LNZA 2RH5A 1T0JB 2VHQA 2VHTA 2C8VA 1TQ4A 1CJVC 2W2TA 1DARA 1TL7C 4MRNA 4BUJA 4D4KA 1CBUA 4LY6A 4TQ9A 4B3FX 1BS1A 1YZNA 5GVRA 4BRWA 1SZPA 4RZ2A 1B0UA 1ELOA 1HQCA 3RSLA 2ODBA 4KAXA 4LBYA 3G5UA 2E9SA 3X1XA 3QY0A 4JLOA 3QUSA 5C18A 5GJWC 4B6FA 5B57C 1XD8A 1QF9A 1C9KA 3EZFA 3MGCA 2W00A 4BFSA 4X8MA 1Z2AA 5GJBA 1KOFA 1Q3TA 3AF4A 2G83A 1T9HA 1KY3A 1ZCAA 2WBLC 5JWHA 4AC9A 1G3RA 1C1YA 4QC2A 4RD1A 5HTKA 3SHFA 3AB3A 3TUJC 4B74A 3UMSA 2F3TA 4QM6A 4D82A 1SQ5A 1XTQA 4FCVA 4DB4A 4IOKA 2PX3A 2RHDA 2AN9A 4JBWA 3FYHA 2YC2C 2PZFA 1XZPA 3BE4A 1PLKA 4NCKA 4M21A 2CL7X 4BZPA 5FOTA 5KYKA 4TL9A 3IQWA 2VSFA 3DMNA 4HDOB 2QP9X 4HZUB 3DOFA 5L3SA 1UAAA 5IT5A 2JJ1A 1YZTA 3RWOA 3SQXA 3NC0C 4BLSA 2PBRA 1EFTA 4LYFA 3GLIE 3TAHA 1C4OA 3QXXA 4OK6A 3PXGA 4QL3A 1SXJD 2HCJB 2AD5A 1GSIA 2IYQA 2ZI9A 2XGJA 1P62B 4LJ4A 1MABB 4M1OA 2BJVA 3B7GA 1ZNZA 3MWKA 5B58C 4D80A 4CEIB 4G1UC 3RABA 5FBLB 3KQKA 2YKGA 3QG5A 1J8MF 1HUQA 1P9WA 2CLDX 3AKEA 1M2OB 1D6JA 4KHZA 1P73A 1AKYA 5IRCD 1Q1ZA 1FOEB 2O0KA 3M0EA 2QN6A 3C14C 1E9AA 4FMCB 1E2KA 4PAOA 1KIMA 1XDBA 1MRSA 3CH5A 1JEEA 4IOJA 1AJEA 2B7BA 3TSZA 2J45A 4OHYA 2F9MA 3K0FA 1E1QD 4EKDA 1AM4D 4M1YA 2PZEA 1P9NA 3CH4B 3AUYA 5EE5B 2F55A 2OXRA 2QG6A 2WAYA 4DCVA 3T1VA 2Q21A 3QENA 4GFDA 4CRWB 3WMGA 2W6JA 4DLSA 3FFBA 4G0NA 5FBRB 3THWB 2HXSA 4ZCIA 1JAIA 1QG2A 5BWMA 4Q47A 1KK1A 3AVPA 4D0NA 2XZLA 3OE7D 5B30A 3RC8A 4TMWA 4Q18A 4BLTA 5F9FA 1ZM3A 4LC1A 2QP3A 4M1WA 5P21A 3KUCA 5C46F 3DOEA 4P31A 3AVOA 2BWJA 4ARZA 3I8SA 4PR0A 2VP0A 1N6RA 2CE2X 5G40A 4DZZA 2HT6A 4OI1A 3V4FA 2WJYA 3W6NA 1Z6YA 4JLPA 1AK2A 3H1TA 1EX7A 4Y0VA 4C0BA 5EE1A 3IGFA 2FEOA 1OKKA 1CP2A 1DBSA 1XMJA 4QBIA 2GWHA 4RZUA 1MO6A 1VMAA 2WAXA 4NP6A 1MKYA 4DUGA 4P0TA 1T3SA 2JIZD 1X8LA 4G5GA 3ZD6A 4DCSA 1JAHA 1EK0A 4OK5A 4DDVA 4CEIA 3BIFA 1N6IA 5FPTA 3NVAA 2YYZA 1NF3A 4TLBA 4WIAA 2FDCA 2QMOA 4DKXA 2Q9BA 5CITA 2J46A 2R62A 3K1JA 1LB1B 3AV0B 4YMVA 3S1AB 3THXA 3L2OB 3QVUA 2ZJ5A 5DN6D 4KSCA 3AUXA 3B1YA 1KNQA 2CJWA 2DCUA 2ONJA 2WWXA 2QL6A 2H57A 1E3MA 2AKYA 5FBQB 3CRW1 1X1RA 4HAYA 3RSOA 2PX0A 1P2TA 4UXJA 1NN0A 2RAPA 2KE5A 3EPJA 1JJ7A 3EC2A 1OXUA 1UEJA 1R8SA 3U3OA 1WBDA 1SVOA 3B9PA 3N70A 3CNOA 4U5XA 5HE8A 3NBYC 4JIMA 2PT7A 8OHMA 3T06B 1FUKA 2JATA 2QPOA 2RGXA 1V43A 2OZEA 1GL6A 2ODEA 1GNPA 1U2RA 4TTPA 3TR0A 2H92A 4CF7A 1QHSA 2OCAA 1GKYA 4C7OA 1Z0KA 2GJKA 1WBBA 2QAJA 4EUNA 2F1RA 2QBYA 1E0KA 4JSYA 3Q9LA 2WWWA 4PHTA 1R5OA 2N46A 2J41A 4ILEA 2AK2A 1G1MA 2IA5A 2YOHA 3LW8A 4ZIRA 2CNWD 3KB1A 4ZDKA 4ESVA 4A15A 3RNLA 3T1TA 1GOTA 3SYLA 4TT3A 4XWAA 2WICA 4H9GA 4PQYA 4OQFA 3BWDD 2J59A 4HB2A 4QNMA 2NZ8A 3HPQA 1JECA 1O87A 3GLHE 5FTKA 4DT1B 1M1YE 3TQCA 4KFTA 2ZSDA 521PA 4YMUA 4A2WA 1J7KA 3T15A 4AI6A 1F2UA 2B8WA 4B35A 4AG6A 2R6DA 1N6OA 3NHBA 5GJCA 4R9UC 2GTPA 3NBXX 3PENA 1E94E 4HUQA 1NSFA 1S9DA 1TU3A 4BLQA 5JJIA 1DEKA 1IXSB 1G6OA 3VKWA 1ZM7A 3W9YA 1G8FA 2YWFA 3SBEA 2XX3A 4LV6A 3EA0A 2A5JA 3MSXA 4Q9JA 1E9DA 5AJVB 1D9XA 1SKQA 2W58A 4AD8A 1RRPA 1TU4A 2JIZA 3R9IA 5JRJA 4A8JB 2JLYA 4IDOA 4ZI3A 4IXNA 3ADDA 1JXMA 4DLRA 4QJ5A 5HCNA 5DHAA 3WYFA 5J47A 2IYYA 3F5FA 4Q9KA 4D81A 2MSEB 3CPJB 4BEJA 2P6RA 5TB5A 3EW9A 1RYFA 2RGEA 2FSGA 4A2QA 5SZHB 2CCGA 1W4AA 3T34A 1FZQA 3KTAB 3WNCA 3PV0A 3CO5A 1TQ2A 4B2IA 1PV4A 2C5LA 3PUYA 2DB3A 2ZAOA 1U81A 1M34E 4LHYA 2Y8EA 5TMPA 3M6AA 4V0KA 4C2TA 4CGZA 4BPBA 1E2GA 1JQJC 4AYXA 1TEXA 2WSSD 2GCPA 1MOZA 1N5LA 2NIPA 2ZRIA 4DCNA 5HKKD 2ZE5A 3QKSA 3WBJA 3MJRA 4ARZB 5KHOC 1GRQA 3NTUA 2C2HA 2WM9B 5KDLA 1COWD 2QAGC 1PJRA 3BFVA 5B64A 1H8ED 5DSZA 2AL7A 1BKDR 3P32A 2R8RA 4XTRA 4YXWA 2VP9A 4DEYA 3NDBB 2ORIA 1IY1A 3LH5A 4MKIA 1CEEA 2JJ2A 2IX3A 2OSBA 2R65A 4NHOA 4OQMA 3U44B 4WBSA 3PEYA 2XB2A 1XPRA 1MO3A 3NXSA 4P33A 3ZYCA 1XEWX 1IN4A 2QE7D 1WCV1 1YJ5A 2X2FA 2UKDA 2EFEB 3I8XA 3VR5A 3RWMB 2GXQA 4B43A 4UNRA 4A2PA 2FFHA 3K0AA 5DE3A 1G8GA 3T1QA 2LKCA 3AF3A 1GAJA 3EZ6A 1ZVQA 1XMIA 4OHXA 4BLRA 3WMEA 2AWOA 1Z0AA 1K5DA 1Y3AA 3GJXC 4PAQA 2GZAA 5G53C 1NY5A 1N3BA 3SC3A 2AR7A 2C03A 3PUVA 4M1SA 5HR5A 1NVVQ 1X6VA 4CEJB 1Z2CA 4GBMA 1IBRA 2IUSA 5JEEA 2FX3A 2EWWA 5D3MB 2NQ2C 5AJYA 4M1KA 4HLQB 1TF7A 4LBWA 1ZNWA 2ZRMA 4ZCMA 4E09A 4ZDJA 2ZRHA 2JLRA 3EARA 2DBYA 4OJKA 821PA 1F60A 1FX0A 4P32A 3TBKA 2XZPA 4XJXA 5EXSA 