3IQGX

Structure of o-acetylserine sulfhydrylase in complex with peptide mnwni
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
310
structure length
309
Chain Sequence
AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Design of o-acetylserine sulfhydrylase inhibitors by mimicking nature.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 116
structure length 309
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iqgX01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iqgX02
3SS7X 5T6MA 1Z7WA 3CEPB 3FCAA 1K8XB 5B53A 3L6RA 5DBEX 1K7XB 5D84A 1CX9B 1O58A 5IXJA 1J0AA 3PC4A 4L3VA 3DWGA 4NEGA 1QOQB 5J43A 3DWIA 1KL7A 2ISQA 4QYSA 4D92A 5IWCA 5I7WA 5JJCA 1E5XA 3AEXA 1K3UB 5DBHX 1P5JA 4D9NA 5D85A 2C2BA 3VSAA 4OFXA 1TJPB 2DH6A 2EFYA 1K8YB 5DVZA 2CLEB 2RHGB 2CLHB 4PCUA 4D8WA 2J9YB 2D1FA 5DW3A 1JBQA 4D8TA 2TYSB 5J5VA 1KFJB 1J0CA 5D87A 4D9EA 5CGQB 4D9KA 4HPJB 1J0EA 1UBSB 3PC3A 3R0ZA 4L0DA 4LMBA 3VBEA 4HO1X 2CLFB 1RQXA 5KZMB 3T4PA 3V7NA 1BEUB 4JBNA 2GN0A 3PC2A 4D96A 1WBJB 4ZU1X 2O2JA 4D8UA 1TZKA 2CLOB 1Z7YA 1K7EB 5D86A 4LMAA 2J9XB 3ZEIA 1WTCA 4D97A 3DKIA 4AECA 5EY5B 4D9BA 3X44A 4NU8X 1TZJA 2TSYB 5B55A 1WDWB 4COOA 2EGUA 1K8ZB 1KFKB 1TZ2A 3VSCA 4D9FA 1A50B 5C3UA 4I1YA 1A5AB 2GN2A 1VB3A 5KINB 4H27A 5B3AA 1VE1A 4XUGB 3VC3A 4LI3X 2GN1A 3IQHX 3L6CA 3PR2B 4Y6GB 5IW8A 3SPXA 4F4FA 3R0XA 3IQGX 1A5BB 1TZMA 2JC3A 5I7OA 2PQMA 3X43A 1C8VB 5B1IA 4L27A 1K7FB 3SS9X 4JBLA 3FGPA 5CVCA 2RH9B 2ECQA 3IAUA 1C9DB 4OREX 1UINA 2ZPUA 5E0KB 1D6SA 4D9CA 1FCJA 1M54A 4D99A 2ECOA 1C29B 2CLLB 1KFEB 2ZSJA 4L28A 2CLIB 4IL5A 1Y7LA 5BW6B 2TRSB 1PWHA 4WX2B 5HBGA 4AIRA 1A5SB 2WSYB 2BHSA 4D9MA 1QOPB 2O2EA 1TDJA 4D9IA 1X1QA 3VSDA 1V71A 2Q3BA 1KFCB 5I7RA 1OASA 5I7AA 1TTQB 4ZU6X 3BM5A 2V03A 1J0DA 1TYZA 2Q3CA 1FUYB 2BHTA 2CLMB 3L6BA 3HMKA 3RR2A 5DW0A 1J0BA 2DH5A 4HN4B 5B1HA 5I7HA 1PWEA 4HPXB 4KKXB 4ZQCB 1UIMA 2Q3DA 4HT3B 3IQIX 2ZR8A 1BKSB 5I6DA 1KFBB 2J9ZB 1VE5A 1TTPB 2C2GA 3AEYA 4D9GA 1V7CA 1V8ZA 5B36A 1F2DA 2RKBA 5JISA 3TBHA 2CLKB 1CW2B 1WKVA
chains in the Genus database with same CATH superfamily
4L4UA 1MX9A 3CKMA 5YASA 4ICIA 2O2HA 3P9PA 4MW2A 3ENNA 2XYRA 1Y4SA 4K1LA 4ZOCA 2C3YA 5KJEA 3ZZ1A 3MTDA 1QK3A 5JAZA 4H7IA 2B30A 5KYWB 2WIGA 4B31A 4U8HA 1S8AA 3L7LA 4TKUB 3LXRA 3O4FA 1C9EA 1PJRA 3SYRA 1KK3A 2AZDA 1VL1A 4BB5A 5I7UA 3EGXA 4IYJA 4CM9A 1O9HA 2ADOA 3ZBPA 2GR9A 1N36B 1GPBA 4J1NA 1Y3HA 1YI8A 2O0HA 4I4CA 4HUQA 2VBIA 3IHWA 3WIEA 2R4TA 3EDOA 3GUZA 4EF4A 2VQDA 1K68A 2A3NA 2JFGA 2V6MA 3WL3A 3WKAA 3HYLA 4TX1A 1HT1E 1P8AA 3HUFA 2O1SA 5DE3A 5B58C 1SBZA 1RM4A 3PLNA 3NHRA 4RJJA 1UM9B 4UD2A 4BBZA 1F38A 3JVIA 3F2VA 4PZ0A 1NYLA 2PU5A 5I8WA 13PKA 4DR1B 4WLVA 4TRNA 4AJ2A 1O0CA 4JI0B 3DEFA 4YCAA 2ZM6B 3DM5A 3KVRA 4EYOA 3B89A 3EMKA 3VR5A 3KJXA 5FEUA 3A2MA 4RJLA 2CFOA 4OEHA 5DSXA 3AQ4A 2JLYA 2I6XA 3LUKA 1D9XA 4D0LB 3WNDA 1JQKA 2IW3A 2VHEA 2DB3A 2QT9A 3X44A 1N2JA 1NXPA 3I4LA 4HLCA 4A27A 1BG6A 5HE8A 4RHYA 4C4TA 2HK6A 2HFKA 3I2IA 1LLFA 2WSMA 4BY9E 4OUDB 1NDUA 3DEZA 1E3TA 3KQYA 4U3JB 5E7IA 3C0KA 4CM1A 1G5FA 3VR4A 2QR5A 1U7HA 2XQJA 1L9XA 3CN9A 3D6HA 3EAGA 5FOSA 5FFFA 3FETA 1J9GA 2HO5A 4OCZA 3V00A 5KTMA 1O97C 1HX7A 4JKIA 3TF5A 1QIGA 3DUFA 2ZJAA 1ZGCA 3T7AA 1J90A 5KJCA 1HK7A 4ER5A 1GGVA 3GX1A 2RH9B 5CEJA 5JNSA 1FQOA 4DV7B 1D4AA 2Q9BA 1YRYE 5A7GA 4UEOA 1CUYA 2AMJA 2VBFA 1D6SA 1PG5A 1YZFA 2FWRA 5HK9A 4HQKA 1IOLA 1GM5A 1MNAA 3U3OA 1RYFA 4DC9A 3N59A 4YJ2A 1H4SA 4QFBA 3U6BA 5KNDH 3DEIA 3IE2A 2BBOA 3QIAA 4CT5A 3ZTYA 1R8JA 3NV9A 4KACA 3GCZA 3OFJA 2IDZA 3GBSA 3VC1A 2AS0A 1DJOA 3CE6A 5T4BA 1ZJ6A 3GVPA 3UA4A 3A6EA 3U6KA 3MCUA 3CX4A 5I7AA 4EB6B 2HV8A 5HIIA 3ZC3A 2VDWB 4CF7A 4HMOA 3IVRA 2FRXA 1RAAA 1SKUA 2WWRA 1RQGA 4BNGA 1W94A 3WGVA 2A0XA 1AB6A 1J06A 4KKXB 3DZJA 2O2SA 3QVTA 4Q18A 2GCEA 1QGYA 2JIRA 1PKXA 1ZXBA 1G19A 1J2UA 4YJ3A 1OYYA 4MVJH 4OP2A 4UVDA 5HXAA 2C61A 4QECA 2VF7A 2HHCA 2X4LA 4E1AA 2G83A 2I2BA 3V4OA 1A8QA 3K72B 3ZG6A 1RFGE 3A9SA 1SK9A 2HZ7A 1WV1A 3AUYA 2LW7A 3CEPB 1YK1A 2HPHA 3NHLA 2QTCA 3KJNA 3MGBA 1K97A 3AUFA 2GS9A 4B46A 4GOKA 1RI1A 4HR7A 4IEEA 4NEGA 3KPUA 3GEIA 3WWPA 4EHNA 2VRWA 1NVTA 2YXPX 3QQPA 3V2UA 2JIPA 1GNLA 2BI8A 1GL7A 2O2IA 3K31A 4EP1A 2QTGA 1H8ED 3BIFA 3DFUA 2DKFA 4OBBA 1QF9A 5E3JA 1YQWA 3X2SA 1R5NA 2HEIA 1A9XA 2C2BA 1DEHA 2BEKA 4PIPA 1SKMA 1OLUA 1I13A 3WK8A 4ER6A 6CHYA 4B09A 2WIFA 5K3OA 1KMCA 3K5WA 5ALPA 5IDXA 3ZPXA 1PZHA 2FHSA 2QZ9A 3L07A 4PG6A 1PFWA 2AYZA 2BMEA 1NDQA 3FTEA 1H2EA 4QJBA 4AN4A 3CINA 1JHPA 3RS0A 4ZJUA 3E2PA 4F06A 3D7SA 4MV1A 1U9ZA 4POAA 4UBJA 5EZ5A 1RS0A 2NWQA 1R4MA 1JGTA 1WU7A 4ZVUA 2R6FA 1CDZA 1X9IA 3E2IA 4M9QA 4ZT7A 1THMA 5G4LA 3GPIA 3RT9A 1N0HA 3UK0A 3T5PA 3ZJVA 1ANKA 3ZEAA 3K0FB 4DANA 4EVQA 2PX5A 1EUQA 3G6KA 4J0IA 2YMLA 5F21A 1XYGA 5DX0A 1JU4A 1R4NA 3ENVA 4OHKA 3PIDA 3TFWA 1XE3A 1BX1A 3SIXA 4MAFA 3MOGA 2JIZD 3RF6A 3F6BX 4GM0A 3EPHA 3IKMB 2EDAA 3IAHA 1KY3A 1XEXA 4BNUA 2LR0A 3NOXA 1KEEA 1GA6A 1PV1A 4TTJA 2HHAA 4B4OA 3S6JA 4AWAA 2RSLA 1DRUA 4BN4A 3TTSA 1NRWA 1UDRA 4RIGA 3D02A 4D45A 2JCSA 1K7FB 1Y5IA 1NN0A 2JJ1D 2YIMA 3NP7A 2QVCA 5TGDA 4BGVA 4F5DA 2BGGA 1MJ5A 