3IQGX

Structure of o-acetylserine sulfhydrylase in complex with peptide mnwni
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
310
structure length
309
Chain Sequence
AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Design of o-acetylserine sulfhydrylase inhibitors by mimicking nature.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 116
structure length 309
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iqgX01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iqgX02
2CLFB 4D9GA 4JBNA 4H27A 5D87A 2CLOB 2CLIB 1C29B 1TTPB 5J43A 4WX2B 3DWIA 5HBGA 1J0BA 2Q3BA 2Q3DA 5CGQB 4OREX 3L6RA 2ECOA 1J0DA 3R0XA 3AEXA 1RQXA 1BKSB 3L6BA 3PC2A 5EY5B 1A5SB 1CW2B 3ZEIA 2ZSJA 5I7OA 3IQIX 5DVZA 5B55A 1PWHA 3PR2B 4QYSA 4XUGB 5I7RA 1JBQA 4IL5A 4NEGA 1KL7A 4OFXA 4D9EA 4D8UA 2CLMB 2J9ZB 1K3UB 2ZR8A 4L27A 5JJCA 5DW3A 2ISQA 1Z7YA 1TJPB 3AEYA 1A50B 3IQHX 1KFKB 3L6CA 1X1QA 2Q3CA 4COOA 1TZ2A 3IAUA 1M54A 1J0CA 3FCAA 4HN4B 4D8TA 3VSCA 1FCJA 4L28A 1F2DA 2PQMA 5BW6B 2V03A 5IXJA 1C8VB 1A5AB 2CLHB 1O58A 2TRSB 1V7CA 5JISA 1D6SA 1OASA 1TDJA 1VB3A 3VBEA 2GN1A 4AECA 1TZJA 1BEUB 3RR2A 1K8XB 1TTQB 4D9IA 3BM5A 4D9MA 4AIRA 5C3UA 1TZKA 1UIMA 4ZQCB 4HPXB 1K7FB 5DW0A 5I7AA 4F4FA 4KKXB 3HMKA 2DH6A 1TYZA 4LMAA 3SPXA 2ECQA 2GN0A 5KINB 1WTCA 5B1IA 5KZMB 3SS7X 4L0DA 3VC3A 1KFJB 1WBJB 2RHGB 2RKBA 2C2GA 2JC3A 3PC4A 4D92A 4D9KA 5D85A 2EGUA 3DWGA 4D8WA 4D97A 4JBLA 5B1HA 4LI3X 5I6DA 1P5JA 1V8ZA 3T4PA 4D99A 1UBSB 4PCUA 4NU8X 3PC3A 5D84A 2O2EA 1K7EB 4HO1X 1J0EA 3FGPA 5I7HA 1A5BB 1PWEA 2CLLB 1CX9B 1K7XB 1E5XA 2TYSB 2WSYB 5DBHX 3VSAA 2CLKB 1WKVA 5B36A 3CEPB 2BHSA 5B3AA 1Z7WA 1KFEB 3IQGX 4Y6GB 5T6MA 1TZMA 1UINA 4D96A 5IWCA 4LMBA 1V71A 2BHTA 3DKIA 3R0ZA 1J0AA 1VE5A 3X43A 1KFCB 4D9FA 4ZU1X 2D1FA 2GN2A 2O2JA 1QOPB 1VE1A 1K8ZB 5IW8A 1KFBB 4ZU6X 1FUYB 3TBHA 4D9NA 5B53A 2RH9B 2EFYA 2J9YB 1Y7LA 2J9XB 5I7WA 2CLEB 2TSYB 5CVCA 2C2BA 4L3VA 5E0KB 3VSDA 4HT3B 1C9DB 3V7NA 4D9BA 2ZPUA 3SS9X 1K8YB 1WDWB 5DBEX 5J5VA 3X44A 4HPJB 4I1YA 4D9CA 2DH5A 5D86A 1QOQB
chains in the Genus database with same CATH superfamily
2C8JA 2CUTA 1M1YB 2Z43A 2IY8A 3K1TA 4NBSA 5FYDA 1L5GB 3F3SA 2I1WA 1GGEA 5A5GA 4BNMA 2NZ2A 2BCGY 1J9EA 1SBTA 5D1NA 1J0BA 3EXEA 2ZB4A 5F1KA 3IE2A 3ZQJA 2ETXA 3QXXA 5DNAA 2F64A 3T1NA 3DKVA 3FMFA 2CMDA 3GEIA 4J0KA 1VDMA 3Q0TA 5DF1A 5BMOA 5EJ7A 3ND9A 1XELA 3ZHVA 2XVZA 3BRCA 3V9PA 1C30B 2XCOA 6REQB 4BASA 3NHYA 1BRMA 5CG2A 4OX9B 1TA0A 1DQSA 1EUDA 1ZH2A 2VAXA 2XQKA 2WU1A 3HCAA 3VYWA 2ECKA 3DYVA 3RJZA 1K6EA 2G04A 1N2OA 4ZVKA 1ZGCA 2P2GA 5IJ0A 1W0KD 2H59A 4M0EA 3SZUA 2O5CA 2IEGA 1SIWA 1AC5A 2JASA 4FPXA 4H1HA 5KVVA 5FWYB 3CZCA 4NCHA 1TEVA 2V1UA 4RK7A 1PR3A 4N5DA 3EY9A 1MRZA 3U7JA 3DMDA 1D4ZA 1AK1A 1MTOA 4HDRB 4FQ7A 2XMDA 4BDSA 3BH0A 4Q47A 1WAMA 4AFNA 4RDCA 1N1DA 4L57A 4LJ7A 2QMOA 2XXBA 1QFZA 3SZOA 1LLQA 2WA2A 3GEHA 3IB6A 3BM5A 3N2ZB 2VYVD 3RIYA 4DRXA 1Q0PA 2D62A 3L7DA 4NLLA 2OXRA 1RQNA 2VZ0A 3FLAA 3HO6A 5SY9A 2GAAA 1GGVA 1O94D 4X91A 2IW3A 4XUCA 4GYJA 1N0UA 4DA0A 5G4LA 4R1OA 3ILHA 2YRFA 1B26A 3I32A 2O1XA 3LPCA 1F9AA 4W5HA 1KH3A 3OT4A 4H6XA 4B7CA 3I76A 4XFDA 2VHVA 4Z7NB 1H4VB 3FOZA 2OXEA 4KN9S 2FQWA 2AG5A 1BG6A 1W8DA 4TMFA 4KZKA 3JQGA 1ACJA 1OGIA 1S9DA 1D2NA 1CJVC 4B46A 3HWX1 1W46A 5EJ9A 3N59A 1J0EA 5LJLA 2M6LA 4A8HA 3RVPA 1J7KA 4AT1A 4YCDA 3QUBA 1O0CA 5TVKA 5HWSA 1JE1A 1E9AA 1DC8A 1SCNE 1NVXQ 2B94A 2YN4A 4TZ6A 3TIXB 4HZIA 1KPHA 4N48A 2QYTA 3CEAA 2PGLA 3IP1A 4P7BA 4REOA 1YIOA 3IAM6 1PS8A 3ZU5A 2IW1A 3T06B 3UMBA 1GYPA 1EUCB 1WXFA 2A1IA 3OLZA 2Q9AA 4BNZA 1XRQA 2BW0A 4Z9FA 4RK0A 3IURA 4S2EA 3I62A 1Q11A 1ZOIA 2WM3A 3L49A 5KPDA 4G9BA 4NJMA 1U0TA 4QPCA 3U4GA 4FR2A 2GOYA 1CR2A 3UCFA 5H3LA 5JH7B 5IRCD 1XVIA 3D8UA 3GLFA 4BVHA 1YAJA 2JBHA 2AN3A 2RH9B 2FFBA 4FR0A 4MV4A 4RDHA 1W0JA 2A1UA 1GGHA 2BIFA 3F73A 2PLRA 4GZ3A 5DNDA 3SAJA 1C3OB 3LNCA 2VT3A 4BOYA 2FZLA 1LVHA 4F6RA 4ENRA 1NY5A 2BGNA 4BGEA 3WZ2A 1N5KA 4CLOA 5CM8B 3GDGA 5BYJA 4EY7A 5HVNA 1NVAA 1I0ZA 2DQYA 2VTVA 1VJ5A 1ZUD1 3DAGA 3WP1B 3AP2A 2O9JA 2G40A 1EFTA 521PA 2HL6A 3B7PA 3EDCA 4PG4A 4F2DA 4ZICA 1S3SA 5DGXA 5LP6A 3MTJA 4Y9SA 5HNKA 2Q49A 1O9BA 3IBFA 5EAIA 1ZVJA 2P65A 2ZIFA 3ZU6A 3DF9A 3ICEA 3RE1A 1N9ZA 1OWNA 3H42B 3H16A 1KQOA 3CUWA 4YQEA 5CA0A 1G3MA 3RF6A 5KHAA 3ZGVA 5I01A 1W2GA 2B6NA 4BQSA 1RQXA 3N2GB 3NIDB 1XTJA 1J8MF 3MMNA 1ADJA 2NQTA 2ZBEA 3OCCA 1Z4MA 3P0IA 3S2YA 3W34A 4LF6B 4EW1A 1Q7GA 1HOTA 1F0YA 3PZBA 3PHHA 1AHNA 2FPWA 3MYRA 2MU1A 1ZI8A 3Q3CA 4CCAA 3TG8A 4MCAA 2P6RA 4LJ5A 3Q7RA 1UPBA 3RABA 4ZT4A 3P0RA 2BFDA 4I14A 1VLZA 1Z7YA 1XYVA 2QLMA 1DIHA 2Q2NA 3CS3A 3AETA 1P60A 3OA0A 4PHGA 5LSAA 4JYZA 2VXCA 4H4DA 4C7VA 1UMBA 3RS2A 2OO5A 3DE6X 1SUDA 1TQ6A 1AQUA 1KP9A 4ZRNA 4LJ4A 1FTWA 1U2GC 1WCXA 5D3ZA 4O2AB 3AW8A 2ID7A 3TIIA 4LOHA 3CX7A 3HA7A 3NUQA 1S7GA 1MT3A 3B2EA 2YVLA 3DOUA 3FLEA 3QX8A 1NUSA 4Z6KA 3NBUA 4R5HA 4ARZA 1NFQA 2HMAA 1N7GA 3DZKA 4V0RA 4DG9A 1GTVA 5F9MA 3IL2A 3G9XA 1SCJA 3LJKA 5D3KA 2HA3A 4X7MA 3RG8A 1TAUA 5FEUA 2JAUA 1PV1A 2W42A 4TGLA 2HUPA 2HLDA 2JVKA 3HZRA 3IVXA 4MJ3A 1R18A 3P0FA 4JLNA 4LMAA 4RETA 1PLLA 3WLJA 4FFWA 2CEKA 1E0AA 