4QM6A

Structure of bacterial polynucleotide kinase bound to gtp and rna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of bacterial polynucleotide kinase in a michaelis complex with nucleoside triphosphate (NTP)-Mg2+ and 5'-OH RNA and a mixed substrate-product complex with NTP-Mg2+ and a 5'-phosphorylated oligonucleotide.
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Transferase/rna
molecule keywords Metallophosphoesterase
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qm6A00
1KI6B 5CJ2A 1B23P 3SDZA 4PC7A 1RYFA 5HZHA 1OSNA 1JALA 5EP2A 1HE8B 2J1LA 3TW8B 5FBWB 2VHJA 5FPYA 1IM2A 2CCKA 3SE0A 4IDOA 4LHXA 2GEDA 3QVUA 5G3YA 4BZQA 1U8AA 1KI3A 2IYXA 2CEAA 3UMSA 4JKYA 4RFSA 2IS6A 2X1VA 3SQXA 4HAWA 1CF4A 3QEJA 4N3NA 4UQOA 3ICEA 2FE4A 4P4SB 4Z1MA 3LNCA 1G7RA 2ZE6A 2F43A 2OXRA 4MDEA 2A5GA 3P27A 4MYHA 4OJKA 4AD8A 1UDXA 2QSZA 3SHWA 1V43A 2LKCA 4QGGA 1YU9A 5CIWA 1FNNA 3GJ7A 4QBHA 1BYIA 4U7DA 3IEUA 2IUSA 4JLOA 4KYUA 2QENA 2IF0A 2NTYC 4KJZA 3AF1A 4A0RA 3X1DA 1E2NA 2CE7A 1SQ5A 5CJPA 3UPUA 1LB1B 1TADA 5FBLB 1IY1A 1KY2A 2OFOA 3QOFA 3VR4A 3QE0A 1KK2A 2FFBA 4DLYA 3SQWA 4TMKA 4O2LA 4QM7A 2OUKA 2H16A 3SBEA 3K0SA 3VKGA 4B71A 2H92A 4B76A 1QHHA 3P4XA 2C96A 1TNDA 2D3WA 3I32A 2PJRA 3UKDA 3KL4A 3GJ4A 1XCGB 3JVUA 5BXQC 2P6UA 5G40A 2YOGA 2WSSA 3CWZA 4BZXA 3NEYA 2OAQ1 1DPFA 2JIZD 3BOSA 3KUCA 4ACBA 1E2JA 1RJ9B 4XD7D 3SI7A 1NSFA 1S3GA 3WMFA 5FOWA 1DBSA 2HXSA 4Q1DA 2WWYA 2ZI7A 1E69A 1IJFA 3X1WA 1ANKA 1U8ZA 3ZGXA 2ZR7A 3UWOA 5H70A 4QC2A 4C4PA 4BFZA 1KJWA 1TU3A 5CK4A 2R6CA 4GOKA 2VHTA 3HYTA 4TL6A 5EE9A 4MA4A 3L0PA 1S96A 4QHTA 3EIEA 4PAQA 3DKVA 5AJVB 2DR3A 1DOAA 1Q21A 2A7QA 5AK0A 3MWJA 2GJAA 2Q21A 2KI5A 2ZRHA 3VFDA 2XZLA 4JLKA 1NIPA 3FDIA 5ELXA 1K5DA 2J87A 1SZPA 2CVFA 1XCMA 1E2EA 5DIFA 4QFMA 2ZM5A 1F60A 3BWDD 4BRWA 1ZM7A 3FTQA 1N6OA 3IIKA 2ZR9A 4ZI3A 3TK1A 3L0OA 3FKSD 2ZI5A 5J4LA 1OV4A 1W5TA 2O8CA 2O0JA 1IQPA 3R7WA 1JB1A 2C9OA 2WWWA 2NO6A 4JLBA 2JJ2D 1ZINA 2CJWB 3B60A 4D81A 2A30A 1QVRA 2IYTA 4Q5IA 3CLVA 1NG9A 2ZQ5A 3KUDA 4A1FA 4AKIA 4CYMA 3I72A 5FOXA 1E2IA 1I4DD 3PG5A 1GL9B 3AVUA 4JS0A 1SHZA 1ZU5A 1FFHA 4C30A 5JMTA 4PSAA 4HUQA 1ZD8A 5IRCD 1GOTA 5LDDC 3PVSA 1TU4A 4JJZA 5FUYA 4L15A 1Z28A 1P9NA 4L9WA 5DE3A 3T34A 4QJ5A 2QMOA 3LFUA 5FPKA 1R2QA 3P20A 3B5JA 4TMWA 1NN5A 2G1JA 1NF3A 3IQWA 4O25A 5AUQA 5F9FA 1N6NA 1N6HA 1UKEA 2IHYA 4EQ6A 1ZIOA 1CP2A 5DYGA 2E1RA 3SFZA 1T3HA 2JEOA 4X8MA 3U7FB 2VYFA 4XWOA 5FL7D 1NSTA 1VCMA 1TUEA 3KX2A 3QXCA 1Q57A 3PEWA 3IGFA 1TX4B 4OI1A 5KSOA 1BYUA 5KSYA 3QG5A 3ADCA 5EP1A 1H8HA 3U4QB 3D6TB 4DT1A 4A6XA 1U81A 4JBXA 3RLFA 1Z07A 1OF1A 1JAHA 1NL3A 4IXMA 4TL9A 5HPYB 4Q48A 4E22A 2PMDA 1XMVA 3NG1A 4Q4HA 4YDHB 2X19A 2V7QA 3DM9B 1UPTA 3HR7A 3I3SR 2V1XA 4JLMA 3PXGA 1XJQA 1AS3A 5TXGA 3MD0A 5CM8B 3ND9A 3NBXX 2GF0A 2H17A 3CUEF 4IW3B 3OHMA 2O8FA 2IYYA 4LY6A 1P3JA 4GOJA 1JJVA 3QPWA 3EC2A 4P4TA 4F4JA 2JLZA 2WWXA 1JR3E 1QF9A 1DAFA 4RKEA 1ZMXA 4ZV4A 1FTSA 5H1YA 3LX5A 1Z0FA 1EG7A 3OEEA 1VIAA 1P9RA 2GF9A 4I1OA 5KO2A 5FOTA 2HF8A 1OHHD 3FGNA 1Q1ZA 2GAOA 4P3YA 1Q1QA 1AK2A 4AKGA 1G8YA 2N1BA 5BYKA 1L4UA 4JZKA 2NG1A 5TMPA 2GRJA 1RW4A 1NY5A 4LWZA 2GCOB 2RGNC 4GP7A 5FUXA 2YOHA 5FPSA 5EZ5A 2VO1A 1WB9A 4DKXA 4TN1A 3IUYA 5LD2C 2G9NA 4G5RA 1BMFD 3KFVA 3TKLA 3DM5A 5HCNA 1JEDA 4ACAA 5TY0A 4TYNA 2F7SA 4ZDWA 3AP2A 4NE2A 2GJ9A 5KPJA 4LBYA 1DAIA 3U61B 3F5FA 1U9IC 2F9MA 3AVOA 2NPFA 4M22A 2AKAB 3KQUA 1W0JD 5AUOB 4QL3A 1XTRA 4M1OA 3K9NA 4EPTA 2UZ3A 1ODFA 2HCBA 3QF4A 2B7BA 2QRZA 2FSGA 1YR9A 2Q9AA 4Q1AA 2W0MA 1EWRA 1PLLA 1NIJA 4MUBA 5HE8A 4LYHA 4ASUA 1G8FA 1KNQA 2WKPA 1JECA 1XWIA 3RS3A 1YQTA 3QKRA 2BJWA 5CB8A 1E2LA 2FDCA 4G01B 4NYJQ 5ANRB 1J99A 3FMIA 4IDNA 1OKKD 2WV9A 1AN0A 1X8JA 3TRFA 2NMVA 1MV5A 1EFRA 1JR3D 3R20A 2P2LA 2C9YA 4LV6A 2XB2A 1RPZA 1U8YA 1QG4A 2RGBA 4CEJB 1NVVR 4YMVA 1QVAA 1S8FA 1KI4A 3BD9A 3N2EA 1IY2A 1QHYA 3T1TA 4Q9LA 1MRNA 2JA1A 2OEPA 2IT1A 1VIYA 4UXHA 2EFHB 2ZI3A 1GNRA 4LGMA 2CHVA 4I4LA 2IW3A 5GVSA 1EXMA 4Q4JB 3DMNA 1WMSA 3TW4A 4RZXA 4KFTA 2C99A 5JCZA 3L2OB 2FGKA 3KKQA 4ZIRB 2ZI4A 2J3EA 4LBZA 2BBWA 1GKUB 4PPGA 5C1BA 4PZYA 2GEVA 4UNSA 5L3VA 4LRWA 3IKJA 3G0HA 3W6OA 5KNCA 5FI1B 3IO5A 1DELA 1IN4A 1KY3A 4JLDA 3T1OA 1CS4C 3LV8A 2ZS9A 4V02A 1WBDA 3ZD6A 4A2PA 5K8LA 1TMKA 3HU2A 2EFEB 2HUPA 2ERYA 821PA 5JRZA 2GCNA 3CZQA 3D7MA 2O5VA 4MKGA 1S1CA 4EJSA 5DSZA 3VR1A 4DIDA 2IS4A 1KAGA 3CPJB 3CPEA 1E2HA 2BMEA 5CYPA 5JECA 5TARA 1AS2A 2PZEA 2QMEA 3ZLJA 4OJQA 2BIFA 5E95A 1KDRA 4B2PA 1T6NA 1VHTA 4PFSA 2XITA 3RRMA 4DLVA 2JLVA 2WWIA 1CULC 4QGAA 2IUTA 4HDOB 5KHOC 3EZ2A 1XTQA 3VR3A 4DUGA 3NEJA 4TT3D 1Z0AA 4JLJA 4OI4A 4AG6A 1OXXK 4ON9A 4B3DA 2GZDA 2Z43A 4NMMA 3QKSB 3CRW1 1W0JA 1ZM3A 2OSBA 2FFHA 1Z0IA 3CX8A 2HDNB 1PVOA 2G0TA 4WZBE 2FU5C 1LNZA 2QROA 4GMDA 1Q1EA 3GJ5A 3VNVA 4HATA 5FUWA 3UG7A 2O0KA 1A4RA 1BMFA 4L16A 2FX3A 2IX3A 3KQNA 2AFHE 2GXQA 4YLGA 3ICQB 4X8HA 121PA 4P31A 5KDLA 2J46A 2CNWD 3R9IA 4KXFB 3V9PA 2CLCX 2WWFA 4WBSA 1SKYE 1NP6A 3WYFA 1U2RA 4A36A 1XRJA 4XVRA 5JEDA 4IEEA 3TMKA 1OHHA 2OG2A 3OEED 5SZJA 1XD2A 1GAJA 4DB4A 4FMCF 2PMKA 1P2VA 4D80A 1TF7A 2IYWA 3A8TA 5EUQB 3F3YA 