1LB1B

Crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide exchange factor DBS
publication title Structural basis for the selective activation of Rho GTPases by Dbl exchange factors.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 178
sequence length 178
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lb1B00
4LHXA 1F3OA 2IYRA 3ZDQA 4LCBA 3PJRA 2FDCA 1R10A 3SS8A 2ODNA 2WMNB 4NH0A 2IBMA 1CULC 4AIIA 4TT3A 2WICA 1JR3E 1LV7A 3GLGA 1W48A 3KX2A 4LV8B 1KI6B 3HYTA 4NONA 1D2MA 4DDWA 3K53A 2C99A 2BEKA 1T5IA 4KVGA 1G6OA 2WAXA 4G01B 2QMOA 5L3SA 2ZJ2A 4KU4A 3QXCA 3TAHA 8OHMA 3U4QB 1XMSA 1WXQA 4QJ5A 1VCOA 4TMKA 4QM7A 3U7FB 3TUJC 3GLIA 4HLQB 4XSHA 3U7HB 4TSFD 3LNCA 1AGRA 4C0HA 3EIHA 3AB3A 4W5JA 4AG6A 2P5TB 1G4AE 1GVNB 3AF1A 4LJYA 1K6MA 1XX6A 1GITA 2EFGA 4Q19A 2WWWA 3U2QA 1P4SA 2ZRHA 5JJLA 1OYWA 2B92A 2NIPA 2R8RA 1M7HA 5H1YA 1NN0A 3CNOA 1RE0A 4C2UA 1G8YA 2NPIA 4NZYA 4PFSA 1T0HB 2LKDA 4JKIA 3K8YA 1N5LA 4B6FA 4Z51A 1N0WA 1NLYA 4GMDA 2QNRA 5FR1A 2ZJ8A 4Z1MA 4TZ6A 2J0UB 5CM9C 3TSOA 4OQNA 2JJ2D 1GKYA 1YZNA 2GZDA 3GLFA 721PA 4Q1BA 4QM6A 3AVVA 2ZROA 2ZYTX 3FKSA 2D74A 4BRWA 2PJZA 3SOPA 3AKYA 3VHXA 3AH8A 3IPYA 2QZ4A 2AXPA 4UNQA 4B3FX 1AJEA 1NVWQ 4DB4A 3GLHE 4FMCF 4YMSA 1XPUA 1QHGA 1FOEB 4RZ2A 1G18A 2P67A 4A8JB 1OLOA 4Z54A 1E2QA 2OT3B 1NMYA 2AKYA 3FWYA 1ZNZA 1PVOA 2FU5C 4M53A 4QHYA 4IVQA 1U94A 4B44A 4B35A 3VAAA 2AK2A 2KBEA 4C0SA 3SJAA 1DAIA 2C5LA 3VU9A 3IHWA 3OIYA 2QENA 1LF5A 1R8SA 3ZH9B 2IYSA 3ASZA 4FINA 1IJFA 2WOOA 2VEDA 4IOKA 1CKEA 2L0XA 4W5HA 1P6XA 5AJYA 2EFCB 2C9YA 2JJ1D 2IF0A 4DCSA 3K9GA 3LBHA 1BKDR 4DSNA 3DMNA 2ERYA 3FHOA 3MGCA 3O8CA 1ANKA 1XEXB 2A5JA 1I4TD 3VKHA 2R6AA 4KFRA 2VQSA 3SI7A 3R9IA 1PUJA 3I5YA 3CPEA 2KWIA 3X1XA 2XTMA 4Q21A 1NIPA 4DSUA 3C5HA 1Z0IA 3ICQB 3KKPA 3VR6A 4BECA 1DAEA 3RC3A 4PO9A 3MWLA 5J4KA 4GBMA 421PA 1TMKA 1E2GA 1R6BX 5KSPA 4P33A 3L43A 1R0WA 3QKSA 3U44B 2GZAA 2YOFA 4ZDIA 1AM4D 3KDSE 4RY2A 4NPHA 1HYQA 1E2HA 1YJ5A 1XD2B 2W0SA 5EZ5A 2CMKA 3A8TA 1MRSA 4C0KA 4Z8YA 1DPFA 2C95A 4D0NA 1OFIA 4OK5A 2BM1A 1HQCA 2VLIA 1CJVC 2YINC 1LVGA 1E32A 3BJIC 4GNKA 4CVNA 4FIDA 3AVXA 3CB4A 1UKVY 2D4HA 2GCOA 3SN6A 2ZRMA 2GXAA 1C4OA 1RFLA 2GXQA 3E2IA 1JR3D 1EFUA 4RKFA 1BH2A 2WJHA 3ADDA 2ONKA 4I1OA 5EXTA 4TMVA 1E2FA 1F48A 5HKKD 1S9DA 3V4RA 3EASA 3RC8A 2I4IA 4Q4HB 2O8BB 5DN6D 2OESA 1KOFA 3DVLA 3JZAA 2D3WA 2R62A 4FMBB 4TLDA 2XZOA 3V4FA 3RNLA 4PO1A 2HF9A 4XD7A 4LGMA 5KDLA 1FNNA 4M4SA 1OKKA 1R5NA 4NE2A 4IDHA 4PXAA 1KI9A 4PPQA 2FV8A 4H9GA 4BLOA 1Q20A 1Z06A 4JSYA 5K8IA 4JIMA 3VNVA 2OFWA 1MO3A 1UJ2A 2AD1A 3LVRE 5D3MA 2X1VA 3OIWA 3RS3A 3PVSA 1TQ2A 3MJHA 3OZXA 1ZNWA 4MKGA 1NJFA 3TSZA 4QGGA 1DS6A 4QHSA 2R6FA 3PUVA 2HCBA 4C4PA 5CDFE 3RANA 3B78A 2JCSA 4NKRA 4BRUA 4L15A 3RS7A 4WW0A 3RVBA 1T8TA 1CBUA 1ODFA 2IYWA 3TKLA 1ZCBA 1H8EA 3A37A 3PEUA 4HAWA 2IXGA 4H1VA 5CM8B 2B7BA 4LJ7A 5L8VA 2GJ8A 2QPAA 2F9LA 1LB1B 4G0NA 1KKLA 1H65A 1II0A 2JLRA 5JLJA 1E9BA 3RS2A 5DE3A 3T06B 3NHBA 3UATA 4KCGA 4OQMA 3LH5A 1N6KA 4CZ2A 5G53C 4LWZA 2F55A 3MUFA 1N6NA 3WBJA 1E98A 1KGDA 1TNDA 2CL6X 3K09A 3F5FA 3QF4A 1SKYB 2QM8A 3K0CA 4QBIA 5JWHA 4QKQA 3X1ZA 4UNNA 2IS2A 3THYB 2FEMA 3KQLA 1OIWA 4C9BA 2GVDC 1OYYA 2BCJQ 2ZSAA 3KFXA 2ZETA 3QXJA 4Y0VA 5SZJA 3TUIC 5CK4A 5FOVA 5BW8A 2FF7A 3CPHA 4LBWA 5B64A 5L3QB 1P9WA 1J99A 3H86A 3KB2A 2CLCX 1JAHA 2YZ2A 3OIVA 5J47A 2NTYC 1EX7A 1SZPA 5LD2C 1ZD9A 4V0KA 4B3CA 3GLIE 1SVWA 2WWHA 3B7GA 1B0UA 2FX3A 2XNDD 5C46F 1VHTA 4W5WA 4D25A 5AUQA 1GIAA 1VIAA 4TSFA 2G9NA 3H1TA 3SYKA 1KMHA 3RDPA 3VTKA 5EXXA 3UANA 3TQFA 4EJSB 1DG1G 1ZRHA 4V0NA 1T3SA 3PIRA 5DHFA 1G19A 4E5UA 4US2R 1UF9A 4FWTA 1R8QA 4TTPA 3DPUA 3FPAA 3AVQA 1GKUB 3GJ7A 4URZR 4D80A 2V55B 1RYHA 1JB1A 3R8FA 3TQCA 1Q3HA 2GJKA 3I1FA 5AJXA 3H4MA 1KDPA 1JEEA 3GJ0A 2A5YB 4M1OA 3AVWA 5DYIA 2V1UA 1B23P 3UG6A 1UKEA 1J90A 3LV8A 4KYUA 3GLFE 4GT1A 1G5PA 2JJ2A 3RLFA 1N3BA 3EX7C 4XVRA 3VR4A 3EA5A 4RKEA 2V6IA 1FX0B 1D9XA 1G20E 1KI2A 4LHZA 4B6EA 3AVPA 4M1SA 1U90A 1VTKA 4A36A 1OT3A 1T4GA 4PPNA 2JLUA 3LBIA 1W0JD 2ZRCA 4GP7A 2P65A 4ON9A 3IO5A 3UG7A 3WXMA 4F38A 3IHLA 1UBGA 3NBFA 2CLSA 1Z6YA 2RMKA 1N6LA 3CZPA 5TARA 1W46A 4DLWA 5C4MA 1T8UA 1IXRC 1FMJA 3B9PA 3PUZA 4CDGA 1W4BA 821PA 4GP6A 3WNCA 1FP6A 2GWHA 2GAOA 4S2EA 3OAAD 4BFVA 2IF2A 4B48A 3QE0A 4L16A 4DSTA 3GJXC 1Y3AA 1MV5A 4KI0A 4A8JA 2GF0A 1P9RA 3WMGA 1D8TA 4LY6A 2P2LA 3FMIA 4IW3B 2A78A 4I81A 4MGYR 4DRZA 3QSYA 3MSXA 3I8SA 2CDNA 1AN0A 4AKHA 3EZ7A 2WV9A 3I73A 4LV6A 2JGNA 2JJ1A 4IXNA 2BBSA 1DEKA 2EW1A 2FFBA 2ZE7A 4IOJA 4HDCA 4NL4H 4MGZR 2O8DB 3C15C 3KQHA 1RYFA 4OBEA 4M8NE 4Q9JA 2R65A 1XD9A 3TSWA 2R44A 1X8KA 3K0FB 2A3RA 3ZGXA 1KK3A 2G1JA 1TUIA 1LTQA 2YOHA 5IHPA 1XEXA 1ZJ6A 3LLUA 5KUTA 3PXGA 5GJVC 3FTQA 1F2UA 2UZ3A 1Z0KA 4I4LA 1LNZA 2QT1A 5SZHB 3I62A 3CX6A 2ZEJA 1I2DA 2ZI9A 3TAUA 4DLVA 4L8GA 4DT1B 1OIVA 2IUSA 3L82B 4M9XA 2BMJA 2BDTA 2QL6A 1E2MA 2D2FA 4JBYA 1YU9A 1TF7A 5A4JA 4DLXA 1J2JA 2GDJA 4PAMA 4M9QA 5IDVA 1UEIA 1UBCA 3D31A 5LPNA 2CL7X 1JR3A 3WYGA 3WNDA 1E69A 1A7JA 3QBVA 2C03A 4KITB 1EFRD 5EE1A 1ETUA 1P3JA 4LSGA 5HKKA 1QG2A 1E0AA 1IAQA 4WZAE 1KY3A 