4QM6A

Structure of bacterial polynucleotide kinase bound to gtp and rna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structures of bacterial polynucleotide kinase in a michaelis complex with nucleoside triphosphate (NTP)-Mg2+ and 5'-OH RNA and a mixed substrate-product complex with NTP-Mg2+ and a 5'-phosphorylated oligonucleotide.
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Transferase/rna
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qm6A00
2AWNA 3PIRA 1EFUA 1N5LA 1VHTA 2VH5R 5J5CA 2C98A 3VMFA 3EASA 3W5JA 2B8WA 4MGIR 3Q3JB 4ZI3A 1SVLA 1DARA 2ZI4A 1FZQA 1P61B 3TBKA 3CPHA 1J2JA 3T61A 4Z8XA 1HE8B 3IHLA 1FPMA 1W49A 2QROA 4TMWA 3U7GA 1W36C 2GTPA 2P6NA 2AHOA 2P65A 1KTVA 2ANCA 1Q1QA 3ZLJA 1Q0UA 2HDNB 4CGZA 2V9PA 4B6FA 2WWGA 4OHWA 5JMTA 3KQUA 2Q0HA 2GCPA 3AF3A 2WOOA 2YWHA 1WBBA 2WZQA 2QBYA 1NF3A 3NHAA 1U0JA 1AS2A 4TLCA 1XXHE 1G7CA 4GPTA 1KMQA 1KK0A 1JNYA 3CBQA 3K70C 1MT0A 1XTRA 1UBFA 2B92A 1KMHA 3DL0A 1OXTA 1OJLA 1T5LA 2ASEA 4NYIR 1J70A 2GDJA 1RJ9B 4Q1AA 3U3MA 5JCPA 1Q21A 1N3BA 2FDCA 2Q3HA 1IN4A 3RS0A 2AFHE 4PXAA 4FWTA 2VHTA 2P6UA 3BH7A 1KDPA 2DFLA 2FZ4A 2JIZD 4IOMA 2NQ2C 3KKMA 3WMFA 4ASUA 3LWNA 3ECCA 1P6XA 4NBSA 1ZUNB 3IKJA 3BB3A 5HE9A 2WVJA 4QL3A 3G0HA 3ASZA 2IYZA 2JA1A 2HV8A 4NCHA 5TY0A 2AD5A 5FBWB 3MGCA 2XNDA 5KPJA 2RGAA 3FE2A 3PENA 4Q48A 5FTKA 1CJKC 1FQJA 4YLGA 4R71A 2VRWA 5FL7A 1XXHA 3BRWD 2HYIC 1S96A 5FPKA 4QG7A 1VCOA 2GK7A 5G3ZA 5AUQA 2W0MA 4KVAA 4G3XA 2D62A 1GVNB 4HI0E 4PPGA 3MRSA 2ZREA 1IXSB 3U7FB 4BQSA 3RANA 4HAWA 2R6AA 4RCZA 2FSGA 3H4MA 3NBZC 2WMNB 4FMBB 3HYRA 4KCGA 1XTKA 2GXAA 1U9IA 3GJ6A 4RZ3A 1U99A 4BFUA 1ZNYA 4JJZA 4NYMR 2XTZA 3KXLA 2A5GA 3OAAD 3LBHA 4QBHA 2FPMA 3W6PA 3H84A 4TMKA 3B78A 2HLDA 5FL7D 2BKUA 3AKDA 5GJCA 3EPKA 1XTQA 1ETUA 4QGGA 2NZJA 1ZNZA 4TLAA 1NG9A 4FW9A 1VG8A 3VHXA 4C0QC 1NLYA 3B9QA 1JQJC 3E1SA 2XZPA 1Q3TA 2ZJZA 3L2OB 4QGHA 4IDQA 3WYGA 3ADKA 2R9VA 3L43A 3EWAA 4LJ5A 1NY6A 1QHGA 1Z8FA 2ZI7A 3P20A 1Z5ZA 4HB4A 1P4SA 4WA7A 4AKGA 1ANKA 2RGXA 1NI3A 2CHQA 1DE0A 3GJ7A 6Q21A 1E79D 3U44B 1AQYA 3HU3A 1E2PA 3D3QA 2CHGA 2GEDA 3PV0A 2BOVA 2DB3A 4NONA 3GEHA 4B32A 2GBLC 4CEHA 1UEJA 1XPRA 4W7SA 4P4UA 2NO7A 3KKOA 5HZKA 4DLXA 1YJ5A 3RVBA 2FJUA 2BBTA 4A15A 4JSYA 4AI6A 3F8TA 3WBKA 5AUNB 3P1JA 4IDHA 2RCNA 3LX5A 2XB4A 3LD9A 5BXQC 2GF0A 2FH5B 2ZVQX 4NCNA 3K09A 1W2GA 4EPYA 1ZC4A 1M8PA 4I99A 4UJ3A 2WTUA 1A82A 1WMSA 1Z22A 1M34E 2FV8A 1A7JA 4M0LA 5FI1B 4E5UA 1MR3F 2YOHA 1GL6A 1P2VA 4MRRA 2G0TA 1U8AA 3IIJA 4CRWB 1RRCA 1UFQA 2IYRA 1KSJA 4KO8A 3O8RA 3EW9A 3EXAA 3K1JA 4A2PA 2OE2A 5TMPA 4DDVA 3OIUA 2H57A 1KDRA 2ZSAA 1GWNA 1NRJB 3CZQA 1I4TD 1VHLA 2JLQA 4M1SA 3EZ6A 4M9XA 4B3FX 5IRCD 3QXSA 1XU4A 4A0FA 4OK5A 4KV9A 4BLSA 2TMKA 1GP2A 1GNPA 3OEED 2F3RA 1EFCA 5FOSA 5C4GB 4F92B 1KO8A 4O0MA 2QE7A 3U44A 5EUQB 2BJVA 2X77A 1LV7A 2VP5A 3P4YA 4Q00A 1OXSC 4BFYA 2JLUA 3A58B 5FBRB 5A5GA 4M1YA 2XITA 3HJNA 1RFLA 1N6LA 1XCPA 2GETA 2WJGA 1TAGA 1KSHA 4LHZA 4DDWA 1VG0B 1WP9A 4IVQA 3SC3A 3W6NA 4B3GA 1FL9A 3ASYA 4A0GA 4TL6A 1X3SA 2PX0A 2PMKA 4BECA 1RRFA 4PC6A 1R5NA 1MO5A 3LQRA 1G4AE 1XCMA 1N6OA 3TK1A 2VSFA 2JEOA 2GVDC 4YMUA 3FOZA 2ZSEA 3NIBA 1E0JA 1M7GA 1F3OA 1EG7A 2MSCB 4LYHA 4ZO4A 4FMDF 3AUXA 4TLEA 4DHEA 1KI3A 2VF8A 4S35A 3ICEA 1K5GA 1VDZA 4A4DA 1XBTA 1HQYE 4Q1FA 3VNVA 1Z0IA 1YR6A 3WP1B 3TNFA 4QFMA 1Z0KA 4PSKA 3OE7D 2QMHA 3L0IB 5JCZA 1MKYA 2FGKA 1XWIA 1MO4A 1DG1G 4RD0A 2GZAA 1G291 1ZC3A 3IO3A 4GNKA 4LY6A 2NG1A 2NO0A 2OESA 4FXPA 4QKQA 2OBMA 2GCNA 3ZVNA 5L3VA 1E9DA 1I2DA 2FF7A 3NBYC 4ZKDA 4QM7A 4JJKA 4Q01A 3D31A 3P26A 2YWFA 3CLVA 1OSNA 2GK6A 2IK8A 2VHJA 2BV3A 2J59A 1Z2AA 4XSGA 4MYUA 3O8CA 1SULA 4TQAA 4PC1A 4TL7A 1Y63A 5JJKA 3SJBA 1CJTC 1JAHA 3PITA 2PZGA 4XTRA 3REGA 5BN5A 2QPOA 2XEXA 3FPAA 3E5HA 1E2GA 4P31A 3TW4A 2ATVA 1T3HA 1FQKA 2WAYA 4B35A 5IDVA 5JEDA 4L9WA 2JLZA 5ELXA 1CLUA 1G64A 1GZSA 1GSIA 1ZAKA 2HYDA 2PJZA 2BCJQ 2G9NA 4C9BA 1OYWA 4NYJQ 4L4UA 1ZVQA 3E2IA 4TYNA 3L8ZA 2FFAA 2V6JA 5TVKA 1Z0DA 5JECA 5DN6D 1YKSA 1R5OA 1Z47A 3B9PA 4RZXA 1DAHA 1PUIA 2QUZA 4V03A 3A4LA 4D0GA 2HJGA 3PXGA 1GL9B 1SZPA 4O2RA 2VP2A 3QPUA 3QG5A 2OT3B 1LTQA 2ZANA 1HURA 221PA 2ZJOA 4Q1CA 4AK9A 2ZS7A 5CLQA 4BEJA 5FPSA 3OIWA 4B33A 3LW7A 3L0SA 1WQ1R 3W90A 2XAUA 4LDJA 5EE0A 3RYTC 4D0NA 4DXAA 1IQPA 1T0JB 2X19A 4ZCIA 1IY1A 2ZSDA 3RS2A 4R98A 721PA 1KK1A 1P3JA 1FTSA 2ZYTX 3CKLA 5JFGA 1E2EA 4F4IA 1W4RA 1KZGB 4IOLA 2W2XA 4M1MA 2X2FA 3BH6A 1T5IA 1IM2A 4G01B 4NCIA 3JZMA 3Q7PA 1LF0A 3GD7A 4JLBA 3GLFB 4C7OB 5TXGA 3AF1A 2OUKA 3BORA 1CTQA 2JAQA 1XDBA 2QY9A 3B13B 5KSOA 4ZCLA 1G21E 5JBQA 2WBLC 1UBEA 1SGWA 1R4AA 2DFTA 4DSTA 2RGCA 5EP1A 4RSGA 1SVOA 2IUUA 1PLJA 2GCOB 3AF0A 5LDDC 2WJHA 4UQOA 1SVMA 3M4YA 5GJWC 5H8WA 1QHNA 2F55A 3K9GA 1S8FA 3Q72A 2CCGA 4PO1A 3X1XA 4P0TA 4C0BA 2J41A 1P72A 4RZ2A 3VQTA 5JS8A 1US8B 4G1UC 4U7DA 3GLHB 1E9EA 1DAFA 3SR0A 2YWEA 3KB2A 2R65A 4URUR 1OH6A 4F7WA 4DLTA 2FN4A 2YHSA 1R0YA 621PA 3U3OA 3GPLA 2IC5A 2QM7A 2VLIA 2VSOA 4BE7B 4KLNA 4HAYA 4NKRA 1WB9A 3AP1A 3VKHA 1JPJA 2YC2C 3I73A 421PA 4KODA 5J4LA 3QIAA 2JJ1D 1L7VC 1ONBA 2IA5A 3C8UA 4JVNA 1OH7A 1CP2A 4ZV4A 