4O0MA 4C0SA 1ZM4A 3GEEA 1XXHE 3THYA 2ZU6A 3HR8A 3QPVA 4DSNA 3X1YA 1E1RA 4N3NA 4JLAA 3S1AA 1OFHA 3G82C 3GCGA 3WXMA 3EAQA 2CVFA 1DOAA 2DFLA 4L9WA 1Z5ZA 1UKYA 2G6BA 3K0CA 4MGZR 4KVGA 2EYUA 4QBGB 1G64A 4HATA 4HAWA 1W44A 4OI4A 5AUQA 4XVQA 1AS3A 2Q3FA 1JEDA 2OUKA 3OE7A 1RZ3A 3GLFE 2FPKA 3QF7A 5L3SB 3K9LA 5DI3A 1UM8A 4CIDA 4R71A 4KFUA 3I5YA 3AH8A 2J3EA 4LHZA 5ANRB 1E2PA 3ASZA 5FOXA 3GLHA 1B23P 5JJKA 3UIEA 2HF9A 2XITA 4EIWA 3EIQA 1P6XA 1G5RA 4NYIR 1Q1EA 1P5ZB 2JASA 4Q4AB 1KKLA 1K5GA 2QORA 5H1YA 5KOYA 4DRZA 2GESA 4E07A 2VEDA 3PCRB 4WZ6A 3CWQA 4CVNA 4PC7A 4B3XA 1XCPA 4RD3A 4II7A 1R10A 4F4IA 1CXZA 1KI2A 1P2SA 5KUTA 1S9HA 3IIMA 2ECKA 1IONA 4PC1A 4AIIA 4CZ2A 3RDPA 3OIUA 1P72A 1Q44A 2J0QA 2ERYA 4ZKDA 1E4VA 1ZINA 4I4LA 1G9XA 5LD2B 4FXPA 2C77A 3WNDA 4MGIR 4OJQA 4Z8YA 4TYWA 4BFXA 3I3SR 4US0R 2C99A 1GKIA 4GNKA 1AQYA 4V0LA 3ICEA 3U60B 5DNYB 4R98A 1Q3HA 2B92A 3CBQA 3LBNA 4L15A 3REGA 4ESHA 4HI0E 4BLOA 4FW9A 4B44A 2FV8A 4M8NE 3AVUA 2BOVA 5C1BA 4KI0A 2JJ1D 1VCNA 4IW3B 4QGAA 1EXMA 2ZJ8A 3CPEA 5J4KA 4GMDA 1T8TA 5AJWA 4B3BA 1QG4A 2XZOA 3FKQA 1WRBA 2QTFA 4TZ6A 4OHWA 1XCMA 2AFIE 3WY9A 5KDOA 3LRPA 1YHNA 3SYNA 1HURA 2A3RA 1BIFA 2O8BB 1KDPA 3C41J 3KJIA 4M9XA 1V5WA 3QE0A 4TMVA 2MMGA 3B2EA 1KYIA 4DLUA 3AF2A 2O8DB 1ZJ6A 2XNDA 1RIFA 2QTHA 1AGRA 3KX2A 5JWRA 1CR4A 1EFRD 1Z6TA 4URUR 4X8OA 4W5WA 4R7ZA 2VA8A 5TY0A 3E70C 2AKAB 3HU1A 2YJTD 4M1TA 4M1MA 1E0SA 4RCZA 4TL8A 1TUEA 4QG7A 3OHMA 1KZGB 3TIFA 5C2JB 3BORA 4TTRA 1YZGA 2A30A 3ZZ0A 3SZRA 4P4UA 4UKDA 3O8RA 3K0CC 1NP6A 5EE0A 2IF2A 3FKSD 1ZIPA 3RRNA 2AXNA 3B1XA 4ASUD 2GXAA 5K8TA 4G5OA 1SXJE 3TUIC 1VG0B 4A0RA 1G16A 3U7EB 4YMSA 2OE2A 1QHNA 5D3MA 1E0JA 5FPSA 5G3ZA 1M6NA 4CDGA 4Z1MA 1DO2A 4KYIB 1FNNA 4X8HA 5H70A 4DLYA 3UANA 4EFMA 2XTZA 5KSOA 4U7DA 4Q66C 4LK2A 1H8HD 4HDQB 2Z6VA 5AJXA 5JJLA 4LCBA 5EJEA 4LJ5A 3ZZTA 3DL0A 1WDTA 2LCFA 3EIHA 5CDFA 1VCOA 3LDAA 4I1UA 1GNRA 2VHJA 3D31A 3N2IA 2FFAA 2QMHA 1E69A 1DVRA 2YNMA 3KFXA 3UMRA 4BFUA 1VTKA 1UFQA 1XP8A 2FGJA 3E5HA 2V9PA 3CF6R 4KFRA 4KO8A 4A1FA 4Q1DA 1R2QA 2EFDB 1XRJA 2GEUA 1BO6A 1FMJA 1NVUQ 3L8YA 4QKQA 3H4MA 3WHLA 5JMTA 4IDPA 4RFSB 2WMNB 1JR3D 2A78A 3R7WB 1Q22A 3BRWD 4M22A 3CW2A 2WWHA 5DH9A 121PA 3PEWA 3V9PA 1HE8B 2ZUCA 1G7CA 3A4NA 1WB9A 5F2EA 2ZJBA 4AY2A 1CJMA 1WMSA 4IJMA 4P3YA 1QHYA 3CIOA 2SHKA 1HYQA 1T5LA 2XEXA 2DFTA 1E2LA 2IXFA 1G5PA 4TZ0A 4IDQA 1I4LD 2O52A 3CNNA 5L3RA 5BXQC 1RPZA 1UEIA 4HLCA 3VTKA 4BASA 3FE2A 4C4PA 3NEJA 5KO2A 4WZBE 4IVRA 5A0FA 4R2HA 2C9YA 1P61B 3GJ4A 1R8QA 4D25A 1UBEA 4UXIA 2JAQA 2DFNA 5C4GB 4GOJA 4AK9A 2IXGA 4NDZA 3QBTA 2O8CA 2Z43A 4IKEA 3OFND 4KITB 5EP4A 1W36C 4PZZA 4AYTA 4GI7A 1TUIA 2NO6A 2IHYA 3BH0A 2I1VB 1G5TA 2AD1A 3KKNA 4RD6A 4Q21A 2QENA 3FGNA 1U98A 3X2SA 4BRUA 2QQ0A 4S35A 1TTTA 2IYTA 1KO5A 4ZPXA 5B2ZA 2J0SA 4FMDB 4U02A 2BCGY 3FMIA 4DC9A 3PFIA 3LD9A 2ZR7A 3K70D 3SEAA 1CJKC 3CZPA 1U8YA 1WA5A 1M74A 1ZM9A 2VH5R 4EPWA 2IEZA 3QF4A 3BBPA 3TW8B 1BH2A 3B78A 1E2EA 4DWJA 2IYUA 1VG8A 2IWRA 1JNYA 4DT1A 1E79D 4M4SA 2ZYUX 3P27A 3WYAA 2Z5FA 4PC2A 2DYKA 2G77B 2GK7A 1VYUA 2FEMA 1VG9B 1Z47A 4RZ3A 4XD7D 4Q00A 1JALA 4HZIA 1VHTA 2IXEA 3ZQJA 4TL7A 2ZRJA 1NN5A 2K5UA 2CXXA 3CRMA 2PLRA 1P3JA 1II9A 1G3MA 4ABYA 1PLJA 2D2EA 2CHGA 2GZDA 4TLEA 3BB4A 3ETLA 2OFOA 3PUZA 4PO1A 5KNBA 2JEOA 2ZJ2A 1RRCA 3BB1A 3N5CA 3FHOA 3RYTC 4B47A 4QNRA 2IYXA 1N5IA 4JBXA 3TSOA 1SULA 2R9VA 1CIPA 1ZBDA 4LI0A 3QBVA 4UNSA 3TNFA 2JLZA 3OEEA 3K9HA 4H1VA 4WVFA 4URYR 4RFSA 1L2TA 3CKLA 3GJ0A 4DXAA 5LBIA 1Z07A 4N1AA 2ORVA 5EE9A 2V1XA 3OIYA 1FW6A 1K8RA 2QTVB 3OFNA 2BBSA 2J0VA 1KAOA 3K70B 4GP7A 5FUYA 3CLVA 2PCJA 5DYGA 2ZPTX 4OL0A 3VU9A 2WZQA 5HZKA 4FIDA 2P6UA 4Q1CA 5SZJA 3MWJA 1F48A 3N2EA 3B60A 2GCOA 4GOKA 1UDWA 5FPKA 3QKRB 4KXFB 2CHQA 2UZIR 3EZ2A 1OE0A 2NG1A 2XJ4A 1JB1A 1TADA 3MUFA 2V1UA 4QHYA 1SHZA 5KSYA 5IF9A 3MWLA 1YE8A 4C0AC 4Q4JB 2CEAA 1ZAKA 1N0VC 1VCIA 2ZE7A 1NSTA 2P0EA 1IQPA 3AKYA 2JLWA 5DI9A 2WKQA 1UJ2A 1IXRC 2H17A 4XSHA 1KDRA 3MLEA 1FUUA 2XB4A 2EVWX 4FMCF 1E96A 1S1CA 1OH7A 5FPHA 2YOFA 2BMJA 2NO9A 4NZYA 3VHXA 3D7MA 5JZVA 3LAWA 2OO7A 4TWZA 3SU8A 3DHWC 1SHKA 2QAGA 2CBZA 2VYFA 4MYUA 5J4LA 2EU8A 2R6FA 4JS0A 3HR7A 2V4ZA 4RD2A 4URZR 2V6IA 2O8CB 1BYUA 1Z6GA 4K46A 4NYMQ 1YZQA 1DG3A 1YR6A 