1Z0KA 1S2MA 4PSKA 4B3CA 2DY1A 2O8DB 5FFMA 4R71A 3C4JA 2JLRA 2R62A 1S9HA 3O8BA 2QP4A 4CGZA 1P60A 2DYKA 3HPRA 3KFXA 2ZROA 3T61A 4AY2A 1G4UR 1XXHA 4IFBA 2PCJA 1D9ZA 2V6JA 3AEZA 3MWYW 3IIJA 5FR2A 8OHMA 2JDIA 4LDJA 2F1RA 3JZAA 4D4KA 3UMFA 4B48A 1KYIA 2B8WA 2O8DA 4AKEA 1XBTA 3K9GA 2C5LA 2IHBA 5JHGB 2QG6A 2EQBA 3KJHA 1G1MA 1YZQA 1D5CA 2ZI6A 1GILA 4HB2A 3GLGE 2FH5B 3A1WA 3EPLA 5L8VA 3W8NA 3K8YA 1W5SA 5KDOA 2H18A 4FMDF 2I1VB 2HCJB 3PFIA 3DDCA 4WIAA 1WP9A 1QHGA 2QRNA 5C46F 3KKPA 3DOEA 2WKRA 4F91B 2IK8A 4Q9IA 5FL7A 2DFLA 4TLEA 1PLJA 1UF9A 3QNUA 4LYJA 4PSVA 1II8B 2QI9C 1W4BA 4RSGA 2OCYC 2F43B 1Q1BA 5EXSA 5LBIA 3ZQ6A 4H9GA 4Q7MB 5JWOA 1OE0A 2OILA 3QPUA 3NC1C 4JT4A 2IYLD 4RD3A 2WICA 3LD9A 3O8DA 1P75A 4UKDA 1CR4A 2V54A 1GRNA 2C8VA 5HZKA 4NBSA 3THXB 4QBFA 2ZYTX 4LYFA 1RYHA 4PPNA 2FJUA 1IJEA 4MKHA 4G5QA 1R5BA 1W1WA 4A9AA 2WPDD 4O0MA 3Q85A 1G3RA 4D0LB 4IFEA 2VP6A 3BS4A 2WKQA 2ZIAA 3C41J 5FTLA 1NJFA 3FKSA 4V0LA 3OAAA 1YR6A 2KE5A 4OK5A 4B35A 1WQ1R 4BASA 3AVPA 4Q66C 4Q9HA 1KZGB 1G6OA 3A1UA 3NH6A 1ZNXA 2IYRA 2REBA 1E9SA 3EPKA 2KBEA 4OL0A 5FTNA 3AQ4A 2OBMA 3HYRA 1NVUQ 5H68A 3AKCA 3ZH9B 4OHZA 4Z51A 3U6BA 3W90A 2QE7A 2GCOA 1Q12A 3ZS9A 4YC7A 1KI8A 3AH8A 4AI6A 1R5OA 3ETLA 5HKKD 1US8A 4KBGA 1PUJA 2YINC 3DZ8A 3EZFA 1X8LA 1W47A 2GJ8A 4R2HA 4PC6A 2C9CA 3GQBA 2K5UA 1P2UA 1QHHB 4JLVA 1FP6A 4IVQA 1OXVA 1N6RA 1XJ0A 4NP6A 3AKYA 4KBFA 4XD7A 2ZS7A 3GJXC 1KSGA 1XPRA 4ZDJA 3B1XA 3DHWC 3BFVA 2ZJ5A 3QPVA 1E1RD 5KNBA 2FEOA 5SZHB 3R9WA 1M74A 2VF7A 2WSSD 4N0DA 2PLFA 2VP4A 3AKEA 2QEQA 2WJIA 4HEJA 3C7KA 4JL8A 1KI7A 5L3SA 2ZAOA 4JVMA 4Q9JA 5GJCA 1OXSC 1ZNZA 1XNJA 4L9SA 4TQ9A 1P62B 4H1VA 2RCNA 5KSZA 4I99A 1NN3A 4NONA 1P7CA 3BB1A 4DCUA 2GNOA 721PA 4HLUA 3R7WB 2GZAA 5HR5A 2AK2A 4PC1A 2ZSFA 1G5PA 2XZPA 2BDTA 3RS7A 2XB4A 3PITA 2YYZA 3Q9LA 1LF0A 2IF2A 5LPNA 3I8XA 4XTCS 4ARZB 3W3AA 2ZANA 1D6JA 1U0JA 2XSZD 4RFSB 3VR2A 1GL6A 1N0WA 3IDQA 3KXKA 2OCAA 1W2HA 4BEJA 3O8RA 3QG1A 4OQMA 4PO9A 4LBWA 4B33A 4QOSA 2Z83A 4B74A 1T0JB 1XD8A 3GEIA 4FMDB 3LBIA 5DNYB 1KI2A 1SVLA 4Z1MD 3U7HB 2O52A 1J2JA 5SZIA 5FPHA 2CK3A 3SC3A 5AUNB 3I62A 1KMHA 5BN3A 4MRVA 4PO1A 2FGJA 1BS1A 2P65A 1I4TD 5FBRB 5JSZA 1OH5A 4TTQA 3TVTA 2ZRBA 1T5IA 1ZD1A 4Q4AA 3UXMA 2F55A 1X6VA 2QORA 3IIMA 5B58C 1P2SA 1KMHB 2AFIE 2ZPTX 4IDPA 4OKSA 5TB5A 1AKYA 1IY0A 1HH4A 1KI9A 3U7GA 3QKUA 3MUFA 2PCLA 2OM2A 3NVAA 2OFXA 3QF7A 5GVRA 1RFLA 2N46A 2FMXA 1OH6A 1VCOA 2GWHA 2LKDA 1G20E 4UJ3A 4KLZA 4BECA 2Q3MA 2ZRPA 1KZ7B 2IUUA 1E2MA 3WP0A 2IYQA 2OCPA 3QXXA 1UBCA 2DBYA 1K5GA 3C5CA 1DAKA 4I1SA 4X8LA 1JBKA 3VMFA 1T3LA 2AK3A 5DGXA 4EKDA 3HR8A 3AUYA 2RGNA 5B30A 4PHTA 1SXJB 3E5HA 4N0EA 1HQCA 3GJ6A 4MYUA 1ONBA 4IKEA 4Q02A 2ANBA 3LVRE 3T12A 2EU8A 3EZ7A 2CMKA 2PX3A 4JLPA 5F2EA 4A4DA 1OH7A 3GD7A 4FCWA 2WJYA 1CXZA 1MRSA 2I1QA 2AKYA 3RRYA 1SVSA 2HJVA 2R6AA 1WA5A 1MOZA 5J5CA 1LVGA 1J8YF 2D2EA 2GXSA 3VAAA 3OIWA 4TL7A 2WM9B 5GADl 4BPBA 1Z29A 4DLZA 1NMZA 5JSZB 2J45A 4RD2A 2A5JA 3CH5A 3AKDA 1E3MA 3L0IB 3AP3A 1G5TA 1AIPA 1F6BA 1M7HA 3CF6R 3K0AA 1XD2B 3VHXA 4ESHA 4M1SA 1Z8FA 3RAPR 3H0KA 4M4SA 1XCPA 3ZIAD 1Q3TA 3ZZ0A 221PA 2FZ4A 3BIFA 2H1LA 4JT2A 4RD1A 2BMFA 1RRCA 1DADA 2D7DA 1IN7A 4EJSC 1S1MA 2F9LA 3QIAA 1UBGA 2P67A 1LY1A 4FN5A 4G3XA 4CEIA 3WXMA 4TLDA 1R7RA 4TLBA 2R6FA 4WZAE 3ZVRA 4NH0A 4RZ2A 4JVLA 3AVTA 3VKHA 5F98A 3GLGA 4C0HA 2NPIA 1TEXA 3B85A 1UFQA 2ZJZA 3OEHA 1O87A 3GFTA 4ZIRA 1G3UA 4E03A 1PV4A 2HXYA 1N0UA 3GJ3A 2XJ4A 3Q5EA 4E07A 2F1HA 5DH9A 5FTKA 1SVKA 2WVJA 1SVWA 2QT0A 3B6EA 4B3FX 2ZYUX 1YRAA 3G5UA 4OQFA 5DN6A 4DXAA 1E2KA 3K09C 4KHZA 1ZAKA 3IHWA 2BOVA 1OYWA 1E96A 4FXPA 1RRPA 2QGZA 1ZNYA 1KIMA 2QBYA 4CF7A 1E79A 2R6DA 3LBHA 3A4MA 2YC4C 3FWYA 1ZJ6A 4XVQA 3TUIC 4OK6A 4A2QA 1D2MA 1L4YA 1NBMD 2VPPA 1GKIA 5H8WA 4Q7JB 4DLXA 4IEIA 4JIMA 3OE7A 3AGQA 5EE5B 3IQXA 4LHVA 2VSFA 2J0UA 1VDZA 4O3MA 2ZUDA 1WDTA 4HZUA 1LFDB 1YZUA 3ADBA 1HY3A 1M7GA 2A5FA 3DMDA 3A36A 3GEEA 2GA8A 4JYBA 3AUXA 2FOLA 3RRNA 2L0XA 3EAQA 2R44A 3VKWA 1NN0A 1VG8A 3EW9A 5CK5A 5EE1A 3VX4A 5E7MA 3HDTA 5JRJA 1W7AA 2J59A 4L8GA 1CBUA 1T8TA 4KFUA 2NQ2C 1T5LA 5EXXA 1MT0A 1KO4A 4W5JA 4TZ0A 1FQJA 4NYIR 4B47A 4G0NA 4G5GA 3EPJA 3R8FA 1ESNA 1G21E 2GXUA 1E9EA 1UBFA 2XTNA 3AGPA 4W7SA 1OB5A 4Q21A 2WJJA 2RGGA 2ZAMA 1OPXA 1XTSA 1KI6A 1I4LD 1AZTA 3I4LA 4PO8A 4AC9A 1GWNA 1Q44A 4Q4AB 1N25A 4HUTA 4NHOA 2DFNA 4U00A 4Q9KA 4CDGA 3AVYA 3BH6A 2FZLA 3ZS8A 1E9RA 3K70B 3C5HA 2BVNA 4EFMA 2J9RA 2ODNA 2R9VA 3B1YA 4II7A 1Z08A 1Q0UA 2E9SA 2KJQA 2YNMA 3BK7A 2DFTA 3MWLA 1XU4A 3QF4B 4B75A 2W6JA 4MRPA 4RFVA 2YOFA 1ZUNB 4GPTA 2A2ZA 4B32A 3AM1A 4M9SA 4OHVA 4FMCB 4C2TA 3ZVMA 2IYZA 1C1YA 2W83A 1KSFX 2QNRA 2HLDA 2WWGA 1QZXA 4LSGA 3DZDA 5C18A 3GPLA 4HAUA 4A92A 1NVXQ 5KU1A 1WCV1 5J4VA 4CVNA 1SKQA 2ZSEA 3SYKA 1DG3A 2NOAA 4K8OA 2FSHA 4DHEA 1F5NA 3FHCB 3NBZC 3T15A 4PZLA 4Q1BA 2JLXA 4B6EA 3CR8A 4HSEA 4TZ6A 4DWJA 3BB4A 2HJGA 3SN6A 4URYR 2ORVA 3VR5A 2HT1A 1J90A 4A8JB 4W5WA 1JXOA 2GAAA 3EA5A 4IOLA 4B43A 2J0SA 2W0SA 2QP3A 1NMXA 1XTKA 1SVOA 5JZVA 3NBFA 4HB0A 3QXSA 2F6RA 5BQ5A 1B0UA 3AF0A 2W6ID 2J7KA 5DI3A 4JSYA 3FB4A 2ZE5A 3MCAA 1IXRC 4XTRA 4Y0VA 3I73A 2G83A 