1SQ5A 2IYXA 1SULA 2OLJA 3RHFA 3VMFA 4DLZA 2ODBA 1AK2A 1ZVQA 3WYAA 1Z83A 1XZPA 5DN6A 2QGZA 4NCHA 3K70C 4CEHA 4FMCB 3EZFA 1HT1E 3U3JA 2I3BA 3AVOA 5J5CA 3EZ2A 3W5IA 4PO8A 1KIMA 4A9AA 1KAGA 4Q4HA 1Z0AA 4E07A 4EFNA 3Q3JB 1M2OB 2OUKA 4HB2A 3HU3A 4JJKA 1JXOA 5DGXA 4NCIA 1S0UA 5BYKA 2ZRBA 4IDPA 1RJ9B 2NO0A 4UKDA 4RD2A 2OM2A 2ZI4A 1S3GA 1U8ZA 4KAXA 4R2HA 3TMKA 2X19A 3QKRA 3TIFA 2MSCB 4DLSA 1E6CA 2XB4A 1VG8A 4B34A 4JLJA 2JLYA 1TX4B 4JLMA 3R7WB 2BC9A 2LWIA 1EFCA 1HY3A 5F2EA 1W1WA 3NVAA 4RZXA 3S1AA 3FB4A 4G1UC 2ZXUA 5CIWA 1Z47A 1NVXQ 1ZINA 2F1RA 5P21A 3CW2A 1NMZA 1E79D 1GM5A 5A0FA 4EQ6B 1RRFA 1YQTA 2P3SA 3ADKA 4H1UA 3TRFA 3HU1A 4JVNA 2P0EA 2ZYWX 3I32A 2J0QA 3AKDA 4A0RA 3NXSA 3GLHA 4EDHA 4A0HA 2IS6A 3GJ6A 3NIBA 3TR0A 3G0HA 2P6UA 1KO8A 1XTKA 5TDHA 2GESA 5G3YA 2O8CB 1MOZA 4JLAA 5FBLB 4UXJA 3FMOB 1XBTA 3ZIAD 3KJGA 1FQJA 2XOKD 3AVUA 1Q57A 1X1RA 1KI8A 2JEOA 5LB2A 1YHNA 5JWRA 1IXZA 1VPLA 1IN8A 2YJTD 3BB1A 4KFSA 4LPKA 4MITA 5JS7A 4FMDF 3P20A 2BOVA 4I99A 3VR3A 2J46A 2FSIA 3THYA 5F9FA 1YR6A 3LQQA 2HXSA 4KVAA 2W6ID 1LS6A 3CRVA 4LRWA 1K8RA 3NHAA 5BWMA 2WJGA 5HZHA 1F60A 1DBSA 2IA5A 2XNDA 4DDVA 5L3QA 1YKSA 1Q0UA 1ZC3A 3ZJYA 5JI3E 4FXPA 4Q9KA 3ZVMA 3B1WA 1C1YA 1IY0A 3A1VA 2ORVA 3OEED 5CJPA 3AP2A 3BFXA 4G5RA 1CXZA 3N5CA 1NL3A 2CK3D 1SVOA 3BFVA 3U61B 4P4TA 3HR7A 3RS5A 5H8WA 4ESVA 2PCLA 2QBYA 4KLNA 1QVRA 2ZE6A 4ZDWA 1CJKC 1A1VA 1WRBA 4BLRA 2ZJOA 2ZRIA 3LX5A 2V1XA 3ZS9A 2ZSEA 1F5NA 1XMJA 1ZYUA 4NYMR 4Q7JB 1XJQA 5ANRB 3EPHA 3K09C 3LW7A 4X8OA 1GWNA 3AP3A 4PAOA 2FA9A 3K0CC 2GEUA 2FMXA 5JZVA 4PZZA 1KAOA 1MKYA 1IN5A 5KHOC 3D6TB 4YQFA 1P61B 1NMXA 1XTQA 4AY2A 1UAAA 4URWR 4GRAA 4URXR 1W0JA 1W36B 4PSKA 3CKLA 1Z22A 4NHOA 2AN9A 3BH0A 3R9XA 4P3YA 3DHWC 1XTRA 3MWKA 4Q48A 1JI0A 1NI3A 4C0JA 1W36D 1NLZA 5JJIA 1GRNA 4EKDA 2EFEB 3OAAA 3IIJA 2PT7A 1XPRA 2BKEA 2ZU6A 1VCMA 1G3UA 2RHMA 1WMSA 2BMEA 4B2LA 3Q85A 1G8GA 5JS8A 2V4ZA 1WE2A 2IYZA 4TYPA 3RAPR 4NCJA 2RB4A 2O0KA 5CDFA 1YRAA 1P2VA 2CLDX 4WIAA 2RGBA 1GP2A 3B82A 4Q47A 4DVGA 3MLEA 2JLQA 3QXSA 4AK9A 4DLUA 3AKCA 1X6VA 1NG9A 2ZREA 2SHKA 5FH9A 1OPXA 4JSTA 4B71A 1O87A 2ZPTX 4NMMA 1UEJA 4PHTA 4BFYA 4MRSA 4OKSA 4C7OB 2J59A 4JZKA 5CJ2A 4TTQA 1CR2A 4XTRA 1M1YE 3Q5EA 3TNFA 3VR2A 3A36A 2PMDA 4IKEA 2YC4C 1FTNA 1KSHA 4IEEA 1G7CA 2WAYA 2QN6A 4HZUA 2I1VB 3K0FA 1TF5A 2OLKA 2QT0A 3SHWA 4C0AC 2GILA 3G82C 3CF0A 2PJRA 1MR3F 2KJQA 2XSZD 4IOLA 4NYJQ 2QTHA 5FL3A 1JPNA 1OIXA 1ZNXA 2ATXA 4IDOA 4UXHA 4A82A 4ZDKA 3KXLA 1MABB 4ZDJA 3R9WA 4HAYA 1E2IA 4L5BA 2O8FA 3LFUA 2QE7D 3GJ4A 5H68A 4XWOA 3FHTA 2KB0A 3IEUA 4B3XA 3W8NA 2XJ4A 4DEYA 121PA 1J7KA 2QEQA 1U0HC 4DT1A 4XSGA 2CCKA 3PV0A 3VKWA 4A4DA 3BC1A 3WHKA 3KQUA 3QG1A 2JLVA 4D82A 1VKJA 5FPKA 1NP6A 3DEFA 1EFRA 4TL8A 4DB2A 1CP2A 4AWXA 2JDID 1G5RA 2JLXA 5KPJA 2WSMA 1KO1A 2BBOA 2PEZA 2R9VA 3QNUA 5FOUA 4JYCA 4BE7B 1QG4A 3CWQA 4B3GA 4XTCS 1GL9B 3KXKA 2J9RA 3GMTA 3R20A 2RGDA 4IXMA 4PTLA 5FTNA 1PJRA 3T61A 2JLZA 2AFHE 2B7CA 1NKSA 2FPLA 3NG1A 4B43A 1FUUA 1G64A 4QNRA 3TVTA 4DEXA 2GXUA 2YYZA 4A2PA 1E2KA 5JCPA 1NN1A 1T3LA 4PHFA 2BJWA 4TYWA 3B1YA 1DAFA 2ZRKA 2QQ0A 2V54A 4XOIA 3LBNA 4C0BA 4IJMA 3C4JA 1UDWA 4OK6A 3RRZA 2BMDA 2FGKA 2KE5A 4NP6A 1SKQA 2ZR0A 4GOJA 2DFKB 4NCNA 3EW9A 4U7DA 4S35A 1IBRA 2BIFA 4V0ME 1CEEA 1GILA 5JWOA 1D6JA 4JLPA 5L3RA 4MKIA 5EXSA 1KDTA 1N6RA 3M0EA 1YR8A 1GUAA 3RYTC 1E79A 1R0XA 2VF8A 4BZQA 3P26A 3R7WA 3PG5A 3KUDA 4A0FA 2DHRA 1IJEA 3FMPB 2ASEA 2NPFA 2YWHA 5CITA 2OSBA 4LPSA 1TQ4A 5K8LA 3WMEA 5JCZA 1TADA 3WRYC 5IRCD 3NC1C 4N3NA 3X2SA 4EQ6A 1C9KA 4QXAA 3SQWA 3SBEA 4ZI2A 3ZIAA 1S2MA 5G3ZA 2XOKA 4CEIA 3EPJA 2F7SA 2MMCA 1DVRA 1K5DA 3OFND 4OI2A 5EE5B 1SKYE 3L0OA 4K8OA 2C9OA 1OH6A 1XEFA 1US8B 2B8TA 1N5KA 1WP9A 2O8CA 3AGQA 1P72A 2BBTA 2IXFA 1T91A 1Z3IX 1VYVA 3EG5A 4TMTA 5L3VA 4HLDA 4HEJA 4DZZA 3AGPA 2X2EA 2HDNB 3A4LA 4RJLA 5FI1B 2ODEA 2W6IA 3TVDA 1TQ6A 2ERXA 4JLBA 1G5TA 3FGNA 1G16A 1Z0FA 5DI9A 2QTFA 1GFIA 3KZ1E 3UMRA 5FPYA 3ECCA 3M4YA 1JPJA 3OEEA 4A2QA 3ZLJA 3A1SA 2D7CA 4WOPA 1TQDA 2EWVA 3DDCA 2W2TA 3NC0C 3GEIA 2EYUA 2XEXA 2DFTA 2CK3A 3DM5A 3GQBA 521PA 1Q21A 1R0YA 4JKYA 4HDOB 2CCJA 4JMPA 3FDIA 2PL3A 4FCWA 5DI3B 5M04A 1SXJB 3F0TA 3LW8A 3WNBA 1ZM9A 5C2JB 3LVQE 4ZIRB 2VSXA 1OXXK 2VL7A 2ZUCA 2Z5FA 3DKVA 1QBKC 3BB4A 4PR0A 1NSTA 2AL7A 2EYQA 1FUKA 3QF7A 4CYMA 5JECA 1KK1A 3AQ4A 1RPZA 4Q01A 1RZ3A 1SXJD 3AM1A 5EUMA 2B6HA 3LQRA 4I1VA 1G8PA 2FPMA 3MFYA 5FUXA 2YVUA 4Q1AA 1NNEA 4PC1A 2G1KA 3CZQA 2RGAA 1VIYA 5FTJA 3HWSA 4P32A 2D2EA 1KJZA 5FUYA 3WMFA 1MO4A 1II9A 1U0JA 5E4FA 5JRZA 3C14C 1E96A 1Z6GA 4LDJA 2IX3A 2VRWA 3O8DA 1J70A 1EESA 4AI6A 4ZCLA 4DWJA 5IF9A 4QG7A 1L4YA 4LHWA 5UKDA 2OCYC 3SQXA 3M1IA 4ERNA 3AF2A 3CNNA 3THXB 1VG1A 1JJ7A 2NOAA 2QGNA 3LWNA 4LBZA 5FBWB 5KYKA 3JVVA 3NH9A 1X1SA 2FN4A 3KTAB 2QM7A 1U2RA 2HF8A 2D62A 4KSCA 1JQLB 2MSDB 1BIFA 4M1WA 2C2HA 4ACAA 2LKCA 3K0AA 4TYNA 3LD9A 1II8B 3W8RA 1XF9A 2BVNA 2PBRA 3DOEA 4J0QA 1M34E 4CT5A 2OZEA 1XCPA 4LHYA 4LYAA 5BN5A 3SR0A 3FYHA 3IKJA 3GFTA 2V9PA 4TMXA 5EZ6B 4TYYA 3O47A 4QRHA 5EP2A 5JSZB 2Q3MA 3BRWD 1W2GA 2F3RA 1OH7A 5CYPA 2OXRA 1ZM4A 4B47A 4PPGA 