1LB1B

Crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the selective activation of Rho GTPases by Dbl exchange factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Guanine nucleotide exchange factor DBS
total genus 59
structure length 178
sequence length 178
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lb1B00
2A2ZA 1UBEA 5EE9A 4B48A 5IK2A 1VCMA 3PQCA 3I61A 2XOKA 4KITB 1SXJD 3TKLA 2F3RA 4P4SB 2ZRPA 5CM8B 2WAXA 4HLDA 5BN3A 4RZUA 1C1YA 1CR0A 3AGQA 1AQUA 4LYFA 3IIKA 4BFYA 4Z1MA 5SZJA 2RGNA 4UNQA 3MAAC 2J1LA 2QGZA 4MA4A 4GPTA 3EPHA 1KAOA 2FEMA 4K81B 4Q4JB 2FSGA 1ZW6A 2QMOA 3F5FA 1A2KC 2D74A 1VCNA 3CR7A 2NQ2C 3BIFA 4U00A 4WW0A 1X1RA 2EWWA 4Q9LA 3U7GA 3SU8A 1P73A 3ND9A 4EPYA 1R8SA 2NO1A 3NBFA 1QHXA 2QZ4A 2QT0A 4NL4H 5AJWA 5A5GA 1AZTA 3LQRA 2BMFA 4XTCS 4DZZA 3KXKA 5FR1A 1GNQA 1ZRHA 2IYZA 1U9IA 4UJ5A 1NVXQ 5A0FA 1OXXK 2PCLA 4NCNA 4C30A 3GCGA 2O0HA 1R7RA 4MGKR 1E9CA 3ASYA 1J99A 3NHBA 5UKDA 3UMRA 1XPRA 3ZIAA 4IEEA 3ZQJA 1G3IA 1P9RA 3K0FB 1E0SA 4KODA 2DR3A 2JDID 1AZSC 3QF4B 1QVRA 4PC1A 1WQ1R 5JEEA 1NMYA 1G7TA 3VMFA 3QKRB 4FINA 4TQUS 4PSAA 4C0QC 2XNSA 2ZRDA 2IS1A 1NVUQ 1XD9A 2FX3A 4DIEA 1YR9A 4A8JC 2GRJA 2A5DA 1IY0A 4D0GA 3QY0A 1LTQA 5SZIA 4AKIA 3VR5A 1JR3A 1R0XA 5AJVB 2QEQA 3W90A 3DMNA 5DO9A 1RYHA 1Z0IA 2HCBA 4L9SA 3FKQA 1OLOA 1SVMA 1S3SA 2BBWA 4HI0E 4O25A 3SYNA 2IXGA 4TL8A 4EPVA 4Z54A 3MJHA 1DO0A 4A92A 3RHFA 4YXWD 4JZKA 5KSZA 1OW3B 1Z2CA 5B64A 2QTFA 3AP2A 4NMMA 4TMKA 3OIWA 1OSNA 1Z0KA 4PR0A 1W36C 2FGKA 5CDFE 1G8PA 2J0UA 4LC1A 1Z29A 5F9FA 3C16C 1SVLA 4ZDJA 3ZVLA 1UPTA 2D2FA 3DVLA 2ODBA 3LX8A 2ZU6A 3Q3JB 4G5OA 421PA 4W5WA 4MGYR 5G41A 3NG1A 1R0ZA 4OYHA 2YWEA 3BERA 4NTZA 2KSQA 1HE1C 1RFLA 2CK3A 1YU9A 2IA5A 4AKEA 2VP5A 1E4YA 1ZD9A 5JSZB 2WOJA 1FX0B 4TL6A 3KB1A 3TVDA 4S2EA 3BH6A 5L3SA 4XVQA 5FOVA 1DO2A 1JQLB 3WRYC 4DLSA 4PC2A 3K0CC 4US1R 4DLWA 5JEDA 2XXAA 