3SZRA 4PZYA 3HPQA 2J9RA 2FWRA 3GLHE 5FTNA 3CRRA 1BS1A 3AH8A 4JVSB 4BPBA 1VYUA 2RAPA 2R6FA 1GFIA 2WIAA 2JDID 1ZJ6A 2AN9A 4Q9JA 4KSCA 1VG9B 2KBFA 2C5LA 4NYIQ 2HT1A 1KNQA 2PH1A 3K9NA 5HCNA 3K70D 3P27A 1NVUQ 1Q1ZA 4LJAA 4E07A 2AX4A 2B21A 4LYFA 3TRFA 1OIVA 1N6IA 1XMJA 2C04A 1XD8A 2DFKB 2QAGC 1ZYUA 1E2DA 4R2IA 4LBVA 2WJIA 1KDTA 2IYQA 2GCOA 4JLNA 3RRMA 2G83A 3KJHA 2QPAA 4ZDJA 1G3QA 5KSZA 2Z5FA 1LF5A 5KU1A 2ZE5A 1NNEA 2HUPA 1NLFA 1Q20A 4P4SA 3GFTA 4X8MA 2QG6A 3R7WB 2ODNA 2G0NA 4DCNA 2FOLA 3EG5A 1UEIA 3WRXC 3EPLA 3MMPA 1JALA 1ZMXA 4TMZA 3HYTA 3TIFA 1XNJA 1G7RA 1ZUHA 2ZI9A 1UPTA 2I1VB 5LD2B 1DAGA 1GG2A 3TH5A 3ZGXA 1MRSA 5K8LA 2F6RA 2ORIA 5AWFC 3MWLA 2G1JA 2CE2X 2Z4SA 2OEPA 1E2LA 3K0FB 5EZ5A 4RKEA 4B74A 3FMFA 4KLZA 1CJMA 1RPZA 1X8LA 1U2RA 3SNHA 2GAOA 2DR3A 5KO2A 4TT3A 4YONB 4PO9A 3BBPA 3PUVA 1E9RA 4O3MA 1N6HA 2CHVA 5E95A 4FIDA 2OFXA 3NC0C 4FMCF 3F0TA 2WWIA 1R8QA 2P2LA 4NCKA 1G9XA 1SQ5A 3CRVA 1N0WA 1QBKC 1Z0JA 4H1UA 4XVRA 1FNMA 1OKKA 5E7JA 4QHTA 1YR7A 1IXRC 4DLRA 2J7KA 2EWVA 3GJ4A 2QMUA 5GADl 5D3MB 5F9HA 1TU4A 4FCVA 1GDDA 3HPRA 3UXMA 2ORWA 2GVZC 3UMSA 1WRBA 1JBKA 2W6IA 2J0SA 3LNCA 1NIPA 1PLLA 3L82B 3TR0A 3BD9A 2F9LA 4HAVA 2YINC 3A1TA 2FSHA 3QI2A 5JI3E 4N0DA 3UANA 3WHLA 2CBZA 4D26A 3QY0A 3R7WA 3VR3A 4NL4H 4UNPA 5EE9A 1Z06A 2F1RA 2Q3FA 1G6OA 2KWIA 2GJ8A 1GNRA 1OXVA 3KUDA 1E99A 2W2VA 4PPFA 3VR2A 1RKBA 1OKKD 5AJYA 2ZRKA 8OHMA 1H8ED 1I4DD 3X1YA 2H18A 5FTLA 1OW3B 1UKVY 3NBFA 3TVTA 5K8IA 2B8TA 4JT2A 1ESNA 2OHFA 1S0UA 4WOPA 4M1WA 4HDOB 3K0FA 3IHWA 2ZAOA 4BFVA 5EP4A 2W6ID 1JR3E 2ERYA 5FOXA 1G1MA 4BLTA 1NJGA 4EKDA 4MDEA 1T91A 3QVUA 4IXNA 3SE0A 1WBDA 1DELA 1G8HA 2F7SA 3ZIAA 3B2EA 3ND9A 2QN6A 3K0EA 1G3MA 3DEFA 3F5FA 3BE4A 4KU4A 2GEVA 2N42A 1XTSA 4FINA 4JS0A 3TKLA 2JLXA 4MDFA 5EE5B 1OFTA 1VKJA 2QTFA 3QXCA 2ZE8A 3RDPA 4TLDA 1TX4B 5D3MA 3VR1A 4L9SA 4U5XA 4DCTA 4B3BA 3QJYA 4M21A 1U98A 2YC4C 4KJZA 1FNNA 2F1IA 2JLWA 4ZKEA 3X1DA 1NMYA 1GNQA 3NG1A 2V3CC 4KBGA 4M4SA 2VP0A 4TYYA 3ZYCA 1UAAA 4GOXA 1CKEA 4IFBA 1T8TA 1NVVR 1TQDA 3RRYA 2VHUA 1S4QA 1HUQA 1JR3A 4F4CA 1PVOA 5KDLA 2C8VA 4HAZA 1E2HA 1KI2A 3BFVA 2HT6A 1TU3A 2G1KA 1GM5A 5B58C 5BN4A 5BN3A 1S9DA 1GTVA 4OI2A 4XD7A 4WIAA 2ZJ5A 2ATXA 3LY5A 3RNLA 5JI2E 4DSNA 4H9GA 3H86A 3I5XA 4A2QA 1S2MA 3VR4A 3T1TA 4JKIA 4YMSA 5ANRB 3WNDA 4MRVA 2WAXA 2QSZA 2DPXA 3U2QA 4K81B 4CF7A 4H1VA 3HR8A 2REOA 4RVCA 1IBRA 4WXRA 1XD2B 1XRJA 3KFVA 2KI5A 1N5KA 2NZ8A 5H1YA 2ONKA 1Q12A 1S3SA 2IYLD 2QAJA 2KSQA 1V43A 3AB3A 3CF6R 1O3YA 5DSZA 3SU8A 2DWOA 4MQBA 3SOPA 4MGKR 4WZAE 4OYHA 4U02A 4UJ5A 3TAUA 4ZCMA 3SYKA 4U00A 4P3YA 4BZPA 4IDNA 2FNAA 1LS6A 3SYLA 4QHSA 4Q9HA 5M04A 2RB4A 4XD7D 2J5XA 4MUAA 1XZQA 1ZM3A 1OHHD 2IF2A 3HP1A 3AVUA 2FSIA 5KYKA 4M8NE 2IHBA 1ZP6A 3D8BA 2W58A 2XTNA 5EE3A 2QQ0A 4MYCA 5AJXA 4MKFA 4Q1DA 4M2LA 1GRRA 3AVTA 1Q22A 4HB3A 3NDPA 2QGZA 1I4LD 1DBSA 5JWRA 1QHYA 4GFDA 1AGPA 3J81k 1JECA 3KTAB 3BXZA 4JYBA 1W46A 2UZ3A 5EP3A 1NP6A 2OAQ1 4DUGA 2NPFA 2JIZA 2A5FA 4Q66C 3LV8A 4BASA 1G4UR 3KX2A 5BYKA 2B7BA 2G77B 4PQFA 4CEIB 3CF0A 2XZOA 5DI3B 4OKSA 1SVKA 3PEVA 4JLOA 1FTNA 3VKWA 3LX8A 1MABB 3AF2A 4AKEA 2FPKA 2Q3MA 2OFWA 3THYB 1NMZA 1KI8A 2BVNA 2QMOA 3ZZ0A 3TJZA 2C9OA 2ZIAA 1XD9A 3GJXC 1D5CA 2AXPA 4KBFA 1XD2A 2ZRNA 4OI1A 4OQFA 1IJFA 4HZIA 1F5NA 1XJCA 3B6EA 4AD8A 1EK0A 2YYZA 1ELOA 2ZPTX 1E94E 3WMGA 5EXPA 3CZPA 1A2BA 1F2TB 2JJ2D 4XWOA 1HV8A 3LLMA 4Q4HB 2IWHA 4DUGD 4US1R 3EPJA 3RSLA 1DS6A 1KI7A 4BRUA 1N5JA 1FW6A 3IEUA 1IY2A 3CR7A 3ZQJA 1Q1EA 3W8RA 4JLVA 3C41J 1TQ2A 1L2TA 1UKZA 2ZRLA 2JLVA 1OFUX 2KB0A 3PVSA 1N6RA 5EP2A 1A5TA 2EFHB 4EJSC 3I8SA 1R6BX 1UF9A 3G5UA 5CIWA 1GRNA 2MSDB 3RWOA 1WA5A 2AFIE 2WJJA 3OAAA 1E1QD 1ZRHA 3PR1A 3DVLA 5A0FA 4CEHB 1II0A 4PSVA 5TV2A 4LJYA 4V0ME 2QPTA 2OLJA 1HA3A 1W0JD 2QTHA 2XOKD 3DM9B 4UXIA 5F2EA 2BIFA 3MUFA 4AWXA 3E70C 1FP6A 3KTAA 2ZU6A 3BC1A 1KSFX 2ZRGA 4JL5A 2JLSA 2Z83A 3KXKA 1E2JA 2BJWA 4D4MA 1Z08A 2IYVA 2WWFA 3KJEA 2YZ2A 4XH9B 1OT3A 4K8OA 4Q4JB 3T34A 1DTSA 4UXHA 4A6PA 4ILEA 4CEIA 1NN0A 2QP9X 2JJ8A 3FHCB 5DI3A 3W34A 1W44A 1W7AA 1ZIOA 5HE8A 3WXMA 1EWQA 1E79A 3CB4A 2C95A 1MABA 3SFVA 2H7VA 2ZU0C 3OEHD 3THYA 2XXAB 1G8YA 2RGNA 2BM1A 1H8HA 2ZI5A 1W5SA 2ZR7A 5EXSA 1R8SA 1ZNWA 4HB2A 4HAUA 3I8XA 3SN6A 3PEYA 5EUMA 2OXRA 3LBNA 1F2TA 4D25A 4Q4HA 1AA9A 4V0MA 1ZM9A 1ESMA 3IQWA 1KGDA 3FTQA 4DWJA 1DVRA 3EZ9A 4LSGA 5HKKD 3MJHA 2V1XA 1Z63A 4V0KA 4QBIA 2VP4A 4CEJB 3C7KA 5FPYA 5HR5A 5LPNA 2IXGA 1LNZA 1CR0A 2ZRFA 1Z0AA 1DO2A 5C46F 4B2LA 1H8HD 2FGJA 4MYTA 4L15A 3QOFA 1QHSA 4A0HA 3OIYA 3MWKA 4MRSA 2O0JA 5H68A 5FOUA 1SVIA 2UZIR 3ZS9A 4TYWA 1LVGA 1XTJA 1JXOA 2W00A 5CK5A 4D4LA 5AJVB 3O47A 3RC3A 4A1FA 2AXNA 3NHBA 1W4AA 4Q4JA 2ZRPA 1KKMA 1NN1A 3SJAA 1XEWY 2O5VA 2WWHA 3OEEA 5B2ZA 2NTYC 2G88A 1RYFA 1TUEA 1AJEA 3MD0A 4LBWA 2BBWA 3TGPA 4DB2A 1CR2A 1QHXA 2C03A 5FUVA 3TSZA 2XXAA 2NPIA 4HLUA 3OESA 4LGMA 2PBRA 4UNSA 1D8TA 2QTVB 1E9CA 1JXMA 1KK2A 3CF2A 1XTIA 1XFAA 4EFNA 3IEVA 3MFYA 4QJ5A 4WXPA 5FTMA 4EDHA 4DB4A 2IYYA 2VQSA 4Q9IA 4EIWA 3TLXA 4LHVA 1AN0A 4B44A 2J1LA 5F98A 1UM8A 3RSOA 1UADA 1ZD8A 3QKTA 1NKTA 3MSXA 1XMSA 1EX7A 3R9XA 1R10A 4PHFA 