1A82A 5KNBA 2KBFA 2TMKA 4A2WA 1RVDA 2PT5A 1E4VA 4F92B 5ELXA 2QORA 3HYRA 1U8AA 2NZJA 3B2EA 1X3SA 1Z6AA 1SVLA 5BN3A 4TMWA 5CK5A 2OCBA 2WMOB 4Q66C 4KV9A 3T34A 3TW4A 1OH5A 2XSZA 2XB2A 1G3IA 3SFZA 2J1LA 4BQSA 4HB0A 3CH4B 3ETLA 1N6OA 3KKNA 3T35A 2QE7A 3U7GA 1T5LA 2F9MA 1G41A 1FFHA 3IGFA 1VECA 4B73A 1XCMA 4Q7MB 3EWAA 5D3QA 2Z6VA 4NBSA 5AJVB 5DO9A 4M1MA 4R7ZA 4F91B 3LX8A 4ZKDA 5DH9A 4IDNA 1AZSC 2FSFA 2UKDA 2VH5R 4TLAA 1U9IA 1SGWA 4HUQB 1X8JA 1KI6A 2MMGA 1XXHB 1KSFX 2IHBA 2JDIA 4M0LA 3KL4A 4FCVA 5EE9A 4CT4B 2PZGA 3A1UA 3ASYA 2FNAA 4OQXA 1CF4A 5E3HA 3GCGA 3DM9B 5GVRA 4Q02A 3U4QA 5JJKA 4F4CA 4NYIQ 4Q4JB 3REGA 2OCPA 3AV0B 3BB3A 3E70C 1IN7A 4FWIB 2QQEA 5BQ5A 2DWOA 1JXMA 3LO5A 3CR7A 1AS3A 3VQTA 4UJ5A 4FI3C 4AKGA 4YDHB 1IOZA 2XAUA 2YWEA 4OJQA 1L7VC 1Z8FA 2CBZA 2JAQA 4RZUA 2G88A 3MD0A 2ZAOA 4RZ3A 4NTZA 4BFTA 2H17A 5JEEA 4QGAA 4LV5B 5HE8A 1SVKA 1G8HA 3MMPA 5KPDA 3VHLB 1T6NA 2GHIA 1XMVA 3TJZA 2PMKA 2J0UA 1T9HA 2ZQ5A 4P4SB 5E7MA 3AP1A 1LF0A 2HT6A 1TAGA 2RGNA 3K9NA 4R98A 1OB5A 2XTZA 1BO6A 5FUWA 3BFKA 4RFSB 4XH9B 4ZPXA 5DISB 2QRNA 2HJVA 1J8YF 4AKIA 3OESA 4Q7KA 2HLDD 1NVVQ 4HB3A 1DAGA 2DWQA 4KO8A 4QBGB 4WVFA 3RS4A 4BLTA 4TL9A 1CJMA 2WBLC 3BS4A 5G40A 2RH5A 1WB9A 4QBHA 4O0MA 4UQOA 2WWYA 2IL1A 1NKTA 3GFPA 3T1TA 2F1HA 4PZYA 2HCJB 1HV8A 2H1LA 4NCKA 4EPWA 1PV4A 1DAHA 3OFNA 3ZVRA 2V7QD 2KI5A 2W0MA 4DBLC 4MRPA 2MSEB 4BASA 3HJNA 1QDEA 1JALA 1YR7A 1E4YA 2PH1A 4DJTA 4TQUS 3IPXA 4DCUA 2CJWB 2REBA 2A9KA 2CHVA 3GEEA 4MA4A 4IFBA 1G8FA 4A15A 1KK0A 3T1VA 4JLOA 1E3MA 1US8A 2ZI3A 3A4MA 3TR5A 3G5UA 2H18A 1BYUA 2QPTA 3SYLA 2X77A 3ZVLA 2BV3A 1A2BA 1W7AA 4LJ8A 4PANA 2B8WA 4UXIA 1SHKA 3SNHA 4ZI3A 1XJ0A 3EZ6A 3PEYA 2CE2X 1N5JA 2IWRA 4GZMA 4LOAA 2VF7A 2W83A 2K5UA 2YV5A 5KSOA 2QMEA 4LJ6A 5EE3A 3K9HA 4KBGA 1P7CA 2H16A 1JEDA 3QKTA 4OI0A 1K5GA 1LFDB 3W34A 4RVCA 4V03A 1BS1A 3FFAA 3VKGA 1YZTA 4MRVA 4F7WA 3MG9A 1CJUC 2W2XA 3Q9LA 3U44A 3QXXA 2FFHA 2VTKA 3PUWA 1NVUQ 5EE0A 1KKMA 5DI3A 2XXAB 1SXJA 4DDUA 1WF3A 1XD2A 4YMWA 5BN4A 5EJEA 4PHHA 1E2NA 3EA0A 4ACBA 1DARA 2IYLD 3U6KA 4TWZA 5F98A 2AKAB 3BD9A 3K9LA 4TZ0A 4O25A 2HXYA 2J87A 2BMFA 2IUUA 2HUPA 2WIBA 2VSOA 1Q1EA 2Y8EA 4B2IA 3GLGB 2WTUA 3U60B 2PZEA 2HV8A 2REOA 1IONA 1UM8A 4JLDA 5FOXA 3W90A 4YMVA 2BWJA 2WKRA 4HAVA 4Q9HA 3ZZUA 4F4JA 3KQKA 2X2FA 1MT0A 1CR4A 4P0TA 1NY5A 3QXHA 3I4LA 1KNXA 5BYJA 2F43B 3ND8A 3DKPA 3TH5A 2C8VA 3FE2A 1F2TB 3A4NA 2N46A 1H8HD 2IHYA 3EC1A 1W5SA 5TV2A 4AYWA 2O8BA 4RD0A 4C3ZA 2IWHA 4KBFA 3TE6A 4JL8A 4TTRA 1D2EA 1LS1A 5HZKA 2E1RA 3ADCA 5HR5A 2CNWD 4B3DA 5JHGB 3WYFA 2BBWA 2GJSA 1FPMA 2IYQA 4FCTA 1FL9A 5B30A 1OXSC 4A92A 2NMVA 2Q6TA 4D81A 1N2CE 3GJ3A 4Q03A 1TUEA 2NO1A 3LXXA 5KNCA 5FOTA 1JR6A 4GFDA 4IVRA 1QHXA 3AUXA 4TLEA 3W6NA 4WA7A 4AD8A 2R6CA 1U98A 2HEIA 4V0MA 1II8A 5LB4A 2IXEA 3C16C 3OF5A 4KODA 5AUPB 4XWKA 4PQYA 1Z6TA 4CW7A 1E9FA 1ZM3A 1KI1A 1XDBA 2GNOA 3B85A 3CBQA 5F9HA 3QKUA 3RWMB 1U8YA 2Z0MA 2CVHA 1M7BA 4TLBA 2WVJA 4LBVA 5KSZA 4M1KA 3UIEA 1GTVA 2GXSA 2G3YA 1NIJA 1UADA 3LA6A 2EWWA 1YZLA 1SVSA 4Q4AB 1PUIA 3L0IB 1E2JA 3FVQA 2HYIC 4P31A 4WAUA 2RGGA 4YC7A 4RD4A 1GNQA 2QMHA 1W36C 3CRW1 1CLUA 1FP7A 1VYTA 4DXAA 1PLLA 1EX6A 2VYFA 2AXNA 1RRGA 2WIAA 4FD2A 4CF7A 1HURA 2W2VA 1OFTA 2ZRGA 1GNPA 1HE8B 2JASA 2YWFA 2E9SA 1KI4A 4UNPA 2OO7A 4C0QC 5CB6A 2WSSD 3B8HA 3O8RA 3ZVNA 3HDTA 4G3XA 3K70B 1KDOA 1NBME 3UK6A 4YMTA 3GEHA 3KFVA 2ZSBA 4MKFA 1GSIA 2QP3A 4XIGS 5FTMA 5C18A 3CRMA 2Z43A 4B32A 1R0ZA 4HUTA 5FFMA 1XXHA 2O0HA 4M21A 1EXMA 2PX0A 1QHYA 3W9YA 1BMFD 2RHDA 3MWYW 5FPSA 1W44A 4URYR 4QOSA 3C41J 3VR5A 1KO5A 4R2IA 1G21E 3BIFA 4IRUB 5CYOA 4EJSA 3QVUA 5IT5A 2ZANA 1HUQA 1V43A 1ZUHA 3IBGA 1E2PA 2OG2A 3EPKA 2OEPA 2NZ8A 1DTSA 2GVZC 1XTJA 2XITA 2ZI5A 5EXPA 2O5VA 2FE4A 3B1VA 3H2YA 2IEYA 4ZCIA 4D6PA 4M1TA 4CEJB 4N1AA 4IOMA 1ZM7A 4L4UA 5DHAA 5KSYA 3DO6A 1A4RA 2ECKA 3CH5A 1S3SA 3NEJA 4IVPA 4RCZA 5TXGA 1N0VC 3B6EA 1GL6A 621PA 2GCOB 3RS0A 5DYGA 1R4AA 3E5HA 2LCFA 3ZQJA 1F6BA 3QENA 3ZZ0A 2XX3A 2A2ZA 4HSEA 2HLDA 1GRRA 5DNYB 1FQKA 1FX0A 4PSAA 2C96A 3RWOA 4LX0A 4P4SA 2OAP1 1DADA 2AD5A 2OBNA 3CRRA 1KTVA 3PEVA 4RFSA 5GVSA 1U9IC 2W00A 3BK7A 1T0JB 4IHQA 1EFHA 1YZGA 1Z29A 2VO1A 3RSLA 1PLKA 2J5XA 1HA3A 2PLRA 2V7QA 3P4YA 2ZJYA 4Q9LA 3FFBA 4G5GA 1YVDA 1N25A 3T5GA 2Z4SA 2CHGA 2JJ8A 2QAGB 1IXSB 4M9ZA 1R2QA 2CXXA 3RRNA 1P2TA 4XVQA 2IYTA 1E0SA 5EUQB 2FZLA 1EGAA 4V0LA 5K8TA 1LW7A 1WBBA 1KZ7B 1XCGB 5K8UA 1E9RA 4HB4A 4QL3A 2EU8A 5D3MB 4HYYA 5TMPA 1A5TA 4BLQA 5KNDA 5J4HA 3FOZA 1MO5A 3SE0A 1GG2A 4PC6A 2CJWA 2WHXA 3CO5A 1ZIOA 2ZS7A 3D8BA 4K81B 4LHVA 4EAQA 3O8BA 2J41A 4PQRA 1Z63A 4Q7LA 2O8DA 4O2LA 1ZU4A 1OXVA 1VCNA 3PQCA 2A5GA 1R5BA 2ONJA 3FHCB 4HATA 4U02A 5TY0A 2WKQA 2ANBA 3VX4A 2FH5B 3U3MA 5GJWC 2ZE5A 2RGNC 1E9SA 4Q1CA 1YZKA 1OW3B 2FZ4A 3PENA 4OHZA 1DG3A 1OXTA 2ZRFA 1Z28A 2FSHA 1OJLA 2YNMA 4DC9A 1SXJE 4RCYA 4D4LA 3I92A 1E1QD 3QF4B 4HZIA 2XZPA 4RD3A 3BWDD 1YZQA 4LJ9A 4MRNA 1NN5A 4LJ4A 2ATVA 2GCNA 3OE7D 4AYTA 2ZU0C 2G6BA 4PSVA 3KKMA 3U3RA 3OIUA 1OE0A 4Q9IA 5TB5A 4A8JC 3NEYA 1XP8A 4BFWA 2IYYA 3PR1A 4DKXA 1S1CA 1AQUA 1OB2A 4DSOA 2WZQA 2XXAA 2V6JA 4JBXA 