3AVXA 4LJ9A 1AQUA 5KOYA 2BEJA 4QXAA 3B8HA 3AVQA 4R7ZA 2ZUCA 1N5IA 5C4MA 3EWSA 2VHUA 3K9LA 1GRRA 4LPKA 421PA 4B73A 4WXRA 3ZZTA 2F3TA 4A0HA 2BBOA 1TF5A 1NLFA 2QU8A 2W2TA 2AWNA 2RGAA 5B64A 2C2HA 4LBVA 2H8KA 2YVUA 4OYHA 2AWOA 2C04A 1XB2A 4PAOA 1P2TA 3L8ZA 5SZKB 4A8JC 2RHDA 2ZSAA 3EWAA 2CHQA 2DWQA 3MAAC 1OIVA 4TYWA 1I2DA 1ZIPA 5FOUA 2IXGA 4RD0A 3RVBA 3FVQA 4OHXA 1LS6A 1M6NA 2FNAA 2V9PA 1H8EA 1SKYB 1YHNA 5AWFC 2O8EA 3IILA 1F3OA 1XMSA 4BLRA 1NLZA 4XWAA 1VECA 4ZKDA 3X2SA 3BORA 3GFOA 4M9QA 2NO1A 4R9UC 4A82A 2YHSA 2VF8A 3B78A 2AD1A 2JCSA 2PL3A 2R8RA 1DAMA 4DDTA 1WRBA 2ZJ8A 1XTJA 4V0KA 4L4UA 2HYDA 2ZRMA 4DSOA 1IN6A 3BB3A 4LCBA 2HT6A 4HB3A 2QTVB 2JLQA 3EG5A 5IK2D 4FWIB 2BCGY 2KWIA 1RVDA 3QKTA 4URZR 4ITRC 2ZSBA 3RC8A 4Q03A 2VA8A 3NDPA 5L3SB 2RGCA 1HYQA 4LHZA 2OCBA 4TYYA 1A1VA 2CHGA 2IS1A 2UZIR 2BCJQ 3WP1B 4IOJA 3B9QA 5B57C 1CR1A 2DHRA 4DDWA 3TR5A 1IAQA 5EZ6B 2QZ4A 3CRRA 3NH9A 3ZZUA 4B3GA 1JR6A 4IRUB 2RGDA 2ZRIA 4QNRA 3SR0A 3X1ZA 1MH1A 4QHSA 3T5DA 2ASEA 4F38A 1PJRA 4GMXA 1JXMA 4WAUA 2N42A 2O8FB 2CLDX 2CJWA 2B21A 2ZI9A 2G6BA 2IEYA 4DSUA 3SZRA 1HA3A 3CM0A 1P5ZB 1VG0B 4DSNA 2XOKD 4MKFA 4PPQA 4CW7A 1Z83A 3PR1A 4JYCA 3V4RA 3BJIC 3MFYA 4CEJA 3HWSA 1A2KC 1RIFA 3K1JA 5KYKA 4JSTA 1Z06A 4LJ6A 5IDVA 3AF3A 4BGDA 4TMZA 3BC1A 1T3SA 1IXSB 1ZP6A 3FMPB 4P32A 4ERNA 2CL7X 4I1VA 3ADKA 4GT1A 3JZMA 3B13B 3THWA 3GFPA 1YZKA 2GESA 1KJYA 1SXJD 3RC3A 4IXNA 1WE2A 4URVR 2VLIA 2Q9BA 2W58A 3W6PA 2IA5A 4V0ME 5LD2B 1R5NA 5K8UA 1OIWA 3WHKA 4Z8XA 1D9XA 2AL7A 3WNBA 4AWXA 1E1QA 1EWQA 4NCHA 4NU0A 3I8SA 4DLUA 4ILEA 5CIQA 2JJ1A 2P3SA 2Q0HA 4PAMA 3R9XA 4UJ5A 4JBWA 4S2EA 3MJHA 4DVGA 5DI9A 4EQ6B 3ZD7A 2GBLA 2JAQA 1CJVC 2VP0A 3QVVA 2PX0A 2RGEA 3M1IA 3TJZA 1E2QA 3KQLA 1G4AE 1P73A 3U3RA 4ZCLA 3VQTA 4AURA 5JCPA 4AYWA 4C0LA 4BLSA 5F9HA 1VYTA 3LLUA 2H7VA 5EXPA 1SVMA 3LA6A 4C0SA 3B1ZA 3KTAA 2C95A 3AB3A 1MKYA 4AIIA 5KTYA 1W0KD 1Z47A 1E1QD 1XDBA 5AJYA 4RZ3A 1FTNA 2IXEA 1MO6A 4KAXA 3PUWA 3H86A 3LQRA 3QSYA 4Q1EA 2OBNA 4NCJA 2YJTD 2ZRDA 3HP1A 3CF2A 3FMOB 2YZ2A 2GKSA 3KB2A 4AK9A 1CIPA 1SXJA 2BBTA 1YZTA 2NZJA 4V0OA 5BN4A 1LTQA 5EP4A 4CEIB 4JVSB 1E9BA 1SVIA 4U5XA 3IEVA 4DCSA 1IN8A 1CJKC 2GTPA 4K46A 4A0FA 5BWMA 1ZCAA 1NVVQ 4TSFA 5FUVA 3GLIA 4TQUS 1DO2A 2GEUA 1XEFA 2PT7A 5K8TA 3THYA 1OJLA 1CU1A 1YJ5A 2BEKA 2OE2A 4F93B 5G41A 2QT1A 2XJ9A 4F92B 3KKNA 4URUR 4D4JA 3THWB 1OIXA 2JJ8A 4HLUC 4CRWB 2OFWA 3CNOA 1X1SA 1AQYA 3FFBA 3CRVA 1KOFA 2WTUA 3MJRA 5KPDA 2HF9A 3TIFA 1AJEA 2JLUA 1X8KA 1N6KA 1KK1A 5AUPB 2RAPA 3CH4B 3IPYA 1GIAA 1ZRHA 2J0VA 4QBIA 3MGCA 3SJBA 3RWMB 3ND8A 4Q1CA 3TH5A 2X2FA 2ZRCA 1XP8A 2CCJA 2XAUA 2ATXA 3THYB 1OFUX 4XIGS 2BHRA 2REOA 4QJ3A 5UKDA 1ZCBA 5IK2A 1KNXA 1QHXA 1KAOA 2IWRA 3CF0A 2V4ZA 4NYMQ 3SYNA 3TGPA 5F3WB 1TEVA 4TMVA 1OXUA 2QAGA 3P32A 2BMJA 4XWKA 4ZCIA 2KBFA 4C0QC 1FQKA 1G6HA 2Z6VA 1G64A 4AYXA 1COWD 2Y8EA 2LWIA 2D2FA 1OT3A 2F3RA 4Z54A 1XEXA 2AXNA 1R0ZA 2RHMA 5JS8A 1G7TA 2VIIA 1GDDA 1Z6TA 4IVRA 3BGWA 1C4OA 1H8ED 4PQRA 5GJBA 3PEVA 1ZC4A 3U60B 4QKQA 5G3ZA 3PEYA 2J41A 2JASA 3A1VA 4JL5A 3C16C 2G3YA 3EASA 1R4AA 2BM1A 4QRHA 1A82A 2EFDB 4UNRA 1Z2AA 2QPAA 2H57A 3QQ5A 2IC5A 1R6BX 1VCIA 4U02A 1N6IA 3SFVA 2WMNB 4LJYA 2XTZA 3DOFA 3Q7PA 1KO5A 1KDPA 2ODEA 1CR2A 3KJGA 3LXXA 4JKIA 3SJZA 2UKDA 4EDHA 5J4KA 4EUNA 5LB4A 5JJKA 2QSYA 3QY0A 3WBKA 4JBYA 4FMBB 1FW6A 2QY9A 4GI7A 2O8BB 2XNSA 2ZUBA 1HTWA 3BFXA 4HLCA 1U94A 4IJMA 1E0KA 1Q20A 4UNNA 4URWR 3J81k 2VQSA 4PQFA 3BERA 4D0NA 4M1KA 1AGPA 2O0HA 4UNQA 4C9BA 4XOIA 3VNUA 1KK0A 1U98A 1GNQA 1W4CA 4Q4JA 1YVDA 4OI2A 1KHTA 4GRAA 4AYTA 4IDHA 5L3QB 2CDNA 2X8AA 1M2OB 4KSBA 3CNLA 3P4YA 4QG7A 3FPAA 1E2PA 3QENA 1NKTA 2QN6A 2WOJA 3CRQA 5FTMA 3GLFB 4BZPA 2YWFA 3ECCA 2VSXA 5JJLA 3TVDA 4I1UA 1G8HA 2QP9X 4LJ4A 1SULA 4DEXA 4ZCMA 4QGFA 3GLHE 3P26A 2R65A 4D4MA 1EGAA 1VG1A 2A5YB 3PUVA 1V5WA 3C8UA 3MMPA 3LW8A 1XEWY 4M1WA 5HCIA 3KB1A 5BW8A 5EUMA 4JJKA 1KMQA 2HLDD 1NNEA 1IBRA 4Q7KA 1FMJA 5J47A 1E98A 1WXQA 1ELOA 4HB4A 4MRNA 2HV8A 3QKSA 3V4FA 3B2EA 4BFUA 3GLFE 4CEHA 1ZM9A 4YXWA 3OFNA 3PUXA 1AS0A 4ABYA 4GDFA 3WHLA 3CIOA 1GNPA 4Q4LA 4CT4B 4C0KA 4GP6A 1CEEA 3SHFA 1TAGA 1JEEA 5IF9A 1UEJA 3H4MA 2RKOA 3TLXA 2EFCB 1E32A 3T5GA 1EESA 2PLRA 4POAA 3KKMA 2SHKA 3GMTA 1U90A 4O2RA 4BLOA 2X2EA 2ZRAA 1NBME 2D7CA 1FX0B 3OESA 4TMXA 1G3MA 5CDFE 4V03A 4D25A 1E6CA 2OLJA 4D26A 1FUUA 2A5DA 1E9FA 2EVWX 1Z22A 5M04A 2OBLA 4LUCA 5AR1A 1Z3IX 4LOAA 2HYIC 1R0YA 4LV5B 3TSOA 1US8B 1XZPA 4CEHB 2AHOA 1MABA 4JL6A 2GETA 2ZREA 4ARZA 4US2R 1RE0A 4GBMA 1E0SA 1AZSC 2J0QA 1U99A 4G5OA 4EPWA 3ZQJA 3W8RA 1IONA 3QBVA 4RKFA 1RJ9A 3THOA 2BV3A 1EFHA 3WYGA 5JWRA 2JLSA 2FEMA 3B1VA 4OK3A 4M9XA 3TSWA 2XNDD 3B7GA 1GTVA 1BH2A 1DAEA 1LW7A 2E87A 1NLYA 4KITB 4KODA 2B92A 1HUQA 1HV8A 2Q3FA 1OH8A 3Q72A 4RVCA 2J7PD 4D82A 5FH9A 3RS5A 2DCUA 2BMDA 2DPXA 1IHUA 1QHIA 4EPRA 3SU8A 2PJZA 5TV2A 2RH5A 5L3QA 3AV0B 1S0UA 1XX6A 2XTMA 3ZJYA 2GVDC 2QQEA 4BFSA 1KKMA 4ZDKA 3OE7D 2ZRGA 3S1AB 4N1AA 3Q7QA 3QBTA 2I3BA 2IEZA 3TAHA 1NJGA 2IL1A 4A6PA 1QG2A 4R98A 1X1RA 1VHLA 5DO9A 1W46A 2QMUA 2P0EA 1O3YA 1YR7A 3A1SA 4DJTA 3A6PC 3U2QA 3E2IA 4TYPA 1UM8A 3W9YA 2J7PA 2OV2A 