1GT6A 3K0FA 2AFIA 1L6RA 1D1SA 1UOEA 1TK2A 3E7PA 3NX4A 5CU7A 4XYBA 3WHLA 1KTIA 1YC5A 4EECA 2VK4A 3WJ2A 2QNRA 1F60A 5KOYA 3BXGA 2CXRA 3O8QA 3AVUA 3FR7A 3WXBA 1X7YA 3OZBA 2HKIA 2O5RA 3AFIA 4J8PA 4C22A 3OZAA 1SG6A 1W94A 1LPNA 1RJGA 3KIPA 5KPJA 5ESWA 2CCJA 3PXUA 4BVEA 1XVTA 1Y33E 1QVAA 2ROQA 1BVYF 5KTMA 1DC5A 1VG0B 1SUBA 2LIPA 6ABPA 3O8NA 4Y2HA 1LDNA 4ALJA 1QF9A 4D0LB 4MUKA 1XQWA 4ZCMA 4MQ4A 4CIDA 3VKGA 1TLLA 4L85A 1IWPB 4CRWB 2XB9A 2JIRA 3CJRA 2OECA 5TPWB 1LQ2A 2JFVA 4CL3A 1E6EA 1KFCB 3G9QA 4FZ5A 2PGXA 4TV9A 3WNDA 4JUBA 1BE8A 1VE6A 3R77A 3C41J 5COAA 4A2QA 2KHZA 1X15A 4RULA 1Z8HA 4QOHA 5JNUA 3N1UA 3ROXA 1OZAA 2BFEB 4LJ8A 1H0RA 2P78A 3JR3A 1FDRA 3N0VA 3C39A 4PLVA 1P9LA 1J2JA 2GJ4A 4YFYA 1JZSA 2UUPA 4JFRA 5E8RA 4OPMA 5IG2A 3SFZA 4DBZA 1WPRA 3TZ6A 1K8YB 4M9QA 5EE5B 2DR0A 2NLOA 5TARA 1U7TA 2WAYA 4GKAA 1YVPA 1YDFA 1U31A 2PEYA 3F78A 4U02A 2P9ZA 3EEYA 4MMZB 5BOVA 3RT9A 4H27A 2HRZA 3KSUA 3KSBC 1SY7A 4CEIA 3EUWA 3K5WA 2BEWB 3QKIA 3EHDA 5TX7A 1HORA 2QRVB 4IAOA 2AWNA 3H99A 4X8OA 4DV7B 4ETNA 4DIOA 3FVRA 1R6XA 3GT0A 4Q3KA 1JW9B 3BJMA 1BX1A 4FNGA 3D8RA 4EFKA 4C6RA 1ZM7A 3NALA 4X1KB 2CL0X 1X7XB 2RCNA 3K9GA 4TTVA 2A5YB 4DSZA 2HIMA 2G63A 2ZBQA 1JQKA 2PQ0A 1CY6A 1K3UB 2V6GA 4B6SA 1W5AA 2FZWA 2X7JA 1XDSA 1TM4E 3FKSA 4TSFD 1M75A 5AVTA 4IRMA 2E55A 3COZA 3WK6A 3R9WA 2TMDA 1XTTA 1NASA 2OHGA 1E7QA 2KBEA 1RZUA 5K09A 4PG6A 4I3HA 4X45A 1KI6B 2GFQA 1ECFA 3MINB 3Q0EA 3QELB 4MKXA 3W7VA 2RONA 2M1XA 5IBPA 4V2UA 3B3JA 5TV2A 4O2BF 1AXRA 1ODSA 2NXCA 1TE2A 2B9VA 3G2KA 2J3KA 3HN6A 3DCJA 3KOZA 3O8BA 5EMHA 1VB3A 4UTXA 2HN9A 4P92A 4OBEA 2YFYA 3KHKA 4OUDB 4DSUA 3CLTC 4U2BA 4KN8A 5CJJA 4BAZA 2ZIWB 4NPCA 3U4AA 3EISA 5CBPA 1YMUA 2VQEB 1QCYA 4BNXA 2FHPA 2PS1A 4HUQA 1DOAA 1DFIA 1JAZA 2GCPA 3GFOA 4FOOA 5D3QA 5IK2A 4HLUC 5JSYA 3X1WA 2QLFA 3LQFA 3RUHA 3BERA 3UTDA 5LNK6 2A78A 1QRUA 5FWXB 1KDRA 1KDOA 3MLBA 4B84A 2NO6A 2OAQ1 2R6DA 3PNVA 5HMMA 4EPTA 1J39A 2YV2A 2EV9A 4QU8A 4CMEC 4M7RA 1YCDA 4H7IA 1DBSA 1YOVA 3A6LA 3LCUA 4PXSA 5I9LA 4F56A 5BSVA 1N36B 4BPRA 3NWEA 4KDRA 4EG4A 4AMBA 1IBMB 5K4AA 2H0AA 4PR0A 3ZW7A 1ZO8A 1DIAA 2B5WA 5DSTA 5KYGA 1NLUA 2QX9A 1KZ7B 4DGQA 3FFXA 2EEPA 2ZREA 2AZXA 3ZCVA 4XW2A 4IH4A 1HE2A 2DBQA 2BHSA 2IUEA 3PC8A 1RXWA 2FX5A 5LOVF 3F5QA 4ENPA 1HC7A 1ODLA 1YD7A 2IPXA 2KPOA 2C04A 2PBRA 4HVAA 1CVIA 2HPAA 4EO7A 3EPJA 3KOXA 1XHLA 5F3RA 1YT5A 4FYMA 3IHKA 3ESQA 1Z6TA 2AMJA 3GAAA 4KPEC 1FFXB 3QPBA 2X8JA 1GVNB 1CS4C 2FWRA 2VVTA 1GZHB 1Y9JA 4G56A 1GNQA 1J1IA 2OZPA 3FBTA 3OWXA 3TRFA 4AF6A 2FX3A 5CCXA 3RU9A 2H2AA 4E1AA 1N5MA 1V43A 4QWWA 1WUKS 3EC1A 2IDZA 3UXHA 2Q45A 1NWHA 3C45A 3VDRA 3QHQA 1CG6A 3A6FA 1HE5A 4JIGA 2YINC 4HNQA 1BXRB 3ZJVA 1NW6A 2J3DA 2JFXA 2QLNA 1FNDA 1YA4A 1KJNA 4HAYA 2OV3A 3DLPX 3CIFA 5M3BA 1UJ5A 1LTHR 1WV0A 2R6FA 4MKZA 4LPSA 3SSAA 4AO8A 2GVDC 2CXQA 1A69A 5CLGA 4KREA 2NGRA 3PQFA 4OHZA 1J0DA 5B3JC 3QY0A 4BKQA 3VO2A 1J42A 2VPWA 2R25B 1G8SA 1NQUA 4LE2A 1NHGA 3DAFA 3EQ8A 2H3HA 3N3AC 2XCTB 1TJ3A 2UDPA 2KW5A 4N49A 1NBWB 2QL6A 3KQVA 4A16A 3DBVO 2RCYA 4NY1A 1QZXA 1OT3A 1PN3A 4JU9A 5C80A 3SJZA 3VPBA 3QFSA 4GS5A 1M76A 2BRUC 3V7YA 2XZDA 3A14A 4HNRA 4JJKA 5F1OA 6AT1A 2WIBA 3B6EA 3PUVA 5CX1A 3RYCB 3EFEA 3PQCA 3VVCA 1H6BA 3FOCA 4M76B 3LU1A 4JLAA 4R83A 3GH3A 4MR8A 2B20A 3F9CA 3TLXA 3M9LA 4XIGS 4E13A 3L07A 3I2YX 1EP9A 1Z8NA 2UZIR 2IPMA 3PLRA 4OYLA 5KKNB 4PSAA 5BYBA 3OZ7A 4EJSB 5IAKA 1BWRA 4MUIA 4E08A 3COWA 4BQOA 3CGWA 1SCUA 2WV7A 3L79A 5C53B 1JSCA 1D0VA 2NV6A 2P69A 3ITDA 4Q9AA 4US1R 2R97A 1Z5GA 2NUTB 2AD1A 1X19A 3NKFA 1I0IA 4FFPA 4H17A 5FTWA 2YWDA 1XSEA 1NYRA 1JJFA 2DPYA 4YMWA 4CI0B 3SQLA 1GUFA 3U7FB 1JIKA 3PQDA 2FSIA 5TMEA 2O8DB 1LZLA 3PF8A 2IHZA 3EMDA 2BPOA 2FGKA 3OETA 2YIVX 5I9TA 5CH5A 3ND8A 3TFOA 4LY3A 2QN6A 3Q41A 3F8SA 3KQQA 1NN0A 2NPOA 2O0KA 1XEWY 2IYNA 2AKYA 3EVTA 4KPFC 3NAQA 4IGIA 1EWTA 2FJPA 2PH3A 2HLPA 1KZGB 2ODBA 4ED9A 1HY3A 3KKMA 4M9UA 4EQZA 2HEIA 4ALNA 2BTOA 2ERYA 2QAGA 4B32A 1BGVA 2ZRFA 4CUZA 1UAAA 1YDMA 4UQPA 4BNLA 2PKWA 1A8UA 3GVCA 5CVEA 1ZCZA 3H9EO 4LHWA 4P93A 3VO1A 4C87A 3FWHA 5KOJB 3JAWB 1T1JA 4KX3A 2WG0A 4QUAA 1KKLA 4FX2A 4I55A 3RTBA 1WW3A 5HYVA 1E2HA 4M9ZA 4EB8A 8ADHA 3LKDA 3OY7A 3BK2A 1R8XA 2J30A 2Y0EA 1K92A 1F8XA 1WP4A 3FDXA 2JIBA 1U0LA 3CZPA 3QPAA 4JC4A 4U2EA 3CLHA 3UHFA 3GGGA 1CD5A 5AI8A 1EVKA 4HAWA 4CQJA 3RFTA 5DT2A 5EIWA 1TA4A 3FPJA 2OYSA 4DLZA 4UCWA 2K2QB 5G1NA 4EHIA 1D5WA 5DHUA 2PMEA 2QOEA 1DTEA 3EH2A 5DTMA 3W5JA 3ZD7A 2BM1A 3B3GA 1E3LA 2QTVA 4LKRA 1CEEA 5KTPA 4ZK6A 2ABWA 4YRZA 2H92A 1AKUA 1H2HA 1MC8A 4LMPA 4WKCA 3X44A 4CKBB 3MMSA 4EI9A 2IYRA 3IV9A 4HX5A 4AS2A 4MJXA 2QA5A 4R05A 2VBGA 1NQ5A 4YP1A 5KYVA 4KI7A 4RTJA 4C06A 3K0CC 2ZQ5A 1V6CA 2AX3A 3L0OA 2WJIA 3VR5A 4B31A 4CEJA 4L1KA 4JYBA 2VKTA 3PKJA 2WTBA 3EUEA 1B93A 2J67A 4P82A 1KE1A 3ZQ4A 2JFFA 1J25A 4LECA 1Y5RA 3CZAA 5L3ZA 3TRHA 1T8TA 3K1YA 4B40A 3U7HB 5CXUA 3DZ8A 2HXYA 4DSOA 1B3BA 4YMIA 1PR6A 4Q4AA 5K2MA 1ZOPA 3TRJA 5L6LB 1LJ8A 4P83A 2WWGA 2X2EA 4RKYA 2OCXA 2PWZA 1P9OA 5F4ZA 4DAOA 4DR7B 2G1PA 1PD0A 5KQPA 1YR1A 3OLXA 1SG9A 3T1VA 5ALNA 3TRKA 2Q5HA 3C6MA 3EARA 3REQA 5JAPA 4TVSA 3HYSA 2P1DA 