3C5CA 5FBRB 2QTVB 4BZPA 2AFIE 4L9WA 5AR1A 2J7PD 5J4YA 5LBIA 1X8LA 3VNUA 1ZAKA 2GA8A 2DFLA 1XU4A 2ZRAA 3BORA 1NBMD 3CIOA 4NDZA 4NYJR 4BLPA 4YXWD 2PCJA 4KLZA 3T5DA 5FTKA 3MJRA 1DAKA 1H8HA 2Q21A 2ZITA 4Q5IA 3R8CA 1LY1A 3KKQA 1U81A 2NO7A 4UNRA 3UPUA 1KNQA 1KMHB 2FG5A 5H70A 2ZRJA 4IEIA 2ZRLA 2JIZD 2F43A 3LY5A 1NJGA 2H92A 2CNWA 2FFAA 2FJUA 4KYIB 1TEVA 1F2TA 4B2PA 1AZTA 2X8AA 3PUYA 5HCIA 2ZR7A 2G0NA 3SJZA 5GJCA 2RAPA 2IS4A 1XD8A 1U0LA 2H57A 4B3BA 3TGPA 1P2UA 4HAUA 4UNSA 2DCUA 1RJ9A 4JLVA 4EFMA 3SU8A 3GJ5A 2ZRNA 1RC8A 1ZNYA 3IIMA 1UKZA 3OHMA 1L2TA 4JL6A 2OBMA 2ANCA 4QC2A 1KI7A 2CCGA 3TK1A 3D3QA 4EIWA 3LRPA 2Q3FA 2DR3A 4PQFA 1AKYA 1E99A 1SXJC 3P4XA 1GRQA 1R5OA 3P32A 2ZJAA 4KFUA 4OL0A 1ESMA 2N42A 2Q9BA 3KJHA 5HPYB 4PC7A 2EVWX 3P1JA 4KSBA 5HE9A 4R71A 4DCVA 4JT2A 1UPTA 1Q1QA 3L0PA 1I4DD 4X8HA 2J7KA 4CGZA 4EPVA 4E22A 1YE8A 2BCGY 3UKDA 3HPRA 4V02A 1XNJA 3CNLA 4GSYA 3IUYA 4GDFA 2Q9CA 3WY9A 2XGJA 1P73A 4GMXA 4A6PA 1SHZA 1COWD 4AURA 2O8EB 3CR8A 3SJBA 5C1BA 2I1QA 4Q4AA 3C7KA 1S1MA 1XZQA 3AF3A 4UJ3A 2IC5A 1GOTA 1W0KD 4YDSA 5JRJA 2GBLA 3H0KA 1PLJA 1QHHB 4MRRA 4WBSA 2WSSA 4D0GA 1D2NA 2NG1A 4HLCA 2ODWA 3UWOA 5FL7D 4K46A 3N70A 3BXZA 4Q1FA 1JQJC 3L2OB 1KMQA 2WPDD 4EUNA 2GK6A 2NO6A 2GEVA 5IK2D 3BAFA 3IIKA 4ASUD 1XXHE 4JYBA 2ZS8A 1KYIA 3PITA 2IS1A 1HE1C 1XEWX 4TYQA 2PZFA 1AS2A 1BMFA 1XWIA 4MYTA 2NGRA 5FR2A 1BOFA 3Q5DA 4JVMA 4JT4A 1IY2A 4LC0A 2JLWA 5HCNA 1RKBA 2C04A 1F2UB 1DE0A 1E0JA 4CRWB 1Z07A 3CLVA 3V00A 4RD1A 1D9ZA 4M22A 3E1SA 3NDPA 4BGDA 3N2IA 4E09A 2DB3A 2IYUA 2QI9C 1KJYA 1NY6A 1OFHA 4Q1DA 3I61A 2WWIA 3RABA 1GDDA 3C8UA 2P5SA 3L0SA 4AG5A 5EQTA 3SDZA 4OYHA 1EFTA 3QPUA 3M6AA 1DELA 5KU1A 2AR7A 1IQPA 2F1JA 3MAAC 4G5SA 3Q72A 1UKYA 2ZM5A 1QRAA 4CEJA 1KJWA 4PPFA 5DLQC 1W2HA 3IBYA 1Q1BA 4O3MA 2ORIA 2PX3A 5DSZA 3DZDA 4OQLA 4TQ9A 2EQBA 1ELOA 2FWRA 3EZ9A 5JI2E 2VA8A 3BE4A 4ABYA 4XJXA 4CEHB 1IY1A 1KI3A 3X1WA 4WXRA 4D2IA 1NN3A 1KSGA 1BYIA 1QHNA 4BPBA 3TUZC 4OI1A 3F3YA 4A0GA 1CRQA 4URUR 4DDTA 2OV2A 3H84A 4MGKR 1G7TA 1AQYA 1SVIA 2OAQ1 2UVQA 1ZP6A 3I72A 1NRJB 3NKVA 2VPPA 4FMDB 1FZQA 2WWFA 2A5DA 4QGHA 1G7SA 1XFAA 2BM0A 1OHHD 5G41A 1TU3A 2IT1A 1CIPA 2QAGA 4BUJA 4EJSC 4HLUA 4F4IA 1E9AA 3QIAA 1ZUIA 5JFGA 3V9PA 3QKRB 1NF3A 1VMAA 1IHUA 1OV4A 3LXRA 2V8OA 3QOFA 2ZR9A 4QBFA 3BOSA 3J81k 4US1R 3S1AB 3QVVA 5AJZA 2H5EA 1Z08A 2N1BA 3W6OA 1E9DA 3IQXA 4OHVA 5JHHB 4MYUA 2A7QA 4I1UA 2GZHA 3TW8B 2DFNA 1GAJA 1FMLA 4C7OA 4D4MA 4C0LA 4OQFA 4B75A 4RSGA 1GL7A 2ZIAA 4G5QA 5FOSA 4N0DA 1Z0JA 2WM9B 2VP9A 2GRJA 3GLHB 3QPWA 3B9QA 4U00A 4ESHA 1E1QA 3GFOA 2ZAMA 1XRJA 1L4UA 4TMZA 2QRZA 3BBPA 1G4UR 3OE7A 2GETA 4MUAA 2W6JD 1MABA 4LYJA 2FOLA 1S4QA 2VIIA 1JJVA 3JVUA 2WWGA 4FW9A 4JVSB 2GF9A 4LZZA 4US0R 3T1QA 2QU8A 2QP9X 1GKIA 1OH8A 1KO4A 1N6PA 2RGEA 5CLLA 2VSFA 4LI0A 2V3CC 4GZLA 1FW6A 2HT1A 2J7PA 3EC2A 3CX7A 5KDDA 4DUGD 1Z6XA 1WDTA 3THWB 1VDZA 3GLGE 3PFIA 1E2LA 1S96A 2QY9A 2Z4RA 1NBMA 3ICEA 3GD7A 4YXWA 2Q9AA 2QAJA 1N0UA 2DPXA 3RRMA 2J0VA 1XPOA 4V0OA 2YC2C 5F3WB 3VR1A 1E1RD 1Z0DA 4MDEA 2RGXA 4CIDA 3A58B 5JMTA 1VYUA 4JL5A 3GP8A 2H8KA 2JIZA 3BH7A 4BFXA 1XMIA 4RFVA 4L9SA 4Q00A 1TTTA 2AWNA 1W5TA 2FGJA 4LUCA 4LYFA 4ARZB 1KDRA 1P62B 5FTLA 5TVKA 1RRPA 2ZVPX 3NWJA 3SHFA 2QMUA 5CIQA 4FN5A 4NU0A 5B2ZA 4A6XA 2QBYB 4G5OA 4JLNA 1L8QA 2VHCA 3HR8A 5FI0B 4MQBA 5KO2A 2R6GA 1WCV1 1Y63A 3CONA 2ZVQX 1G7RA 2EFHB 1EK0A 3OEHD 4NYIR 1ESNA 2E87A 3T15A 2GJAA 1CR1A 4DCTA 1CRPA 4XWAA 3HPQA 1W49A 5SZKB 3WRXC 3LDAA 2RKOA 4ZKEA 1G3RA 4BFSA 2J0SA 4MGIR 4URVR 4EPXA 3D7MA 3QPVA 2AWOA 1GNRA 2J45A 2OFOA 2Q0HA 2ZS9A 3EXAA 1TU4A 2ZTSA 4HAXA 3A1TA 4Y0AA 1TPZA 2QPOA 4EFLA 4D26A 1Q22A 1VG0B 1T3HA 1UDXA 1WA5A 1YR9A 2ZI7A 4YLGA 4X8LA 3FKQA 2DWPA 3N2EA 3W6PA 2DYKA 2VP2A 5KOYA 4W9MC 1COWA 1JECA 3I8XA 1IM2A 4DIEA 2C78A 4Z8XA 1CTQA 3U5ZB 2HJGA 5LD2B 4BEJA 1E0KA 4DLTA 1W0KA 2ZJBA 3AKEA 3EIQA 4BZXA 4OHYA 1IN4A 2VP0A 2VHUA 1NVVR 2WOJA 4XVUA 2O8EA 4KJZA 1DOAA 4PC3A 5FL7A 1EG7A 5DIFA 3LAWA 3K1JA 4GPTA 3NBXX 2WJJA 2J3EA 2WPDA 4LJAA 3ZQ6A 3CRQA 3GJ8A 3QBTA 5IK2A 3SBDA 4ASUA 5AUNB 1QHHA 4JJZA 4OJKA 4ILEA 4KXFB 1XTIA 2IUTA 3WP1B 5FBVB 1W4CA 1FNMA 3Q7QA 5HTKA 3EPLA 4D0LB 2GTPA 2QSYA 2VHQA 3BH6A 1W4AA 5E7JA 1N6IA 2HYDA 4QHTA 3B5JA 2F1IA 1WBDA 1ONBA 4ZO4A 4EPRA 4HZUB 3AEZA 4PHGA 1J8MF 1MH1A 2A30A 3T1OA 3CWZA 3EWSA 5FUVA 3SEAA 2JATA 4JBWA 4ZIRA 3FMFA 3CF6R 4II7A 5B57C 2CEAA 3QI2A 1JNYA 4MKHA 4QNMA 2O8FB 3IILA 1M7GA 4GOXA 2G77B 3PCRB 4U5XA 3UMSA 2OBLA 2YKGA 3SZRA 4PX9A 2G83A 3WBKA 5FPTA 2IK8A 2IEZA 2QG6A 3BGWA 3CF2A 2IYVA 4BEBA 3WHLA 5CB8A 2PLFA 1W47A 4W7SA 2F6RA 5L3SB 2GAAA 2YWGA 4MYCA 4Q18A 2A5FA 1G9XA 3L8ZA 4TT3D 2GBLC 1DO2A 3UXMA 2ORWA 2VP4A 4LBYA 1O3YA 3GLIB 3ZS8A 4AYXA 4BFUA 2DBYA 6Q21A 1ZBDA 3IO3A 3K0SA 1YRBA 3UWKA 2F3TA 3QQ5A 1VG9B 1CJTC 5E7IA 1DO0A 1I2MA 2EFDB 2GKSA 3THXA 3BERA 4BFZA 1M8PA 2BHRA 1ZD8A 5EP4A 4O2RA 1OFUX 2QSZA 3NH6A 3AUYA 3KKOA 3KTAA 1N6HA 4GL2A 1OHHA 1G291 3SYNA 2NQ2C 4PC2A 3Q8XB 3CUEF 2VP6A 3B1XA 1TL7C 1Q44A 2QROA 2ZUDA 1HEIA 1X86B 1XB2A 3L8YA 1VHLA 3GLFB 4Q1EA 4TL6A 4EPYA 1P60A 1YZUA 3RSOA 4Z1MD 1CS4C 4ZV4A 