3IQGX

Structure of o-acetylserine sulfhydrylase in complex with peptide mnwni
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
310
structure length
309
Chain Sequence
b'AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
molecule tags Transferase
source organism Haemophilus influenzae
publication title Design of o-acetylserine sulfhydrylase inhibitors by mimicking nature.
pubmed doi rcsb
total genus 116
structure length 309
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iqgX01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iqgX02
4D9IA 1WDWB 1K8ZB 2D1FA 2CLLB 3L6CA 5DVZA 1BEUB 5E0KB 5B1IA 4D97A 4I1YA 1TZMA 3VC3A 1K8XB 4HPJB 3BM5A 4D8UA 2GN0A 3PC3A 4D99A 1J0DA 5J5VA 1C8VB 1A5BB 5IXJA 1WKVA 1KFCB 2EFYA 2GN2A 2RH9B 1K8YB 3T4PA 4D9GA 2Q3DA 2WSYB 1J0CA 1KFEB 2ISQA 1TZ2A 3X43A 1J0BA 2GN1A 5EY5B 4IL5A 5DBEX 5CVCA 2EGUA 1UINA 2BHSA 5IWCA 3HMKA 4NEGA 4COOA 2O2JA 4D9FA 4D9BA 1TDJA 4D9CA 1VE1A 4H27A 1K7XB 2J9YB 2J9ZB 3FGPA 4HN4B 5T6MA 2DH5A 4D9MA 2ECQA 4HPXB 4PCUA 3VSDA 1FCJA 2Q3BA 4F4FA 3RR2A 1D6SA 2O2EA 5J43A 1A5SB 1WBJB 5BW6B 3DKIA 1A5AB 5D87A 1UBSB 1UIMA 5B53A 5B36A 5B3AA 1V8ZA 2CLEB 3PR2B 1TTQB 5DBHX 1QOQB 1VB3A 5DW3A 1K3UB 1K7EB 1TZJA 2CLHB 1TJPB 4D8WA 2V03A 3CEPB 4HT3B 3TBHA 5HBGA 1QOPB 5I7OA 1P5JA 4Y6GB 1Z7YA 2ZR8A 5C3UA 1Y7LA 2CLIB 5IW8A 3VSCA 1OASA 1KFKB 1PWEA 4LMBA 4OREX 1J0EA 1F2DA 3AEYA 1M54A 5D86A 3SPXA 4ZU1X 5JJCA 1TYZA 1TTPB 2J9XB 4D96A 1Z7WA 4D9KA 3DWGA 1C29B 3IQGX 5KINB 3L6BA 3IQIX 4OFXA 2CLOB 5D85A 1CW2B 1BKSB 1X1QA 2RHGB 1J0AA 3IAUA 4LI3X 4D8TA 2BHTA 3VBEA 1CX9B 1O58A 2TRSB 3IQHX 5I7WA 4ZU6X 4AIRA 1K7FB 5I6DA 5I7RA 1FUYB 4XUGB 1KL7A 1TZKA 4ZQCB 1V7CA 4D9EA 4HO1X 4D9NA 4L27A 5DW0A 5D84A 2CLFB 1E5XA 3SS7X 5I7AA 1JBQA 1VE5A 1KFBB 2ZSJA 4AECA 4JBLA 5CGQB 2ZPUA 5KZMB 4QYSA 1KFJB 1C9DB 4JBNA 3V7NA 4NU8X 2CLKB 3AEXA 4L3VA 3SS9X 5B1HA 2ECOA 3PC4A 1PWHA 3ZEIA 4KKXB 2C2BA 3FCAA 3R0ZA 2Q3CA 4L28A 3L6RA 1A50B 1RQXA 2PQMA 2DH6A 5I7HA 3PC2A 5B55A 2TYSB 2C2GA 1WTCA 2TSYB 4D92A 2CLMB 2RKBA 4LMAA 4WX2B 3R0XA 5JISA 2JC3A 3X44A 1V71A 3DWIA 4L0DA 3VSAA
chains in the Genus database with same CATH superfamily
3GVCA 1Z29A 1C0LA 1E7WA 3I5MA 3PEWA 1YGPA 2CLSA 2BGKA 4DWVA 4CE6A 2XKKA 4U0JA 2ZRBA 2A8YA 1SBZA 5FHQA 4LYDA 3LKVA 5IASA 2ZYIA 1JNYA 2WSIA 4MS4B 3WJAA 1BIFA 1P1RA 4RUKA 4ZTZB 2HMWA 3PDWA 1JBKA 3UY4A 1ZL2A 3ADDA 1RWOA 2QX7A 4I19A 2Z6QA 4DDUA 3AP1A 2CHQA 3NDJA 4LBYA 4PQEA 1PUIA 2HWKA 1AG9A 1SVKA 1Z8HA 4DIUA 2ZIZA 1JEYA 2PO5A 3HA7A 4UAJA 5AHOA 2P9TA 1W46A 1AQUA 4HQ6A 1FJHA 3BE6A 4H4CA 4HMPA 4YMWA 1FC0A 1XZHA 4YRAA 2JFYA 2YJTD 1QNLA 3CZAA 4CM5A 3O95A 1PJ8A 4CIBA 1W52X 3EEIA 4ZV7A 1JQKA 3I04M 4C43A 1N3BA 4KIUA 1DUIA 2QD2A 3GRYA 3NHYA 2F8SA 3G0BA 4FZRA 4DCSA 2P91A 2OV4A 4B83A 3EVNA 4G1BA 1TAGA 2JJMA 3R7FA 3B3FA 4MUFA 2Q1YA 4GKJB 1OBFO 3ER6A 2E1PA 2H7VA 5DEIA 3WYDA 1JUDA 1E20A 1XB2A 3AW9A 3ROQA 1OAAA 2OFWA 3GEGA 3CN7A 2QXUA 3G9UA 1F6BA 4Q02A 1SVIA 5HIJA 4P4UA 4ENRA 1WP4A 3TQRA 4X64B 3IIJA 1Y7TA 3OBIA 4C21A 1PL0A 2H59A 2DKOA 3HY3A 1BXRA 5MDHA 2HRBA 4ZJUA 2HA5A 2G0NA 7AT1A 3MOIA 3AC0A 1LA2A 3KL2A 2LXNA 4Q1CA 2IZOA 5TGDA 1A2OA 2OCIA 1N6KA 4S04A 1KKLA 4ICIA 5LP6F 2YHIB 3HKEB 3G8AA 3OE4A 4ZZIA 3KJGA 4UJ5A 3ROZA 1BKSB 1ZCJA 2FMXA 3ASVA 4KBYA 3CJRA 4ZODA 4BMNA 4NXMB 2NACA 2CBZA 2HADA 3DZ8A 4KZPA 3HKCA 1KWGA 1EP9A 5EC8A 2F3QA 1KF0A 3QU9A 1SUCA 2BFCB 4DA8A 2VDNB 4INOA 4LZAA 2NU8B 3VVCA 4L27A 2WLTA 3T3DA 5DI3B 2BZ1A 2LUOA 2Q6OA 3WQQA 1YZNA 2Z83A 4EYQA 5MN6A 3I8XA 5EZSA 1LWNA 1XAGA 2B6NA 2NYAA 1POWA 1VE9A 2QZSA 2YWXA 3FWYA 1EUYA 2WF9A 5HP4A 1BN6A 2OORC 4W5TA 1EM8A 3TW4A 3DHWC 1B3RA 4IFIA 3RC7A 1TFUA 3M6VA 2IF2A 4YRJA 5JD6A 3E53A 3SR3A 4Q21A 1VBNA 1TF7A 3KAKA 4KBGA 1V11B 1EKXA 2UYQA 1QC5B 1MU0A 2W2KA 2IFTA 2EBFX 2VN8A 3JRNA 5JW6A 4IJUA 1BG6A 2ANBA 4Q9IA 4Z1MA 4CLEA 1U1DA 3BHJA 1N34B 1L7QA 3N28A 3QA9A 1IZYA 3C2QA 3GP5A 1ND5A 4DEYA 2UKDA 4PG8A 3ZWVA 1A7UA 1US8A 5AKEA 4D7AA 4MV0A 3BYZA 1ADJA 1JQJC 3HZRA 1ZN8A 5BY2A 4FNAA 5HM6A 3UOAB 4D8VA 3PRHA 3PHCA 2C94A 2B1GA 1WCIA 2C2KA 2P3LA 2VFAA 2GTHA 5TMBA 4LC1A 5T57A 3S2SA 1G4AE 1JKJB 1RNLA 1YL6A 2D3TA 3AP2A 1YVUA 3VYWA 4DYDA 5B7GA 4KR7A 2DEUA 2RH9B 3WYAA 1U4NA 1HRDA 1JDNA 1XVTA 3JQQA 4LPKA 4BBAA 2J4CA 4CHTA 3FF4A 3ZD8A 2P1RA 3B52X 4QPJC 2Z3VA 1GA4A 4GRDA 1KYXA 1XD8A 5HG0A 3ZY6A 2ODQA 4B7AA 1RVV1 4IUYA 4BRWA 2DETA 1O7JA 3P20A 4PR3A 3WK5A 4AROA 4Z8XA 4IIUA 1TEXA 3H97A 3NR2A 4MYRA 4AWAA 4DLRA 1UBKS 5REQB 4F06A 2E5WA 3WK4A 5LWHA 3TJZA 2PFGA 1E2JA 3V8VA 2I2BA 2Q50A 3I3SR 4PCUA 3LT1A 2BWJA 1I6MA 4WUVA 5CA0F 4LZLA 3UJPA 3ZY2A 2DULA 1GPLA 5IVKA 3GFSA 2HCRA 1JR3A 3DKIA 2JA2A 1KARA 2VKTA 3N8HA 4Y1RB 4G5HA 2BMEA 3PQ7A 3H0KA 1W5FA 3RI3A 3UUGA 1SB9A 2IY9A 3NONA 3OM0A 2ASVA 4KVZA 4PNPA 4NQRA 2I4MA 4JC4A 4YX9A 1YMVA 3H65A 2Q21A 4IOJA 3P9XA 2PRZA 4WNIA 4A8JC 5A2QA 1W93A 6YASA 1PJZA 4R1MA 3H99A 1BXZA 2J09A 3D7NA 3DF9A 5DNDA 1EFRD 1RT9A 2O1EA 5EXEA 3U7EB 4KK3A 3FUUA 5ALDA 3VXKA 2RHHA 3EVTA 1AKUA 3A4YA 2QV7A 1VI5A 1M6WA 1RYMA 2JCSA 3AEYA 3R2JA 4LUCA 5KQPA 3Q85A 5L6LB 5CDFE 4N48A 1P5ZB 3Q10A 4HEHA 3OUUA 4BN0A 1XZNA 