4KO4S 5FL7A 9LDTA 2II6A 3CXRA 2WMYA 2PL3A 4KYUA 1O6BA 5DNUA 5KYKA 3PSHA 4YJ2A 4EGAA 1YBHA 3HCBA 2O8CA 3RARA 1AKVA 2ZJAA 5K8CA 1DXYA 1F2DA 2FSHA 2QRGA 4IEIA 4Q7KA 3DEFA 3WLQA 4RADA 1ZGGA 1JLKA 1S01A 2ZITA 2BMVA 2WW8A 1Z7GA 4KSYA 3OZRA 3PPXA 3D5EA 3UAGA 3ZGOA 5KYNA 3IIEA 3R5HA 3EOBI 4GG1A 1FLVA 1DLJA 1JFFA 5LP6C 1I13A 3P0EA 1Y8RB 3QI2A 4WZBA 5JPDA 2WSSD 3B3FA 2R8EA 1CRPA 3H4IA 3KUKA 2J3HA 3I9NA 2B8NA 3P2JA 3R2JA 4GM4A 1W2HA 5ALQA 1TF2A 3C70A 3H6HA 4DQ0A 5GGXA 4CW7A 4FSXA 2G8LA 5HIMA 1GDHA 1QIKA 2Q4RA 1OBOA 1M6VB 1RJ9B 1SK9A 1SUIA 2VK1A 3ID6C 3N53A 3ML1A 5FTNA 3WLSA 2BC9A 1DTSA 2RKBA 1KEVA 2F00A 1DGQA 2PT6A 3P9KA 2FXVA 1E69A 3EVNA 5K0JA 1KI4A 2E48A 1AX9A 1OAOA 1ZUWA 5B1HA 2P8JA 3RFXA 4QEDA 4OGLA 5B2FA 5BWMA 3O7WA 3ROGA 1CNEA 1TJNA 1Q50A 1U8EA 4XVRA 2C61A 1NNLA 1ZICA 1ZN9A 3KHUA 5H3CA 1U3VA 2CMGA 3UWDA 3GZTB 2OO5C 1JDVA 3HDHA 5A05A 3RPEA 2CLDX 2JJ1D 4KODA 4XYMA 4DLLA 4E5KA 2J59A 1XV5A 3E58A 1HETA 1AN9A 3O93A 2OV6A 3OIVA 4PBTA 3UFXA 3W05A 1T4GA 3N0RA 5AHRA 2GESA 4B3FX 1IVSA 5FUBA 1V7QA 3ZY6A 3HKCB 2D00A 3R0IA 1Z0JA 1UBLS 2IHYA 2CHEA 3LG2A 1ZA1A 3PIRA 3QGMA 5DJ5A 4AZSA 3KQYA 3KOYA 5HCIA 2HPHA 4ZGGA 4XGIA 1XO1A 3WGQA 1GPKA 1ZBDA 2GEUA 3LDAA 2BUCA 3MTIA 5J63A 3TM5A 3NG1A 3WHPA 3CCFA 1FF9A 1BRTA 1T24A 2Y0BA 2MHCA 3KEMA 4Q1DA 4UXHA 4R81A 1MX5A 3G13A 2FUG1 3IQZA 4PFSA 3CNNA 3G0IA 2W2VA 4KQMA 4HMOA 4EF5A 2Z0MA 5CAEB 4M86A 3VSBA 1IG3A 5DBEX 3NRCA 2JBAA 1S96A 4RZIA 1OXKB 2N46A 1P80A 1OXXK 2PKXA 3U6KA 5J23A 2YWFA 4HUJA 2ZRDA 3WB1A 4QAJA 3M5DA 1QRSA 2AUNA 3NBFA 5T4HA 5CVDA 4ZO6A 1P0IA 1TUEA 3STYA 2O0JA 3VAZA 4P5EA 5HUHA 1ETUA 4RIFA 5EJ8A 4HTFA 2Z8ZA 1KQGA 5HBGA 2Q3BA 3Q1LA 2NXJA 4NYIQ 4COKA 1G8FA 2H31A 2PRKA 3A4IA 1IHXA 1M2JA 4B2LA 4CQMD 2L0XA 5IBRA 1PZEA 3KM0A 4CIBA 1H4QA 5EYPB 4H3KB 1NLMA 3WK4A 1JB1A 5BN3B 2ZSKA 3ZJTA 1LF0A 4ZO8A 5G3ZA 1KY4A 3ADPA 5F4BA 2FUCA 2YWGA 3ZJUA 3FY4A 5AM3A 1F06A 3WBFA 1H69A 4YMUA 4WFKA 3PD7A 4JBGA 2YX1A 3D2AA 3EIHA 1T6NA 3HK2A 4LK2A 4DARA 1U65A 1IN1A 2X6QA 2AMVA 4FFBB 4M8SA 1OLUB 2D4HA 3HG7A 1J56A 3BGOS 1WF3A 2OGZA 3ZDDA 4FNMA 4N0QA 2ZSDA 3KDPA 4UTPA 2QZZA 1OXVA 2UUBB 3B1WA 2ZUTA 3SMQA 3G02A 5GZ1A 2QENA 3E05A 4PSVA 2XMPA 3AHHA 3QNUA 1QS0B 5T67A 4RA9A 1BE6A 1K4MA 5FFNA 1FTQA 2IKSA 2REOA 2QHXA 5IDVA 4AS3A 4EHHA 3P9YA 1ZMXA 3ADOA 4D9MA 5C5CA 2JH9A 4YJFA 3UUWA 5JPCA 1R8QA 3PJDA 3T3IA 3U62A 4ANFA 2FWNA 2P7IA 2NZUG 4KWIA 4ZQCB 3USCS 3ESZA 3TLJA 3C7DB 2VKQA 3MFYA 3HYLA 4AMUA 4EPWA 3R40A 3FTEA 3JRNA 4TXLA 3GLHB 4MI3A 3LC1O 1ZVQA 4L08A 1FX0A 3O94A 3J80A 2UUOA 2PR7A 4HS9A 2V96A 4IHKA 4X95A 4FUQA 5FUWA 4MGIR 3TTYA 4W9MC 2R6HA 4LY6A 1PS0A 1A9YA 1AKQA 1CDZA 1WCWA 2WM8A 2FJUA 3K94A 4KLAA 4RQTA 4G1EB 4Z0TA 5BSRA 4QHYA 4DLRA 1E1MA 1KZHA 5ENDA 2VDWB 3CRMA 3PHGA 1K6IA 1AZSC 2CDNA 2GI4A 3VPSA 4B6PA 4XDHA 5KTNA 3CX6A 5LR6A 1B1CA 1C30A 4H2DA 4N3GA 7REQB 3C3CA 3LY9A 3GLGA 2XECA 6REQA 1Q6ZA 4LZAA 4XLLA 3LY8A 1KNXA 4R2KA 4JV5B 2CFOA 5DYYA 3B9QA 1H9CA 5KSYA 2OG2A 3FOFC 1OBVA 4DCPA 3UWMA 1QFXA 2HJHA 3I4CA 2YR0A 1B8PA 4EHBA 3CY6A 2NT4A 5U1PA 4PWYA 2JANA 3ULKA 2PZKA 5CLJA 3Q9LA 1PP4A 3VO8A 2V97A 4HDRA 4DC9A 1EDEA 4HL6A 3TFQA 3JQRA 1YQQA 4BEBA 1NKVA 1D2CA 1XX6A 2VDKB 2ORIA 3IEPA 4PXAA 1FTGA 3NM5A 1PFUA 4U9IS 3KOOA 4GQBA 4WOBA 4KRXA 3OA2A 4O2AF 1GYRA 1Q1ZA 2VNAA 5ED0A 5THXA 1WXWA 3SK0A 1ECBA 2BFCB 2IS2A 1ZIXA 3HY3A 2CHFA 4I6JA 1TU4A 2LE0A 4ZD6A 3RTCA 3VR4A 3VR3D 5J5VA 4CF7A 4V0LA 1TKBA 1ZM2A 3KOUA 4ZVVA 4DWJA 1A9XA 5C4GB 4M46A 5HIJA 3HYCA 1DAEA 3E3AA 1V25A 3GRKA 5LMNB 1TI7A 3GMSA 1YBVA 1NVEA 3C3EA 4Q4DA 1ZY2A 2GZ3A 3NXSA 2IU6A 1GWNA 2JLSA 2XUQA 4FFDA 1QYWA 5TQ2B 3ZDFA 5JAHA 3ZBTA 3W79A 4DMCA 3N3BC 1KF0A 4QJ4A 4RF5A 4BVKA 2WRZA 2SKEA 1XLTA 3DMGA 5BR7A 2QROA 3LKZA 2ETVA 1NVDA 3A05A 5A3VA 1QIDA 4ZCIA 4GNKA 3ZCRA 4UUQA 1E1LA 4UAVA 4B3IA 3PC8C 4TTRA 2B2CA 2IP2A 4HNHA 3ZK8A 3U60B 1IAQA 1G20E 2GKOA 1C2YA 4DCMA 3AERB 2FOIA 3PR2B 1QGYA 3C6ZA 4WKOA 2WT8A 3IQWA 1XIVA 4OLHA 2WFZA 5HRCA 4HMQA 1B0AA 3WLEA 4WNIA 5I9BA 1EUCA 2G08A 2IBMA 3DV0A 2QM7A 3RRMA 4DPLA 1LSOA 2A5DA 1W4ZA 4M49A 2QE7D 2LKCA 4COOA 4PGGA 1KWGA 2X2FA 2IFTA 3OBBA 4FHCA 2DF8A 1S4MA 2G71A 1IEVA 3S44A 1ATZA 1F9EA 2C1XA 4TM8A 4W7IA 1XDDA 3IVAA 5AJHA 5IZ4A 5JC8A 4GKKB 3Q3EA 2FHSA 1WUTA 2LKDA 2O3RA 2LRHA 4R2MA 4ARAA 4WOKA 5I45A 3A4TA 4G0NA 4MWBA 4MVJI 4GXRA 4TKVB 4C0WA 3W8NA 4GHWA 4OCZA 3WB0A 1RZRD 1C3OA 4OHBA 5JW6A 4B75A 3VGPA 1CF2O 1AM4D 1OASA 1PJ4A 1YOBA 3UWSA 1JKJA 4HAXA 4G2NA 2VDUE 4AJ9A 2WDPA 3OKFA 4Q1FA 5IPFA 3AZOA 1XMVA 5LA6A 1FMCA 1NR7A 4X20A 1X9GA 2VK8A 3R7NA 1Y1PA 1C7JA 3CPSA 3UCXA 1NUUA 1BCRA 1NDUA 3KWMA 3VYRB 1TW2A 1JKIA 4Q3AA 3WIOA 3DDZX 4KUGA 5KVQA 4I3FA 1WRBA 5JV5A 3QEMB 1V5EA 2JC3A 1R0YA 3DE2X 3PRKE 4BN0A 3NW9A 5D85A 3ENVA 3FX2A 3GRPA 2WSMA 4IYJA 2NXNA 5G0SA 3CZQA 1G8AA 4BLWA 2XBMA 5EJFA 1LLDA 3A4LA 2HMVA 1NBME 4RF2A 2I76A 2I3GA 2WD8A 3IOCA 3I6MA 3TCKA 1O54A 1FQKA 4FOPA 4JI3B 3TTXA 1LVGA 3E7WA 4LY0A 4LAFA 3L4JA 4ZEXA 2HA7A 4C6HA 2DR2A 5EJ4A 1OR8A 3SBXA 4KPYA 3NB0A 3KEGA 5JMPA 4CL0A 2YZ2A 1RABA 3NIGB 5BV2P 2IUUA 3B6KA 1QVZA 1KK1A 2Q1YA 3EUAA 4ZIRB 1BS9A 1KEUA 1PRYA 4S1VA 3LZ6A 