2WJYA 1E94E 1SVMA 3ZZTA 3ZD7A 1QZXA 5FOWA 5JSZA 1HTWA 2JA1A 3NBYC 3QEJA 4B33A 1EWRA 3RRYA 1OXUA 3IDQA 3DL0A 2XTNA 1D5CA 3W3ZB 1P2SA 3QEOA 2D06A 1G17A 5E95A 2W58A 4HI0E 3FKSD 3B13B 3CM0A 4YONB 2FPKA 2ZRPA 4OHWA 2UZIR 3THOA 2GK7A 2YOGA 4MDFA 3ND9A 2W6JA 3KUCA 4CEIB 2DY1A 1Z2AA 3VU9B 4EPTA 2VBCA 2WJIA 2CL0X 1HH4A 2FFQA 1JBKA 4M2LA 1ZUNB 1KK2A 1G3MA 4GI7A 4TLCA 1KSJA 5SZIA 2GCPA 2JLSA 1KO7A 2ZSFA 2ZSDA 1I4LD 3EARA 1ZW6A 4C30A 5C4GB 4MH0R 4DUGA 4JLKA 2RCNA 2OCAA 4E03A 1NLFA 2G0TA 2P6NA 1AS0A 4R9UC 4ZCMA 2QAGC 3MCAA 4HLUC 2QA5A 1ZD1A 4HUQA 5EP3A 221PA 3VX3A 3K70D 2H7VA 1E1RA 1NSFA 4LYHA 3K0EA 3THWA 1OSNA 4MUBA 2CHQA 4X8MA 4LK2A 3U3OA 3IEVA 4NYMQ 3A1WA 1U99A 1G1MA 3DMDA 4Q4JA 2ZUBA 2R6DA 1E9CA 1UFQA 2BEJA 1QF9A 1XJCA 2CVFA 3MWJA 4MYHA 4D4KA 1KY2A 3QKSB 5FPHA 2GJ9A 1A2KC 4OK3A 1S9HA 2R2AA 3EIEA 2FSGA 2B21A 1HQYE 1P9NA 2BKUA 4JVLA 4YMUA 3AVTA 1QVAA 3KXIA 4A1FA 4ARZA 5A5GA 2ZRDA 3HU2A 1ZCAA 5GADl 2XZLA 1DAMA 3EAQA 3ZYCA 3UMFA 1QHSA 3A6PC 1ZC4A 1Q3TA 3OEHA 3SFVA 1P75A 4P4UA 2YHSA 3PEWA 4Q4LA 1E9EA 4DLRA 2PEYA 2AK3A 3KJIA 4LJ5A 2WKPA 1Z2CA 3ONWA 3TLXA 3REFA 3QY0A 2AX4A 3SC3A 2D7DA 4POAA 2ZI6A 5CLQA 3ZD6A 5J4VA 5JBQA 4B74A 3DOFA 2WWXA 1G6HA 4F93B 1E2DA 3I3SR 4B76A 4D4JA 3U6BA 1QHIA 1ZIPA 3I5XA 4IDQA 4N0EA 5JEDA 4I1SA 4DHEA 1MO6A 5LDDC 4GOKA 4TQAA 3U3KA 3CPJB 2IW3A 2BJVA 2FEOA 3WP0A 3SJCA 1G3QA 5AWFC 2GEDA 1IN6A 3NBZC 1JAIA 1KZGB 2XJ9A 4HDQB 4PZLA 1S8FA 1TF2A 3B1ZA 4WZ6A 3W5JA 2OE2A 3GPLA 4IFEA 5GJBA 4RD6A 1UBFA 5J4LA 1MRNA 3CX8A 1R7RA 3NTUA 4TN1A 4QJ4A 2ZJ5A 3DZ8A 4AC9A 2CE7A 3ADBA 3QG5A 4XD7D 1ZU5A 1E2EA 4JS0A 2ZJZA 2REXB 1ZMXA 1OKKD 4WXPA 1N5IA 4KHZA 2WJVA 5KDOA 1VCIA 1CU1A 2OFXA 3F8TA 3K0AB 3PUXA 1OF1A 5J40A 4DIDA 3T12A 4TL7A 3KQNA 5KTYA 4BLSA 1FTSA 3W3AA 1NG1A 1RIFA 1XEWY 2VHJA 1P5ZB 1CR0A 2ZYVX 5AUOB 5BXQC 2VHTA 3IQWA 5B58C 4WZBE 3TBKA 1PZNA 4C2TA 1V5WA 3VFDA 4AKEA 1HT2E 1EWQA 3U7EB 1Q1ZA 2Q3HA 3NDBB 2C9CA 2O0JA 5FBQB 4LC1A 3P27A 1AGPA 4OI4A 2O52A 1RRCA 1AKEA 1RW4A 4BWYA 1H8ED 1ZM2A 3QJYA 4HAZA 4ITRC 5AK0A 2QUZA 2OXCA 2NO9A 3AVYA 2P6RA 1W4RA 1WQ1R 1M74A 4KFTA 3MRSA 2ZYUX 3HP1A 2AHOA 2XNSA 2Z83A 1Q12A 3KJEA 1M6NA 2QP4A 2VP5A 2C77A 1XTSA 3AF4A 3AF0A 2OHFA 2KSQA 1TEXA 4QGFA 4M1YA 5AJWA 3QUSA 3X1YA 4PAQA 2C98A 4QJ3A 1KHTA 3JZMA 3KB1A 4DCNA 4QFMA 1GZSA 2OILA 3B60A 3X1DA 2ZE8A 3Q7PA 4M9SA 1AIPA 5EP1A 4DLYA 4OHXA 3LLMA 1UBEA 2RGCA 1AA9A 1Z5ZA
chains in the Genus database with same CATH superfamily
1VZ3A 5CDTA 3ZDQA 4LWOA 4Q9NA 3WAJA 1Y3FE 4QXRA 1LRKA 3MN1A 1KDZA 4L4RA 1VA4A 3TIIA 4ZTUB 1CULC 1O54A 3KO8A 1C81A 1D6MA 1GV0A 1JR3E 4QUGA 4N47A 1PX0A 1W48A 3CBGA 3EFBA 2OAEA 3KX2A 3O7MA 1PK8A 4LAFA 3OUUA 1P7ZA 3HVUA 1MB9A 2I6TA 1LK0A 2WAMA 4CM4A 4BPRA 3MGGA 3EVAA 5KWJA 4BMXA 1DCKA 1C4XA 4I1PA 3AOGA 2JW5A 4G01B 3A7DA 5HJEA 2PZMA 3H3XA 4KU4A 3FPBA 3BKWA 4MVWA 4JLWA 3QFCA 4QJ5A 3G8YA 3B36A 4QUAA 5ALWA 4IJ6A 5DRTA 1EQAA 1T24A 5DX8A 3GLIA 4XSHA 1HE4A 3U7HB 1NTOA 2Y76A 4QPPA 4PYLA 3KEOA 4C0HA 1D09A 1FP2A 2WIDA 2X86A 1YZFA 2D59A 5DB4A 3J81A 4WGFA 4W5JA 4AG6A 3IMCA 2G1PA 4CGYA 1GVNB 3GIWA 1XX6A 3FGPA 3L6OO 1Q11A 5TMEA 3IURA 5A4IS 1RKXA 4AFNA 1UWKA 1OYWA 2ZOSA 4M98A 5T5QA 3IH5A 2VZ0A 1Z35A 4ZT5A 1JB9A 3ED5A 3M33A 1CFJA 2EERA 3KVVA 4DJAA 1P0MA 1M8FA 1R88A 4I2VA 5FADA 4ZCRA 4PFSA 3CW9A 1AUOA 1O97D 1ZRSA 3VGPA 2GAIA 3W06A 3MUNA 1J0DA 1QIGA 1N5LA 2QW0X 3K8YA 3LCVB 3MS7A 4QUBA 4Z51A 1PJLA 1NLYA 4GXQA 4Z1MA 3AESB 3U4DA 3BZBA 2XV1A 4Z9BA 3JR7A 1COZA 4KH0A 2Z04A 3QVOA 5TLSA 4AO6A 4BO5A 1GKYA 1NVBA 1YO6A 2PU5A 5LLTA 1XRPA 3RROA 1QZTA 3KKEA 1F8FA 5J2UA 1C3OB 3C1UA 3J7AC 2P11A 4M46A 4G41A 4WCFA 4Z0NA 3T3GA 2P2NA 1J9GA 1R50A 1SUCA 2NX2A 2PJZA 3B2NA 3B20A 1U1FA 4FDVA 1YXMA 3CW8X 5TT1A 3SOPA 3SQLA 4D9CA 3PQ4A 3RF6A 2AUTA 2QZ4A 1OFGA 4UNQA 3TZQA 1VOTA 4FUTA 4XSVA 4B3FX 1CPYA 2XUAA 1CE8A 1RM3A 4DMRA 3TM5A 1XRLA 2DKFA 2YJ4A 3LHDA 3VPDA 3M4ZA 1QHGA 4RZ2A 1G18A 1PJ4A 1Z8HA 3DUFB 4ZMSA 1ISGA 1ECBA 2OT3B 4K9KA 1YCHA 5A1TA 1NMYA 1J9EA 3FJOA 3SSNA 4UCWA 2O6LA 4B44A 5D8DA 3VAAA 3EBLA 5LA6A 4C0SA 3GVIA 5L3ZA 2QX8A 4EG7A 3WGIA 3WGNA 4C5AA 4WKCA 3CSUA 1BCSB 2RG1A 4CG2A 4DR5B 3DOHA 1N5DA 1Q0RA 2IE0A 1FFXB 2QTMA 3F6SA 3GFBA 3HNOA 5FWAA 3TLZA 3GYBA 5T6BA 3ZH9B 3WIDA 2WOOA 1GTJ1 1VP9A 5AIBA 1JLMA 4I2NA 4PCLA 2ATIA 4MI6A 4DJJA 2C9YA 3D5EA 4M86A 2IF0A 2XCIA 3K9GA 3L7YA 3W7BA 4NE9A 1Y8RA 2CFOA 1J1IA 2YV3A 4KK3A 5EHIA 1VKRA 3FHOA 1DINA 4LXXA 2YXNA 4WESA 5KAPA 2W2LA 5IZCC 2FLKA 3FOFC 3TSCA 2PYIA 3CRZA 3IDSA 2A5JA 2Q1TA 4J1TC 4JDPA 3SI7A 1IM8A 1H2AS 1U02A 3DF9A 4HDAA 1O9GA 2VS1A 3GG9A 3QLTA 2P4EA 4M7PA 4WCDA 4BE4A 2QRVB 1XZBA 1ZGJA 4JR0A 5KZMB 2WJPA 1GYPA 1U3CA 4NICA 4HS9A 4NJEB 5E2AA 3B6KA 5IYZF 4PV7A 1R0WA 4HADA 2IVFA 1GTMA 3I45A 4UTNA 2X4IA 4F4UA 2FXIA 4E7OA 4NPHA 4YP5A 3ABRB 5F77A 1HYQA 1E2HA 3MJSA 2CMKA 4A73A 4M0FA 2HSJA 5SY4A 1DPFA 4TWAA 2H31A 4D0NA 2A9RA 2UU9B 5E4YA 1SCUB 2VLIA 1CJVC 2YINC 4OHFA 3FKJA 3BJIC 1E32A 3DXXA 4IKPA 3R3YA 2H11A 3RYFA 3WKCA 2KLBA 2ZFUA 3WICA 2GCOA 3QM1A 4S04A 1RQNA 3KT8A 2GXQA 1ZSNA 2HCRA 1U7DA 5C35A 4IDBA 4ZYLA 1VE5A 4CI0B 1XALA 2WJHA 