4LHYA 4PHHA 2IHYA 4CVNA 1WE2A 4M9ZA 4CEJA 1F2UB 2QNRA 1CXZA 4UNQA 4DEYA 1AKEA 2HF8A 2R2AA 2WJYA 2ZYVX 1SVSA 4PHGA 3CX7A 4BUJA 3RC8A 2JATA 4TSFD 3OE7A 3T5DA 1OH8A 1C9KA 5J4KA 4MA4A 4D4KA 2FFQA 2Z6VA 4LJ8A 4LX0A 1P73A 4MKHA 3NH9A 1IOZA 5DYIA 3CO5A 4HDCA 4PHTA 3RRNA 4X8LA 1DG3A 2QMEA 3MCAA 3PJRA 4B75A 4OJKA 1DPFA 3TUZC 1R0XA 1Z3IX 3AEZA 2J3EA 3O8BA 5DO9A 1CJUC 1Z6YA 1LFDB 3VFDA 1S1CA 3K0SA 1HEIA 4LOAA 1ZNXA 4BFWA 4KFRA 1YZQA 5DE3A 4RD2A 3EC1A 1KK3A 4V0OA 5KDOA 1NN3A 2CLCX 5FI0B 5JHHB 1Z29A 1N6PA 3UWKA 2IYSA 3PUYA 3EWSA 4WW0A 2QL6A 2ODWA 1G20E 3D6TB 3BJIC 4TMXA 3ZVLA 3IQXA 1P5ZB 1G6HA 2V55B 5DN6A 4Z1MD 3T1OA 1E1RD 1ODFA 4V02A 4C2UA 2A5DA 3I72A 4M53A 1F2UA 3R8CA 1KNXA 2XNSA 3CWQA 4DIDA 2IEZA 4C0AC 5KOYA 2QEQA 2RGBA 4Q7MB 2ZM5A 4JBYA 3KL4A 3NXSA 3ETLA 1QDEA 2EFCB 2V6IA 1E2NA 1P9NA 5FUXA 3MWJA 5SZKB 3WRYC 2NO6A 4KVGA 3N2EA 4FCWA 1W36B 1Y3AA 2EFEB 1R5BA 1QVRA 2X1VA 4LWZA 2RGEA 4Q4AB 5EZ6B 1GUAA 1P7CA 1H65A 5J4VA 4Q02A 2C9CA 2EWWA 3VR6A 4TYPA 5H70A 2GHIA 4JIMA 1YRBA 2OILA 1E2KA 1NN5A 4EFLA 2DFNA 2ZRAA 1KY3A 1F6BA 4DEXA 3CNLA 2PMDA 4CZ2A 2PEZA 5G53C 3K70B 4W5JA 2FEOA 4I4LA 1E2IA 1SHKA 4BLQA 3LAWA 4FWIB 1SXJC 3TMKA 4RFVA 1W2HA 5JSZB 1NVVQ 5DI9A 4Q9LA 1YHNA 4HUTA 5KPDA 4PZLA 1KHTA 3D7MA 1Z07A 4EPWA 3ZVRA 2O8EB 1HE1C 5E7MA 4TMVA 3CPEA 3I32A 1ZU4A 1E9BA 1QZXA 3IILA 3AKEA 1GRQA 4B6EA 5F3WB 1TMKA 3AKCA 3SJCA 4LBZA 1EESA 4F91B 1HT1E 1GITA 2NGRA 1RRGA 2IWRA 4LRWA 2WSMA 2WWYA 4JLPA 3U7HB 2O8FB 3QQ5A 3QKSA 4A8JC 4Q4LA 1GIAA 2PLRA 4KYIB 3LA6A 3LBIA 4DLVA 3DMNA 3FHOA 3EPHA 4PAMA 1CU1A 2ZR9A 4A2WA 1JJ7A 4MYHA 1Z6AA 1G19A 1C1YA 3ZDQA 2FE4A 1G8PA 4LJ7A 2FZLA 2JJ1A 3H0KA 1KYIA 2ECKA 2OSBA 3EZ7A 3UATA 1KJZA 3OFND 3KQHA 1JPNA 2CVFA 4WZ6A 2W6JA 3I92A 3W6OA 3C4JA 4TLBA 3Q85A 4Q4AA 1KAOA 4C0HA 5KSYA 1ZD9A 4N3NA 2BMJA 4P4SB 3KJGA 5AUPB 2WSSD 5FBVB 4Z51A 1AGRA 4JL6A 2JDIA 2CVHA 3VX4A 4IRUB 4DSOA 3Q9LA 3FB4A 2BEKA 4QGAA 3RHFA 1W4CA 1X1SA 2REXB 4OQLA 2IS1A 4ITRC 5JSZA 3V4RA 3GCGA 1DOAA 4GRAA 4KITB 3B85A 1UBCA 5FOVA 2HJVA 4IKEA 1FP7A 3EA0A 4I1UA 1M7HA 2QENA 4DLZA 5L3QB 1OB2A 2O8EA 1NKSA 1GL7A 1N0UA 1JEEA 5CYPA 3B1WA 4Z8YA 1W36D 4RJLA 2W6JD 3I3SR 1FUUA 1YZLA 4LK2A 2GJSA 3RS3A 2VP9A 4IEIA 2N46A 1GAJA 4HUQB 2FSFA 4BEBA 1FMJA 2EFGA 3AV0B 4NH0A 4B34A 3NTUA 2O8FA 2R44A 1W48A 3VHLB 1U9IC 2GZDA 4JLJA 1FX0A 3P4XA 3EA5A 4ESVA 2NMVA 2ZUBA 2QSYA 1DEKA 2ZUDA 5GVSA 2WWWA 2D2EA 2OXCA 3T15A 3T5GA 2ZRHA 4RFSB 3V9PA 2F1JA 3FHTA 1P62B 3AQ4A 4EAQA 2FPLA 3DHWC 3LVQE 2BHRA 1COWD 4R9UC 1EFTA 4PANA 2ZEJA 2GJKA 2YV5A 5AJWA 4HLDA 2BMDA 2ORVA 4GOKA 1BKDR 2GESA 4URWR 2ZJBA 3VKGA 3KZ1E 3TQCA 4XVUA 3RRZA 2J46A 4HAXA 3M0EA 2JLRA 3RWMB 3IUYA 4II7A 2IXFA 1BOFA 3WHKA 4G5OA 1YR9A 4AYXA 1SKQA 1VCIA 1W47A 5L3RA 2D3WA 3FFAA 1N6NA 2IYTA 4Q03A 4C30A 2UVQA 3DZDA 1L8QA 3DM5A 5FBLB 2QORA 5CJ2A 5FTJA 5FL3A 2GWHA 1OB5A 1M74A 2HCBA 3TVDA 5L3QA 3EIQA 1KZ7B 3HU1A 4G5SA 3SJZA 2GZHA 3MJRA 4FMCB 3B8HA 3A8TA 4MKGA 1T4GA 1BIFA 3AP3A 4TYQA 3IBYA 5KNDA 4LZZA 4TQUS 3PQCA 2AD1A 3JVVA 2OM2A 4HLCA 1U94A 2CEAA 4G5RA 2REBA 2MSEB 3BH0A 2WV9A 4HUQA 3KQNA 4OQXA 2PEYA 1XMIA 5F9FA 2AKAB 1U90A 1GKYA 1KAGA 2B7CA 2ZRMA 3OIVA 4IHQA 3TQFA 4DCUA 5JRZA 2RHDA 4WZBE 1ZUIA 2AR7A 4DSUA 2YKGA 2GBLA 1J90A 1H8EA 3PFIA 2BCGY 2YOFA 2A2ZA 2CL0X 3AKYA 2HXYA 2F43B 2GF9A 2DCUA 1YZGA 3QPVA 4RFSA 821PA 4AKIA 2RKOA 2DY1A 1SVWA 3K8YA 4I1VA 2SHKA 3QEOA 1AZTA 3AVVA 2FG5A 2V8OA 2Z4RA 2ZI6A 3IIKA 4XVQA 1Z0FA 4LBYA 4P4TA 1NG1A 5IHPA 5FPTA 3SEAA 1F48A 4M9QA 4LYAA 4HEJA 3N2IA 1EFHA 1CF4A 3HU2A 3BWDD 5AUOB 3WMEA 1OPXA 4A9AA 2ANBA 4FCTA 1NVXQ 1E98A 3K9LA 4EPRA 3I4LA 3CONA 4N0EA 2D2FA 2ZRCA 4IEEA 3BB4A 1U8YA 2ZQ5A 3MWYW 1DO0A 1S1MA 4UXJA 1FMLA 2NIPA 4IW3B 2AK2A 4TQ9A 1M6NA 5B57C 5J47A 5JWOA 4B76A 4AG5A 1PZNA 3CNOA 4BFTA 1F60A 1RIFA 3ZH9B 5AR1A 2UKDA 1B0UA 1JB1A 1GKIA 1CJVC 4P32A 2ZJYA 3HWSA 2OG2A 1XMVA 1YE8A 3I61A 1E2FA 3VU9B 3CH5A 4RD6A 3TAHA 4NU0A 2AWOA 4LCBA 3UK6A 1N6KA 4YC7A 2IXEA 4CW7A 3UMFA 2R62A 3NWJA 1D9XA 1BMFD 1GILA 1G5RA 2OCAA 3ZZTA 2WPDD 4WVFA 2EU8A 4LHXA 2F43A 1XJQA 3ONWA 2HF9A 1TF7A 2CE7A 4A0RA 2O8BB 2W2TA 3PEUA 4DT1B 3THXB 1G3IA 1VTKA 1FOEB 2E87A 3SFZA 1E0KA 1DAMA 2A5JA 2ZRJA 2ZJ2A 1J8YF 3W8NA 5C4MA 4GDFA 4F38A 2IS2A 4B3DA 5IK2A 3ND8A 4JBWA 1W5TA 1QHHA 5FBQB 3M6AA 4US0R 2C2HA 4W5WA 4BLPA 2V1UA 3KQLA 2V4ZA 5FUYA 2O8CA 4JLDA 1OHHA 4R7ZA 3SBDA 4HLQB 1ZD1A 3B1XA 2ZETA 4JLKA 1CBUA 1L4UA 4RZUA 3A36A 3C5HA 2ZI3A 3CIOA 4J0QA 2YNMA 2D7DA 1U0LA 2ZRBA 1G3RA 2J87A 2VA8A 4I1SA 4LC0A 1PJRA 1RVDA 4D81A 4XJXA 5CB8A 1CR4A 2YWGA 1E32A 3KKNA 4B47A 1Z6XA 1IN8A 1J99A 4MITA 4PAQA 4ZPXA 2CK3D 3SYNA 3U3JA 5P21A 2IUTA 3CH4B 3EC2A 4IJMA 3VU9A 1IN6A 1XP8A 4DCVA 5IK2D 5E4FA 4DVGA 5D3QA 2CNWD 2HEIA 3ZZUA 1KO7A 4GOJA 4OI4A 3SDZA 2P5TB 2XSZD 4MKIA 3THOA 1P2SA 5E7IA 3DMDA 4O25A 4D6PA 2XB2A 3QF7A 2R6GA 2J45A 4DDTA 4LPKA 4PC7A 2CXXA 1VMAA 2IT1A 4QNRA 5AK0A 2PJRA 4D4JA 4PC3A 3BGWA 4NTZA 4NZYA 4QRHA 4DZZA 1XPUA 3C16C 2O8BA 1S9HA 3AUYA 5E3HA 5KDDA 4DT1A 3THXA 3DDCA 3ZS8A 5BYJA 2V7QA 2B6HA 2VBCA 1WCV1 2C99A 2CJWB 2ZYUX 4GSYA 4OL0A 1KO1A 4TZ0A 5DIFA 5KUTA 3BS4A 3L8YA 1L4YA 2Z0MA 