2CE2X 3LWNA 1GG2A 1L2TA 2BKEA 4C0BA 2WBLC 2XNDA 3AVVA 2CL6X 1QDEA 3A4LA 4IHQA 2PT5A 3TUZC 3I92A 4EFNA 4MDFA 3Q3JB 3W5IA 1LS1A 4XVUA 1CRQA 4Q18A 2REXB 4P33A 2PH1A 2ZETA 2ZU6A 4YMUA 3SJAA 2F1JA 4MRRA 5FTJA 4PQYA 4AG5A 1YZGA 4GZMA 2IBMA 3NC0C 1F48A 1G291 4BLTA 3K70D 2OLKA 2J5XA 3T1QA 2IS2A 1YKSA 4J0QA 4DB2A 3B82A 2WMOB 4LJ5A 3W6NA 4NCIA 3ZIAA 3NIBA 5KSPA 3W5JA 1W36D 1N6LA 1OLOA 3QXJA 3QXHA 2GCPA 3RDPA 3RS2A 1YZNA 3W34A 4GL2A 2ODWA 2EW1A 1MO5A 3EC1A 2KB0A 5JFGA 4IDQA 3L0SA 3VHLB 1TTTA 4CZ2A 2GVZC 1CJMA 1YR8A 1FMLA 4EAQA 3U5ZB 3U6KA 2FV8A 4RZUA 1FZQA 2WIBA 5E7JA 1OB2A 3WMEA 1QRAA 3A37A 3LBNA 2AR7A 3OFND 4YXWD 2O8EB 1MO4A 1NMYA 5HE9A 4DCVA 4H1UA 2KSQA 1KSHA 3K09A 5DHAA 1GUAA 1U0LA 2VEDA 3HJNA 2WSMA 3L82B 3UANA 1YRBA 4HAVA 3FHTA 2P5SA 2ZVPX 4DDVA 5JBQA 2OXCA 4M2LA 4BRUA 3UWKA 1Z6YA 3IBYA 3EIQA 1G8GA 1XFAA 2A9KA 1GSIA 1CLUA 1J8MF 1RRGA 3AP1A 4DLWA 3GCGA 4G5SA 2ZRJA 2QTHA 2OO7A 2VP5A 3EZ9A 1KO7A 3KTAB 3GEHA 3LW7A 3REGA 3IO3A 1ZUHA 4LC1A 1ZBDA 2BJVA 2ODBA 1DO0A 1DS6A 1W2GA 4DBLC 3GLIB 3KXLA 2ZYWX 2I4IA 3ZDQA 2EFGA 3PENA 4BFVA 4LJ8A 3EPHA 4LJAA 4OI0A 1R0WA 5D3QA 3RANA 2GILA 1JAIA 1ZM2A 1CJTC 1G8PA 3A4NA 3LX8A 1NKSA 5P21A 4OBEA 4GNKA 1GITA 4C3ZA 1Z2CA 2RMKA 2MSEB 2P5TB 2D74A 2CK3D 3FOZA 1P6XA 1E9DA 1J70A 1MR3F 4US1R 2EWWA 4KCGA 3RYTC 1Y3AA 3B9PA 5FOSA 4D0GA 4EJSB 1EFUA 2YWEA 3RRZA 3K0FB 3OIVA 4W9MC 2WAXA 1L8QA 1HEIA 2QMHA 3N70A 2XX3A 3WNDA 2ECKA 3LRPA 1FPMA 1GKYA 3D8BA 5D3MA 3BBPA 521PA 1E4YA 3TBKA 1KKLA 1XMJA 4DCNA 2XSZA 2YKGA 1JQJC 4MYCA 1ZW6A 3NKVA 1L7VC 2GJKA 1KSJA 5JWHA 5CB6A 4L5BA 4PC3A 1E0JA 5J4YA 1E9CA 5K8IA 2GXAA 1XXHE 1Z6AA 1J7KA 1DARA 2GK6A 3HPQA 1KGDA 2C77A 1G41A 5L3RA 1DE0A 1GP2A 4DIEA 5JHHB 3U44B 4LI0A 2O8BA 3OZXA 1D8TA 4RY2A 1G5RA 3WNCA 1E2GA 1T0HB 3N5CA 1KDTA 2QQ0A 4NL4H 2JLWA 1XD9A 2VSOA 1HT1E 1SXJE 1TQDA 1VG9B 3DL0A 1H65A 3LXRA 3RSLA 1COWA 1HT2E 5DHFA 3WYAA 4RCZA 4B3BA 5E3HA 1G3QA 4LPSA 4M53A 5J4HA 4GSYA 1BKDR 1E1RA 2Q3HA 2MMCA 1X3SA 3Q8XB 1VYUA 4PPFA 2D62A 1Z5ZA 4RD4A 1S3SA 1JPJA 1CRPA 1G7SA 4PXAA 1M34E 3DO6A 2G77B 3X1XA 4M9ZA 2WJGA 3M4YA 2X77A 1EFCA 1UJ2A 1GVNB 2V55B 4HZUB 3GJ0A 2CCGA 5HKKA 1VTKA 5JS7A 5BN5A 2FG5A 3O8CA 1II8A 4XH9B 2ZTSA 4P4UA 2QPTA 2ZEJA 3BH7A 2QE7D 1Q22A 1GRQA 1Z6XA 3CW2A 3F0TA 5AJXA 1G7CA 1KI1A 3LQQA 5BYJA 1RC8A 4GZLA 1PLKA 3TUJC 3FHOA 3MG9A 4RJLA 4LHYA 1AGRA 2GHIA 4P4SA 2QBYB 1YZLA 3EZ6A 4JLAA 4EPXA 4JMPA 3GLHB 4YMWA 5EE3A 1E2FA 3WBJA 4URXR 3CONA 1NN1A 2Z0MA 3KKOA 3OAAD 4XSHA 2BM0A 4HDQB 5D3MB 1N5JA 5FBQB 1U0HC 1JQLB 2Z4RA 2ZU0C 4F4IA 4NZYA 2WPDA 3ADDA 1C9KA 4FCTA 3K0FA 4TSFD 4WW0A 2FF7A 3DVLA 5TDHA 5FI0B 2QPOA 4QGHA 3PUYA 4MRSA 2FSFA 5CM9C 3N2IA 1ZNWA 3BRWD 3R8CA 1W44A 3S1AA 2QL6A 4IVPA 3M6AA 3U3KA 4QJ4A 1N5KA 4XSGA 4B6FA 1OFTA 1GL7A 4NYJR 4E09A 2ZXUA 4BEBA 1W0KA 4C0AC 3E70C 4DLSA 2CL0X 1XZQA 4NKRA 4LC0A 2GJSA 5FL3A 2ZS8A 5IHPA 3ZVNA 1XEWX 4KO8A 2CXXA 4KU4A 3K9HA 1PUIA 2W2XA 3KJIA 1W4AA 2Q6TA 5EXTA 1AKEA 4Q1FA 3L43A 3ONWA 4LHWA 3K70C 3VU9B 1ZU4A 2EYQA 2G0NA 3C14C 2JLYA 2AD5A 4LJ7A 2QA5A 4F7WA 1Z63A 1KDOA 4HZIA 1UAAA 3UATA 2JJ1D 3NBYC 2DWPA 1W36C 1UKVY 1CJUC 4Q7LA 1XPUA 3M0EA 2JDID 3SJCA 2DFKB 1F2TB 4NCKA 3P1JA 4Z8YA 2AN9A 1W48A 2QAJA 2P6NA 4HAXA 3D31A 2W00A 3H84A 4LZZA 5FBVB 2WAYA 4OQNA 5JEEA 4NYIQ 2DWOA 2Q9CA 5EP3A 2HEIA 3LO5A 3OIUA 2ZJ2A 4FD2A 1FUKA 4M1YA 4D4LA 3ASZA 3I5XA 3NWJA 2V1UA 3KDSE 1N6PA 1I2MA 1FNMA 1F2TA 1DAHA 2GK7A 3MRSA 2WJHA 3HU1A 4IOMA 4DRZA 1ZC3A 4V0NA 3AF2A 5LB2A 2XOKA 4XJXA 1II9A 2VP9A 4FIDA 4DDUA 4BLQA 2LCFA 5A5GA 4TTPA 1NG1A 1E94E 1M7BA 3VR6A 3CB4A 1UKZA 2Z4SA 4WZ6A 1S4QA 1JNYA 3FKQA 2EWVA 4BFWA 2CNWA 4P0TA 1M8PA 1AA9A 2BBSA 3PEUA 3MLEA 2R6GA 3U7EB 4WVFA 1NI3A 4LYAA 4UNPA 4MH0R 3OIYA 2V6IA 4YMTA 1DTSA 2VHQA 1GZSA 4PR0A 1E2DA 2FPKA 3F8TA 2ERXA 3K53A 1KTVA 4WA7A 5JI2E 1SHKA 1E4VA 2IYVA 1ETUA 3RNLA 1KO8A 3FMFA 4E5UA 1NVWQ 1W49A 2NIPA 3JVVA 4FI3C 4TT3A 3TR0A 1XF9A 4DUGD 4DCTA 1KK3A 1ESMA 2A3RA 3DEFA 3AF4A 5EQTA 3AVWA 2YWHA 2ONKA 3NXSA 1WF3A 4JLNA 4LV8B 4C0JA 3CNNA 1MO3A 1VPLA 4PHFA 4KVGA 1CTQA 3SS8A 1E99A 4PHGA 2ZRLA 4MKIA 2VRWA 3A1TA 3PV0A 5B2ZA 3SNHA 1PZNA 3GLIE 3K0CA 4TTRA 2GZHA 4UXJA 3I1FA 1EX7A 4B44A 1OFIA 4KYIB 3IBGA 3QJYA 3W3ZB 4FINA 3WMGA 1FP7A 4M21A 4Q19A 4YQFA 2RB4A 2B7CA 3NHAA 3CKLA 3V00A 2W2VA 1TF2A 621PA 1VYVA 1K6MA 3PCRB 1G18A 3QKRB 3CRMA 2VP2A 4HI0E 2FFQA 1P9WA 2A78A 3CX6A 3NTUA 3VTKA 4ZO4A 4M1TA 4JVNA 5HTKA 1W4RA 2BKUA 1A2BA 3MWKA 3CPHA 4TQAA 2C98A 2PBRA 4M1MA 2PZGA 1LV7A 4KLNA 4B34A 1QHSA 1FX0A 3PJRA 4HUQB 2VTKA 4GFDA 1HURA 5FPTA 3CO5A 4OQXA 2XZOA 2H5EA 3KJEA 1RZ3A 2OT3B 3CWQA 2ZYVX 2OHFA 1R10A 2IWHA 2G1KA 2ANCA 4FCVA 2FWRA 2NO7A 2XEXA 4GOXA 4PHHA 3UIEA 4TYQA 3EX7C 4Y0AA 4PTLA 1MABB 2VBCA 4DSTA 5FR1A 4I81A 2QGNA 2BC9A 1VMAA 4KV9A 3TAUA 2IYUA 3H2YA 3QUSA 2WJVA 4Q47A 2QAGC 5C4GB 3RS4A 2YC2C 4V0MA 3GJ8A 5DISB 4NYMR 3NDBB 4HDCA 1VCNA 2R2AA 1QBKC 2W6IA 4TWZA 1ZM4A 1JR3A 2XXAA 1EFRD 2QM7A 4PZZA 2ORWA 4DZZA 1R0XA 1OKKA 3T35A 5AJZA 3U3JA 4R2IA 3TNFA 1G17A 3K0EA 4FWTA 5JJIA 3H1TA 3T1VA 4ASUD 4DC9A 4YONB 5GJWC 3RS0A 1F2UA 1NRJB 2ZJBA 3NHBA 3CX7A 2VL7A 4MGZR 4RD6A 3KQHA 