4QM6A

Structure of bacterial polynucleotide kinase bound to gtp and rna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
b'SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structures of bacterial polynucleotide kinase in a michaelis complex with nucleoside triphosphate (NTP)-Mg2+ and 5'-OH RNA and a mixed substrate-product complex with NTP-Mg2+ and a 5'-phosphorylated oligonucleotide.
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Transferase/rna
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qm6A00
3T15A 1G291 1HY3A 4JVLA 2Y8EA 2ZSAA 4I99A 4PZLA 2QAGA 1NKSA 3BRWD 1RW4A 2QMOA 2WKRA 4AIIA 2FEMA 1AS2A 1VYUA 2QGNA 4BQSA 1A4RA 3P26A 5E4FA 2FDCA 4DKXA 2V8OA 1IN7A 2GCOB 2ZRHA 3QXCA 1FPMA 4UXHA 2ZREA 5CLQA 3QG1A 4ZIRA 3BB1A 1AZSC 2RAPA 5JEEA 3NWJA 5KHOC 1SQ5A 2QT1A 3HYTA 4POAA 1E9RA 3GLIA 2QROA 3CF2A 1R4AA 1Z6GA 2NQ2C 1CR0A 4XJXA 2WTUA 2JIZA 4A92A 2GXQA 4E5UA 4DB4A 4EFMA 3TRFA 5CJPA 1DVRA 5L3RA 2ZSDA 4URWR 3RC3A 2ZS9A 2CL6X 2ZRBA 1P61B 2REBA 1G3IA 1Z29A 2BBTA 3F0TA 4A4DA 2WSMA 4CEHA 3F5FA 1RZ3A 5G3YA 3EA0A 1MO6A 2QP4A 4HDQB 3G82C 3LX8A 3QPWA 4TT3A 3DHWC 5FR1A 1YR6A 3IHLA 3U7FB 1NBMD 3BH6A 2AWNA 4HI0E 1WF3A 1ZNXA 2ERXA 3T1QA 2O8FB 3FOZA 1ZU4A 4KJZA 2B92A 1VMAA 3KXKA 2W2VA 1GP2A 3K0EA 4BLOA 1CR1A 2G6BA 4OQNA 5BYJA 1YR7A 1L2TA 1XPRA 1R2QA 4Q9LA 1AGPA 1NG1A 5EP2A 4TLDA 1Z07A 2IF2A 1YZQA 1KO4A 1FX0B 3FKQA 1WQ1R 1UDWA 3KJIA 5KYKA 4S2EA 3V00A 1US8B 2QM7A 3HDTA 3ZYCA 2PZGA 2ZSFA 3QPVA 1W5TA 4K81B 421PA 5J4HA 1OH6A 2QTFA 3LA6A 4Q9KA 1S1MA 4WOPA 4GSYA 2JLXA 1GIAA 1WE2A 4PAMA 5EP4A 2QE7D 3KJGA 2OUKA 5LBIA 3LVQE 3HU2A 1E2KA 4GNKA 2VHCA 1LB1B 3I3SR 3EZ6A 5IK2D 4ON9A 4MUBA 3H4MA 4G5RA 5A5GA 2GCOA 4QBFA 1E98A 4B33A 3U6KA 1Q21A 3KL4A 5JWOA 1BS1A 2J7PD 2XSZD 4P33A 4HB4A 4JVSB 3AVPA 3K9NA 2B6HA 3G0HA 3UANA 4KHZA 4NBSA 2N1BA 3M0EA 3I92A 4N1AA 4RD4A 4PX9A 3DKPA 2P5TB 2V54A 4DLUA 4IEEA 1NJGA 2HXSA 1JEDA 3MJRA 4J0QA 1HT1E 1TF5A 5IDVA 1Z06A 2G0NA 3AF2A 4LC0A 4DLXA 4OK5A 4LHVA 1MT0A 2EFCB 2WAYA 1ZM4A 4NHOA 1UEIA 2BBOA 4NYJQ 4FXPA 5FOSA 3EPJA 2VLIA 3R7WB 3GJ4A 3CF0A 1KO1A 5AJYA 4QG7A 3EPLA 1A7JA 1DTSA 4O2RA 1R0WA 3AB3A 3MWJA 1XB2A 3DZ8A 5J5CA 3UATA 4K46A 1UADA 2A5GA 2IYVA 2ZI5A 4Q1BA 2O8FA 5EJEA 4PC2A 4DSNA 4UNSA 2ATVA 3I73A 3MCAA 3L82B 1U0HC 2OM2A 4G01B 3VHLB 2ZM5A 1Z63A 2D4HA 1KMHB 1S2MA 4JSYA 4TSFA 3QXXA 4EUNA 2WWYA 2OG2A 4LBVA 3PEVA 4B75A 3SR0A 2QQEA 4I81A 1FX0A 2RGEA 2VPPA 4HZUB 4LHZA 1WB9A 1LV7A 3DKVA 1ZD9A 3OE7A 1US8A 3IPYA 1BMFA 2VF7A 4ZDIA 5JWHA 1EWQA 2Q9BA 1KJZA 1VIYA 2A78A 3WHLA 4LV8B 5DNYB 2FPLA 4DJTA 4DDUA 3PIRA 1NSTA 3HP1A 3BXZA 5A0FA 4MYCA 3GEEA 2XOKD 2BCJQ 2IUSA 4LJYA 1HTWA 1U8ZA 1JR6A 4ZKEA 3KKOA 2Z83A 4A82A 3ZLJA 3VR6A 1DAFA 1E0KA 3EW9A 3UMSA 3EA5A 3QENA 4EFNA 4QBHA 4C0BA 4D2IA 2RGAA 3NHAA 1JPJA 3KQNA 1OSNA 3GLHA 3QXJA 3VU9B 4WW0A 2QGZA 1SKYE 3E70C 3WXMA 2NO7A 1U0LA 2LKDA 1RE0A 1S3GA 4IDOA 3VTKA 1E4VA 3KKNA 4EPXA 1XRJA 1ZIOA 2ZSEA 3VX4A 4EPWA 4KODA 2KJQA 2GAAA 3GQBA 2BWJA 2BHRA 3MWYW 1VYTA 4CEJB 4HLUC 4LX0A 4D4LA 2VP4A 5FBLB 3FKSA 221PA 5DISB 1RRFA 1M7GA 3WP1B 4KLZA 1XMIA 1E0AA 3PXGA 1E1QA 4GZMA 1N6NA 1UAAA 3CNLA 3R7WA 3PEYA 2WPDD 4F93B 3AQ4A 4ASUA 1OH8A 3CNOA 5JSZB 3HU1A 4WVFA 1G3QA 2YWGA 3CRMA 3NG1A 4D4JA 2RHMA 1II8B 3B60A 2WWFA 5DE3A 1UF9A 4HLUA 3AKCA 4Q7LA 1RRPA 5FTKA 3IO3A 4LJ9A 4KBFA 4L8GA 2OCBA 4HAZA 3I72A 1R5BA 4LK2A 4Q47A 3SQWA 1VPLA 2AXNA 3E5HA 5EP3A 1KMHA 3DOFA 4CW7A 1P2VA 2OFXA 4B71A 2C95A 5HZHA 3AV0B 3V4RA 1ZNYA 2VYFA 4HZUA 4MGZR 1GWNA 1KSFX 3KUDA 4URUR 2CNWA 3B1ZA 2OT3B 1QHSA 5H1YA 3IEVA 4LCBA 2J41A 5DYGA 1SVSA 2WKQA 3KZ1E 3GFPA 2CK3A 4WZ6A 2MMCA 2ZXUA 3OAAA 3FGNA 4ZDKA 4KITB 2OLKA 4EIWA 4C30A 2ZEJA 4PPQA 3AF3A 4OBEA 4QKQA 2C03A 2ERYA 1WBBA 3FVQA 1Z6XA 3TQFA 1KGDA 4PC1A 5AUQA 4Q4HB 3DMDA 5B57C 1FFHA 3RLFA 2AN9A 4EJSB 3A4NA 1UBCA 1F5NA 2GVDC 3KB2A 3SOPA 3GLFE 1YZKA 2YC2C 4GMXA 2QN6A 3U60B 4MDFA 3VU9A 3K0FB 2NO0A 1KDOA 4BLPA 1ZMXA 5FUXA 2JDIA 1Z6YA 1OXTA 1GKYA 4TL6A 3SN6A 3M6AA 4O3MA 1CF4A 3ZQ6A 1SVOA 3ZVNA 4RVCA 4P32A 3IBGA 1UBFA 2NIPA 1KDPA 4B76A 5FUWA 2FFAA 4TLBA 3Q7PA 1Z0DA 3K0SA 4Y0AA 2YNMA 4URYR 3KKQA 3T35A 4B2PA 2PCJA 3AVUA 2YJTD 1Z0KA 3PEUA 2C2HA 2H92A 2QI9C 3GFOA 1DEKA 1S9HA 4RY2A 1G64A 1NMZA 4TYPA 4YMWA 2HDNB 4E09A 3GPLA 5JSZA 3IQWA 2QY9A 2B8TA 2G9NA 2ECKA 4DBLC 4BEJA 4BFZA 1OKKA 2AFIE 2VIIA 1JNYA 1SVMA 1II8A 1NKTA 1OYWA 3LV8A 1CR4A 3KDSE 2X2FA 1EFHA 4TQ9A 1RYFA 1TNDA 2F6RA 4IVRA 4IOJA 1N6LA 4QBIA 3BH0A 1OH5A 1QF9A 1KAGA 1ZIPA 5LDDC 3P27A 1S8FA 4HLDA 5CK4A 4CF7A 1J2JA 5FPTA 2F9LA 4DCSA 3H1TA 3ZZ0A 2ZI9A 2BJWA 2J0QA 2QPAA 1IY2A 4LOAA 1NN0A 1T91A 2E9SA 2HV8A 4DRZA 5B64A 1MABA 4NP6A 1Q3HA 3GMTA 4PHGA 4PANA 3PQCA 4US1R 1NVXQ 4DLVA 4EFLA 2EWVA 1OLOA 2GZDA 3WBKA 2WSSD 2AWOA 1E2DA 2ZI4A 3H2YA 2ATXA 4M1WA 5HCIA 4V02A 4ZI3A 1N0VC 1IBRA 2C5LA 1L7VC 1P60A 1E2MA 4A0FA 3PITA 2QMEA 4N0EA 4Q4HA 4ZDJA 2PBRA 3CNNA 3CWZA 2BDTA 2IEZA 4PSAA 5FTNA 4JKYA 3LLUA 5EE3A 2IL1A 4M1MA 1KI7A 3K0FA 1W2GA 1DBSA 1R7RA 1XXHB 3WMGA 1XTSA 4WBSA 4HB0A 5HPYB 3KXIA 2IEYA 1TUEA 2UZ3A 4RZUA 2VP5A 1DADA 2ZJOA 4Q48A 2QAJA 4JLAA 1ZCAA 1RFLA 