1OIXA 3TAUA 1KAGA 1J70A 3PG5A 3TGPA 2YC4C 1KI3A 2QSZA 4JLMA 4MYHA 3JVUA 4TMTA 4LJ9A 1HY3A 2I4IA 4OHZA 1N6KA 3FDIA 4NKRA 3WP0A 2XNSA 4ASUA 5KNCA 4FINA 5F3WB 4G01B 4DCTA 3QSYA 4KBGA 4MGKR 2KSQA 2ZR9A 4O3MA 3JVVA 4XVUA 4DDTA 4PSVA 1I4TD 5FR1A 4A8JC 2CK3D 3DKPA 2RB4A 2HLDA 3CUEF 5E95A 3SJAA 3X1DA 1KZ7B 1CKEA 2VF8A 3IBYA 4IRUB 4C9BA 3X1WA 2O5VA 5JFGA 1CRQA 2DPXA 1E1QA 3ZZUA 4N0DA 4ZO4A 5FFMA 3U4QA 3CRVA 1HE1C 2FU5C 1OHHD 1FQKA 1P2UA 4C30A 1KI4A 1W0JD 1D2EA 3Q5EA 2DHRA 3AVYA 2JDID 1DE0A 3H2YA 4RY2A 2IS2A 2R6CA 1KDTA 3DEFA 4TSFA 4S2EA 5G41A 3GP8A 3MMPA 4XIGS 3GD7A 2CCJA 5K8UA 3B85A 1TQDA 4MYTA 1KO1A 4LBVA 3REFA 3WHKA 1GL7A 1VDZA 4HB3A 3K09C 1OJLA 1N6PA 1OXVA 3QXSA 1E9FA 4DIDA 5H8WA 1UKZA 4TYQA 2ONKA 4JKYA 4NYJQ 2CDNA 221PA 4FWIB 1SVMA 1ONBA 5EZ6B 1YQTA 2W0MA 2ZUBA 4Q7KA 3UATA 1IN7A 1XTIA 5JSZA 4GPTA 3P26A 2ASEA 2OCPA 3OAAA 1OFIA 4KSBA 4ZCLA 3VQTA 1NVVR 4ZKEA 5EP1A 3RS7A 3QI2A 1GWNA 4A6PA 1D9ZA 5L3VA 1NN3A 2ZR0A 4DHEA 2OLJA 4PPQA 5FUWA 5HPYB 2JA1A 4K8OA 3UPUA 4LV8B 1UDXA 4A4DA 5CIWA 4MITA 4TLCA 4LHVA 3I4LA 2CLCX 2LKDA 2ZRLA 4Q1AA 1N2CE 1I2DA 4Q5IA 3OESA 4IEEA 1DTSA 4IOLA 2MSCB 3ADKA 2KBFA 1UBFA 1EG7A 4Q1BA 3WRYC 4XWKA 5LDDC 2FFQA 3B1VA 4PHFA 4EPVA 4NCNA 4LJ8A 2RGNC 3C15C 5TDHA 5FBWB 2CVHA 4XOIA 4D6PA 2C98A 4AYWA 1NN1A 3ZD7A 1LF5A 1N5KA 1XJ0A 4LGMA 3LNCA 2VTKA 3A4MA 3LXRA 1JI0A 1IM2A 2OXCA 1TF2A 3KUDA 4BECA 2QBYB 1NKSA 3FWYA 3GLGB 5L3QA 2HJVA 2WIBA 1XJCA 3BGWA 4URWR 2PT5A 2J1LA 4G3XA 2P6NA 4TMXA 4WOPA 3AM1A 1S4QA 3O8CA 3QVVA 2HXYA 4HUTA 2ZRGA 3PR1A 1FX0B 3IBGA 3TMKA 2VP6A 2W2VA 2ZAMA 1II0A 2OFXA 1XEFA 3DMDA 4PC6A 4CEHB 1KMHB 3B1ZA 1T3LA 1KNXA 2QGZA 5DHFA 1BMFA 3Q7QA 2ZITA 1X8JA 4Z1MD 4M9SA 3SFVA 3U61B 4LHWA 4M2LA 2OBLA 4PZLA 4HSEA 3A37A 1W2HA 4ACAA 4MGYR 3MJHA 4OK3A 3HDTA 1HT2E 4F38A 3Q85A 3I5XA 2PEZA 4EDHA 3D8BA 4IXMA 1Q12A 1QVRA 4NYIQ 1A7JA 4HAZA 1VHLA 1UF9A 2J9RA 5CJPA 1IN6A 1YU9A 3GPLA 4MKGA 4HEJA 4M9ZA 2PJRA 3W3AA 5K8IA 2XXAB 3AVTA 4BWYA 3CX6A 4KYUA 1NIPA 5CJ2A 1QHIA 3EWAA 2E87A 3ZVNA 1RRGA 3P20A 4KFSA 2BMDA 4LJ7A 3PQCA 4PX9A 1P9RA 3UKDA 5FTNA 5CIQA 2JLUA 3QKSB 2OV2A 2X19A 5LB2A 3P4XA 1X1SA 2CLSA 1NLYA 3IPYA 4W5HA 5LB4A 1KHTA 1ZIOA 2R6GA 2IYSA 2OFWA 4NTZA 3U3KA 2PJZA 3GFPA 2QMUA 2V7QA 1GUAA 3EPKA 1QHHB 4WZAE 1GP2A 2DFKB 5TVKA 2PZGA 3TKLA 2GVDC 4FN5A 2X2EA 4RCYA 3CR7A 5C4MA 2VHUA 1DAGA 1A82A 3HU3A 4KCGA 4QRHA 3Q7PA 1NJGA 1MR3F 4JLKA 2F1JA 3B5JA 1ZD1A 5DIFA 1OPXA 5JBQA 2D3WA 1G291 1OV4A 3AGPA 1CJTC 3LBHA 4KJZA 5TV2A 5BN5A 5L8VA 2FF7A 1PUIA 1ZC4A 3C4JA 3NH6A 1L4YA 5IDVA 1GDDA 2JDIA 721PA 4GT1A 2DR3A 4QBHA 4BFWA 1NLFA 3K53A 5JI3E 2KJQA 2J7KA 3E1SA 2DWPA 2ZU0C 5DGXA 3RS3A 1ODFA 3U3RA 4WXRA 2BKEA 2BM0A 4O25A 2QPAA 4QFMA 3FFAA 4HLUA 4PTLA 3ZS9A 2QY9A 2QRNA 1SVLA 2X1VA 3LFUA 3OIVA 5FI1B 4CT4B 1XJQA 4JKIA 4DLZA 3C16C 3F3YA 4OYHA 1QBKC 3L82B 3EA5A 2VP5A 2RGAA 3FKSA 2QI9C 3TJZA 1XU4A 2C78A 2WJIA 4C3ZA 1LV7A 2W6IA 3IDQA 3CX8A 4Q7MB 3VKHA 1AN0A 2R2AA 4FCWA 4TQAA 2WWGA 4ZDWA 2CK3A 4JJKA 1W36B 2BIFA 5LPNA 3GJ7A 3BS4A 3A4LA 4W9MC 3C5CA 2OG2A 3K0SA 4LX0A 1ZC3A 4UNQA 4V0OA 5JHGB 3ZDQA 4KBFA 1R0WA 3E2IA 2GVZC 2XOKA 4OKSA 5GVSA 1E2NA 4TYNA 1U8ZA 2HDNB 2VSOA 1IXZA 4Q19A 3ZQ6A 3THWA 2NPIA 4TYYA 1SXJB 4KLZA 2FFBA 1KY2A 1XZQA 3LQRA 4P4SA 3H84A 3AF0A 3IHWA 4GOXA 1A1VA 3DZ8A 1CR1A 5LD2C 3VNUA 2ERXA 4RZXA 3LVRE 4PQRA 4EFNA 2GHIA 3KQHA 1RJ9B 2V8OA 1M7HA 1H65A 1PLLA 4MDEA 2AHOA 3I72A 1KSHA 1A4RA 3NIBA 3ZLJA 3PUXA 2Q9CA 3CX7A 2H18A 3I61A 1XD2A 3I32A 1A2BA 3UXMA 5JCPA 2CJWB 4NH0A 1CTQA 1F6BA 1ZUHA 4R2IA 1GIAA 1MT0A 1U9IA 2QROA 2EYQA 3EWSA 5J4VA 3DM9B 3QKRA 4LZZA 1UPTA 1Z83A 2ANBA 2A2ZA 1YZLA 1E9CA 5DISB 4AKHA 1OB2A 4Q7LA 2ZI4A 4F4CA 2GXUA 1NY6A 2PL3A 4JT4A 1PVOA 4Q03A 3W6PA 4B2LA 4Q4LA 2RGNA 1X8KA 2QT0A 1G21E 1W5SA 1NMXA 4Y0AA 2D74A 3UWOA 4DLVA 2N42A 1MV5A 4J0QA 2BJWA 2Z4RA 2DWOA 2REXB 3HU2A 2OBNA 3LO5A 3QG1A 2EFGA 2AWNA 3VX3A 1UKEA 2NTYC 1KSFX 3HP1A 1G3UA 4GMXA 1XTRA 1KI1A 5KNDA 1YZUA 4MRRA 2G1KA 2JJ2D 2Z83A 2NO7A 2ZYTX 2RHMA 1JQLB 2IT1A 2W83A 4EAQA 4M0LA 1YZKA 1MABA 1Z0JA 4NCJA 3K70C 2QUZA 4QHSA 5FH9A 1DAHA 5JCZA 1KJZA 5FTMA 3LA6A 3T1OA 1IJFA 1UBGA 2ZEJA 1XWIA 4LWZA 1W49A 3TVTA 4JLBA 1OKKD 4DEXA 1W0KA 4XH9B 3NBFA 5HKKA 1EWRA 3KKQA 