2NGRA 4Q00A 2G88A 1G16A 5KUTA 2VH5R 2FN4A 4D2IA 4NTZA 4OQLA 1XEXB 2ZITA 5EE0A 1T4GA 4TMTA 3SYLA 2QM8A 4MGYR 2YV5A 4BFTA 3U4QA 1OFHA 1ZVQA 2MSCB 2WWHA 3G82C 4C7OB 1BIFA 3DPUA 4DEYA 3CR7A 3L8YA 3C15C 1Z6GA 1G19A 4BFYA 2QAGB 5A0FA 2W6JD 2FSIA 3UMRA 2C03A 3LVQE 5A4JA 1IOZA 2EYUA 2NO0A 2AX4A 3D3QA 1TQ2A 4MGIR 4MGKR 3X1YA 5KNDA 2ZE7A 2P6RA 1Q3HA 5FOVA 5TVKA 2ZRKA 2UVQA 1ZD9A 1W36B 2NZ8A 4PC2A 4WOPA 2D06A 2QUZA 1F2UB 3EA0A 3OF5A 4KI0A 3LLMA 2OESA 2IYSA 2PZFA 3TE6A 1SGWA 2XXAB 1FL9A 4MQBA 1X86B 2PEZA 4LK2A 2CLSA 4X8OA 2MSDB 5E4FA 2D4HA 4HLQB 1YE8A 2ZVQX 5DLQC 3FFAA 1TQ6A 1P4SA 3BH0A 1NY6A 4CIDA 1T9HA 2RGXA 1DAGA 1CR0A 4TLCA 4PX9A 5E7IA 1A7JA 4NDZA 1TL7C 2MMGA 4ZI2A 1SXJC 1JJ7A 1G9XA 3CZPA 4G1UC 3GP8A 2ZJAA 2CVHA 1M1YE 3VX3A 2GDJA 3RSOA 3KQKA 2ZJOA 1D2NA 2V7QD 2JATA 1RKBA 4KSCA 1HQYE 2JGNA 3CBQA 1UBEA 2ZJYA 3IHLA 3QEOA 4TLAA 3U3MA 4C7OA 3A58B 3LH5A 1EX6A 1ZYUA 4MUAA 1R8QA 4QNMA 1KO1A 5JI3E 1H8HD 1TPZA 1R8SA 2BWJA 1IXZA 1OW3B 1N3BA 1LF5A 2WIAA 3TSZA 4AKHA 1U9IA 4PANA 3EARA 5J40A 1IN5A 1XJCA 4BLPA 1HE1C 2GBLC 1ZUIA 5CITA 1TQ4A 3MSXA 1Z0JA 4Q4HB 3SEAA 5G53C 2Z5FA 3WRXC 1WBBA 4TL8A 4QM6A 1CKEA 2B8TA 1NBMA 3REFA 2WZQA 5CDFA 3LDAA 2V3CC 4B2LA 4OHYA 4LX0A 1RRFA 4ZKEA 1GM5A 1FOEB 3EXAA 4F4CA 4ZPXA 1QHNA 3VU9A 1P61B 4MYTA 1E79D 1DG1G 2FA9A 2DB3A 2WHXA 1N5LA 4DT1B 1II0A 1XTIA 1T8UA 2V8OA 4QHYA 1E0AA 2YWGA 2OAP1 1UEIA 3DKPA 4IOKA 2AXPA 2ZR0A 1BO6A 4M0LA 5DN6D 3IPXA 1Z0DA 4K81B 1GFIA 2FPMA 1D2EA 2J0UB 2C78A 3I5YA 6Q21A 5AJWA 2JJ2A 2VHCA 3BXZA 1P72A 3LY5A 4HLDA 3WY9A 3U44A 3SOPA 4BE7B 3UG6A 3OEHD 3FE2A 1KJZA 4HAZA 4FW9A 4US0R 3THXA 4BUJA 2OZEA 4EPYA 5EJEA 4BQSA 4RCYA 2ZSDA 5DI3B 3PQCA 1XMIA 2ONJA 4KVAA 4W5HA 4CT5A 2FPLA 2CBZA 3E1SA 3WRYC 1UKYA 3HU3A 1JI0A 4HAYA 2ZRNA 3BE4A 1UDWA 4B3XA 4Q01A 4UXIA 4EIWA 3ZVLA 1XXHB 1BOFA 1EK0A 3KZ1E 3QI2A 2O8CB 4BFXA 4ESVA 2ORIA 4YDSA 4YMSA 4B2IA 3K0CC 4OHWA 1E9AA 3I61A 3BAFA 2TMKA 3BFKA 1T91A 4C2UA 4KFSA 4A2WA 2PEYA 2WOOA 3PIRA 1UADA 3GLHA 3TQFA 2IXFA 5IT5A 2ZRFA 3KXIA 5CLQA 3Q5DA 1EFTA 3RHFA 3GLGB 3UK6A 3PUZA 1AM4D 2QTFA 4BWYA 4NPHA 4M8NE 4EPVA 2JIZA 4NCNA 4MITA 4DLTA 3FYHA 1VKJA 4ZDIA 2F1IA 4A0GA 3U3OA 3GLFA 5C2JB 4HYYA 1JPNA 3RABA 2NO9A 1A5TA 1TUIA 5CYOA 4S35A 5GJVC 3T06B 5KDDA 2XGJA 3ASYA 4A15A 3SBDA 1XPOA 3K0AB 1Y63A 4WXPA 2ZE8A 3RWOA 1K8RA 3O47A 2ATVA 3ZYCA 1N2CE 4D6PA 1DEKA 3B1WA 3TQCA 3EIHA 2FFAA 4A8JA 1OXTA 4EFLA 2B6HA 4DLRA 5JLJA 1S9DA 5DYIA 1DVRA 5CLLA 4KFRA 1G3IA 1N0VC 4QBGB 3LAWA 1OYYA
chains in the Genus database with same CATH superfamily
2YXPX 1BWSA 1KI6B 3OLZA 5AVKA 3L7AA 3CZCA 1G8SA 5SYNA 1RPNA 4CMBA 3MWDB 4E1AA 1NUQA 5LR6A 4RULA 2B8NA 3QPBA 4ROTA 1Q1NA 3EFHA 1FNSA 3FROA 2J1LA 5C52B 2I1WA 4OMUA 5KYUA 1NUUA 3QXGA 4IJ6A 3SE0A 1NV9A 2P91A 3ZWMA 3QVUA 4BZQA 2ZR8A 1QK3A 2P9FA 3E05A 4BNMA 3OZ7A 5MN4A 4RFSA 1YVRA 2WUGA 3RAJA 2UXDB 2IS6A 1QG0A 4XWOA 2GRAA 3CUTA 2IZOA 5FNVF 2WG2A 3WBBA 5IJZA 1CF4A 1J5XA 2ZYAA 2I4NA 2DAPA 3AUAA 4F12A 2FE4A 3WX0A 4BGVA 3LNCA 1G7RA 4UCWA 4RVSA 3TQIA 1I2ZA 2A5GA 4OJKA 1L5KA 1X70A 4K6KA 2NUBA 1IBSA 2C5EA 4MIYA 1OAOA 1V43A 3T7TA 2DECA 4INOA 2QN9A 4WVLA 1YU9A 5CIWA 1FNNA 4ZOAA 1XQ9A 3QNWA 3LUCA 1YH3A 3C5WP 4ISCA 3N86A 1FVOA 3D64A 2IUSA 3IEUA 3N2GA 4JLOA 3TLZA 1SNYA 4A91A 8ABPA 1WQ3A 3LPMA 4A0RA 4Z7OB 3SWWA 4WY5A 2CE7A 4MR7A 1OZAA 1TADA 2PWAA 1IY1A 3OCYA 2XCOA 4HNAA 2QT9A 2RH4A 3PUKA 4PNZA 4UASA 2H1FA 5ESWA 1KK2A 4TM8A 4G0XA 5LQJA 1NQXA 2VDRB 5J3JA 3VPFA 3O91A 2OUKA 3E6AA 3SBEA 3WWZA 2C7RA 1KE2A 2VPQA 4PNPA 4B71A 4A8HA 3TKAA 1FYVA 1QHHA 1Y7TA 3Q9NA 3A2MA 3EGWA 3WQQA 3I32A 3T3NA 2VJBA 1OU4A 1LH0A 3SDSA 4YUAA 3GJ4A 3JWJA 2VBGA 3EOZA 3JVUA 5BXQC 2B0CA 2P6UA 2BHNA 4CN9A 5CD1A 1RZRA 1IDN1 3EH1A 1A95A 1E5DA 1FVFA 1NC3A 2AI2A 2HU5A 1QOZA 3C97A 2FHPA 2FF5A 3MC1A 3NEYA 1A8SA 4AJEA 1DPFA 3QLEA 4NV3A 1YSCA 1XNQB 4RGYA 4ACBA 4EB0A 3PHHA 1J8FA 3GRAA 3ELBA 5DGHA 5I3ZA 3WMFA 1LQ2A 4V3CA 3N8KA 1IG3A 2ZI7A 2XMDA 3X1WA 1F5SA 3ULKA 2ZJ3A 1EZ4A 2ZQYA 1I0IA 3OOSA 4L4YA 1MJHA 3I05A 4RJJA 1HK7A 3AUJB 3KQPA 4HH4A 3BKWA 1KAMA 4QC2A 3UWOA 5KMGA 3NHYA 3LNTA 4B1FA 1Q2UA 4DC0A 1RQLA 5FV4A 4GOKA 2XV1A 3MT0A 4HO1X 3HYTA 4L7VA 5EE9A 5H82A 4MA4A 4D3XA 3OFJA 4FS3A 4PAQA 2GS9A 1VKNA 5LQCA 5F35A 5ALVA 4MJ3A 2DR3A 5FO0A 1RC0A 3ZOZA 4LVNA 4CR8A 2GJAA 2Q21A 4QDTA 1SUAA 1PF7E 2ZRHA 4KLCA 1N7JA 1QDLB 4JLKA 3X1YA 3FDIA 3LIPA 1K5DA 2J87A 2D4AA 4UMVA 4U2FA 5K6AA 1E2EA 2ZM5A 1Q95A 5LP6A 4CXMA 4D9EA 4YAEA 1CS0A 3USCS 4R8SA 2ZFUA 3FTQA 2P75A 1WZIA 3IIKA 2ZR9A 3TGWA 3BHMA 3QMVA 3TI9A 3HYSA 1FP4B 1OV4A 1SM4A 1W5TA 1IQPA 1WW8A 1RSZA 2BTQA 2NO6A 3G2MA 4MWCA 1PR5A 4JLBA 3VC1A 4DMHA 1BX1A 1ZINA 2CJWB 2X3UA 3B60A 5FT9A 4F4HA 2A30A 1QVRA 2NUPA 3TIIA 3KUDA 4AKIA 3CEPB 4LY3A 4YIKA 3PUIA 3FNGA 5FOXA 3PG5A 3W5BA 4AN0A 1GL9B 5C81A 2Y9PB 1Y8CA 1I2CA 3RBXA 5KVCA 4C30A 4PSAA 1ZD8A 4WLNA 5JQWA 2V7BA 5C51B 1GOTA 4QXRA 1DUIA 5IP5A 1RWMA 1P1BA 3T34A 5CXQA 1FRZA 3RFFA 4RLFA 1T3TA 1I5OA 4WDRA 3VNAA 4BQPA 3KPWA 3IQWA 4UUBA 1BVYF 1DIHA 4N7JA 5AUQA 3MMXA 5DLYA 1CP2A 5KQMA 2ZDHA 4GG1A 2E1RA 1A5SB 2JD0A 3SLRA 3U7FB 1OWMA 3TINA 4PX2A 1LSOA 2X9VA 1Z0ZA 