4X8LA 4U8HA 2QMEA 2FZEA 3UW1A 1ZIPA 2C96A 1VLHA 1E5LA 1ICIA 3OOEA 4CQLB 1EJ0A 2C57A 3PXAA 4ZYTA 1UMDB 4C88A 1XP5A 1FSGA 1K27A 3FFBA 5T6BA 1RQGA 3G5MA 1MOZA 5FIUA 3V46A 3B36A 4D82A 4EBFA 1N78A 3UG6A 2IZ1A 3C85A 1QE0A 1O8BA 5ALOA 3HCEA 1CR6A 1PSZA 2O8NA 1DWPA 4I9GA 3TQQA 2AOXA 2Y0PA 4J03A 1XZGA 5G1PA 5BUSA 1VL6A 2LXNA 4ZQBA 3AB7A 4S1OA 4E31A 4K05A 3GLUA 3EQ2A 1HDEA 3HI4A 3V48A 1X8LA 4BUZA 1KO8A 2FFAA 5JBIA 5KNBA 1DBVO 2ZAIA 1M7GA 2G1KA 3R7FA 3QWFA 2QAGC 4CUJA 3AVOA 4B3HA 4AKHA 1VGVA 3I8OA 4IF4A 1HPLA 2X0JA 4LZNA 4M1TA 2J3JA 3PZRA 1KZ1A 3BD7A 4M8LA 4RGBA 4KSBA 1D2EA 1N2ZA 2GX6A 3AEXA 4OXYA 5DSZA 4C20A 3ADCA 5FOVA 2YV5A 1P61B 4MQEB 2C59A 4PPFA 3I30X 1UKCA 5LMUB 1L5ZA 4FCWA 3SC4A 3ZX4A 1WCIA 4ID3A 2G5TA 2I2FA 2BM0A 4GGPA 2IV2X 2NQ8A 3QG1A 5D7NA 3SHVA 2IGBA 3CA8A 3IT0A 4JT2A 4CIWA 3FAZA 1QZZA 2UXCB 3NHRA 1M54A 1BS2A 1J0CA 2JGAA 2CN1A 2HSWA 2Q5LA 1IEWA 4UE6A 1J23A 3STHA 4BVFA 4ZARA 1RXYA 4PZEA 5B58T 1JEYA 2HGZA 1U0OC 4X41A 1ZMRA 1M6NA 2BFEA 3AUFA 1D5CA 3E2MA 4LXTA 4OHUA 3EG9B 4IRXA 4Z99A 1ZH4A 5E6SA 3TOSA 2R62A 4CLXA 3HEBA 1CR0A 1UZMA 1U1IA 1PEKE 2NUBA 3D31A 3D6FA 4MK4A 1HOXA 4IH9A 4IMRA 1UBEA 2JGKA 3R7WA 1L7MA 3FMGA 1TTQB 2WVGA 3W5UA 1G6OA 4K86A 1ATIA 1TO6A 2JI8A 1MEOA 1UK9A 2F1HA 4UBNA 5DM1A 4O2RA 2W8ZA 4PC6A 3O9VA 1VSBA 3JQEA 3OC6A 4KKXB 5ICCA 2GK6A 4L5CA 2ZYGA 4J4BA 1NJFA 3NBKA 2BEWA 3Q4GA 5KINB 1MBZA 2GZHA 3OCYA 2RJOA 3WGJA 4CKYA 2QRVA 3O2QB 2OZLA 4XQCA 4NBUA 5BWLA 2WD9A 2RGGA 4CM4B 3FHTA 4B79A 3SIPA 2EXXA 2VJOA 2WWTA 3CVUA 5H80A 2C8VA 2EDCA 4HMPA 2OAP1 2QQGA 4X1KA 1X7XA 2CD7A 2PT9A 1JSXA 2FB9A 3BK7A 2AL7A 2YJNA 2YOHA 3G2HA 1GY8A 4OO3A 1OBCA 4D3DA 3AJAA 3LF2A 1RM5A 2SHKA 1HT3A 2QV0A 4NEQA 1P7CA 4WN3A 4N6NA 1ESMA 4XD7D 2B1JA 4IG9A 1GZUA 3W8RA 1XPUA 4C3OB 5IT5A 4MGHA 1LTKA 2QORA 1RFGE 1UZNA 3HEMA 3HR7A 4KCGA 5DV9A 4BX8A 3P5SA 3TQSA 1UAYA 1ULTA 3GPCA 3EXFB 3KALA 3PWZA 1ZQ1A 4EKGA 4F71A 1MFPA 1GL9B 4HZGA 4MRAA 3S1AA 1TTTA 2Q4DA 3QE0A 3RSFA 3GJRA 3DKIA 1EVEA 3DC7A 5CB6A 3A28A 5IM4F 2CDRA 3FKQA 2HBRA 3QJGA 4OMDA 3ZD6A 3QHAA 4G84A 4BBZA 4PO1A 2GMWA 4OUDA 2IHKA 2E5LB 2VSOA 3G1WA 5KB3A 3MWJA 1Z0KA 4JB3A 1IJKA 1H8EA 2WAOA 4TWZA 1JEQB 1X1TA 4KWHA 1U0RA 2DWPA 4X64B 3W3AH 2XY4A 4J9UE 2KSQA 4NAUA 4RX1A 2QN9A 5KYYB 1TA9A 2GK3A 2QRZA 3K1JA 1OAOC 2PX5A 3UAOA 3WQSB 3ER8A 1TF5A 2JFNA 4OV6B 2I33A 3ESDA 4DCOA 1IM5A 3ZTTA 4RH1A 3AHJA 4DSNA 2WNHA 1Z08A 1BQ4A 4MUAA 4NZMA 3W6PA 5DXFA 5J47A 4PCLA 3P4XA 3TXAA 3B6MA 4JQCA 3S2GA 3AUTA 3TW0A 3ZGNA 2VUUA 3SR4A 1JFTA 4IR7A 5EXSA 4WBSA 4DQXA 3B1XA 1H1TA 1HFJA 2ZSIA 4FLEA 4LBWA 1ZJ6A 4DTIA 2J85A 2GBGA 3BB1A 5EPUA 5FJIA 3CVXA 2TMKA 3KSZO 4KW7A 3E9DA 2CT8A 1KEWA 2Q27A 3E84A 2I2AA 4YMGA 1IZYA 3QTBA 3VAYA 1TK9A 1Z0ZA 3JYOA 2H4HA 2HK7A 2PLAA 1QGDA 1OQAA 4XPZA 5EIXA 1T2VA 5LB4A 1WDKA 2G17A 1NQXA 4J6FA 1ZH8A 3P0JA 5ANRB 1GAXA 2AQHA 4JJEA 2HNKA 4AN0A 1RI1A 1FFXA 2PZLA 2WYVA 3D6NB 3K6JA 3DBRA 3PNMA 1TQDA 2CHUA 5KNDA 5FBQB 2FZCA 3B38A 2FMHA 5LZ5A 4OB6A 4PBSA 2NO4A 4BBAA 2WHEA 4HEHA 2FN3A 1ID1A 1KYZA 3FGNA 4EW6A 1C1YA 2PRYA 4DQUA 5THQA 2W43A 1RLOA 5DM4A 4XQ9A 4MAMA 1KSFX 1WUYA 2ZBPA 3I0ZA 2C4WA 3RR2A 4LVNA 3UUFA 2V65A 3OIYA 3ZE2B 1RW4A 1AV6A 3T5DA 1CRLA 1BH6A 2JHGA 1AGXA 2VF5X 1SZPA 2Q07A 2ODAA 1NN3A 4J1SA 1EHCA 4MPPA 2BE9A 3D81A 4YRRA 4QVIA 3QBEA 1R88A 3I3SR 3MT8A 3NKVA 3GAMA 2OFFA 2AR0A 4KQJA 4X6YA 3SEZA 3HBFA 3BH7A 1M2FA 4QDOA 4FGUA 3L84A 3MOSA 1G41A 1ZP6A 5DCLA 2WJJA 1ZGJA 1UJ6A 1VECA 1ZNYA 3PGVA 5EPOA 1JALA 4BRSA 4ND1A 1AHIA 2F3UA 1Y4ZA 4RY2A 1KI3A 3NVMB 1OSNA 2A3NA 3OCWA 2ZEJA 3G2QA 1KVRA 3GEBA 1PYDA 1VSQA 3N2YA 4J1QA 4KPUB 4O4HB 3IE0A 5DH9A 1TEHA 4AJ4A 4YUVA 2GZ2A 3ZWMA 2Y4OA 1BHJA 3OQNA 4MGYR 1T0HB 5AYVA 3OUTA 3EY4A 4X94A 3RS7A 4IWXA 3NIBA 3B85A 4I1IA 4MLDA 5IXYA 5B64A 1A1SA 5CD9A 4MP8A 2BGIA 3FYCA 3RYCA 4HSGA 3COSA 1GKUB 1HH4A 2VN8A 3KPJA 5ADHA 5AM4A 1H5UA 3C24A 4MQMA 1UFRA 3J7AC 3BT7A 3NTRA 4GPEA 3UH0A 2DKOA 4EVSA 5BRNA 5ADUS 3SWWA 1WZUA 3ITKA 3EODA 1T6ZA 3X43A 5J58A 4ZJYA 2IZ6A 4EJSA 2FF5A 2ZE5A 3AVVA 1C9JA 2B37A 1YZUA 2G9RA 3GYBA 5CMLA 1CUIA 3RI3A 4V0NA 4W6ZA 2NUTA 4JL5A 4RDIA 4HT3B 4CEHA 2NADA 1UUFA 4CYMA 4Q48A 1AXGA 3DMFA 1KMQA 4OJYA 3ORHA 4EB6A 3SQWA 3T52A 2HHHB 2JJ2D 3VZQA 5AVVA 2FG6C 1B0PA 2O8DA 3VOAA 4HQLA 2C9MA 1E9SA 3U2QA 5C8XA 3I3OA 2VH5R 2EWWA 3AFHA 3AY7A 2OA0A 3QFRA 3REGA 3ZIAD 3GLIB 1POWA 2L82A 3OQ1A 1U2DA 1AY0A 1RKUA 4KFTA 4MRVA 5K0CA 1KJWA 1WWKA 4AJJA 2W2KB 1WXXA 5F78A 1ECGA 3LXRA 2GJ9A 5A2QA 2O3JA 2R84A 2EKLA 4GOND 1ADGA 3AF0A 2CXUA 1E8MA 3OFVA 4GI1A 4JL8A 1KMCA 1ARZA 1U8TA 1ZN8A 1SZJG 4YXWD 2FVYA 1U11A 3NBMA 3RKSA 3SG0A 3UY4A 4CWAA 3Q98A 5J9FA 4I08A 3UK0A 5KOJA 2NU7A 3JAWA 3TQOA 3GFVA 1FL9A 5KUTA 2IH2A 2BJWA 3QYAA 4LJSA 2FN7A 4EKEA 4OM7A 3L1KA 4GPZA 1NBMD 3MM4A 4L72A 4HGQA 3MRXA 4RY0A 1QMGA 1L5KA 1HDCA 3BMCB 1T10A 2EJUA 1M0TA 3HPRA 3OPYI 5CXQA 6Q21A 4GXQA 4DRYA 3L7OA 1BCSB 1L5FA 1Y3IA 3HDYA 4QDKA 2EW1A 4TTTS 4X93A 4WFQA 4CXMA 3NMUF 5LYJB 1ZGBA 2YMQA 2DFVA 2R7AA 3NASA 4P3NA 1XDUA 1GLNA 2NYAA 1XCPA 3KR9A 2BMAA 3WWDA 3AI2A 3OFNA 1URPA 3VVMA 1TUBA 3IT3A 4UHJA 1YSCA 2J0UA 1I6KA 3PUWA 4CQMB 3TTSA 