2JEOA 1IM2A 1G18A 5FI1B 4HLCA 4NDZA 5JLJA 2QAGA 1SGWA 3K8YA 3PITA 5EXXA 1G5RA 1E9SA 4BLPA 5J4VA 1ZM9A 4LV8B 2W6ID 3T35A 4AWXA 3OAAA 3Q8XB 3B2EA 4KXFB 2VPPA 3G82C 1ZVQA 4C3ZA 1HH4A 2CCKA 4URUR 3UPUA 1R6BX 2O5VA 4HAZA 5J4YA 4URVR 3I92A 5JHGB 1Q22A 2VHUA 4OI0A 4HB0A 3THXA 4KBFA 3U3OA 1Q3HA 1KI6A 3RANA 2GK6A 3LBHA 4PAMA 2XTMA 1KDPA 3IPXA 3GJ7A 2QROA 2FH5B 3GLHB 5HPYB 1U99A 3MSXA 3CUEF 2NZ8A 5G53C 1SXJC 4JBWA 2EFHB 4HDOB 1KI6B 1V43A 1AGPA 3X1WA 3CONA 4C0AC 2MSCB 1TQ6A 1Z0AA 3RWMB 4CEIB 1FUUA 3GEIA 2UZIR 5C46F 4F91B 2J0VA 1HURA 2WKQA 1S1MA 4DEXA 1N0VC 1W36D 1ANKA 4A6XA 3H4MA 4F92B 3U3JA 2C98A 1P62B 2F1HA 4NCHA 2DY1A 3NBZC 4P4TA 4BGDA 4W7SA 1BKDR 1NNEA 3RRMA 1W7AA 3A1TA 4PC7A 1EFCA 1G3RA 2RGGA 3V4FA 1SVOA 5GJWC 2IL1A 3KTAB 4TTRA 4N0EA 4XJXA 1YJ5A 4PQYA 1AM4D 3RS0A 1J90A 2ZS8A 2VF8A 2FGJA 3SE0A 2J7PA 1Z6GA 4U5XA 3EZ6A 4Q7JB 1VCOA 4G1UC 2RMKA 1FFHA 5FUXA 5TDHA 2ZPTX 2PT7A 1EESA 5HCIA 1VG8A 1XMJA 3L0OA 4DDWA 2R44A 1KJYA 4D4JA 2AHOA 2AWNA 4GBMA 1K8RA 2VHQA 3B1XA 2IYSA 2FJUA 3GEHA 1XTSA 5AJYA 5AUOB 1W4BA 4CEJA 2FFHA 3DO6A 3SZRA 1IOZA 5DI9A 1XD2A 4MKFA 4JIMA 3P26A 3LD9A 3IEVA 3TH5A 5JZVA 4Z8YA 2JAQA 1FMLA 3OFND 4KYIB 1Z6XA 2W6JA 4LBYA 2R65A 1XX6A 1A2BA 4V03A 1NKSA 4D4KA 3EZ7A 4OBEA 4RD1A 2IEYA 1CF4A 4ZIRB 4P4UA 3K9NA 3T12A 2PLRA 2RKOA 2BBSA 2VP4A 2K5UA 4NONA 2UKDA 1G41A 5EXTA 1CXZA 1E9BA 2Q3HA 1ZNZA 5FTMA 1E2IA 3AF0A 3P1JA 3Q7QA 2OV2A 4YDSA 1ZCAA 3I72A 5AUPB 1S1CA 3OAAD 4HAXA 3RLFA 2QPOA 3EA5A 3SBEA 2GA8A 4GDFA 2H57A 2WTUA 1OXSC 1KSGA 3TNFA 1E2LA 4M1OA 3TE6A 3ZQ6A 1A5TA 2ODNA 4TLEA 3SDZA 1JI0A 2REOA 3BORA 1A82A 4L16A 2V6IA 4G5QA 4TLDA 4LHXA 5CDFA 2GZHA 3RSOA 2F55A 3O47A 2IYVA 2CBZA 2JCSA 1VG9B 2WPDA 2XJ4A 4LUCA 3E5HA 1US8A 3W5IA 1XJ0A 2ZSAA 4XOIA 5DHAA 3OIYA 2DCUA 4EJSA 3EPJA 4KI0A 3C15C 4FN5A 1E2FA 5IF9A 3KZ1E 1EG7A 2VRWA 2CL0X 3TUZC 3R8CA 5DISB 4B44A 3L8YA 3LBIA 