4IFEA 2JJ2A 3C14C 2N1BA 1T9HA 1X6VA 4HSEA 1RC8A 1D2EA 4DLUA 5HPYB 3GLGB 1S3GA 3DOFA 1NMXA 1KI4A 2ZRDA 4C0KA 1C4OA 2OLKA 4QHYA 4DC9A 4L16A 5C2JB 4RCYA 5HTKA 5EXTA 3U6KA 5L8VA 2NOAA 3RS7A 2GILA 4OK3A 5K8UA 1B23P 4MH0R 4ARZA 2GA8A 1LY1A 1XJ0A 4KHZA 2BDTA 4Y0AA 1MO3A 3CRMA 1KO4A 2PT7A 2ZVPX 3K53A 1E1QA 5DHAA 2IX3A 5FOWA 1BH2A 3EARA 3QG1A 4QM6A 2XX3A 4JL8A 521PA 5JLJA 3U6BA 3GP8A 2V7QD 2P5SA 3TSOA 3CWZA 1OIWA 1OXXK 3U61B 4FN5A 2VO1A 1W0JA 3EZFA 2XOKA 4TTQA 4DIEA 1O87A 2ZROA 4Q5IA 3GLGE 5B30A 1SKYB 3QPWA 4A36A 1YR8A 1M1YE 1KI6B 3X1ZA 1A2KC 3ZVMA 5DISB 2FX3A 1IONA 1DAEA 4EPVA 4GP7A 3Q7QA 4I81A 1A4RA 4PZZA 2WKQA 4Q1EA 1XEFA 4A8JA 4OHYA 3T1QA 4E22A 4URVR 1E0AA 4RD4A 4B73A 1SXJD 4D0LB 2QGNA 2QAGB 2NO9A 4DLYA 1AIPA 1NBMD 1Z6TA 3Q8XB 4OHZA 2QI9C 3OEHA 1K5DA 4CDGA 3BAFA 4DCSA 2LKDA 2D7CA 1SKYE 3GMTA 3AF4A 2WWXA 5LB2A 4DKXA 3AVXA 1OXUA 2OV2A 3WP0A 1QF9A 2CJWA 4OK6A 4Q7LA 1Z6GA 1WF3A 4QGFA 4NCJA 4EPTA 1YZKA 3NEJA 2OBNA 3QXJA 3PUZA 1NSTA 1CIPA 3A4MA 3KKQA 4NHOA 3LO5A 5BQ5A 3L0PA 1AKYA 2R6DA 4FI3C 3GLGA 4C4PA 2IBMA 5SZHB 3NH6A 5HKKA 2ZAMA 4AY2A 1AS3A 5IF9A 1EFRA 4GT1A 2ZRIA 2QT0A 1PUJA 3AGPA 4GZLA 2EVWX 4Q7KA 3X2SA 2ZITA 3LH5A 4F4JA 3DZ8A 2C96A 4F93B 2K5UA 2QA5A 3RS5A 2BEJA 2CLDX 4M1KA 3P32A 1KSGA 1G8FA 3CX6A 3M1IA 1W0KA 3TUJC 2R6CA 4ASUD 2P3SA 3CPJB 4Q1BA 3NC1C 2VPPA 2IYWA 1SHZA 1KI6A 3Q5DA 3WNCA 1OFIA 1E9SA 3IDQA 2OZEA 4QJ3A 2W83A 1N2CE 1V5WA 4C0JA 4DRZA 1TUIA 3AP2A 4CYMA 2DWQA 2XNDD 4XOIA 4L5BA 3WNBA 1OE0A 1EFRD 3QKUA 2QAGA 4PQYA 3MAAC 3NDBB 2O52A 1RJ9A 4B48A 2ONJA 5BW8A 1KDOA 2IS4A 2QU8A 4K46A 3IIMA 4D2IA 4E03A 2CL7X 2GKSA 1W0KD 4JZKA 1AZSC 1CULC 2QRZA 3FYHA 4GBMA 4G5GA 4GMXA 1II9A 3IGFA 4JYCA 4OJQA 5DH9A 2A78A 5GVRA 3A1SA 4OQMA 3KXIA 3LLUA 2PZEA 1G41A 4G0NA 4BFXA 5BWMA 1TF5A 1LB1B 1CR1A 5EXXA 1UKEA 4ZDKA 3DPUA 3PEWA 4LHWA 1ZBDA 2HLDD 5GJBA 4NDZA 5CYOA 2ZS9A 3W3AA 3LRPA 5G40A 4KAXA 5CB6A 1TADA 4Z54A 1LS1A 5KTYA 4TSFA 4LV8B 2I4IA 4NPHA 2GNOA 3KDSE 2C9YA 3X1WA 4OHVA 4MGZR 3CW2A 3SHWA 3PUWA 3KUCA 5FFMA 5TARA 5KNBA 2X2EA 1G18A 1KOFA 3A1WA 1TQ6A 2YOGA 3DOEA 2EFDB 3T1VA 3SHFA 2PL3A 5JJLA 1EX6A 3GFOA 2WKPA 1KO5A 2VHQA 2PT5A 1TEVA 4KFUA 4M1OA 4BFZA 1M2OB 1Q44A 1YVDA 2AK3A 4FD2A 1X8JA 2BBSA 2I3BA 4EFMA 1P2UA 3SQXA 2I1QA 3UG7A 1QRAA 2GXSA 3WBJA 4PR0A 2JASA 2J0VA 3AVQA 4HYYA 4QXAA 3B5JA 2XZLA 2IS6A 3VNUA 2WM9B 5JWHA 1M7BA 3B1YA 5C18A 3CUEF 5LD2C 3T35A 3TE6A 1K8RA 2BMEA 2IEYA 3CR8A 2WIBA 4LUCA 1WDTA 5TB5A 5FUWA 2IYXA 4LJ4A 3R9WA 4QBFA 2A30A 4G5QA 4ESHA 1YZTA 2KJQA 4KFTA 4B43A 1D2MA 3QSYA 3CRQA 2EQBA 4FMDB 4ABYA 1G17A 1N25A 1EGAA 3QBVA 4MRPA 3RABA 4Z1MA 1E1RA 3K0CC 3GLIB 1XEXB 3BB1A 2ZE6A 1E69A 3KFXA 4CIDA 1OF1A 2OCBA 4BLOA 1FUKA 1E4VA 3SQWA 1MV5A 2RGDA 1Q1BA 1R2QA 3LXXA 5LB4A 1Q3HA 2EW1A 2GXQA 5IT5A 5G3YA 3U60B 1U0HC 4IDOA 3GEIA 1X86B 4GI7A 4ZIRB 1HTWA 3O8DA 4ERNA 4W9MC 4A82A 2OO7A 4S2EA 3IPYA 3GLIE 3ZQ6A 4AURA 2QE7D 3AM1A 2HCJB 5FR2A 1E2MA 2VF7A 1UJ2A 4LJ6A 3IO5A 1WXQA 1T3SA 4CT4B 1ZU5A 3NVAA 3QKSB 1I2MA 1K6MA 4TMTA 5J40A 2Q9AA 3LFUA 4BRWA 2G6BA 4DLWA 4Q21A 1AK2A 1FFHA 1RYHA 1U81A 1VYTA 2C77A 4PAOA 4EPXA 1PV4A 2FU5C 1T3LA 1UKYA 2C78A 1CS4C 4IXMA 1NL3A 3TR5A 3BFKA 1XF9A 4URYR 1P2TA 4A92A 4DDUA 1AS0A 5LBIA 5B64A 2J0QA 2O8DB 4CT5A 1W4BA 5CK4A 2VEDA 1AM4D 4E09A 4QNMA 2O0KA 1HQCA 5CJPA 2F3TA 4KFSA 2VTKA 3V00A 3GLIA 1XEXA 5DYGA 1MRNA 1QG2A 3KB1A 2H8KA 5C1BA 1ZM2A 5JHGB 1KJYA 3QVVA 4L8GA 5HCIA 3KQKA 4POAA 3THWB 2MMGA 1IXZA 3W3ZB 5SZIA 4HB0A 3W5IA 1ZM7A 1KI1A 2VHCA 3A6PC 4HZUB 4R2HA 1E6CA 3ADDA 1P9WA 1VPLA 4RD1A 3PUXA 1G5PA 1VCNA 1VIAA 4ACBA 1D6JA 2PX3A 4QJ4A 2J0UB 4JBXA 3REFA 1II8B 4ZIRA 4RKFA 1NY5A 3FMOB 3OFNA 4MRNA 1UDWA 3ADCA 4KYUA 4GP6A 5SZJA 1MH1A 2QP4A 3ICQB 1IHUA 4EJSB 4BWYA 1LW7A 5A4JA 1ZIPA 1YQTA 1TNDA 2WSSA 5DGXA 5JZVA 4B2IA 2FMXA 2A7QA 5EQTA 1E3MA 4JLAA 1CRPA 2DWPA 1E0SA 4AYTA 121PA 3OZXA 3WYAA 4QBGB 1OYYA 1FX0B 1KY2A 2LWIA 1E2QA 1XX6A 2WMOB 4US2R 5CM8B 1IN7A 4PFSA 4C0LA 4B2PA 1RE0A 3R8FA 4URZR 1CEEA 3EZ2A 3MG9A 2KE5A 2Q6TA 3S1AB 3ADBA 5CDFE 3UKDA 3CRW1 2O0HA 3FKSA 4RY2A 4Y0VA 2O8DA 2CL6X 4I1OA 4YDSA 1AQUA 3RAPR 4PSAA 2V54A 3GFPA 2IF0A 2IYUA 1E9FA 1N0VC 4LV5B 1ZINA 2BKEA 3LXRA 4EUNA 5HZHA 4Q18A 2IW3A 3FVQA 4W5HA 3THWA 3U4QB 3L0OA 1G7TA 1RZ3A 3B7GA 3U7EB 3WYFA 2FA9A 1Z28A 4HZUA 1G8GA 5EJEA 1J7KA 3GJ3A 4QOSA 4AKHA 1PLKA 4URXR 2GEUA 2XTMA 4GL2A 1EWRA 3B82A 2A5YB 4UNRA 3GLFE 3A37A 3F3YA 1U8ZA 2J0UA 1II8A 2ZYWX 4XIGS 3FKSD 4BLRA 5K8TA 3LQQA 4C3ZA 4TZ6A 3RLFA 1COWA 3LVRE 2P0EA 5FR1A 1TL7C 5CDFA 2Q9CA 3AVYA 3I62A 4EJSA 3DKPA 3K0AB 4M1TA 4NE2A 4X8HA 2RGGA 4LI0A 1QHIA 4RD3A 3ZJYA 4HATA 3JZAA 5FPHA 4BZXA 2ZSFA 2H16A 4Q7JB 2QM8A 1VIYA 4MGYR 4DLSA 4YQFA 3AVPA 2GAAA 3UMRA 2RGNC 3K9HA 2Y8EA 4IVPA 4PTLA 3C5CA 4TL8A 4XWKA 3U3RA 2RH5A 3S1AA 3H1TA 1T8UA 4PPQA 3B1VA 3PCRB 1CRQA 1OIXA 3CX8A 5KHOC 2CDNA 3AGQA 3FDIA 3A4NA 3QBTA 3PG5A 3GLFA 2ZR0A 3HR7A 4KSBA 4C7OA 2KBEA 2ZJAA 2R8RA 3T06B 4OQNA 3KJIA 1E9AA 3WY9A 1TTTA 1BO6A 1IJEA 4ZI2A 1VCMA 4Q19A 3FWYA 5GJVC 1MO6A 5G41A 3U4QA 4BFSA 5DNYB 1GOTA 2QRNA 2FFBA 3GJ0A 2D74A 2OCYC 1T6NA 5CLLA 3RS4A 2OCPA 4YXWA 1N5IA 