3FDXA 2HCRA 1TUEA 3PEWA 1BRTA 4KGZA 4BE4A 3PC8C 4RTKA 1JJFA 4OQEA 1JG3A 3FYUC 4JC4A 1LQUA 1I24A 1H4SA 5KSOA 1U65A 5IKMA 1EFDN 2EX4A 2NV0A 3CSSA 3W4IA 4IGIA 4UOQA 3ADCA 3IEMA 3M6MD 4YA6A 1T13A 1MC1A 1Y9DA 3U4QB 1ID8A 4A6XA 1ULZA 4EBFA 5JCXA 1LVHA 1Z07A 3EIXA 4IKPA 3A3YA 4DLKA 3M6FA 4IXMA 4GE0A 5A4IS 4E22A 1NZFA 2OD7A 1USWA 1XMVA 2PMDA 2YFQA 3ASVA 4Q4HA 5FPQA 4YDHB 1IXYA 3V8RA 3A6DA 2X19A 4L6IA 1GAWA 1UPTA 3HR7A 3I3SR 2B4AA 2Q5FA 4JLMA 3PXGA 1O0BA 1Z5NA 2D8AA 3GW8A 3MJDA 3NBXX 5CM8B 4NARA 3STVA 2CNOA 3OHMA 3U4GA 2EX1A 4EKGA 5E3JA 5K6RA 4RTMA 2O8FA 3G2PA 1Y1TA 4G24A 4GOJA 5CCDA 4C5CA 5JAZA 3NT4A 4P4TA 4EG4A 2AMYA 2WSYB 2WWXA 4FVTA 4W4TA 4EUSA 2B8EA 1ZQ1A 3P9CA 2H1RA 4GM4A 5L7YA 2G1PA 4JYPA 3I6YA 5H1YA 3IPRA 3LX5A 2WUEA 3NM6B 4ZT3A 2WHQA 3EF0A 2VK8A 3JQEA 4X65B 3QVLA 3OEEA 3WHPA 1V7CA 2GF9A 3WADA 3ZZMA 3GAZA 5KO2A 4IY1A 1YTUA 1Q1ZA 1KWKA 2XCSB 4W5QA 4P3XA 2IHZA 2JI6A 1G8YA 1WTAA 2O3RA 1L4UA 4I4CA 5BYKA 1F8UA 3HJBA 1O94C 5AH0A 4K2HA 2Q4EA 4LWZA 4OIFA 5FUXA 4BVKA 4QU9A 1RWOA 2YZNA 1WNFA 5I7RA 4AL4A 4MVJH 1PGJA 2G82A 2HLNA 3DH0A 5EZ5A 4MUFA 4H7IA 4HBZA 1J56A 1JGTA 4OXIA 4YHHB 5LD2C 1JEOA 5DMHA 2DHEA 1BMFD 3KFVA 1EFKA 4ZAWA 1WV1A 3FI9A 3LOUA 1JEDA 3QJ5A 4AXXA 3HJFA 5TY0A 3GA0A 1UAGA 2H1CA 3DXZA 4Z86A 1DAIA 3U61B 4ME6A 2PRIA 1U9IC 2QB5A 3Q9SA 4RCVA 1SC6A 2AKAB 3IB3A 4PS0A 3H75A 3R6LA 1WSDA 5AUOB 2I65A 5A04A 2YQZA 4EPTA 3H18A 1KU0A 4JH0A 2HCBA 2Y0BA 5IYZF 3QYFA 4JI4B 2QRZA 2ZIVB 5E9AA 5KX5A 5KTSA 1JHVA 4JD5A 1YR1A 4QUAA 1V4NA 2XUIA 1PLLA 1X7XB 1NIJA 3JALB 4MUBA 3DMTA 4ASUA 2BZSA 4YMLA 1E6LA 1JECA 2ACKA 3RS3A 1WXXA 1JKMA 1YQTA 3W9SA 3EVGA 2QN8A 2HIMA 3MQ2A 3DNPA 3QKRA 3EQ7A 4GX2A 4X84A 4MS3A 2E4XA 2FDCA 4G01B 4GVLA 4NYJQ 5DX1A 3FMIA 1U0TA 4Z7QB 1Y81A 3NNSA 3CURA 1QONA 2KLHA 3BRCA 3SF8A 3T9DA 3UW1A 3V2HA 1MV5A 1QZUA 2RGUA 3SC2B 3ZLBA 4MUEA 4P92A 2R6HA 3ZD6A 1FSFA 2C9YA 1GPUA 3ODPA 3ZHZA 3UEOA 4BNLA 4IIDA 4B5LA 3ZR4B 3ILHA 1CY1A 4JGBA 5GIPE 4DA9A 1MX9A 3GDWA 4JB0A 2FG6C 3K94A 4TWRA 1KI4A 1XVUA 1I6KA 1IY2A 1QHYA 1ULAA 1UXOA 2P0AA 3E5RA 1O95A 3GEDA 4OXKA 5AKEA 4EZEA 4I46A 3GFBA 2BGGA 2ZI3A 3HCRA 3HXKA 5A7GA 2CHVA 3BWEA 3PNQA 4HV4A 2PBLA 5EJ4A 1EXMA 1X1BA 3H6GA 4N18A 3DZGA 1C5KA 3WICA 4KFTA 3TM4A 5AW5A 2W6OA 2C99A 2J5RA 4MJ7A 1YS9A 1RRVA 4MPRA 5DX0A 4BJ6A 2ZI4A 4NPAA 5IYZA 4HG2A 1VMKA 1G42A 1WUKS 2OQ2A 3TOZA 3G0HA 3DS8A 4MKXA 5FI1B 3W6OA 5B4VA 1VP9A 2B4RO 4JN6B 5C8YB 3AW8A 1JSLA 3LK6A 4DG8A 4YO8A 2WYUA 4JLDA 3EXFA 2A0FA 4ZZ2A 1CWUA 4OUDA 3H3FA 1FSGA 2FDRA 1XYGA 1EWVA 2CLKB 4RA9B 3HU2A 3IXLA 1RMYA 1PFVA 3ISVA 821PA 2IYOA 3LK7A 4GVXA 2GCNA 3CZQA 4MKGA 2O5VA 3ZBUA 5IJWA 2H0RA 2JGKA 5TMEA 3OQBA 1IZ9A 3F47A 2O2IA 4Y6LA 3K72B 3RTGA 4DIDA 1QAQA 4QYIB 4TXJA 3AF6A 5KC9A 2GEFA 4UAUA 5A4KA 3FNFA 3ZCVA 4BNHA 5CYPA 2HLPA 1O5OA 2VJQA 3ZGYA 2X0IA 5JECA 1U63A 3ZJTA 1B2LA 5FOQA 4JENA 1OMOA 3MMSA 1RZUA 1RTKA 4K0KB 1KDRA 1VA5A 1V4VA 4B2PA 5ALQA 4YRJA 4LOJA 1T6NA 3L7CA 1OI2A 2JF0A 1TEHA 4K6OA 1K9VF 3RRMA 2JLVA 1QYXA 4IINA 4WMLA 1PBTA 3WGHA 1KYZA 2IUTA 2WFMA 3FB1A 4OB7A 1UT5A 4A0QA 5KHOC 3IUSA 4HJXA 1KE1A 3VR3A 1FQWA 1TTHA 4QOFA 3UB3A 1RKVA 2B3TA 4JLJA 4D1YA 3NALA 1M76A 5D86A 4NMMA 1F06A 3EVDA 3QKSB 1VXRA 3CRW1 4R1TA 4B8YA 1ZM3A 2FFHA 3TDMA 1Z0IA 3E48A 3G9XA 3TEJA 4EL0A 4BO2A 3FJ1A 2HDNB 1EDBA 2HZBA 2K6GA 3VM6A 1M6HA 2YJGA 3BXFA 5CXSA 4QQRA 2DCMA 1HRDA 1ZMOA 2ZTLA 3RBVA 3E7XA 3KQNA 3HZHA 3ICQB 3WWYA 3I9JA 3CUKA 4WECA 5KDLA 3R3VA 2ATEA 4LSZA 4WOCA 1KF0A 2IEBA 1QIMA 1SJ9A 2GI4A 2XWSA 3BMXA 4K9NA 4N5IX 1SKYE 3IUBA 4B82A 1Z88A 3IOEA 3OA0A 1U2RA 4A36A 2NAFA 1JE1A 3BG5A 2PNJA 2HO4A 2XBUA 3BDVA 4HF7A 4MB6A 3TMKA 1SCUB 4R1NA 2OG2A 3OEED 2V7PA 1KOGA 1XD2A 5IASA 1GAJA 2HRDA 5FAKA 5CVUA 4DB4A 2VDWA 2PMKA 3FSJX 3HB5X 5LZ2A 1LU9A 1TF7A 2IYWA 5K0SA 4XUDA 5EUQB 3HMQA 1Y6JA 1Z0KA 3R5FA 1S2MA 2DY1A 3IT2A 3TXAA 5FFMA 3RREA 2QZJA 4R71A 5I01A 4OMFG 3P0JA 3U4HA 1SBHA 2EW2A 1WW2A 5GOZA 4CGZA 4DLAA 1BQ4A 3T61A 1PDOA 1I0LA 2IIQA 2AJDA 3ESCA 3Q2IA 4UCXA 2V6JA 2ZJ1A 4ND6A 4YJKA 3JPYA 3IA7A 2IYPA 4PSCA 3MWYW 5FR2A 4MEJA 4ZOLA 4H35A 1PNVA 3GUUA 4NS1A 4D4KA 4UTNA 4ZVUA 1EGHA 3LCJA 1M1NA 3KLOA 3AERA 3PXAA 1I9GA 3P0FA 5K0NA 1W5BA 1ISGA 4Y2XA 1GZVA 3VI4B 2QG6A 2P9CA 1HLGA 2YJNA 1G1MA 3LXMA 1D5CA 3MTDA 4L1KA 2P40A 2FK7A 2BFAA 1X3LA 4JITA 3A1WA 4YQYA 1G20A 1CUWA 1D4OA 1GPKA 3K8YA 4PG8A 5KYUB 3ZU2A 2RC5A 1FYFA 3B89A 1N2IA 1TU0A 1W5SA 4Z3DA 3CZMA 4FEGA 1RYEA 4CHTA 3EFBA 1FSPA 4FJ2A 4E21A 2UYHA 3QFCA 5HZMA 3ETHA 3OLVA 2QX8A 2L2QA 3C1OA 3KKPA 2BGMA 4DV0B 2VG8A 2WKRA 3I3OA 4F91B 1CY2A 2Z2XA 4Q9IA 4UVEA 5FL7A 2FW8A 5FULA 1H9AA 7GPBA 4ZEWA 3QNUA 4E3ZA 3IL2A 3QZUA 5EIBC 3RU3A 1N33B 1Z4JA 2OOSA 4OREX 4EYEA 1NSYA 3EEYA 4KRYA 2OCYC 1CQWA 1PFKA 2F43B 1TUBA 1IMJA 4YRTA 3SMVA 1JU9A 3F97A 3PPIA 2JJYA 4H9GA 3ROMA 4GOLD 1BDMA 5IX8A 1UZLA 3IUEA 4AO6A 5JWOA 2DH5A 3RS9A 3PQDA 4CCSA 2OILA 3DOHA 4NEQA 1C7RA 2XHZA 3IAXA 2BM9A 2C0QA 3QMMA 1UBLS 5KYYB 5JT1A 1HMPA 3D0QA 2IXBA 1LDGA 4UKDA 2V54A 4KQ2A 4L50A 1YOVB 2HA6A 2ZPUA 4QBFA 5JCJD 4DLRA 1GQFA 4ZOLF 4EUEA 3THXB 4LQDA 2FP4B 3UWPA 1E18A 2A9FA 2Y27A 2CMDA 1IJEA 2X9QA 