1XU4A 4TMZA 3WNDA 2GTPA 5G3YA 1YE8A 2RGEA 4GI7A 4QGGA 4CEHA 1EWQA 3ETLA 1X8JA 5C1BA 4A15A 1VIAA 2OM2A 3PUVA 4OQNA 2RGDA 3K09C 3KB2A 3IIMA 4FCTA 4B34A 4IOJA 2ZYVX 5FOTA 2ZVQX 3CR8A 3KX2A 2WSMA 1PVOA 3VU9A 5LD2B 4F4JA 5JBQA 3L8ZA 4DT1B 1NVVQ 3FE2A 3MD0A 5FTJA 5JWOA 1B23P 2KB0A 1II8B 4QRHA 1XD8A 1KSFX 4M1WA 4BUJA 1EGAA 3U6BA 2GCOA 1NVWQ 3CO5A 4D4MA 4JKYA 4D80A 4TT3A 2HXYA 2ONKA 1GTVA 3C7KA 2ZETA 1SKQA 4Q48A 4IFEA 3U60B 3L43A 3ECCA 4OQLA 3CNOA 4UNRA 3VKWA 4OHYA 1G4UR 1KK2A 1TL7C 3KKPA 3FB4A 4QBHA 1NY6A 3RVBA 3HWSA 2XITA 1CJTC 5JJIA 2VTKA 3ONWA 2FF7A 2FPMA 2GCPA 3FFBA 4WXRA 4MRVA 4C7OB 4JLPA 1YR7A 1VHTA 4L9WA 2GVZC 4LYAA 1D8TA 221PA 2CVFA 1NN3A 3O8CA 4L4UA 3AM1A 5EQTA 3X1DA 3GD7A 2F43A 4ZCMA 4HAWA 3I4LA 4BECA 3CX7A 4CYMA 5EZ6B 1XEWY 4LOAA 4UXJA 3ZVMA 2FPKA 1P6XA 1DAEA 3SN6A 3WRXC 4A2WA 3W6PA 3W8NA 4B6FA 2YC2C 4BQSA 5LB4A 5LDDC 1RVDA 4GMDA 4LJAA 1E79A 1I4DD 2JIZD 4PO1A 4DWJA 5B30A 1DOAA 3AKEA 3UMSA 5KO2A 4F93B 1BS1A 1NJFA 2B8TA 2LKDA 1PJRA 5TV2A 1LFDB 5EP4A 1NN5A 2GHIA 3TW4A 2QI9C 3I73A 3PR1A 4OI2A 3DDCA 1X3SA 5HE9A 2QBYA 3GLHE 5CYPA 1ZM3A 4FXPA 1JPJA 1U98A 4OJQA 2FZLA 3CX6A 4NYIR 4GRAA 4JLMA 1MR3F 2G88A 3GJ8A 2D06A 4IFBA 3U2QA 2GNOA 2G77B 3BH7A 3AVUA 5GVRA 4JLKA 4YXWA 1R5NA 3GFOA 1AKYA 3UG6A 3ZJYA 5BN4A 4Q4HA 1GKUB 2XNDD 2PZFA 2BMJA 2W6IA 4X8MA 3WMFA 4BZXA 2VBCA 4PTLA 1OKKD 3AVWA 5DYIA 4KBGA 3W6OA 1Q3TA 5L3SB 1FZQA 3IKJA 1E9RA 4M21A 2JLZA 2FA9A 4JBYA 4TSFD 3R9XA 5HKKD 1G9XA 4V0ME 5C4GB 4WZBE 4LV6A 4BFTA 1FTSA 2GAAA 3VX3A 5G40A 2Q6TA 1N6HA 1G3MA 5HR5A 3QJYA 3X1ZA 2O8BB 3HDTA 4PPGA 3TQFA 3ND8A 2KBFA 3DM5A 5GJCA 4GP6A 1G1MA 1G8YA 2KI5A 4Q1CA 2OSBA 4PPFA 3KJEA 5KHOC 3GLFA 2CE7A 4ARZA 2GAOA 3QSYA 4TYPA 4NYMR 4PO8A 1QF9A 3CPJB 2OT3B 3VR1A 1IN8A 1P2TA 1JR3E 5CITA 1J8MF 2W0SA 5FTNA 3RC3A 2F9LA 4POAA 4D2IA 2Y8EA 4TYWA 3GLFE 2YYZA 4G0NA 2GETA 2KBEA 4V0KA 4E22A 3AVYA 2W2XA 