4YONB 3EIWA 3IH5A 2XDYA 2IYOA 1E1RD 4CNQA 2QRHA 3I2KA 2I3AA 2QZ4A 5ELLA 2GPSA 3PDCA 1HRKA 1RM4A 5AXAA 4ZZ2A 5JTUA 2F8MA 4J7CA 2ZSBA 3N7AA 3VKWA 4GL4A 3URMA 4PPQA 4F06A 4EYGA 2DSNA 1N2EA 4FFRA 2JJQA 1M2GA 4QTZA 1GDDA 1NG9A 3KQKA 1VMKA 3FZEA 4BV2A 3BFXA 3LUBA 3MUNA 3B52X 3M1YA 2AVNA 4KR6A 1FRFS 4YA6A 2ZUBA 5LXTB 1WB6A 4F2HA 5BT8A 4J0CA 3GJ3A 3BHJA 1COZA 2Z83A 4P54A 4PNEA 3CHYA 2DCUA 4KH0A 4NL4H 5A9SA 3ERCA 5CD1A 3OZXA 5REQB 1QR6A 2FWPA 1Y5IA 4PG7A 2QM0A 1SO8A 4OAOA 1BC5A 2POCA 5CDFA 1YZTA 4IQ4A 5BSTA 1WKVA 1XBTA 3Q7PA 3VOBA 4GBED 3JWIA 3T7EA 4EJ2A 2AJLI 4QAQA 3TL2A 4N76A 1OH5A 4E5DA 4PG8A 1IWOA 1AA6A 2IUFA 3CSSA 2R1TA 2AZMA 4KJZA 1ZGZA 4QBHA 5AJUA 3G23A 4U0JA 2MIIA 4LEIA 5E9JA 4YAUA 4B35A 3KKZA 2QTRA 3G49A 3Q8KA 3G6WA 3UOGA 4RY8A 2PXXA 3TBFA 2F4VB 1SR8A 2B3DA 2QP9X 2X23A 1BDJA 1GT91 4HEJA 5E7MA 3AOEA 1QP0A 1E59A 1L5OA 4EIWA 4EI2A 5EKUA 2Z6UA 2C31A 3OPNA 1B23P 2JGFA 4AMVA 3Q15C 2IELA 3PEVA 2EARA 4B3JA 2OESA 2IYZA 4X3OA 2GUWA 2ZVDA 3KKNA 3NS7A 1KH1A 3X1JA 1U7HA 4DB4A 1ZSYA 1EINA 2UZ4A 2BI7A 1UBTS 2XGMA 1FVXA 1ZD2P 1N5DA 1UK7A 2H18A 5BXQC 2QUJA 4PZCA 1IY8A 1G60A 1PW7A 3QBDA 1T5HX 1W52X 4N7MA 1PYOA 1QNLA 2IGTA 1IZ8A 5ER6A 3FGZA 2VC2B 4GR4A 3PHLA 3H9UA 3HABA 3BRWA 3FTCA 1T5TA 2ZJ8A 3D8NA 2NO0A 4Q18A 3V8EA 4EY8A 4DW8A 2PANA 1Z4KA 3OZIA 4M0DA 5AHOA 1RVDA 4QGAA 3RBAA 2V7QA 2C82A 2HM7A 2MSNA 1CR1A 1WKBA 1L7AA 3OQJA 4RHEA 1T6BY 1SHUX 1NBHA 4J0QA 4DT1B 4DIKA 1QGUB 1AS0A 1VL5A 4QATA 5EE3A 4BX3A 4L27A 4DYDA 4RO0A 5FT9A 5LCXA 3S5JA 1JR3A 2HIHA 3DBHA 1IBLB 3JVVA 3RYHA 2WU4A 3LOUA 3GJ6A 3WICA 4BECA 2PVSA 2RHTA 1E9RA 2XOKD 5FWAA 3ZWQA 1YS2X 3CRW1 4IRUB 5C5EA 1LD3A 1V5FA 2VPQA 3AC0A 4ZHQB 4ESVA 5FOUA 2VUIB 3HN7A 4YQYA 3L82B 1DAMA 2O7SA 2X5OA 3F46A 1TVCA 2WFLB 4S0XA 1IN8A 4X62B 4JI0B 2XTAA 3BMOB 4J4HA 3M6XA 4X3CA 3VR6D 1G18A 1H42A 1TKCA 3WAJA 1Q0SA 5DCUA 4ZKDA 4ZYLA 4L8VA 2GZSA 4MS4B 4MW4A 3IERA 2DERA 1PJRA 2R44A 1U9CA 4TLBA 3UYLA 3VOSA 1DEAA 4IIJF 4RF3A 4M1MA 3AEKA 2VDPB 1DXOA 3MZ0A 1REQB 2AUMA 4JASB 4EFMA 5LQJA 4CETA 1A76A 3EVGA 3HYNA 2GXAA 2AHOA 1NSFA 1CY0A 2WD7A 4DVGA 2X0EA 3RVNA 5EWLB 1VG1A 3EDQA 3KYJB 221PA 1Q1AA 2XDWA 5EYPA 5KX5B 4YEDA 1UZAA 1CRWG 2HWWA 4ZQIA 3RKUA 4KRGA 1Z8FA 1EA5A 1TIKA 1ZN2A 4GICA 2YKGA 2Y1FA 3LT4A 4FK8A 4RK5A 2HYIC 4HYEA 1QYVA 3ZHYA 4GLBA 4NPAA 1RZVA 3P7MA 4ZQGA 2YTZA 4G5QA 1GQSA 4UBOA 3D6JA 4B34A 5CXXA 4AD8A 2P0EA 2NV2B 1Z16A 4FFBA 2IP1A 1OLUA 3EEBA 1MOQA 2O07A 4KIJA 4NU0A 5B4TA 3AQ4A 4QE3A 4U0KA 4XCQA 2WJ4A 1FVOA 2ZSEA 1QHIA 5KYXB 4KE7A 3CMCO 1BIFA 2ODPA 4JELA 5M29A 2ZXEA 3KAPA 1V1MA 1EDOA 1HFEL 1EK0A 4IOLA 4W7HA 5TPZA 1OGJA 1JQ5A 3EG5A 4IWYA 5TQ0B 3SOZA 4UKDA 1QQ7A 4RHUA 3UBTA 1VIVA 1YHZA 5TY0A 4EYEA 1SD5A 3G5AA 4TQUS 1N2IA 1LWOA 3EVCA 1IHPA 2IPNA 1YVDA 1R4MB 5GWXA 5K3CA 1UKVY 2FEPA 3CE9A 1MTZA 2XIJA 3GUUA 1GZ4A 1ZD5A 2B7CA 3M33A 3TFWA 4CKCB 4EKIA 3ZDEA 1AZTA 4MYUA 3P0HA 3O82A 2VDWA 4CLDA 3F6YA 2VTBB 4Q3LA 5IAEA 2ZSHA 2VHZA 2XYGA 7REQA 1PZGA 3KDSE 4GM0A 2Z6QA 2F90A 4BKPA 1YB5A 3D0RA 2CZQA 1T9KA 1K9SA 1XTQA 4X0EA 3VPDA 5A5FA 1AKYA 1XTZA 3KHTA 1SVMA 2R85A 1NVMB 1RYDA 3UPUA 5FWNA 4CM1A 1W59A 1MO3A 4EJ6A 3VU1A 5CH3A 3TCNA 1UQRA 4GZLA 3ZXIA 1LRLA 2P9QA 3GPIA 3KR1A 4UPDA 3DONA 2R11A 4A73A 1PWYE 3I4FA 4Z1OA 4WLFA 2ZANA 5DYNA 4CCYA 4N01A 2RGNA 3CT6A 3JQFC 3OJXA 4ER6A 5B7GA 3UKJA 2A7XA 2NNWB 4GOOD 1U0HC 4LJAA 1EESA 3VR0A 2J9FB 2Y1XA 4JLSA 5EIOA 3UK2A 1TAHA 1V6SA 3A2LA 3A7DA 4TKZA 5TXGA 1F0NA 5F7XA 2TRSB 3CEMA 1L4EA 2RGXA 2L69A 1U3UA 3IEUA 3T1OA 4BLQA 4EF4A 4FGLA 4BFUA 1BZYA 3K6SA 1OFIA 3SLRA 2SKDA 4S1WA 1QZUA 3R76A 1EFRD 1HFKA 2C5EA 4LRSB 2GA9A 4UDNA 2QK4A 1UDRA 4FOTA 1MJNA 1KHTA 4EUNA 3IOMA 1XTRA 2QXYA 2Y1CA 2C0QA 2QMYA 1CY8A 4X1IA 4ZPXA 2I62A 5FULA 4EMSA 2VP2A 3KSRA 2I78A 1IG0A 3DG9A 2JLBA 2C8LA 4QC2A 1H0KA 3BOSA 1W4RA 2GM9A 3AI7A 3IELA 4G0ZA 2H0RA 4IJWA 5FYQA 1N3BA 3NDJA 3R7LA 1RRGA 3LZCA 1O9HA 4XEHA 4B71A 3UJNA 3U7EB 2PRSA 4IICA 2EFHB 4KO2S 4LV8B 4RK6A 5ALLA 2OSVA 1E2FA 4ZN6A 3AKYA 3QUCA 3ZWAA 1G17A 2RHWA 1P5JA 5K8VA 3V34A 3HUFA 3T5TA 1DPFA 2ZPTX 3FVWA 3M49A 3T7SA 3ZGLA 3IEMA 3WSWA 1WLSA 1ZHHA 2Z9BA 1FDVA 1W35A 1QH0A 4ZMRA 2PUGA 3K2IA 5JRZA 1UPCA 1WPGA 2OQIA 3W9SA 3C4JA 2CLLB 1F48A 2PRZA 4IVPA 2N9UA 3IRVA 4JOQA 3RVLA 3AT1A 5DX0A 2CLKB 3MPUA 4JQYA 4MV5A 5NLLA 4D5EA 2WOJA 4O5AA 3BE4A 1EK6A 4B9AA 1ORVA 2P5SA 5KNCA 4Z51A 3PUXA 3W1VA 1M1NB 3ZDYB 1PEDA 3HWWA 4IIXA 2GYUA 2VYQA 2IEDA 4KDEA 2OMEA 1X2EA 3EW9A 5K51A 4HG2A 4PX2A 2N0SA 4PZPA 4QPZA 4X00A 1BHQ1 3T9FA 1QZ3A 4O4JA 4BJ6A 4FEAA 1ODKA 5AHXA 1NU6A 4XB1A 5FL3A 2D59A 1YUNA 3OHPA 3STUA 1G59A 4B7ZA 4YDRA 3FIJA 5C2JB 4J43A 3QE2A 5GPBA 5JHHB 3QWBA 5BPHA 4J76A 3MCUA 3EZNA 4JZKA 1L5HA 4FINA 3JARB 1I1QB 4QFBA 4D4IA 1WOYA 1VIMA 2GM3A 4XQEA 5JZMA 4LBVA 4POAA 5BYKA 4RNCA 3GDFA 5ALHA 5CH8A 1KAMA 5IARA 3VBCA 1L5QA 1GR1A 4MRMB 1E1QA 4MWSA 3LC7O 4IX9A 1OX5A 1O95D 3R3WA 4MULA 4QNRA 5H5JA 3BMNB 1QGAA 4X60A 3WL6A 4F7WA 1JIXA 2O06A 1QQ6A 4A1OA 2X19A 4IDGA 3BA1A 4J2HA 5CGQB 5CFRA 1A7JA 2YS6A 1D2MA 1JDJA 3E7XA 3L46A 2JKYA 1T0PA 3O1IC 2E87A 1Y6FA 2GRJA 3TMAA 2I4NA 4Q7LA 1TTHA 1NVUQ 5FQNA 