3OEHA 4P4TA 3NDPA 3UG6A 4D26A 4TYPA 4DVGA 1XFAA 3LX8A 2OM2A 3RS0A 2A5GA 4QOSA 4D4JA 2O8EB 2P2LA 2CHVA 3BFXA 3GJ6A 1IN5A 4LOAA 1W4RA 3CRQA 5DLQC 3IO3A 2HF8A 1AIPA 1E9BA 1DPFA 2NZJA 3RAPR 4YONB 3GLFB 3ICQB 1MO4A 3VR6A 3A1VA 2TMKA 1LY1A 4B73A 4HB4A 1LF0A 3KDSE 1YKSA 2RGGA 4B34A 1JPNA 3BB3A 1BOFA 4F4JA 4LRWA 4MRPA 5JLJA 4GL2A 4Q4HB 2ZJAA 2G88A 3SS8A 1PUJA 2GJ9A 3K09A 1CLUA 2A5DA 2F7SA 2ZSEA 5IK2D 5F9HA 2VIIA 5FL7D 3KXLA 4BFTA 3THOA 1T91A 2WKRA 4IEIA 1FFHA 3SQWA 2GAAA 5FOWA 3VR4A 2E1RA 3QOFA 5AR1A 2ZRCA 1II8B 1ZNXA 2HYDA 3DKVA 1AS2A 3U4QB 1JR3E 2P5TB 4IDHA 3U7HB 2YVUA 2ZRDA 3C8UA 5JWOA 1G19A 4OQLA 4XVRA 3TSWA 3BH7A 5EXXA 3IPXA 3JZAA 2F3RA 4CEJA 5UKDA 2P3SA 3GEIA 2G0NA 1Z8FA 4UNPA 1SXJA 3C7KA 1U0HC 4L5BA 4BGDA 3SDZA 3ZH9B 2O8FA 1IY0A 3FTQA 1N0WA 4PPFA 5DO9A 1NL3A 4AG5A 4G5SA 3L43A 4YDSA 3SJZA 3BAFA 1CS4C 1G3QA 1Q20A 2ZRAA 1E32A 2ZTSA 4QJ4A 4EPYA 1TEVA 2YWHA 2F1HA 3GJ8A 2D7DA 4NMMA 3BC1A 1XTJA 3TQFA 3X1ZA 3PJRA 3SI7A 2G0TA 1OFTA 3DO6A 4MQBA 1G18A 4CYMA 1E2JA 4HB0A 1XD2B 3OAAD 2D62A 1S8FA 3NBZC 3TH5A 3NH9A 2QP4A 2ZI7A 4C0LA 1ZD8A 4M53A 4B71A 1Z0DA 3B82A 4JLJA 3AP2A 4NCHA 2ZRNA 3U2QA 2GCNA 2WVJA 1I2MA 2EFHB 2VPPA 3I92A 3LW7A 3EG5A 5DI3B 4UQOA 3W90A 2OT3B 1CULC 3TK1A 3L0SA 1NBMA 2I1QA 2ODNA 2WWIA 5SZKB 2NOAA 2OAQ1 4FCTA 5E3HA 3WMFA 1D8TA 2BKUA 1JR3A 4URXR 2BBTA 4HYYA 2ZXUA 2C95A 4IFBA 4JSTA 4C2UA 3D3QA 5CM9C 3IEVA 5CLQA 5EUQB 3ZVMA 5FL7A 1G17A 2FWRA 5IK2A 4XSGA 2PH1A 2PLFA 3ZGXA 4EJSA 5AWFC 2QSYA 2NO0A 2Z4SA 1W7AA 1EWQA 4NCIA 1P60A 3IEUA 4GP6A 3A1UA 2GKSA 2QQEA 1YVDA 4H1UA 1VYTA 1KI8A 4TL6A 5GADl 3OZXA 2LWIA 4KODA 3GLGE 4US1R 3RVBA 1XXHA 2QMEA 4MDFA 5JHHB 3H86A 3GLIA 1UADA 1PZNA 2WOJA 2YV5A 3IHLA 2PMDA 4M9QA 5KDDA 1OFUX 2BCJQ 2VRWA 4LYAA 4YMTA 4Q01A 2ZUDA 3B8HA 4PXAA 1EFUA 4YC7A 3VR3A 5KPDA 4A82A 4LJ6A 4TMZA 4DLWA 3IKJA 2VL7A 4PSKA 3HYTA 2WPDA 2J7PD 1XX6A 3PIRA 2JLSA 1OH8A 4F93B 1TQ6A 2VBCA 1JBKA 2FH5B 4YDHB 3K0EA 1W0KD 1U90A 5EZ5A 3UMFA 3QXJA 3GJ3A 4G5RA 2ZVPX 4PFSA 1XXHB 2C96A 1E1RD 2QPTA 4ITRC 4I1OA 4BZXA 2WTUA 3LLMA 3GLIB 2W0SA 1XMVA 5CB6A 3ND8A 4IFEA 3KTAA 2J0UB 4JLVA 5BW8A 2A5FA 1NVXQ 2BV3A 2ZROA 1E98A 3A1TA 4OBEA 3U5ZB 4Q1EA 4HLDA 1JPJA 3CRRA 4Q4JA 1ETUA 2O0HA 1AA9A 3F0TA 2H7VA 5J5CA 2GNOA 1F2TB 4U00A 3FMPB 1XTKA 3NG1A 1G7RA 2WV9A 3FMFA 2RKOA 4Q4AA 5KSPA 3RHFA 3KFVA 1W5TA 4YXWD 2OEPA 1X3SA 3CR8A 1R0XA 1OW3B 1ZUIA 4V03A 3KL4A 4HDCA 2FSFA 5E7IA 1EX6A 3ONWA 5DN6A 3SHWA 3EIEA 2D4HA 2QE7A 1IJEA 1SXJC 3KZ1E 1CF4A 2RCNA 4K81B 1Z63A 3NC1C 4L4UA 1GRNA 3P4YA 2H8KA 2HUPA 1OLOA 2ZE8A 3NWJA 1W1WA 4JBYA 1KK0A 3A8TA 5A5GA 1CU1A 2ZYVX 1LFDB 1AZTA 2J87A 1W2GA 1VYVA 1KJWA 2ZSFA 4PPGA 5CLLA 3HYRA 2I3BA 2HT1A 1U0LA 2CMKA 1H8HA 1N6HA 2PEYA 2ZRBA 3KJEA 3FVQA 3SYKA 1QRAA 3RLFA 4GSYA 2REOA 3R8FA 1FP7A 2BDTA 1NG9A 2JLVA 1E2HA 1RFLA 1L4UA 4A0FA 1S96A 4X8LA 2IUTA 1Z6XA 1DAKA 2JJ8A 1G3IA 4PC3A 4LUCA 1RRFA 1ZU5A 4HAXA 3TUZC 1JJVA 1S2MA 1FTSA 2CL0X 4XWOA 2BHRA 4E03A 4FD2A 3GQBA 2GETA 1IHUA 3LV8A 3MWYW 5EP3A 3EX7C 1DADA 3FOZA 4TN1A 2DWQA 3O8BA 5BN3A 2FSHA 4A6XA 2EW1A 2W6JD 2FN4A 1E2FA 4AKEA 4NPHA 3GLGA 2WOOA 5GJVC 2ZANA 1KMQA 3KB2A 2QRZA 4UXHA 4C7OB
chains in the Genus database with same CATH superfamily
1IUNA 5IHPA 4F86A 3LF2A 4FNAA 4ZV9A 1LLFA 1C0KA 2PLNA 4AXXA 4RKYA 1Y4DE 4HR7A 4KZPA 5IJ0A 1E6CA 1K27A 2B34A 2PGNA 3AHFA 2CNOA 2GLUA 5JVDA 2C82A 3A6LA 1U9IC 5CLGA 4PWYA 1R7RA 2GRJA 2GEVA 3FWHA 3T3IA 4BE9A 1FVXA 3C5HA 3V8MA 3T3OA 1JFFA 2WJGA 2BE7A 1TRKA 4UU8A 1CR0A 4XGIA 4CF4A 4ZOQI 3MLAA 4MV7A 4XD2A 5EAIA 4JVLA 4X7BA 3DL2A 1UOOA 2ARKA 2ZREA 2VCYA 4ENTA 2PX4A 2I6TA 5DT9A 3D0QA 1T8UA 1JJIA 1IEXA 1DAEA 2QNRA 1QIIA 3A3OA 3KVNA 2C5GA 4HWKA 4KFCA 2QR3A 4W8GA 4B4WA 2R1VB 3RRZA 2VJDA 1H66A 3VOAA 1SZCA 3CZ4A 1L7XA 3FLEA 3L0OA 1DO0A 1D8AA 1Z88A 2DRIA 1FNMA 1Q1GA 1QV9A 1PJ8A 1KKMA 2IIVA 3A2LA 3IJ5A 5IT4A 4MKRA 4DIBA 1E4EB 1V16A 1MJGM 2X8LA 1WXQA 3DBRA 3QM1A 4NMWA 4LGYA 4YWJA 5AM4A 3H87A 5HILA 3A1DA 4F1JA 1WSBA 3VAZA 2A9KA 1ZA1A 4HLUC 3KKMA 4ZREA 3RUFA 3H5TA 3AYZB 4EK9A 1NNEA 1D2GA 1EUCB 2EX1A 3EYAA 4KO2S 3I4CA 3IO5A 4R2WA 3FZNA 2VRCA 4MGEA 3K4QA 1EESA 1NLZA 1M2KA 3ZJYA 1B2LA 1E1CA 4L08A 1XVTA 3OP1A 2PD4A 3IC5A 2WTAA 2Q3HA 3LHFA 4O2LA 4BBPA 4MUJA 