5BYBA 1JEYA 3O9MA 2G4CA 1MTOA 3E9YA 4MROA 4UHBA 4WE3A 4FDUA 2Y92A 5DWDA 1C9MA 3DTVA 3TS1A 1ECPA 4DQ0A 2QTMA 1G3RA 1OLSB 4P3OA 3BS4A 3C41J 5KTTA 2PSEA 2B2NA 3FKSA 4V0LA 2WKWA 4LOIA 1QCDA 3OAAA 4OK5A 2UZ1B 3G2IA 2FEXA 5FWNA 1BH6A 2XD9A 4BASA 2UYYA 4DSZA 4Q66C 5DNCA 3V4ZA 1MQ9A 4OGFA 1KZGB 1H69A 3CB2A 5CA1F 1E1LA 1I8TA 1NXXA 1S2OA 2IYRA 3L1JA 3O9VA 3QBJA 5HBRA 5EIEA 2CNLA 1UBJS 3DPIA 3CU5A 3UB2A 3AQ4A 4TKVB 2IE0A 3HYRA 5H68A 2EJTA 2P2SA 3FTNA 4KE7A 2XB8A 4MR8A 3U31A 3DFFA 5J58A 4ND1A 3VZBA 2WUDA 4HTFA 5G4LA 3JPWA 4HFRA 3ZS9A 1TB4A 4X85A 3OUTA 3K9WA 2B0JA 5F2KA 3WOHA 3OE1A 5I3CA 4AI6A 3RROA 4PGGA 1SHLA 2G40A 2YINC 3DZ8A 3WLEA 1W47A 2GJ8A 3IUMA 3JAWA 2KPOA 3KQYA 3VGJA 1T0UA 3KYCA 1P2UA 2AMVA 4F96A 3JVIA 3NVMB 2PX2A 1TDJA 1C2TA 1E92A 3SR4A 3VR5H 4KBFA 2MSWA 1MIHA 2ZS7A 5P8WA 1O7JA 1C80A 4CG2A 4EKYA 4DR2B 3O6VA 3B1XA 5DM60 2X6QA 2D8MA 2ZJ5A 1SKUA 3BFVA 3HCEA 3QPVA 4EB8A 2VQEB 1OLUA 1U0BB 2I6XA 3R9WA 2VF7A 3IMGA 3HVRA 4U0KA 1B14A 3D4IA 3C4VA 4XIFA 2QEQA 1ISJA 4MLPA 1KI7A 2HL6A 5TQ2B 1UBRS 2ZAOA 3C1UA 4C4TA 1A9ZA 4C05A 2B4YA 3C7DB 1OXSC 4RPHA 1ZNZA 4L9SA 3W7AA 1T36A 4C4OA 4D4IA 1EFVA 3CLUD 1P62B 1Z4LA 1NPYA 2BSAA 2DLNA 4PFJA 3RIXA 3WOVA 3ND7A 5KSZA 4P5DA 3DJYA 1MX5A 3BB1A 1U0OC 4B09A 2GSWA 2YMMA 3DKIA 3IIIA 2A0UA 4HLUA 4IGEA 4NDZA 4RPKA 2XA2A 4FQ8A 4IUCS 1G5PA 4JP1A 2H1WA 2HTFA 2XZPA 3AOGA 2HPVA 1MCZA 1SQGA 5WRFA 3GPBA 3PITA 4BJHB 4G23A 3LKDA 1M8FA 2AG6A 3BPSA 2C3UA 2QD4A 3COYA 4A73A 3O4VA 2RHJA 3I8XA 1KQGA 4H4CA 4ARZB 2ZANA 2XSZD 4MMYB 5IN5A 5A06A 1A96A 3G2HA 5DPMA 1N0WA 5HKBA 2C7OA 1W2HA 1NQOA 1A4IA 4OQMA 5DNAA 4JODA 5F12A 2GB4A 1LA2A 4V0QA 3ANXA 1TYEB 2Z83A 1HE4A 5K4HA 4B6JA 2L17A 1XD8A 4U2DA 3GEIA 3LBIA 4ETMA 3QOXA 3GOQA 4HSGA 5JBIA 3OG9A 2VUSA 1SVLA 1GGFA 3PRKE 5ICFA 3BN3A 1VGVA 4OMCA 1DRKA 2O52A 4Q16A 5EKSA 1PT9A 2HPHA 4RY8A 4EYSA 3AESB 5LYJF 4PAGA 4Y1RA 2AOTA 2PTGA 3KSAC 2AKEA 3JAMA 1BS1A 3T3MB 5JSZA 5J2TF 1OH5A 3Q10A 3TVTA 4OM8A 4ZD6A 5JFOA 1U0EA 3VKVA 3EAFA 1KBQA 3IIMA 1P2SA 4OKSA 1DMSA 5KVQA 1L4HA 4QPPA 4QTXA 4D9BA 2B3DA 2CBGA 3AJRA 3K5IA 2PCLA 4ZQIA 1OBVA 4BJ3A 2WNHA 1MAAA 3WRYA 5DNUA 3HO1A 3QF7A 4BHTA 1FP1D 3R3XA 3UB4A 3L6CA 3LZ6A 1N8KA 4BRZA 2IDKA 5JJBA 1R0KA 2OGTA 1ULBA 2H00A 2LKDA 1Z4KA 1RPTA 3RS8A 4FGKA 3SSOA 1KZ7B 1HFKA 3EFOB 1E2MA 1YK1A 2IYQA 2WDZA 2OCPA 1GY8A 3WP0A 3NBAA 4JKOA 1VE6A 1DAKA 2J09A 4R3UC 3AUKA 2GX6A 2I7TA 2I1LA 2RGNA 4JB2A 1SXJB 3VH1A 2ETXA 2EKLA 2CKMA 2ANBA 3ESYA 4DJEC 1XMQB 3KYDA 1IG0A 2EU8A 3EZ7A 5F2EA 4J3NA 3T12A 3GI1A 3R9XB 3BWVA 4P8RA 2PIAA 2Z2YA 2YFYA 2WJYA 1FYDA 4LDAA 1RACA 4N3BA 3AZPA 1O5IA 4Q3CA 4PZ0A 3BXOA 3G0IA 1OA1A 3QKIA 5ER6A 2R6AA 1WHSB 2OBBA 1XCLA 1JG1A 4GIBA 4IWNA 5CLHA 1UBHS 1PW7A 1GQOA 1EDDA 1SUIA 2GXSA 2H9IA 4DQKA 3VAAA 1SU8A 5B3JC 3ZCUA 2ZBGA 3JQRA 5GADl 1SCDA 1ES9A 1GKKA 1KYQA 2E7ZA 4NY1A 5DSTA 1LBSA 2PMWB 3MA0A 4FONA 3I9MA 1E3MA 3IV7A 3VPXA 1Y9ZA 4D7AA 4U7GA 1PWZA 1A9YA 2FMTA 1F6BA 1IZYA 1M7HA 2JI9A 3K8QA 1DJPA 1DXOA 4YCCA 5K0CA 4G6ZA 4M1ZA 2KQUA 3JASA 3H0KA 1UJ5A 4GMFA 1FLAA 5CJJA 3REOA 4EO9A 3LCVB 4X62B 2JL1A 3ZZ0A 1ONNA 3N5KA 4YP5A 3BT7A 5I4KA 3LECA 2AOUB 3PC2A 4JT2A 1NZJA 4HKTA 4R01A 5JISA 3PD7A 1IN7A 1VDMA 4H3KB 3UK0A 4EJSC 2GCGA 1S1MA 3QIAA 5KQPA 4FN5A 4G3XA 2I9KA 3B9RA 5DYTA 2CVPA 5LXTB 3U62A 1UZNA 2R6FA 3FVTA 3RFTA 2YZGA 3HUUA 4FCCA 2JFGA 3D0OA 3ZCRA 1QHEA 1Y0BA 5GZ1A 1TEXA 3BZUA 1CDDA 3OEHA 2ZJZA 4F6CA 1PV1A 4ZIRA 4B3SB 2WTBA 3QUAA 2AFHA 4CL0A 1PV4A 3Q6MA 3CZ4A 1AH2A 1F0YA 3GJ3A 3H05A 3H9CA 4GLFA 4MI1A 1RXCA 1GLNA 3Q5EA 2Q5OA 2QTNA 2J07A 3RK4A 2PGOA 4XRGA 1CEQA 1ISIA 3DFUA 1SVKA 1L4EA 2WVJA 3I4CA 2PO7A 3B6EA 2WMYA 3NM5A 3S2UA 2W6QA 3GRUA 4B3FX 3G9ZA 1HYBA 2L42A 4OQFA 2QD3A 3BK1A 1GTG1 2ZBQA 1JDJA 3K09C 2CLMB 1Y6QA 3QYJA 3IHWA 2WC1A 5L4LA 3A6EA 4IJKA 3NYQA 4G4SO 1E96A 1N8TA 4FXPA 1QR2A 1RRPA 4LMAA 5IJXA 1TYAE 2QVBA 1KIMA 3B6KA 3D2CA 3ODGA 1CJSA 3AI2A 5H83A 4CF7A 2V7EA 4CCYB 3VPAA 2YC4C 4XVQA 1NUAA 4OMDA 3MOSA 3QKWA 1E66A 1ZO8A 1NBMD 4MO2A 1GKIA 4UUPA 5H8WA 1B6SA 4Q7JB 4BPRA 4KWCA 4ZEXA 4L3OA 2Q3LA 2NTVA 4RESA 4LHVA 2VSFA 1YUBA 2J0UA 1CQIA 2ZUDA 1WDTA 2WF6A 3DLTA 3OTIA 2DF8A 3HR4A 2VQ6A 3ML1A 4ENSA 4H1WA 2OP1A 2UVPB 3G7NA 1IBKB 4DGSA 4HDNA 1CZLA 3O1IC 2A5FA 2GA8A 4I9NA 3AUXA 2FOLA 2R48A 3ONFA 3EAQA 4Y7DA 1I4EB 2R44A 2A8YA 4G1MB 3NHJA 4GBED 3QVGB 4R8KA 3L18A 4UE6A 1L7OA 3NAZA 3WKEA 2XUHA 4G0ZA 3ORRA 4L8GA 5AVZA 2J9FB 2CFOA 4UHFA 2C2BA 1Q7EA 3HJRA 4LDQA 4ER3A 4CL2A 1LUAA 3DEYX 1T5LA 3LL7A 4E5YA 1QSGA 1EWTA 1QH0A 2R11A 2XH8A 5D3KA 1CIJA 5TF0A 4C03A 3IV6A 5CVVA 4ALMA 3I8OA 4DA6A 5MHTA 3AFIA 2WM2A 3HDYA 5ALWA 2H7CA 4Y6SA 4W5JA 3UC9A 1FQJA 5CIYA 4TZ0A 4A16A 4B47A 5D51S 5I7SA 2GXUA 1UBFA 2X0KA 3R23A 1R12A 2WJJA 1Y6FA 2RGGA 3NHWA 1PVVA 1YR3A 2QJRA 3GLKA 3H1GA 4ZXFA 5ALPA 4M1QA 3Q8KA 1CEYA 1N25A 2AQ8A 1J1IA 5H80A 3WWCA 3A31A 3OZRA 2DFNA 1KYTA 2VKQA 2UUOA 2VJNA 1XZMA 1T3ZA 3PVCA 1E9RA 3ZS8A 4U8GA 4RDXA 4V1CB 2PU7A 4L5IA 2Q1XA 2BVNA 4PG5A 3JQDA 5E7IA 5JG7A 1MAHA 4BZWA 4O8ZA 1H9CA 2AHRA 5KNLA 5ALLA 4RTQA 3BHJA 3D3KA 4HC4A 3BK7A 5KNDD 3MWLA 1R8YA 4HDKA 1Y80A 1XU4A 1QV7A 4L5AA 2R5NA 