1G5IA 4F60A 1GUBA 1ZUWA 3KU4A 3QRWA 3VJMA 4ZVQA 3ZBTA 1Q1NA 1BJKA 2WSSD 1E3QA 4ZVTA 5C7LO 5KYYA 2O2DA 2PFKA 5SZHB 3WB1A 5JCPA 1TVMA 2ZEJA 3BXXA 1M0SA 3AHHA 4B3BA 4AIRA 1XQWA 4JI2B 2BCJQ 4BO1A 2V3WA 3IB3A 4GBJA 4EKDA 4U2BA 4ED9A 3ZDBA 1IM2A 2RKWA 3M1LA 1O7JA 2ZI6A 3DT6A 5F64A 1W5SA 2CFIA 3NBQA 5JH7F 4CEIB 4NFHA 1P5RA 1MABB 4A10A 4X6YA 3HI4A 4EITA 1U4OA 1Y89A 1UANA 3T54A 4REQB 3UAOA 2W90A 5ICEA 1Z4PX 3W2HA 5CT5A 1ONNA 5IVKA 2HF8A 4LHSA 2COUA 2YCLA 3AVOA 1FJHA 1WUJS 2ZRFA 4FDTA 4M1TA 4MB2A 4B4UA 2DEUA 3SIPA 1JV2B 1UDXA 2VSQA 3F73A 3ZW8A 4ZAZA 1E61A 1IQ0A 3UO8B 1K92A 2G17A 4MQ5A 2GWRA 2EKPA 5BT9A 4MHTA 5D2CA 1JALA 2PA3A 3HA2A 2BFFB 2ZRAA 2YRFA 1JEJA 1G1MA 1K98A 4B6SA 4B0PA 2Q2VA 2QSZA 2C1ZA 1K6XA 2A88A 2PMFA 5JMTA 5FLXA 4XSVA 1II9A 3CH5A 2DWOA 2HDOA 1U9CA 3RD5A 4C7XA 4G89A 1XTPA 4XASA 1VP3A 5J43A 1FTSA 4Y1GA 1H0SA 4L0QA 1JU9A 3E9ZA 4OXXA 4B9AA 2YKGA 1L9KA 1MJHA 1PDWA 5EZYF 5H80A 1UJBA 1GFSA 3V9AA 3DGFC 3EYWA 1V8OA 4OH7A 5BOSB 1G0NA 4TS4A 2IYTA 5AK0A 1XHLA 3FZEA 2AOUB 4PCUA 3UB4A 1L4GA 4OMUA 2WTBA 2OPBA 4A0FA 3RREA 2YOGA 1L7EA 3FWKA 4FFNA 1TC1A 5DHRA 3G5AA 5HOEA 4XJXA 2OCDA 2GARA 4CG1A 3PCTA 3M9LA 3E0XA 3QUQA 3B20A 1Z2NX 5K2OA 1KZGB 1VKNA 2ID4A 3E5HA 3HJUA 3MQFA 1T5LA 3O82A 3PUHA 4YAIA 2ZJYA 4F96A 4MJXA 5JBNA 3T1YB 1VYTA 4FWIB 4AJ1A 3ANTA 2Q7DA 4YXWD 3K5HA 4F3NA 2GJKA 1DKUA 1RJEA 3EVZA 3JQ7A 4UEKA 5JDCC 5FOUA 4CHTA 3P32A 2VSNA 4JUBA 1DDIA 3G8AA 4AZ0B 1B8UA 1Z5GA 2LCFA 3CUUA 3RUEA 3UWKA 4B3TB 1YZKA 3EH1A 4WEOA 1E6EA 2XB8A 1II0A 1U63A 4J3FA 1JA1A 1WHTB 2JBWA 3PRJA 4MWEA 1VL5A 2XVZA 3QA3E 1ULTA 4AI6A 2BUAA 2OV1A 3FYCA 4CKEB 3NW9A 5GGYA 2D62A 3AJ8A 2NZVG 4CL8A 4YJHB 5JQGB 3UMJA 5FTKA 2IEAA 3UAZA 2O7SA 4PZAA 1U3FA 3PA6A 3L8CA 4EO4A 3Q9UA 3UV6A 4RGBA 1TD9A 3QVMA 2RKOA 3FDIA 5IKXA 1SQSA 2WU0A 4RHEA 1QRDA 1WXFA 2FPGA 5FYDA 3G8YA 2IZ7A 2P75A 5DGXA 4XLLA 1XTZA 4ZICA 1ZONA 4BFYA 4DV3B 4FE7A 3TNFA 4CIBA 4P58A 2IEYA 5JDIC 2X22A 1LSOA 3VOTA 3JARA 1G1AA 1V39A 5CPFA 1GA4A 5JIBA 2FG5A 1XL1A 3CNHA 4QHTA 2PRSA 2DUUA 3PZRA 2C94A 1FDWA 2L69A 4GM1A 1Z08A 2B9VA 3NDRA 1JEYA 3JVDA 4MYTA 1IIBA 3CNEA 5CGZA 3H1FA 1ADGA 3KFVA 2ECKA 3KAPA 3ETLA 1BU8A 3STHA 3KQOA 3DZBA 4ZO9A 3BQ9A 1N2GA 2BC9A 1QIMA 5BNWA 4INAA 3USZA 4H6PA 3DPSA 1FC0A 4DNFA 1JB1A 1A04A 2DKNA 2BSXA 4B85A 1CUFA 1GSIA 2P5TB 4GW3A 1G3MA 2C97A 1V26A 1S7CA 3AHCA 3N6VA 5L7WA 4BQIA 3VR5D 3OIDA 4ER3A 4JN6B 5E2BA 1W6UA 2PTGA 2YFQA 4EUFA 5FUQA 2QTBA 5IDWA 2H7CA 3CWQA 1K8XB 3EIHA 3I2FA 1S6YA 1KDZA 3H9BA 2TMGA 3VR3A 1XX6A 4JY7A 2N1MA 4BUZA 2O8EB 2QIOA 1MZPA 1T36A 3DTVA 3D5QA 4PNPA 4WKGA 5EG5A 1PDVA 4C2UA 1HDIA 4LOIA 4O5AA 2OXIA 3U3RA 2CMKA 4MW1A 2JLSA 1OVMA 2HA3A 3D7MA 3K1AB 1P7PA 4ZDIA 4YRIA 2VLBA 4ZN6A 5KJ6A 4D9NA 5CA0F 1JJFA 1GTZA 3OTQA 3NJ4A 3N28A 1IUOA 1S2LA 1EFKA 4Q05A 4DA9A 1H9BA 4RL4A 4EJSA 2N3ZA 4TVBA 3LUCA 1KOJA 3DXZA 5ECDA 1TVKA 4FKZA 4F97A 1RNLA 4BO5A 4EG4A 4IM7A 4F1WA 3TQFA 1HG0A 9ABPA 2IXGA 1BKDR 4ASUA 1L4EA 3EF1A 1X8LA 3OPMA 2O54A 1QP7A 1MF7A 2R751 3LWZA 6ABPA 2D1QA 1B16A 1AY0A 2Q9CA 1NI5A 4EHAA 1RJFA 1YNSA 2BGRA 2BFPA 3AFMA 3DHYA 3TZKA 2NN3C 4XH9B 1CRPA 1KI3A 3LT5A 4LK3A 4D96A 3LC0A 1FY2A 1DEKA 2J48A 2ZCVA 4JLAA 1NOIA 3NH6A 1W8IA 4LE2A 3SIRA 4B0OA 1IEVA 1FP6A 3D0OA 1M73E 2B36A 2J9XB 2O2CA 4KSYA 4UNRA 5KOIA 4GNKA 2O5EA 4I9UA 1KDVA 1KTIA 2PH3A 1E0AA 3JQBA 5HQ3B 1B3RA 2AX4A 2YXEA 4L76A 4ND6A 4UUAA 1RAFA 2E9SA 3HYSA 4F04A 3TTYA 2QQFA 1ZIXA 1JE0A 1DC6A 3DLCA 1TAHA 4Q3AA 4PN3A 1CEEA 1EFTA 3SPXA 3N70A 1UJ5A 1CJTC 4Q02A 1IPFA 5F52A 2DETA 4DQUA 1JWBB 1KDPA 5A02A 3A4IA 2ZZNA 1OX6A 1DJPA 1QHYA 4WOBA 2OXTA 5B6IA 5LZ8A 4JYZA 2EFJA 2YRWA 4NFLA 2VXYA 3G0OA 2JHAA 3LNCA 5AHOA 3RU9A 2F4VB 4PBTA 2X15A 2P9JA 3ABZA 3WMFA 1PJCA 4S1PA 3DXXA 3AESB 4FCWA 5B58T 5AD1A 4F9GA 5ED4A 1TTTA 2D0DA 3KKQA 4INZA 5DIZA 1PZNA 1Z7EA 1K0FA 3L84A 3VVCA 4ES6A 5KSPA 1ESCA 2VJMB 5BURA 5AVSA 5K7SA 1NM5A 2YZ2A 1ZITA 4A2WA 3FDZB 5KIAA 1JX6A 2V7QA 4LDQA 3LFTA 2B92A 3QKIA 4MPPA 1RI3A 5HM8A 1YH3A 2IA5A 1I4EB 1O5TA 2Q5CA 4O4JB 4YR7A 2OZEA 4R8SA 1N57A 5I7RA 3I9MA 3FUVA 4UM5A 1TTQB 2FPIA 4IHJA 2ERYA 2IBSA 1YQXA 2IYQA 2J85A 4R69A 1EINA 1RAIA 3DLHA 4KH1A 3GYBA 1LJLA 2H57A 3GLUA 1JZSA 3N8IA 2BFMA 4F8YA 3IVMA 4K3UA 3CWZA 1QORA 2IOFK 3A1FA 3HSSA 4Q7MB 3KEFA 3RTBA 1MRSA 2PVCA 3N2KA 3P9NA 1ENZA 1XAHA 2I80A 2IFTA 2IE8A 3GLHE 3FUXA 4M99A 3UOAB 5B1EA 3FR8A 1IVYA 1T43A 1Y9AA 3GRAA 4AM8A 4C4YA 1B6SA 1RPZA 3VZQA 3M5CA 4NBVA 4LYGA 4ZOEA 4HQLA 5KWEA 1VP9A 3ZGVA 2WFMA 4WFKA 3DZCA 5JHGB 1SOUA 2R65A 5L40A 3CVXA 4XOUA 4QOJA 1M1UA 1NVWQ 1DLIA 1XTBA 2WMDA 2XRFA 1CQPA 5IF9A 5DNUA 1VSTA 5I4CA 1K8QA 4RA6A 1YHNA 1NV9A 1DEAA 3F3MA 1F8GA 1WEKA 1LK5A 1J0AA 3BMCB 4JU8A 4TYMA 4AJOA 1Y80A 4GX0A 3PWSA 5AJTA 4Q34A 3MS2A 4E2ZA 1GUAA 2G04A 4QGFA 1LTQA 4CQLA 3TL3A 3LY9A 5DCUA 4M8LA 4EB0A 4DR4B 3QP9A 1TM1E 1NBAA 3PNSA 4D4HA 1L4KA 2CLEB 3U7FB 5ALWA 1XLTA 4EI9A 4CM4B 2YN0A 3C14C 2YL2A 3OEED 5M3BA 1NATA 4MKRA 2L18A 3D8NA 2XT9A 2P9HA 2J3EA 2XGGA 3RK1A 1R8QA 3VSEA 2HPVA 4PZPA 5AOBA 2ZJ0A 1YU6A 1KFJB 2C0PA 3Q7EA 3A6HA 5CB6A 1R88A 4KQFA 1R6TA 4ABTA 3PXXA 1GARA 2LDBA 2R1ZA 2O8CB 