4KX5A 1RLTA 5EZ5A 1WE2A 4LF9B 2P11A 2PPLA 4CM8B 4ZOQI 2ZUFA 3FFTA 4EJSC 5DBFA 1YJ8A 4ZREA 3EVBA 1AUVA 1JAHA 2AJBA 2JGDB 3N8GA 4DDVA 3ROQA 2BFMA 3OP4A 4MINA 2X6TA 2FP3A 4TWBA 3QJYA 4CQLA 2FR1A 4GMXA 1UMDA 5FNZA 3GRVA 5YASA 2XCLA 3BB3A 4ILKA 2C03A 1IK4A 4HF7A 1GOTA 4Y8VA 1A88A 5F1YA 4ZJPA 4J90A 1JQDA 3TXXA 1ZYUA 2XB8A 2M2IA 4C0BA 3KWLA 4YMTA 4IIUA 1RI3A 2C7QA 2TMYA 4GX0A 5LDGA 2JG3A 2QZJA 3JWGA 3KDAA 3UT0A 1KBQA 1U2DC 2BGUA 1E9VA 3FPCA 5DI3B 3TI7A 4IG4A 2XUIA 5JZOA 2PU5A 4B4VA 4NZYA 5EJIA 4C7JA 4RPIA 5JAOA 1CZHA 1VL2A 1C3JA 3SYNA 3MFQA 4MAFA 3N0WA 4ZCQA 2HX1A 5IAGA 2V7EA 4KEAA 1O96B 1G8MA 1SQSA 5FOSA 4E21A 3FNGA 3DC2A 4G5GA 1U9YA 1RS0A 1ECJA 2GJSA 4IOJA 2BAGA 1J8FA 1SQ0A 2X9QA 3KX2A 1GD1O 2OZVA 4IQ8A 3WZMA 2RJNA 4BQFA 2Y1WA 4MQEA 1U8CB 2PX4A 3SHQA 3KQPA 1QYRA 3QJ5A 5A6SB 3U61B 1GQ2A 2C5AA 1MUUA 2L2QA 1UC4B 2OOKA 3O90A 5CT4A 4LXYA 3PLAE 1FSPA 2FW0A 1I4LD 1BMDA 4HO1X 2OQRA 5KYUA 3RGWS 2RK6A 3FNHA 3OE1A 1YR9A 2RC6A 2IHJA 2G72A 1HMYA 5UKDA 4PG5A 3R7AA 1QF6A 2X0IA 5ESRA 4O29A 3W4KA 1G16A 1VBMA 4BNKA 3EPLA 4L3WA 3QYFA 3PNYA 3T4XA 3KQUA 4MV8A 1Z7WA 5KSPA 4OXIA 3TK1A 2CJWA 4PPYA 4CIXA 3E5NA 2IYLD 3IJEB 4RVOA 4CQNA 4UFNA 2WVJA 4YV1A 3E9MA 1WF6A 2JHCA 3HCNA 4LDPA 3LFHA 2PH5A 4X9XA 4K28A 4IHJB 1VLQA 1ZD4A 3ET5A 4MW5A 4OQLA 2AOUB 2HSEA 5IT0A 4UM8B 1SUEA 1VC2A 2JAWA 3SVTA 1T1IA 3BWDD 4CTNA 2HJSA 3SJBA 3FSGD 3PSAA 5CG1A 1VJRA 2ODWA 4Q9NA 4Y1FA 5FWDA 1EIWA 3SS9X 2AI3A 1TMGE 1UANA 1FXSA 4IJ5A 3B7WA 3LT1A 2GF9A 2PIDA 2QEQA 4XPIA 5E2IA 1E9BA 1C9KA 2DUUA 2ENWA 1JIIA 2C3PA 3TNFA 1QONA 1LPOA 2W2MA 1VHWA 1QOQB 2JVIA 2QW0X 1HNZB 3JV7A 1SBIA 2UVDA 3P9XA 4C0XA 3R20A 3CUTA 2H5EA 4OJMX 4BFTA 4XR9A 2ZJOA 3E1SA 3O2JA 1F3LA 3FZYA 2GD6A 3HXQA 3THOA 2DZDA 2B25A 1EVQA 5KQGA 4KR9A 2QJOA 2QY6A 3OPVA 4Z3DA 1G1AA 3GCZA 4YQFA 2B4YA 7ADHA 3TZKA 2N3ZA 1BFKA 1XQ6A 4HB4A 3B5EA 4O4HF 2Z58A 1YB1A 2L42A 1G20B 1XCOA 4C5AA 2VXOA 4Y2UA 3NAGA 5C8DA 3ROZA 1LQUA 1DLIA 3IDOA 4NENB 4X7RA 3U56A 1I5EA 2GTIA 2I2WA 2FWBA 1L4GA 2OHFA 4FMCB 1KXZA 1MQ8B 2C5BA 1HYGA 3EXFA 5CA1B 5JBQA 5IS2A 3GQBB 1BNCA 5K0ZA 5BP7A 5IN4A 2QUAA 1LPMA 2OOSA 2PG3A 3MSXA 1OH6A 4B5KA 1PL8A 4MUXA 3D3EA 3ORSA 5EE1A 2WB2A 4R5MA 1F4VA 3DFUA 4JUAA 3HJHA 4ZWNA 3UGQA 3WLIA 2VNKA 3PC6A 2WHXA 4JVOA 2JFBA 4RZHA 1MVLA 2ENUA 4KR2A 4QICA 3TB4A 1ODIA 2P9EA 4I9NA 4UHKA 3RFCA 5IF9A 1FP6A 1DIOB 1THZA 2P67A 2QSYA 3ZHBA 2CBGA 3DE5X 4MQFB 3IVGA 3FM9A 4B47A 3DTVD 3RK4A 5IBCA 2WM2A 3HUTA 2HTFA 3ZE0B 2YV4A 3NWBA 3RIXA 5I9MA 3KTFA 3CR3C 3ISTA 4WK0B 2YFKA 4BC1A 5IX8A 4L5BA 1X77A 2AOTB 2VF7A 5FOXA 3HTXA 1DKNA 1T3TA 3IQEA 3THWA 5FBHA 3TLCA 2IYVA 1QVRA 3SS7X 4CZ2A 2PRJA 2RFLA 3OU2A 1F7VA 3HDGA 1SBCA 2XIQA 4DNPA 4EEKA 5E7IA 1GPBA 2F43A 2EFCB 3WX0A 5BW4A 5IMBA 3FNRA 4DF3A 1E3QA 4ITUA 1NDHA 3AK4A 3FJ1A 5E4FA 1Z62A 4X8MA 1ODTC 1JQEA 1KJZA 1MAWA 5AICA 3KHSA 2ZZMA 3CUKA 1O94C 5GY7A 2XUKA 1ZISA 3AKEA 5BWNA 4F5DA 3ABQB 3H3JA 1KAQA 2Q0SA 3W4JA 5G0TA 3HUUA 1INLA 1J2TA 2Q1TA 2FMKA 2Q62A 3KJIA 5KDDA 1ITZA 1XCJA 2BBOA 3RYTC 3UIEA 5HJ7A 2O1WA 4R16A 3SE0A 4P0PB 2H06A 2RAPA 4AX4A 3BH6A 4ALKA 4OGKA 5E1MA 1OW3B 1E1DA 2ECPA 2GNAA 3HCWA 3VRHA 2F55A 1DKLA 1ZRSA 5JCPA 3WYNA 4KXNA 4B45A 2GN2A 1RWMA 1L3CA 5ILOA 2IXTA 4NOLA 4PYIA 5FLYA 4M1QA 2B92A 2GAJA 2WC1A 5DBGA 5DGDA 4EY5A 5BR4A 2GM5A 2O0LA 5ICGA 1D0IA 4TYYA 1P4HA 5CLIA 1YRLA 2ZK7A 4RS4A 3IUSA 4P3OA 3TKAA 3TSOA 1C1DB 1ZKMA 3INTA 4UNIA 3P2YA 4Z0PA 1FS4A 1Z7BA 1CUGA 2FA9A 1YZYA 3JQ7B 4QHSA 4U9UA 5D5HA 4Q0MA 4ZVRA 4OG2A 3GJTA 4ABYA 1WABA 4BY9E 2R8YA 5JQGF 1AZWA 3S6JA 4ENSA 4XX0B 1FDIA 3QLEA 4J75A 5E6UA 2J6HA 3TQIA 3OJWA 3LECA 5LD2B 1KYIA 2A0YA 3L1VA 4FP9A 1DINA 3U0BA 1GL3A 4QU0A 3PEWA 1JWAB 1P18A 1EK1A 2QKYA 3H5TA 3R3JA 4HDSB 2QRMA 4PF1A 3AQIA 1TTPB 2XAAA 3F1LA 4C7OA 5JAIA 1A95A 4LGYA 3MAJA 1PSDA 1AUQA 3KOWA 1U5AA 2IYUA 1ZVKA 4W8OA 4FB5A 3BGVA 4FGSA 2X8WA 1HE8B 1ZUNB 5LXTF 4UNRA 1ECPA 2XMBA 1N7JA 1QORA 2VHTA 2XCIA 3BJRA 5EZSA 3H5LA 3ZHCA 5KKAA 5IH7A 5ALJA 3V4ZA 2I6UA 1R74A 1LBIA 2GEDA 3AP1A 4JL6A 5AVQA 3UMMA 4MW2A 1EDDA 4OFXA 4BAUA 1ENPA 1PNTA 2AA3A 1FA9A 2YXNA 3QU7A 2VT7A 3U3KA 2HU2A 1W4LA 3U3RA 1XQYA 3NKLA 2GZDA 2WWIA 3H11A 5H59A 4LRUA 2DQSA 3S2EA 1B8UA 4AMYA 2XZOA 2FJ0A 1DWQA 3P2EA 1HRDA 1KIAA 1W8IA 3GDWA 5HZMA 3F5SA 1T4DA 2DECA 2WR8A 3QKRA 1GFWA 4RKEA 1L7EA 2DQ4A 4WCDA 3ZE6A 1OTXA 1WQ3A 5CFNA 1NMEA 3B13B 1C3LA 2VJYA 5F23A 1OXUA 5TMDA 2OLKA 3PF9A 4RFLA 2XTMA 1J97A 3CXUA 2Q8NA 2VDRB 3NATA 2B30A 3HDJA 2AH5A 3NRBA 1JPVA 1MRNA 2E6UX 3PI6A 2ZJ5A 4AECA 5AUNB 4MQ5A 4NYMQ 1YUBA 1V3VA 3GAFA 4YY3B 3C1OA 1SXIA 4IINA 1MW9X 2HZ7A 5G41A 2PLWA 1Q6YA 2Y99A 3T35A 3LPMA 3TD2A 2PXHA 1JDPA 2B21A 4GE3A 2H9AA 1E79D 1WD5A 3KKKA 2FPGA 2W2KA 5KTRA 3R5SA 1JDZA 4MO9A 4W9RA 5IYZB 2WI8A 3EEQA 3N2IA 3ZQUA 2K6GA 5CEJA 2G7ZA 1B6GA 1QX4A 2NWQA 2RGNC 3QF7A 1TCAA 3KYBA 4LTDA 1I3LA 3PDWA 4JR2A 3K92A 4JENA 4MVJP 2JIOA 4L6IA 2FNAA 2HAEA 1YHNA 1J5XA 2WF5A 4Z1MA 5CIQA 3SICE 1JSLA 3BSFA 2GPYA 3UOAB 3EJWA 5CLHA 2NVWA 2KI5A 1CP3A 1SAYA 4OBXA 3T15A 5HKLA 3M5PA 1QPZA 1PVVA 2YQZA 4A10A 3A37A 3P32A 1OFUA 3LVQE 4B0PA 4UULA 5DN6D 2Q1WA 2IQ5A 5LYJA 4DMGA 