5T4EA 1L7NA 1GPUA 6Q21A 3JVIA 2ZCVA 3EPHA 1S4MA 3WGYA 1NW6A 1Z35A 5J2TA 3K0FB 1GPMA 2PKRA 3ZXXA 1UXKA 1QUFA 1DKNA 2Q5JA 1P2VA 1DQSA 1V71A 1IQUA 4IILA 2MSDB 5FUVA 4RFLA 2HX1A 1Q1QA 1R88A 3QKTA 2JI7A 4QGGA 2I3ZA 1R0ZA 3DZBA 2YX1A 3O8QB 4N0EA 1WCIB 3GZ4A 5JVDB 3R20A 5JCJA 1OTYA 2FPPB 3AP3A 1GZSA 1PNVA 2WD9A 3BJEA 4RPCA 5JQGF 4EQ6B 3DV0A 4RULA 2X2PA 1ACMA 2NVUA 4EVQA 3ZU6A 2WPDD 4XX0B 2WUVA 3O9MA 2NTVA 1KJIA 2JFGA 2MYPA 2AYZA 4KE8A 3OFKA 1G41A 1IDN1 1WKCA 4W5JA 2DJ5A 4OJNA 4ZI7B 1BQ4A 4JQCA 1IPFA 1WTCA 1IHXA 1V8PA 2Y1FA 3MRSA 3RRMA 4RDIA 3Q6MA 3GRVA 2WP0A 2GCIA 3A9VA 1LKZA 4YLEA 2WZDA 2PUJA 3G49A 1RJFA 5AJTA 2FOLA 1OI2A 1ZMBA 2J9FA 2D06A 3BK7A 1WZ2A 4GI2A 1T1IA 2PMCA 4ZZ3A 1DPGA 2ZAGA 4ESOA 3M1IA 4I1YA 4IIDA 4QTTB 2OWEA 5CFLA 1GTG1 2P30A 2B2NA 3GLUA 1GTMA 1NW9B 1R4AA 4FOSA 2IS6A 1C2TA 4HQLA 3EDCA 4PQGA 1VHWA 2J3DA 5DZSA 4A0GA 4RSRA 4B48A 3NHYA 1RWPA 1L5GB 2IWHA 5K09A 5LMZA 4IVPA 2YJ4A 1E4YA 1V26A 3RKRA 3ZPXA 3EVEA 4C87A 4RELA 1IB0A 3MCVA 2JBWA 4CEHA 3A32A 4A0QA 3N3BC 4ZOLF 1H1LB 2F59A 4TTAA 4UTXA 1CLEA 4MCAA 3UHJA 4AM8A 1I4OA 1KMHA 2VJOA 3PVSA 1N77A 3TNYA 2XUFA 1C9YA 2AX4A 3HKCA 3ZBUA 1VECA 2YWJA 4R9RA 1NBMD 3C1AA 4U8HA 2I3AA 3JQRA 4FMBB 4L07A 4TV8A 3QPUA 2NSDA 1HLFA 5DGDA 4EY4A 2QT1A 5EYPA 3R7SA 1DOZA 4ENVA 1KQPA 4MAFA 3DNFA 1X7XA 3D7SA 2J8ZA 1VCMA 1YA4A 1YUNA 2H31A 4QPJC 3W06A 3HVKA 3BF8A 2P35A 3GLTA 3DE1X 3L7JA 1EQUA 2P77A 1PK7A 4HADA 5CRIA 1QOPB 5DGIA 1KJYA 1PR5A 1AU9A 4OYRA 5CVEA 4V1CA 4DAEA 5AI4A 4KMOA 1X7WA 3S5UA 1YFKA 1SFRA 1YIAA 1DIBA 2IDMA 2SKEA 4RY9A 4BLOA 4RTKA 1OYYA 3OZDA 3HVUA 2HWXA 3RSHA 2IC5A 2VQDA 5KMGA 1ACLA 1QMPA 5IKXA 1SVWA 2CCKA 1CS0B 3UWPA 1TJ4A 3MMXA 2ZGVA 1AMUA 1VBMA 2I2WA 3K9WA 2IQIA 4OMDA 5TQJA 4AX8A 3UHOA 2OV8A 2BMAA 3TD2A 3FUCA 3P5SA 1ZMTA 3M5WA 1S5PA 1II8A 3NEYA 4KI7A 1N2ZA 3S29A 4DA4A 3LFTA 4UDYX 1L3IA 1RE1A 4Q3EA 2IF0A 1SJ9A 4FN4A 1OXTA 2J6IA 1I30A 5DOVA 4IOMA 1T2CA 1YNOA 3ER8A 3PT9A 1IY8A 3LC0A 4Z1OA 3HUTA 3GFTA 5BY2A 2EIHA 2FXIA 1H05A 2IHBA 3C8ZA 1NI3A 3NAQA 5T3YA 1NE7A 3ICOA 1QHHA 2ZJOA 4FHZA 4BE7B 1RLMA 1XQ1A 4JT9A 4FYHA 3W5HA 2GBLA 3NOVA 2ZBGA 1AC5A 1ECLA 1N0HA 1W0JA 4M6WA 1NYTA 2ROQA 1Y7TA 1G55A 4L6CA 4DR2B 3H2HA 1OHHA 3LNTA 2OHXA 4CODB 1H3NA 5BW6B 3ES9A 4QUJA 2B2XA 2WSIA 4CMIB 2YY6A 2JIOA 2P4EA 1H6BA 2PR2A 5CK5A 4PHHA 1MVLA 2QI9F 4HGZA 2GA8A 3GPDG 4HNAB 3RS2A 4QM7A 2ACKA 4HFJA 4DKJA 2PZJA 2QVZX 3L92A 4XM2A 1GFIA 3W5BA 3RLIA 2AEEA 4RACA 4BGVA 1BYIA 5AUPB 4C6TA 3ROXA 2ZQZA 3EH2A 3MAAC 4TLDA 1T2VA 2JLBA 1W34A 4V0ME 2JH8A 2XMPA 1CZOA 3OA0A 3ZWAA 2Y1XA 3AHCA 1UKAA 2WU3A 2BBOA 4X95A 5C7LO 1A5TA 2C2ZA 2VRNA 1U28C 3PC4A 1OD6A 3BRQA 4K8RB 3K0BA 1ZA2A 1SCUA 1VI6A 4GBED 3WLFA 1RQPA 4F96A 3EIFA 4OHVA 3ECCA 3MTDA 1K86A 3DAYA 1W5AA 1WCIA 4HZGA 1V6SA 3C6MA 2B94A 1SGWA 4OFBA 4UVDA 3C7CB 3AVVA 1CR6A 2AR9A 4NOJA 3OIFA 2IU6A 4GZMA 5E2IA 4D74A 3SN6A 2XDQA 3DBLA 4Q15A 3V4PB 4BFZA 3KUUA 1OB5A 1NMYA 2A0XA 4GX1A 1YIOA 2ZWPA 2FEAA 3QU5A 1ZHHA 1JXOA 5EJ4A 1C1DB 3C7DB 3OJ0A 3HDHA 3GCWA 3QELB 1RYZA 1V0JA 3QH4A 1GAQA 2ZQ5A 3EIOA 4WLEA 1M8JA 2FPXA 4HAUA 5BV1A 1M5UA 1D6NA 2C9CA 2CMGA 3KB6A 4WK4B 4GUAA 1Y8RB 2WFMA 2YR0A 1KRHA 2JFHA 2QD3A 3DSRA 3EDYA 1CUHA 1NW3A 1CP3A 2JRLA 2VPQA 4MA0A 5JBIA 1CK4A 3S8EA 3GNQA 3OOHA 1TNDA 5TXGA 1MG0A 1HT1E 4P38A 2CVPA 2X9NA 2PPVA 1T2FA 3ORSA 1NVWQ 1Z08A 2NGRA 5ALOA 4IWNA 1LQUA 1PL0A 2TRSB 4HX9A 4EVIA 4BFLA 3JD2A 1YK1A 4DHWA 4L28A 1M7BA 4EBFA 4F04A 4IEFB 1ZJ5A 1HEIA 3SX0A 4AP6A 3GA0A 2HMVA 3RVRA 5INTA 4WWHA 4QXPA 3U44A 1YR9A 5BWOA 1NFRA 1P7ZA 1NZJA 4BNNA 1A9PA 3QYFA 1Q15A 1U6KA 1AV6A 1AUOA 2I2FA 1ORHA 1A2QA 2NO1A 4OXRA 4RDCA 2DBZA 2GDJA 2OMEA 3FPAA 4Q48A 4TMKA 4LTMA 1GARA 5PGMA 3H5IA 4KLRA 1RJ9A 2J30A 1ZNYA 3P9KA 5D5QA 4KOAA 2IV3A 3P1JA 3S1LA 1LRKA 4HX2A 4J7UA 1L1FA 5J4HA 1E1YA 3DUWA 5JJ5A 3OTQA 2C5HA 2G36A 3EGXB 3MJDA 2A1TS 4DSTA 3WLEA 1PYGA 1MQ8B 3FPGA 2YIVX 4HQOA 4EENA 2IYVA 4RD0A 4B31A 3FVTA 1FSZA 1JFFB 4GQBA 2Q7DA 3UAGA 5L6MB 1ABEA 2GCGA 3QXHA 5JNTA 4G56A 4NBLA 1JZTA 1QHXA 4UCXA 4ACBA 2VTBB 1J90A 5FLEX 4HDMA 1KI6B 4MV4A 4I1VA 3VR1A 1WXWA 1H42A 1JEOA 4OI0A 1YB4A 2VDOB 5FX2A 1WR8A 5CDFE 5AKYA 4QOJA 2OGTA 5JPCA 2Z6AA 4B3DA 3JTEA 3DEYX 3RG8A 2R8ZA 5HRAA 4C6RA 4I81A 