2CLSA 1JEDA 2NO1A 3EAQA 1US8A 4C2TA 1E4YA 1ZM4A 3GLHA 3TUIC 2X8AA 4JT4A 2VIIA 1XEWX 5KSPA 2W0SA 2WHXA 4TN1A 2JCSA 1G3UA 3GJ8A 4Q47A 3SS8A 3VAAA 3TW8B 4NMMA 2H17A 4JLMA 4N1AA 3K0AA 4QC2A 4XSHA 4O2LA 4KI0A 3K09C 1R0WA 1ZCBA 2GJAA 1HY3A 1YRAA 4IOJA 1MOZA 2PCJA 4OHXA 2A9KA 4XWAA 2D06A 1NJFA 3BOSA 4ZDIA 3U5ZB 4WBSA 2ODEA 4HLUC 4M9SA 3H2YA 2E9SA 2VSXA 4NP6A 4DBLC 5J4YA 1XZPA 3QUSA 3DO6A 3U3KA 4PC2A 4YXWD 3CM0A 1R7RA 3VTKA 2H1LA 2BC9A 4YMWA 1RRPA 3LW8A 4GMDA 1JI0A 4NYMQ 2LKCA 4BGDA 1JQLB 3V4FA 1Z83A 4AG6A 3MLEA 3NBXX 1KIMA 1BYIA 2DYKA 4B3CA 2CCJA 2QP3A 3OF5A 3QF4B 1X1RA 2AL7A 1NIJA 3IPXA 4B3XA 1OH5A 1QHHB 2ODBA 5JRJA 2JLYA 3ZD6A 3SBEA 4IDPA 3EX7C 1YU9A 4BZQA 2O8CB 4M22A 4KXFB 1XB2A 5JJIA 3UG6A 3LDAA 4EQ6B 4XTCS 4JVLA 4LC1A 1BMFA 5DLQC 2WPDA 2YVUA 4PQRA 4V0LA 1XPOA 2E1RA 2Q9BA 4TT3D 2PLFA 3DKVA 1X8KA 3BK7A 3FGNA 4AYWA 1G7SA 2H5EA 2P67A 1ZW6A 3BIFA 2BBOA 4LPSA 2ZS8A 1DADA 2F9MA 3EIHA 1P9RA 1A1VA 1G5TA 3QENA 2QZ4A 3N5CA 4P33A 3I1FA 1HH4A 1YZUA 4D82A 2Q21A 1DAIA 1IAQA 4JMPA 1VYVA 4JSTA 4A6XA 2XJ9A 3QNUA 1TEXA 3QXXA 4HDQB 5UKDA 1KJWA 2VL7A 3QKRB 3FKQA 4YMTA 3T12A 5L3SB 2EYQA 4TL9A 1Q57A 2WICA 3HDTA 1T0HB 5AJZA 3IBGA 4Q9KA 2A3RA 2WJVA 2OBLA 3B60A 1D2NA 2EYUA 2IL1A 4AC9A 1BYUA 2D4HA 2JGNA 2VP6A 2ZE7A 4NYJR 3K0CA 2F1HA 2ZTSA 4OBEA 1HT2E 2CK3A 2H92A 3CNNA 4JVMA 2GXUA 3VX3A 5JS7A 2DHRA 3QF4A 1DAKA 2CMKA 2CNWA 3R20A 4YMVA 2PCLA 1YZNA 2QQEA 5KNCA 2PZFA 2XSZA 2VYFA 2GJ9A 2J7PA 2BMFA 2OFOA 4TTRA 1SXJB 3A1VA 1EXMA 1D9ZA 1HYQA 3UPUA 3Q5EA 2HXSA 1JR6A 4EQ6A 1KKLA 1G16A 3JVUA 4JKYA 3W9YA 4ARZB 2G3YA 1QG4A 4X8OA 4ACAA 1Z2CA 4LYJA 3GQBA 4V0NA 1NLZA 1ZCAA 3FMIA 5TDHA 2LCFA 5JEEA 2ERXA 3ZIAD 2XGJA 2FEMA 4DJTA 3AVOA 1UDXA 2QT1A 3NKVA 2RMKA 4UKDA 1E96A 2RHMA 3UWOA 3QXHA 3VR5A 4PPNA 5CIQA 1TQ4A 3UIEA 4LJ9A 1SXJE 4ZDWA 2FFHA 3R9IA 2QBYB 2BWJA 2AKYA 1NBME 4PX9A 4A8JB 1GKUB 3A1UA 5FOTA 2J7PD 3BERA 3C15C 3TSWA 1P60A 2ZJ8A 3EIEA 3QEJA 1VECA 2DBYA 2XJ4A 2BM0A 3G82C 1KMHB 3QKRA 4AIIA 2ZXUA 1JJVA 4GZMA 3FFBA 3AVWA 1KI9A 5L3SA 4ON9A 3GEEA 1IY0A 4UNNA 1NVWQ 1P75A 2Z43A 3KKPA 1TPZA 1OV4A 1J8MF 3I5YA 1JR3D 5J4HA 4IVRA 2ZUCA 3N70A 3QE0A 1IN5A 5CM9C 2WOJA 2OAP1 5DHFA 3SI7A 4YDHB 3B1ZA 1QVAA 1XCGB 4IOKA 4B71A 2WKRA 1TF2A 4WAUA 3BFXA 4TWZA 4OI0A 5CITA 2L0XA 5EE1A 4MUBA 2P6RA 3GJ5A 2MMCA 3NEYA 1R0ZA 3ZD7A 2IUSA 1OLOA 2GRJA 4LV6A 4D80A 4C0SA 1VG1A 3FMPB 2YJTD 1RW4A 1NSFA 1SXJA 4TTPA 1JAIA 2ZSBA 3OHMA 5FH9A 1UBGA 1W1WA 1XXHB 1NBMA 2CCKA 4PO8A 1OFHA
chains in the Genus database with same CATH superfamily
3PNKA 1EFUA 5J5CA 1SOMA 1VHTA 2D6FA 2C98A 2P9CA 3EASA 1NX6A 3FJ1A 4WINA 2X8JB 4I2VA 1YK0A 3Q3JB 4YJDA 2ZZNA 1KJQA 3RRBA 1DARA 1YRWA 2XZDA 4AZ0A 2JJMA 4RPGA 4F71A 3DAYA 4Z8XA 1W49A 3FWPA 4LE2A 4RVFA 1W36C 4X54A 2AHOA 4KQCA 3ZIDA 2AFHB 4MVJE 1Z26A 2VJQA 2FMIA 2HDNB 4WZAA 1YDEA 2YRWA 5F2OA 2RJNA 2G9UA 2HBYA 1MB2A 4JJAA 4P3PA 2QBYA 3LP6A 1AS2A 3JTMA 5AW4A 1G7CA 1CP3A 3DXZA 5KYXB 1EUQA 2PD3A 2VJCA 2QVLA 2FRXA 2H5JA 4RWZA 4UM5A 3K70C 2NU8A 1K7EB 1OXTA 2ASEA 2Q1UA 3CF4A 3IAM1 2HF7A 3PFHA 4NAVA 1TA4A 3E22B 2C5EA 4DLBA 2FDCA 1DCKA 1AF7A 1Z39A 3VHXB 2ZFUA 1NZJA 2AJCA 2AFHE 3O38A 3W05A 3AHDA 3COPA 4IOMA 5T4BA 2DFLA 3UQYS 1JEOA 3WMFA 2NQ2C 2FWBA 4UUOA 3V3KA 5BUSA 3M4JA 1KC1A 1P6XA 3N5KA 4YRRA 4OREX 1ZUNB 3BB3A 4E33A 2DJIA 1YOVA 1ZEJA 1F0KA 2IYZA 1LJLA 1QFJA 4W9RA 4WV3A 2FP3A 4GZ5A 3MGCA 3TD6A 5K0SA 2YTZA 4LDQA 2XNDA 4C29A 4F85A 3OJFA 2IH5A 2BGTA 4J6EA 3FE2A 3ZXUB 3PENA 4MV5A 2RJ3A 2VRWA 2IH2A 2ET6A 2PDAA 4O4LA 1KPIA 1S96A 3C74A 3DZHA 4ZI7B 1VCOA 4FBMA 5BVHA 2VF5X 2DKFA 4PLWA 1QG0A 1IEQA 4B3SB 4KVAA 2PFSA 4B71A 2JZCA 5CTJA 3P2MA 1NWCA 4V1CA 3G13A 1VHQA 2FY8A 5ICMA 1K3UB 1KP3A 3AB7A 4KN5A 4ZEMA 5TR9A 4GBJA 4TWBA 5BR1A 3NCHA 4RCZA 1P19A 2FSGA 3AEXA 3H4MA 3I2KA 3ER8A 2WSYB 1OV6A 3L7MA 2WMNB 1DXYA 4MXDA 2LIPA 2GPAA 3HYRA 2ETVA 3GCXA 4BOYA 4I55A 2BFFB 4HVTA 1ZG3A 2QF7A 4RZ3A 1U99A 4BFUA 3WTCA 1TM7E 5FIUA 4F0JA 4YAIA 5ALDA 3ROQA 4PAGA 1CERA 1L5KA 2BKUA 3RYFA 2AXEA 1PCXA 1O6GA 1ZNZA 1NG9A 3KOZA 2WU8A 1NLYA 2H7XA 2XZPA 3E1SA 2W8BA 4IDQA 1I1NA 1X39A 2R9VA 4GQBA 4PTYA 4KO4S 4XCQA 5ALIA 2PKCA 3UT5A 3WK5A 2M32A 1QHGA 1TUGA 1Z5ZA 3U4GA 2IQ5A 4WA7A 1SCJA 1Z2DA 3FDXA 4FT2A 4HQFA 4IQGA 4AUMA 3IEKA 4GVXA 1A9ZA 2CHQA 5I51A 5LOVA 6Q21A 1E79D 3W79A 3U44B 3HU3A 1E2PA 3D3QA 1IMOA 4UDOA 4PYJA 2Z8ZA 2R8ZA 4Y6GB 4BGEA 1L5ZA 4MV8A 2ENWA 3GEHA 2GBLC 1S5PA 4JSRA 4I9HA 1E7SA 3ULKA 1UEJA 3JS5A 4DR4B 1ZR2A 3JQ8B 1TMGE 3GZNB 2ZCVA 1DXOA 2EX1A 3ELUA 5KYWB 4OTZA 1AGNA 2BEWB 5BYBA 1QQ6A 3SCZA 3PI7A 5EFZA 5T4FA 1XQ6A 4F5ZA 1EH5A 2WR8A 3QPAA 2BGKA 2ZIVB 2XA1A 1FDVA 4JSYA 3WBKA 3TIXB 5KYUB 4JCCA 1DC6A 1ZMTA 2WF8A 4JOBA 2RCNA 4CTOA 2XB4A 2VSNA 3AL2A 3LD9A 4TUYB 4UZFA 4ZU6X 2FH5B 2ZVQX 3HVKA 4NCNA 2OSVA 3K09A 1W2GA 1W6RA 1R66A 4P3OA 1ZC4A 1K8ZB 4I99A 4JAVC 1QYDA 4UJ3A 4ZO6A 2WTUA 5H02A 4QT4A 4CMCA 1OZGA 2FV8A 3V97A 4BO6A 3ZHUA 3BL8A 1I0IA 3IPRA 1MR3F 2YOHA 3KU4A 2FR1A 3LYAA 1ODKA 1QPBA 2G0TA 3V4LA 5DM4A 3W2HA 2BHLA 2G72A 3LKVA 3MEQA 4BVLA 5TMPA 3AR7A 1YDGA 1EB8A 2OCGA 1EINA 1DXHA 2HAEA 3ZGVA 1KDRA 2ZSAA 4KPUA 2JGIA 1TO2E 