2GNAA 4KIFA 1C9NA 5L6MB 1MRNA 2DLCX 1QHNA 3PNLA 2JH9A 4TOIA 4NCIA 5GIPE 2ZJ6A 2D4HA 4I50A 2DQ4A 2JLQA 5HWSA 4MNTA 1OYYA 2VJMA 1WUYA 3PEUA 1MW8X 1QFSA 2JEYA 4ZDJA 5CEEA 4WY5A 1S9DA 4HO1X 3CSUA 1MHTA 1K4YA 1FSGA 1IBMB 4XPZA 2DUUA 4IQFA 1OHHD 4G1UC 1AUVA 1THZA 2OCAA 1DKPA 1EDZA 1LQUA 1JSZA 1ZRMA 5AVYA 4F1KA 1HQCA 5I9SA 1I3CA 3L8DA 3TDNA 2XLCA 3MK31 1P2GA 3V9PA 4DQVA 4PWZA 5CG1A 1GAQA 2AKAB 2CJWA 1L4UA 3DFUA 1ZU4A 2R6AA 5C8YA 1WNTA 3PC2A 5CA1B 4OK5A 1OJ7A 3V00A 3OPXA 1G9SA 4I8XA 4B4VA 1U8YA 2GSDA 3AMVA 3OJCA 3ILYA 1UBOS 2C99A 2AFIE 3KU1A 2I8AA 1E0SA 5HPYB 3K2IA 2WSSD 4HNUA 2JFBA 4AT1A 4PLCA 3SSOA 1KXJA 1YIAA 3UA4A 1EWVA 1QOZA 5LJIA 3B82A 1G8JA 3LX8A 1LPBB 3M34A 1WMDA 1TQHA 1XG5A 1I7SB 3T1YB 5K8IA 3CE6A 2QRUA 3LF2A 3GA5A 4XDZA 1K8YB 3GG9A 1XHEA 3GGOA 3LLUA 4IZHA 1WAMA 2QI9C 3NNNA 1IN1A 4HDSA 1GJRA 2CZCA 2PV0A 3IT1A 4CGYA 1EAYA 4OBWA 4C04A 1IY2A 2GXQA 3ECAA 1WUJS 4RDHA 5ICMA 4NBVA 3OY2A 4MVJP 2N46A 3C5EA 4R2WA 5F33A 3D4LA 3F9CA 2ZBPA 4Q9LA 2ZUTA 1SB8A 2B4TO 1FS6A 3WNVA 4W1QA 3U3DA 1YQGA 4BLQA 4HL6A 3DLPX 4FVTA 3MPOA 3CX3A 2ZZMA 4OPMA 3I0ZA 1CZKA 4PANA 4WZBE 5D87A 3TCXB 1T0JB 5B3AA 3GOQA 1EFCA 3M1IA 4AMBA 3SVTA 4WDQA 2RKWA 3NTRA 2NZYA 4RTJA 3U0VA 4FFBB 2WAOA 4QXRA 5ITVA 2O6HA 3QVMA 1F5NA 2D2IA 1CLEA 4X54A 2WD7B 3AU8A 3IDSA 3OF2A 4KVGA 4XIYA 4XTCS 5TMDA 1PR4A 1JYEA 3TAHA 3ZWYA 2UUBB 3TI9A 2BJWA 4R0MA 4N6OA 3AB3A 3QKRA 4JHXA 1G66A 3C85A 1V4VA 3CLTC 4KL8S 2AGVA 1JYSA 1AB6A 2G80A 2IYWA 4RD6A 3TM5A 1NFRA 2HLDA 5FWAA 4DVGA 1TYZA 1IU9A 3EVEA 1ZRHA 3D54D 4ND8A 4PSVA 4E2FA 1HYBA 2ZYGA 4CODB 2G7ZA 1IFXA 4HXGA 1XI2A 2QUKA 2C7VA 5EQJB 1Z5GA 4CMJA 3P9PA 4GDMA 5KYNA 4J4HA 3C5CA 3WA7A 2J3DA 2IUYA 2H11A 1YVRA 2LVBA 3DL0A 1UKCA 3MSCA 4G3XA 1UC9A 3WHKA 4DCVA 4IIJB 1G6HA 3ECSA 1LU9A 4PYJA 2QGNA 4AXXA 1G17A 1Z34A 2AG8A 2PN1A 4PR0A 1G6Q1 3AHJA 4R7TA 3GVPA 2RGDA 5FH9A 4F9EA 4RLHA 4FYMA 5HXAA 3S28A 4JP5A 4DCOA 1DMSA 5AXBA 1P0FA 4CG0A 1L8LA 1V26A 2CD9A 3K72B 3JQFA 4RE6A 1TUBB 4FEEA 3P0HA 1AO3A 2HIHA 1JE1A 3V3KA 4C4SA 1KY4A 1YTUA 1DX4A 4L4UA 3FCAA 1MQ8B 1NJ6A 4TV8B 1Y5MA 1Q15A 1II8A 3FRJA 4OP2A 3TR0A 5H81A 3A9CA 2BEVA 3O1HB 3KJHA 4WD3A 5KSOA 1NR5A 2UUAB 3K5HA 4IQ0A 3M82A 3L7NA 4XVCA 2EIHA 5JH7F 2CYAA 1CU1A 2NO0A 4ZXPA 1T2FA 3GZJA 1I4EB 3ZXXA 2RFLA 3O8OA 3S3TA 3I64A 1C81A 4E5MA 5KVQA 2BEWA 3KJEA 4LDNA 3KYJB 5H83A 2WPDA 4JBWA 4BC0A 2DX7A 4FS3A 3S99A 3RUCA 3QIVA 4BY9E 3M5PA 3SQNA 4TQUS 4GICA 3OTQA 3BCRA 5LN1A 3W78A 4TPKA 1UPXA 2FQQA 1OFUA 2HJVA 2XWJI 3VISA 2AK3A 1JEOA 1VSVA 4GI3A 2W6JD 3HKBA 5EKUA 2BYTA 5DTRA 1C8VB 4CM9A 5DPMA 5JQGF 1ZSYA 1XKXA 2H85A 2X1VA 3K0BA 3O4GA 3Q8XB 5JFGA 1GGMA 2Y4OA 3AHCA 3DHNA 2INGX 1FQWA 2IHTA 1DXHA 1VLMA 1A9TA 1Y8QA 2LZ0A 4IFEA 4NYJR 2EFEB 2O8BB 1PJ2A 1O1YA 2VF7A 3HGMA 4OBBA 2Q7XA 1S96A 4PRZA 3VPDA 1DCFA 3VR3A 1WM1A 2WB4A 5CA0A 4COOA 4FLMA 1ANKA 5DBFA 2IY7A 3DLCA 4GBJA 2RBGA 2JJ1A 3BZWA 2H1CA 3KR1A 4MW1A 4B3CA 1CJBA 4C2AA 2BGLA 1HX7A 1WQ3A 3OMLA 5B1YA 2VPTA 1GPUA 1AK1A 1B8VA 2B7BA 3DMNA 3LWDA 1ZBQA 2GDZA 4UVDA 4ZEWA 3KXLA 5IJWA 1S2IA 5F5NA 5GJBA 1OJLA 3A4NA 2MINA 1RWVA 2NXEA 3HDTA 5KTKA 3G2NA 1KH3A 3L8YA 3L6DA 1H1LB 3EC7A 4GE3A 1K6EA 4GEKA 4V0KA 4ND3A 4WEOA 5FTWA 3NWEA 5B53A 1TGVA 1XZQA 2PH5A 3CZCA 4RD1A 1GCIA 3L8MA 1WXHA 4H1HA 1S89A 4AW9A 2YV1A 3DCIA 4Y0AA 4AJOA 1IY0A 1WSDA 3KBOA 4AJEA 3C7DB 5L40A 1O54A 1SUEA 4MPDA 3TN7A 5JNLA 1KDYA 1TNDA 5FUWA 3U3ZA 2XD4A 2FSHA 3MFQA 4D79A 5K6TA 1Y4UA 4EG3A 3QPVA 3PU6A 5IM5A 4YRSA 1GPKA 2H2FA 4F92B 1XZPA 3I4FA 5A1JA 3FR7A 1LUAA 4E3ZA 2Y66A 2PWYA 4E94A 1EFTA 4AN0A 2WJWA 3QY0A 1C3JA 1M3SA 3HFGA 3X0DA 5AVSA 3WO1A 3ZDCA 4RIGA 1WQ1R 2Z2YA 5KSPA 5ALLA 5C2JB 3TS1A 5JANA 4D8TA 2Z9BA 4EYOA 1YK0A 1BCRB 1WUIS 2ZG6A 4LMRA 4Y7DA 5KKAA 3RFCA 2QT1A 4BNLA 1SD2A 2CB9A 2L2QA 3GB9A 4MWZA 1JSLA 3S2YA 4TYYA 1CUJA 3LPAA 3TEJA 1UBNA 2VHWA 4JQOA 3SLKA 3PEYA 1Q20A 4EFDA 5A9RA 3IXLA 4EJSA 4KR6A 1JKXA 2OV2A 4D57A 1ZUHA 4PO3X 3GLQA 2XNCA 2IVZA 2P2NA 3EMKA 4P3KA 5I7AA 1HORA 2POCA 3ZV7A 1DX9A 3GCZA 2WABA 5CGQB 4GUDA 4URHA 4M9QA 1D1PA 4R41A 3NJ4A 1SCNE 4MLDA 3AHGA 4LVUA 5IC5A 1NVUQ 4I5GA 2FN7A 1I0IA 5CLQA 3RYHB 3RJTA 1ODKA 3KHTA 2B1RA 3OCXA 4DLUA 4PW0A 1AN9A 4NCJA 5FNVA 3SC6A 1Q11A 1D9ZA 3TDKA 4EHLA 2L18A 4LDQA 3UJ6A 2HLHA 2MU1A 2BFCA 2O0JA 2QRKA 2PL9A 3ADPA 3EIWA 4LJ9A 1OLSB 4C3UA 4E2WA 3KTAB 4NZOA 1H23A 2F1OA 2XW6A 1UIRA 5DI3A 4CKBB 3V2GA 3OC6A 2X2OA 2JC3A 3JVIA 2P62A 2C4KA 4JODA 3VR4A 4IZ6A 3ZJ4A 1YHZA 4D3ZA 3OQHA 3ZDAA 2F8TA 3I9V6 3NW9A 4RIEA 3MD9A 1EJ0A 3QKWA 3WLPA 4X60A 4ARZA 1IL0A 3RUAA 1QR2A 1XLTA 1XEWY 3NP7A 3OCZA 3GLVA 3ROKA 2CVPA 1NN5A 1N1GA 4KFSA 4M6WA 1MN6A 3SVZA 5KI6A 3ZCSA 1SWVA 2VT6A 3PRYA 1IAVA 5M2QA 3HO1A 4L3WA 5HR5A 4DQUA 1ZGHA 4CEHB 3NC0C 5BUCA 2XODA 3CNLA 4RO0A 3OVMA 2BEUA 3O3NB 3WJ1A 3S7ZA 3ADKA 5LYYA 1RI1A 4D2IA 3TW0A 5IX8A 4RZSA 3UGJA 4JLWA 1JVBA 2VBGA 2VBIA 3KZXA 3V7FA 3IC5A 4M0UA 1L4NA 2ZI3A 3D43A 4NCKA 5HMMA 4YMHA 2PNJA 2XYVA 3TVYA 4NY1A 2IYYA 1S2GA 1NI4B 1ZBDA 4RSHA 5A4IS 5HX7A 4MIKA 1N5KA 5JVDF 3BXZA 1E0KA 1LNQA 2CYCA 4HNAB 4KYTA 1CUFA 4XGRA 2MSEB 4N54A 3AF6A 1QF6A 3H2IA 4KO3S 5EZ5A 1PSDA 2LBPA 4JKIA 