1FXWA 3N6VA 1YHYA 2XE7A 3HSSA 3RROA 4D9NA 1GUDA 4PGAA 4EGJA 1G5IA 1DKUA 3DPIA 1L7OA 3O8OB 2XT9A 4EATA 1XZ8A 1W36D 1S1MA 3Q9NA 1N25A 1PQWA 4DQDA 3GZNA 4ON9A 3O84A 1DS6A 1G9SA 3RD5A 3FPLA 4US0R 4NQZA 4FBLA 1KS2A 2AFRA 2DQKA 3PQ8A 3WYDA 2VTDA 4I1YA 4WFIA 1AGRA 4JB8A 5IDWA 1SU8A 3IYLW 4I50F 5IJ9B 1G98A 4KYIB 3ZXSA 4HZUB 1WTAA 4CG3A 1KZ4A 2UYOA 1UFQA 3BDAA 3L43A 4RTKA 2BSAA 1KA9H 2H1RA 2PO5A 5DTRA 1DKQA 1CFZA 1VJGA 4LXQA 4KTTE 1SC4A 3U5ZB 4MQUA 1DTWB 3LO8A 5CHYA 2CE2X 3O4HA 2ECOA 2G36A 1G5FA 3PVSA 1RMQA 2BHRA 4PLZA 3W9YA 2R8RA 4BFCA 5EEHA 1UC5B 3D4NA 2FUKA 4LHYA 5CGZA 4CODB 4L7VA 3GLFE 3FLMA 1JT2A 1T26A 2D7JA 2E4YA 2R79A 2Y1LA 3G2LA 1XHFA 2HA5A 2VJAA 3GRAA 5I7RA 2JLYA 1CERA 5CB4B 1EVZA 5L51A 1ZJWA 1IATA 3GXOA 1J1ZA 4I9HA 1DQPA 1FP2A 3E4CA 4ML3A 1T3GA 1NP7A 2FRVA 3DYBA 3GGCA 3WKDA 2XVMA 3G5LA 4J7AA 4C07A 4TWAA 4LX8A 2UAGA 4HQ0A 1PR5A 4EK9A 2MR5A 2J3MA 3OTHA 3ZBPA 2VR1A 3IAUA 1TT7A 1IY2A 1Z5ZA 1ZCFA 3TDKA 1SQ5A 3RFVA 4Y1RB 1KP3A 3K15A 2VRCD 1CCWA 4LZJA 2CB9A 1XVAA 3FPFA 2R5NA 3KVYA 1X0XA 4E32A 1XVLA 1XCMA 2FMIA 4NTZA 3EMVA 5JNRA 4DEVA 2W11A 5JSZA 5I8WA 4YAIA 1DL5A 1NXWA 4ZYYA 1XZPA 2O0HA 1SZDA 1K4YA 1NBOA 1EP3B 3MPOA 5C8YB 4KITB 5LZ9A 4UM7A 1JTEA 1PK7A 2IU4A 3WGGA 3KJGA 3ZY4A 4DJFC 1RZ3A 1J7JA 2JS7A 4M0MA 4B3BA 4BLRA 5I7AA 5JSQA 1JAXA 2YL2A 4DUGD 1OLSA 4FSHA 2DH6A 3KUXA 4OQZA 3TVTA 4ER7A 1AMUA 3TO5A 1Y3AA 1GM5A 1B8NA 4U6NA 2F62A 2XQIA 3OEED 5FA6A 3N2EA 1KVSA 2AR7A 2FN8A 4ARVA 1GJRA 2DMRA 4C76A 1IB0A 3HU5A 1W5EA 3UXYA 2W6ID 4HB3A 4PS1A 4AYXA 1SC9A 3DPUA 421PA 3VNRA 4F45A 4C4SA 2IRWA 5ITZB 3IEIA 1DKPA 1I9CA 1P19A 1O77A 1PKXA 4G36A 1OIVA 2OP1A 3PICA 4AXXA 1ZH0A 2Z04A 4M22A 4DT1A 1PWZA 1WHSA 1AUOA 1YZKA 3NHKA 1K7XB 1QTQA 3FXAA 5GINE 1PF7E 2COEA 1HEIA 1W19A 1W73A 3IQDB 4KYTA 2QTTA 3DCIA 4BE9A 1HNWB 5TB5A 1B41A 1FW8A 2X2PA 1SUCA 2I4MA 1OYOA 2YYSA 4M60A 4S35A 1RXSA 5EQDA 2RGEA 1F8YA 2WJZB 1Q57A 1XZDA 4MYDA 3TKYA 3V97A 3C1TA 4G0UA 2HBQA 4KJXA 2RHCA 4FFLA 2XF8A 4OD0A 4ZHQA 2XNSA 1XCLA 3O6VA 3O47A 1UT5A 2D1FA 3AUXA 1R6VA 3NNDA 4XH9B 5BQPA 4MICA 5DX8A 4MWDA 5JDCA 3BMOA 3K7EA 5IVHA 1C3EA 2X15A 3TOXA 4QZVA 2IY7A 4LPKA 1OU0A 4WZZA 3U9SA 4MS4A 1DJNA 1PJQA 1TLTA 4WW0A 3SBEA 3P1JA 2FDXA 3KD2A 4Q4JB 4YRNA 2RARA 4BGDA 4YBZA 2HJWA 1AQLA 1R8JA 2ZDGA 4GW3A 3U44B 4Y9TA 1R66A 1JB9A 1H0SA 2UKDA 3BILA 4FSDA 1SFRA 5A4AA 1CUXA 4MP6A 5ALGA 3S8MA 5BY2A 2CHGA 5FV4A 3WAGA 4UW9A 3KBOA 4DANA 1F3OA 1IIBA 2E0IA 2QE7A 2QYHA 3O4IA 4PQYA 3OESA 4XYGA 1DT3A 3EGXA 3VU9B 5KX5A 1QV9A 1MEJA 4FC7A 3PRYA 3CUSA 3EXAA 4QU5A 5EJ5A 2O7QA 2OTCA 4U8GA 1Y1RA 3USES 1BDMA 3RK1A 1ZR2A 2J7KA 4EA8A 1RZRA 4LRYA 1L3BA 3EGDB 4KXFB 1M2KA 2A5GA 3QQPA 4BO3A 2X8AA 2BBSA 3MAAC 4UZFA 3QOYA 4IL5A 3ZHSA 1Z18A 1T9BA 2V0GA 3EN0A 1G5PA 5CFMA 4AICA 2H8KA 1S8OA 3QK7A 2VHUA 4H0FA 4I1OA 4OFZA 4DYHA 4CFYA 2GO7A 2WILA 2J5BA 3DTYA 3FOWA 1ILEA 3M81A 5DLYA 3TWOA 3WSTA 3DO5A 1OBFO 4W99A 1CJCA 4V02A 2GCOA 2P2SA 3ABZA 3INRA 2I6GA 3F5DA 3MTGA 2BL4A 3UQZA 3PDIB 3S7ZA 1BW9A 4KAJA 4PYJA 2Y77A 3AF2A 4JZYA 4NU6A 4NZOA 4RMJA 5TQ0A 4IIBA 5BOSA 1E7MA 4W5QA 1BYUA 1JA0A 2D7CA 3RU7A 2QPLA 4MITA 4PNPA 4YP6A 2GVNA 3GH1A 5JXGA 2ZYHA 1SC1A 2E85A 2YRWA 5DNCA 4LSMA 5KNLA 3PC7A 2DETA 1TZKA 5ECYA 2A6PA 4DZZA 4YH1A 3QKSB 2QTMA 5CVTA 4PZDA 2JPDA 3DCNA 5IFLA 1EMDA 2VTBA 2OZKA 4XDGA 3I8XA 3DQQA 3AM3A 4JOSA 3LGXA 3WLNA 1WX1A 1VLMA 4XQGA 3U49A 2X22A 2GFIA 1T5OA 2NTEA 4NOKA 5AK0A 3NP7A 1XU7A 3GD7A 3O03A 1YCFA 2IS1A 4DLPA 4FYKA 1F1JA 4JBXA 2YZMA 1E2PA 1K0FA 5KVCA 2LCIA 4MWOA 4E4TA 1YB6A 1USVA 3V9AA 2IH4A 1V48A 3MWDB 3M1IA 5DN9A 3N9IA 3CKMA 1WLYA 2ZRAA 3FCUB 3QU9A 4G1BA 4PYLA 3IV7A 3R6WA 1NMSA 2F1KA 5IFKA 5KQRA 4AJHA 3HHEA 3D4LA 4GUDA 3QA9A 4B44A 4BP1A 2J9FA 1IXZA 4IQ0A 4KO1S 3M6IA 3X1MA 2BN4A 2HLNA 1RDFA 5KOHA 2JZNA 4YAOA 2JJYA 4UEOA 5G4KB 1IVYA 1PT9A 5H3HA 1EQAA 1QG2A 2VA9A 2XA2A 3DXZA 3OMLA 1X1DA 5DNYB 1QOPB 4PN7A 2A1TS 1R8SA 2G0NA 1OROA 4DIUA 3LPNA 5D00A 2X0DA 3K53A 4QGSA 4K88A 3WNCA 3ZIUA 3I61A 3EIQA 3AFGA 1JHPA 2VRBA 1U0FA 4K26A 3ZJ4A 1U3TA 3R6DA 1T35A 3MQ2A 4H3SA 2RKOA 4I3GA 4R3NA 5FAXA 3ZZUA 3LWNA 3H9GA 2AFHE 3ES9A 3JVEA 1Z4LA 4UVIA 4EHLA 4K9MA 5JO0A 4TV8A 4E09A 5AXBA 5L45A 4HC4A 1R3DA 1XPOA 5D01A 5K8TA 4MQLA 2I8LA 4BXOB 2NAFA 4KOAA 1RVV1 5K8IA 1JHQA 1HDIA 4WHMA 3D7MA 4E14A 1P1HA 1TXGA 1WXGA 5KMGB 2ZYSA 2PT7A 1K9VF 1STOA 1TFRA 1FBTA 1WUHS 3MEQA 3IV6A 1XZBA 5FI1B 4XARA 1C7EA 5JFTA 2FZ4A 1QPGA 2W8BA 4HGNA 1I9GA 2IOFA 4TRMA 1GPLA 2CFTA 3K32A 2IYXA 3FCYA 3NBQA 2XTZA 3OJOA 1RP7A 1TYAE 3IUJA 4ZTBA 4HNAB 3RM3A 1T8RA 1I2AA 3Q7EA 1UKZA 3JYPA 3OKAA 1EWYA 4BATA 1XRMA 2DOKA 4N1AA 4E2FA 4WDRA 1M1NA 5A3RA 5AKZA 4YI5A 1HTWA 1QHFA 2WZBA 3FTDA 4DCNA 1KNQA 2JCBA 4NBRA 1TT5B 2FG7C 2IIVA 1UADA 2MSDB 4MR9A 1WOMA 3VUFA 4DV3B 2NZJA 2WF9A 3G9UA 1U94A 2J5KA 4F4JA 3JYLA 1SZCA 3NVKI 4U7GA 2SCUB 1C8VB 1KDTA 3TSZA 1JVBA 1K2VN 3HFJA 4LRWA 1DEHA 4CG0A 5F2NA 1PL6A 4QULA 1JNXX 1QG4A 4DLAA 1RPNA 3A3NA 4W1PA 5SICE 2NO5A 5CLFA 1QQAA 2WFAA 4OK3A 4QBKA 3HZZA 4UBMA 1GL7A 3E48A 1XD9A 2Q6LA 1KVQA 3K5IA 1A7AA 4HEQA 2D06A 5HUJA 5DOZA 2P6UA 2I87A 2JGEA 4HGZA 2ATIA 5F77A 5TEVA 