2HLDA 4ZCMA 1KI3A 3QKRB 1NY5A 1XCGB 2R9VA 1P9WA 1VG1A 4BGDA 2KE5A 2JLRA 2A5JA 2LCFA 2P65A 3RC8A 1GITA 3LFUA 5FPHA 4URZR 2O8EB 4DIDA 1SVIA 1OXXK 2GZHA 3WP0A 5CDFA 4DUGA 4PAOA 3C5HA 4E07A 1JBKA 1PUIA 1BYUA 3LXXA 4QRHA 4PQYA 1RC8A 4A6XA 5SZKB 1P5ZB 2DHRA 2IYZA 4A36A 4W5WA 4KYUA 5KU1A 4D25A 1J70A 1HYQA 2IYWA 2W6IA 3NBFA 2NO1A 1UBEA 1XMVA 2FWRA 4LHXA 4PXAA 1NN1A 1FTSA 1SKYB 1ZNWA 3CB4A 1P7CA 3QQ5A 1T5LA 1NIPA 5L8VA 4FWIB 3LY5A 2V7QD 2YOHA 4OQXA 1W4RA 4DCTA 2IS6A 2BMDA 2FGKA 2PLRA 2UZIR 4H1UA 4R2HA 2FFBA 1P72A 4RJLA 1T3HA 3T1TA 2JLSA 3QVVA 2VP6A 3BS4A 4L4UA 3Q72A 2ZYTX 5G53C 1KO7A 3U7EB 1G7CA 4TN1A 2H17A 3ADKA 2CBZA 4RFSB 2XSZA 5JRJA 2P3SA 3CPJB 1CJMA 1XZPA 2ONJA 4M1YA 1W36B 2QNRA 1G7TA 2XNSA 2GJKA 2JGNA 4AYWA 5TV2A 4KBGA 4L15A 1D9ZA 1KK3A 1KNQA 4Q4LA 4B73A 4BZQA 3SYNA 3E1SA 1HE1C 1ESMA 1Y3AA 4WAUA 2D7DA 1XZQA 3KFXA 1J99A 5J47A 4MQBA 1XXHA 1Q1BA 1RKBA 2WWHA 1EX6A 3THWB 2AKYA 4IDNA 2I1QA 3WMEA 2PJRA 1X86B 5BQ5A 1N5LA 2XGJA 4UXIA 1KYIA 1S1CA 2BMEA 1HURA 4AI6A 3W3ZB 3QKRA 4JT4A 2IT1A 3L0SA 5AJVB 1YZTA 1KY3A 2IXFA 1R5OA 4M21A 4MRSA 5FI1B 1ZYUA 2IYLD 5FPSA 4PPNA 3A37A 3QBVA 4C0AC 1Z28A 2O8EA 1QHXA 2R6GA 1L8QA 4PO1A 3RWMB 5FUVA 3MUFA 4HB2A 4AYXA 2G3YA 4HDCA 1P62B 1YZGA 2JJ1D 3OIWA 4IOKA 4DLZA 1J8MF 1N5KA 4TMTA 4V0MA 1ONBA 2GXAA 3GLFB 2EYUA 2YINC 3NH9A 2WVJA 5KPDA 4E22A 4Q4AB 2UVQA 1BKDR 2C96A 4KFSA 2ZI3A 5DI9A 1J7KA 3B8HA 5UKDA 1AA9A 3IUYA 2PZFA 4Q7JB 5E7IA 1GL9B 1W36C 1VDZA 1R10A 2ZJBA 2FJUA 3D31A 3SFZA 2FOLA 3N70A 2ZYUX 2GKSA 1X8KA 3EZ7A 1E32A 2RGXA 4Q9HA 5CM8B 1W0KA 5JI3E 4RKEA 4OJKA 2X8AA 4TL9A 2GJSA 4JL6A 5JEDA 3NDBB 1QG2A 2EW1A 1SHKA 2VSFA 5EE9A 3AVVA 2IYXA 2YC4C 2C98A 2ZRMA 3C41J 4RFSA 3X1YA 3CRQA 2OBNA 4Q02A 2G77B 1TU4A 2MSDB 3SHFA 4A1FA 5JZVA 1KJWA 2QPOA 3S1AB 4US0R 1SHZA 1FW6A 2J59A 1KI8A 4C0JA 1Q22A 2ANCA 4GI7A 2FFHA 4NCNA 3A4MA 1GSIA 4M1KA 3VAAA 4LGMA 1LF5A 2CDNA 1AS3A 2GJ8A 4NKRA 4MYUA 4KU4A 2PMKA 4Z8XA 3E2IA 1TEVA 4NZYA 2XEXA 1CULC 2Q21A 2RHDA 4G5GA 4OK3A 721PA 4H9GA 4RFVA 4QNMA 3BBPA 1AKYA 1KKMA 2ZRDA 1VYVA 3FMIA 1GL6A 3OEED 2ZR9A 3U3RA 2YZ2A 4Z1MD 3RABA 2FPKA 1PLJA 5IF9A 3THWA 2ODEA 5ANRB 1F60A 2QA5A 3F3YA 1PJRA 1JR3D 2CHVA 3W9YA 2ZUDA 4PTLA 2WJJA 3FHTA 3ZJYA 2JATA 4A2WA 2IYTA 5KNBA 3K0AB 4D81A 1P2UA 2ORWA 2WJIA 3DEFA 5CYOA 2RKOA 2AR7A 4IOMA 1OJLA 3VR1A 4LUCA 1SXJD 1MRNA 1W7AA 1QBKC 5F98A 3LW7A 1CP2A 2A5DA 1UKZA 4QGFA 2GJAA 1JR3E 5HKKD 2J45A 1EESA 2FPMA 1KDTA 3NBXX 1SGWA 3IBYA 1SVKA 2QTVB 3U6BA 5KO2A 3R9XA 2ODNA 2RB4A 1DAEA 2J87A 2O0KA 5TDHA 4DDVA 3GLFA 5B30A 4QGGA 4Q4AA 3GLGE 2K5UA 4IOLA 1U8YA 2J0VA 4PHTA 2VBCA 3PUYA 3AVOA 3P4YA 1VCMA 2XITA 4GPTA 1S3SA 3VR2A 1EFRD 3PUXA 2JLWA 3HPRA 2F1JA 5JHGB 3K09C 3PENA 4HB3A 2HCJB 3QEJA 2D2EA 4QHYA 4A15A 1COWA 1ZM7A 3THOA 1XWIA 4B34A 2F43B 3V4FA 4DSOA 1W0JD 1CKEA 2KSQA 4TMWA 4QOSA 2VRWA 1S96A 1OFHA 5K8UA 4PC6A 1GRNA 2IW3A 3O8DA 4UJ5A 3CZPA 1IY1A 5GADl 1XTKA 4TYQA 4QGAA 3RSLA 3C5CA 1BYIA 4Q4JB 2D74A 1IN8A 4PQFA 3S1AA 4URVR 1DAGA 2NG1A 3PVSA 1WMSA 3W8NA 1AIPA 3K09A 4GRAA 1TPZA 3AVWA 2XAUA 2A2ZA 4WZBE 3U5ZB 3CR7A 4HATA 2A3RA 2IUTA 2JJ2D 2ZE6A 3DDCA 1GVNB 4NYIR 3X1DA 3B7GA 1D8TA 1K5GA 1H8HD 1ODFA 4KV9A 4TTRA 2IS1A 5FL7A 1II0A 2GZAA 2ZVPX 1JXOA 5J40A 3TVDA 4C0HA 4AG5A 2D06A 1MKYA 3KB1A 3W34A 4RD2A 2OO7A 4TL7A 4P3YA 3U61B 3K0AA 4PHHA 4M2LA 4TMZA 4Q1CA 4AKEA 4DLSA 1NN3A 1HA3A 4C0LA 1ZUNB 5FFMA 3RYTC 1TX4B 1TUIA 2XB2A 4EQ6B 1RRGA 2BOVA 3EZ9A 1WDTA 3CRRA 2NOAA 1OV4A 4US2R 1EK0A 4PC7A 2ZAMA 1ZD8A 3T12A 5AK0A 5M04A 3CO5A 2J9RA 4LY6A 1DAKA 1D2EA 1TQ6A 1I2DA 4DSTA 3H0KA 3OEHD 1E79D 1O3YA 3THXB 1E94E 2WWGA 4LYFA 4W7SA 4CT4B 1KDRA 4IVQA 4LJ7A 1OIVA 1E2FA 1I4TD 1M7HA 3TW4A 3AKYA 2CMKA 1LY1A 1NBME 3VMFA 3ASZA 1IAQA 2XJ9A 5TY0A 2VTKA 3T5GA 1W4CA 2F43A 1G4UR 4B2IA 3TUJC 2D7CA 4HAUA 1FP7A 1OB2A 1J8YF 2VF8A 2IHBA 2GK6A 2OAP1 1XMSA 5KNDA 1JEEA 1CRPA 3QXHA 2I1VB 3I8XA 2MSEB 4Q4JA 4FI3C 3BFVA 3A8TA 1IXRC 1YZUA 3RDPA 5EXXA 1N6HA 4TLEA 1JAHA 2PT5A 3DPUA 1KJYA 4ZO4A 5EZ5A 5FOTA 1IN4A 1PLLA 3TBKA 4F4IA 1ZUIA 5BN3A 3LBHA 3UIEA 4ESHA 4B44A 1DS6A 3GLHB 1U2RA 4LSGA 1VG9B 4C0KA 3KQHA 1G18A 1OFIA 4JYBA 4MITA 5FOUA 1F2UB 1S0UA 3CX8A 5FPKA 1LS1A 3LX5A 5DH9A 3AEZA 4GZLA 3C16C 4ESVA 3MMPA 4LYJA 2IWRA 3AKEA 4QJ5A 3B6EA 1X6VA 2CCJA 4CDGA 4JLBA 3B82A 2FSHA 5FBVB 1I4DD 4JJZA 4IHQA 2P6NA 4JL8A 3FYHA 1ZM9A 4RD0A 4IVPA 5C2JB 1GILA 2OSBA 3GJ3A 1Z3IX 2QPTA 3U7GA 1A82A 3PCRB 3ZD7A 3WYFA 2DFKB 4EQ6A 1KHTA 1EFUA 1S9DA 1X3SA 2R65A 3DL0A 3IIMA 4PPFA 1BIFA 1OIXA 3IPXA 3EXAA 3P20A 4YMUA 2WWIA 4NL4H 5F3WB 1ZINA 2ZANA 2ZI6A 3IGFA 2QTHA 2FNAA 3L0IB 2ZRJA 1OF1A 1R0XA 4MA4A 4QL3A 5FBRB 4DLWA 2RMKA 3GJXC 4UQOA 4TZ6A 3THXA 5SZIA 1U81A 4KYIB 5J4LA 3RS7A 1OIWA 2DCUA 1T8TA 2WV9A 3T5DA 2KBFA 5FBQB 3HU3A 3LXRA 3OFND 1AZTA 2VP9A 2D3WA 4TWZA 4XSGA 4B2LA 4HLQB 3EC2A 1KI1A 1N6KA 1E1RA 2H57A 4IDQA 2D62A 3BE4A 6Q21A 4IW3B 3MFYA 1JAIA 2JLUA 2CJWB 4OJQA 1XEWY 3OESA 4FCTA 4LBWA 1H8ED 4YXWA 4EKDA 1E2HA 1KK2A 3T1OA 3NH6A 2V1XA 4WXRA 3SFVA 4M22A 4FMCF 5EXSA 3ND9A 5JJLA 2RGGA 2C9YA 1N0WA 4MYTA 2DB3A 2QQ0A 2ZVQX 1OYYA 3WYGA 2Q3MA 2W2TA 1KO5A 2R2AA 1LW7A 2N46A 