4M1MA 3JQAA 4F6RA 4JL6A 2HF2A 5LXTA 2P6MA 1OWOA 2OFFA 1JXAA 2XWJI 3LQQA 3TZ6A 1MJNA 2GBLA 4LXHA 3OTOB 2ZRDA 1U1FA 1WUTA 2ETVA 2V6BA 4TM7A 3RDPA 4QJ3A 2OESA 4Y7DA 1RZ3A 2HOQA 1HXHA 5JCJA 4ARCA 3EHDA 4CMHA 4KNVA 4Z4HA 4OGWA 4L3WA 4Z4QA 4BMDA 2IV3A 3PT9A 3RNOA 1WQ3A 1EQAA 1LWOA 2CHEA 3FWNA 2E37A 4HG2A 4K28A 4L9RA 2JDID 4X45A 5KOYA 3WJ1A 3AFIA 2FR8A 3N2IA 2NVOA 4I81A 5D3MB 4HB4A 3WOHA 4DGQA 2O06A 1BE0A 5LDHA 3QSYA 4C0LA 5JCXA 2R44A 3DZDA 3NT2A 4YI3A 4DLSA 4LJ5A 1T9KA 5K0SA 2H1FA 2ZT7A 4QNNA 4PCLA 3F5QA 4Y2XA 3NPAA 2IHBA 1EUZA 4LSMA 3DV0B 5FBRB 3C8MA 4JXZA 4CU2A 2GSWA 4EUNA 2G1UA 4XW2A 1EU1A 1O5OA 4Q37A 4DHEA 5JVDF 4QRIA 2NP6A 1IPHA 4FEGA 1WY7A 1UJ2A 5DNVA 1VCOA 1M54A 4O63O 5FTJA 3TTTA 3D2LA 1JAYA 2DUMA 4P4TA 1LSUA 3K3PA 4QXPA 3ZY3A 5JWRA 3M33A 3SFZA 1WCWA 4FIZA 1B2LA 1K3TA 2WYOA 4FUTA 7YASA 4WUTA 3CURA 3MN1A 2G9NA 3THYA 2BKAA 4OFZA 3MD0A 4LXUA 4Q6BA 1RRGA 1IM5A 4RMIA 1NL3A 4BZZA 2OKGA 2FSFA 5FNVB 3OQMA 2ZULA 5EHNA 2PUCA 3UAYA 2I8AA 2QLJA 3NUGA 5I5EA 3BXPA 2AFVA 2ACWA 4YRTA 2HJSA 1NKSA 3I45A 5DBGA 1Z22A 2ACVA 1MG5A 5DBFA 5IEJA 4RTNA 3BCRA 3IT3A 3F7NA 3GFQA 1U0RA 1LK0A 1N5MA 2IUYA 4IV0A 3CF2A 4NG4A 1GQOA 4B9EA 3A6PC 3JAKA 5KNBA 4NSNA 1XVAA 1Z07A 3I2GA 4GMKA 1QH1A 3HABA 1AUVA 1ZN2A 5HZMA 3OPYB 4BLSA 4B79A 2VXBA 3T1NA 4E70A 2JFZA 2ZZKA 4G4IA 2OCYC 4I1UA 4HKTA 4M3NA 2WSIA 1J8VA 3CKLA 1M8KA 3EG9B 3UUEA 2P8JA 2IYZA 2IYFA 4ZVKA 1KVSA 4C76A 1AU9A 3QLVC 4KO4S 1V5EA 5EYPB 1C1DB 2HSDA 3ESCA 4CKWB 4A15A 1IL0A 1KI1A 4DMHA 3MUOA 1GT91 2FPOA 2Z1MA 4JUFA 3MG9A 4GKAA 5DB4A 4BEWA 5HWSA 5JI3E 1ESZA 3LHDA 1QV7A 4MARA 4RTQA 2JFVA 1YQGA 2QRGA 3NHFA 3GP5A 4FZRA 4YQEA 4PLPA 2RGWA 2V4MA 1OX4A 2QL9A 3OZCA 4I50A 5D85A 3E9DA 2WIKA 3MMPA 3LUGA 4ZANA 4NBNA 5FNVF 1JJ7A 6PFKA 3VVBA 3CNQS 3KZOA 1BOFA 3A70A 3HKBB 2XBLA 5KB3A 4YDHB 4V3BA 1NFQA 1QLWA 1WG8A 4QUIA 3DDZX 1F1BA 3TZLA 5IVHA 4FMCB 2JVJA 2KW5A 1MAHA 4B2YA 1FBTA 1QYCA 2IQIA 3OQBA 4PR3A 1DO2A 1NSYA 2PZFA 4AROA 1YA6A 3R6TA 1J5EB 3BFXA 4KKVA 2XUZA 1Z2AA 5H4HA 4DSZA 2PSSA 1TT5B 4QGGA 1OSNA 3GMIA 1J4AA 5TEVA 2IITA 1I80A 1SVLA 3TJRA 3VXKA 2D2VA 1ORWA 2EXXA 1N2EA 3DJFA 3COSA 4G4GA 2NUTA 3V8EA 2BKUA 4UCWA 3RNLA 2XOKA 4E12A 1BCSB 5JXJA 3CX6A 3HJFA 3UANA 4DB4A 4XQGA 1XROA 3G5MA 3EVEA 1S4MA 1Y1SA 1ZMXA 3F7OA 2DR3A 3OX4A 2OORC 5FD8A 3WBFA 2CHFA 4UU8A 3NWJA 5JOQA 2QTLA 3T9AA 3HYNA 3B7WA 4F93B 1U0SY 3LVBA 1ODLA 2XKJE 1M6HA 2FN4A 4JELA 5PGMA 4EELA 1GV0A 2WFLB 5JNTA 3V8BA 3CB2A 4OO3A 4DA7A 1EFVA 3KB2A 1SUAA 3M6FA 1U28A 3U1TA 4KXWA 2QTTA 2ZKIA 4RQBA 3ASZA 3OCUA 3VU0A 5AVWA 4RL6A 1G8MA 3ZNOA 1K6MA 1TA9A 3PKZA 1OH5A 3AEKB 4FMCF 3EJWA 4MJLA 5FOVA 3THXA 4Q7LA 1YZHA 4JASB 1FPQA 2Y3IA 3WRYA 2Q5EA 1IC6A 5IJ9B 2GN8A 4MUYA 2I1WA 2Y2VA 2ENWA 2Y0PA 3KYDB 4X3OA 5CFLA 1N34B 3MNFA 3O2JA 2XUGA 1N6OA 2B25A 3BKXA 1YQQA 3WGMA 5CCBA 2ZATA 2ZJ2A 3OZSA 3CPSA 3BG5A 3LLSA 1DC5A 3ZJ5A 3LUAA 2SECE 4R3UC 1TF5A 1DCKA 1NVMB 4N0MA 4MVWA 3LBHA 4S0XA 4DLTA 5K8LA 4WY2A 3A2LA 2CLMB 3RB8A 1QHHB 2O6LA 3X1YA 3F71A 5F9MA 4MV8A 1J0BA 1UJCA 2OEPA 3QPDA 4YECA 1PJTA 1KYZA 5CM9C 3RCBA 5ALUA 2OFPA 4PZZA 3V1MA 1LDGA 2N0SA 4MPRA 2OPHA 4LJSA 2YR0A 4AKIA 3QNUA 4B3FX 1VIMA 2DC1A 2IXFA 1AH2A 3QQ5A 3TLBA 4KAXA 2IH5A 1PR9A 2RKBA 5HKKA 1T9GS 2JATA 3TRKA 5FIUA 1RWQA 2GASA 2V6FA 2GCOB 3I0MA 4OHPA 5FJJA 1G16A 5K5EA 4R2JA 4CWAA 2V96A 3LC1O 3LBIA 3QWIA 3PJRA 3I6IA 2PM8A 4UD6A 3PGJA 4O25A 4F4JA 5K51A 1ZVVA 3OVMA 1DIHA 1E6UA 4GSKA 4C20A 4J1QA 4UAGA 1GGJA 5LDDC 1Y6GA 3Q7SA 1E5LA 1CZKA 4GOND 1CVRA 4RVGA 5AKZA 2WUWE 4O4LA 1CR0A 3UWOA 1SUFA 3NLLA 3VTFA 4ARVA 1D7OA 3DL2A 3G2OA 4F3YA 2YWGA 1YT5A 3NOOA 2Q45A 2RI6A 3FTPA 2OBLA 2AE1A 1C3VA 2CXPA 2FRVA 1DAKA 1T2VA 3PHHA 3W8RA 2MSCB 1Q3TA 2SBTA 3NG1A 1QZXA 5K6AA 4JLOA 3PTAA 2E48A 4FFDA 1BHSA 1NN1A 2JKZA 1GIAA 2AN9A 2ZS9A 4CDGA 2CDRA 4K6KA 1RJ9A 3U4IA 2WY2D 3DVAB 3F8TA 3S28A 5DM4A 2BTQA 3WQHA 1CFJA 2CLFB 1CQJA 3AW8A 3LUPA 1U1IA 2LP4Y 3OFSA 3PEEA 2XF8A 1E8MA 1NP7A 4AJ4A 3GXBA 1XMOB 2RHHA 4XPIA 3H5LA 4ZAVA 2EERA 4ERXA 3LO8A 1JR3A 4KQMA 2X2FA 3R5XA 4LZJA 3R4CA 3GA0A 1NWCA 2IVFA 3EZ7A 1SU4A 2BFCB 2P3OA 3BMOA 3U40A 3S27A 3RVLA 2D7JA 3OE1A 4CM8A 3EC1A 7GPBA 4COOA 2H1WA 1CUAA 3JTEA 2I8CA 1FMFA 5FO0A 4WFIA 2R96A 4ZQHA 3H16A 4GI2A 4PVCA 5DYTA 1SXJA 3PLRA 5T4FA 1GVHA 1NBWB 2NZUG 4BNZA 2P3SA 1CS0A 5EIEA 5AK5A 4C08A 3EDYA 4AS1A 1FYXA 3IQGX 5HKOA 3GJZA 1PQYA 3G8DA 3KUUA 1K75A 3IKJA 3ZWYA 2PUWA 3CMCO 3B7GA 1FL9A 3MJ4A 4JOSA 4P0QB 5FO1A 2JFWA 2CL5A 4JSRA 1CNFA 2Q5FA 2APJA 3Q3HA 5KPDA 1EP9A 2DJ5A 2ECQA 4YVFA 3RIHA 2W48A 4HNRA 4E5KA 1FRQA 3L4SO 3D2AA 3A2KA 3D8TA 4R1PA 1DJLA 5ESXA 1B1CA 3ESDA 4EQ6A 3Q1LA 2YWRA 1ZCFA 3F96A 5AM5A 2C8VA 3HEMA 1Z62A 3KD3A 3VOBA 4ZALA 2PT5A 2H2WA 2I4LA 4UTOA 5ILGA 2QP4A 3Q11A 4IEIA 4PAOA 1J42A 1UMDA 2OMEA 3L2OB 5AJXA 4DUPA 4DMRA 1W5AA 4LC1A 3T7RA 3TB4A 3TM4A 1WMAA 2F8MA 4OB6A 1FFBA 3NZEA 3AUUA 2IYOA 2QRPA 1TYZA 4MS4B 4M1WA 4I14A 1JILA 3VH1A 4EYEA 3ICPA 2WA1A 1QUEA 1IJKA 2ODAA 2MIIA 3SM9A 3BK1A 4Q7JB 5C7OO 1XVLA 1WTAA 3OQ1A 1SXGA 2R48A 2NZYA 1H22A 1MHTA 1BOOA 3BMXA 3EQ8A 1BMQA 1MOPA 3JQAD 3PXDA 4MTLA 4A6DA 3EZGA 4ZYZA 1QF6A 3ZS9A 