4P22A 4MRPA 2VJLA 1BXGA 3L8CA 5DHUA 4BV2A 1QKKA 1U3UA 3SIXA 3F67A 4QXQA 3OX1A 4OUKX 4M9SA 3JATB 3REQA 3A7EA 2VZ9A 5IH7A 5C3MA 3RIHA 1QZXA 3S7ZA 3VH2A 3WLQA 3K15A 1WPGA 3RKRA 3GPLA 1AO3A 1F1BA 4A92A 1OREA 1WSBA 4Q9AA 4NESA 3DWIA 4TXNA 2V0CA 1Z0SA 1YDHA 1FS4A 1SKQA 2IGBA 3E84A 5EVJA 1ICEA 3KEMA 3UT5B 4TT8A 2NOAA 5KYNA 4D3SA 4EVRA 3FJOA 4I4TB 5K3DA 1F5NA 1MHTA 2VHYA 3HUDA 4U1RA 2FQQA 4RVHA 2JLXA 1O97D 1A76A 1EJ0A 3WLMA 1ITZA 3G1TA 5ADVA 2ORVA 1KVUA 3VR5A 4KI7A 3WMXA 2HT1A 2Z8YA 4D56A 3ELWA 3ZQUA 3RB8A 3QWHA 1JXOA 3S2EA 3PHCA 2JFHA 2VHXA 1LC3A 2XVZA 2W0SA 1Z4OA 2GD2A 1PT7A 1LBHA 3IS3A 4HQ6A 3O2SB 3O93A 5D85A 1EFPB 3QXSA 5TT1A 1M73E 2W6ID 3OTGA 2P9QA 1ZCJA 1QWSA 1UINA 2ASVA 3CSDA 3FB4A 4CIBA 2OBYA 5AOCA 2Z1DA 4OB8A 4PLCA 2J8ZA 1P74A 5TJHA 2HRCA 4I55B 1VRWA 3BIWA 3VYVA 3AVXA 3GV0A 4LJ9A 9LDBA 3DE0X 2FPWA 2A1TR 2OY0A 2ZJ4A 5DGIA 4C2BA 3WGQA 1AUXA 3I1IA 4PBSA 2WPNA 3QFFA 1IU9A 1SELA 2CFTA 4KHPB 1N5IA 1XQYA 3E9QA 3K9LA 4HEA6 1GYQA 5CA0F 3O3MB 4LPKA 5CPBA 421PA 1FXSA 4A0HA 1SOMA 4P3KA 2QU8A 3RJMA 4I36A 1WB6A 4HY3A 4RHEA 5B64A 3R41A 4EX7A 2XMSA 4BX3A 5KWVA 2C2HA 3H1BA 2I76A 4LBVA 1NW8A 1P19A 3M49A 2A92A 4C3VA 2C04A 4HNHA 1C3VA 2VAWA 3L8ZA 5SZKB 3BWMA 1SWWA 3DC2A 3MOGA 5EPOA 4A8JC 4J8PA 4EW1A 4YP1A 2RHDA 1A8UA 2DWQA 1DC3A 1OIVA 2DSNA 4D96A 4YRQA 5FOUA 5FFFA 1BFDA 4OHXA 2LE0A 1LS6A 1P9OA 1MC4A 4K03A 5AM2A 4L2IB 4AJ9A 4AZ3B 2O8EA 4CLDA 1YO6A 2F1KA 3G5MA 5TF4A 4XWAA 5BV1A 4HADA 1KJ9A 2BI4A 2E21A 4J9UE 4X41A 8ATCA 1M2KA 4R9UC 1Z6QA 4A82A 2HGZA 4XPIA 3I6BA 3SLGA 3L6OO 4E2XA 4A27A 3KUXA 1I32A 4HXGA 5KAMA 3EA4A 1MZPA 2IQIA 4CLHA 5F77A 1SBIA 3PQFA 4DSOA 4WERA 3PXUA 4HB3A 1C0IA 5I9NA 1PD0A 1ILEA 2JLQA 3FYUB 1DC6A 4F9FA 2O1XA 3R76A 3ZXIA 2KWIA 1RVDA 1XZIA 3OU2A 5I7OA 4HX5A 3OCZA 4GQAA 2QJWA 2CDCA 4GKVA 2RGCA 3NCHA 1QMPA 1HYQA 4LHZA 2OCBA 3KBBA 2BSQA 1X77A 3KNZA 4WCVA 3K35A 1R3DA 2VJMB 2FJPA 1B16A 3D54D 2FR8C 5A3RA 2X13A 2BCJQ 3GK3A 3D2BA 3K8OE 5FIUA 3NOQA 3QBEA 5G0WA 2X8LA 1CR1A 4YV7A 2VNHA 4DDWA 5B1EA 2OORA 2VYCA 3VO9A 4EI7A 5BNWA 2QZ4A 2I2FA 2YIDA 3CRRA 3WLTA 3FLBA 5CH3A 3I9KA 4YMHA 4B3GA 4IRUB 2RIPA 3SSMA 2ZRIA 3JQ8A 4QNRA 1DBIA 3X1ZA 1ODJA 1FS6A 4QHSA 3T5DA 4YALA 5AVWA 2CJPA 2ASEA 4XD2A 5A4MS 2SKEA 3KELA 1PJRA 1L3IA 4PRKA 3VKFA 4WAUA 4N47A 4N01A 5F3RA 3AONB 2CJWA 3HKCA 4B0PA 1NP3A 1K63A 3CM0A 2IFTA 1P5ZB 1VG0B 3FXAA 3GT0A 3O75A 4MKFA 1C8VB 3A26A 3AXSA 3Q7RA 1Z83A 1V2GA 4CW7A 2IHTA 2QNIA 3V4RA 3QHQA 7MDHA 4BQNA 3CLKA 4JROA 2PV0A 3GNTA 4EG1A 3K1JA 3LC2O 1XQ1A 3ESDA 3KR0A 3GNSA 2OWDA 3WMRA 1GCIA 1Y42X 4XASA 4ZYYA 3VJRA 1AHIA 1T3SA 1IXSB 1GFWA 3FMPB 4QTUB 4CNBA 4P2BA 4EWLA 4R8MA 3ADKA 4DKJA 3JZMA 3THWA 1RKXA 2R1TA 1L7AA 4IV0A 1SXJD 1A4XA 2GHTA 2AOVA 4HR7A 2D2VA 3B48A 3AG6A 3ABZA 1PNOA 1S4MA 1WE2A 2VLIA 3V6MA 1RWKA 1YL7A 3WO0A 2A5LA 5LD2B 4YLYA 3H9EO 3R24A 3WHKA 4Z8XA 3L06A 2C94A 2WTAA 2ZG6A 2YICA 1S89A 4ENVA 5E8JA 2QOEA 2HJHA 3I8SA 2M2IA 3K6KA 3MTJA 4JXJA 4OLBA 5LZ8A 4I3HA 4R3NA 1HX7A 3IAM1 3KTFA 1BX0A 1B6GA 3FPEA 4JBWA 4EQ6B 3LIIA 1XXLA 3GJSA 3D2AA 1YHYA 2RONA 1CJVC 3QVVA 3M1IA 1U3TA 1U1DA 3HVKA 1KJNA 1PE0A 1JSXA 3JQFA 1K5PA 1JDTA 1G4AE 1P73A 2HV9A 1E1YA 3N7TA 3V4PB 4BNYA 4CL8A 5JCPA 3MERA 4E7OA 1KETA 3IJEB 2FPSA 3VXKA 2YN4A 4D57A 1P1KA 3SBOA 5B6IA 1QH8A 4MMXB 1QQ5A 1SVMA 2NZUG 3KT3A 3NOOA 3LA6A 1N0IA 2R1VA 3QRWA 3TTWA 4YYZA 1A98A 2OCGA 3P2IA 4TM7A 4X1IB 3VC3A 3W06A 3W3AH 4DYVA 3KTAA 2C95A 2OAEA 5LP1A 4N6OA 3AB3A 1N4DA 5KTYA 4XCVA 3EEOA 1WPQA 1XDBA 2VHWA 4JMLA 4MYDA 4I19A 4NAHA 3RRFA 5JJ5A 1FTNA 4X6LA 3GQVA 3LQRA 4JQYA 2BY4A 3I2IA 3R3YA 4NCJA 4YIHA 4TXLA 4GS5A 2YZ2A 2H31A 3H9GA 2QLJA 3GIWA 1YZTA 2NZJA 3P71T 5BN4A 2ETVA 1UFVA 3GELA 3L8EA 1NMEA 4JVSB 1FDTA 4EF4A 3IEVA 3FDJA 2OP0A 3TLGB 4DCSA 5C5IA 1HC7A 1CJKC 2GTPA 3E4DA 4NNOA 3F1KA 3M3PA 3NEAA 4QYMA 3TD6A 1NVVQ 2QTZA 4TSFA 4XJVA 5HJ2A 3OQMA 2DR0A 2FPXA 2I22A 3W2GA 3O03A 2I54A 2ZJ6A 1XEFA 4ZYVA 5JMWA 1DINA 4GDMA 5KKAA 1CU1A 3EEBA 1Q91A 2OE2A 3O4IA 5G41A 3LYHA 2RB5A 3I9NA 1UPUA 5SICE 4JBNA 4OHPA 1U28A 3KKNA 4D4JA 3PX2A 3TOSA 2PANA 3THWB 1A97A 1OIXA 2M6LA 2P4UA 4JUBA 4M87A 2ZIGA 3CNOA 2E55A 4R6XA 1X1SA 3P52A 4NBUA 2LXNA 2X9LA 3AOEA 5JROA 3DZKA 2PN1A 1E7WA 3BMOA 5DBOA 1AKUA 2JLUA 2MYNA 1KYWA 3B12A 3IPYA 3NR2A 5JAQA 5C37A 2NXWA 4ARAA 3ETEA 1Z36A 3AL3A 3UT6A 4KEAA 3QU4A 4QBIA 2QL7A 3V3TA 3VH3A 1IVYA 3FFTA 3WDMA 2BI8A 3ND8A 4LXXA 4Q1CA 4TUYB 4RTNA 4XJSA 3ZZNA 2Z8XA 4LC1A 3THYB 5T4BA 4LKOA 4RSHA 2REOA 3AYZB 3QPDA 2Q6KA 5IK2A 3I6IA 2NVWA 1KAOA 1OY1A 3OI7A 4I8DA 5AW8A 4UPDA 1TEVA 3I1JA 2YIJA 5JS2A 2VQ3A 2O2EA 4AMUA 1AURA 5KWIA 5AOAA 1HOXA 2PXCA 2WF7A 4JI2B 4TTVA 3TQHA 4DUPA 3I58A 2G0AA 4RPGA 1JN0A 4KPEC 4ZVNA 3QU2A 3QMPA 3T7IA 1UKAA 3CV3A 2NXEA 4Z54A 1R0ZA 1QPGA 2DTXA 3ANTA 3SZMA 1GU1A 2EGGA 1AMUA 1E8DA 4JB8A 1N92A 4CMAA 2O5CA 1GDDA 1W4ZA 2R97A 4IVRA 3I12A 5DULA 1WXEA 2G7MC 1C4OA 1FXWF 1H8ED 4N5LA 4NK5A 2FSUA 3PEVA 4NZMA 4PQRA 5A3SA 2AFHB 1EP1B 3NS7A 2WEKA 3H5OA 2VBIA 1MO2A 1A7UA 3C16C 3D5TA 2G3YA 1BE1A 1V7PC 3E82A 4EJ2A 4O2AA 1VRVA 5JSQA 2HEGA 1A82A 3FZGA 4UNRA 1UJ4A 3IAFA 1P3Y1 4G56A 4LRXA 4XVCA 3QQ5A