4Y0VA 2B7BA 3P32A 3TSWA 1F2UA 1U94A 2W0SA 3CH4B 4OHVA 3B2EA 4W5HA 3DOEA 1ESNA 1HQCA 4JLPA 4EDHA 1PV4A 1NRJB 4MKHA 4Q03A 3X2SA 4KFRA 2ZRIA 3UMFA 1E2IA 3SZRA 2AL7A 3CM0A 4DCNA 3ICQB 2YWHA 5AWFC 2C99A 3U7HB 5EE0A 4ZCIA 3GJ0A 2GNOA 3TAUA 3ZIAD 2Q6TA 1WA5A 3IHWA 2Q0HA 3KJHA 3NDPA 3QUSA 4JLMA 4XH9B 4ACBA 3K70D 4P31A 1Q44A 1L4UA 4FMCB 4ACAA 3ZGXA 4AWXA 2V9PA 4M9ZA 4RZ2A 4LJ8A 1XTQA 3QJYA 4OI4A 1UKEA 1ZP6A 4RZ3A 3TQCA 1R8SA 4I1VA 2Z4RA 4JLKA 3IIKA 4KFUA 1G6OA 4NU0A 4B6EA 4TTQA 2RGNC 4Q1DA 5DGXA 1ZVQA 2GTPA 3SQXA 3AF4A 3UXMA 5GJBA 4RSGA 821PA 1KK1A 5KDLA 3EWSA 1GKUB 1U9IC 2QP9X 2GXSA 3CR8A 4HAWA 1FNNA 2NO9A 5HR5A 1Z5ZA 4WXPA 2IS4A 2BEKA 1MABB 1OXUA 2KWIA 4TL8A 3B9PA 1TEXA 5K8IA 4NPHA 3BOSA 1Z08A 2BBWA 3SJAA 2A7QA 4C2TA 4XD7D 4DIEA 3HWSA 2GEUA 1RJ9B 2GEDA 2CJWA 3O8RA 4DC9A 2RGNA 3P1JA 4QBGB 4G5SA 1C9KA 2H7VA 3EX7C 3ZZTA 2FFQA 5TARA 4YMTA 4B32A 1FUKA 5J4VA 2JEOA 1U9IA 2Z6VA 2GJ9A 3QF7A 2I3BA 4RD3A 3SHWA 2O8CB 2BJVA 2Q3HA 2UKDA 1E9AA 3SDZA 1AS0A 1R5NA 3BH7A 3MGCA 4LBYA 5AJXA 4ZKDA 2OESA 1WBDA 3GLGA 5FI0B 4Q1EA 3RS0A 2W83A 3U3KA 3NHBA 4NCKA 4EPRA 2XXAB 4JLJA 4FW9A 5KOYA 5DN6D 3PUZA 4HAXA 2ZAOA 1Y63A 4XVRA 1IY0A 2QMUA 5D3QA 2RGBA 4NH0A 4ARZB 4W9MC 4UJ3A 2FSGA 1KTVA 3GEHA 4C7OA 1GOTA 4OK6A 1FUUA 4B3XA 4LC1A 1ZC4A 3I1FA 3IIJA 1NLYA 4LPSA 5G40A 1Z2AA 3T61A 1TAGA 1AQYA 4B6FA 1R0YA 3TAHA 1E96A 2R6DA 1DE0A 3NEJA 5FR2A 2YKGA 1G4AE 2JLYA 4BFYA 2C9CA 3MLEA 2XNDA 4D4MA 4GBMA 3CWQA 2W6JA 3CUEF 3GJ5A 8OHMA 1XTIA 5K8LA 4PZZA 4X8MA 2AFHE 2E1RA 3MD0A 4F4JA 2PCLA 4M9QA 3SS8A 4Q00A 5FH9A 5HCNA 4F7WA 1G16A 2G1JA 2ZIAA 2ZR0A 2A9KA 3HPQA 4IXMA 4PHFA 3A1UA 2ZPTX 3LWNA 5C18A 3NC0C 1Z0JA 3ASYA 3UPUA 3SE0A 2X19A 1Z22A 4MH0R 4DDWA 2FF7A 3PUVA 3SJZA 4I1SA 4WA7A 4L16A 1RJ9A 2JIZD 3TNFA 3O8CA 3TR5A 2GHIA 4S35A 4BFWA 4M53A 2W58A 2B7CA 2FZLA 3B1WA 4MGIR 1A5TA 3BB4A 3N2IA 4UNQA 2O8CA 1N6OA 4TT3D 1NVVQ 4GOKA 2OE2A 5FTMA 1GKIA 5FPYA 3RAPR 1YZNA 3PEWA 1KSJA 2O5VA 2VH5R 5KSYA 3I8SA 2XXAA 2ODBA 3BB3A 4LBZA 2WICA 1OHHD 1U99A 2XB4A 1NBMA 4BASA 2HT1A 4JVNA 4ARZA 1H65A 2A5YB 4M9XA 4MGYR 5JWRA 1FZQA 1UBGA 2DFNA 1BOFA 5SZHB 2C8VA 3VFDA 5EP1A 1P2TA 4X8OA 1D9XA 3GD7A 3D8BA 4C9BA 3DZDA 4FCWA 1D2MA 4LDJA 2FEOA 3ZVRA 2H1LA 521PA 3TJZA 1DELA 3FFBA 1T5IA 4R71A 4ZI2A 1E6CA 2AXPA 5F9HA 1C1YA 3W8RA 3CF6R 5JCPA 4DB2A 5FOWA 3GFTA 4Q7KA 3MSXA 1FL9A 4Q7MB 1A1VA 4IKEA 4Q19A 2IS2A 3CX6A 3FMPB 1OFTA 4X8LA 2QE7A 1DAMA 1UDXA 3CIOA 4Z51A 1HEIA 1DAIA 1G5PA 2NGRA 4A2QA 3WHKA 4JMPA 3WYAA 2BKUA 2OCAA 5IK2A 2R6AA 2OFWA 3A6PC 4LYAA 3VKGA 3GJ7A 2BVNA 2CCGA 5AR1A 1QHNA 3UWKA 4AURA 3RS5A 2PEZA 3A58B 4KI0A 4OYHA 1XCPA 1T3SA 4A8JB 2J7PA 4FINA 4OI2A 1P9NA 3I32A 2YYZA 4YC7A 2IC5A 3K9GA 5HE9A 3EARA 3RRYA 3M4YA 3DVLA 2QUZA 3MWLA 5LD2C 1OFUX 4JBYA 3ZD6A 1RYHA 2ZE8A 3EPHA 3RS4A 1Q20A 1E99A 1KMQA 2HF9A 3AVQA 1I4LD 3CH5A 1GG2A 3GP8A 3ZDQA 2X1VA 3EASA 3NEYA 4C3ZA 4D0LB 5KNCA 3JZAA 4OHZA 1K8RA 4JS0A 1ZCBA 2L0XA 5GJVC 1GRQA 3BIFA 1ZUHA 4GP7A 2XTNA 4G5OA 4FN5A 4BFUA 1E0SA 3FWYA 3D7MA 3TUZC 2OEPA 3RSOA 2EFEB 2G83A 3AM1A 5HE8A 2IYYA 3MRSA 2ZRFA 1YE8A 3PG5A 1DARA 3RRZA 3X1XA 1VCNA 2P6UA 5DHAA 2DFTA 4TSFD 3VQTA 4PC3A 2O0HA 1E4YA 4XTRA 5FTJA 3GEIA 1OW3B 3VR3A 4ZDWA 5DI3B 5L3SB 4G3XA 4TMXA 1C4OA 2XX3A 1JXMA 1K6MA 4FD2A 4KO8A 3OE7D 1BMFD 3QG5A 5D3MB 2Q9CA 1W46A 1KAOA 4MUAA 2YOFA 3ZZUA 3J81k 1CIPA 1Z6TA 1AK2A 3OFNA 2IYQA 3FHOA 4BFTA 1R6BX 4AD8A 5E95A 4E03A 2OBLA 2ANBA 4EAQA 3PJRA 2ZI7A 2G0TA 1AM4D 1VTKA 4TYYA 3CW2A 2VQSA 1RIFA 4ITRC 4NYMR 4A8JC 3A1VA 5CB8A 2JJ8A 2ZQ5A 4HLCA 3SEAA 1ZC3A 1ZJ6A 1FQJA 3PUWA 1T6NA 4K8OA 2JA1A 3CRVA 1XP8A 2R8RA 2WKPA 4P0TA 2R6CA 2XOKA 4GOJA 4BPBA 3U2QA 2KB0A 4JT2A 1BO6A 1JALA 2HXYA 3BFKA 1E2GA 5GJWC 4AYTA 4A0RA 5BXQC 2WIBA 3LQRA 5EZ6B 3RNLA 5KSZA 4FIDA 5JS8A 3RS3A 1S4QA 1DO2A 4OHWA 2IBMA 1CLUA 1M8PA 4JKIA 4F4CA 3IEUA 1XEWX 1JECA 2ZE5A 3MWKA 2EWWA 1XFAA 2GRJA 3D6TB 3SYLA 4A8JA 2XZLA 3FKSD 3QF4B 3FPAA 2ZJYA 3KJEA 3K70C 2Q9AA 1NF3A 4DXAA 4KAXA 4RD6A 4R9UC 2WBLC 2R44A 1E1QD 1WCV1 1P4SA 1IN6A 1N2CE 1GNQA 1KSHA 3T34A 2OAQ1 4ASUD 1GFIA 1G8GA 2FN4A 4U5XA 3I5YA 1GRRA 1EX7A 2QRZA 1V5WA 4HYYA 2CCKA 1X8LA 2W2XA 1RVDA 3N2EA 4LJ4A 4NONA 3NKVA 2HYIC 2WWWA 3QKSB 4PFSA 4WZAE 3AF0A 1ZW6A 2HJVA 3R9WA 2WPDA 4BLRA 3AP1A 1NLZA 1M34E 2H8KA 1W49A 1R8QA 2PX3A 3C15C 2PEYA 2GF9A 4M4SA 1NP6A 3UMRA 2R6FA 2VHQA 4D0GA 3TE6A 3QIAA 1TQ4A 4A9AA 1E2QA 3FB4A 4GT1A 5DI3A 3UK6A 1W4AA 2JCSA 5L3SA 2OFOA 3P4XA 1CEEA 3TLXA 2CNWD 2QBYA 1KIMA 5D3MA 3IDQA 3WRXC 3LLMA 2C77A 4D80A 1TADA 3W5IA 1JJVA 4HUQB 4JBXA 3UWOA 3ADDA 3OAAD 1XJQA 2PJZA 2F1HA 1MO5A 1BH2A 1CU1A 1XCMA 4BRUA 5E7MA 2CL0X 4RCZA 3JVUA 1UJ2A 1TL7C 2HUPA 4BFVA 1TU3A 2FV8A 1UEJA 3RS2A 4ZPXA 3T1VA 4TTPA 2OHFA 1SXJE 3DO6A 1NL3A 3GJ6A 4DT1B 5KTYA 1NI3A 1W48A 3EIHA 3R8CA 1P2SA 5BWMA 2Z4SA 1XPUA 1E2EA 3RWOA 4AK9A 1UPTA 4CGZA 1EG7A 2D2FA 1QHYA 1KNXA 4KLNA 2GILA 2JAQA 2JDID 4KFTA 3ADCA 2QG6A 2CXXA 1OT3A 2ZJ2A 1P75A 1CR2A 1V43A 3A1SA 3IKJA 4MGKR 2V1UA 2O8DB 1OPXA 3RRNA 4B48A 1LTQA 1VHLA 2QRNA 1FMLA 5CJ2A 3BFXA 3EIEA 3TSOA 3B85A 3AUYA 1LNZA 3CBQA 3L8ZA 5DN6A 2WOOA 3A1WA 3QF4A 1P6XA 3Q7QA 2SHKA 4BZPA 