2GETA 1YZYA 4XD2A 3GHYA 3VR6H 4MWCA 1VBFA 3WS7A 1Z5VA 2JIMA 2LPMA 1K66A 2Y9MB 3F2IA 1SPXA 3KUKA 5AVOA 1M1YA 5AJUA 3L5KA 4KXFB 1WABA 4ZRMA 3FDFA 3CLTC 3VHQA 2F9LA 3ZU5A 2KYRA 3IKVA 3ZZMA 2AA3A 3ILSA 5LFAA 2VO1A 1UJMA 3WLQA 2X19A 3DONA 2G76A 2BFBA 5AW5A 2C1XA 1KJNA 2G36A 2WMYA 1GCIA 1O58A 3C41J 3KE8A 3LWNA 2NU8B 1IWOA 1UOQA 3IO5A 3IAAA 1Z73A 1LU9A 3U3MA 1XYYA 2GH1A 1TJ3A 3B9PA 2B1QA 4IWYA 1H3FA 4PLHA 4EA8A 1GGFA 4PG8A 4RIEA 5IG2A 5HYVA 2ZVJA 3EA5A 2WINI 5JNLA 4WSOA 4OFXA 4DMFA 3B2QA 5DM1A 5I5GA 2N47A 3GJ4A 3I12A 2UVDA 4QJ4A 3U3JA 4NQZA 1UDAA 3ERCA 4C4PA 4G5QA 5BSMA 1W6RA 2M6RA 3O8QB 3NHJA 3VDRA 2PV0A 4FNOA 1H2AS 1GN9A 3RS8A 2AGVA 1CRZA 4B84A 2MJLA 1EVIA 2QPOA 3L9WA 1O03A 2YV1A 1J2YA 3AI2A 2BZGA 1H4VB 2NYAA 2RHWA 3GAAA 3F1KA 2WU4A 3KYIB 2E1RA 4JOCA 5AW9A 1YOVA 1CRLA 5LA6A 5LP6C 2P2DA 4XRGA 1ZP6A 1KR5A 2IUTA 2HA4A 2G9QA 3F74A 3L7IA 1CR4A 3LKZA 3OLCX 4KAFA 4LN1A 2VA8A 2CZGA 1XU7A 2PSEA 2FPPB 1M9NA 1O96B 4JIGA 4X24A 2FLKA 3K09A 4ZO4A 2B7LA 2VHUA 1XZMA 5BWMA 1OHHA 2GZMA 5HCIA 3CPHA 1IH8A 1YV9A 5JRDS 2PY6A 3QMWA 4I9HA 1RXIA 4RGQA 2YNMC 3IAEA 3DBLB 3M6WA 1OH6A 4QXRA 1Y1LA 4MKZA 1AS3A 2QGFA 3KHUA 4K0RA 5DCYA 3L8EA 3QE9Y 4ROSA 2EDCA 1DQNA 1C3XA 3AKCA 1LPMA 4ARUA 3ES9A 2ZM5A 3HVIA 4HAZA 3R3VA 2QHXA 4G1UC 4NYIQ 1EWQA 2Z6UA 5DHAA 4E2FA 5LZ5A 1RLUA 3FHCB 3HG7A 3S2SA 1B7GO 4IDBA 3TEFA 1MJGA 3EG5A 2PS9A 3LM8A 4L75A 2AOVA 4EIWA 5BWLA 3ZVNA 4PZEA 2EYQA 1IULA 4E2YA 1T3GA 2IHKA 2ECOA 1MC1A 3QKRA 3LO5A 1Y4UA 5EMLA 3ZCSA 5E2AA 4HS9A 3KKZA 1XCOA 1XZLA 1SRQA 1XKTA 3I37X 3PSHA 4MO9A 4TXJA 4PHHA 2C7GA 5AKYA 4EVSA 1PLLA 9MHTA 2GN9A 2CVFA 1CD5A 3T9BA 3WGGA 4N49A 2ROQA 2HU2A 5CIYA 4DFDA 1S0UA 2FCAA 2IYEA 3T1HB 4TL6A 2BMWA 2J07A 2XECA 2E5FA 4J0EA 1KEPA 3L5OA 5AMXA 4AZWA 5JD6A 1FX1A 1RYNA 3F98A 4RC9A 3JD2A 4JT2A 4OYRA 1QRRA 5ELLA 3TMKA 3VTZA 3VNVA 4N0PA 1ZMBA 4FGLA 3DE7X 3O2SB 1U1DA 4OQYA 3VO1A 2OFWA 3FGNA 5JZOA 1Q0PA 2G1AA 4OX9B 4MKFA 2O5CA 3HDQA 4OHVA 4NKRA 1CUUA 3LNTA 2YWEA 3PRKE 4KXXA 4P2BA 2JGDB 2VPIA 3GJXC 2O8DA 3N7UA 3KK0A 3AXSA 4JZKA 2XLBA 3S4YA 1CLUA 1DRKA 2QLLA 1HDXA 3JQGB 1EM8B 2BEUB 5JAMA 1P3JA 4X93A 5GOTA 1IB6A 4FYYA 3TQRA 4EKGA 2K2WA 5JFTA 5D7NA 1E7RA 4IDAA 3DH0A 3JQ8B 3IC5A 3I4FA 3ECSA 1U2TA 5CNMA 5HPYB 5HF9A 1WAMA 2RC5A 4OJNA 3NIWA 2DHCA 3OUUA 1E3WA 5JLJA 1Q7BA 1A5ZA 3D4NA 3EPKA 3OY2A 4LBWA 2PZAA 1DCTA 4YRBA 1WR8A 1TLFA 4ZYLA 2V8BA 3K30A 4CV1A 3LIIA 3TQCA 2L82A 2QRKA 4BCBA 2FUEA 1HSOA 1UK6A 2CLCX 4LTDA 3LKBA 4ZCLA 3FAKA 4I4TB 5GAJA 4RM2A 5JXWA 2DPXA 1SUPA 1RHRA 2WUGA 1YBMA 2I34A 2YS7A 2V55B 1Z4NA 1BS9A 1HQCA 1YB7A 3OPNA 2I62A 4Y1FA 1WUHS 2ZSBA 3BZWA 5HIKA 5HNKA 5DNCA 3ZTWA 3OIGA 1AK9A 1EZZA 1XZIA 2YJ5A 3TOSA 4P4NA 5K0CA 1ODTC 1S1CA 4BX2A 8ABPA 1EYZA 3NTQA 1L5RA 2OSBA 3RVPA 3ZDXB 4BDTA 4LE1A 4WE3A 1QV9A 3PYXA 4GMDA 5B1DA 3HY3A 4AJHA 3PC8C 3D6VA 5EP4A 5H7XA 4QTYA 2XCIA 1C4KA 1HZZC 2DJIA 2VP5A 5C46F 1FLAA 4S3MA 4EAQA 3ELYA 5L51A 1PT9A 5JS8A 4KQ6A 3CO0S 3ENKA 1KA9H 2ANBA 2WB2A 2FV8A 3T7SA 3ZQ6A 1E64A 2R86A 2HUNA 3JQFA 4UUPA 5EQJB 1LUAA 4BC1A 2ZG6A 5LZ9A 1VZ3A 3ZTTA 2GXSA 2GGSA 1TA4A 2PK3A 2WNHA 3DBHA 3DULA 3SKYA 3WQRA 2VRNA 3D2CA 4RWEA 4C5CA 1XB2A 1R2QA 4XGKA 3H7AA 4MUMA 3PQCA 1G8SA 3FGPA 1PQPA 5KWIA 4QPZA 1NG1A 4DA0A 3MHTA 1QVWA 3BSYA 3CH4B 2B69A 2IT1A 1E77A 3CIFA 1FNDA 4O08A 4OREX 5BMVA 3ZHQA 2UUAB 4IX9A 4N6GA 4CR7A 4BO8A 4DLPA 2CMGA 2GN6A 2YJTD 1ZSYA 1KXZA 3BQMB 3Q40A 3GFRA 3E1KA 3IV9A 1HURA 1T9HA 1JHZA 3C8UA 4KK4A 2O1XA 4R01A 1UAGA 2KSQA 2PYZA 1ZBQA 4OHBA 1FFWA 3JWIA 4AMVA 1ZW6A 1WQ1R 4J8PA 4YY3B 1KSFX 1C3JA 2IK8A 3CZCA 5DV9A 1W7AA 4NJOA 1HYHA 2CY0A 1HC7A 4RSHA 2P2GA 3ZGOA 4DRXB 3UJBA 3KELA 4HN9A 2GZDA 4NNPA 3I9OA 1E1DA 3T61A 1CYDA 1DTEA 2UUCB 3NT5A 2IUUA 3ZE0B 3E8XA 2QM7A 4I46A 5IMBA 2XGOA 4FR5A 4RTKA 3CX3A 2IU0A 1GPKA 1PT6A 4UZSA 3A9CA 2CK3A 2PX0A 4M38A 3RUCA 4F7WA 2H3HA 5T8KC 1VLHA 4X7RA 1CW2B 1GPMA 2B1IA 1R6AA 1N6LA 5AR1A 3TEMA 5KI6A 3PFHA 2OFOA 4WCFA 4JL5A 5IAEA 5EJEA 2I7VA 1RW4A 4HXYA 2J0VA 5EWJB 4DYHA 3C7TA 4O6VA 4CODB 1K08A 1M8JA 4BV2A 1KYVA 2VOEA 1ZD4A 1SD5A 3BCSA 2X1HA 2ZJ4A 3AEXA 4GXTA 1C2TA 2P40A 2I91A 4QODA 5K2MA 1RZRD 1G20A 5BN3A 3BSFA 3VR2A 2Z5VA 3IV6A 1YQTA 3BDAA 5COQA 1RQRA 3V8QA 4WL0A 1N7GA 4X54A 2IU3A 1C41A 3UUFA 4LDZA 3KQHA 1VLQA 3WK5A 4AKHA 3ZU6A 3WIVA 3GJTA 4WK6A 1HEIA 4HC4A 4LZWA 4C06A 1V8PA 2I6QA 3EPLA 4KQCA 1UWLA 1LTKA 4O3FA 1UIRA 4QQ8A 1ZCZA 2NZ8A 4E7PA 5EWMB 3RRZA 5KZMB 4J90A 2PL9A 2XEDA 5CB4B 1Y3IA 3OM1A 5U1PA 1BWRA 2IPLA 2IUSA 2YC2C 4IMIB 3E48A 1IAQA 3H1GA 3ITEA 3O8RA 2JKVA 3DMGA 3U9SA 3VU9A 3KC2A 2IF2A 3L0IB 2Y76A 5K03A 4OH1A 1Z2OX 2XNKA 1BFKA 3L6DA 4QU9A 4Y2PA 3TXAA 4D5GA 3SC2B 4FN4A 4L4SA 1THGA 1L8OA 3JD1A 3ON5A 4LXXA 1E1YA 1S2DA 3ITDA 2WZCA 4GBMA 4CUZA 1UP7A 3E9QA 1NW9B 1F8YA 1NR7A 2ZYWX 1N3YA 3KT6A 3D7LA 4Z4GA 2VJNA 4UUQA 1EMDA 1DV2A 1ZD9A 2ZYIA 3SAJA 4Q01A 5DGTA 5LLTA 2F1RA 1TYEB 1YZVA 5IARA 1AF7A 1V96A 4K6CA 1JT9A 3V1KA 4WRRA 1LDMA 3N6RA 4A73A 1XF1A 1SC4A 5T7BA 4ENQA 3F6PA 1GYQA 1MO4A 4JP2A 4A8JC 2PZMA 5HRAA 1ODFA 4KGDA 3K15A 1BW9A 5K99A 1M6YA 3RJMA 1J07A 1R5JA 4LX8A 1XQ9A 1GRNA 1P1FA 3SE7A 1ISFA 3FJOA 