3SEZA 3QEMA 1FPQA 2QD4A 3ZGZA 3UH0A 2JLQA 3JR3A 2F48A 4X93A 3QXSA 4A0FA 1DWQA 1P7ZA 2ZYAA 1EAYA 1U7UA 3T9CA 4BLSA 5HJ5A 5ECGC 2GZ2A 1BH6A 2YH2A 3KWLA 4RUKA 1SUEA 1UL1X 2WU0A 3OQHA 2F3RA 3BJEA 4RM3A 5HQ3A 2RKWA 1PWYE 2VUSA 1EDDA 3PHCA 2P3QA 2E4YA 4O0MA 5EKUA 3RV3A 2Y2UA 2BJVA 2X77A 3I9V1 4HFMA 4CLEA 5FA6A 3LG2A 1D3AA 2WF6A 3IVXA 4MS1B 1HOXA 1ZJYA 1WX1A 3JXEA 4ENQA 5FBRB 1P5JA 4JI5B 2C4MA 4JB0A 3SG0A 1XXLA 4D3FA 2DG2A 2HCTA 4OHMA 1RFLA 2GETA 2K6GA 4P34A 1ZZGA 2CMHA 4OYRA 1ZJ5A 3IRVA 4LHZA 4RDXA 2VI5A 4JB8A 5IHXA 4B3GA 3LRXA 3MNFA 4J2OA 2UVDA 1RRFA 4GMHA 1IHXA 3H5IA 5HKOA 1R5NA 3AJ9A 3LQRA 3LC0A 1K97A 1MA3A 2GVDC 1EWVA 1RJFA 3DEAA 3ROEA 1OPRA 3MK31 1F3OA 4YT5A 4OXKA 7ABPA 2UZAA 4BWFB 3MM4A 3ICEA 4RV4A 5KWJA 2VF8A 2Y0DA 1K5GA 4I46A 4GQIA 1R8YA 1HQYE 1U2ZA 3JTEA 3WP1B 4NABA 1GEEA 3TNFA 4QFMA 4KI7A 2WUVA 2GARA 1MKYA 3G5LA 1TZKA 2Q4DA 1L7MA 1Q83A 2GZAA 4DMGA 1ZC3A 2B3TA 3NUGA 4Z4HA 4LSMA 4CQMD 2PSEA 3F49S 2IEDA 2K7FA 3FPKA 4QKQA 2R7LA 2C1EA 2AV6A 4R1TA 1A97A 2R6JA 2NUAB 1I2DA 5K3CA 4F8JA 2P2ZA 3IODA 5K0CA 5EJAA 3PTAA 4AG3A 3P26A 4QZVA 1GGEA 2YWFA 3HCFA 1OSNA 2IK8A 1C3LA 2BV3A 2GFQA 3HMKA 1XA0A 3IVRA 3MJ4A 4J0DA 3WIDA 4D45A 2R68A 5IKXA 2AKEA 4P84A 1LNSA 3FPFA 4FHEA 5DLPA 1SULA 3KE8A 4IRMA 4TQAA 2ZPAA 4PC1A 1I2ZA 2VPQA 2GBGA 1Y63A 1HDOA 2JEZA 1GZ3A 3WB9A 4CR6A 4CUZA 3PITA 2UZ1A 4NZNA 4OOFA 2I2DA 3B2NA 3E5HA 3ODGA 1IWOA 4P31A 4WJZA 1ADYA 4MTCA 3EIXA 1JKMA 3JQQA 3UKJA 4CDMA 1I7QB 4MUFA 1AZWA 2BGLA 2CL5A 3O8OA 4K40A 4KPFC 1DOZA 3RK4A 4EI8A 1ZAKA 2HYDA 3AILA 3NYRA 1OYWA 4NBRA 4TYNA 3E2IA 3M6MD 3L8ZA 2R79A 3NKFA 1N9GB 1F06A 1TCCA 5HK9A 3BXEA 3BDIA 1M2VB 2QDKA 2Z04A 3HGMA 1Z0DA 3IQZA 3UB3A 4LF4B 1PFYA 1JZQA 2XMBA 4BO7A 4DQXA 5ESXA 4RYDA 2QUZA 3PF8A 4D0GA 3QE3A 4IF6A 3ZZMA 1SZPA 4CN8A 2VP2A 3CLTD 4MB0A 1RQ2A 4YCBA 3JPWA 2CMFA 2GCIA 1HE2A 2EATA 2MSWA 1LTQA 2ZANA 2WB2A 3QLJA 4KDRA 1RFGE 1AB6A 1YRYE 1AKUA 1ISPA 4AAYA 1K3FA 3G79A 3GDFA 1SA0B 4X84A 3R7FA 2XCUA 3O26A 4RY9A 4BEJA 3OIWA 1NJ5A 1DKLA 1X2BA 1ADBA 2UUCB 5I8ZA 2XAUA 1HFWA 3RYTC 3A9SA 1BXZA 4WFKA 1GGNA 3ODPA 1IQPA 1T0JB 4NCBA 3UUWA 4YXFA 4QXPA 4RVHA 5C32A 5KNDH 1WMEA 4QYIB 3LF1A 3RBVA 3BWMA 2PV7A 1FTSA 2FRDA 3CKLA 1X7XA 4FX5A 4YRJA 1E2EA 2ETXA 4F4IA 5JFGA 2BTEA 4QATA 1AQJA 5COAA 9GPBA 1EIZA 5CB4F 4K3VA 2X2FA 2UXDB 1EUCA 1IM2A 4G01B 1UDAA 2BFPA 4CBVA 3AMVA 4MI3A 4JLBA 1JEQB 3NBAA 3I2HA 3WKDA 5H4GA 3AF1A 5JH7F 3BORA 1EPUA 1CTQA 2Z2JA 3NHLA 5TMBA 3HN6A 4Q82A 3EGWA 4MV6A 3DZJA 5KSOA 1JDTA 2X9GA 1UJCA 1FXWA 1ZOSA 3GRPA 4KIUA 4ZCLA 5HUHA 1U2DC 1UBEA 2B8EA 5JBQA 1GPDG 4DSTA 4YRSA 3KLPX 2VTBA 5KS2A 1SBIA 1T2AA 5CLIA 1QFMA 3DVQX 2FQ1A 1IFXA 1PLJA 5JLAA 2EV9A 1XUOA 5CA1A 3RVSA 3B1JA 3PJDA 3LBFA 2WRZA 4IUCS 5ALSA 1J9EA 5H80A 1P5RA 2G9RA 3E2PA 2NU9A 2DX7A 1HXHA 2OM6A 3CLSD 5GJWC 2F55A 2I1WA 1S8FA 3LL4A 4WXHA 4C04A 1JVNA 3N0XA 1SBYA 1UM9B 4GSLA 3NT5A 4J8PA 4MR8B 3VQTA 4B4UA 2ZBFA 3NTRA 4J0FA 3HXOA 1TUBB 2SBTA 5KJEA 1E9EA 3D6FA 4JJ7A 4KQIA 4MWDA 1K6EA 1OZFA 3L8FA 4DV1B 5AXCA 2R65A 5E6SA 1CUFA 2BTQA 1C0IA 4PRKA 4JZYA 2C07A 2J9GA 1R0YA 4O2BF 1BFKA 1PJ2A 1JHPA 1SOWA 2Q99A 4ENPA 2VLIA 3ETNA 4OIFA 4KLNA 3D4IA 4HAYA 3WB2A 2R7AA 4CM4A 1LQUA 3K1AB 3O3OB 5JYDA 3PFBA 4KZKA 3VKHA 4CUKA 4NE7A 3RYIB 5ETJA 2Z98A 1L7VC 2GD2A 1DTEA 1E3WA 2LTAA 3JD1A 1OH7A 3W5AA 4KX3A 3HPQA 1UXKA 2CXNA 4FOLA 2NUTB 3O74A 2NADA 4TLLB 5HFJA 3Q9NA 4ARSA 5A9SB 1BJKA 3CRRA 3IEIA 1WSBA 2OWEA 3ENKA 3H5VA 4P86A 1VYUA 3RJZA 3TDMA 4B84A 5A3RA 4Q7EA 3R7DA 3ITKA 3A4YA 3PB3A 2CLEB 2QZPA 3OM1A 3URKA 1C1XB 3OTGA 3G17A 1GLNA 4KSCA 2OORC 3QNMA 4NYIQ 4BFCA 1KNQA 2PH1A 3K9NA 5CLHA 1R15A 5DP1A 5HCNA 3ZDAA 2VAMA 1O96B 4LJAA 1L8AA 4UD6A 2AX4A 1CUYA 1OIVA 4F2PA 4Z0TA 4J0GA 4YCCA 3NHWA 1K6JA 1M72A 1L7AA 4LBVA 2PMCA 1KDTA 3CWCA 1J0BA 4ZYWA 3RRMA 1T13A 2G83A 3NOQA 3PYMA 4PGGA 3CUKA 3D64A 5KSZA 4ES6A 5KYGA 1GU7A 1EYZA 2ZE5A 3F9IA 2WNHA 1IZ7A 1EEHA 1NLFA 2HUPA 2UVPB 2ZJ7A 3A1CA 3KHTA 4G24A 4N48A 5KNCH 1N33B 1H1LA 4P4SA 3GFTA 2OCIA 3GF4A 1NQTA 1G0NA 2CNNA 2JBHA 3H87A 3MWEA 4LHSA 5AM0A 1ZH2A 3WGYA 2YCBA 2L2QA 3VI4B 4DUZB 3QVMA 2NTNA 5M34A 3Q9UA 2GWRA 2CXHA 2Q6OA 3AM5A 3KLNA 3HVUA 3TIFA 4RTLA 2E0IA 3FCEA 1DIOB 4ZYYA 1XAHA 4YUXA 3RS8A 4BRZA 1F1BA 5LD2B 1YS4A 1DAGA 3RUAA 4MVJM 3TH5A 3IAS1 4HDKA 3ZGXA 1QQ5A 5U1PA 4X00A 5BWOA 2ORIA 3DG9A 4UPDA 3MWLA 5AK6A 5IMBA 3UOGA 4RVNA 3U4CA 1E2LA 2PHZA 4B74A 3FMFA 3PC8A 4JB2A 1OLXA 2IFTA 2BN4A 4KLZA 1SEVA 3E15A 4R2MA 4HXFB 3RT9A 4FE4A 3C7CB 4PO9A 4XWYA 3CW9A 4YONB 3RFTA 4ND3A 1QQTA 4BO0A 1VJCA 4FIDA 4XFJA 1QCDA 1VQ1A 4D92A 3WYNA 3N0RA 4R05A 4NCKA 3FGPA 3FVVA 3PHGA 3OQBA 2AOTA 4DJ5X 2X7HA 5DSXA 5ES4B 2AOXA 4XVRA 2RC6A 2XLBA 4J16C 1D1PA 1FNMA 1KOGA 4AM8A 3IV7A 3LUDA 4REMA 3OF2A 5E7JA 2QLLA 1V9LA 2NUAA 3Q0IA 1WW8A 4DLRA 1E1MA 1DX9A 5LDHA 2J7KA 1P0FA 4C2AA 4COOA 4UBNA 1XLTC 4L5CA 4PFQA 3HXTA 3GUYA 5F9HA 3HG7A 1U0EA 2I78A 1ZIYA 3HPRA 3UXMA 1GGKA 2ORWA 2JFOA 3DP9A 2B6NA 1VJ0A 3UMSA 1MW9X 2GD6A 3PGJA 3ILXA 2YUTA 3ZE2B 4MEAA 4F12A 2J0SA 5EKXA 3F46A 4E1VA 4JNCA 4JYZA 3BD9A 1C9YA 2FMHA 5BORA 3Q0TA 3KSRA 2FSHA 1YSCA 4N0DA 3UANA 3KWMA 4ALNA 