2IHTA 3FOEC 3OD1A 3V4FA 3JTEA 4X97A 4GP6A 1NVFA 1SVUA 4TKLA 1Z74A 1M7BA 3BMNA 3GOQA 4KAXA 2G3YA 4MUBA 3HA5A 3I04M 4NBVA 4B6RA 4HWTA 4YV7A 5C7YA 1LBTA 3K9LA 2V6JA 1RHJA 4AL4A 4YCLA 3RYIA 4QOGA 4AG5A 4Q19A 1NJGA 4Q1CA 3RTGA 3B1VA 4J29A 3E70C 3ZQ6A 2RB4A 2HFJA 4U7PB 2NO7A 3CNBA 1QTIA 3CNQS 4ZVPA 1Z2DA 2FMTA 2FPLA 1IBRA 3ZE1B 3WC4A 4H1TA 1EFPB 2HPVA 4C5BA 3K05A 3ZYZA 3TKLA 3FHLA 4WJZA 1NW3A 1F2TB 1L5VA 1D2AA 2JGDA 4OUKX 4FMCF 1J33A 2VOEA 4LX0A 2X9LA 3JQ8A 4YUYA 3WLLA 2G1JA 4E3ZA 1G5HA 4RU1A 3DTVB 4Z4IA 3ZZ1A 3R3XA 4G0MA 5ALZA 1VI2A 3S99A 1T8PA 4F4CA 2Z95A 1UINA 3QMPA 4JOBA 1NTRA 3DZDA 4IILA 3RKRA 1W1WA 1J9GA 3QVGB 4KGVA 1SOUA 4YRBA 2PZJA 2FE1A 3URKA 2JFUA 3H65A 4QXPA 1W0JD 2CVQA 1GPYA 3L9WA 2P75A 3T5CA 4RPJA 1H0HA 1RBZA 2H1FA 1UQTA 2I6XA 1E7WA 3K9NA 5DM2A 5DI3A 3HDTA 3SU8A 4IF6A 1C41A 4OQYA 2UYCA 4HRVA 3JATB 3DFMA 1FLDA 1GRQA 1JU3A 2JK0A 4NZZA 5FQOA 4E5UA 3C7KA 1WVIA 3M6WA 3M89A 4YFVA 5JS1A 2A0XA 1JVSA 2I67A 4J49A 2WSIA 1BXZA 1HLGA 2QJRA 3L4BA 3IEVA 1MO5A 2X5XA 3EZ2A 4YVFA 1F0PA 3ETLA 1VCNA 4W5TA 1VSUA 4URZR 1II8B 5ALSA 5DHSA 4WD3A 2H1OA 4RJLA 2PH1A 4GFDA 2ONZA 3TLEA 2FPKA 4Z4EA 2MINA 1IJEA 2FW1A 3NIFB 2DJIA 2H2DA 2VT6A 1QDEA 3KPWA 5A6SA 3RSLA 4BZZA 3LAWA 3L6RA 3NHFA 5E3JA 2ATCA 3JWPA 3QXSA 1ENYA 5IVDA 2P3OA 4GM1A 4LJ6A 2AK2A 2OCGA 4D4HA 4DY4A 1Z0FA 2VH2A 2ZYRA 1LH0A 1U80A 3FWZA 3K1AA 5AK3A 5C52B 1F2UA 3QUSA 4DJAA 3OIGA 1SCBA 3HCPA 3HNRA 5BWBA 2QU7A 2WMNB 3EBOA 3GLKA 1R0CA 3TL3A 4MWEA 1UXGA 4MHOA 1A50B 1ZSVA 2I7DA 3CO5A 3PITA 4LBYA 1P4AA 5F98A 1BOOA 1BDIA 2QZPA 4HWPA 4CV2A 1JGTA 1H6AA 4IHJA 2BMJA 4FKMA 1W9MA 1I4EB 1QDUA 2AOUA 2WUWE 2WTUA 1LNSA 2W2OA 4Q9KA 3JALA 4ZCRA 1EM8A 4DCUA 4WBXC 3DQZA 2G9UA 3I92A 3U37A 2BZ0A 2IIPA 3D6UA 4INPA 5BQOA 1XXHE 4ENTA 4K9PA 2DY0A 2HLDD 4F72A 1XVVA 4ZP1A 4UEKA 5FOTA 1EX1A 3AJEA 4EQ6B 2CL7X 4KNVA 3I2FA 4PFKA 3EQ6A 4BVAA 3EVAA 1ZD8A 1N3YA 4I4CA 4Z5XA 1IXKA 3LQ2A 2NSDA 3KK0A 2QN3A 2LNDA 1Q1BA 2EL7A 1W25A 3NGMA 1Y89A 1D4FA 3VKFA 1NI4B 2BLNA 3EEOA 2ZI4A 4D9KA 3B1KA 3K0AB 4XSGA 5AKIA 2OCIA 4KGXA 4M6WA 3TOCA 1P3Y1 4URYR 5KREA 1W93A 5LQRA 1YAHA 1LLCA 1WXIA 3PCRB 4G01B 4C1NA 5FBZA 3TUZC 5L3QB 2A4MA 1IXRC 4PGFA 3NHAA 5CA1A 5JDIA 2XYPA 3QXCA 1G4UR 3CF6R 1RAIA 1DAFA 1E5DA 4RKFA 5KWJA 1Y82A 2FR8A 4K3UA 4ZOAA 1YO6A 2QLTA 1TKRA 4UCFA 5B36A 4B3RB 2NP6A 3PEEA 1Z8DA 2JJ2A 3E15A 1DOZA 1GQQA 2NT3A 3MUOA 4AS1A 4IUBS 3K4QA 2OCKA 4R8SA 5EJ2A 1KU6A 1RYBA 1XQVA 3G2MA 2CXHA 3F4BA 3GR6A 3PFFA 1V1JA 4JJ4A 1XN1A 1E62A 1UEXC 5JCJA 1M10A 2G67A 2ZATA 2XLBA 2VP5A 1I14A 4MYTA 2FYTA 1U3CA 1VLLA 2PXAA 4WAUA 1XF1A 3LSTA 1VE3A 2OV1A 1GVHA 1LS1A 1V7PC 3GMIA 5FUYA 1I7SB 2D8MA 3MERA 4MUEA 4NDAA 4YAFA 5JD5A 4WK2B 3X1KA 3CNHA 1MO6A 4MVJH 2AOTA 4JR1A 1MB2A 2JFZA 2PCLA 2Y2UA 4QQNA 4JA2A 4FYWA 1MIOB 2UU9B 4UPEA 1Y98A 5B58C 5ITVA 4UZEA 4DDHA 1AF7A 4EZIA 4JI4B 3FCSB 1X1RA 3HB0A 4KDCA 4FEGA 3SZGA 5JEDA 2YC2C 3ELBA 2YXBA 10MHA 4MKFA 1X87A 4OQXA 4JCCA 1IOZA 1TPYA 4O2LA 4QA9A 4C0JA 1I3MA 5J43A 4ZZ3A 2XWQA 3MC1A 4F3CA 4B6JA 1LSSA 5IYZF 5E8JA 2HWKA 4XB6B 3JZAA 1E7RA 2XMQA 5I48A 4O4LA 3HJRA 3PRHA 4TYWA 4CHGA 4BO0A 2DWCA 2FE4A 4ZOCA 1PAUA 2PUWA 1PWHA 4MQBA 5CJ2A 4QPPA 1E2LA 3A1TA 5DLPA 3FKSD 4P3YA 3Q85A 4MCIA 3TVYA 2VNHA 1X13A 4X7PA 4DS3A 5JDCC 2JAPA 1TX4B 2H2GA 4G5YA 3KRTA 5DT9A 5SZIA 1W36B 3TE7A 1RXUA 4ER5A 4DJ5X 3ZOZA 5B6IA 1DO0A 4E2XA 4JX8A 4HAOA 2NZ8A 4GC5A 4RPHA 4PO8A 1FCJA 2GBLC 2RI1A 5DTIA 3RHTA 3WLOA 1Z88A 3DLAA 5C7IO 4YT8A 2J08A 1EKXA 1SA0B 4TQGA 2ZLBA 1C1DA 3TMKA 2AG6A 3BYZA 4RHFA 5IAJA 3SJ7A 1DKOA 3JQ7A 3LHFA 1ENOA 3KXKA 2NZYA 2ZULA 4IGFA 1K8XB 3D7KA 2WNSA 4I2NA 4JWTA 2VUTA 3AM1A 4XX0A 4QBIA 2WHPB 4J9VA 3TW8B 3HJFA 5IK2D 1J1UA 1UJ4A 3QKTA 2AEFA 3R8CA 3SHTA 4BP9A 4KQ1A 1D3AA 3IMFA 5G0WA 4F8YA 4OHKA 3LYHA 5JVDB 2J87A 4ZA2A 4E5NA 2X42A 4I1UA 4D4MA 1MH9A 1Y6RA 3GJSA 1VL0A 2YXLA 4ZIRA 1KR2A 3JASA 2JW5A 3LLCA 5BN4B 5K3FA 3U7RA 2QMZA 4UNQA 1UJCA 4N41A 4D4LA 4PX9A 4D99A 4NJOA 3DT6A 4YMSA 4M0FA 3LIIA 1B76A 3X1YA 3BQMB 4MIYA 1U1FA 5D84A 4AJPA 2QLLA 4TMXA 4RFSA 2ONKA 3KQTA 3WWPA 3A9CA 2H2FA 2CBZA 3F3YA 1PZNA 1XKXA 3LQQA 3DMTA 3R1IA 4JT8A 1VJDA 5CB4F 2OV4A 2FW8A 3FSEA 2H11A 1IM8A 4XWKA 5FNVA 4PLTA 3VI4B 3H1FA 3HNPA 1O08A 4PW0A 1GNRA 1NLFA 4RA6B 2OBMA 1C9MA 4DJJA 3D7NA 4TTQA 4R6WA 2BDTA 3UENA 1D9XA 1ONNA 1W48A 5MN4A 3PNBA 4INZA 1TVKB 2GRAA 3ZD8A 5TLSA 3P9CA 3A1NA 3ZHUA 3QENA 3MCTA 4DCGA 5JFOA 1RXCA 1Z7EA 2GF2A 1QO0A 1XU9A 3HCFA 4QU9A 1WDTA 3UUGA 3JQBA 2EBHX 3FDZB 1AZLA 3MJVA 1NNSA 3E5HA 3TD6A 1N7IA 5DBIA 1MHPA 2PL9A 1R4NA 2DGDA 2P4SA 2WUGA 1NNUA 2YWBA 1QWSA 4HEA6 1FP7A 1I5RA 2B98A 5T3YA 4MOWA 4N47A 3HWRA 4MKGA 5E7JA 4OHRA 4CFSA 5B6PA 1VBFA 3ED1A 1S2OA 3RQIA 1U5CA 3ETCA 1JT9A 3L7JA 3L8GA 1G1MA 1KPGA 1OTYA 1JJ7A 3ZLBA 4RDXA 4AKTA 4CKWA 1O6GA 1B42A 2PN1A 1ZPDA 5KYTA 1BYIA 5AO9A 2P35A 1V4VA 2WIAA 4UQLA 2RIRA 4P34A 3R0XA 3DLIA 4JXJA 2Z5VA 3C14C 5DZSA 4TPKA 3W5BA 1C1HA 1CE8A 4HDAA 2A9VA 2Q46A 4GLLA 1S7CA 1VRWA 2C4NA 1SUAA 2FCRA 3EXHB 4L15A 3RIHA 4ACAA 3RAGA 2P6MA 4KP7A 4P33A 4UUBA 1JR4A 1F6WA 2ESRA 2CXTA 4CN9A 3DV9A 2EJWA 4DLXA 1UFKA 1U0NA 3L7KA 5IDYA <