3GEPA 3IEKA 1LWNA 2QVLA 3VV2A 3N07A 1FVXA 4B4DA 4DS3A 5FKJA 3OQPA 1Y33E 1A4XA 3UENA 3NONA 4V3CA 2ZI9A 1Q0UA 3FWZA 5ENZA 5LKRA 1JWAB 4CMEA 1SMKA 4HDCA 1KOFA 5TLSA 1AO0A 3IL2A 1PJ4A 3LGXA 4N3GA 1R9MA 1R0BA 1X1DA 1C9KA 1KJ8A 1KI4A 4QFDA 1X19A 4TKUA 1DAHA 3L8MA 5AH0A 4AQYB 4CQMA 4KR7A 4G0MA 5AO9A 1D4FA 1L5WA 3NHMA 2ZUSA 3L4BC 2GWHA 1T6BY 4HI0E 3L0ZA 1BWSA 2GLTA 4BFXA 2DT8A 2FPKA 2R2AA 1PEKE 2JFNA 3ML1A 4W5JA 5TMBA 5BN1A 2VRCD 3A31A 3ZDZB 3R0VA 1W2HA 4QG3A 3IMGA 2QRLA 1LVHA 1KYQA 1ISPA 3W5DA 3S81A 4G0NA 2HGZA 2GEDA 2DXIA 4E5VA 2AG8A 1YDFA 2RAPA 5MN6A 2XUKA 5TE9A 1TAUA 2PL1A 4ZCQA 2G1JA 2HWXA 3VNQA 2JI9A 1I3MA 2FP4B 4WLNA 3E27A 5ERYA 1LBTA 1UM9A 5DOVA 5L4NA 1N5KA 4FGSA 5K1ZA 4RD2A 5G3YA 1GLNA 3EWSA 4QRHA 3ESRA 4QM6A 3NR2A 2I2XB 5EGSA 4DNQA 2IPAB 2GT1A 1FDIA 5REQB 4DQDA 3WYFA 2QVBA 2FEXA 3UMBA 4XYGA 2WPNA 1OR8A 3AI7A 2C4HA 1QHSA 1SH7A 3PX3A 1ZR4A 3CZAA 3SDBA 3QELB 10MHA 3WKCA 2OQIA 5HILA 1UZMA 4C14A 1NU6A 1UBTS 2J6BA 3BXZA 4TT8A 1D2HA 3CKYA 4FKMA 3SJBA 2XTZA 5JD4A 1PTJA 4OUDA 4U3JA 3DMNA 4OSOA 3PC3A 4WZZA 3RABA 1U7UA 5AVQA 1CLEA 4G2TA 4PIMA 1TVEA 5EGNA 3SMQA 4KOEC 1LXCA 4BO4A 3UJHA 4PX2A 3RUDA 5JEDA 3Q8MA 4NS4A 2VJYA 1H6AA 3T7TA 2HTFA 3RGGA 2QNIA 2G4VA 3D8RA 1SOWA 2PG3A 3F6RA 1O94C 3L7NA 4MINA 3VTAA 2ES4A 3D3WB 4BQFA 3I2YX 5AW4A 5FULA 1BH2A 4RFSB 5KYGA 3SI7A 1I2DA 2VWHA 2X4GA 1KDRA 1P2TA 1SIOA 3LUHA 3U7EB 5JZSA 1EFAA 3KQKA 3KDAA 3QVUA 4BKRA 4YMLA 4FHEA 2Q6OA 4M1ZA 1SQ0A 4L72A 1KBZA 2JD2A 4CETA 1UT5A 3VGPA 1P75A 1XFAA 1MDBA 4Z4IA 2XW6A 5BWCA 5AXAA 2LCQA 4F4FA 1KY4A 4B5LA 3QIVA 1P9WA 4M7OA 1N6NA 1HRDA 2D3TA 1L0BA 1M75A 1NIPA 1YZGA 1HKHA 2ZVPX 2O57A 1TZBA 2YFKA 3HWX1 1BQ4A 1SY7A 3L7JA 3NAQA 4YP5A 3U7IA 4EB6A 2HPAA 2VDWA 4ER7A 1X6VA 2K7FA 1I14A 3GGDA 5KNCA 1UBKS 4QUAA 3ZW7A 1PT8A 2NV2B 1LK7A 1J2JA 1D2RA 3MQ2A 4ESHA 4XVCA 4EF5A 2QRNA 1H1TA 2Q7XA 3LOPA 2V7XA 1Y7PA 1ORHA 3GIDA 2IWRA 4I6JA 5IFKA 4IYRA 3B2EA 4H1UA 4I55B 4DMGA 3NHPA 1KQPA 2A0KA 2IHJA 3IPRA 5DPMA 4PLYA 4UPEA 4QHSA 2WSYB 1DWQA 2BHSA 2R5WA 3ECCA 2A4MA 1PJLA 3S1AB 5JS2A 2D2FA 3MOIA 4OQXA 3RPEA 1FSSA 3AW9A 1KOLA 1II8B 4R54A 2FW8A 2C5GA 3QFRA 3K1ZA 1L7RA 1XEWY 1WXQA 3RC7A 4LJYA 3ZHZA 3HM2A 4ZI3A 2G09A 3Q8LA 1JKMA 3W5JA 1L7QA 1JQ3A 2D0PB 3DE5X 4IZIA 1H2WA 4C0BA 1IXZA 1G5HA 2RGBA 2QM0A 3RO7A 1E2BA 4CGYA 3N0RA 3NGMA 5ALDA 2C83A 4DLAA 1CVIA 3L7BA 4ETWA 3D6TB 1VE6A 4NS1A 1GTL1 3AL2A 4I4IA 2ZBDA 4FD3A 1BMFA 1UCFA 3G13A 1Z4MA 4MEBA 2IS1A 4LXTA 4GFDA 4IUYA 3GJ8A 1Q7EA 3H2HA 1LPNA 3OX3A 4G0OA 3S2FA 5LNK1 3HCBA 3WWEA 3H1TA 1RWKA 3TTWA 3UEOA 5C8DA 3VR5H 4MVCA 4MX8A 4E30A 5FUYA 1OH7A 1YTLA 1DG1G 1NVUQ 2AD5A 3LPAA 1EXNA 4EA6A 1PK7A 1NRJB 1OF1A 4QC2A 5JASA 3HO1A 4BJ3A 2YYYA 4PXYA 4C07A 5EHZA 3EDRA 3CBQA 3MT9A 3SQLA 4ZZIA 1LLDA 1T2AA 1B42A 4LNAA 2OZKA 3K0FA 2CE7A 3QVOA 2DBZA 4TYPA 1XVUA 5DVZA 1GRVA 4KQEA 3FUTA 4MNTA 1EJ6A 1KEUA 4KO3S 2CSUA 1XMVA 4GKVA 5ESRA 2CXNA 1QG4A 2Y6VA 1LC0A 3INGA 3K4PA 1UP4A 3KPJA 4BMOB 1O0SA 3D5EA 3KV1A 3MLBA 1Y5LA 2AOWA 4L0DA 1YI0A 4XJVA 1GITA 5HFNA 5E9QA 1V6AA 5BORA 2ZIWB 3ASYA 4RMGA 3SVTA 4ZC8A 2GXUA 3AFGA 3I4CA 5AVYA 4HDQB 4PIVA 1IOVA 4LV6A 4DQVA 3ROFA 2QTFA 2WVHA 3OP1A 1NQTA 1GKUB 1T0JB 2FMKA 4Q3LA 1T9DA 1PCXA 4D82A 3JALB 1SG6A 1G5TA 3OZGA 5LMUB 4OBXA 2FN9A 4XCQA 1BE1A 1WXWA 2V7BA 3LZDA 3R3JA 4ZI5A 3WBJA 1PNOA 1WDWB 2I6GA 4G0PA 3BFPA 3U26A 3A04A 5CVEA 1MZVA 3EA4A 3A6LA 4BPBA 1KOGA 1OBFO 4R8VA 3PR3A 4GC9A 5DK6A 2RH5A 3D9QX 5CX4A 4CTJA 5C53B 2IOHA 2BEJA 2QG4A 5IW8A 1YIDA 5BY2A 1EUDB 1QS0B 2Q4BA 4NMHA 4CEIA 2DP4E 1RRFA 3HL0A 2XXJA 1FSZA 1MABA 2H2AA 4GD3Q 3PE4A 2ZUDA 3L1UA 5CYFA 5J2UB 4NABA 4Z51A 3AR7A 4JS0A 3WYBA 3MMNA 4REQA 3E9RA 5CB8A 4PICA 3AF1A 1N75A 3I58A 4CR8A 1FK8A 4IMRA 2DBYA 2ZUFA 1WB9A 1NULA 2JVIA 2OCXA 3TD2A 4ZZ2A 3WI7A 2EG5A 5CYGA 5IZCC 1ADCA 4RJ2A 2P30A 5EJMA 4O33A 1BGWA 3RADC 4R8LA 1U0GA 4QPPA 1AUXA 1VG0B 3QI7A 2YC4C 1E2MA 1DXQA 3QXSA 3R0JA 2BFFA 2JAXA 4N40A 2AF4C 5EJ8A 1Z4KA 5DHQA 5EZSA 4DV4B 2ENUA 3OQOA 1B3BA 1ULAA 2FQ1A 1DKQA 3O3CA 2EFEB 1WP9A 3ZI4A 5BR4A 1YONA 3JYOA 2YXNA 3THRA 3OPYI 2QD5A 1YSCA 1IY2A 1U2PA 3C3MA 4HV4A 2X5XA 4B47A 2AX3A 4LHZA 5GJBA 1GRQA 1VTKA 3P0HA 1KVRA 4ZKEA 2JGJA 2J9GA 4GWKA 3WWCA 4CR6A 4ZVSA 4F2PA 1JYEA 2Q9AA 3F67A 3I8OA 2QTNA 5A9SB 4KYUA 1NHWA 1PEYA 2Y0CA 4X8OA 4KSCA 3ENWA 3VDNB 5JR3A 1Y1PA 4G4SO 4GXQA 4JL8A 1E60A 4BFTA 1IOZA 2X7JA 5BOSA 5KDOA 4LWZA 1EGMB 1XCJA 4PPFA 1I01A 2BW0A 3KSRA 2AOUA 1OOEA 1V3TA 3ODGA 3GDOA 1ITZA 3QOXA 3COJA 4RV5A 4ETIA 3FGOA 2J30A 1Q7CA 1PQ4A 3R4VA 1PUIA 4RHTA 1ZA2A 2I4OA 5K20A 1N1GA 5B53A 4W5OA 4US1R 3G7UA 4Z7JA 1SVOA 2HHLA 4LF5B 2DE0X 3OM0A 1P2VA 4N6NA 4RTMA 3RFXA 1D6NA 4K86A 5H3LA 4H3KB 5DHUA 1L1QA 3GA7A 3KXKA 5K3BA 3UGKA 3FXAA 3CJRA 2H65A 4EHKA 2VEDA 4O2RA 2IZ1A 4TTPA 4F72A 1P7YA 4BYGA 4F2HA 2CNKA 2XD9A 1I6WA 1GJRA 1IEQA 4HRVA 4QDZA 4EQZA 1Z56C 4LMPA 4BS9A 2XZLA 3FTQA 2WUVA 4D8WA 4I5EA 4AO6A 1WHTA 4ESOA 2BH9A 1X3SA 4AN0A 2EZTA 2BI4A 1UEIA 3KVVA 2CXTA 3ZU4A 1WOMA 5HF6A 4CKEA 3GK3A 4ZYXA 3B6JA 4UPDA 2O2XA 3MWJA 1YDMA 2OM2A 3H2ZA 4KL8S 1T1RA 1UWCA 5JQGA 4FINA 3RQIA 5C9ZA 4HBZA 1OBOA 4DV2B 1KE1A 