4EI8A 1PTJA 3G82C 3QGMA 5IZ4A 2AOTA 5AM3A 2LR0A 3AUTA 3WHLA 2OGSA 1EQAA 2I1LA 4IXWA 1HE4A 3DQPA 5F3DA 1VL1A 3PRKE 5LFAA 2PKEA 3UMVA 4RPLA 4DV0B 5F12A 2GJ9A 4QDUA 2MR5A 5K8VA 2LRHA 4H7FA 4LYEA 4EGSA 3T7IA 4EEKA 3HLKA 2H2IA 2D13A 3HU5A 5TVGA 5DGHA 3Q8MA 1XVUA 4Z49A 4V0SA 4LOHA 3EASA 1HE2A 3UMRA 1F2DA 4NOKA 1VJ0A 2WVGA 4UASA 4UUQA 1K89A 1QYXA 1FDIA 1IUKA 2NYRA 3MZ0A 1UAGA 1ZH4A 3A3YA 1N3YA 3I04A 2IW3A 1HFEL 3N39C 1KK0A 4FFLA 4O29A 5ERYA 1EFHA 3ZQ6A 1Q0LA 1KEEB 4BGEA 1EUZA 3P4XA 4BBZA 4C88A 2ZAOA 3DFMA 5T8KC 4C7VA 1I5OA 1ZOSA 3E70C 3FMIA 3CVUA 3D02A 1PSWA 3Q7TA 3KPYA 2OHGA 2Y1LA 3FLBA 4YAWA 3UENA 1Z6AA 3NLLA 5B4VA 1PTKA 4GGPA 5CGZA 3EIHA 3QVOA 4K6KA 1E4YA 2W6QA 5A5DA 1S9HA 1GTZA 3KFLA 1W76A 2R60A 4R6XA 1P45A 3CT4A 4MB6A 4YCDA 1SIUA 3ROTA 4ZI7A 2VLBA 3UM9A 2CUKA 1UUFA 3ZWDA 4TXNA 3Q8KA 2HYIC 5ALTA 4LXQA 2OV6A 2XDWA 5EPUA 1W581 2XA9A 1YA6A 4NBRA 4LQDA 3N8KA 1XAIA 5AKXA 3WNZA 3ZHRA 1NOJA 4KXNA 4YXWA 5EKXA 3IE2A 1A4IA 3NYQA 4QULA 3CKLA 1T2NA 2HWXA 3DVLA 3RYTC 5B55A 1TU4A 1YDHA 5H4GA 5AKHA 4AU1A 4X92A 1KAEA 4DE5A 4JQCA 3BJMA 3UVEA 1QIEA 4L0DA 5AOCA 4IJQA 3RE1A 1SBQA 1YSCA 2B0JA 5AKJA 4R3UC 4ZYYA 5FL7A 1NPTO 4NE2A 3WWZA 1L5FA 1JZSA 1ZS9A 2X0RA 2QE7D 3OLXA 2VWPA 4RY2A 3HSKA 2PGNA 2REOA 3AT1A 4HS9A 3JSAA 3SHOA 5LMCA 3NANA 2EATA 2WZDA 3DVAB 3F49S 1BTOA 3GJ3A 3UMGA 5A02A 4UBOA 5M7EA 5LQAA 1CJCA 1N2HA 1ZM7A 1E32A 3BIOA 4PXAA 5FUXA 2BJHA 1X8LA 2QD5A 2G77B 2I80A 5FPPA 1BQ3A 2JAXA 5CNMA 3OQ1A 4Z0TA 2VH2A 1GNVA 1EUCB 3VOTA 5KTSA 2IX3A 3BJIC 2QIPA 4FWIB 2DKNA 2ZIXB 1V8DA 3KWFA 3ND5A 1OC4A 2BTEA 3AVXA 1QWSA 4HZUB 5HW0A 5BN3A 4X93A 3L0SA 1D0IA 1C2YA 2V4UA 3FSGD 1H0HA 2BFAA 3FPBA 4MAAA 2BKEA 3PA8A 1A76A 3H1AA 1EX6A 9MHTA 3WTCA 3FF1A 3B20A 3C3EA 2GR9A 2OZLA 4MQ4A 5KSYA 3N8DA 2G0AA 2NT3A 5EQDA 3GGPA 5K0GA 2WWYA 2BBSA 4HNTA 3NIGB 2GN4A 4GWLA 4G1FA 1UT5A 4MS1A 2FN3A 2D8MA 1AURA 4RS3A 3LLSA 5EVJA 1LCIA 2HDHA 2QN2A 5J59A 5JAZA 2KSQA 1NIPA 4DNXA 4JJFA 4CDNA 3G7SA 4P22A 1K5GA 1G6KA 4EW3A 3OZBA 4FMDB 3T8YA 2GA9A 4DSAA 4PN7A 5A7FA 3UG7A 1TADA 3N2NA 1R0KA 2V7VA 3ZU3A 2J07A 4OH1A 3MJSA 5AHWA 4HAWA 3LPLA 4FJ1A 3GFOA 2GEBA 2ZE7A 2EQAA 4QOFA 1VXRA 4YFYA 3RU3A 4YRCA 4AN1A 5CB8A 2X1LA 1F7VA 1USWA 4RVCA 3EXHA 3QLVC 4WOCA 1Q91A 1J5PA 3HJBA 1U0SY 4GX0A 1M33A 4AZSA 3UAVA 4N03A 5CB0A 4W1PA 5DM1A 1OB5A 3DTVD 1GG8A 2F3SA 3TIIA 1SKYE 2IITA 3R74A 5BP7A 3BGSA 1YB4A 4ZQGA 1IG3A 5KTTA 1ZJ4A 3V33A 3U37A 2LE0A 4NKRA 2YCLA 4ZQCB 3AKEA 1P0IA 2HN9A 1NM5C 2VL7A 1EX9A 3P5SA 4C3OB 2XUPA 4ADSG 4E03A 4KP7A 3H5NA 3MAJA 4I6EA 5CLIA 2C20A 4IXTA 5EE0A 1MD9A 5AW0A 3AO0B 4ND8B 1PJCA 1V16B 5BW5A 3GQVA 3O8QA 3OU7A 2BM8A 1VKNA 1CIJA 2VBCA 2CF5A 2X0JA 2JKVA 3TXAA 4UDYX 4B3JA 2HRDA 3JAKA 3GLRA 1TVEA 4ONEA 3TIFA 5C8XA 2C07A 5LIPA 5A4JA 5LIRA 4DANA 4BPRA 4FJ0A 5MF6A 4RDXA 5EJ9A 4BS9A 4FZ5A 2AE1A 2NZ2A 2RGXA 1SPBS 1R16A 2E9SA 1ZXLA 1W59A 2NP6A 5C53B 1NQ5A 2BGUA 4QASA 4JB3A 4QXQA 3WIEA 1CUSA 1YQ9A 3R6LA 5JDCC 2QAGB 4MCAA 1V71A 5HTOA 2H1WA 4B7ZA 2ACKA 1I3LA 1MPTA 1Y8AA 1Z0IA 2XXJA 3DEIA 3FI9A 4WA8A 4C1BA 3UK2A 4QDOA 4BIIA 3B1KA 4R9VA 4N7BA 1S6YA 2RGGA 2NVWA 3NH6A 4M1TA 4E1AA 1NSYA 3MOSA 5B12A 3K0CC 2F2TA 2I3DA 1GQSA 3EVFA 4NCNA 3X2EA 2BMAA 1IMOA 1SVUA 3B36A 3PQ8A 1M75A 4ZPXA 1AKMA 1OFGA 3WMGA 4LC9A 4GFDA 5U4XA 4BGDA 3EPLA 2FTKE 1EHIA 1PZMA 5BWNA 1ZJZA 1CQPA 1T8UA 2ZRQA 3QENA 2AN4A 2FPRA 2QMUA 1QMGA 2EGUA 3N2KB 4G85A 5TPZA 3PL5A 1E77A 2M6RA 3QOWA 1YK1A 1LLQA 2QMEA 4DZRA 3FVQA 2HJGA 2QTRA 2R11A 1Z83A 1V35A 4M1SA 4QHYA 3O2JA 4NFLA 1H66A 4YJ3B 4ZCIA 4U7DA 5DNYB 1M76A 5C32A 1IQUA 4RAQA 2JAPA 1Y5IA 1JLLB 2O7SA 2PEZA 4FR5A 3I72A 4YMSA 4O6VA 1YBMA 5ALYA 4ZVTA 2F4NA 2CN1A 1KDZA 4BZPA 3L6EA 4OL0A 5FRDA 1A5AB 4WT7A 3IFSA 2GI4A 5E4YA 2F1RA 5SY4A 4XB1A 1QP4A 3U4MA 1R0BA 2V7BA 2PH1A 1QZ3A 3NDIA 2EW2A 1EP3B 1PI3A 2XSZA 2ZWIA 2K5UA 2ZEJA 4QDXA 2A35A 1YBFA 5DM0A 2G6BA 1GLGA 1I9GA 2O5RA 2MWMA 1IXKA 1BKYA 2VP0A 4L1KA 2ORYA 5B3LA 1M34B 5BRJA 2L82A 3VO8A 3G6WA 3P9SA 4BJHB 4BO2A 5HJ5A 3R6GA 1FX0B 2IYFA 4FMDF 2YX1A 2LCIA 4LCJA 1L9KA 3DDSA 3MINA 4MINA 4UFNA 5F7OA 3KQWA 3BFKA 3LT4A 1Z2EA 2HCJB 1B93A 4BKMA 3KQPA 4ZKEA 3H9CA 4KPFC 1PZNA 4TLMB 1ZNXA 1KZGB 1UPFA 4DCUA 4YT4A 2HJWA 2A9VA 3FRIA 4UOQA 2B3DA 1OBHA 3L7CA 5FORA 5GAJA 2Q6TA 2DU8A 1AS0A 2ZIEA 2A14A 3IODA 2X8JA 3A9WA 3EFHA 4K8RB 5BXQC 5IJ9B 3SYRA 3CVWA 5JAHA 1VDZA 1NL3A 2P1DA 2GPBA 4NONA 3TRHA 4KPUA 1Z5VA 2NVUB 2ZSUA 1U1EA 5E4TA 3S5JA 3ZJTA 2WMYA 2F6RA 4IO1A 4GPEA 3NI2A 1UBEA 2NQ8A 1J21A 1O5IA 2CXOA 4LK2A 2WT8A 4YMIA 1KJWA 1Z33A 3EGXA 3RAJA 3KWLA 4XSHA 2EJVA 3IAXA 3QMMA 1U1GA 3R5KA 3PI7A 1VPVA 5CHEA 1DKRA 1OB2A 2UXDB 3TGLA 3ZYCA 4MYDA 3ZS9A 1UBMS 4PN3A 1T9GS 1LQ2A 3D5TA 1J8MF 4HEQA 2P7HA 3FKSA 1Q1NA 1C1XB 2PL5A 2R2AA 3AR5A 4W5JA 2ZSAA 1BA3A 2B9EA 2XGMA 2RK6A 2YY6A 3P9ZA 1YKSA 2PJZA 2PKQO 1QU2A 1OGYA 2XUAA 2EDAA 1QKJA 4JH0A 4EO4A 4UMVA 1FS5A 3NOOA 1B2LA 3UH0A 1TKBA 3HL4A 2Q4EA 1U81A 3OOHA 4TWJA 3AZOA 3KVNA 3W5UA 1G64A 1DBPA 1UBHS 1USGA 4DLTA 1NMXA 2UZ3A 3K96A 5EP4A 5TXGA 3JU3A 5JY6A 5TS3A 1UM9A 4PO8A 3P7MA 3UKJA 4C0XA 1ZISA 3AUJB 1PGPA 3H16A 1KO4A 1QBKC 4JC8A 3D4BA 3ITNA 3AFHA 