4PONA 3QYAA 2Q27A 5LZ7A 5CFMA 1MW8X 1BFUA 1PGJA 4O4HF 1R18A 3U4HA 1Z0ZA 3HU5A 5FR2A 4TTTS 5K3FB 1KC3A 2JL1A 5JY6A 3USCS 1IWOA 4EYSA 3W34A 4OHBA 1NQOA 4FEAA 4FILA 4IDEA 3DBOB 3DYBA 3L5OA 2GF0A 4YGYA 2F9FA 4DLBA 5BURA 3OCXA 3NM4A 2F8TA 4AZ0B 1ULBA 3AESB 3BMOB 4U8GA 3K9BA 2GBLC 4PLCA 4BVKA 3SGLA 4W6QA 1XZFA 5BSHA 2V9CA 3CUYA 4YAKA 3V8NA 4OX9Y 2I7CA 1DFHA 2FCAA 1Q6ZA 2O2IA 3CGWA 3GWGA 4J2OA 4Q9HA 4CM4A 3OKPA 5EC8A 4ZYTA 1TLFA 3P0RA 4A8HA 4YUAA 5BR1A 5ENZA 2QTTA 4B2YA 2DSTA 5CEFA 4D98A 3S81A 1C3LA 2BTEA 4U2BA 4P7FA 1QGED 2HLPA 4KP7A 2YHUA 3KKOA 1B0AA 4PSDA 4V02A 2XXAA 2IEYA 4O1MA 5AKHA 1UKBA 4Y6GB 3M9LA 2FZ4A 5FI5A 3JX9A 5AMXA 1AQUA 1E3IA 4F0JA 1FDTA 3KSDO 3GFFA 4CNBA 3IIJA 1R0YA 3FYUA 3RB8A 2WFAA 1VSTA 2XJ9A 1FTNA 2OZLA 3GUHA 4RORA 2XMDA 4KU4A 5EXEA 4J4BA 1OF1A 1P5RA 2ZUUA 3UGQA 2UYCA 3KAQA 4RVGA 3OSUA 3WVNA 4W7SA 2G82A 2H52A 2Q6TA 5HUHA 3EW7A 4BLPA 2H6EA 3O8NA 1MJGA 1X14A 1DB3A 2RJNA 5BT9A 3T3EA 5B4UA 4LNUA 1TJ3A 1LBHA 1WBJB 1IQ0A 1O6BA 2PD6A 2XWSA 1X15A 1M2JA 2D2FA 5CBPA 1CE8B 2BFPA 1IXKA 3A36A 1N5JA 4LYYA 1FFAA 1UC9A 4NL4H 1JRLA 5ELLA 5FWDA 1V1JA 1W87A 3CRNA 4FGZA 4EG6A 2RG7A 5FP0A 2GTIA 3X44A 2F43A 2CNKA 5F78A 2O3JA 3EQ6A 2R85A 4L9SA 3TNJA 2H4XA 2BI8A 4I1SA 1KY5A 2NV2B 3T5BA 4MX8A 2YCBA 2F1OA 3MA0A 3R0JA 5AIAA 5JXGA 3PFBA 4NI5A 1TKAA 2N3ZA 4YWHA 1WAMA 1DCKA 4LJLA 3HB0A 3IV6A 4WZBA 3WO1A 2EHJA 2XTMA 2YV1A 3K32A 5KYXB 2R6AA 4C0KA 2FOXA 3B9QA 2OAP1 3K72B 1E9RA 3F7MA 2O57A 3T9DA 3MGKA 1G21B 1VLZA 4M0MA 2GH1A 4J94A 1DBVO 2ZS8A 3HP4A 3ROGA 4EB6A 3BIJA 4A1OA 3UFBA 4Z54A 5JZ9A 2AX3A 1JHXA 3FPFA 1BXGB 3AQ4A 1DAIA 1K97A 2UYYA 3LJKA 1K6MA 4YAOA 4EGSA 5KNDH 4ZGBA 4E0BA 4WHMA 4ID9A 1T6NA 2GPWA 2OD9A 1ESMA 1XRQA 1MRNA 1ILEA 3ZBQA 1JR6A 3TNDA 1OLSB 5KYYA 1JSRA 4UNNA 3F9IA 2O8NA 4KR7A 1HDOA 4GZLA 4WI1A 2G76A 3ADCA 3SSAA 4YA6A 4BMYA 1E3SA 2JAWA 5FXMA 1OH6A 5ALKA 5FEMA 2RE8A 1EVQA 5I7SA 4CL0A 3RBZA 4D02A 4E5MA 3H0EA 3IP1A 2WHRA 1M2VA 2H4FA 4PPNA 1Z0IA 1MDBA 3H1AA 1Z3IX 3I62A 1RYYA 2XYHA 4NENB 1VA4A 1SOMA 3UJ3X 4DRXA 5EGSA 2UVQA 4BV9A 4IDDA 3ROQA 2P5UA 2RKBA 1KO4A 3KJGA 2IEAA 4FOTA 4PQFA 5KOHA 4IHQA 4Q7JB 3AP1A 3HKCB 3PL5A 5DK6A 3HCCA 5EMKA 2HLDD 4C1BA 3II6X 1EGAA 3L9WA 1E6WA 1PTJC 3ASUA 2WE8A 4NR0A 5IVHA 3R7AA 5A7FA 2OGSA 1K7SN 3RUHA 5D86A 2O7NA 1ZRHA 4AJIA 3AI3A 2YW2A 1X86B 2F43B 2WAAA 3VMFA 3KQUA 4EL5A 2ZIAA 5JTUA 1D07A 1U0JA 1LQ2A 2MMCA 5EZQA 1KWKA 3VFDA 5FL3A 4RTRA 4PO8A 4UASA 3CZRA 1TX4B 2XNCA 4KV9A 2WHXA 2MIIA 4ZXFA 3RC3A 1G8HA 4QTZA 1UBCA 2ZKLA 3AERB 3L7NA 4BV8A 4V1CB 3RBAA 1IJKA 4P83A 1MB3A 2AMVA 3QVXA 3ZHUA 3E9NA 3ZE9A 5KU1A 2HFJA 4AFNA 4YCNA 2JFYA 5CR9A 3G0GA 3BMCA 1TE2A 1XZCA 3A9SA 3K35A 5AVRA 2HCTA 2IS1A 3G2PA 3RVKA 2VO1A 1JIVA 4TS1A 3HZZA 4RABA 1Y6JA 1HQYE 2QJRA 3PCXA 4RKFA 3RK0A 2GO1A 1KFEB 3G2HA 3HUEA 2OESA 3SNHA 1QGAA 6ADHA 3I5AA 1EP1B 4JXZA 2I8CA 4HAVA 4GYYA 1O4VA 2J9ZB 2VLBA 1OZAA 3IMGA 3R3UA 4HZUA 5TF0A 3RIGA 4WXEA 2E6KA 2B4RO 3HVHA 2BD0A 1LSOA 1PT7A 2YXEA 2XMQA 1ESNA 1RXCA 3SXUB 4N5LA 2QZ4A 1L4BA 1Z38A 2Q6KA 4DIMA 2DEUA 3MQ2A 1QDEA 3O1HB 4BPRA 4WY2A 5I4CA 5KVCA 3AFOA 1H8EA 1DKOA 2VBIA 4JOQA 1L6RA 3URKA 1ISSA 4CDRA 5DX0A 3GBVA 4BTLA 3OUUA 4IJQA 4Y2JA 3PF8A 3TW8A 3OPMA 4Z7QB 2B30A 5AVJA 1R9GA 4GIBA 5DHRA 4HXGA 1OIVA 1N75A 2F9LA 3NHAA 5A5EA 3UJNA 3FD8A 4HMPA 1ZO8A 5A1TA 2YHSA 2C00A 2YINC 3W8RA 3DZDA 1T9CA 3ME5A 2YOGA 4YT5A 4IYRA 1V37A 4EY6A 3SR4A 4JI1B 3TOXA 3QBJA 4EGJA 3HKEA 1L5MA 3LBIA 2IW1A 4RA6B 4M8KA 1M2GA 1PV1A 2V54A 3OEED 3T3DA 3ZOKA 4BVHA 4EYGA 3RAJA 1AY0A 1L4FA 1VLQA 1FRZA 1Y9JA 2YMQA 3TO5A 1BVHA 1CRPA 2W7TA 1PFQA 2PUEA 3FTNA 3LX5A 4KNWA 1N3LA 1ZUNB 4MS1A 3U7QA 4BP8A 1XF9A 4G8DA 1MN6A 1ODSA 3CM0A 4CG1A 2YXDA 1JDUA 4HF7A 4KREA 4ANFA 2V4UA 2HWWA 3CCCA 3FNQA 4O4LB 4HC4A 4OLAA 2JGIA 1E3DA 1TUGA 1M2WA 5B3JA 2YFYA 4FSXA 5F77A 4YCBA 4EUFA 1M8PA 2WFLB 3A3YA 2BFFB 1LNZA 4ZP1A 1KY4A 2VHTA 3QK7A 5K45A 4K9NA 3T4PA 1FYEA 4GSKA 4PN3A 1JHMA 4H6PA 1CBUA 2GM5A 1V1MA 4PYOA 2P78A 1OAKA 1VPVA 1YZNA 2EG9A 3EDMA 5FBHA 1SZPA 3IQEA 1Q16A 5GONA 5B36A 4Q93A 5EMHA 1JT2A 1ML4A 4LBYA 3I01A 4ZQHA 2NTEA 1S2GA 3O2SB 4JLOA 4R1SA 4Q0MA 1DBIA 1MAHA 1E59A 2PRZA 2W00A 3MGCA 4BFSA 5KTTA 3AF4A 2M32A 2G83A 3T5TA 3TOVA 5JWHA 4ZU6X 