3NDIA 4MGIR 3TLEA 3FIJA 4F4IA 5LM3A 2HREA 2QUBA 3AUJB 4RX1A 1ABBA 3TQQA 1MGPA 3K9HA 5HZHA 3V2IA 4ZU1X 3RC1A 4J7XA 3T95A 2EGGA 1R10A 2V7WA 2G80A 3G2IA 1Z2PX 2OLEA 2K5UA 2Z1NA 3BRWD 4M4SA 4DWWA 2BCEA 3GUVA 2XCUA 3W6PA 2XRZA 4RCVA 2EHDA 4L07A 3B3GA 2ZTMA 2TMKA 3G9XA 1PFYA 4LXYA 4ZQGA 2XE8A 5JSZB 1GV1A 1Z7GA 2R0QC 4ZOLF 1XMPA 4CMKA 1FTNA 4JI8B 3VNBA 4B75A 3KZNA 1GPNA 3DE1X 3VR0A 4HWGA 4AX4A 5I7FA 1XP8A 2C8KA 5FF9A 3EPJA 4D43A 3R5TA 1EZ4A 1DOHA 3ZZNA 1ZYUA 4HDKB 1H9CA 1W36B 1C3LA 1N2CE 1PR2A 4KWIA 5EMMA 3UQZA 2Q6KA 4L27A 5EJGA 3K1TA 2LUOA 4M0LA 4MA5A 4ZXFA 1O57A 5JO9A 3NATA 1V1JA 3HACA 4AIIA 2FZ5A 4XVUA 2X77A 3FH0A 3TSCA 4DCJA 2ZWIA 3DBVO 2ARKA 1KFEB 3R23A 4MIEA 3CJQA 4OI1A 2HK8A 3KB8A 4ZRDA 3OJEA 3A06A 4AS3A 4XGIA 3VNRA 2H51A 3OE5A 2ZBPA 3WNZA 3WFZA 4P93A 1CQZA 5ESDA 5JSQA 3DPUA 2O5RA 2GRJA 3N2YA 4I9GA 2XH8A 3HVJA 5M7EA 4XJTA 1Y8QB 2PT6A 2R5FA 2DVMA 2X8JB 2HFJA 3HY6A 2O8EA 4O1HA 2AKAB 1CUCA 4UQOA 3ZDFA 2JGRA 3M89A 3LK6A 2XUQA 3OPXA 2HC9A 1DX4A 2NTVA 2ZK7A 1ST3A 3VYVA 1PFQA 2RGEA 3K1AA 3MAGA 4MV7A 3N8HA 1T2DA 3WFJA 4IOKA 1R9NA 3PPXA 1RKVA 2QJRA 2OXEA 1JZTA 1ZR2A 3Q8WA 1MO6A 3HVUA 4C7VA 4EI2A 3HVRA 2PEYA 4X1YB 4GO1A 5GONB 3TLGB 3LLUA 3ZYZA 4CFYA 5JXIA 4HJXA 3BXGA 3ROEA 1XNRB 5A5VA 2BKXA 4K1XA 4ANFA 1J7JA 2PH1A 1BN7A 2PT9A 4JWTA 4Z4FA 4ZYTA 2A14A 4C6RA 1THTA 4TL9A 2F1IA 2R87A 2I6UA 1XN1A 5KC9A 4AY6A 1EP3B 4TMXA 4KQHA 2HQ1A 2RE8A 4PC6A 4B76A 3HJNA 2IVZA 2MSWA 1XRQA 4OTZA 1OZ0A 2NU9B 4EO7A 4GC5A 1IU9A 4WLFA 4CIXA 2R11A 1YQ9A 3DA8A 3FPEA 1XYVA 1OIWA 1ES9A 2QY9A 1LS1A 4WJKB 2ZPAA 3DV9A 1SBNE 1AD2A 5DW3A 3K0AB 1RHJA 3CEHA 4C4RA 4H7HA 4P3YA 3NRBA 5HQ3A 2OAP1 1W1WA 5KNCD 1OB5A 3INRA 2QTZA 2ZJ5A 3AG6A 4O4IF 2FDRA 2Z5FA 3T99A 4AP9A 1AGYA 4L74A 5BQ3A 1PW7A 2OHIA 3QFSA 3T5MA 3EQ7A 1TFUA 3ABQB 4PM4A 2QTRA 1GQYA 4OHCA 2RGAA 3I3OA 4KBGA 4LV5B 3OEHA 3RRYA 4NESA 4JT9A 5ICFA 2QX8A 2O3JA 3E53A 4IJWA 5BWNA 1DWPA 1NVKA 3VUFA 3AESA 3HGMA 1ZWKA 1PU2A 1DBIA 4B6FA 3CR8A 2G5CA 4D9BA 1T3HA 2ZYUX 1FS4A 1E2NA 4QLBA 4L9SA 2CZQA 3K0CC 2EYUA 2HU8A 1T9CA 1P74A 1NKTA 1T0BA 1XXHA 2VJMA 5CCDA 3DZKA 2J3QA 4UVIA 1E0JA 3FDZA 3IUJA 4YAEA 3DHNA 2J1LA 1GNSA 3KOMA 4I9NA 4OA8A 5B3AA 2B82A 1HNXB 2E5LB 1E3DA 4NV3A 4NCBA 1FNBA 4TV8B 3FVRA 3R0XA 4XVQA 1SU7A 4G0VA 4O4JA 5C7IO 3KJQA 4FZ5A 4LJ7A 4AULA 4E15A 5FPKA 2GVZC 2KBEA 3GRUA 1XRNA 2BOVA 2PQ2A 5E4JA 3NDJA 2CXOA 2IUEA 1TK2A 2HCJB 3DYBA 4G9GA 4M8SA 2W4QA 2I7CA 2VNIA 2V4ZA 3AT1A 1GZSA 3R6GA 1W34A 3X1DA 4V24A 2BR5A 4CZ2A 2IHYA 5E9WA 3E2MA 3ZXYA 4FIDA 1J20A 1S5PA 1Y5NA 2R97A 4URZR 3CUTA 2GVDC 2EHJA 3M0EA 3Q6IA 2BISA 4OJKA 1TO1E 3P4UA 4QYXA 1RIIA 1FYVA 2BF7A 2BDEA 2ZJ6A 2W2KB 1L4MA 1OGYA 1QGOA 1I2MA 1GNVA 3OTWA 3AIMA 4FMDF 4JLKA 3C24A 4MKGA 5DCLA 1FUYB 5DO9A 3ZE7A 2XHZA 3E4DA 1I33A 3H9QA 3L6BA 5KYUB 1RKXA 1WEHA 3BEOA 3DTNA 3HGQA 3ID6C 3BMCA 4KBYA 1CHDA 1ZY2A 3CX8A 4R51A 2KLHA 1VKZA 3DE4X 3E9YA 3GROA 2NGRA 3EX7C 4B3RB 3IDFA 4J7UA 4W9NC 3M5WA 4YUYA 4L5YA 3THOA 1H5NA 5EKXA 2WV7A 4RK1A 5IP5A 5L3QB 1OBVA 2D7DA 1WUYA 4PLCA 7AT1A 4HUJA 3QW4B 2YOFA 3NBYC 1XT6A 1AA9A 2IS4A 4C89A 4CM4A 3AZPA 1U8FO 2B8EA 1ZM7A 2H1VA 3ZHCA 1M76A 1T5IA 4FYKA 4EWLA 3G0IA 1L7AA 2A9PA 2FZWA 3JYQA 4LZAA 3PXGA 3ZWVA 2IPOA 4B3HA 4UBNA 4EATA 1P3Y1 4X91A 2BSQA 2FN8A 3BT7A 2O8CA 1CX9B 2PWBA 3N0VA 2HX1A 4TTQA 3ICQB 1UBMS 2XMPA 1YIOA 1R15A 3O92A 4I1RA 3R3HA 1X38A 3JZIA 1SOAA 4J2OA 2XCRB 4FGUA 5JPCA 3WL7A 2ZT5A 3AIIA 1CP2A 3KWFA 1ZS9A 1SK8A 1W8DA 1ETHA 1BMTA 4HH4A 4J0QA 4KGVA 4PC3A 3C7CB 5K8JB 5C51B 2GEVA 2Q28A 1RQ7A 3R3WA 4J43A 4MA0A 2C31A 1MD9A 4FHZA 1J8YF 1ENOA 1K4KA 2FETA 4OAQA 1GILA 2EKBA 1G3IA 4NQRA 2FCRA 2MSDB 1BFUA 2GYVA 2X58A 3FM9A 3X1MA 2A9JA 3DV0A 2YVAA 2B0CA 1MQ9A 1S3FA 3IJ5A 1QC5B 3A3KA 4GLJA 1IFXA 3B1XA 4NU5A 4TLLB 2O3RA 2RGDA 4YWHA 5IAJA 3UFBA 4BKUA 3L0OA 4PX5A 1FSFA 2GCGA 4Y9SA 2OL4A 1M72A 2YOHA 4FYXA 3CEAA 3INNA 3JWEA 3LC2O 1S3GA 4CIYA 4GKJB 1KFKB 5F7OA 5J59A 2I2AA 2WDPA 1VG1A 3IQZA 5IH3A 3PUKA 4NBWA 5H4GA 4Q1FA 5U4XA 2IPMA 4O1IA 5F7ZA 3GUHA 1PNVA 3UB3A 3UH0A 2WD9A 2AN5A 4B2PA 2GCNA 1TU3A 3KD2A 5FA8A 2J31A 4FU0A 5KTYA 4JDUA 4DLLA 4IMJB 1HLDA 4JVMA 4MEAA 1POWA 1FXWF 1T5TA 3GMTA 2VJOA 1QGDA 4WLEA 4B4WA 1I1QB 1C30B 3LWBA 1EK5A 3LE8A 4OOFA 4NAHA 3G7SA 4NC9A 5GZ3A 1RMYA 2OK8A 4EECA 4JUIA 4NOLA 4GEGA 3WIBA 4L0CA 2Z0MA 4LVCA 1RVV1 2NAPA 1IY0A 1OIXA 4E5UA 1AV6A 3QOFA 5IT4A 3QEBZ 4QNMA 2G82A 3DC7A 3O38A 3K0EA 4YUVA 4PY2A 4IILA 4ZAWA 5E8JA 4LJ4A 4LJKA 4FP9A 1RXCA 1I9GA 1Z5ZA 1Y1TA 3LS2A 4JUDX 4YBRA 1BVYF 2ODBA 3ETEA 2X8WA 3OPYA 4IDNA 1P8JA 3C1TA 1H42A 4U6SA 1QP8A 1J8MF 4LOHA 2QG6A 1PO7A 1GKLA 3PGVA 3G89A 1QLJA 1R8YA 3CE9A 2QR3A 1RVDA 3EG9A 3KHSA 5CEFA 3NWOA 1XZHA 3IVCA 3LCMA 4RO0A 5LUBA 4AJPA 4INJA 2XIQA 5EYPA 2FW0A 4OKSA 4C2AA 2PRIA 3BX1A 4CKWA 4GUDA 2XMCA 4X3PA 1KZ4A 1WZEA 4X7MA 2VHCA 5B1HA 3WL6A 1YR6A 4KWTA 5CXUA 4QO8A 3S8MA 2OBYA 4R9VA 3K20A 3KPYA 2WU1A 3LFUA 4MA4A 3ZIDA 2R1TB 2J6HA 3G2HA 3DDHA 3H9UA 1EJBA 1QKJA 1WPGA 4GZLA 3EEBA 1PLKA 4G3XA 5FWDA 4H1VA 1PEAA 3HKBA 4HVAA 3Q7RA 3U49A 1SVNA 2ODNA 2GX6A 1WB5A 2KQUA 2RONA 1CC1S 3IUQA 1ZMRA 3KHTA 4XARA 1EE9A 2RMKA 