1EUCB 4N5HX 2DECA 4PXYA 4AZ3B 5DWDA 5C9ZA 2XBUA 4YJ3B 2PWPA 2Y1WA 4A8TA 1JZTA 3TR6A 1F48A 2XNHA 1S9DA 3O1JC 1I9GA 1SUEA 3V4RA 3DBRB 3GCXA 4KWHA 2W9XA 2B4QA 4FVTA 2O8BB 2Z1DA 1KOFA 1A0OA 3CLKA 3JZAA 4FMBB 3O8NA 4IIJA 4M1EA 4TLDA 5FRDA 5HXAA 4RPIA 3N2GB 3I30X 4QSMA 3W2IA 4BVBA 4PO1A 5G0SA 4LGMA 5KDLA 1FNNA 2B5WA 2O3SA 4M4SA 1WPRA 4CV2A 4NS1A 3BCRA 2W6QA 1KI9A 4GGMX 4IDHA 5AOBA 1U7PA 4PPQA 4H9GA 5I8PA 1Q20A 3G7UA 3O4GA 1PL0A 5B5SA 3P9NA 3H2JA 4JIMA 4LTDA 2OFWA 3STYA 4HDRB 1L4LA 4MKGA 1TQ2A 3PTZA 1NC3A 1ZNWA 3EQ8A 2A9FA 4QHSA 4C4PA 3PUVA 3LUAA 3VPBA 5M34A 1TUBB 4E5DA 2GGSA 2QF7A 4I8IA 4EMSA 4RTKA 2VPIA 4HPJB 3X2FA 2CLIB 4QYSA 4LDRA 4XD2A 4JI1B 3T7AA 4WW0A 2YZ7A 3RVBA 5JCXA 3PA6A 4QPCA 1T8TA 1ODFA 5HS6A 4WOBA 1RM0A 3PEUA 3DTYA 4G4SP 1PVDA 3ROQA 2MTBA 2GJ8A 1HRDA 1P5JA 1V1RB 3K5PA 2F9LA 3LKZA 2BFCA 2WNIA 1AQ6A 2Z3WA 3OLXA 4W1QA 2BHNA 4BOYA 4P7KA 1H65A 1DRVA 2QYSA 3GIDA 4J7XA 5BWNA 5JLJA 2AJCA 4FN4A 1E1KA 2FW6A 3RFUA 3NHBA 4YYEA 5JXGA 4KCGA 3COWA 3WLIA 3TRKA 2ACWA 4CZ2A 3PNYA 4GXNA 4MMXB 4KRFA 1AQNA 2DH6A 3OZAA 3TXAA 3MUFA 2FRVA 1RYYA 3E3OA 1N6NA 3WBJA 1IHYA 1E98A 1VBNA 5NLLA 1I3MA 4B3SB 3CUTA 2CL6X 4ICIA 4JLUA 3K09A 3QF4A 1EJ0A 5A3QA 2QM8A 4PGGA 2BZ1A 1DRJA 1KF0A 4EJFA 2IPLA 4G6ZA 4UNNA 3X1ZA 5DLDA 4Z7NB 4X7PA 5A9RA 3VVBA 3DL7A 3LPDA 1GPYA 1OIWA 4HNQA 5HFAA 4C9BA 1X7ZA 1UDBA 4RFLA 2CXOA 2ZSAA 3KFXA 1H1LA 3C3YA 1WHSA 3KLPX 4K86A 4DBZA 2PL9A 3R0QA 4FQ7A 3AL3A 5KU7A 4HDKB 1V2HE 3ZWAA 5B64A 3HKEA 3D0QA 4AKTA 5J1TB 3H86A 3V1KA 3VR3D 4EDFA 5T8KA 3CCFA 4Z9AA 2PH5A 8LDHA 2D54A 2NTYC 1Y4ZA 1MIOB 5CA1F 1W76A 2WPNA 1GA1A 1IZYA 3KJNA 2ORYA 3C1OA 1NBOA 2WWHA 2LDXA 3GLIE 5K6AA 5A5EA 1B0UA 5C46F 1GY8A 5HDQA 2WTBA 5HUJA 5JI2E 3QSGA 2ID9A 4D25A 1FSSA 2CXTA 3JS5A 1DJNA 3KU1A 2ZUWA 5LIPA 1KMHA 4BJ1A 3DHNA 4I4TB 1N77A 3KOMA 1DWUA 1Z36A 2IGBA 1DG1G 4E5UA 3WK9A 3PIRA 3I2HA 1L1EA 3QK7A 2PT9A 1OWOA 1RXIA 3AVQA 3M5PA 4G9GA 4NWIA 5IWAB 1GKUB 2PGDA 1TYEB 3U40A 3UK1A 6REQB 3COJA 2EOAA 1GARA 4C06A 4ZK2A 1JB1A 4N5DA 2CXRA 3R8FA 3TQCA 3VV2A 1Q3HA 1X19A 3T3OA 1LWNA 2P1RA 1ZG3A 4CL8A 4S05A 4IS3A 1BMTA 2Q62A 3H4MA 3T9DA 1NW9B 3JYHA 4M1OA 3UHFA 4OREX 1C8LA 4ZVMA 2F2TA 3D7LA 4LGCA 4AMYA 3LUCA 3EEQA 1PGPA 3W5UA 5GONB 5DCWA 1J5XA 3VYUB 5AW3A 3EX7C 2PZ8A 4PGMA 1L4HA 1IWOA 3VNVA 1KH3A 3ECAA 4PSUA 4RKEA 4L08A 1PYOA 1KI2A 2A94A 4B6EA 1G38A 3AVPA 2UUAB 2F3SA 2NTVA 1F7UA 3Q8LA 3O93A 3PQDA 1OT3A 2W98A 2AN4A 3ZHRA 3LBIA 1UODA 3PKJA 2WZDA 4TTVA 1V1JA 1GTSA 5D7BA 4TKVA 1AKWA 4DN6A 2V74B 5CDHA 4MVJI 2CLEB 4RQBA 3NBFA 1K9VF 2W4MA 3LF2A 3IX7A 2HSWA 1N6LA 2OOSA 3CZPA 1JHAA 5TARA 1RT9A 4UHKA 4Y2RA 3HCAA 5C1IA 1NE2A 1UZNA 3CVWA 1PT9A 3IAS1 1K6EA 1FP6A 2GWHA 2GAOA 1JLSA 4L2IB 1P1HA 3QE0A 4L16A 1QFSA 4QYIB 1QIJA 4NULA 4ND6A 2AI2A 2I2BA 4A8JA 2R25B 2X8BA 4IGAA 2GF0A 1PDWA 1G98A 1P9RA 2B7LA 4G84A 4I50B 3UC9A 3GDFA 3WZ2A 4IW3B 2XUFA 3R6DA 4DRZA 4QTZA 4HDSA 1NXQA 1AN0A 2NV0A 2AN1A 2R11A 2CLHB 3ZIUA 4WSOA 5J2TB 2LE0A 2V0GA 2GYYA 5EMKA 2JGNA 1GUFA 2LIPA 1ABFA 3EGCA 4IXNA 4LJKA 4KQMA 5IAGA 1UJCA 4EHFA 2Q3CA 2FFBA 1K89A 2HC9A 4X1IB 4MGZR 2DPHA 4XXHA 4A5OA 3UJ8A 4I5EA 1FA9A 2O8DB 1B0AA 1N9GB 2XVZA 2YS7A 3EY4A 2R1UA 3HUUA 4OBEA 1XCBA 4F60A 1DGQA 1J39A 1F9AA 2VYQA 4P5PA 4YCAA 3SC2B 4IHJF 3HSSA 2HB6A 2A3RA 1U4SA 2WM2A 2G1JA 1TUIA 1LTQA 3AERB 1QFXA 1UM9B 2Z3VA 3T1NA 1ZJ6A 2NZVG 4KP7A 1YIAA 2V45A 4OFXA 4R40A 3LLUA 4ZVLA 4ZVTA 3TIGA 3UJBA 3VR2D 1U7UA 2VPQA 1SRRA 5GJVC 3RFTA 4BMNA 4N48A 4D9HA 1G0OA 4WCFC 2AT1A 4TV8A 3G89A 4HRYA 3EYWA 1SCQA 4L4XA 2CLOB 1WDMA 2I7VA 3RFVA 4CIBA 2QT1A 5BOSB 3TKAA 5SZHB 4Q6BA 1IRIA 1XYGA 1F4VA 3MJDA 2BR5A 3T9AA 3WKAA 3VH3A 3DV9A 5F4ZA 4DLVA 3AG5A 1XMPA 4HTFB 3BQMB 3D4LA 5AH0A 1U3UA 4FOOA 1YBHA 2EBWA 2QJFA 5A4JA 2PUTA 2PZJA 2VJYA 4Z86A 1LVHA 1CQJB 3F3MA 3JQAD 4Q9AA 2MYPA 5IDVA 4X1KA 1RE1A 1UEIA 2AH5A 2F67A 1X7GA 5LPNA 1HQKA 2LIVA 2CL7X 2I7CA 2NU9A 4RY0A 2H3HA 1Z4IA 4HEQA 4WLNA 4KITB 5EE1A 4MSUA 1XE3A 2VP3A 1F8XA 1P3JA 2XUHA 4DIFA 1KY3A 1SQ5A 3OZCA 3DEJA 1AK2A 2V7BA 2X0JA 1XZPA 5L4NA 2QGZA 3NYWA 3I9FA 1MF7A 4EUKA 3HJAA 2OXIA 1HT1E 2NU6A 2BFFA 2CZCA 4OTZA 2PVCA 3W5IA 4MV4A 1ZGBA 4CE6A 4Y98A 4B3TB 1TMGE 4FILA 4MO2A 3ZY2A 3P19A 5HFJA 2A0XA 3DE3X 1L5LA 4GYJA 5IXYA 2JFVA 5CLIA 3VH1A 4QGSA 2DLCX 1GADO 2PL1A 3RYHB 2IDZA 4LVNA 3CF4G 1FP4A 2AFHA 2H1OA 2BELA 5DGXA 5BYKA 3DEAA 3RYIB 3IA2A 4L4ZA 1ZICA 3LVFO 3EN0A 4RD2A 5L6MB 1ZEJA 2CNBA 3SQDA 2H2GA 1VIVA 4MS1B 4GU5A 1P0QA 1JBQA 2O2SA 2UYQA 2IY9A 4ER7A 5BPHA 1YC2A 2O3UA 4ZHQB 1UDAA 3K05A 3TW6A 3ZDEA 3GFQA 4JLJA 2ZK7A 1WUTA 4MUNA 3AFNA 1TX4B 2C5FA 3C7CB 1NYLA 2QQGA 4JLMA 2BC9A 2LWIA 3KUKA 5LLSA 4YMLA 4D9FA 3NVAA 5IVIA 5KKNB 1QB7A 4J43A 4C3OB 5CIWA 3WGGA 3WJ7A 1K5HA 2GPYA 3B3GA 2F1RA 2NUAA 3UMMA 1E79D 4EZIA 5A0FA 4OGKA 3ADKA 4H1UA 3M6XA 5DLYA 4A27A 4DE5A 3K4HA 2P0EA 2WD7B 3QYAA 4AWBA 3H6KA 1MAAA 5JOQA 2J0QA 4AUMA 3QZUA 2K7FA 5IM4F 1QX3A 1GDHA 4H2DA 1YU6A 1AQJA 2MINB 3HBLA 3G0HA 2P6UA 2O4UX 3NWBA 5KNDH 3NONA 3ZIAD 4L9RA 1FQJA 3M4NA 4C6TB 1RACA 3IJEB 5CA0A 4KR3A 4BMDA 5E4TA 3QJGA 1O96A 1U8TA 2HU8A 1DEHA 5YASA 3FY4A 1KI8A 