1BVUA 2ZBUA 3WHLA 4D26A 1KETA 3M89A 3R7WA 2HU8A 3C43A 3F9CA 1Z06A 4D96A 1EFLA 2GJ8A 3O8QA 1OXVA 1QCCA 3RSCA 2O57A 3DCIA 2VDUE 4LXGA 1FUYB 4MR7A 4QT0A 5BN3B 2A94A 1E6MA 2Q5JA 3GT7A 3M5DA 4X3PA 5EMMA 4AS3A 4RF3A 1H8ED 2R1UA 4N3GA 3NBFA 4C4OA 4D8VA 1VL6A 1UT5A 5K8IA 1SU6A 4JT2A 1ESNA 2OHFA 4U4AA 4CLDA 3M6XA 3ZCUA 4M1WA 1KZYC 3FDZA 1WOYA 1QKKA 4EVSA 4GX0A 4DNPA 5JAIA 4MKZA 4DJJA 4CF4A 2ZAOA 4BFVA 4OATA 4MO2A 5COBA 1G1MA 1M6EX 3EFBA 3IP1A 4JUFA 4XDGA 5E4YA 5TQ2B 3RUIA 3C3DA 4YCDA 2OQVA 5JG7A 5IPFA 4MDEA 2IDZA 3DL7A 1T91A 2HZBA 3K6RA 3D5QA 2X5KO 3VO2A 2H0RA 1POWA 2F7SA 2W2MA 3F6SA 3HSYA 3EVBA 3QUBA 3NZEA 2AIRA 2DKOA 2NN3C 1G3MA 3GEDA 1YMQA 3C1TA 2QD1A 2ZTVA 3OD5A 4NJOA 4FOOA 1LDNA 1SIBE 3OZAA 1O5IA 2ZIXA 4JS0A 2ZUVA 3L6DA 3N7TA 3M1AA 3ZDDA 3TKLA 1Q7RA 2JLXA 3LPCA 3PPWA 5JNTA 1OFTA 2JIPA 3PFWO 4MO9A 1CEYA 2C2BA 2K2QB 5B6PA 4QSMA 3EXEB 1T36B 3ZWAA 3NP9A 1AHIA 1B0AA 2LXNA 1FY2A 5D3MA 1U98A 2YC4C 3COJA 1GZDA 3ZY4A 2JLWA 2DFPA 4ZKEA 2W4MA 1GNQA 1W6UA 4CKWA 3LUFA 1DT5A 4M4SA 3DUFA 2IEGA 3B70A 3GC6A 3WKAA 2OV4A 3K94A 4E4TA 5IXSA 1DIBA 4EEKA 4X1KB 5A0VA 3AEQA 2MOKA 1FLNA 1TQDA 3LUAA 1E3SA 1RYNA 2P2YA 1PVOA 1HUQA 4XUGB 1ZNQO 1AD2A 1Y8CA 3R6GA 1KI2A 1DBWA 1JS1X 1SO8A 2HT6A 5KVVA 1SKBA 2G1KA 2BCEA 4N5MA 4GI2A 3UC9A 2H65A 4G9BA 2FMTA 1GAWA 2ATXA 3F6RA 3J81A 4FVTA 4JH0A 4QBTA 3H86A 5IYZF 4YPFA 3I5XA 3LQFA 1S2MA 1M5RA 2WUFA 4U0JA 4BQOA 4YMSA 2NSLA 4H17A 4MRVA 5B55A 3P2EA 2GLTA 4DQDA 3OMXA 1E77A 1I10A 4DQVA 2QSZA 2PGAA 4ZJYA 3CX4A 3U2QA 5ALKA 4CF7A 1LXCA 2YR0A 1PSWA 1IBRA 1U1GA 4WXRA 4A5OA 1C30B 4Z4EA 2I66A 2KI5A 1N5KA 2NZ8A 2ONKA 1KYQA 2QAJA 4HVLA 4I4TF 5CCBA 3KVOA 2PA3A 5AICA 2D8MA 4YQZA 3T6KA 4EYEA 2TMGA 2P62A 1O3YA 4RMJA 2R4UA 2M2IA 2CHUA 3BILA 2CLIB 5DSZA 5T57A 2GLUA 3DPSA 3G2HA 5CXUA 4BBAA 3SOPA 1ZVMA 4HQRA 1OVMA 4OYHA 4ZCRA 3KVNA 1JQ5A 5FEUA 1Y6GA 3HA7A 3JYLA 3K5HA 1KL7A 4IDNA 1OWLA 2FNAA 1LS6A 3PNVA 2ZTHA 1VJGA 2R7KA 5KYNA 3B3QA 1LPNA 1O94C 5FA5A 4Q93A 5JCJD 2D00A 1I30A 3AI1A 4EYKA 2H4YA 4YA6A 5KYKA 2IHBA 4PXYA 3VJRA 2D1QA 3DCYA 2IXAA 3HABA 3IVCA 4MKFA 3H9BA 4KUEA 4Q1DA 4M2LA 5FHQA 1JIQA 3LFTA 4FM9A 2YWBA 4G67A 5AJUA 4JASB 4Y9SA 4FYXA 3G9QA 1I4LD 4G1MB 1DRVA 3GI1A 3KJZA 3LKBA 4YAGA 5JWRA 1S8AA 4BNFA 3FOCA 3HBLA 4K6CA 2VCYA 4IH4A 2KLHA 4OGLA 2LIVA 1XZJA 2DSTA 2WJ6A 2F3QA 3KTAB 3J81k 5AVKA 2QD2A 5D86A 1D6NA 1RAIA 1HDZA 1KE1A 2NPFA 2O2JA 3BTUA 3VSCA 5I9NA 1RQ7A 2JI4A 1T0UA 1X13A 4Q3LA 5EMKA 4EG8A 2NU6B 5KC9A 3NIWA 1QV6A 1G0OA 2G4LA 2J9FB 2R1ZA 1NAHA 3PXBA 2I6XA 3OZCA 1KRHA 3B48A 1MC5A 1SVKA 2A67A 4WKOA 3PIDA 4ZRNA 2QMQA 3PEVA 4EFDA 3VKWA 3HO1A 1HDIA 3H5WA 1XIVA 3LX8A 1O57A 4NPAA 1SUFA 4YN3A 1ZVVA 1F4PA 1U1EA 3DQPA 1NVGA 1XTZA 3LOPA 3THYB 1E5XA 1B43A 2BVNA 3L6EA 4UHBA 4EO7A 3GJXC 3GCWA 1W5EA 2C1XA 4TPKA 1HKHA 2C2ZA 2W98A 5ALOA 5E3IA 1IJFA 2JRCA 2YICA 4WY5A 1QGED 3UT0A 1YA4A 4AD8A 4BEWA 3GJSA 4UU8A 3V8BA 5DLDA 3WIUA 1WDKA 2Z6UA 1Y1RA 2BSXA 4UHJA 1ATIA 1F2TB 4XWOA 4UUNA 4Z1OA 1CVLA 4YGXB 4PIMA 1GPYA 1KI7A 3LPLA 4BRUA 1N5JA 2I34A 3LT1A 1H2XA 1VIVA 2FE1A 2J4DA 2OCDA 1GNVA 2JHPA 3CINA 1H2RS 1Q1EA 3W8RA 3K6SA 4YGYA 3WTBA 1FF9A 5HP4A 2JLVA 3MD9A 2I9KA 1AT1A 1G8KA 1N6RA 1Y8QA 2WE7A 4EY8A 2C8LA 3OTOB 3ID6C 4FQ7A 3TRJA 3KELA 5CIWA 5AKXA 1PWEA 3INYA 3K72B 4KH1A 4OXRA 4P93A 3VSAA 5JDIC 4QPCA 3U3DA 2Y9PB 1T2DA 5CFQA 1WA5A 1V7PC 4D98A 4Y2VA 3DZIA 1UAGA 1JIXA 3QUCA 4HHEA 1ZRHA 2A0FA 3DFZA 3PR1A 3L4KA 2QLMA 4ND8A 4X0EA 4PSVA 1DEHA 2V8BA 1F6WA 4Y1GA 2BYTA 2CLHB 1BMQA 1PG2A 3WYEA 1RPAA 2WIGA 1HDCA 3K4HA 4UXIA 4RTQA 3MT7A 1VKNA 3JVDA 2TYSB 2ZRGA 5LBUA 3IVMA 3MMXA 2JLSA 3WIOA 1ZIXA 4D4MA 3GDHA 3ABZA 1U5BB 3JQ9C 4PYQA 4TOIA 5DSTA 4EJ2A 2H29A 4XH9B 1XMOB 1OT3A 2DZDA 2O3QA 4OQEA 5LXTF 1O0SA 3G23A 1KZ4A 1DTSA 2GTIA 1JYEA 2O07A 4A6PA 3ZKWA 5AFSA 5B4UA 1NN0A 1G5IA 2JJ8A 3FHCB 5DI3A 1W7AA 1TM3E 3KR2A 2JB9A 5EFOA 3H8WA 3WXMA 2P9YA 3PHIA 3FOBA 1ICIA 1Q19A 1DKRA 2C95A 2HNKA 2QOEA 2YWXA 3CB4A 7ADHA 1P3DA 2G25A 3WGIA 2AOUB 3RHTA 2WFAA 3ZBTA 2WD7A 2ZI5A 2ZR7A 1RPJA 2DUNA 1ZNWA 2NV0A 1M8GA 4HAUA 4EHKA 1DZIA 2POCA 1OJ7A 1THZA 2OXRA 3HBMA 1KA9H 2Q1TA 2V4MA 3D7LA 3ZHQA 3ZCSA 2RD2A 3BMQA 3K4PA 5BT9A 2FEAA 1JG7A 2VDQB 5AVXA 2CF6A 1KGDA 1IVSA 1H94A 1X7ZA 4U9HS 2NPOA 1GZVA 4EY6A 1KGSA 1E2UA 4RGQA 3VPDA 4G0VA 4BNTA 2YZ7A 3OOHA 4KQ6A 4QBIA 2YBEA 5G1OA 3F97A 3GAZA 3P2YA 1D4FA 3MN1A 5FPYA 2A33A 3QVGB 2B4KA 5HR5A 5LPNA 2RARA 2GRAA 4Y2SA 4AS2A 2JFZA 2QVYX 3AOGA 4DWWA 3RYCA 1DEOA 1H85A 1JPUA 1PS0A 5JZMA 4AJOA 1J20A 1WULS 2FGJA 4N40A 3H11B 4CV2A 1SUWA 2PUCA 3LGAA 3OSZA 1FJHA 3DBLA 2B25A 3MWKA 4XQCA 1BKYA 1A71A 4M0FA 4PONA 3MGGA 4YJ3F 2DXIA 3KOWA 3A1DA 1GEGA 1LVGA 4O5AA 5B2EA 1XTJA 2XB8A 1AMUA 2WT4A 4D4LA 1T6XA 3IV6A 5F23A 4U5QA 3O47A 3RC3A 1WHTA 3RUPA 1JHZA 4JVOA 4M0DA 4Q4JA 1NN1A 1P0PA 3SJAA 1QGAA 3I52A 4ZHSA 1ULSA 2BGJA 2G88A 1BN7A 2PVCA 2YL2A 1EJ2A 4LBWA 1CR2A 4G26A 4Y7DA 4XWWA 4HMQA 5LWQA 3SZMA 1WU8A 1J7JA 4F21A 1FYVA 2XXAA 4R1UA 1VZ3A 5THQA 2DOKA 3NRCA 1D8TA 1E9CA 4HD8A 1NDHA 3EZXA 1RP1A 3JQEA 4QASA 4AVYA 3MFYA 1SUCA 4M87A 1YTUA 3RVRA 4EDHA 1G8AA 1IB6A 1E1YA 1PEKE 5K99A 3K16A 