3CEHA 3NCTA 4BCDA 3BHNA 3R3SA 5FWYA 4RD1A 4H6WA 2BH2A 1FFXA 2DHEA 3UMSA 4D8VA 2C1XA 4YQZA 1F2DA 4D82A 1PAUA 1XTQA 2VUUA 3D3NA 5I7VA 2DAPA 4IOKA 2DQYA 1DIHA 4JBWA 4I7EA 3FYHA 4RV9A 4DXHA 1NI4A 1PLKA 2O7RA 3BE4A 1N1MA 4DIOA 2H7CA 2CL7X 3OOSA 1CUVA 3K94A 1M83A 2QRUA 2VSFA 1ZFNA 3THRA 3FGOA 4RA6A 4RTNA 2GFQA 3DMNA 1AKUA 4HDOB 5DCYA 5F5LA 5CCBA 1LUAA 1NTOA 1QIEA 3DOFA 2FW8A 3RAFC 4MLDA 3L9XA 4BX8A 3CX4A 5BOSB 5IT5A 3B9RA 3UC9A 3SQXA 3NC0C 4RHTA 1QS0B 4XVHA 1D2RA 3E27A 3SM3A 1XVLA 3DE3X 4I50A 4LYFA 3GRRA 2H9YA 3P9CA 4FKMA 5IAEA 4HNSA 1HDYA 1YKFA 3UWSA 4K6GA 4D9CA 4WCVA 5JAIA 1JIQA 4QL3A 1RJEA 3BWVA 3ETHA 4OU5A 4L9AA 3ZGOA 1C7QA 2XGJA 1H1LA 1I9CA 3DXYA 4KYVA 4LJ4A 1BRTA 1MABB 2PU7A 1ZNZA 1T1GA 1L9KA 3P8ZA 4HMOA 4YV0A 5JLAA 2HK6A 4G1UC 1EK6A 2YKGA 3Q40A 1UWCA 3G1TA 3X1JA 1KDYA 3DFZA 3CKMA 3S2FA 3GU3A 1Z12A 3AKEA 4CR8A 1PR6A 1D6JA 2EOAA 2ZVJA 4AJPA 1FVFA 5IRCD 1KMCA 1FOEB 2O0KA 1L5ZA 2EERA 2QN6A 2TSYB 4WA8A 1XQ6A 1E2KA 1KIMA 4R9VA 5E1DA 4ZYZA 1GG8A 4IDAA 1E3WA 2F9MA 2FN8A 1C0EA 1E1QD 2P1ZA 1AM4D 5HF9A 4M1YA 4MV8A 3AUYA 5EE5B 4BNJA 1CNEA 2M98A 4CUKA 4HDNA 2OXRA 5DLEA 2Q21A 3QENA 4GFDA 2P41A 4DUPA 4E3ZA 1KZ4A 1P31A 2WF7A 3KT6A 3WMGA 2W6JA 3CRZA 4YGXB 4AUEA 4DLSA 3V33A 4EHBA 4RO0A 4PAGA 3LCRA 3SXJA 1QP8A 4MCIA 1JG6A 2I5PO 4R2LA 1QG2A 4OIMA 5TIIA 3JD3A 5IJ9B 3EAGA 2AFHA 1DRWA 1JA0A 3NV9A 1IOLA 4DPKA 1K5PA 5SICE 3AR2A 4WKBA 3PQ6A 3LCUA 4LC1A 4HFNA 2H4JA 2QP3A 1HGXA 2Z9CA 4M1WA 3M5DA 2SCUA 4OIFA 4WRRA 5P21A 3AKZA 3DEJA 1L3BA 1CIJA 3QLEA 3DOEA 2QYSA 2HJHA 3FUUA 3I8SA 2CE2X 2VWQA 4XEHA 1JWAB 3MB8A 5GGXA 3V4FA 4DZZA 2XRFA 3KEFA 5LCXA 4WBNA 1Z6YA 4JLPA 5ER6A 1AK2A 3W4KA 1EX7A 4Y0VA 4RTQA 3CTPA 1XZ8A 2FEOA 1XMJA 1DBSA 3RU9A 1V3QE 4QBIA 4YFYA 4BGUA 2OZKA 1KARA 1UXOA 3FW1A 1GQOA 3O91A 4RKRA 1FDSA 5KX5B 2GK3A 4IXTA 2O06A 1BFKA 3D8NA 1K88A 5IJZA 1MCZA 1Z4MA 3B38A 2P75A 1BGXT 4OM8A 5AKEA 3QW4B 2NP6A 4LQ4A 3C2QA 1N6IA 4YMIA 4JT8A 5FPTA 3NVAA 4DE5A 2C7OA 3U80A 3PNBA 1I2BA 1XL1A 5JFTA 2ORYA 2QMOA 4DKXA 4RTMA 2FDCA 4INOA 2XMSA 4RJ2A 4LX8A 4M7OA 2Q9BA 4PYQA 3QHAA 1WW8A 5ERGB 4KE6A 2ODAA 3THXA 2QUIA 3LUDA 4N03A 5DN6D 3UAZA 3O4HA 4IR7A 1MTOA 1YL5A 2F90A 3HEBA 2DCUA 3KSMA 1FZTA 3VV2A 4NG4A 3BE8A 1NURA 5J2TB 2ZXEA 2C9MA 5FBQB 3CRW1 1N3IA 1WXIA 1HKUA 3K2QA 3QBDA 3RSOA 3UJ9A 5HM8A 1Y1PA 1ZK0A 1P2TA 2O1WA 4NENA 3KAKA 3VUFA 1MAUA 2RAPA 3BE6A 2ZIXA 4AZ3B 2VUTA 1L5HB 3H9QA 2WVAA 1WBDA 4OF4A 1PRYA 3M2PA 3NORA 3ZW9A 2CB0A 3I1JA 2BFFA 3OOWA 3QTBA 2ZZMA 3FROA 2PT7A 4LMRA 3ZCTA 3VUEA 5KYGA 4ZHSA 3B5IA 3T06B 4KDFA 3Q1KA 1DLJA 3AR3A 3OQIB 1USWA 2OZEA 1YOBA 3H9UA 2IY9A 1TVEA 4RK6A 2OHOA 5K6AA 1JTVA 2XNHA 2Y66A 3O9ZA 4JY7A 3GLQA 1U2RA 3ELBA 3MINA 4KB5A 2Q7OE 3TR0A 2XUJA 4Z4QA 3O3CA 5EJ7A 4M7PA 2Y27A 4F5EA 1Z0KA 5JSKA 2A9JA 2VJQA 3INYA 2HSEA 1BQEA 2G9ZA 2N0SA 2WUFA 3FYUC 4UVGA 1GGMA 1K75A 3OX4A 1R16A 1M34A 2PL1A 3WMXA 1SCBA 1H4VB 2OBXA 5U1PA 4BX2A 3TQSA 2I6GA 1CQJA 1E66A 4YRMA 5AD1A 1QRTA 3VPXA 4QNMA 4HB2A 5DTMA 2NZ8A 3HPQA 3D7LA 5FTKA 4DT1B 1M1YE 3E1KA 4RJIA 3ZGZA 2H2WA 3GEDA 3NTXA 3A1EA 4KFTA 4MCHA 4HDAA 2VTEA 1B73A 5BV2P 1GGEA 1LJUA 5M29A 1VJDA 4IHAA 3PRHA 4B35A 3G13A 3OZVA 2YRXA 2R6DA 2RH8A 1WXHA 2HU5A 2GPNA 3D1LA 4IKPA 1JMYA 1O96A 4HUQA 2FN9A 4LN1A 5JJIA 3HWX1 4TTSA 1G6OA 2C2WA 3O1LA 3PI7A 1SBIA 3VYRB 3N8GA 3W9YA 1G8FA 1PJQA 2HRDA 4P2GA 3SBEA 4LOIA 4Q9JA 4ZWNA 3ZDRA 3V32A 3V8QA 6REQB 2HMAA 3ZWCA 1D9XA 2W58A 1GGVA 5H3CA 3Q15C 4QLAA 2JLYA 4IDOA 3L7MA 1NVEA 2BP7B 3PC6A 3QFFA 4ZI3A 5A7GA 4IXNA 5I9TA 3ADDA 2CD7A 2XIQA 1J9GA 3HC7A 3JU3A 3N6VA 5DHAA 4IIJB 2IYYA 4DLRA 1BZYA 2AG8A 1QYDA 1CRZA 2VDMB 3C6KA 3RC7A 4D81A 4D9JA 2BT4A 4E2ZA 3A10A 4RH1A 4QULA 2P6RA 1RYFA 2RGEA 2FSGA 2P0YA 3VI3B 4CMIA 1U04A 3OE5A 3L06A 4PICA 3T34A 5H81A 3LOPA 3ZZNA 3R6WA 3PV0A 3LUGA 1RWXA 4JHXA 3RUIA 5KCMA 4B2IA 5B2EA 3PUYA 2DB3A 4DPLA 3FWKA 1HF3A 3AIOA 1R0LA 2ZBFA 3KLMX 4J1TA 1EFVB 2AOUB 4YCCA 5KTMA 1EVYA 2Y8EA 3M6AA 4EMSA 1ISFA 4CGZA 1E2GA 1V9CA 5AHRA 5K6RA 3SXUA 4AYXA 1YUMA 1LA2A 1QHFA 2WSSD 4UMDA 3U9TA 1YDWA 4IF6A 5E4TA 1GFZA 4DCNA 1CDZA 4LG1A 5FNZA 3RSZA 1SG9A 2PK3A 3F5DA 3PB3A 4BNVA 1Z6PA 1QB8A 2IIQA 3H1FA 4DY6A 4CT0A 1COWD 2QAGC 3K5PA 1KAMA 2IV7A 2BDEA 3C4VA 1SBCA 2AG6A 3CT4A 