5JWRA 3QELA 1VPLA 1ZOOA 4G1FA 4BNXA 1TTHA 4PYJA 1QCZA 5JS7A 2FZ5A 4FMDF 1HLDA 3VR3A 4ZJYA 3COZA 4FDAA 2I2XB 2I2FA 5GIPE 2JBAA 3BZWA 1E7QA 4RQTA 1C9MA 3MTAA 1VXOA 1ZH2A 3LQQA 4WDQA 3WB0A 1OXKB 4AG3A 5AW4A 1LS6A 1FCJA 5BWMA 3NHAA 2D7JA 1QNFA 5EMMA 2IA5A 4DDVA 4MW5A 4E2ZA 2NTJA 1N7IA 2PXHA 1LDGA 3WV5A 1XQ9A 1WMAA 1ZC3A 4DMHA 5CXUA 5IKPA 1ADGA 1CS0B 2B4RO 1C7QA 4FXPA 4Q9KA 3VMMA 4ARCA 4TS3A 1UZAA 3RT1A 2HRRA 3QUAA 1T36A 1IY0A 4GIBA 3AP2A 3MCWA 5L4LA 4GYWA 2I7TA 2VK2A 3L0BA 3A6ZA 4J0HA 4KH1A 4ZCPA 4ADSG 4OU4A 3M9LA 2DPGA 3C7DB 3L04A 4P4TA 4DC0A 2R1TB 1SIWA 2H63A 3AY3A 3RS5A 2R0QC 4UM5A 1A69A 1FRNA 1XU7A 3L1KA 2QBYA 1QVRA 3KCQA 1FXSA 2X76A 4OBWA 3UKJA 3M6FA 5K8VA 1QRSA 2C92A 4G2TA 4HF7A 1WRBA 5DTQA 1WV0A 2CN1A 2ZRIA 3LX5A 3OWOA 3WWPA 1X42A 1ND6A 1ZK4A 3KEGA 3PQ2A 3MUOA 4TMFA 4NYMR 4Q7JB 2WQZA 1BQEA 3IUBA 3K09C 2M32A 3ZTYA 4J03A 4EA6A 1CY7A 3LW7A 2QZ9A 3ZY6A 4PAOA 5GGXA 1L7BA 5AO9A 2QRQA 3IJPA 5I7UA 5A03A 1KAOA 1MKYA 3BMCA 2VJMA 5LXTA 1OVMA 1XVIA 4OQYA 3DV2A 1MX3A 2C54A 3D6TB 3OT1B 3L7JA 1XTQA 2GQ0A 2Z9BA 2CDRA 4A7PA 3Q3GE 5F33A 1DKUA 4CG1A 4YRBA 1VMIA 1ENOA 2QSUA 4YJGB 3RAEC 3LKVA 4YJ2B 5T8KC 4NHOA 3VYRB 5AVUA 1MEOA 1Z25A 1G6Q1 1USVA 1LLFA 4P3YA 4OIFA 3EGXB 3C6XA 4C0JA 4YO8A 5JJIA 3VH4A 1M2VB 2RHWA 3RARA 5K6AC 3PE4A 1XDZA 3LYUA 2VWPA 1TZBA 2ZU6A 1ECFA 5DW0A 5A5VA 5BSUA 3LG2A 1A8SA 4JP2A 1BN7A 2RHMA 1DX6A 3A14A 4K2AA 1N2CB 3VHRA 3EOBI 3GA7A 3EDCA 2IYZA 2JVKA 5EHGA 5HTOA 1U63A 1P7YA 4NCJA 3ZUPA 4LVUA 2Y0EA 1DJLA 1KVQA 1N2ZA 2AC4A 2QB5A 5DGCA 4KNYA 4BV2A 5ENVA 3W1WA 1EFVB 4MGEA 1WAMA 3QOWA 4ZAFA 3B82A 3BCUA 4Q47A 1Y82A 2C5BA 1ICEA 2JLQA 3QXSA 3RSGA 5H16A 4HV4A 2VUSA 1DG9A 1B74A 4D9MA 1O97C 4G0WA 1NJ1A 1X6VA 2B25A 5FD8A 4EYKA 2ZREA 3DLAA 3HG7A 5FH9A 1OPXA 4TS4A 4G0UA 1PFVA 3E03A 4NMMA 5LP6B 1NU6A 4OKSA 4B4OA 1MVNA 4C7OB 1XP5A 2J59A 3FJ1A 4NBRA 4N01A 5DDIP 2VK4A 3W8DA 1L7NA 1QYDA 4TTQA 4XTRA 3VR2A 2B82A 2PMDA 1P8JA 4IKEA 4ZA2A 3VOTA 2CDBA 5KNBD 2F48A 2YC4C 3MT9A 1FTNA 2EF1A 5CNKA 3HGMA 4YQEA 2QN6A 3LP6A 5BOSA 2VOJA 4JUBA 3W9UA 1UXOA 3E8MA 2HA6A 4W8HA 1P5RA 2YIMA 3CF0A 4NFYA 3RVOA 4MJ3A 2PJRA 1MR3F 2KJQA 4IOLA 3D6VA 1EUDB 1NP3A 1YJXA 1OUMA 1ZNXA 4A82A 4ZDKA 4ZDJA 5I7EA 1MABB 4Y6RA 1E2IA 1BGWA 4L5BA 3LFUA 3RBZA 4DJDC 3BJZA 1M5UA 2IBSA 1DIHA 2H4JA 3FHTA 1E66A 2PKQO 4TWBA 5GGYA 1PFWA 4C89A 7MDHA 2OWDA 1YGYA 3JQAA 4LXHA 121PA 1J7KA 1PS0A 4YRJA 4DT1A 3HA2A 3N86A 4XSGA 5TQ0A 4DZTA 3UGJA 3DE1X 3BC1A 1GA6A 4J2TA 1RCFA 1J6UA 2OA0A 3PBKA 5LWQA 3H99A 1T2NA 4JB3A 2NNWB 4UVGA 1V35A 4TL8A 1UOOA 1ZLYA 2QXYA 3A9VA 5AHWA 1A5SB 1T9AA 4BXOB 1R9JA 2IOFK 4K6HA 5KPJA 4M1ZA 2YRFA 1E92A 4ZO9A 4UREA 5FOUA 2I29A 4BJ5A 3JASB 3BFPA 3NATA 1QG4A 2FJPA 2IUFA 2NVUA 1GU7A 3VZBA 4O4JA 1QH1A 5DTIA 4BUZA 3R20A 3MWFA 1ITZA 2FK8A 5FTNA 2DY0A 1ISMA 4I6JA 5KBYA 3SLRA 3PUJA 4UAGA 4UU0A 4BB0A 1EGHA 2AFHE 3QJ5A 2JLZA 1SC1A 2FPLA 4H60A 1R6TA 2VBGA 3TVTA 4F3YA 3GLQA 1HDRA 1E2KA 4HJRA 3CMMA 1VLLA 3HKDA 1V2GA 2P5UA 2BJWA 4TYWA 4D56A 1E5VA 1DHRA 1Z4KA 1CJBA 2WF7A 4MWSA 3PJDA 1O4WA 4XOIA 4J49A 3BA1A 3C4JA 4OK6A 3ZWMA 1UMDB 4DUZB 3FSRA 1H9BA 4ZPJA 2WM3A 2D5IA 4LXQA 5E2IA 3A3KA 5MF6A 3G8BA 1CK4A 3ORQA 4EY4A 5ILGA 4EJ2A 3DZGA 3MJEA 2DFKB 3VSBA 1NJ6A 1EYZA 1NOKA 3EW9A 4LNUB 4NCNA 1JDBC 2G5CA 4S35A 4FPXA 5EWMA 4YHBA 3VBEA 3VU1A 5L3RA 5E9AA 1KDTA 1RSZA 4KTTE 1GUAA 1KKUA 2PUBA 1E79A 2OVFA 2WJAA 5L51A 4BZQA 3R7WA 3PG5A 3PNSA 3T4UA 3CUWA 4UBJA 3ZK8A 5CFMA 3GELA 1ILWA 3BICA 3JWPA 3Q3EA 1HEYA 5ALXA 4UCFA 1Y3DE 3WMEA 3OQ1A 1IHPA 1LK7A 3RVKA 4E5MA 3KHUA 1JEQA 2PSDA 4WNCA 2HQSA 3NJ8A 4BLVA 4YRIA 4EQ6A 1B2RA 4N3NA 4FBLA 5DM2A 3X2SA 4DS3A 3UT6A 4ECEA 1K6IA 3E1KA 4EO4A 1MC5A 4QYWA 5IAEA 3ZIAA 2IQIA 1S2MA 2JI6A 4LSWA 1GKLA 1AB6A 3N0WA 4R7GA 4UTRA 2ZYGA 4MO9A 2F7SA 2UYGA 4RHFA 2ZTMA 1OYOA 3EVCA 2X0EA 2C9OA 5TC4A 3G1TA 1N5KA 4UUOA 1A50B 2FX2A 2QMYA 1JG1A 2PT6A 4OGGA 1VB3A 2CW5A 3FOCA 3O38A 5CB4A 1Z3IX 1IOLA 1D0VA 3EG5A 1TRKA 4TMTA 1Q95A 1D4AA 5L3VA 1VLZA 1KEVA 1U1CA 1Z4PX 2V98A 4YPOA 2HK7A 3BGDA 4LA4A 4RJLA 5BMOA 1HO3A 5BUSA 3SX2A 1T4BA 2JAOA 3C3BA 2LZ0A 1TQ6A 4I46A 3DLHA 4UARA 4CLOB 4BNLA 1G5TA 5EJ5A 1R6AA 1GXSB 3O8QB 4PRKA 3AF6A 3NHKA 2NW6A 2QTFA 1GFIA 2ATEA 1T4CA 2P78A 2RH4A 3KZ1E 2ZXFA 4H4CA 3TNDA 5JUWA 1JPJA 4L76A 5K6TA 2PTHA 5J2UF 4DDKA 3FCYA 5F7XA 5FUQA 4WKNA 2HZ7A 1Z7GA 2D7CA 1P6UA 2EW8A 3K73O 1ZJYA 2R66A 2AOXA 4MCAA 3DTVB 4O2BA 1U8XX 4XYGA 3DM5A 1AKTA 3DL4A 4ZT2A 3UVEA 3GQBA 4F56A 3HCDA 4JKYA 3UH0A 1YF3A 5DI3B 2PL3A 3ET4A 3IBFA 5M04A 1CVIA 3F0TA 4L6CA 2GYUA 1T0BA 4KMOA 7YASA 1DKPA 4TWJA 4DQLA 1HNWB 1I01A 2VA9A 4P3OA 5E6SA 3VPFA 1NSTA 2EYQA 2PX6A 1FUKA 3BWMA 1WW2A 2VLBA 3DT6A 1GGJA 3AQ4A 3EXG1 3P2KA 5LA6F 4UATA 2EHJA 1OQAA 2JCYA 3IXQA 3L0DA 1E60A 2AW5A 4RLSA 3LQRA 1TYCA 4V3BA 3N53A 4I1VA 5EUMA 4L3VA 2B5OA 5FUXA 4OVKA 1TKBA 2CNLA 3CZQA 4HP8A 2RGAA 1VIYA 5FTJA 3UO8B 4MWOA 3T0IA 4M37A 4D45A 3A9RA 2PBZA 1KJZA 3NOOA 3QU2A 1O8BA 4QDKA 1L5HA 5IVKA 2AYYA 3DHVA 4QRIA 1JWLA 4V24A 3ZU6A 1DAPA 1NDHA 3M5WA 1NJSA 1NFQA 3O8DA 5TQJA 3H5NA 1J70A 4J76A 3ZCUA 3ESXA 2AG8A 4RVHA 4WNAB 3QU4A 