4X8LA 4D3YA 1I33A 2G67A 1TPZA 4RK1A 2FK8A 1CNMA 2IEBA 3FZYA 2JAOA 1W87A 4MP8A 4FT4A 4UDXX 4MJXA 1YZTA 2X0NA 5THQA 1K08A 1T3LA 3L7MA 4F5ZA 2VT2A 3W1VA 4YDQA 2XR1A 1LBQA 1ZD9A 3ED5A 4U2FA 3HVUA 2Y0BA 1KS9A 2QN6A 4RSMA 3GT0A 5G40A 3IAFA 1XRMA 1Y1RA 4P58A 1YR2A 1GPWB 4WK2B 3TPCA 5JYDA 1XA4A 2I03A 1JIQA 1XCOA 3A3NA 3O4IA 4IH1A 1C1HA 5CX4A 5U9CA 4CFZA 2OWDA 4HS4A 4X66B 2E48A 2I3BA 2OILA 3IO3A 1QNFA 1IJFA 3F8TA 3MPUA 2CHFA 4H15A 2NUTA 5M5BA 3GEEA 1FK8A 3SQXA 4C4ZA 2GK3A 3TRFA 3HXMA 4AY2A 1NONA 1A4XA 3KEFA 3PFWO 4BP8A 5B30A 2JANA 2FFQA 4GOXA 3RPEA 1ABFA 3SX2A 4WFIA 4RMHA 4WK6A 1V1RB 4XX1A 1RCTE 4YIKA 1LC3A 2GBGA 5TJHA 2FDXA 2FF7A 4A27A 1NLZA 4QU8A 3VZCA 2AA3A 2QMYA 3GROA 3HJRA 2V97A 3R0VA 1XAJA 2WYWA 2GHRA 2ZE6A 4ZT5A 3TXXA 2H00A 4Q03A 2E18A 4JY7A 5TDHA 3ZE0B 4YPVA 2P8JA 2I55A 4MVJD 1A9XA 4PAQA 4Q34A 1GITA 3CWCA 1UDXA 2FPXA 4EHNA 5DM60 3U44A 1P4HA 1ACLA 3IYLW 1W2HA 4JJ4A 4RLSA 4D96A 1ZH0A 3NM4A 4RPJA 4AMGA 3W34A 3QYAA 2BHRA 4RCYA 1YJCA 1KC1A 4BWVA 1FYXA 2OT3B 2XAAA 4D43A 1E1CA 1JWAB 1NJ1A 2EW8A 1R4NB 4L5JA 1A8PA 4BO4A 2FZ5A 2XT9A 4BMDA 4G0WA 3JWHA 3E7FA 5FWXB 2R6R1 4HEA1 1VPTA 3JTEA 4JOBA 1Q0SA 1RQRA 2ON6A 1X9IA 2EXXA 1J33A 2H4HA 3HI6A 1EMDA 2O3QA 3LL4A 3IUEA 4MPTA 1KJYA 4Z7QB 2VRBA 1LY1A 1X6VA 5EWJB 1NP7A 1WXQA 4QECA 3UUFA 1M1ZA 3QUSA 1A5TA 1PZEA 3EH2A 3W5IA 1P75A 3SJUA 5KHLB 2C5BA 2MYNA 2ZJZA 3B9QA 4KN6A 1XZBA 4QSHA 2IU0A 5KYVA 3L7LA 4LEIA 4OTZA 1SVLA 2C7BA 2WTBA 3OG9A 5PGMA 1NUUA 1HGXA 5C52B 2GD6A 3T34A 4V39A 4TV9F 5ALUA 1NATA 5K0TA 4QPDA 2RAVA 4CNBA 2WKWA 1UJ4A 4LCEA 2NXJA 1EVJA 4OU5A 1FP4B 1XMJA 3W6OA 5F2NA 2ZWPA 3DW3X 3H9GA 4JLSA 3A6PC 3SZLA 5BMVB 5JMTA 2B4KA 3AETA 2RKBA 4MQUA 4JSYA 5A04A 1M2OB 1R5NA 2VJQA 4UXHA 3FUCA 4D46A 1CQJA 2PX8A 5K9ZA 1H5NA 1L7OA 5KQSA 2OCYC 4RFSB 3RK4A 3CB2A 3WLQA 1BS9A 3L07A 3LW8A 5FB3A 4HK4A 3U2QA 2WNSA 4X6YA 5GVRA 2GESA 4S2EA 1AZLA 1BKDR 1ODLA 2X2FA 1P1FA 1UXJA 5EFZA 4D8UA 2ZDQA 4O1HA 3L7OA 5FFMA 4L07A 3W5JA 5JSFA 2CFOA 4EKDA 1NG1A 3LLCA 4JP3A 2JZOA 3R8XA 4EZBA 2EJUA 1CUYA 4RZIA 5H7XA 3SX0A 4BV3A 5D3MB 2A94A 2HSWA 1Y4DE 2DRIA 3EF0A 3RD5A 1T0IA 1GAWA 1MG5A 2WIAA 4G89A 1U7PA 4BRUA 1G18A 1JHQA 3HWRA 4I2VA 1XLWA 2QS9A 3L0CA 3W8FA 1SU6A 1C1YA 3DA8A 1CIPA 2FXVA 4MS1B 4JYCA 3VBCA 4JEHA 1EXMA 3M4ZA 2VNAA 2X4GA 1W29A 2XT6A 3KNZA 4X7BA 3U9TA 3VJKA 5CNJA 2R86A 3FH0A 4YHHB 1PNRA 5B5SA 1XCGB 3CF4G 1B00A 1LRKA 1XLTC 3QBTA 2EDCA 2LW7A 2JFQA 3BKXA 4JCCA 5BUZA 1Z4JA 2PWBA 1RPAA 1RXIA 3AJEA 5B6PA 1IN6A 3NVKI 4KTTE 3H8VA 1VPLA 1GARA 2DFNA 2K7ZA 4XM2A 4YBRA 3TLGB 4QOGA 1GU1A 3GW8A 3JQRA 4YQZA 2FW0A 4OGFA 3LXXA 4J0KA 4JT2A 1KVUA 1ZK0A 3TBHA 1AQYA 1K8RA 4M7RA 1B76A 1VJCA 2ZU6A 1KEUA 1NVXQ 2WJAA 1ZLXA 4N1AA 2V7PA 2W6CX 4L0MA 2H2GA 2PSFA 4RU1A 1RBMA 3SSMA 5CFQA 1W36C 1ZQ1A 5HOEA 1AT1A 1GRQA 1SO8A 1MNQA 5BN4A 3MVEA 1JKJA 1ZSNA 1VPEA 3K3PA 1THMA 2HLDD 3G49A 3P96A 3DS8A 3U4HA 4TYMA 5HF9A 4RH3A 4ZARA 2IU6A 2QQGA 3CRNA 2HI0A 1RAHA 1GL9B 4IF6A 3L0YA 4YAOA 1OKKD 3A7DA 3OCUA 4EPVA 4GECA 4ENTA 3F5FA 2E49A 2OHVA 5KOJB 1H2AS 2P67A 1SOMA 5JLAA 3HYRA 1XTBA 3UHPA 2SICE 2DPXA 2WAAA 2EZUA 4WXHA 1BN7A 3T6KA 2NV6A 3HEMA 2PS1A 1N0IA 1FA9A 3F6EX 4NH4A 4JJAA 4ALNA 2HQ1A 1T3TA 1E3SA 2J6IA 3IIMA 1V7CA 2H4XA 3N3AC 1NE7A 2VUTA 3BK2A 3H2HA 3KLNA 1T9AA 3EG9A 1P62B 5FT9A 3TEMA 5IZCC 1X94A 4IKPA 2AOXA 2HKIA 3KQTA 3RIMA 1R4AA 4B6SA 3TIVA 5KWVA 5E2AA 1L8OA 1JHXA 2CW5A 4PAWA 4TKVA 2HEIA 2P4SA 3MEQA 5DP1A 1GFZA 1QV7A 2IEDA 2ISSD 4K7JA 4XGKA 5MFPA 3GUZA 3DMPA 2C4TA 3HJHA 1TUBA 3HPQA 5IUJC 3BK7A 1WP9A 4OI2A 2UXCB 1EFDN 4BNJA 2BCJQ 4RE5A 3I45A 2J6BA 3VR4H 1QRDA 2AHOA 1ID1A 1SBYA 1DFIA 4CIXA 4PLPA 5EIXA 1K5HA 1JECA 3RODA 2W2XA 3OT1A 2XKJE 4ESVA 2CNKA 3MJDA 5IYZF 3CNQS 1EBBA 3KFVA 2CYBA 2PR7A 2PMBA 3E2IA 1FFDA 4GPBA 1SC3A 2FPPA 3ZI0A 721PA 1BHO1 3E2PA 4EMSA 4XYLA 3IEVA 1EZ4A 5EGNA 5JECA 5ALGA 3GJ5A 3EQ7A 1F9EA 4UNIA 8AT1A 2I67A 2ZS7A 3BWBA 1O6CA 3HFJA 2G1AA 3T3NA 3ERCA 1NMEA 1NXVA 5A9TA 1G5QA 3QMPA 4HEA6 3QKSA 1FSPA 1W0JD 2PUFA 2FHSA 5CLFA 3D6NB 4ZQBA 3AL3A 3OJ0A 3QEAZ 5ALOA 5E8JA 1DAHA 1XE3A 2VYFA 1YB2A 1ESNA 4NMXB 1PFYA 3WBBA 3RU7A 5CDHA 4OOFA 1E96A 1L5SA 4JB2A 3VNBA 2OCLA 3DKRA 3ESAA 1WULS 4L73A 4CMGA 1IXZA 1PJRA 2VOJA 5BSHA 1RFLA 5BUSA 5JASA 1U8AA 2GAIA 1W94A 2H9AA 5JWRA 1SXJC 2A5DA 2AYZA 3EG5A 3TCKA 5GIOE 1AKEA 1LW6E 1YC5A 2HX1A 3CRZA 2V5UA 3ZE8A 4MTLA 1A5SB 3OCCA 4JDUA 2BFBA 1Z5OA 4EGAA 1W4ZA 4X63A 3UPUA 3IR5A 4G0QA 1SOVA 4EHFA 3AXTA 5FWYA 3IERA 3T5PA 4HJRA 1LBIA 1T5HX 3MGAA 5GV7A 1V7ZA 1S2MA 2LWIA 2OFFA 4E5VA 1R6AA 3E58A 4XDYA 4YJGA 3LMKA 3WSTA 3KQYA 2FMHA 1SG9A 5DH9A 4L8GA 2QBYB 2VJMB 3PRJA 4K9NA 4R9NA 1ZN7A 1XDSA 3K70D 1PK7A 4A2WA 3ECCA 4XD7D 4IICA 1K88A 4RV9A 3DO8A 3KDSE 2BGIA 2PUAA 3M89A 3PCRB 1VKHA 2O19A 2GKSA 3LC0A 4ZIRA 5JFOA 5KNLA 3UXHA 4H1VA 4MIEA 2II6A 1Y3IA 3DYBA 4M7WA 4ZQIA 1GTG1 2GQ0A 3BF8A 4FE7A 2FWRA 4YREA 4M22A 4CUKA 1NLUA 1BNCA 5IVPA 2VA9A 3LD9A 4OQDA 4P53A 5EIBC 4WNAB 1OFTA 4HUTA 3ZBTA 3B8EA 3PQ6A 4P2BA 4V0RA 4BFZA 3PXGA 3IE1A 3E8XA 4UFPA 4XQ9A 4O08A 4O59O 3IQFA 4IG9A 5DNAA 4CF5A 2Z4TA 3QUTA 3UT5B 3FG9A 4WZ6A 3ZHCA 4DIEA 3KL4A 1FS4A 