1UPCA 1GA6A 1YD7A 2XADA 2C0QA 1S01A 1GXSB 2WFLA 4LHVA 1WSDA 4TYMA 4X62B 2C59A 2WWVD 5IG2A 1NKTA 3MSXA 2PMWB 3ZNQA 3NBUA 3QJGA 4ZYZA 2JJQA 4YUAA 2XCQA 1YF3A 1XMXA 4RK0A 3UUGA 1C29B 3MA0A 3F9RA 2IHYA 3U80A 1IBSA 3G9TA 4KAAA 1KBOA 2WJ3A 4OG2A 4DEYA 1AKEA 5D85A 3RTCA 3CKKA 4JYMA 1TW3A 2HK6A 5BN5B 3RLIA 3DL4A 3NT2A 3CX7A 4D43A 3ABQB 3NTOA 4K2HA 4WOKA 3UV3A 4M1EA 2OENG 3GDGA 2P68A 4TSFD 3DBVO 4PNEA 2VH2A 3G2QA 3L79A 4MA4A 2QTCA 2GN0A 1JH9A 2Z6VA 4PGHA 4LX0A 3DE3X 1EDOA 1MC8A 1YJXA 5AT1A 1IOZA 3H5RA 2LDBA 1SCDA 4HDCA 4N8SA 2RI6A 4YMLA 4MTLA 1ND6A 1E3IA 3RRNA 4KQJA 4X8LA 1NDQA 4DYVA 3PJRA 3TUZC 1Z3IX 5ALZA 1DRKA 2OR3A 1JKJB 4RL6A 4MSUA 1HLGA 2X6RA 4RPCA 3O8BA 4Z4GA 5DO9A 2QN2A 1S1CA 3WI7A 1SMKA 2PUHA 3PQ2A 3HRIA 1KAMA 1YZYA 4OEHA 2QV0A 3ZXSA 2Z5LA 5DNUA 2EERA 5BSKA 2WMYA 4HDNB 5KKNB 3BZUA 1HLPA 1MNQA 2GHQA 3I2FA 4EVQA 5AK3A 1M1NB 5KDOA 2J5BA 1NN3A 5MN5A 5ILOA 4U2CA 3SNKA 4N54A 3BE8A 3IVGA 3QNWA 3EWSA 1PYDA 1MEEA 4KQGA 5BNZA 1PJSA 4MAMA 4X97A 4BMNA 5EIXA 2HXGA 3A6LA 3BJIC 3GGCA 5EIHA 5F7OA 1U28A 3TL2A 2JFBA 4KO2S 4QTZA 3EFOA 5K8VA 3P52A 4FTWA 1WCWA 3B6IA 3KAQA 3P7MA 1A04A 3BVPA 5JNUA 1R6AA 3BL6A 3ESYA 3JQFA 5DN6A 3VC2A 3S1SA 2CZCA 1YB2A 1RYBA 5FAKA 4JGBA 4Q3AA 3G8DA 4YP6A 3RFVA 3GN2A 3I72A 1DT3A 2H00A 4OFBA 5CW1A 2A1TR 5MDHA 4DIDA 1VL5A 5BOSB 3V8NA 5KOYA 4DKJA 3UZUA 3FVWA 4G0XA 2YXBA 3JYOA 4QXRA 2VK4A 3MQ2A 1UWVA 5TVGA 5C53B 2ESRA 1YXMA 3W1VA 4ZWNA 4Y30A 5LQSA 4GPD1 4A3SA 1MAWA 1BRMA 4TSKA 5CDTA 1T1GA 4U2KA 5CU7A 2JK0A 1P9NA 2J31A 3SSAA 2X8BA 4TN5A 4EY5A 2OHGA 2PZLA 5EJ6A 1AK1A 1EP3B 4KVGA 1YONA 4BS9A 1QONA 2FWPA 2WLSA 1R5BA 1PDOA 1WNTA 3AXTA 3DONA 4ENTA 1QVRA 2X1VA 2YXNA 5EZ6B 3QYPA 1P7CA 5LU8A 5J4VA 3AY6A 1V25A 2C9CA 1VE6A 1NQUA 2EWWA 2ONCA 3GYBA 3RUEA 3H65A 3UV6A 5AVUA 1YRBA 4EFLA 2DFNA 1D03A 4H77A 1F6BA 3TXAA 3CNLA 2PMDA 5DEIA 5BQFA 4G09A 1BWSA 3QU7A 4J91A 5G53C 2P6OA 1C0LA 3Q3CA 3QUQA 1EK2A 4L57A 4FWIB 1DLIA 1HYEA 2RHJA 2VNKA 2VXBA 5KOHB 2V98A 4G81A 4FB5A 2ID9A 1JYSA 3LX6A 3PPYA 2X13A 3E23A 3GGOA 1W35A 4J43A 4O4JA 3TCKA 3DKRA 4UD2A 2IH4A 1GPJA 4MCAA 1YIDA 1EQ2A 2LRHA 2PH7A 3RCBA 3KAPA 1NBIA 1YFZA 4LBZA 3SJCA 3D0RA 4GW3A 1I80A 2PJRA 5ENZA 1QB7A 1FP2A 3ANLA 4KMRA 5F7JA 3HWWA 3UEOA 4QG3A 1GITA 1RRGA 1WCIB 4BKPA 4BE4A 4C4YA 3FHLA 3P0JA 1LPPA 2CXOA 4IINA 4EYGA 3SHQA 2O8FB 1ZK0A 4NCAA 1JXQA 2H2FA 4WX2B 3CJQA 4KDCA 2WVGA 3BQNB 4CUJA 2NU7B 5IVKA 2AR0A 2VC2B 1WZCA 4BVAA 3LA6A 3LBIA 3EPHA 4XCXA 1SK9A 3C5EA 1TEHA 4DPLA 4MYHA 4TTIA 3DVSX 4R9VA 5C1PA 1C1YA 4XGQA 4KBYA 4A6EA 4KR3A 4NNPA 4IXWA 5JATA 1T1RA 1G8PA 4LJ7A 4JUAA 1ZD5A 1L9KA 4BL5A 3UATA 4M8IA 1KJZA 1O03A 3D3KA 5CLJA 2V03A 1BS2A 1LI4A 3TOZA 4WZ6A 3SC2A 3I92A 4KXVA 4BTEA 4F8YA 2WB4A 5ICSA 2Q3CA 2BSQA 2BF4A 2BMJA 1SXHA 5BVGB 4YRNA 5AUPB 1QC5B 1RZVA 4BO9A 4Z51A 2UYGA 4JL6A 4K05A 4J2TA 4MV1A 5DK6A 3VX4A 1F8XA 1P7WA 4KMMA 3ZHTA 4EDFA 5JADA 4G9GA 4C3UA 4U8GA 1CYDA 1W93A 3DBIA 4EG7A 4I5EA 2EHJA 3CUWA 4LXHA 3D2CA 2XUHA 4H4CA 3DMTC 1UT6A 4JOCA 1P0MA 4OQLA 4TV9B 4HVCA 2WJPA 4ITRC 4D9JA 4ZYLA 2DWCA 3TI9A 3A2KA 5JSZA 4GRAA 4EW6A 5FOVA 4IKEA 1FP7A 3EA0A 5TLSA 1L1EA 1NMSA 4Z2AA 1M7HA 3IAEA 2HNAA 4L1KA 4DLZA 5I7FA 5L3QB 2PU7A 2O8EA 2Q27A 5CB4A 5IMSA 3GEGA 1JEEA 3MWDA 4Z8YA 2XMPA 4LDNA 1ECCA 1PBTA 4JBGA 1FUUA 2PRYA 3UAXA 1GGMA 3VSBA 3ZBUA 1VJTA 4G4JA 3RS3A 2W7TA 4GH5A 2N46A 3AG6A 3BIWA 4IEIA 3HCAA 4F5WA 5JH7A 3U37A 4BEBA 1NNSA 4Y1RB 3TNJA 3ZE8A 4DLXA 1X38A 4CWAA 3GMSA 2WP0A 3B2QA 1FTWA 4YLYA 2OQIA 2GYYA 1JWAB 3C3XA 5I47A 1W48A 1U9CA 3CUUA 3E18A 3VHLB 4YRZA 1PR4A 4RELA 5FWAA 3PWZA 4G2NA 2H54A 2QSYA 3TFWA 3UO8B 3JAWB 3W5DA 3IRUA 5GVSA 1JAZA 3LXMA 3FR8A 2OXCA 3QBEA 4FR5A 3T15A 3T5GA 5F7XA 4L0QA 2CJPA 4RF5A 2F1JA 3RVNA 4B6PA 3EPJA 1DMSA 4XDYA 1P62B 2HIAA 3PCXA 3LT2A 1Q17A 3DHWC 5CBPA 2GEJA 2ZSIA 3COWA 1XZEA 1ZVKA 2BHRA 1EFTA 1JQKA 3KOXA 4H15A 4IJ6A 4PANA 4RLFA 3ZUPA 1HGXA 5JSHA 2XE8A 5E1MA 1XCJA 2OGUA 2GD0A 4HLDA 2BMDA 3D7KA 1P1BA 2QW1A 4GOKA 4URWR 2PL9A 1T35A 2REQA 3E0QA 3HDHA 1YB4A 3DEIA 3KZ1E 3VKGA 3RRZA 1UDRA 3CMMA 3GX1A 4Y2HA 3PX2A 4O2BA 1GZUA 1PL7A 2C7BA 4II7A 3WHKA 2D0DA 3BN3A 1Y7HA 1SKQA 3AUJB 4AYXA 1Z33A 1NUUA 2AMVA 3ACDA 2IYTA 3U40A 3ZGNA 4Q03A 1Y4UA 3FCCA 4C30A 1FRZA 5LP1A 4QU5A 4H3KB 4Q7QA 1OBOA 3OE1A 2J5KA 4BVBA 4JELA 4C05A 2FMUA 5LYJF 1B6RA 1YC2A 1OI7A 2ONYA 4UVHA 4DEVA 1MX3A 1YR3A 1KH3A 1P4RA 1E1LA 1WVGA 3H5AA 2ZVDA 1XZFA 3M3HA 4G5SA 3SJZA 3V4ZA 3EF0A 3A8TA 1HTTA 9ATCA 4PM4A 5TGZA 3UPTA 1JSLA 3LY8A 4KC0A 3M3DA 1EWYA 1D0SA 1U8XX 4HGNA 3IBYA 3PQCA 1G6KA 1VBFA 2KPOA 1C7IA 2OM2A 4K0RA 1C4XA 4NECA 4QGBA 2WV9A 3T3OA 1K0FA 1XMIA 3GMDA 2PUFA 1U90A 3OIVA 1S2LA 1I6KA 2B7CA 2IHKA 3N6VA 4IHQA 4R1PA 4RJIA 5F12A 2RHDA 3TQOA 4NV0A 1RP7A 3W5BA 1ENZA 1J90A 5IVIA 3O8NA 3IE1A 3LM8A 5DNVA 4WI1A 1F7UA 3DTTA 2AOVA 2GDZA 4PG8A 2A2ZA 3ANNA 4LEIA 3N2GB 4CU2A 2HXYA 3M6VA 2F43B 4RHYA 2DCUA 1JG6A 4XKJA 3QPVA 4RFSA 1RXEA 2SHKA 3ZPXA 3MCUA 3V80A 1HDRA 3IIKA 1Z0FA 4LBYA 4OU4A 1L4EA 2EZTA 1G8SA 4HUJA 4TQGA 1F48A 3QYAA 1I3MA 3EDYA 4M9QA 5D6NA 1Y42X 3CY6A 3T0GA 1EFHA 4RETA 2H1RA 1SCNE 1IY8A 2D2VA 5K4AA 2PKQO 5AKZA </