2OCYC 4DEYA 3OZXA 3QSYA 1X8JA 3VKWA 2I4IA 4AC9A 4M8NE 4DLRA 2QAGC 3FMFA 1JQLB 3TSZA 1OXVA 4NCIA 4QGHA 3BWDD 3AGPA 3AVXA 2FE4A 1G8YA 2F3TA 1OKKD 4Q18A 1CJUC 1GDDA 3HJNA 1ANKA 1E2PA 1QDEA 4A6PA 1F48A 3QKSA 3CONA 3BK7A 5C4GB 5DIFA 2GCNA 1XPOA 2PL3A 4TZ0A 3TW8B 1FMJA 2ZUCA 2DWQA 1SULA 4U02A 4MRNA 2VSXA 3EZFA 4LPKA 3NTUA 2X77A 3LNCA 4JL5A 3WMFA 4JVMA 3ZS8A 3B13B 4PO9A 1Z83A 3Q3JB 3PR1A 1KK0A 1Q57A 2BM0A 1GL7A 4AKHA 5FTLA 2BMFA 3QY0A 5F9FA 1X1SA 2F3RA 3L43A 1G5TA 4ZV4A 5E7JA 1E9DA 4D0NA 1G19A 2QP3A 4HUQA 1AGRA 1KO8A 2IF0A 2GBLC 4OI1A 1HUQA 1YJ5A 2YVUA 4ILEA 5AUOB 1W47A 3LDAA 2AK3A 2WSSA 5CB6A 4B3DA 4XWKA 3ND8A 2P5SA 1TQ2A 2HJGA 3KX2A 4BLTA 5H8WA 1KI4A 1NY6A 1YKSA 2ZRAA 2PX0A 4BFSA 5H70A 4DT1A 2V3CC 2GEVA 1QG4A 4TYWA 3I62A 1QHGA 3UG6A 4RD1A 1G3RA 5JMTA 1ZNZA 1M74A 5F2EA 5P21A 2GBLA 2WJVA 3L8YA 1LS6A 1RPZA 3WNCA 4V0OA 4GP6A 2Q3FA 3ADBA 2O8DA 2HLDD 2G1KA 2F1RA 3TVTA 3AP3A 2DY1A 4JJKA 4IDHA 5BW8A 1UKYA 4QM7A 5EQTA 4EPTA 2ZYWX 5AUPB 1T9HA 1ZBDA 1OE0A 2WJYA 1OHHA 3U3OA 5H68A 3SJBA 1EXMA 4DUGD 1NVWQ 2PLFA 1GUAA 5B2ZA 3ZH9B 1ZU5A 1D2NA 4L9SA 5BYKA 2J7KA 3CLVA 4I1UA 3QVUA 4M0LA 2QSYA 4P4UA 1KZ7B 1GTVA 2ZETA 1CXZA 1Q1ZA 2J0UB 1SVWA 5JJKA 2W6ID 5C1BA 2DYKA 3IO5A 2O0JA 1LF0A 2DFLA 1WP9A 3ICEA 4GMDA 5CDFE 2ORIA 3SBDA 4M9SA 1ZAKA 2ZROA 3H84A 1XU4A 2ZJAA 3W3AA 2RCNA 1IJEA 2EVWX 3WNDA 1CS4C 3O47A 1FOEB 3EZ2A 2WJHA 1YRAA 4OL0A 1AJEA 2IXGA 4PQRA 2V7QA 1D6JA 4C4PA 4I1OA 2IHYA 5JECA 5AUNB 4MRRA 5LPNA 4Q66C 2ZRLA 2CVHA 2OLJA 3BJIC 3HR7A 3G5UA 4LYHA 4OQFA 4Q1FA 5L3QB 3I5XA 2IK8A 4JLVA 3C14C 2VL7A 5DHFA 2DBYA 2GF0A 4CRWB 1TF2A 4Q9IA 1N6RA 3KQKA 3OIYA 1DPFA 4UNPA 2NMVA 4JLDA 5GJCA 2EYQA 2QSZA 3K1JA 5AJWA 1M7BA 4DCVA 1E3MA 1G8FA 1U90A 3VNUA 1FP6A 1II9A 2JASA 4F91B 4XIGS 3RANA 2ZUBA 5KPJA 4HEJA 2XTZA 4FWTA 4M1OA 2BMJA 2ZITA 4R2IA 2WZQA 3NBYC 1GNPA 2FA9A 4AY2A 1N5IA 3THYB 2ZU6A 621PA 1M2OB 5DLQC 2AKAB 4G0NA 2QZ4A 1YU9A 3SBEA 2ZU0C 1AN0A 5KUTA 2IUUA 4MDEA 1KOFA 2OILA 2EU8A 5EXTA 2QU8A 1XXHE 1NMYA 2BKEA 1G1MA 4M1SA 4BZXA 1W5SA 2GWHA 4C0QC 1Q1EA 4A2PA 5L3VA 1XEFA 4DZZA 4TLAA 3BGWA 2Z43A 4G1UC 2A5FA 2VO1A 1XTJA 4YDHB 3OF5A 3R20A 1KI6B 1D5CA 5CIWA 3R9IA 3SI7A 5IRCD 3LW8A 5JRZA 4TYNA 4B3GA 2IA5A 2F7SA 4EPYA 1SXJB 4CZ2A 3GLGB 2XJ4A 2EQBA 2J0UA 3ZVLA 5GVRA 2ZRNA 3ZVMA 4FCVA 5C46F 3U44B 1XDBA 4QNRA 3TR0A 3W6OA 4D26A 1G6HA 1L4YA 3GJ8A 4A0HA 1WXQA 2JJ1A 2QMHA 1XD2B 2V6JA 4L9WA 3NXSA 4B3BA 4BEBA 3TUIC 2EFDB 3VX3A 5CIQA 2CE2X 3JZMA 4Q21A 1OXSC 2PMDA 4C7OB 1KKLA 1N5JA 4DSUA 1MRSA 1ZM3A 3QKTA 3U3JA 2FG5A 1W44A 1G8PA 4V0ME 4ERNA 2O8BB 1NMXA 1YHNA 1U0JA 1W0KD 2B8WA 2NZJA 1G9XA 1XX6A 3EIQA 3FHCB 1M1YE 2AHOA 3CRW1 1FQKA 2CEAA 2BEJA 4AKIA 1R0ZA 3W90A 2Z0MA 4IFBA 2QORA 3BD9A 2CL7X 1IM2A 1HV8A 5L3QA 1AQUA 4TMKA 2MMGA 3AGQA 4L5BA 5JI2E 1W36D 3QNUA 4Q5IA 4IXNA 4FMDF 3IQXA 2JLVA 1JJ7A 3DMNA 4AKGA 2ZS7A 2J46A 2VEDA 4DLYA 3UKDA 4IEIA 4LHWA 1XEXB 2NO6A 2IWHA 3W6NA 2REOA 2YWEA 4GDFA 1SVLA 4NYJR 1YR9A 4C2UA 4KXFB 3SU8A 2ZRCA 4YMSA 4XWOA 1E2LA 4BRWA 4QXAA 3VKHA 3LVRE 1T8UA 5AJZA 2BBSA 3EAQA 4RCYA 5CITA 2OV2A 2WIAA 3LO5A 1Q12A 1G41A 3TKLA 3THYA 4NMMA 1SXJC 1YR8A 3QOFA 4QFMA 1G5RA 1T3LA 1FNMA 4R98A 5FL3A 3OEEA 3KUCA 4YLGA 3VR4A 4NE2A 4Z1MA 2VHTA 5C4MA 4LJAA 5DSZA 4BECA 5EE1A 1JR3A 4P4TA 3QEOA 4PPGA 3W6PA 3REGA 3I61A 4LI0A 2VSOA 3RHFA 4FMDB 1KI6A 4G5QA 4JZKA 3K8YA 1RRCA 3D3QA 2NPIA 3K9HA 1SXJA 3X1WA 4MRPA 3MAAC 2XZOA 1IN5A 4C0SA 1IJFA 1E2NA 3LD9A 2IX3A 4BUJA 2CE7A 3U44A 1E9CA 5HKKA 3Q5EA 4B3FX 4JLNA 4MRVA 4JYCA 4PO8A 1XD2A 4YMVA 3TH5A 3VR5A 1CTQA 2QENA 2V4ZA 4YDSA 1B0UA 2P6RA 1JPNA 1COWD 2JLQA 1ELOA 3KKPA 1G7RA 2EFGA 2O8BA 1Z2CA 1DG1G 2J3EA 1Z0FA 3C7KA 3AVYA 1Z47A 2AD5A 4LZZA 1IOZA 2KI5A 3B78A 5J4KA 1EFRA 2X2EA 1ZD1A 3RVBA 2P2LA 3CPEA 3A36A 2B21A 3NC1C 4Q9JA 3SC3A 2VA8A 1MO3A 4B47A 1CBUA 3QKUA 1W0JA 3H86A 4UXJA 2AK2A 3BORA 3LRPA 4CEJA 1YRBA 4XWAA 3Q5DA 3NVAA 1Q1QA 1CRQA 2BIFA 2W0MA 1XBTA 4XVQA 1XEXA 2JLZA 1KY2A 1QZXA 5JHHB 1QHIA 3ETLA 3KQLA 3B1XA 3DM9B 4RZXA 2N42A 4GFDA 4DHEA 5ELXA 5FL7D 2GAOA 1KSGA 3O8BA 1UKVY 1NLFA 1FTNA 2CLSA 2JJ2A 3Q9LA 1G20E 1E9SA 4LRWA 4CIDA 1XTRA 1ZM2A 4KSCA 4DEXA 1N25A 5FBWB 1H8HA 4CVNA 2WMOB 1G3MA 3FFAA 4JLOA 2ZJ5A 4URXR 5KDOA 1GM5A 4B3CA 2CLCX 3N5CA 4IRUB 1XJCA 4V0LA 1QRAA 4TQUS 1DG3A 3LBIA 4KVGA 1G17A 3GLIE 1P9RA 4LV6A 4O2LA 2PZEA 3AF1A 1F2TB 4EJSC 4ZCLA 3L2OB 2KBEA 4XTCS 4QHSA 1MR3F 2P67A 2HT6A 3IILA 1Z6AA 2FSFA 3MG9A 1IQPA 4PAQA 4WIAA 1UFQA 4KCGA 4R7ZA 3WNBA 1QVRA 4YONB 3B5JA 2IXEA 3HR8A 5KDDA 5LD2B 2WWXA 1G3UA 2LKCA 2H5EA 1XD8A 3QPUA 2VP2A 2J0SA 1DAHA 3AVTA 4EPVA 4V03A 1ZRHA 4NDZA 1N0UA 1E9FA 2OXRA 2C9OA 3VHXA 1QHHB 5TB5A 3REFA 4OHYA 3CKLA 4EJSA 1KI9A 4II7A 3NBZC 3OEHA 1E79A 3TMKA 2DPXA 3A4LA 1F6BA 3C8UA 3U3MA 5LB2A 3WY9A 4LJ5A 1TMKA 5BN5A 4HZIA 4OHXA 4MKGA 2P0EA 4TMVA 1NSFA 2WHXA 1E0JA 1NIJA 1SKQA 1T0JB 1VKJA 4NYMQ 3TIFA 2QL6A 3CX7A 3FE2A 2ODWA 2YWFA 5CLLA 4A0GA 4V0KA 1UM8A 2C78A 1F3OA 1TTTA 1NJFA 4B43A 5CM9C 2OCPA 3CZQA 2V55B 3WBJA 1NN5A 2F1IA 2OBMA 2H16A 2GK7A 4JBWA 3SJCA 1AKEA 4YQFA 3I4LA 2J5XA 4B35A 3C4JA 3MJHA 4XSHA 3RRMA 1IXZA 2Z5FA 2ZTSA 1SZPA 4N0DA 