4E21A 2P6MA 2WNIA 3R5XA 1ZEJA 1JBQA 2AEEA 4ID9A 2ZETA 3KKQA 1OBOA 3B1JA 4PQGA 1Q50A 3H6GA 3PUYA 4ZOAA 4B9EA 3JSXA 3PYXA 5CDFA 1CXZA 2QYOA 3DH0A 1UMDB 4WECA 2ECOA 1KDPA 4FK8A 3K5PA 2J4DA 3AZPA 3EZYA 3RBVA 5CAEA 1D4OA 3T4UA 1K98A 3CO0S 3CZPA 4QEKA 3UANA 4AX4A 1KEPA 5JCZA 3DEFA 3AVUA 1M2FA 3EXHC 4I66A 3UGTA 2PCJA 4KC0A 5KQRA 1RXYA 1E7RA 3U31A 1IBKB 2PLWA 4RTMA 2HREA 1KMHA 2MSDB 3MLEA 4ZDIA 1C1DB 1MTZA 3DV0A 3QVTA 3S40A 1NI5A 3RUHA 1KK2A 1OZGA 1T4MA 2FW7A 2NZVG 5K0JA 3ELWA 2AEFA 3HKDB 4ARSA 3ASZA 5B58T 3LBIA 3KZNA 2WA2A 3IKVA 4L0CA 1H6AA 4LY3A 4CMAA 1J1UA 1XZIA 3VKGA 4DG5A 3GFTA 3H83A 3PYLA 4G1MB 4MO9A 3EEOA 3S1AA 5BOSA 4XIGS 5BW4A 5IDXA 3UEOA 4Q7LA 1IBRA 3WL7A 1PRYA 5HZKA 1FFWA 4J1NA 1O6ZA 1LEHA 2R3SA 2RHMA 3C3DA 3DZBA 4JI5B 1MOSA 1N75A 3FDZB 3EPJA 2B3TA 2NO5A 3LBHA 3QVGA 2PQ0A 4IXDA 1QU3A 1Q16A 3A4TA 3FWPA 4N3BA 2IE0A 5JZBA 1RJ9B 3K92A 4UJ3A 4LJSA 2IYTA 3KZMA 3G0CA 4BVFA 2BGWA 2V1XA 4KQFA 1ILEA 5ES4B 2RH8A 5FULA 4JI6B 1L7VC 1PQWA 1OILA 1K0UA 1TDJA 2B4QA 4MW2A 2JLBA 3VJRA 4Q4HA 5CXXA 2CXXA 1MQAA 1R4MA 2VTEA 2X3FA 4B3HA 2Z57A 2FETA 1MIOA 1GAJA 1W25A 2RAPA 5B4TA 2GO7A 4WVLA 1UL1X 2AXEA 3UJNA 3QA3E 4RF4A 3BGIA 2ZWMA 5BYJA 3IQXA 1J42A 3K7EA 3MIZA 4Z99A 1R0YA 1KE1A 3RSSA 4TSFD 4NMLA 3UT0A 3ZVNA 4OJQA 4MTCA 3V7UA 5CT4A 4RENA 1M8PA 1TZJA 1FJGB 4G97A 5DLDA 4PZYA 1AZTA 1R0WA 3LG2A 2ZIWB 4QT0A 2B0CA 2XADA 1XJCA 3T7DA 2OG1A 1JZQA 4MZXA 5AI0A 3PHHA 5A4DA 3OX2A 4EY8A 4YRFA 4JXKA 4QPPA 4ROTA 1YRLA 1RAEA 4KIWA 3EPKA 4MA0A 2WZCA 2YVLA 4QOIA 2GCPA 1XPJA 2A88A 4UBNA 2XITA 4BX0A 1E58A 2NSYA 5CD9A 3D7LA 3A9SA 3BH0A 4FHCA 4BXOA 1T9KA 4X6XA 1E6LA 3DBLB 5FF9A 4B6QA 3U4QB 1ECJA 1DQSA 4RV5A 2O3TA 3F71A 3KV1A 3WYEA 2IUSA 3NEPX 4CM4A 2XF8A 2XZTA 5F51A 3LWNA 5DK4A 4RVNA 3MLAA 4LI3X 2G72A 3GQBB 3WIOA 2CLCX 2RB5A 4YN3A 4AUMA 5FKJA 5LQCA 3G59A 1PR2A 5IZCA 1JPNA 1IAQA 4E5UA 2Q5JA 4QZVA 1T8YA 3NBYC 4P4NA 2XZDA 4MLPA 3UQZA 2G40A 4ND2A 2PVPA 3I32A 2PGJA 4XYGA 2WMOB 5JCOA 4EY4A 5ISMA 4MYUA 4ZAZA 2JH3A 4XWGA 3ZU6A 1FP7A 4CM8B 3T3OA 4R98A 4I1RA 3T3HA 1Y5LA 3GJYA 4E13A 1CQJB 1GZ5A 1QIJA 3TFOA 4V0NA 4W6QA 1H65A 2V9PA 3TJRA 2YW2A 4OHKA 1MPXA 3AU9A 4MX8A 3W3AA 4DAOA 1QRTA 1VL2A 5BQFA 3AB8A 2YOGA 1XTQA 3RGGA 1FYDA 4OXYA 5JUWA 1YJXA 4WL0A 3HRKA 2PRIA 2ZBQA 2XAUA 4FQ7A 5TEVA 2X2EA 4TROA 5B37A 2IYPA 1U9JA 4HBGA 4REQA 1QQ5A 2V7WA 3Q8LA 4MRNA 3I53A 4ZDKA 1KTVA 4ALKA 1T6YA 2IGBA 3INRA 3R0XA 3AEUB 3VVMA 4DKJA 1NBME 4MRMA 1C9MA 4HN4B 3LIIA 1PF7E 4WE3A 3RJ5A 1H1TA 4ZK2A 5JPCA 1O57A 3CRW1 3ETNA 4D4HA 3K2BA 3G5AA 5CA0B 4ZVLA 4AL4A 4C78A 3KAQA 5E1DA 2QTWB 3PCXA 4GXNA 4X6LA 2AI3A 1L5HA 4AWXA 4K0KB 1NVFA 4PHFA 5BORA 3Q7RA 2DAPA 3G7UA 5EP2A 4HLCA 4EITA 3H1BA 3U7FB 3Q9NA 2NZXA 3G6KA 3RT9A 4HQ0A 5EZYB 2YWCA 4DIDA 4M6WB 2PZBA 4G5OA 4OBXA 4P0PB 4G4IA 3PD0A 3AZQA 4IIBA 1L4YA 2AN3A 1XROA 3JARB 5CMLA 5GY7A 1QIKA 4WNCA 2BFMA 1X77A 2GVNA 4Z0HO 2PT9A 1G63A 2FFAA 4JYAB 1CIVA 1ORVA 1TMKA 4I55A 2J5RA 4G8DA 3TE7A 4EDFA 4OK3A 3FBGA 4JS0A 3DOUA 4HRXA 4FHFA 1VJTA 2PZLA 1Q1BA 2X14A 3DDOA 2J9GA 3L7DA 2WLSA 3P8ZA 3RC2A 4YRTA 4PSCA 5EJ8A 3RR2A 1T24A 4K5QA 3NVMB 1E94E 2DPLA 2VS1A 4EK9A 4B3SB 1HT1E 4H3VA 1SU8A 4D4LA 3UGKA 4BDSA 1N4AA 5E3HA 1L5OA 1DB3A 3CZ5A 3Q0EA 1QAQA 3VJLA 5KX5F 1BU5A 1QQBA 1LC0A 4JOSA 3KOMA 4UU1A 4I9NA 3OO0A 1UEIA 3BQMB 4GZMA 2XMQA 3C1TA 4X61A 2AUNA 2DTXA 1TUEA 5K6AC 4L9RA 2Q3JA 4Q00A 3OQBA 2GPYA 4RJLA 5GJVC 1EBUA 2MSCB 1VG8A 2WQ7A 3F3KA 2HNBA 4K9KA 1E3IA 4F5YA 2XE7A 1S7CA 3H9JA 2CHUA 3NV7A 3UYLA 5D86A 2C7QA 2R5NA 4EW2A 1C7ZA 1KI1A 5CYGA 2C9DA 5E4JA 3CF6R 2R1ZA 4UDNA 3OE5A 3F6SA 2CF6A 1XZ8A 2VP5A 2XHEA 3ONWA 3V4RA 3L4EA 4TTPA 1QBGA 5D85A 3IQIX 2ATVA 3ZHYA 3MCZA 1ZOOA 4GD3Q 1QYDA 3WYGA 5DF1A 4DV2B 1XZJA 5H3HA 3I92A 3FJOA 1DC5A 3WL6A 1NW6A 2ZUDA 1JG2A 2EYUA 4RELA 4V38A 1U9YA 1PUXA 3TQOA 4BQPA 1RKXA 1XPOA 4N76A 1ILWA 1KEEA 3AHDA 4Z9AA 1J4AA 3E0QA 2A0YA 1FFSA 3T61A 1L7AA 1YU6A 3VFDA 5JSHA 3HG7A 1K8QA 3BUSA 2R97A 4QFCA 1XNRB 1NNEA 2C0QA 1WHTB 1X39A 3L2OB 5I9NA 3QBJA 3Q6NA 4EQZA 4EFMA 1JMVA 4D0RA 4GPAA 1AO0A 4Q9DA 4IGEA 1BDHA 2AEMA 2E3JA 4KDFA 3GP3A 4PZEA 2K2QB 4EABA 2GPNA 1MZVA 4YFVA 3TX6A 3QW2A 3C3YA 1TUIA 2OZVA 1GTMA 4HNGA 3V1LA 2Q6LA 2W5UA 2B5VA 1U65A 3C3XA 2YXPX 2NO9A 5AVTA 1QP0A 3ZJUA 3SJ7A 2TMKA 3QXHA 5H8WA 1V5EA 3NXKA 3RHFA 2SBTA 4MWOA 8LDHA 4MR8B 3R3SA 1TIBA 2E37A 2VAWA 2OV3A 1KNQA 4Y98A 3E22B 1Y3FE 4YAGA 2XGJA 4O1IA 4Z4IA 4TTQA 3OKCA 3PTAA 4NOMA 1JJIA 2ZB8A 1Z0AA 5ALHA 3WDMA 4JSTA 1YA8A 3V1YA 3EGDA 5ABPA 1JQAA 4RJTA 1MGOA 2V7UA 4BP9A 1ZD8A 3H1FA 3GUHA 3W04A 4RIFA 3RCBA 3FHLA 3EYWA 2P41A 3PC8C 2JLCA 3K15A 2IV7A 1GGVA 1XL1A 1VI2A 4JUFA 5KTRA 1QE3A 3BHIA 3QI7A 4WXYB 4Y6SA 1FNNA 1WZNA 3RRJA 3GVHA 5A3VA 3JQEA 1CQWA 3ANLA 3U4CA 3AXSA 4YT2A 1Q1QA 3X1JA 1XWWA 2WYIA 5JBIA 4G9GA 2IPNA 3N8NA 1KEKA 4LF6B 3DYIA 4PS0A 4Y8VA 3PD7A 2WWIA 4GEGA 3WL3A 2V45A 2HF8A 1ZN9A 3A6GA 4BN4A 4D9MA 3EDYA 5KOIA 1T15A 2B99A 1VLZA 1GG9A 3OICA 1N6NA 3H3JA 2R8PA 3N7AA 1T1IA 3QEOA 4C1NA 3VC1A 3IT0A 4B4WA 5KX5A 1UBCA 2R8OA 4JGIA 5LL6P 2RSLA 4LZPA 1U2RA 4TT3D 3W2GA 1AKQA 1S3FA 1U2DA 2O0HA 2V6JA 4DQXA 2E21A 3EIEA 2AK2A 3KB2A 