3ZLBA 2AL7A 3I9LA 3P32A 5B64A 3PQ2A 5I5EA 2VP9A 4M1EA 1VGQA 1IY1A 3MZ0A 4MKIA 1XMPA 2JJ2A 1EP2B 1HL3A 1T5TA 3P9SA 3SLRA 2EJVA 2OSBA 3B2NA 1O6CA 3U44B 4HNHA 4WBSA 2AMLA 2B25A 4H4CA 3WK8A 2O20A 1POWA 1MO3A 2C31A 4H3SA 3KIPA 2Z04A 4P33A 5TT1A 1R0KA 2Y1OA 3DLCA 3ZYCA 1ZUNA 2PR7A 1YJ5A 2Y1GA 3U7QB 3WL8A 4B43A 3Q8LA 3DMTC 5BVHA 3L4SO 4A2PA 5HQ3A 1GPNA 1G8GA 2PMBA 2Y0DA 1ZJWA 3EUEA 1GAJA 4KN6A 1Y9EA 4XOUA 1L5VA 2IYFA 2YWBA 4EARA 4QYWA 5HM6A 5E1BA 3CO0S 1STOA 5I7HA 1K5DA 1M0SA 1Y3AA 3OWXA 4PAQA 5G53C 2NTJA 4RQUA 1DQZA 2C03A 1WPXA 3JQGB 1POXA 1BC5A 3AILA 4GBMA 3TLGA 3OZAA 2GPTA 4O0LA 5DP2A 2EWWA 2FW9A 1L9XA 3H5WA 3ICVA 4HNQA 1HI9A 4JC8A 5AJYA 3TCNA 3W79A 1EG2A 1O5OA 4HLQB 4RWEA 1Z25A 1ZNWA 1WXXA 1RWKA 2NUPA 3MOGA 4ZCMA 5KJ6A 4ZDJA 2R4TA 5JXIA 1LLUA 1ZIYA 1YS6A 1ZRMA 2DBYA 4GOND 4RL6A 1JILA 2OXFA 4ZEMA 1WUHS 1YMUA 4P32A 821PA 3GK3A 4XJXA 4WXMA 5JS2A 3H16A 3Q8KA 3GEEA 1XXHE 3BFPA 3SVZA 2N75A 4DSNA 1R4NA 2BGKA 4OFXA 3UFXA 4XCQA 4AS1A 2O19A 2J6HA 4JP8A 3CV3A 1PYOA 2OGWA 5B1SA 4PXYA 4DNPA 3GCGA 2C7GA 1U5AA 3N74A 3WXMA 1XAIA 5JXHA 1JXAA 4KQFA 4EHDA 3HCAA 2XVYA 1XLVA 4CJXA 4KO1S 4GZ3A 2L19A 2D0PB 5FCDA 2RI1A 3ANSA 1BWPA 3KYJB 4MGZR 2ZIVB 3SF8A 4DWOA 2C4NA 2AXEA 3MOSA 3EN0A 4OI4A 3EUWA 2Q3FA 2OUKA 1E7WA 1XL0A 4NPCA 5ESDA 4HS4A 1PK8A 1NFFA 2LRHA 1C29B 1YJCA 2G5GX 3ANNA 3K9LA 3OPXA 4GMKA 5DI3A 5IW8A 4X6XA 1PTJA 1KAQA 3KALA 1Y3FE 1NLUA 3HCRA 2IY8A 2IOHA 4MWCA 3ASZA 4CM7A 3G0CA 3GLHA 1BXKA 2WNHA 3QPDA 1JDTA 2HF9A 5CLFA 1SMKA 1BEUB 1Y8CA 2COEA 3G9XA 2PWAA 2PZAA 4PWZA 1NV8A 4BB6A 5BSFA 5EJ5A 1P6XA 1G5RA 2VKQA 4XE5A 4QT4A 5B7PA 4B7ZA 4Q4AB 1KKLA 2J31A 3EBLA 3CEPB 4IMPA 1PHRA 2WG2A 2GESA 4D96A 2VEDA 4D9GA 4PLFA 5CLJA 2D8MA 3JWEA 3WAJA 3GOQA 5AKXA 3LWDA 3MGGA 2RAUA 4DVJA 1Y89A 1QTQA 1IYZA 2RGRA 1QYVA 3IIMA 1TD9A 1IONA 3TL6A 3KOZA 2WYHA 1VFNA 4GWGA 2NM0A 4M89A 5ILGA 3ZE6A 1BX0A 3MQFA 3R3JA 3RDPA 4BJHB 1GO2A 1P72A 3CF4G 2J0QA 2ERYA 4QFBA 4UM8B 2MR6A 4ZVTA 1UBTS 1FFCA 2ZJ1A 5HRUA 5LD2B 4E1AA 4M88A 3ZK8A 4IDGA 2FF5A 1C1XA 4TN5A 4EI7A 4Z8YA 1GCUA 3L1UA 3ZDFA 1Q7TA 2AEMA 4G9EA 1SKBA 3I3SR 4US0R 2YS7A 2AKEA 3D4OA 4J91A 5AK5A 4Z0PA 3D2AA 4GNKA 5C4IA 1AQYA 4ZA2A 3ICEA 5DNYB 1R12A 4EBBA 4I4TA 4L0MA 3LPNA 1Q3HA 3REGA 1LWOA 2OZLB 3ENZA 4M55A 5KJFA 5KNCH 4S0ZA 1LXCA 5LP6B 4WOJA 1BKYA 3FYUB 3TVYA 4DJJA 3I2IA 2BOVA 4ZARA 1VLVA 5ALEA 1XHEA 4GX5A 4MS1B 5C1BA 5IVKA 5K3BA 2FX2A 5KJ1A 2JJ1D 5LUBA 2WB4A 4L8WB 4U1RA 1XLTC 3ZHXA 2C59A 3KELA 5J4KA 4GMDA 1T8TA 2BSQA 4B3BA 1A9OA 3N1UA 5EL0A 5KVSA 3KSZO 3QTTA 4E4RA 2JS7A 3NNNA 4BV2A 5EKUA 4JQZA 1XCMA 1UJ4A 1E18A 1UMDA 1QQ7A 4YACA 5KDOA 2NN3C 3LRPA 4B87A 4DQKA 1L5QA 1BIFA 4BN5A 5NULA 4YRQA 1TEHA 4IDFA 1DMSA 2D2VA 4WFQA 2A67A 3IH5A 3HDQA 3UXEA 2FWPA 2MMGA 3EH1A 3NXKA 3V6MA 2O8DB 4RVDA 1ISGA 1ZJ6A 4XR4A 2QTHA 4G86A 3PRJA 4BNZA 1EFRD 3UYKA 4CF6A 4KXQA 4EJ2A 3AZPA 3HU1A 1D4ZA 1SBNE 4QNNA 4W5RA 4TL8A 1TUEA 4QG7A 3ER6A 3OHMA 4DMHA 4JR1A 4AJLA 4XQEA 4ZZ1A 4BIIA 1CQZA 3NX4A 4XYEA 3S27A 1HSOA 1LRLA 1JDBC 3VKGA 2QJTA 2JBAB 2G08A 3DULA 3IVGA 4J2TA 1YQXA 3OEYA 3U26A 4HNVA 2IF2A 4MUYA 1QM5A 1RKQA 3C6XA 1L4EA 3B1XA 4AS2A 4GECA 1DWOA 2GXAA 3NRJA 1UQTA 2CGEA 1G16A 3ONNA 2EWMA 1P3DA 4YMSA 1QHNA 1SVNA 4P3KA 4C4SA 1BXRB 4YIKA 2D0OB 3RUAA 4QE3A 1SRRA 3R8XA 1I7LA 4GZ6A 4X8HA 4EFMA 5A3JA 3WC4A 2H06A 4R7TA 4L8FA 1N9GB 4LK2A 5DNCA 3H5AA 4FXOA 1LDBA 3QELA 4TMFA 4RQBA 2W8ZA 1ZGBA 1I51A 3GVIA 4MQUA 3DL0A 3LYAA 1WDTA 3EIHA 4LDPA 2WM8A 1CEQA 3LDAA 2I0FA 3N2IA 4MUEA 1BSVA 3GYBA 3ZCUA 3WSTA 2QMHA 1LPBB 4QDZA 3KFXA 4MV1A 4R1OA 3I30X 2V9PA 1FP1D 4QOEA 1QCDA 2VXYA 4Q1DA 4ATNA 4N3BA 1R2QA 5K8VA 2X7JA 2HSGA 3Q3EA 4J1SA 1THGA 4BTVA 1XC7A 1O94D 1BO6A 1FMJA 1LK7A 1IG0A 1OA0A 2XUZA 4OY3A 3JQ9C 1JBQA 1KVSA 3MIZA 4IDPA 2A78A 4P4NA 4AF8A 1R74A 1Q22A 4CLRB 1EVKA 1PR3A 3BRWD 3CW2A 3VPAA 2Q7XA 4LK3A 1QVZA 2DPLA 1HE8B 1JKFA 1PWXA 2JVIA 4HX5A 5B5SA 1WMSA 4MPJA 2OC4A 4LEIA 1XZNA 3NI2A 2SHKA 1HYQA 2ILTA 4WZAB 6LDHA 2DFTA 2IXFA 5IKPA 13PKA 4LXUA 1L1EA 1G5PA 4CV2A 2ZRQA 1USGA 2OPBA 4XPIB 3WMWA 4BASA 5HDQA 1WM1A 4J1QA 4XYGA 4B7XA 4YJFB 4QVIA 1OZFA 3E7PA 3Q7TA 3GJ4A 1NOKA 3FDZB 4XYLA 1EK2A 1UBEA 4B0PA 3K6SA 4UXIA 2DFNA 1T4DA 3AB8A 4JBNA 2H1FA 1KRXA 4GOJA