4NTZA 5FOVA 3L0OA 3OIUA 2ZJZA 1VG0B 2E87A 3ONWA 4KSBA 4CEIB 1E2JA 1VG8A 3HYRA 4AG6A 4HDOB 3AP2A 1N3BA 4HAVA 1T4GA 1MH1A 1Z0IA 1XMJA 2BC9A 2GDJA 5DYIA 1Q3TA 3ECCA 4LJ6A 1F2TA 2ZJ8A 1PZNA 1GZSA 4QC2A 3OIVA 4DLTA 2TMKA 4D82A 2RH5A 2RGCA 4FMBB 3KXLA 4BLQA 5K8TA 3AH8A 4UNRA 1OH7A 2NZ8A 2C04A 3K70B 4GOXA 4DWJA 5KSOA 5KSPA 3B9QA 1A2KC 4PZYA 4QJ4A 1N6IA 2YOGA 4D6PA 5JCZA 2F9MA 2WMNB 3PV0A 2FH5B 3BAFA 4HSEA 1XNJA 2ZSBA 2FMXA 2FGJA 4UNNA 3EPKA 2GA8A 2ZRPA 4BWYA 2V6IA 3UG7A 1VIAA 3F8TA 5JJIA 4DVGA 1QHHA 1DO0A 1MV5A 3QE0A 1NVVR 4B74A 1E1RD 2QT0A 1N6PA 2FSIA 2QBYB 4W5JA 4F92B 1NG9A 2XTMA 1U8AA 3BC1A 4PR0A 2NPFA 3K0CC 5JLJA 2GETA 2IYUA 5CK5A 4DDTA 3KFVA 4YXWD 4MKIA 2RGDA 3R8FA 1PLKA 2ZS8A 4LWZA 2DWOA 3QBTA 4IJMA 4OQLA 4Q1AA 4X8HA 3LH5A 3KTAB 4V0NA 5FUYA 1OB5A 121PA 4H1VA 1JQJC 1I2MA 4GL2A 4I4LA 5EUQB 1H8EA 2WOJA 1IXSB 2J1LA 4XOIA 4CYMA 3KQUA 2GVZC 1CJVC 5A4JA 1J90A 1E69A 1EWRA 3K0CA 3U4QB 4DCUA 4NCHA 1HH4A 4XVUA 2PH1A 1EFTA 3WRYC 1XD9A 4JSTA 4UKDA 3EC1A 4MKFA 5EE5B 1YZLA 4P4SB 4CT5A 3PFIA 3X1ZA 1KZGB 2ZYVX 2HF8A 2CVFA 2QM8A 1W2HA 1YVDA 3GLHE 3LBNA 2IYRA 3L0PA 3LQQA 2ORVA 3KKMA 1CJTC 4CEIA 3SYKA 2HEIA 1TF7A 5HTKA 4QM6A 1W1WA 5JFGA 3GCGA 1O87A 4IDPA 1G7SA 3AUXA 4QHTA 5LB4A 3W5JA 2GESA 3VNVA 1E9EA 1JI0A 4NYIQ 1IHUA 1LFDB 4BE7B 1XJ0A 5IT5A 2LWIA 1CJKC 3A1TA 3ZIAA 4D4KA 2H18A 3TGPA 5CYPA 5IHPA 1Z8FA 1M6NA 1HQYE 1P3JA 4KVAA 1TQDA 1HE8B 2W00A 3QXSA 1X1RA 2DR3A 5TXGA 4TLCA 3EG5A 4O25A 1DOAA 4M1TA 2YV5A 5EXPA 5JBQA 5B58C 5BN4A 3TK1A 2ZR7A 2QAGB 3T06B 4PSVA 3Q85A 2F55A 5SZJA 2WJGA 1VHTA 2O52A 2CLDX 2BV3A 2FZ4A 3AKDA 3Q8XB 2PT7A 2MSCB 2ONKA 1EGAA 1PUJA 2VHUA 4ABYA 4ZIRB 1HT2E 1VCIA 1KI2A 2CK3D 2FX3A 3K9LA 1A2BA 1NVUQ 1U98A 4Z8YA 4OI0A 3GLIB 2ZE7A 2R62A 4F38A 1ETUA 3NIBA 1LVGA 5FOXA 4U00A 1G21E 3KTAA 2WAXA 4XD7A 3M1IA 1VECA 1W4BA 4Z54A 5DO9A 2EFHB 2BM1A 2VHJA 3FMOB 1NNEA 4U7DA 1P73A 3OHMA 1XF9A 3B1YA 1MO4A 5GVSA 3QI2A 1EFCA 2FU5C 3EWAA 4HAYA 2AD1A 4O0MA 2CHGA 4N3NA 1IONA 4CEHB 4LV5B 4TQAA 3LAWA 3JVVA 1GNRA 4Q01A 1B23P 2NTYC 2HCBA 2GXUA 1Q0UA 3U4QA 4NCJA 1YQTA 1JB1A 3CPHA 2DWPA 1E9BA 2A30A 2GCPA 5EUMA 4P4SA 5E3HA 2CHQA 1VCOA 2ZRKA 1WRBA 2OXCA 5G3ZA 3FDIA 1QVAA 5HZKA 4OQMA 1GAJA 1K5DA 2G88A 3DM5A 1PVOA 4QJ3A 4OKSA 3FTQA 4IFEA 1Z0AA 1G8HA 2XZPA 5TVKA 4PSKA 4HUTA 4MYHA 5J4YA 5JS7A 2BCGY 4JIMA 2AX4A 4BLSA 2OZEA 2XNDD 3SNHA 3B1VA 2WM9B 3BERA 3ZS9A 3ZQJA 2W6JD 1MOZA 3K53A 5G41A 2YHSA 2ZRGA 2IYSA 3V9PA 2REXB 4BFXA 2HYDA 2QEQA 4RKFA 2VP0A 5TMPA 1T0HB 4LHYA 2ASEA
chains in the Genus database with same CATH superfamily
3T15A 1G291 4JVLA 2EJCA 1UK8A 2ZSAA 4AIIA 3S81A 4N12A 1BWQA 4YDRA 5EJ8A 3FDXA 5CYFA 4MLDA 2QGNA 3BKWA 3DEAA 5E4FA 1N7IA 4DKXA 4LMPA 3QVOA 1YQWA 2GCOB 1T9CA 4KACA 5D7NA 5AHWA 4UXHA 2I76A 4H15A 2ZREA 5CLQA 4IHKA 2CLHB 2YHBA 3G8BA 4K9KA 3CA8A 1M6EX 2A86A 2RAPA 4MHSA 3ZE1B 5JEEA 1CJBA 3NWJA 2FFJA 1RTTA 1JSLA 4UBKA 4DJDC 1QXSA 2QT1A 3HA7A 2FX5A 3EXEB 4RPHA 2L42A 3G6KA 3GNSA 3GLIA 1FRVA 4N47A 1R4AA 3TINA 3TRHA 2ETVA 2HIGA 3TZQA 3FOWA 3I9FA 3U9TA 4AF8A 4DBLE 2WTEA 4N8SA 4Y30A 3TDNA 2WTUA 2GPWA 3VH4A 4EMUA 1ETHA 1DVRA 1MTOA 2ZSDA 3I05A 4RMGA 4KR6A 1WD5A 4I1IA 4OFBA 3F6PA 3WB2A 4PF1A 4ZT5A 6REQB 2W4QA 4JUAA 2REBA 3TBHA 4AULA 4UCFA 4CEHA 3F5FA 1BJTA 1RZ3A 4W9NC 1IFXA 5D1NA 4JI0B 2Q0QA 3FYSA 5HFAA 1XWFA 2PMFA 3LX8A 3RAGA 4A03A 5ALVA 3SQNA 1E60A 1HNZB 3DHWC 2QJFA 4RAQA 5A5DA 5HKBA 4HI0E 1WF3A 3ICCA 1VP3A 1IVYA 4JY7A 3T1QA 5TQJA 4UPEA 2FDXA 2X0IA 2WF7A 1Z6QA 2OPHA 3IR6A 4HYEA 4CCWA 1VMAA 1KMIY 4INAA 4JC0A 4QEZA 5K1ZA 5SICE 1ILEA 1ZJ5A 7REQA 2DR2A 4DA0A 1L5WA 1CR1A 4JX8A 1YR7A 4P58A 4PBRA 2J30A 4AO7A 4Q9LA 1XPRA 1DL5A 1AGPA 2WTXA 3HKCA 2IF2A 5TPWA 1YZQA 4MAAA 1MJ5A 1FX0B 2EGHA 3FKQA 2UXCB 2Z4TA 1PO7A 5ALRA 4DBZA 3OP4A 4ZA2A 1RAFA 4R2WA 4G4GA 5DPMA 2IBSA 3ZW7A 2QM7A 3UV3A 3FBTA 3R3SA 1A9RA 3PD0A 5IAEA 3KKZA 1P39A 1SOUA 4TKUB 4U8HA 1ENZA 421PA 1GPDG 2WY2D 2RHOA 4WOPA 3A31A 1K6EA 4GSYA 3SSNA 3ENVA 5JLAA 1QWOA 5FHRA 1GIAA 2EBWA 2WA1A 2X7JA 3ZBPA 2JLXA 5JANA 1ZLYA 2B37A 4YFYA 1OREA 3A6DA 5LBIA 1T1JA 2NVUA 1LB1B 4B4KA 2NU8A 2WUWE 3EZ6A 4ON9A 3F3SA 3ZLBA 4WNYA 2QJWA 2XODA 1EDDA 2VC2B 4IGFA 3DG9A 5KVCA 1U8FO 3O26A 4AFNA 1IK4A 3FCOA 3O75A 4CDRA 3GYGA 4ABTA 4AMVA 1X7WA 4BMVA 4B33A 2HQBA 3I9V1 1H1TA 1UBJS 1XP5A 3SS9X 4H7FA 3DOJA 1AKUA 5I7AA 3OY7A 1CEEA 3AVPA 2FRDC 2B6HA 5I4CA 4GUDA 3UANA 5A03A 3LHDA 3VDXA 2AOXA 5FV4A 2N1BA 3M0EA 3DBLB 1DTWB 4N1AA 4PX9A 4FYXA 4TVSA 1QUFA 3HKDB 1TRHA 4MVCA 4HRVA 2HXSA 3P2YA 4RQUA 4GNRA 4J0QA 1HT1E 5IDVA 5LC1A 1YDWA 1Z06A 3CPSA 4KQCA 3VBCA 1XQVA 3WWPA 4OK5A 1MT0A 2EFCB 4R7TA 3WWCA 1ZM4A 4UMFA 2H2GA 4LFBB 2BGLA 4PYMA 1VA4A 2VLIA 3IPRA 1T9AA 2AIRA 3R7WB 3U80A 5A62A 1KO1A 1VKOA 2X86A 3QVWA 5ALGA 4QTYA 3SKVA 1JT2A 4O2RA 1Z5VA 2J8ZA 3X44A 4AQDA 4V3BA 3FRHA 3PDJA 5J5CA 1MG0A 2BKXA 3CTMA 1UADA 3AL3A 2JGKA 4EQZA 2W4IA 5AKLA 3GEGA 4PC2A 4U6SA 3VR3D 1TA0A 4RDIA 2A9RA 4TS1A 3WO1A 3IP5A 5JH7F 2YZGA 1A8QA 5C8YF 2WM2A 2D4HA 2J31A 2WFAA 1JA9A 1KPHA 2XIQA 1E5XA 1BCRB 5T4BA 3QXXA 1ZOIA 4EUNA 5B1IA 4TXNA 1EXNA 1JHRA 3MT7A 1JR4A 1MJFA 3PEVA 3REQB 4NHEA 2RGEA 