4KMRA 3AF0A 2BM1A 4ND2A 1USIA 1KDYA 1GVNB 1SO8A 2JK0A 3DZFA 3GLGE 3HRHA 3ZHOA 3FJ1A 4BGDA 1EVLA 3KYBA 3QBVA 3FF1A 1C7ZA 3H8SA 2HY7A 3QWBA 4GH5A 5SY4A 1YA8A 4H3SA 3VAZA 4F9EA 2DUJA 5IWCA 3TX2A 2GFQA 4GKKB 1YB1A 3IUBA 4JUAA 1VPVA 3TDNA 3UJ8A 3R5JA 1GNPA 2B1RA 1QR2A 1XHEA 3UAXA 1ZKMA 2QROA 5ALSA 3IXLA 2QA5A 5SICE 3UKDA 3WL4A 5I01A 5KUTA 2GAAA 4GG1A 2EZ8A 1BCSA 1MX1A 2HMTA 1QHGA 1N3LA 1B6RA 5DYGA 5SYMA 2W4IA 3GVCA 3VVLA 8OHMA 4UM9D 3GD5A 1U99A 2UDPA 1YK0A 4W1PA 3H2GA 1BXRB 5B4UA 5LIRA 3SOPA 5TMEA 3EQZA 3L8HA 3ORRA 2GDZA 2QGZA 1Z6PA 4DG8A 3IXQA 2F8TA 1ZH2A 2BE9A 5GIPE 3JYNA 3MT8A 4G6ZA 2WFLA 2R1VB 3JPYA 2B83A 1X42A 2ZTVA 4JI3B 1LJ8A 4BTLA 1OFGA 3Q9NA 3RTAA 3BGOS 5C4MA 2UKDA 3G0BA 1XDZA 2UZ1B 1TM7E 3MQ4A 1CF9A 1H8HA 3IELA 3G79A 3HC7A 4N3CA 4F45A 5FV4A 3AEKA 4YQYA 1AKTA 3NNDA 1VMEA 2OC4A 3A9WA 1XRSB 3HZOA 3CA8A 3JQEA 2Y1DA 4TRMA 4D44A 2AG1A 1W0CA 3BSWA 3NM4A 3DR5A 3R7SA 3W3ZB 4PEVA 1PFKA 3ILHA 5IJ9A 1Z5PA 2Q4TA 3BIJA 3L8DA 5LMCA 1F6WA 1RLIA 1E9FA 2YXLA 2XNSA 3KYDA 5GPBA 4FHFA 3O21A 1M1ZA 1KWKA 2FF7A 4FI3C 4OLAA 4RELA 4TQUS 1MMFB 3W90A 3F90A 4HXEB 1ID1A 5F1OA 2EX4A 1ZHHA 2IKSA 2W6JD 3GCWA 3KSUA 1AKYA 4PYMA 4H60A 4R2MA 5H9WA 1DKPA 4IQ8A 1RZUA 2ABWA 3OOJA 3G8CA 4U02A 5AXBA 1G2QA 2J45A 1QHHA 4BV8A 4F3RA 1Y0BA 1C9JA 1T8RA 1M34A 2WAXA 1X74A 5B2FA 3TQHA 5KNBH 2HYIC 3VZSA 3M6UA 4L08A 2HIMA 3LFHA 3D1VA 3G9ZA 3HJCA 5AHXA 1WW8A 3RM3A 4BBPA 2FSVA 1BXKA 1I0LA 3I42A 3LY7A 4P84A 2P9TA 3INYA 3QF7A 5JBQA 5JARA 4C88A 1I7SB 2QEQA 4RHCA 3FLAA 4F92B 4D8YA 1E32A 3MYYA 1P7VA 2CLSA 2P6UA 5C18A 1NNEA 3GR6A 5HW0A 1JA0A 4A1OA 1RZVA 2FN7A 4D3SA 1GKKA 3G1TA 4N1AA 1IXKA 3OFNA 3L7OA 2CJWB 3CLUD 5GINE 2GCOA 4OHRA 2DYKA 4RZXA 1DBQA 1V3UA 2FPUA 3QE2A 4M9UA 5KJ1A 3DP9A 1DWUA 2OO5A 3CLHA 2G0AA 4OI4A 5KTSA 2AJBA 2C07A 1D2EA 4GI1A 4OPMA 4ATNA 2I6SA 3HNOA 1E9SA 1Z0SA 3ZWNA 2J9RA 3FF4A 1GU1A 1L5MA 3SKXA 1VI5A 4NEHB 2PAAA 3JVEA 3PL5A 1BD3A 4ZFNA 5C80A 3VHXA 4F5EA 2WICA 4I8IA 3BILA 4TRJA 1DU4A 2FFAA 1XZEA 4KCGA 1HMPA 2P4HX 4R9NA 2GPSA 2WAOA 1AK1A 4K9LA 5FI0B 1WPXA 5FBVB 1X0XA 5JYDA 2YDYA 4XGQA 1NUAA 1WZUA 4QATA 3UMCA 3BGWA 3CSDA 3DVAA 3FCSB 2XYGA 3PSAA 3QI2A 4LHEA 4YCSA 3L1IA 1ZUIA 3ENQA 4P4SB 5ICGA 1ZRSA 4MH0R 1ZSVA 2QUHA 2PXHA 1R8SA 1XTKA 2HKIA 3AO0B 4N18A 3U7QB 3QFTA 4TVOA 3ZDDA 3O4GA 3CUVA 3ZH9B 3H4VA 3W9YA 4X8MA 2BFCA 4I99A 5KMGB 2GHQA 2V58A 2Q2NA 2GEBA 1DDOA 2PWZA 4TROA 2J9YB 1G4AE 3MRTA 4U6NA 3IP3A 3U4CA 3IKTA 3LGAA 4OMCA 1SCNE 4TN1A 1GNTA 4G5FA 3CCBA 4F85A 2OVFA 3L6OO 3OMXA 1XZKA 3MZ0A 3W8NA 3OY7A 1G7SA 5A9TA 1P2SA 1W87A 2C2ZA 4FBMA 5K6TA 2Z30A 3CGGA 1A5TA 3R5FA 1LFAA 2IE0A 4W6QA 3AV0B 1N2XA 4M8IA 1DTWB 4NECA 4YJFB 1E6CA 4RZ2A 2XYPA 1WW3A 1EJ0A 1NM5C 3MELA 1UK9A 5HG0A 3BA1A 1DEXA 3QHAA 2QPAA 1YGYA 3QTLA 4QEKA 5L3RA 3CFYA 4Q9DA 3AUAA 3IEPA 3F7TA 2AJLI 2VHQA 2XGSA 3CCCA 2ZWPA 3MJDA 4KXQA 4ZWNA 3FSEA 1WZNA 3L0SA 5T3UA 2WTAA 4BZPA 2W2XA 2VUUA 3F47A 3RTEA 3UKOA 2VP3A 2HF7A 4LC9A 4EY6A 2QW0X 1C9NA 1Q1GA 4HBGA 1US8A 3MS7A 4LMRA 4LHWA 2R7AA 4JEIA 2X0EA 1IBLB 1XDGA 4E88A 1KO5A 2ALJA 3ZLUA 1UQRA 2WWHA 3L7DA 4JITA 1CUDA 2HADA 2JC3A 4W7IA 5JNUA 3TR0A 4KXNA 4BZXA 2RHLA 1C8VB 4C30A 2O7VA 4YHBA 3TIVA 4Z6KA 2D74A 5ISMA 4IIYA 2HIGA 1AGNA 4MS4A 1ABEA 3PE3A 1HDEA 4G26A 4HQNA 3K6KA 2X7XA 3C48A 3AKDA 1TCBA 3Q41A 4LF9B 1ZUHA 2P3LA 4E4RA 1SXIA 2I8LA 1JMYA 3OD1A 3FG9A 4K5QA 4HNGA 2X40A 2CKMA 4MXDA 3UW3A 5LWHA 2XA1A 1A5SB 1Z2EA 3OAAA 2ILTA 3CZMA 1K5GA 5I9MA 1J7KA 1ZD2P 2DCMA 1MB0A 3IP1A 1C7RA 1XXLA 4PRYA 1KGDA 4GL4A 4KK3A 4WPGA 4KUEA 2QN8A 3KZMA 3T0IA 5MDHA 2IYSA 1MG0A 1K9VF 2X42A 3TLKA 2F3UA 3F4KA 2KS6A 2Z43A 2FJPA 2WTUA 1OTHA 2SCUB 3NFYA 3QPVA 3T12A 4YV1A 4LHVA 1QZTA 4DPKA 2CXQA 3R7BA 1NSTA 5FEMA 2B21A 5EMJA 5C2JB 3EYAA 4DREA 5KS2A 3N7TA 1QYXA 4HS4A 2QPTA 1BKSB 4OG2A 3LAWA 1W29A 1OXBB 2WUEA 3KL2A 1Y1RA 1NJFA 3AR9A 4W8HA 5EIBC 5HE9A 2PIDA 4CLOB 2IJGX 4IF6A 3IAS6 2M32A 3KG2A 1JHMA 1EX1A 1EKXA 4IFEA 4OP3A 2GBLC 4M1YA 2Q5LA 1LW6E 1L5KA 4JR1A 4N3NA 3WJ2A 1U2GC 4BNYA 2EW1A 3JQ6A 3O8QA 4QVGA 2X3UA 3CGWA 3FCAA 2FB9A 3LHKA 3IUEA 4M8KA 1PV4A 1TO6A 3A7DA 3PDUA 5F98A 1JQLB 2PXAA 2ZYAA 1OAOC 3EUAA 3KKEA 4MV3A 4P5DA 3T4UA 3V1LA 5A5EA 4WY8A 1XCLA 1U2DC 3F8WA 1PEDA 3FUUA 4REMA 4WHMA 5HZKA 3QLEA 2AI1A 2IDMA 3RYCB 2WJAA 2ZW9A 4TMVA 3BGVA 5DP1A 1NI4A 2AC4A 2YY5A 3FFAA 3V8VA 3GPBA 4D9JA 1KAMA 2FPPA 2X6QA 3HN6A 1OMOA 1WA5A 1IWBB 4L9AA 3TE6A 3BZUA 4GWLA 1H69A 1LC3A 3THWB 4LF7B 2XBMA 1WPRA 2PKQO 1POXA 3IAXA 2V6JA 9LDTA 2H29A 2EBWA 2F64A 3IKLA 5A7HA 4P4GA 1FTYA 3S2UA 5EPUA 4DHWA 1QVVA 1OZAA 1UXOA 2XJ9A 2D4HA 3EUWA 4KN5A 3V8NA 3DBLA 4BLUA 2Z2ZA 3H2JA 4TWJA 1F8XA 4CKCB 1VJRA 2GESA 1RBMA 2ID9A 3A14A 3QVWA 4IIJB 5AW6A 3I2KA 4G5GA 1M3SA 1PL0A 3KEOA 4R2LA 1KIAA 2QP3A 3KTDA 4GYWA 1F1JA 1FU7A 1JNYA 3J81k 4KO1S 4J0DA 1SBQA 2HQBA 2ZB3A 3KTAB 3L7YA 3ROTA 4D8UA 5AM3A 4GOJA 2RGNA 4WNAB 3S2YA 4FK8A 3WIOA 4CN8A 3NWEA 4H7PA 3DOHA 4UTPA 4K3VA 5AJYA 1L5NA 3G6WA 2ZETA 3T3OA 2QGNA 3R1IA 1PIWA 1QDEA 4I2NA 4Y0AA 4NBKA 4DJJA 2QRUA 3EC2A 5EINA 1A8SA 4FOOA 1UBOS 1QIEA 2HBQA 2GN1A 1EB8A 1ZH4A 1GGKA 5H8WA 3DSRA 4EG6A 3OQVA 3DC2A 1UC9A 