3DWEX 4DWJA 4WZAA 1XK7A 3WIVA 3JQGB 2GS9A 5ESDA 1L4YA 4LHWA 2FZWA 1M1NB 1T9CA 2B8EA 3ZY3A 3H5OA 4H0FA 3WQBA 4ETWA 3QYFA 4NABA 1IWBB 1G63A 1VG1A 1WS6A 3AL2A 2JFBA 3SG0A 5BVGB 3THXB 1NXPA 3OHPA 4J9UE 1O4VA 1LQUA 2QGNA 4LC9A 3BT7A 1S2GA 1F4PA 3JVVA 3Q12A 4KIJA 5J5VA 4CQNA 2ZBEA 3Q98A 4CTJA 1XKTA 1V9LA 2QM7A 3TQQA 2HF8A 2CFRA 7REQA 1I0ZA 4IZ6A 4M88A 6PFKA 3EGWA 1T1SA 5GZ6A 1CUXA 3RC1A 2LKCA 1FJXA 2ZTUA 4OHMA 4MW7A 1A8PA 5KIAA 5LMCA 3N74A 3V1TC 2P7IA 1K68A 2E49A 4GYYA 5JPCA 3W8RA 3WSWA 5KNCD 2X5NA 2O59A 3HYLA 3DOEA 5DGIA 1M34E 8ABPA 3VR4H 4LYAA 3ZWNA 5AVOA 5BN5A 4KDFA 2QW8A 3I9KA 1DKMA 3O47A 3WGQA 1WW3A 5AW7A 2ILTA 3BRWD 3NDRA 4UC0A 2O06A 2RC5A 2F3RA 3QVJA 4E15A 5CDUA 3BIXA 5BWLA 4CNBA 4EY5A 4MJLA 4XUDA 4CFYA 2XXJA 5KNBA 4NY1A 1TLLA 3HBNA 1TM1E 2TMKA 1RVDA 4KC0A 4F92B 4N7MA 5ELXA 1F2DA 1BH6A 1EVJA 2HNKA 3HYRA 1YWGO 1U8AA 2PHZA 3MA0A 3K31A 5KYYA 1GQ2A 4NFHA 2BD0A 4IIJF 2WMOB 1NWHA 4KV9A 4Q66C 2RDMA 3ROFA 1QGZA 5DK6A 4F2GA 1G3IA 1G2PA 1X9HA 3H1BA 1LDBA 4OB7A 3V4VB 4G0OA 2F64A 3E5MA 2PS1A 3Q1KA 3KR0A 1SUSA 3LT0A 1N6OA 4TV9A 1Q6ZA 4LRXA 4X44A 2BH9A 3UK0A 1RZUA 1ISHA 3Q7IA 1YBVA 1SHTX 1T5LA 2EP5A 2IP1A 3U7GA 1FFHA 1YACA 2AOUB 2X1HA 1RJGA 1VECA 2DUWA 3EEBA 3FVRA 3ILHA 3N6VA 4R2LA 1XCMA 4JCCA 3EWAA 4NBUA 5IF9A 1IEVA 2QS9A 3RU9A 5MGNA 2F4VB 1U4OA 2ERCA 3L79A 4F91B 2VDVE 4IM7A 2QRGA 5F12A 3S0JA 1N34B 3HE3A 2X3FA 1Z45A 5EHZA 4KRXA 2X6TA 2QLLA 3DMHA 1OI4A 1XZLA 1AZSC 5DH9A 3RLIA 5ICMA 4MRMB 1U9IA 3OOHA 4E11A 4JR1A 1TKRA 1XXHB 2IHBA 3BEDA 3DXZA 2AEEA 5EE9A 1WLYA 2D8AA 4CN8A 4O29A 4XX0B 1JFFB 2FFRA 3A1UA 3A0UA 1X70A 2C2ZA 4PPYA 3WL5A 13PKA 1CF4A 2OV6A 4JI8B 2QUHA 3PQ8A 3R0VA 4B79A 2Q28A 3NT4A 4Q02A 3NBUA 3F8SA 4NYIQ 4MKRA 1PV1A 5HG0A 3REGA 3R1IA 1Y8AA 2OCPA 3EH2A 3BB3A 3E70C 5JAUA 3ER8A 1IN7A 2Y99A 4GO1A 4TS1A 1HYBA 3G85A 4U6NA 4MB6A 4D44A 2POQX 5CNIA 3ZE0B 1REQA 4WPGA 4UJ5A 1RD4A 1V16A 3VNRA 4OA8A 4EAAA 2FZGA 3R5XA 1TCVA 4KQKA 3ZNPA 2YWEA 2WQ7A 1CB0A 3DBIA 1JJAA 3MGKA 3QVWA 4J8PA 3IV7A 4KPUB 4OJQA 2JAQA 1KZHA 3TM4A 3CVVA 1CYEA 1L7DA 2ZB2A 3SHTA 1EIZA 3AETB 4UNIA 4BFTA 4D4HA 2H17A 3GD5A 3F9IA 3ZHYA 5KQGA 1G8HA 2C8KA 4LG1A 4WNYA 4IX1A 1LVUA 1G66A 1X1CA 1I4EB 2OYSA 3O4IA 3AESA 1A4IA 4EENA 3SBOA 3RQSA 1RQ7A 2PMKA 2ZXEA 1T9HA 2XMPA 1Y6GA 1PVVA 4R98A 3EMBA 1UMCB 3HVKA 1A98A 4E5PA 1PNOA 1RMTA 3HP7A 4LQCA 4XH9B 5DISB 4DCOA 3WDLA 1XF1A 3WKEA 3PLNA 4D6XA 4QJ3A 3T4EA 4LRYA 3RS4A 4KMSA 3NKLA 5BVHA 5C8VA 4O8CA 3K4PA 2XAAA 1JTVA 4PFKA 4QQFA 1A9QA 4ZQHA 4BLTA 2VAPA 2GN9A 5A3RA 1KOGA 4D8VA 3BS4A 4GI3A 5FYDA 4EB6A 1DBVO 5LM3A 1V5IA 4GKAA 2M98A 1JIUA 2A0UA 2IL1A 2J6HA 1MNAA 2Q4EA 2Y1EA 4O4HA 2F1HA 4L8VA 4HGRA 2DVMA 2OM6A 4AQ7A 1PV4A 4F45A 4NK4A 1DJMA 3OKPA 2V7QD 1KEZA 2KI5A 2ZIUB 1OTHA 3F7OA 4XI9A 3HJNA 4Q3DA 4BASA 2O2EA 4P84A 2F62A 1JALA 1YR7A 2PH1A 1TKAA 1M34B 2DHQA 4M8LA 5JO9A 3TKYA 4EHJA 3THSA 2YASA 4U9HS 4J7AA 3UUFA 1HX7A 1BCSA 2CHVA 3GEEA 1GD1O 1UC8A 3D4BA 2XUQA 1KK0A 3T1VA 1FFXA 2C2OA 3KOOA 4KBYA 1RLIA 4BNIA 2YY6A 4WOCA 4DR2B 1SZCA 1A3CA 1F4LA 1I80A 2VZLA 4G65A 3G5UA 1SCJA 1WU8A 4IJVA 4KE9A 3SYLA 2X77A 3MFQA 3PFCA 5EJMA 5IKXA 1TVEA 1FMTA 3ZDFA 4C7XA 2QY6A 2C8LA 4ETIA 3SNHA 1SHKA 1CDDA 5FUBA 1XJ0A 1ZSYA 1RABA 5EWLB 3PEYA 1N5JA 4XX1A 2DUUA 4GZMA 3JD2A 2V58A 4HR7A 2W83A 3EY9A 4NZNA 5JZ9A 2K5UA 5KSOA 3H11A 4HQLA 2QRVA 5EE3A 1RI1A 3K9HA 3PX7A 5DK4A 4UEWA 4LTMA 3DB1A 1I6WA 1LFDB 1A9RA 1V3VA 4RVCA 2YMLA 3MWEB 1Q0LA 4LE1A 2Z56A 2B6NA 4MROA 4V03A 2XE7A 3IMFA 1UBRS 4MRVA 1T26A 1IPHA 3OZDA 2RBGA 2Q5OA 2W2XA 3DP7A 3HGTA 2HWXA 4G8BA 3HP4A 4LZOA 4RVNA 4ZJZA 2VTKA 4LF7B 3WGLA 3RVQA 2DKNA 3P8ZA 3BHNA 1Q19A 3G2NA 1QOQB 3MMNA 5EJEA 2Z9CA 4UM8B 1PZFA 2H8GA 1QLWA 2CVOA 3L46A 3SMQA 2IYLD 2E4XA 5BV8A 3D2CA 1JILA 3U6KA 4HFNA 1VGQA 1Y89A 1QDLB 1SCUA 1FQWA 1EK5A 3K9LA 4G9EA 4OUDB 1TLTA 3HNRA 3AJRA 2J87A 2IUUA 3LFTA 4I6EA 2WIBA 3CZRA 2VSOA 4HC4A 1FK8A 2BEVB 2HV8A 4N5LA 1IG3A 1UM8A 1WBJB 4MHTA 3C2QA 4YRDA 3QVGA 1PWXA 4OHCA 4F4JA 1KEEA 3I4FA 1MT0A 1CR4A 4P0TA 2XADA 3DTNA 3QXHA 2B30A 2PBLA 1IIRA 1BHQ1 3NB0A 4RMNA 3ND8A 4YPFA 3REOA 2Y1DA 4KXYA 3HQ4O 3A4NA 3NAQA 4BNDB 1L7RA 3ABSB 2O8BA 3RNOA 1AKNA 2I0FA 3EMVA 1UPUA 4RD0A 3W78A 2CNOA 1Y5RA 4C3ZA 5FKJA 1K3TA 4KN9S 1D2EA 2OGSA 2R6ZA 2E1RA 3KELA 4BUCA 5HZKA 4ARUA 2JIQA 5ERYA 2VN8A 2CNWD 1Q0QA 2G9RA 4TV8F 4E0BA 1HMYA 3IP3A 4B3DA 3BSSA 2CVPA 4DR1B 1XQ1A 2H1CA 2XRZA 3WYFA 4PYMA 1CHNA 1FPMA 2IYQA 3HGQA 5JANA 4WI1A 1DJPA 3VBCA 4A8HA 4A92A 4BB6A 1JDVA 1ACMA 2HF7A 2ZCVA 2M6SA 3GJ3A 3QUCA 4MR8B 5A4MS 1TUEA 2NO1A 5KNCA 2CSXA 4RE5A 2E5FA 1PD0A 2PM8A 4MVJE 2DKOA 3CEAA 4HDRA 4LX8A 3QV2A 1FSPA 3KYBA 4IICA 4Z49A 5IABA 1Z7BA 2PUGA 4NATA 4YMGA 1U0RA 2XBLA 4Z4GA 2R6CA 1R3DA 3LTEA 4UZFA 3A6EA 1VIDA 1QMGA 2VWQA 3BRWA 4V0MA 4EITA 1PG5A 4PZ9A 3C16C 1Y9JA 2ZJ3A 3QPDA 4QOHA 4BLWA 4PQYA 1Z6TA 2C88A 1ZM3A 3UA3A 5GM1A 4M87A 1XDBA 3KQWA 4MUKA 5THQA 4W5NA 1V1RA 1XRMA 2J9YB 2RARA 4N3CA 4EKYA 5F9HA 4NARA 1C9NA 1USIA 2NQTA 4QATA 3RWMB 3E18A 3THRA 3B9BA 3PC2A 4QG3A 1WXWA 2WVJA 3TMYA 4LBVA 3UB3A 5BR8B 1LBEA 3H5VA 3W4IA 3LRTA 1SHUX 2G3YA 1KC3A 2IHUA