3OU6A 1SQFA 1T35A 4I4IA 3MWDA 5MFPA 2HDOA 2I34A 1UWCA 1ZD9A 2W6PA 2XQGA 3D54D 4OMFG 2OHOA 3LG2A 3SVZA 2C7VA 3IAXA 5LQDA 3PF8A 1BMFA 4WDRA 2R8YA 1OY1A 1LLCA 1YTLA 1XMOB 2I3AA 1KJZA 1YA8A 1VIYA 2A78A 1UPUA 4LV8B 2FPLA 1EP2B 3DWEX 3PIRA 4X20A 5AKZA 2Y1DA 4GSKA 5EERA 2OXEA 1DKNA 2VJMB 1PJCA 3H19A 1I1HA 4KN9S 4UCWA 4B7AA 1NVFA 3WAJA 4MULA 2JG3A 1WUTA 1QMPA 4LE1A 3GLSA 4DIOA 3F47A 4JZYA 2V7EA 3C3AA 4KLRA 2C7OA 4QWWA 2Z83A 1TD9A 1DAFA 2A7XA 2DECA 3MIIA 4RHCA 4NDNE 5HYVA 4H59A 1FZTA 3ABQB 4C0BA 5AJUA 1USUA 4R2LA 1D0SA 4ZQBA 1GNLA 3GD5A 3SICE 1RE0A 2ROQA 3L06A 4NLLA 2JGAA 4Z0TA 1T43A 1Q92A 2R1ZA 1E4VA 1JTVA 3KKNA 3SIWA 1N7HA 3TD2A 1O6BA 1XRJA 3I39X 3PHBE 4RK1A 2ZSEA 5EESA 3A4VA 1LNQA 4TS4A 4KODA 3Q7EA 2KJQA 2PZJA 3MWYW 5TQ2A 4ZZ1A 4EM6A 4G8BA 3UJCA 4Z53A 3IT0A 3A9RA 1M2HA 1QP7A 5FBLB 3ZDDA 3EXIB 3WP1B 2D5CA 2C2GA 3TOVA 3PA6A 1AV6A 2KX7A 2XYGA 1MU0A 2YFQA 1E1QA 3I52A 3IV9A 3ND6A 1UAAA 3CNLA 1TEZA 3NVMB 1IQUA 2XNKA 3K9BA 2C57A 4HAOA 2HHLA 4F93B 2D3TA 4ASUA 3TOZA 1B74A 3CNOA 1OH8A 4RDXA 1QK3A 5A4IS 3RUPA 3NG1A 2BEVA 3BJZA 4OJMX 3E8MA 4UVEA 4B82A 4D4JA 4EJFA 2WWFA 2G7MC 3S27A 3WADA 3RK4A 5LXTB 1O97C 1RRPA 5FTKA 2BFEB 4LZAA 4OHUA 4L8GA 3H1PA 2HMUA 1FLDA 2WYVA 4BVLA 3ABOB 4UZFA 4G0WA 5JZMA 3TRDA 2FLVA 4MR9A 4NJEB 1V6SA 3GDWA 3GVHA 5BNZA 4WMLA 2HCFA 2HRQA 3U3ZA 3DOIA 5HZHA 1R8XA 3NI2A 1AXGA 2HHHB 2CNLA 2E6UX 3BT7A 3N2GB 1C8BA 4FVTA 4R1SA 4CJXA 3OZCA 2IXAA 1KVQA 2V5AA 3OQPA 4BQNA 3B1ZA 5D5QA 3F73A 2OT3B 2IGTA 3UC5A 1E5LA 4QZVA 5IAAA 1QG6A 3I53A 3TTWA 5EIWA 2B6NA 3P94A 4YAOA 1SVSA 5B53A 5C35A 3HO8A 1HGXA 3KSRA 1SG6A 3ANNA 2CK3A 2OBYA 2MMCA 1EX9A 1F3LA 3PL1A 2FPGA 2AHRA 2FEXA 5ES3A 2EJVA 1XVLA 3AI3A 3OZTA 5I9MA 3QLEA 4PPQA 4C30A 4PG7A 3WLTA 2GCEA 2IOQA 2KLHA 1WVIA 2G7ZA 2YWJA 2YY7A 2K87A 3R8XA 2HB6A 3O94A 4BYMA 3FVRA 3HR4A 2OYCA 2PA0A 2PUGA 3IMCA 1P45A 5B57C 1FFHA 3N2YA 1PZEA 4FOOA 5IXSA 2PNFA 3B2NA 4M0MA 4QQNA 3TLCA 1O9BA 2GVDC 3KB2A 5CFZA 2CN1A 1WABA 4ZOQI 2YC2C 3WNZA 2JFZA 4BLPA 4CQNA 2Y66A 2JAOA 2NACA 3F5SA 2JDIA 4FGZA 1YACA 4EB8A 1PFQA 1SK9A 2NYRA 4GICA 5J3JA 1OI3A 1Y5RA 4L6CA 4NU5A 4PYNA 4JXZA 2CHEA 2QLBA 1NBIA 4U2EA 3ZVNA 4NFSA 4RVCA 5MDHA 1ECGA 1UBFA 2J4FA 1DT3A 2NIPA 4GX1A 1LLQA 1X87A 3EXG2 1XF1A 2FFAA 2H29A 1CY0A 3MYRA 5AT1A 3K0SA 3N58A 3LFHA 5AP9A 5BQPA 4YP1A 2QN9A 3Q3IA 4NICA 4UU1A 1HC7A 5CGZA 2YN0A 1HZZC 4EMBA 3NCHA 2W8BB 2QI9C 3GFOA 1DEKA 1YRWA 3P0FA 1G64A 4TYPA 5BYAA 3IPLA 2EW8A 4RBNA 4EY7A 5JSZA 2QY9A 3HEMA 2ECKA 4DBLC 4BEJA 1SPXA 1OKKA 3WGGA 3CUKA 3W05A 1JNYA 2AJDA 1SVMA 3EULA 1M2GA 4J7XA 1Z7BA 4Q34A 2D1TA 1U1GA 2GNPA 2AZDA 4RPKA 3DOUA 4TQ9A 3IAUA 1RYFA 1WPGA 5IJ9A 2F6RA 2ZB4A 4IOJA 1N6LA 3BH0A 3SC4A 2HM7A 4QDUA 1E8DA 3WICA 5LOVA 2G5GX 1I01A 1ZIPA 4V38A 4NEQA 4GKVA 1CYEA 1BWRA 3P27A 2UUPA 2F9LA 1KDVA 3H1TA 1PG0A 5KKNB 5B2FA 3IB6A 2AN5A 2Z9BA 5IANA 3CINA 5DW3A 3QOWA 3HTXA 2WYUA 3BEOA 4RVSA 3N2KB 1YDEA 2AXQA 2E9SA 4HXYA 3I1IA 3PFCA 4NZOA 2GNAA 2OK7A 3IMGA 5ALMA 1BOOA 3CZRA 4BO5A 5CD9A 3GDHA 4DQDA 2KW5A 2R1TA 1BXZA 4U5QA 2JJQA 2EWVA 4BUZA 4AZ0A 4ZYTA 3N0XA 3RT9A 1AX9A 1P6QA 2ZWIA 2ZI4A 2ZUTA 3RBZA 1AK9A 1MORA 3VVCA 3ZVKA 1N2SA 5HCIA 4YIHA 3Q2KA 4V02A 2JI7A 4KZKA 4WESA 4ZI3A 4AZ3B 1DUIA 1TVCA 2R8ZA 2PS3A 2Q1YA 3TOCA 1P60A 1E2MA 4A0FA 3PITA 2DT5A 3ITDA 3QOXA 4DARA 4N0EA 4OYRA 4QASA 4YLEA 3CNNA 2IHKA 1QFZA 4G5YA 3V6MA 3ZCQA 3H99A 1AK1A 3HFGA 3S2SA 3D4PA 1O1YA 5FTNA 5HIAA 3LLUA 2VRCD 1J1ZA 3ORYA 5EE3A 4M1MA 4IVNA 3VJRA 4HZGA 1K2WA 1Z7GA 1W2GA 1HQKA 3NLLA 1ULAA 3TR6A 1XTSA 2HHJA 3ZWNA 5A02A 4WJLA 1QIGA 1TUEA 2FQXA 2UZ3A 1GV1A 1H66A 3JD3A 4EG5A 2VP5A 2WFLA 3KAKA 1RM5A 4JLAA 2BLLA 3WL7A 4ZCMA 1U1CA 4ZK2A 5ADHA 2Q07A 3QKRB 2HIHA 1MDFA 2BGKA 3KR9A 3F6CA 4P98A 2YHIB 3ICWA 2QUAA 1KZHA 1VG1A 2IPNA 1CDOA 4F9TA 3U0VA 3HJFA 4DR4B 5KU7A 3KHSA 1GITA 4LVUA 2F8TA 2J9XB 4I3GA 4QELA 4EGQA 1EUDB 4ID3A 3NCTA 4PZUA 1CQIB 5JT1A 4MV9A 4B3RB 3GRFA 3VSAA 3CCBA 3C5HA 3NPMA 3PQ2A 4C4SA 3LXXA 3NGLA 3PKIA 5KJCA 4HEA6 1NC1A 2HIMA 4Q82A 1RC8A 3VO2A 1YZ3A 2DHRA 2HSGA 1QUEA 3H9GA 4MI9A 4CMCA 4KRFA 3H4VA 3UPTA 5C0OE 5JNRA 3NEAA 3X0DA 5CEJA 1RWXA 2VZ8A 3C1AA 2YFKA 2IYWA 3N0VA 3PE3A 3NBFA 5DTJA 1H1LA 1M1YB 1UBEA 1XMVA 2FWRA 4LHXA 1L7EA 3AOEA 1FTSA 5BUSA 5AK6A 1DWOA 4LQ4A 2C2KA 3QQ5A 4FQ7A 4Y2TA 4XRGA 1NIPA 1GYRA 1QX3A 1NQVA 1Y8RB 4HRXA 4MS4B 4P7KA 4Y1FA 3KU4A 2RI6A 2V7QD 5L8VA 1WEKA 2PLRA 4IUDS 2UZIR 1TLTA 4H1UA 3LQ4A 5HA5A 3KK0A 5B5SA 3UHJA 3W79A 2QHXA 4D4HA 3T1TA 2JLSA 3AERA 3BS4A 5IAOA 3PPVA 1AGYA 2ZYTX 4OJNA 1KO7A 4HEHA 4YCDA 2H5JA 4X6YA 5F4BA 1S2NA 1CCWA 3V7FA 1KEEB 2H17A 1G4HA 1YJBA 2XSZA 2FAXA 2P3SA 5JRJA 1V45E 5ILOA 1RZRA 2D0PB 1XZPA 3E0QA 4HTFA 2FQYA 4CCAA 2EL9A 1SG0A 1NQUA 2I91A 3VH1A 2OL4A 3HVRA 4R3NA 3K6SA 4UZSA 3P96A 1P44A 1KK3A 5I7FA 4BV3A 4UFOA 5K45A 3SYNA 1P1CA 1V1MA 3VSBA 4BX0A 5GZ3A 4G0YA 5HP4A 2FP4A 4LGCA 2MSKA 1BS2A 2CDBA 3KU1A 1RADA 4MP8A 2VH2A 1TOAA 4TV8A 2B1RA 4MQBA 4BQPA 1XXHA 2G72A 3NETA 2WWHA 5IBRA 3GCZA 1EX6A 4ADSG 1JBQA 4K6MA 2I1QA 2PJRA 3GC6A 3DPSA 5BQ5A 3DMFA 4D79A 4UHDA 2HJWA 1R3UA 4JR1A 3F74A 3USZA 1I7PA 1RHQA 1YSCA 3WLPA 4A27A 2HKIA 3AHDA 