4TTJA 4XWAA 5DIZA 3IEUA 2GNPA 4R40A 3REQA 4NK4A 1IHPA 2WUVA 1C7FA 4CLOB 1SMKA 4F8YA 4QYIB 1YCDA 3MHPA 1EXDA 4LNUA 3K6KA 1T2UA 3HEAA 3K09A 1VE7A 3PJGA 5DGTA 3QX8A 2I87A 3WHIA 4WNAA 4LNHA 4RZXA 1Q0TA 3E9NA 1EWTA 2AJBA 3PHJA 3VC2A 1TAQA 1A9OA 3CWQA 2VAVA 2O2CA 4EKIA 3DJFA 1RQ7A 1H8ED 2ZBFA 1A27A 4KACA 4MQBA 3KOYA 1I7DA 2FEPA 4QJBA 3EEFA 1VJRA 1E5TA 3I3OA 1O9HA 1P7YA 2VQFB 4PNHA 1LLCA 1JHZA 1MAVA 3CVOA 2HHJA 1RAFA 3C8ZA 4A91A 2MTBA 4LS3A 3UH1A 3VKWA 5HOQA 1RXWA 1SPXA 5D2CA 4XARA 4BVLA 1JALA 2G4LA 1PEKE 4MWSA 5KBYA 4Y18A 5KYWB 5F64A 1GG5A 1BMTA 5LOVA 1V2HE 2P2SA 3U1TA 5ECYA 1X1DA 2OWEA 1L5LA 1N7IA 1Z6XA 3T1VA 4ZMSA 4ZMRA 3K1AA 5CP8A 4ED9A 4AECA 4EENA 3CH6A 4ENPA 3X2FA 4TSKA 3FUTA 1E9FA 3DE2X 2YXLA 1YZYA 3D2CA 1DC8A 1LFAA 4YRZA 1AQIA 1PUJA 3Q3GE 4TRMA 4XLTA 4KKXB 4C6SA 1XJ5A 3KXPA 5AVVA 2ODEA 4HG2A 4EVSA 2QTNA 3JY6A 1BVYF 4PZUA 5IG2A 2P35A 2C9BA 3DT8A 4K9MA 3HCPA 4Y2YA 4URVR 1N5MA 4FMCF 3LJKA 2YFQA 1CEXA 3TUZC 1E98A 1GXSA 1WX1A 3DBIA 1X7WB 4K87A 5REQA 2P3SA 3A58B 2C54A 1WTCA 3PPYA 5CR9A 1AK9A 2RONA 3R0QA 2QTVB 2GXSA 2YTZA 3S2EA 1XRSB 4ETMA 5KNCH 2YQ4A 4BFUA 1RJ9A 3CKKA 4RCZA 2CUTA 2QUHA 3SQOA 1JGTA 1ODIA 1P0QA 3G17A 2JH8A 5LZ7A 2N3ZA 1CR6A 3UJ7A 1NF2A 4LHVA 2Q8QA 5FJIA 1T5TA 4NV0A 3N6VA 4YAJA 5HDBB 2FP4A 4PLTA 2HO4A 1OGJA 1RZVA 2EKQA 3RRZA 3WQBA 1IZZA 4OGGA 3FPKA 4CM9D 2PU5A 3BAZA 1MLDA 1EZZA 1VSQA 2H3HA 4GSKA 4ZP1A 1ULBA 1UMCA 3M6MD 4F38A 3DDWA 3H1GA 5JJLA 4PZDA 3R75A 1X87A 1KY2A 2GASA 4Y2PA 2CDCA 2R84A 2GYUA 1FY2A 1ZA2A 3RHZA 3MTDA 4L5CA 2BAGA 4LC0A 3RSHA 3TQFA 2VDLB 4RHCA 2WYVA 3AYZB 5IWCA 3WRVA 1LV7A 3RRNA 3KR9A 4R2MA 2H17A 5IEBA 1HY3A 2R8ZA 1XYVA 2VRCA 1TD1A 2F9FA 3W5DA 3BMCA 1FP1D 3LT2A 1RWWA 2P79A 4F3NA 4DLYA 1UMBB 4CV0A 1V25A 4Z2YA 5BWBA 5HQTA 2E82A 4KCGA 1XRNA 4FOOA 3P45A 4RY9A 5FBWB 3EFBA 4JNCA 5DRYA 2VPYA 4C4TA 2VXYA 4PLGA 3IXMA 1W6UA 5FNVF 2CLHB 1L7DA 2ZWOA 3CZ4A 3Q9UA 5SICE 1S8FA 2B61A 3L06A 4R9UC 2RJNA 4ZO9A 3T5AA 1PSZA 5LD2C 2HGSA 1ZHOA 1HYGA 3PFGA 2CCKA 5F1PA 3IR7A 1M1YA 5C5DA 4LV6A 1Z6PA 4N8EA 4YRNA 1PL7A 2CLIB 2HXYA 3BWCA 2YY7A 3NHBA 4HXYA 2DWUA 2EKZA 4M0PA 2NIPA 3CEJA 1CUWA 1TFRA 3GAZA 4K26A 4RMIA 4YV0A 1BD4A 1IXSB 3FIUA 4JI2B 1VLQA 3FTCA 5DFAA 1QJ4A 1VBMA 2R00C 3K8ZA 2PFSA 2J9XB 1TTPB 2PJDA 3NT4A 5D00A 3ZH9B 5SYAA 5AIBA 3STHA 1K97A 2H54A 4J2HA 1AKVA 2WPDD 3V1KA 2NW6A 4HGNA 5JARA 2VHQA 3E5NA 1D2RA 3LAWA 3LSYA 2RHGB 1KMMA 2G83A 2Y1WA 1QTNA 5FV4A 3LGXA 2ATCA 3M7IA 2PMDA 3IJEB 4CEJB 2ES4A 4LBWA 2G9NA 1RLMA 1GIAA 2YHIA 3HKEA 4CT5A 4V3CA 2W6NA 3F3MA 3P94A 1T8PA 3OPYB 3WKAA 4X8HA 5AXDA 2G25A 3CZQA 3BERA 3ENKA 1UFKA 4Q7EA 5A6SA 2IDMA 3EDRA 1BHJA 5LP6A 1CP2A 2X6TA 2YJGA 1AMNA 3T15A 3T3GA 1OWLA 2XVXA 2I7DA 3CLVA 3OAAA 1YMUA 4ERNA 4FGLA 2FSVC 3HBAA 2IGTA 4XIFA 2DY0A 2ZRGA 4FDUA 4JI0B 1RQGA 2H4ZA 1OIVA 3P32A 1RRKA 3HHPA 1TI7A 2OUKA 1U6KA 3EC1A 3O4HA 3EXFB 2X1MA 4I3FA 2RHCA 4JGBA 4QODA 1H9BA 2QM3A 5ESDA 5BNFA 2BONA 2W71A 2FPOA 3L79A 1RPJA 1W2GA 3KSRA 3DC2A 3KG2A 3IHTA 4FXPA 5AVOA 5TMPA 4CCWA 3RLFA 2W8BB 1NXQA 2I1WA 2LCFA 3Q40A 4YCAA 2FPLA 1V5WA 2EZTA 2BTQA 4RPIA 2D1FA 4LJ7A 4B6PA 2O8FA 1H5QA 3FYTA 5ENZA 4JLPA 5HCNA 1KO5A 2BRUA 3CLTD 3QPAA 3WLKX 2WK1A 3AR7A 3PGJA 5TQ2A 3ZIUA 2C9ZA 4F7DA 3LOUA 2L69A 1G3RA 4L22A 2CBGA 4GM0A 2NYVA 3NHKA 1QXSA 3Q98A 1GZ7A 4FGJA 4D9JA 3A05A 1CYDA 1HETA 2Z08A 2DVMA 1XTIA 2FU5C 2W37A 3F5DA 2VDMB 5DULA 2XH8A 3LC2O 2WMDA 3TB4A 4ARCA 4LKOA 2QJTA 4A6DA 4BO9A 4G5SA 4CMEA 1R66A 1FTQA 3B1YA 3QTLA 4IEEA 3HSSA 4TRJA 5EJ6A 1OX4A 4J76A 1JPJA 2WUEA 3IB3A 3QKRB 5LPNA 3EGXB 3D8BA 1RS0A 1ZUNB 4H08A 3PXXA 3TYXA 3EZLA 4MSUA 4BQQA 2JFZA 2EU8A 1I7LA 1SN7A 1YZVA 2FP3A 3OLZA 5IKOA 2TMDA 4OATA 4ZC1A 4B73A 3X2SA 5KOHB 4FDTA 2H0AA 2VF4X 4WK4B 3D7SA 3THXA 4EKNB 2A0WA 3F6BX 1OYVA 3VKFA 3G8DA 1DBVO 1PJ3A 3CMCO 3SYLA 2C2OA 4X3PA 2GZDA 5EQTA 4B80A 2NZ8A 3P71T 4L5AA 4LMPA 1WR8A 3FWKA 2ZVJA 3EYAA 3ZDQA 4KQKA 5LKAA 2WE8A 5HMLA 1Y37A 2QZ9A 3RVSA 2W6IA 2DQZA 4B6RA 1JXMA 3T5DA 2AMYA 3KZKA 3Q87B 1Z38A 1H2YA 3DV2A 1MAUA 4Z4GA 1XD2A 1PFGA 3HU3A 1NYQA 1Y7LA 3QNMA 3G02A 4Z9BA 1ECGA 5DHSA 2F1KA 3SFZA 1EXWA 3QXCA 1T6XA 4KFUA 4YDHB 1WW3A 1ISPA 4IDHA 5D6OA 4OHFA 1PWXA 5BPFA 4J1TA 4WNYA 4M0CA 2HU7A 3GYBA 5EIWA 4UBLA 4U5QA 1M1NA 3A1EA 3L49A 5DTQA 4F86A 3KXDA 1PR0A 1Z6ZA 3DZFA 3OI7A 3R5JA 1U7UA 5FBKA 3IOMA 5EAIA 5H82A 5IUNC 4P5DA 1VBKA 4R0VA 4Z9FA 1SBCA 2V4MA 5CA1F 2Y93A 3D0RA 3O94A 5BQOA 3EEQA 2OE2A 1IC6A 4KNWA 4J6FA 2H0RA 4WCVA 4YJ3A 3ZI4A 4BGIA 3FFTA 4MCJA 4BNWA 4IH4A 3VPGA 4JL5A 1T3SA 1JA0A 1WF3A 2WINI 4W5WA 3FX2A 4OLHA 5EFOA 3VPXA 2UV8A 2IYEA 4HKTA 4BNMA 4MYCA 3AK4A 4OQXA 2I0FA 3DHVA 1N6LA 1H94A 3QF4A 2AHRA 4XJTA 5IKEA 4JMPA 4K2AA 4KLZA 4M36A 2OUIA 1BDMA 1YGYA 5FD8A 2JI4A 3ET4A 1Z8NA 3K6SA 3H8JA 3I6YA 1GFSA 1R8YA 3BMQA 3I9MA 2H8GA 4ACBA 5JCXA 1J23A 1O96B 3F4LA 4CEIB 4FILA 3O1IC 5GPBA 4EY6A 1OA1A 5LR6A 2HA2A 1N3IA 4F4HA 1LJLA 4UREA 3K71B 4HEJA 2B8TA 3JAWB 5E2BA 4CIYA 3H87A 1R8JA 3I9JA 3IRVA 5JISA 3PPIA 4I4CA 421PA 1O97C 1RACA 1K27A 3IMKA 2X0DA 3U80A 1T34A 1FU4A 4FN4A 1FP6A 4AIIA 1P4AA 3NU1A 4NATA 4G0MA 3BE4A 3DTNA 5I9MA 2J3MA 4OFZA 2UZ1B 2IZ1A 