1WSDA 4JK3A 1NLMA 2I4IA 6LDHA 1A9YA 2G0NA 3DOIA 3GEEA 4MVJP 1P1HA 3SS9X 1UFOA 4OMFG 2F9MA 1JXMA 2C88A 2BPOA 2Q62A 3SHTA 3T8YA 3KOOA 1XG5A 2H5IA 4HLDA 1NBMA 5HFAA 1RYZA 4LF6B 4AW9A 5E0KB 1ODSA 4EUEA 2JFYA 5JRJA 1KEWA 1Z47A 4JOQA 1N8KA 3CVVA 4X5OA 1GSOA 3D8BA 3H6GA 2JGDA 1RC0A 3ODPA 3ZH2A 4JJ8A 4RAQA 3Q2IA 2Y0DA 4JI1B 3JQGA 4DR2B 3ROXA 1EM8A 3V3TA 2BEUA 2C57A 3R41A 4H1TA 5GADl 1DCMA 4QG7A 3WE7A 3CCFA 4M9XA 2QT1A 4FBLA 1M74A 3ER6A 1E9VA 4C01A 4WACA 1UZAA 1SBHA 4RPJA 3JQ8A 3B1VA 4OY3A 1MXFA 2YUTA 1OXVA 1OROA 1KIFA 4KRXA 4TKMA 5AK6A 4WH0A 5GMOA 1MHPA 1QTIA 2B61A 2AJCA 2OO7A 2RI0A 3GMSA 5GM2A 1CUXA 1E20A 2P69A 2WTXA 4PTZA 1J9ZA 5AOAA 3TH5A 4DCMA 1JAXA 2GD0A 1FF9A 1Z68A 1LPPA 2XYQA 4RKYA 2W00A 3T9FA 1USVA 2H8KA 1N5DA 2P9GA 3AF4A 1URPA 2VNKA 3TIFA 2XXBA 4KQ9A 5JNRA 1PR0A 1QDLB 4I4TA 5CIQA 1V4NA 2PJDA 2X2EA 4EPYA 5FNZA 1RQLA 4BE9A 1IUPA 2EP7A 4P35A 4ZK6A 2ZR0A 1H8HD 3BHIA 2BZ1A 2GBGA 1YJAA 4HX5A 4YJ2F 3CPEA 4EG1A 2XNHA 1W581 1R3UA 3G02A 3W1VA 3TD6A 4CLDA 4U9UA 3EE6A 2WG0A 3W3AD 1SCKA 2GKSA 2Z3ZA 5JE8A 1EP2B 1AIPA 2PGLA 3IYLW 4JD5A 1NVVQ 3ORQA 4QJIA 3BBPA 2ZI7A 3CR3C 4X3CA 1HFWA 4U63A 3PKJA 2ZI4A 1V25A 1NOKA 2ONJA 2OWDA 5ENVA 1GN8A 2BVNA 2YJ6A 3QUTA 4C04A 1MDFA 2Y2UA 4C78A 1TAGA 2D2XA 1WZCA 2E3JA 4X92A 2Y71A 4UU1A 5CLHA 3I61A 3TGWA 2Q27A 2GZSA 4DSTA 4P7GA 5A62A 5EERA 2QAGC 4YJ3F 2DPHA 2GBPA 1GPDG 2IZ6A 2OHJA 3IQEA 1WD5A 2L17A 1T0HB 3K9WA 4JLPA 2PZBA 2QIPA 1M2WA 1U7TA 1A77A 1QYVA 1YB4A 1ZRHA 3Q12A 4LHYA 1VPDA 4BO3A 2WC1A 4JU9A 3B78A 4FLFA 3KYJB 1WETA 4CLEA 4Z9XA 2PVPA 3CNLA 2BRUC 4A5SA 4H31A 1GZ4A 4ZOBA 2ZR7A 3HV0A 1OXMA 5AUOB 8ADHA 4UHKA 3OFND 3RT7A 4NATA 2TMYA 2ORWA 1AXGA 2OQVA 5HKLA 1ZBDA 1D3AA 2WYWA 4K2HA 2QR2A 3TI9A 5BN5B 1JKFA 4S05A 1YJ5A 3HNPA 4QUHA 2XWPA 3W04A 4WK2B 3OOEA 2QK4A 5F77A 3RAPR 4LOLA 4IPTA 1XOIA 1DAMA 1OI3A 1N6HA 3AB7A 4IR7A 1EDDA 1FNSA 1LQUA 1YQDA 2VCEA 4NH4A 4H4EA 3RVSA 2XOXA 4KVGA 3WTBA 4C3OB 2DF8A 2PS1A 3O3NB 5GGXA 2QI9C 4QULA 1L8XA 4KFUA 4LY9A 4JI4B 3L0CA 3I5UA 3GRZA 2CUNA 4K8OA 4DRXA 1UINA 3UCFA 1IJBA 1QNFA 1C1YA 2XNDD 3A28A 5DNDA 4XSHA 4KLZA 4Y2RA 3C3WA 3RJTA 4E5NA 5A3QA 2LXNA 2XE4A 2FPRA 3WGJA 1XWIA 1ESNA 1Y5RA 3MSCA 4RY2A 4YRMA 4DYDA 4XWKA 2YWXA 4CCWA 4WT7A 2RIRA 4EJ0A 5KX5B 1I4OA 3DNMA 1Y4ZA 2V7VA 1E2PA 1KC1A 3BMQB 4ARBA 1C3EA 1G8JA 3KQUA 2C9YA 3GUYA 4EENA 4RDXA 1MP0A 4NOJA 5TPWB 3B51X 1USWA 2ICAA 4KXMA 4DXAA 4LQLA 3ZW9A 5JAHA 4ZVVA 3PJEA 4MUKA 4QBTA 4WNIA 3DO8A 4AWBA 1KMNA 5EWJA 2KB0A 3DE0X 4QXAA 1WF3A 4RNDB 5D6OA 4NNOA 2P5SA 4HTAA 1EEXB 4L7QA 4RKWA 4TWBA 5I3CA 1R0RE 3L06A 4HY3A 4IX1A 2PUGA 3L93A 5GJWC 1L6IA 3VJRA 1XMJA 5DFAA 3UMVA 3P52A 1XKXA 1GFIA 1NBOA 2DECA 3ECAA 2PTHA 4NIMA 4R68A 3V7UA 3O3MB 3ZV4A 3GZNB 4JXXA 2COKA 3FHJA 4YH1A 1YJ8A 2G67A 5BNTA 1NT2A 1D4ZA 1XLVA 5TJHA 3TSOA 5EWMA 3UHAA 1NJ6A 1LNQA 3KUXA 4G63A 1NE2A 3O83A 4W1SA 1N25A 5CB4A 3A6DA 2X9VA 3OP4A 3NT4A 3R20A 3BWVA 4BN0A 2XOEA 4D1YA 4F4CA 3WQSB 4FYMA 2IX3A 4ZC1A 2JLWA 3HBAA 3A58B 3UT5B 1VHTA 2CB0A 5T57A 5HIMA 1DGQA 3SC2A 1B93A 3DR3A 4MGEA 4HCJA 1RPNA 4G97A 5CH3A 2R7KA 2P2ZA 3O8LA 3ENZA 3RANA 3U2QA 1HFEL 2FGJA 3FNGA 2O8FB 5TQ2B 3A1UA 3EAFA 4KGXA 3BWMA 2VTEA 4X0EA 1BVRA 4DAOA 1GAQA 2AF3C 4PANA 2BR3A 3QOYA 2QUJA 3OAAD 3WV5A 1R16A 2IOFA 1N8NA 2W58A 4PSUA 3LVQE 2F59A 3WJAA 1JSZA 3T3MB 1E2GA 1N3IA 4HAWA 4MOWA 1YVPA 4AKSA 3VJLA 4DJ5X 3BXFA 4E6EA 3R7DA 2F2TA 3RK0A 2A5YB 4R71A 3KETA 1QYIA 1QIDA 4JX9A 1E4EB 2FQXA 1K8ZB 2BDTA 2LNDA 3FVQA 4MR8B 2A1UB 4EFKA 2I2WA 4NCNA 5K3CA 1D09A 2FKNA 1L4LA 2WWXA 1CY0A 4QUDA 2GZ3A 1VE1A 2JFBA 5EQDA 2OP1A 4QYMA 2CVPA 5D1NA 4JJZA 3KEGA 2AUNA 4TVKA 3MA0A 2HQRA 4F4DA 2WSBA 4PHCA 2JK1A 5ADVA 1VQ1A 3NHZA 4CDRA 3FPHA 2FPGB 1RWWA 3JZMA 3TW6A 4IVRA 5C8XA 5TXGA 4OJTA 1DBSA 3HJRA 3HDVA 4MWOA 4NDAA 4HDOB 2FU5C 5BQOA 4EUHA 5FDFA 1G42A 1FA9A 3PUYA 3PDWA 1NW5A 2VKTA 3PXAA 3W7BA 3IAM6 5FV7A 3RASA 1I7NA 2B8NA 3KKPA 3V8RA 2E4WA 3ZD8A 5IAOA 1QRAA 7ADHA 4RY8A 4MQBA 2BL4A 4MV4A 1G5PA 3N05A 1QFMA 4O02B 4C7MA 4AZSA 4S1OA 4EPXA 1Z29A 3GRCA 4OA5A 1JPVA 4U1RA 3UXHA 3AM3A 4UKDA 2HHHB 2FP4A 3QWFA 3I5MA 5CURA 2FI1A 1MENA 3SZGA 2JLVA 4X20B 1AUPA 3C43A 4UHFA 5REQA 3MTEA 1F12A 1ULUA 5FBHA 4RJTA 5DMHA 2MSLA 4F1JA 1R0KA 5JROA 2VP0A 3QELA 3U7GA 1TO2E 1A2QA 1AGPA 5G0TA 4LBVA 3EBLA 3IDSA 4KB5A 1XNQB 3C5WP 1MORA 5HGJA 4DSUA 1WL8A 2ZBGA 4Z53A 5TPZD 1W44A 3CF4G 2QDKA 1FOEB 1KK2A 1MGOA 3FCOA 3FHOA 4LDRA 4A82A 1ADBA 1JJVA 4DV1B 2KI5A 5D84A 3BL6A 1D1QA 1ZA1A 1NY5A 1FFGA 2OCPA 3PPWA 4HWKA 5E1DA 2H8GA 4Y8VA 4ZODA 1YZ3A 2OQRA 1W30A 2X0RA 3WHPA 5JEEA 3X3HA 3GRYA 5AK3A 3OCJA 3GWGA 1OT3A 4DEVA 5DRYA 5C7YA 5JFOA 2PLRA 3D3WA 2IH2A 4AJ9A 4M76B 4RFSA 4GRIA 4QPCA 4AG5A 1K06A 4B4VA 1SQ5A 4CG3A 3FSGA 4KE6A 4BUCA 1IZ0A 3OOYA 5FLYA 4CMIB 1S1MA 2NTJA 4I08A 1YKFA 1QUFA 3FPCA 5E6RB 4URXR 3ESYA 3QHQA 3QUBA 2RK6A 1C0IA 1NBMD 1VJ1A 3EZ9A 4DBVO 4TXLA 4D9KA 1VI6A 4DNPA 4IIVA 4PSDA 3HB1A 4E0BA 3PNQA 2PSDA 1B00A 2FOIA 3KIPA 4BAZA 2C2YA 2Y0BA 1AHNA 3UG6A 5L3ZA 4YCJA 1E5DA 5BSUA 3S44A 2IP4A 3DCNA 2UZIR 4HK4A 3AEQB 4CEJB 1WB4A 4JVLA 3H8JA 3PEVA 2ZSDA 4F2WA 1N8TA 3LHFA 5HRCA 2G5PA <