2HRCA 1KAMA 5SV2A 4JT4A 4PG4A 2DH5A 4F12A 5FI1B 3JZFA 2IYLD 2G4CA 3GLKA 5BR8B 3RE1A 2VJDA 3AEQB 3F7TA 2LGJA 1WZIA 3D3WB 2PT6A 1Z28A 3U17A 3BN3A 1SA0A 2O8EA 1QHXA 2R8XA 3PC3A 4C1NA 4HB2A 1RVV1 3L93A 3D7SA 2CFOA 4P1ZA 1HE5A 2PUJA 4H6XA 2RKBA 2JJ1D 4NESA 1M66A 4HRAA 4LOIA 5J63A 3NVDA 5J59A 2P4EA 1N5KA 1EFVA 1JPVA 4OXYA 4TMTA 2GARA 3CVVA 3C6XA 4KXVA 1IZ9A 1XKTA 3KTFA 4V0MA 1ECJA 2C7PA 1JFFB 5KTRA 2HU2A 3N59A 2UVQA 1J7KA 1TCCA 1VGQA 1AA9A 5UKDA 2OV6A 4KAAA 2I99A 3A3KA 3HDQA 1QKJA 3SAJA 3D31A 2FOLA 4GX5A 4DC0A 2QUHA 4DG5A 4DV3B 4R9NA 2AQIA 2E89A 1FLNA 3LVBA 2ECOA 1N8KA 3KHTA 3WRYA 1XQ6A 2RGXA 1M1NA 3NBUA 3G8YA 2W2QA 4YT5A 3CBGA 3QFFA 4K6GA 1TGVA 5CTJA 4XGIA 4RKEA 4G9GA 4BMOB 4OJKA 2M6RA 3NDBB 5JEDA 2OOSA 2YHAA 2QIPA 2ZBFA 3ZIUA 2DQYA 2XZTA 5EE9A 4AO6A 4KXYA 2IYXA 4YGXB 4E14A 5AD1A 2C98A 2ZRMA 1DMSA 3GB9A 3TZKA 3CRQA 2G77B 2D5AA 4A1FA 3S1AB 3QEMA 1YE3A 2OZKA 4US0R 1FUYB 1QYDA 1SHZA 2CNBA 1E4EA 1KI8A 2Z6QA 4KGVA 1GY8A 1Q22A 3A4MA 4TV9F 1K0FA 1GJRA 1S2GA 3SCZA 3N8GA 2CDNA 2GJ8A 4JODA 5G0WA 4MPPA 1UFRA 2FEKA 3OFVA 1PCXA 4EO7A 3BK1A 3C48A 4G5GA 1GUYA 3WLEA 4H9GA 3R09A 4RFVA 3BBPA 2EF0A 1BWPA 2CXOA 2V59A 3EGXB 1ZR4A 3RF6A 1Y9ZA 5JSQA 3FMIA 1TQHA 3OEED 3LBYA 4CM3A 4IGIA 3HHEA 3WS7A 3BIOA 4OQQA 1YL5A 1JDBC 3RABA 3K5IA 5IS2A 2ODEA 3PWKA 2H2IA 1AO3A 2QZ9A 1F60A 1NV8A 5GGYA 1P2GA 3F3YA 3LCVB 2PU5A 3W9YA 5AKKA 3FHTA 2VNHA 3ZJYA 5JR3A 1O57A 2JATA 1NU6A 4JHXA 4A2WA 5KNBA 2IH2A 1I2ZA 4DPKA 2WJIA 5CYOA 1AZWA 3VR1A 2IV2X 2B2CA 1J21A 1QBKC 3JQAD 2HBRA 3JV7A 4DQXA 2UDPA 4S2UA 1GQOA 3GUUA 1ZN2A 4Z4FA 5HKKD 2Z9CA 2C94A 2IY9A 2FPMA 1SGWA 3IBYA 3VVLA 3U6BA 1I9CA 3R9XA 2ZIVB 4BO7A 1L5LA 1VL2A 2L18A 3LXMA 2DUMA 1NYLA 4HMPA 1V8ZA 4QGGA 3W78A 3PPXA 3DNMA 1U6JA 2K5UA 2CUZA 3H75A 3HL0A 3U7QA 4FBMA 4E5SA 1H0KA 1R6VA 4LHSA 4BVAA 1PJAA 2VBCA 2XQFA 3PUYA 4OBWA 2RGRA 2EZ4A 2H54A 4J1SA 1EFRD 1FFSA 1ZGZA 2HGSA 4H3SA 4XQGA 1IHPA 3HPRA 3IOMA 3AL0C 1Z18A 4HB3A 3HNPA 2HCJB 1U3CA 3RYFB 2P1ZA 4EYKA 1ZM7A 1C3EA 3THOA 2P8SA 3EH1A 4P5PA 2GPSA 3P9YA 1U3VA 1EAMA 1DLIA 2KSQA 2NV0A 2V7VA 3B1KA 3HUFA 3QKWA 4TMWA 4V0RA 5K8UA 1GRNA 3DZJA 4AN4A 5BVGA 5KZMB 4UD6A 5ESRA 1IY1A 5PGMA 4Q93A 3U0BA 3B6IA 5GADl 3OMLA 2DHQA 2O5EA 1RWMA 3RSLA 2E49A 3WNVA 4BCCA 4DM4A 2VK2A 3UBMA 4ENWA 1QZZA 3ER8A 2I8AA 4M8IA 1O0SA 4I3FA 1L3BA 3W8NA 3IUNA 3K09A 1LRLA 1BA2A 4K9QA 1TPZA 1PR9A 5JD4A 3AVWA 2A2ZA 4WZBE 3E4CA 1FJXA 2WIGA 4H16A 4PX2A 1GFWA 2A3RA 3RR2A 4D43A 2C0PA 2CWDA 2XCOA 2EEZA 2Y0DA 5JCJA 5LBUA 1BNCA 2JVJA 3I9JA 3MT9A 3OTWA 4UMDA 2CKMA 4CKBA 3X1DA 4DOMA 1T0IA 2PYZA 2IXTA 3B7GA 1H8HD 1AB6A 4M36A 5F1PA 2Z30A 3P9KA 4GL4A 2IDZA 3OSUA 4UVGA 5ALWA 3ZX4A 1CT9A 4B6JA 4DNPA 4F7DA 5IC4A 4B85A 2UYQA 2ZVPX 5DASA 4X1KB 3AW8A 1F8XA 2QNIA 1AXEA 3KB1A 5BURA 2VDWB 3JR7A 2BGNA 3TSYA 4AJKA 4PHHA 1ZK2A 4PCVA 4DLSA 5DP2A 1YU6A 5H9VA 3FLBA 1ZK3A 4HQLA 1H5NA 1U3FA 2HRZA 4X93A 3U31A 4B8ZA 1CUDA 3ESQA 5FFMA 1XZKA 2WFZA 3IXLA 1T3GA 3RYTC 2V7GA 2Z5GA 4O5AA 1TX4B 2WYHA 4E5DA 1JLLB 2ZSKA 2HN9A 2V8BA 3SSOA 4EQ6B 5KMGB 3OQOA 2XB2A 3GPDG 1XC7A 2G1UA 2O8VA 3SEFA 1ZHOA 3I1YA 1U6KA 2Y0CA 5KOHB 3KTOA 3OX1A 1O94A 4LNUA 2CZGA 3TZLA 3OT1B 3PHJA 1UJMA 4MVYA 3T9AA 2ACKA 5LIRA 3UKJA 1XQ9A 3AG5A 3FWZA 1D2EA 1PAUA 2JBAA 3N8KA 4M8SA 5EWMA 5KYUA 1OZFA 3H0KA 3G2OA 3OEHD 4F6CA 4MUIA 2Z95A 3TZCA 1BE6A 3V3TA 2ZW9A 4AO8A 2B83A 3LCRA 3QFSA 3HCRA 1GTRA 1Q16A 1NAHA 4CT4B 3HCAA 4IVQA 4LJ7A 5KYYA 2VDLB 5K3CA 4R5MA 3FLAA 4D8VA 1LY1A 3OHSX 2DUUA 4NEHB 4B3SB 3DZKA 4ALLA 2GQ0A 1KOJA 3IIIA 3LS2A 4NFYA 2XJ9A 5I47A 5KQMA 2RI0A 3VDNB 1W4CA 4IJ5A 1GSAA 1G4UR 5CHEA 3WWDA 2HLPA 4F0JA 4Z6KA 1PWYE 2QMZA 4O02B 5KTTA 3EQ2A 1CRPA 3M3PA 3QXHA 4KQ6A 3E9NA 1Q0PA 3EUEA 2DFDA 4Q4JA 4FW8A 4UUMA 5CW1A 5M29A 3OCZA 1EDBA 2P4HX 3G1TA 3PQ6A 1IXRC 5EVCA 3F2VA 2J33A 4U3JA 5ESXA 5EXXA 4NZNA 4S3MA 4ZO4A 3EVDA 1ZUIA 3LYUA 5BN3A 3IKTA 1DKPA 4RY0A 4KR3A 1NI4B 3VM6A 4HDMB 4D7AA 1UC4B 4E70A 1DS6A 1UJBA 4LSGA 5DP1A 5K3BA 2QOEA 4ETIA 3QKIA 4ALKA 1NYTA 5ETJA 1DFIA 1F2UB 1QIDA 5AVZA 4WX2B 1S0UA 3CX8A 4JITA 3RRXA 3GCDA 3JASA 4V1CI 4XEUA 2HWXA 5DH9A 3WLNA 1QTQA 4GZLA 1Z7EA 2YMQA 3DBHA 4Y6PA 3MMPA 1LX7A 3S0JA 4ESVA 1L8LA 1B14A 1QFJA 5CLIA 5AI6A 5TQ2B 1NLMA 1O6ZA 4GM1A 4OV6B 3W06A 3NHLA 3DD5A 3TI7A 1FYXA 4NZ9A 2ZXFA 4KQGA 3HGTA 3KOMA 3G5LA 3RTEA 1Q7RA 3VZBA 2COEA 2R85A 4JLBA 4CMJA 3F8SA 3SC6A 3L0CA 1EIWA 4JJZA 4LQLA 3EOAI 1TCAA 3PJFA 1QGZA 1I2CA 4JL8A 4A73A 1ZBQA 3DT8A 1NQXA 4IVPA 4RD0A 3SZOA 3UJ9A 3K73O 2OSBA 3NBKA 2HBQA 2BF4A 2BN4A 5JTUA 1AQLA 2W71A 2BGJA 2RH8A 3UK0A 3WYFA 1KHTA 1MAVA 3ZD8A 1YB7A 3D43A 5DU2A 3ED5A 4C03A 5CX1A 1BQEA 5CVJA 1CJSA 1OIXA 3ZIDA 4IZOA 4OMCA 5IN4A 1O4VA 2PD4A 1WKBA 2QV0A 3OLZA 4F8EA 1SU4A 2WWIA 3EQ8A 5F3WB 2ZI6A 3IGFA 4KQ9A 2AJLI 5DBOA 1YHYA 4TZ6A 1Z5OA 3P7MA 2RMKA 4UQOA 5FBRB 5FFFA 5SZIA 3I6MA 2WW8A 4KYIB 5CT9A 1O9GA 1OIWA 2WV9A 2YMLA 3OG9A 3ROGA 3OFND 3OZIA 1AZTA 1PTJC 5HZGA 2GN9A 1G21B 3B3QA 1RU3A 4G25A 4XSGA 1YJ8A 3EC2A 4FJ0A 1KI1A 1V11B 3HP7A 2B4RO 4KO4S 4NJMA 4TROA 5IEBA 4IDQA 2RSLA 2W6MA 2I4LA 6Q21A 3CRZA 4IW3B 1JAIA 2JLUA 3SMVA 1WDLA 3EDRA 3MNFA 1XEWY 4LYGA 