1SC4A 3RKSA 3DZCA 1G4HA 2WUWE 3OIYA 1YR7A 1S0UA 3MIIA 4FP9A 5FHRA 2Y67A 5J1TB 1XHLA 2GZ1A 1Z4OA 1PR9A 4NAVA 1REQB 1IY1A 3KJNA 2GBLC 2FZWA 2H1RA 3P4UA 3GJSA 5IABA 1WVGA 1Y89A 4B3RB 3EBLA 3RIHA 4LQLA 4YA6A 5B1EA 1JF8A 2H1VA 2V8BA 2DUNA 1TJ3A 4J94A 1MVNA 3STUA 3WB2A 5LQSA 1NQTA 3VNQA 4DT1B 3MJVA 4L6CA 5CTAA 2XKAA 1RJEA 4QXOA 2GCEA 1T4DA 3RQIA 1V3VA 3Q2OA 2QORA 3WNQA 1VHLA 2O8DA 1XV5A 2IODA 2JGNA 4G8BA 4NDAA 1VGQA 4L50A 3DYVA 5JEDA 4G1EB 4PYMA 3GAFA 5FUQA 1OREA 1N2ZA 4EJ2A 3ZD6A 2IYNA 2QP4A 4MUGA 1FLNA 1D7OA 3LRXA 4GMGA 1RRFA 4JJZA 1JTFA 2W22A 1Z6TA 4HNRA 1EK5A 1WPQA 2FUEA 2R8BA 3DE0X 3JYHA 5BSFA 1KMIY 3VU3A 3H2GA 4NPCA 1PBTA 1QHGA 4Q4CA 5KNBA 4B8YA 1BCSA 2N75A 1QP8A 4JBYA 2IKSA 4D4IA 1E1CB 5ERXA 3PFKA 4CL3A 2UXBB 1JR2A 3ZZNA 4DBVO 3G2LA 2H4YA 4IXMA 2FW6A 1FYFA 4Y2QA 1NMYA 4RGVA 2HSJA 4L15A 4R1TA 3C6MA 1PLLA 1OASA 4XRRA 2JLZA 4YONB 4HNSA 3NHLA 4KR2A 4RQUA 5K6RA 3PJRA 1D9XA 1JDJA 3E1KA 4B43A 3LGSA 1CR1A 4L8FA 3KQOA 1L7BA 4MRRA 4WZAA 4RANA 5DHRA 3O1LA 1RM0A 2Q5EA 1Q12A 4OXIA 4PIPA 1ZITA 2B30A 2BW0A 1GGJA 4F4IA 2J7PA 4YUYA 1F06A 4CLRB 1XBTA 4GPD1 4RTQA 2AN9A 1WV1A 3MGBA 2X0FA 1KR2A 1E4EA 3MBKA 5TVKA 3SS8A 3RDPA 3ZJVA 5F3WB 4DCCA 1AHPA 1YR3A 2JNWA 4DILA 1L5ZA 2YYZA 5DI9A 3ZUGA 2V6BA 3G9QA 4UVHA 4HSEA 1I6LA 1L4GA 3LPDA 3FJYA 1YRHA 3ORHA 4YJFA 1GA1A 3AERA 1JSCA 2JK0A 3CZMA 4GX1A 4OQNA 4RORA 2I91A 5ALSA 4BTVA 1XJ0A 5FQOA 3LNTA 1NV8A 4HRVA 4KQIA 4KRYA 5EPOA 1SD1A 3C3AA 3CU5A 1SBTA 3OZRA 4CUJA 5JBNA 3B12A 1PWHA 2DPHA 2C2BA 1LX7A 2ZROA 3FNGA 5EG5A 1G3QA 4UM9B 5AJUA 2OCGA 4GVPA 3FW1A 1FNMA 3WLTA 4TX1A 2FP4B 4DMGA 1Z16A 5K4AA 2PZFA 4NFYA 3M3PA 4NPAA 4TV8A 4WESB 2X9NA 1I8TA 5DMXA 3ETCA 1CLUA 4K81B 3GRCA 2I3GA 3LUJA 1KMHB 2ZVDA 1ZXXA 1YDGA 1SELA 4GP7A 4I2NA 5K09A 2I66A 3JD3A 4CQMD 3L6CA 3Q7SA 3AVWA 4TLDA 2OKGA 1JFVA 4IHQA 1TZMA 3H5IA 1ZDMA 3AUYA 3E7WA 4CG1A 2NSLA 3TSOA 2WG0A 4JEMA 1QQ6A 3WGLA 2D2FA 2A7QA 2Z5FA 1SIWA 1NQXA 3RFVA 1XD9A 4GVLA 3B6MA 4RKQA 2ZYTX 2A0FA 1YRYE 3QTBA 4F9FA 3PDJA 3DLAA 3H5RA 4NG4A 3WGGA 4ZCRA 2OL4A 3UAGA 3QVXA 5BSTA 5T6BA 1OYOA 3DE4X 3FDJA 1FFYA 3COVA 3SHQA 2ONZA 5KDOA 1NFQA 1NRIA 2OXIA 1ONBA 3GDGA 2QSJA 4UUOA 1WETA 1IM8A 3Q3IA 5ULLA 2OESA 4IL5A 3UV3A 1VL5A 5DXFA 3X1MA 3AM4A 4Y9RA 5IF3A 3HCDA 1WB9A 3FCCA 1UKEA 2FZVA 3GRVA 4NJOA 4DREA 3BRWD 3BS4A 3JQBC 1NVVR 3NOQA 5T4BA 4EA6A 2J9YB 2R00A 3AQ4A 2AV6A 1N25A 2A30A 3O38A 3I6QA 3QOXA 4RPHA 4DMRA 4CVNA 2X22A 3WGZA 1E0AA 3EW9A 1QCCA 3PS9A 5CVDA 5CVVA 3RYIA 4D6PA 4M8NE 1N7HA 2PZMA 3S1LA 4XDHA 4EG4A 2AOTB 3EHEA 3L5OA 4JOQA 1SVOA 3MFYA 4W6ZA 4QKQA 4ND1A 1YB5A 5BMVA 1Y8ZA 3NHZA 1J9GA 1EDOA 2FQ1A 1UPAA 1ZCZA 2GPWA 2QL6A 2WFAA 4HCJA 3G3EA 4PFSA 4IDEA 1T6ZA 3I01M 3ZR4B 5HRCA 1VG9B 2NX2A 1P5JA 1ZLYA 1YHNA 2G17A 1P2VA 1I4WA 2AZMA 2YWEA 3OD1A 3PE6A 4LI0A 4UZEA 3H0CA 2DERA 1GNSA 3H5AA 1K3TA 5JCJD 2BISA 2QG4A 1MX3A 4BBPA 2GFHA 2DPGA 1UDAA 3SYMA 2PGXA 1D4AA 1G16A 2FWAA 3CZRA 4R3NA 4ZAYA 4OA5A 4PONA 3RRYA 2AR9A 3SBXA 4WLVA 3WNDA 3M6UA 3IP7A 1DG3A 1UC8A 1VIYA 2CFSA 3AJDA 1SHJA 3M9WA 4FBLA 4R9RA 3RH0A 3BILA 3DZDA 3HUDA 4R84A 2O5CA 4F3CA 5L3VA 1GTRA 5JNWA 2GJ8A 1J6UA 4A1OA 4CHGA 1RZRD 4PZAA 4N82A 1YE5A 2PQ6A 5AOBA 4L85A 5TB5A 3EF1A 1W75A 1Y42X 3OJOA 4O2RA 4QVGA 2WFLA 3TQQA 1JEQA 3UNXA 4C22A 1B8PA 1UPUA 2YXNA 1IBLB 4C87A 4MDYA 4G0UA 1AGNA 3FYSA 4B5KA 1ZKDA 2AJTA 2E87A 2IRWA 2ZUBA 3TI7A 1NASA 1A8SA 1P77A 3MN1A 4FDMA 4KYIB 4Y1GA 4YI3A 1I51A 1UXIA 3T7RA 1TOAA 1JFFB 3MS2A 5CH3A 1VZ2A 1IDOA 2OHXA 1NU6A 1VLVA 2I1QA 4JLUA 4WK0B 5FYQA 1ESCA 3SX4A 4KVFA 4ZV4A 5A0TA 2NXWA 3AIMA 5DRTA 1ZNQO 2F1IA 1AZSC 1V1MB 4MH0R 4DR7B 4PBTA 1IM5A 5JJ5A 1PJ4A 2HFKA 3EGCA 3DP9A 1EHCA 4IJMA 4DWJA 3PR1A 2UVPB 3N74A 4ECAA 1HURA 2NSJA 4B09A 3WB9A 5J4VA 1XNGA 1DWPA 1NPYA 3BJEA 3HO6A 5DO9A 2PRSA 3HCFA 3NEYA 5GONF 3IELA 4ZYTA 1NVWQ 2RI0A 5B2ZA 5FOQA 1FFXB 2ZREA 4X3CA 2IEGA 4PAOA 4BV2A 1COWA 3NV9A 4J3FA 1K68A 1U2PA 5ALKA 3SZOA 2NP7A 1OKKA 2HF7A 2VYNA 4NENA 4CKBA 1DBRA 2COKA 3P52A 1RCFA 3RABA 3T06B 3KCNA 3MJCA 3OPMA 1FFBA 2BSQA 3D6TB 4DLWA 1E8NA 3R44A 3RLIA 2GF9A 4CL8A 1XSEA 2NVBA 2GFQA 3KVOA 5HVNA 1RZUA 1N36B 1K86A 2ZXEA 4Z4QA 5KO2A 1PWZA 1Y1PA 2NYUA 4C20A 3O47A 2HWYA 4K88A 1Z22A 2BC9A 3G2MA 1KIAA 4KWTA 3Q3HA 5FL3A 4ZKDA 5JC8A 3SOZA 2NO1A 1QLHA 3HADA 1NQUA 2PZ8A 4JELA 2V74B 1IOWA 1OU4A 1JP7A 1M2VB 5HGJA 2J46A 1AKTA 2BHSA 1QORA 4N65A 1HC7A 3U61B 2EL7A 4UMDA 2Q62A 3DDCA 3GLHA 2W4QA 3AEQA 2E6UX 2WYHA 3KKNA 4N5LA 1XO1A 2EFGA 4IJ5A 4QUBA 2ZIXA 5CVJA 3BFJA 1I1HA 2B7CA 1E5VA 1N9KA 1XEWX 2HWUA 2J5XA 2VZ0A 2X3YA 3GUUA 4OGWA 2NU6B 1U8FO 1V6SA 1WMEA 1EVZA 2QKYA 3GFVA 3SC2B 1FDOA 4Q1EA 5ESRA 4BNHA 2FFBA 3L82B 4YT8A 4TYWA 5E3IA 4PG6A 1WCWA 1U5CA 1XDGA 2J3LA 1ORTA 3PXEA 1JAXA 4CJXA 2F62A 4N0PA 3NHSA 4KAFA 4Q1FA 4A4DA 3BL5A 4DUPA 4QUEA 3ML1A 3KQSA 2V1UA 2O57A 3HJAA 4L3OA 5IVIA 2JCXA 3WRYA 5JO0A 3EXAA 5EE3A 4BB0A 3IKJA 1SHKA 5CVEA 2SKDA 2C3PA 2O7NA 3DUWA 4LMBA 2DECA 1I32A 3DL2A 4BLSA 4E14A 1U94A 4RHYA 2WU0A 1CF4A 4IIHA 5BNZA 4XUDA 4FZ3A 2OBXA 3N59A 2A1TS 3HXTA 3EBPA 1KRWA 1GYQA 4WKNA 2XOEA 3WLNA 3P19A 2ZYRA 3I39X 1K5PA 2W6OA 1UMDA 2G1UA 2X9VA 2JI7A 