1F6DA 1HSOA 1M8GA 4FCTA 4LBWA 4A2CA 2JGIA 2JIRA 3MLBA 2DTDA 4K9OA 1FIUA 1CEYA 3EH2A 4EZBA 4F1KA 1GHTA 2GH1A 5JYCA 3NH6A 1U5CA 2C7RA 1KY4A 3HGQA 4AP9A 1EHIA 1XRRA 1Q6ZA 3DFMA 4KE6A 2NAFA 5EHNA 2ICAA 1GLVA 2CWWA 3ED1A 5BT8A 2VF4X 1TVKA 3U7JA 1ZJ4A 3ROEA 1IHYA 1N0WA 3DYIA 4MYTA 2G80A 2P75A 3AINA 2DB3A 3WLOA 4UHBA 3GDOA 2Q3MA 2W2TA 3OKAA 4G23A 1D5WA 1X77A 5BVHA 2N46A 4Y0VA 2CNKA 5IAGA 5ENVA 4R1TA 4QQRA 2BM9A 1NXWA 4MHTA 1NXTA 1LDYA 3PIIA 3DOEA 4AUNA 4LDRA 1ESNA 4NOKA 2RHRA 2PZMA 3R74A 1STOA 1ECBA 2DBVO 3P0HA 3SZRA 2I54A 2NP6A 3U26A 2JPDA 2HZ7A 2YWHA 3JAKA 4ZRDA 3W1WA 1GGMA 4R1LA 3I6ZA 5EE0A 4ZCIA 1PT5A 4KWTA 2P9ZA 5EJ2A 3TAUA 1T26A 2FP3A 5HKAA 1QLHA 3HN2A 3NDPA 2OV3A 4JLMA 4XH9B 3LP6A 5E0KB 3QUBA 5B3LA 4D9JA 3INNA 1ZD2P 3RUDA 3X1MA 3VNBA 1R8JA 3QQPA 4UZEA 2V9PA 4AWXA 4G8JA 4DLWA 1LPSA 1WUKS 1XTQA 1JKMA 3D4OA 3QJYA 3PFWO 3T7AA 3OPXA 5IJ9B 1Z4OA 3KEQA 2GM4A 4I1VA 4F60A 3IIKA 1DINA 3Q98A 4X6XA 3I2FA 3VNSA 1PFUA 5DX8A 1V4NA 2ZBGA 1IMJA 1ZVQA 2N3ZA 4YUAA 1XVUA 2YYSA 1NOIA 3I04A 4CGYA 3DAHA 1ZN9A 1HORA 3GP3A 2XDQA 3OJCA 3TNYA 4F2PA 3RG2A 1RWNA 4O0LA 4TTAA 1KQNA 3OM1A 2NO9A 1QIIA 1X1CA 4IJQA 4OXXA 3T1YB 1OXUA 2XWSA 3C24A 4TL8A 4CM8B 3O4HA 5DBEX 4N3GA 3GGSA 2XCRB 4NPHA 1N34B 2Q1TA 1VI6A 1Q95A 2A1IA 3HB4X 4P84A 3IDAA 4C2TA 3KKKA 4P35A 2JAPA 4AZ0B 1C9DB 1CF2O 1DEHA 2CJWA 2EBFX 5B4TA 3PFGA 3UJAA 4D3YA 2JHGA 3ZE7A 4JJ8A 1ZSVA 4DHWA 3QEBZ 4ND4A 2DM6A 3DNPA 3DVAB 1UZUA 4P93A 2HPAA 5A7HA 1IQRA 3S8YA 1AUXA 3EW7A 3OOYA 1N1EA 4OLFA 5J4VA 1U9IA 1BRTA 2Z6VA 2GJ9A 5CMLA 4R8MA 3NM4A 3QF7A 2FJPA 2I3BA 1E89A 2KPOA 1WZEA 3M9LA 3SHWA 1DUVG 1PG2A 5JNTA 1MEEA 4OHPA 2DBZA 1EB8A 1WUYA 2DRIA 2JZNA 3ESXA 4LJLA 3NYQA 5E6SA 5AJXA 3IVRA 3LSTA 4LBYA 1WBDA 3TQIA 4JT9A 3GLGA 3W7AA 3KAQA 4PU0A 3M4XA 3U3KA 4UFNA 1Z75A 4NRDA 1ZL2A 3VYSB 2VHWA 5DN6D 4ZAWA 3SWWA 5AVJA 2PKRA 2WFLB 4BL5A 3C7CB 1Z25A 3W6UA 4XI9A 2RGBA 2ZAGA 1B6GA 4UJ3A 3IXQA 2G04A 2JFQA 4MUKA 3GEHA 2XI4A 1ZGCA 1R4MB 1GOTA 4ZICA 3QW4B 4OK6A 3TLJA 4FMPA 1WU8A 4WGGA 1U7OA 3CF4G 1K5PA 2CLLB 2QLMA 2VDQB 4LPSA 3HRIA 1B73A 1NLYA 2P35A 3T61A 4U2KA 1TAGA 4BO2A 4XYGA 1R0YA 1SD5A 4EJ2A 5LMNB 3VUEA 1PWHA 5GMOA 4I5FA 3VZPA 3TW0A 1JEQB 1G4AE 1ZA1A 4YPOA 5ICCA 2JLYA 3E18A 3OFJA 2ZIXB 5F52A 3M83A 3DB1A 1FYDA 3S3TA 2XNDA 5HQTA 2FQQA 4GBMA 2IE0A 2AR0A 3ZNPA 2ZIFA 2DBRA 4IIJF 3CUEF 3HH8A 2FEWB 8OHMA 2A9VA 3K1ZA 4X8MA 2PNJA 2AFHE 4F4JA 2PZKA 1YQDA 2QD3A 3R4VA 5L53A 2WG2A 5BY2A 3HJRA 5K9ZA 1XDDA 3EFEA 4TWAA 2X22A 3BRWA 4P54A 2HREA 2WKWA 3KT3A 5C18A 2CV1A 1EHCA 2DSNA 2I87A 2NUTA 4I1YA 1SBQA 2GOYA 2VWHA 1E3EA 1JH8A 2FHPA 3GVPA 4K9DA 3P9ZA 4EGSA 4DDWA 1OT5A 3PUVA 4W5QA 3SJZA 5IT4A 1DCTA 1RJ9A 2PVCA 4UDYX 1SCJA 3ZHXA 1YNSA 2OPBA 4CCYA 2E3JA 3TZBA 1M2FA 4RVNA 2IU0A 1PQUA 2GHIA 3TR5A 1FS4A 4F86A 5FRDA 2PSHA 3L6DA 4OATA 3QLTA 1R6DA 4M76B 3BSWA 1M8JA 3F4LA 1G38A 3N2IA 4I55F 1N6OA 4KVZA 2PSEA 1P7PA 1XYYA 5ELMA 4ZZIA 2WJPA 2P3OA 2FP4B 3G7SA 1JKJB 3PE4A 1JYSA 3BX1A 3RAPR 3UOWA 3IP1A 4UHKA 1YGPA 3STTA 4EHDA 5A9SA 4FOPA 2GERA 2O5VA 2VH5R 2JCVA 1J9EA 2DPHA 8GPBA 2VNKA 2BH9A 3BB3A 2KQUA 1M5UA 3LPCA 2FCAA 3ASUA 3BRCA 3TFWA 1U6IA 1NBMA 1FFWA 2HT1A 1Y6FA 1JA0A 4D3XA 3IULA 5E8RA 1C30A 3Q3EA 4MGYR 1QZ3A 2OWEA 1A0OA 2DFNA 3A7DA 3GLTA 2C8VA 3I4FA 3KP1A 5SZHB 5HGJA 5A4MS 1XKLA 1P2TA 2H4FA 4TRMA 4KBYA 4N9WA 3RJZA 3RAEC 2P9BA 2VJYA 1OVMA 3DZDA 1RXSA 4FCWA 1SA0B 3GY0A 4C22A 1ZH2A 1LPBB 2FUG1 5FO0A 4LDJA 1CRWG 4OGFA 3HB9A 3KYCB 3PCXA 4ICIA 4K3UA 4YRJA 3DDOA 3M3HA 4BNFA 4C87A 2UYHA 1DELA 3TJMA 1OILA 1UMBA 2DEUA 1E6CA 1N2OA 1TB4A 4O1IA 2HMYB 4KIFA 3W8RA 4EYQA 3KNZA 5KWEA 1C8LA 4NNOA 4DB2A 4DB4A 3GFTA 3OTHA 4Q7KA 1T24A 3MSXA 3QMVA 1DO8A 3FLMA 1FL9A 4IQGA 2C61A 1IVNA 1EBBA 2IYNA 4ZYYA 3FMPB 4D0RA 4QOFA 3PGVA 2G5PA 3ACCA 4YWJA 2PXHA 1HEIA 1YUMA 4RETA 3RBXA 4IO0A 3BCHA 3DBRA 4Q39A 5CFRA 2NVBA 4URHA 3P52A 1B43A 4RYLA 1NQTA 4LYAA 1MEOA 4RTNA 1EE1A 1M1NB 3D6HA 3HKEB 3A6PC 3VKGA 5LP6C 2JHAA 1QHNA 4QTTB 5AR1A 3DLBA 2PX4A 4AURA 4I19A 3RF7A 3RS5A 3NR2A 1JG3A 5EMNA 4B17A 1THZA 4XPIA 2YXLA 3VPGA 1XCPA 4AN1A 1QE5A 4OI2A 5L95A 1P9NA 3I32A 1H3NA 5CTAA 2WM3A 3HMKA 3RRYA 1FFXB 3M4YA 1W88A 2GAFA 3N8DA 1CUHA 2ZYHA 4A23A 4DLPA 3DV2A 4HUJA 1N9GA 3BGVA 3MZ0A 3QEMB 4AJOA 1E4EB 4IHJB 5LA6A 1QP0A 2WNIA 2YRFA 1E99A 3AVQA 3WK8A 1I4LD 3ETDA 2V96A 3UWMA 2X1VA 3H5WA 4C3ZA 4FDMA 4OHZA 4HT3B 1DAOA 4JS0A 1BQ4A 5EHIA 3CNEA 1CUUA 3ZGNA 3MIZA 1E6KA 4Z0NA 1E0SA 1H5UA 4B6RA 3AM1A 2EFEB 1SB9A 5HE8A 2PDAA 5BV8A 2ZRFA 3NHZA 2XOXA 3HABA 4II2A 5HRCA 4O2BA 4B31A 1LKZA 3EBLA 4J1QA 4BGVA 4NBRA 2Z57A 4MA5A 2DFTA 1EKXA 2O0HA 2FN3A 4CV2A 4G2NA 2SKCA 4HNUA 3AR2A 3Q9UA 3OTOB 5J2UF 5HK8A 1VLZA 2VK8A 5GGXA 3QMWA 4ZDWA 5DI3B 1MDBA 3RO7A 2EZUA 5L3SB 3FRJA 1C4OA 1JXMA 1K6MA 4FD2A 4UULA 3H6GA 3V3KA 5DYNA 4EATA 1EXVA 1BMFD 3EG9A 3NXKA 2Q9CA 3AETB 3KZXA 1W46A 2QDKA 3LRXA 1DXHA 4HCJA 3OOHA 4XCVA 2YFHA 4NARA 1Z6TA 3ZZUA 3B7PA 4RXTA 3W77A 1Y5IA 2B1GA 4L85A 4P5DA 5EQDA 4E03A 3V8VA 4OY3A 1TM2A 1A4XA 4L0DA 1QORA 3C5EA 4EAQA 2WMYA 4DQLA 4L4RA 5AO9A 1RPAA 1BA3A 1AM4D 3WSWA 1MUUA 2R1VB 3HYSA 3LZDA 1VTKA 3CW2A 3FCEA 1XYVA 4MX8A