1IB6A 3JQBA 1JIIA 4U7TB 3OIUA 2GEJA 2X7XA 5AIAA 3OIVA 1LPAB 3H3XA 3NORA 4UKDA 2OK7A 4XVHA 4IHJB 1U98A 3B9PA 4JUIA 1R3DA 3GA7A 1YB7A 5BYBA 3ZBPA 1DLIA 2R25B 1DO2A 4GWGA 4M7OA 5EXDA 3BWXA 5LNK6 4K9SA 1Y3BE 4TYPA 5CFNA 2VXOA 4UCWA 1RBQA 5AKLA 1FSSA 4BE7B 3WGMA 4KITB 2O5EA 3KIPA 1U0JA 4ZVVA 2PBFA 4LSWA 2H1IA 2RGEA 4PYNA 2IEZA 2YV2A 3AEXA 2ID9A 3LX5A 3TNLA 3KSBC 2H16A 2ZT6A 4YUXA 5KPDA 4TTRA 4CM8A 3TFQA 4EJSC 2R68A 2QRVA 2FVXA 1KDTA 3E9MA 3FPEA 1ULZA 1SULA 2ZI5A 3MGCA 4HI0E 1T5DX 5AVUA 1DIAA 3KD2A 1ZG3A 2CXRA 2UZ1A 2ZBEA 2OHHA 3FXAA 4M49A 1QDLB 5E9QA 1QVWA 3UUEA 2ENWA 3O8CA 5DT2A 1YV9A 3AR2A 2P0AA 5AW4A 4EHBA 1C0EA 1V8FA 1GKIA 1CUBA 2VJCA 3LGAA 4M3NA 3K32A 3ZVLA 2HM7A 3MT8A 4PS1A 2EP7A 5FTMA 3MXTA 2RDMA 4CTNA 5EMMA 5HYVA 4RTLA 1TM5E 3I9KA 5KQGA 3EAGA 2J31A 5FPTA 5JG7A 1C9EA 3S27A 3ANSA 3WAGA 1G19A 4C7BA 4H6PA 4F0JA 1ENPA 2BI7A 3GRUA 1LI7A 5H16A 4DKXA 3GLGB 4MV3A 1ADGA 2P69A 3ZBQA 4V0ME 4KTVE 1PEYA 3S2IA 4MR7B 3W6UA 1E9CA 1KEWA 3QLVA 3K2QA 4TUYF 2DFTA 2ZFUA 4Y2UA 5K8CA 3NRJA 4XB6B 3OOSA 1O0BA 4DJAA 3MINB 5A0FA 4A0RA 4UNRA 1P0PA 3IAM1 1BQEA 3O83A 3E1GA 3IS3A 3ZBUA 1HE1C 4Z3OA 5AHKA 4KQ6A 1ADBA 2HYDA 5AQ1A 3QU7A 4D9BA 3PHBE 1HE3A 1DHTA 2RI6A 5CEFA 3AG6A 3IDZA 2HDWA 3K6RA 4HLUA 3V1UA 2FN9A 3P0FA 1RC1A 3KKZA 3QBDA 4MQFB 4MV4A 4O3FA 4RMGA 4O4LB 1H4TA 2QRHA 1JQ5A 3DKVA 4YWJA 1SU4A 4QUIA 4DR4B 2Z4RA 3H5TA 2GZAA 3QUQA 4HLDA 5AT1A 3EPHA 2YNMD 1I2MA 2Q41A 3BL8A 3MT0A 3RFXA 4TTVA 2OB2A 2A78A 3G1UA 5I51A 4HMQA 4PZCA 1BOOA 1Z5UA 4O2AA 1KQFA 3ZVKA 4G1VA 2YV4A 3DLIA 1MV8A 4HMOA 4LE1A 3VR5A 5KYXA 2C3YA 3LKDA 4EX6A 2JJ1D 4YLEA 1AKYA 1SUPA 4JIGA 4OIMA 3GOHA 1GSAA 1N9GA 1TXGA 1SK9A 2GUWA 4IDPA 1RW4A 4KWIA 4JDPA 1S8AA 4G67A 5FR1A 3TZBA 2H1SA 1MO5A 3SNHA 2R6ZA 2AMLA 1HKHA 4AJHA 4UQOA 4ZU1X 5IBQA 1RRVA 3TZLA 5J5CA 2W6MA 3M6FA 4WASA 3PUIA 2GJSA 4F2DA 3RM3A 4L76A 4P31A 5B64A 5FO0A 2C5HA 4J03A 4OHRA 2Q5CA 5F23A 1CG6A 1S3IA 4KXUA 2J87A 3HJTA 1RXSA 4LY9A 2R47A 4OJMX 4QRDA 3TX2A 1PV1A 4A8JB 2XTAA 1QYWA 3DTVA 4MHOA 3I12A 2PUTA 3SHFA 1JKIA 4GQBA 1C7EA 5B57C 1ZMXA 1HYQA 4L8WB 5A1TA 4R7GA 3BSYA 3E82A 4S35A 4XXHA 1BH6A 3NUZA 1R10A 4ZREA 4IPTA 1GNRA 5KZMB 2FEMA 2J30A 4CN8A 3BBPA 3GH3A 2OM2A 3FSJX 3SS9X 4PRKA 5ARCA 3M70A 2WIJA 1V16A 2ZKLA 4DNPA 2VQDA 1BXKA 1QE0A 3QFSA 4HAXA 3UAOA 4OGLA 1UH5A 5F4BA 4P6VF 2JGIA 2O59A 3DUFB 2PUEA 3L6OO 3TTXA 1SA0B 1U04A 5EPEA 5K3AA 4F5WA 3E61A 5DX0A 5ILGA 3KKMA 2IOFA 1KAQA 5A3JA 1JDTA 3UPTA 2CDBA 3ESZA 1X7GA 2G6TA 2X9QA 4Y2GA 3G0OA 1Q7BA 1M9NA 2JIQA 2PBZA 3ABOB 3FB4A 4N7RA 3UWPA 2A5GA 3IAEA 4D9IA 4QHTA 3FMVA 2VJLA 3KTFA 2ZSEA 4D97A 1XIVA 1NDUA 1OIWA 4LRUA 3WLFA 1J8VA 4IHJF 4PZLA 2FLVA 4CM3A 2V6MA 1ISIA 4DAEA 5KYUA 1FNBA 3I5UA 3NALA 3OTIA 3OLCX 1XKTA 5IKPA 1H1DA 2DBRA 3T5CA 1V95A 1XTUA 3GARA 4TRRA 4NECA 1ONPA 2C2MA 2FN8A 4TMVA 5CLHA 3D3WA 5G1PA 3IUPA 1TZ2A 5CPFA 4UVGA 4ANFA 5EY5B 4MXDA 1R8SA 2HZ7A 4OXQA 4M86A 1OF1A 4Z4CA 3RKRA 5JH7B 1FZTA 5JI3E 3UJHA 2WWFA 4JXJA 4FSHA 3U44B 1B6GA 1NZDA 2DMRA 4QHSA 4FFSA 1ZQ9A 1OFVA 3NRBA 2OCBA 1GZ3A 1K7XB 1PQ4A 1S3GA 1U0OC 2XJ4A 3K09C 4LZZA 2AOWA 3RV3A 1BE6A 2YY5A 5AVRA 3QJGA 1LLUA 1X7ZB 2PS3A 3RVLA 4PYIA 1II9A 3ILVA 1H0SA 2HF2A 4I50B 1Y1KE 3GELA 1YS7A 4QU0A 2XBUA 3RAGA 2DQKA 3IEKA 2DZDA 4Q3BA 4E2XA 4NJEB 4DDVA 1PZFA 1O8BA 1P1IA 2QJRA 4D8WA 4DSOA 1O95C 3PPWA 4EIWA 4HT3B 1KZYC 4DV1B 2CZQA 4TMZA 4UFOA 2RBEA 4KREA 5DT9A 3WOVA 5IXSA 3WO0A 1B23P 1ZYUA 4EUKA 4OHUA 2HSGA 4ENVA 1HG1A 1E6MA 4MUXA 1U3UA 2VF2A 1FNSA 1YCGA 4HSGA 4HB0A 1KJQA 4QFMA 2I6QA 1M54A 1NR1A 4DC9A 2I6UA 2Q2OA 3ZWKA 3ZWMA 4POOA 2Q1SA 3CNHA 3KPWA 2OFPA 821PA 1E7QA 1MA3A 1E63A 1ZM9A 2RB4A 4EM6A 5BV8A 3N2YA 1UJ2A 4YLGA 3TOVA 3GEIA 3QFTA 2VQSA 4AY5A 4BX2A 3OMXA 1LRJA 4K6CA 1AQNA 1P5HA 1U2QA 4OVKA 4Y9UA 1HQKA 2R6CA 4LRTB 2UYOA 4IZIA 4X97A 3WQSB 1ZNWA 4BJ5A 1A1VA 1Z8DA 1CQIA 3T7EA 5AKGA 3F4KA 5I4IA 4V0LA 4BE9A 1GNPA 1JFRA 4D9NA 1H3NA 1G8MA 3U5TA 1NAIA 4RBNA 3TIXB 3EWNA 1E3WA 4G23A 5IKMA 1KZ6A 5I8WA 1D3AA 3IRUA 1WE2A 3ZDRA 1FUUA 4W9NC 1DQYA 1JEEA 1K7SN 5EIEA 4F4DA 1R5OA 1P4RA 2OBLA 3M1LA 1XZMA 1FQOA 3K1AB 3M6IA 5BRNA 1W4BA 4TLLB 1X38A 4CFSA 4LNUB 1Y82A 3JQAD 3BF7A 2WFLB 3FCYA 3QFFA 1E8DA 4WUTA 2GLXA 4WOJA 4U2KA 4E07A 1KBZA 3K4PA 2ZZNA 4B2LA 1DINA 4ZRDA 5K3DA 3LVRE 1WU8A 5CX1A 4EW6A 2VDPB 5LCXA 5I3ZA 4F4UA 1W36D 5EI5A 5LSAA 1E2GA 1FYEA 1QHIA 1UEJA 4WLUA 1Z26A 5HKOA 2QTVA 1L4BA 2IPAB 2NZWA 1ZGBA 1GADO 2OQIA 1XRJA 2ZIFA 3NIBA 4N0EA 1RYHA 4ENUA 9LDBA 3K0AA 5J4YA 2W00A 4YPFA 1N0WA 1OI4A 2VYVA 3EZXA 3PICA 4PIVA 4C89A 4BTLA 3A0UA 4IIFA 5JPDA 3C39A 2C2ZA 1UP4A 3HYTA 5DTIA 2M2IA 2P6OA 1OXSC 1PDOA 2R5WA 2PV7A 3LHKA 4FPXA 4Q37A 3ZTTA 4EY3A 1Y98A 9LDTA 1R6VA 3X43A 5LA6A 4EY5A 3LQ1A 1KJ9A 1LBSA 3C3CA 1TCUA 3MTJA 4Q01A 2MCFA 2HK7A 3N0TA 1IBCA 4NIMA 3NCHA 1I0LA 1V43A 2EG5A 3L01A 4B2PA 1XGKA 4LYAA 4PSDA 2YZGA 4QAJA 5M34A 2O7VA 3QI2A 5L7WA 5ALWA 1RLIA 3MJRA 1W4LA 1ZMBA 3GGJA 4B75A 5EP1A 2OZEA 5G0VA 4IM7A 1VJ5A 2ZR7A 2FR1A 4P8RA 2NUAA 4QSMA 1KGSA 5EKTA 3U17A 4D3SA 1NJGA 1T4CB 1VMDA 5C9ZA 5DCLA 2A9PA 3OQ6A 1MB9A 5LLSA 3PNPA 4ZN6A 1RBYA 1UKAA 1UKZA 1UPTA 3A04A 3FOWA 3G8CA