3THWB 1X8KA 3TUIC 2NO6A 1EFTA 4DKXA 4TYNA 2QBYB 1NLFA 1HA3A 1U0JA 4TZ0A 4JLVA 3ZLJA 3IIJA 4BLTA 3CPEA 3CNLA 3FWYA 3OHMA 1W2GA 2F3TA 1GZSA 1GDDA 3FHCB 1BIFA 2HF8A 4HLUA 2RHMA 5C2JB 4QNMA 4XVRA 1E69A 3NWJA 5EXSA 3A1SA 2ZTSA 3VR6A 3MG9A 5CJ2A 1N5IA 4P31A 3AKCA 1LF0A 2X19A 5TARA 2QL6A 4Q9KA 2J0QA 3TSZA 2GJ9A 1KK3A 1OIVA 2IHBA 2WIAA 1CJKC 1HY3A 5IK2D 2AN9A 1W5SA 1R5BA 1S8FA 5FBVB 3FHOA 4E09A 4LBVA 2O8BA 5BW8A 2Z6VA 3A1WA 3BC1A 4RZ3A 4E03A 2ZI6A 4N0DA 1TADA 4D81A 2W6JD 1U9IC 3OEHA 3A1VA 1RJ9A 3TSOA 4C7OA 4JSTA 3LWNA 4TLAA 3UATA 3EG5A 2C95A 3PG5A 3CH5A 3QKTA 4XD7A 3WP1B 2QTVB 4ESVA 1Q44A 4Q9HA 1DAGA 3MWKA 2LCFA 3RS3A 2PEZA 1KZGB 2WWGA 1KDTA 1G7CA 4MUAA 5TY0A 2OAP1 3TBKA 3GFPA 2QP3A 4TTQA 2P6UA 3SEAA 3VR3A 3NIBA 1IXSB 5E7IA 1ESNA 2VL7A 3UKDA 5JJLA 1F60A 3KQNA 4AC9A 1G21E 2RGXA 4IW3B 2H17A 5IDVA 3DL0A 1UDXA 4AY2A 4OI4A 5E95A 3ZIAD 1UKYA 2ZE7A 2ODEA 4JLBA 1G6HA 1QVAA 2P67A 4FCWA 4BLSA 2CJWA 3QXHA 5M04A 2NOAA 1M7BA 2ASEA 3K9HA 5AUQA 2XZOA 1U8AA 3BWDD 1IN5A 1LW7A 2B92A 4NE2A 3QVVA 1U90A 5JWRA 2AXNA 1KSHA 3BH0A 3H0KA 2C9OA 4PSKA 1E2DA 4N1AA 3TIFA 4WBSA 2IYQA 2EYQA 2CJWB 4PQRA 1KO8A 3CF6R 3SFZA 2CLSA 3AUXA 4LPSA 2YOGA 1GILA 2HF9A 2IK8A 4K46A 2ZI7A 1TQ4A 4AYWA 2ZJZA 2C5LA 1Z47A 1KO1A 2VF7A 4ZKEA 1MO6A 1OT3A 1P4SA 3U6KA 1MRNA 1NJGA 4MKHA 4MYTA 3IDQA 5FBQB 3IUYA 5CIWA 3GLGA 2XAUA 2ZIAA 1VG1A 2B21A 3G5UA 4PZZA 2NTYC 2ZRIA 1T5IA 4WA7A 1NIJA 1NSFA 4G01B 4LC0A 5J4KA 1XEXB 4ZKDA 4IOMA 3RC8A 2DFTA 2PZEA 4BWYA 4DSTA 2GBLC 5CK5A 4MRPA 1GRQA 1R2QA 4HLQB 2V6JA 1FQJA 5KNDA 3HYRA 4Q66C 1OB2A 4US2R 2HUPA 5FOXA 1OFIA 1NN1A 1PV4A 4KCGA 4CEJB 2GEVA 5KNBA 2NO0A 4ARZB 1LNZA 1T8TA 1KSJA 3N2EA 4D25A 2ZVPX 2RAPA 1G16A 3AKDA 4RCYA 3DOEA 1S9DA 1G3UA 1NMZA 2XX3A 4QGFA 1FP7A 5D3QA 2GJAA 3AF4A 5CLQA 1E1QA 2YC4C 2QMEA 2JDIA 4OKSA 4LX0A 4B3XA 2O0JA 2DWPA 3QEOA 3UXMA 4AURA 1HV8A 2PX0A 1KI3A 2ZI5A 4BFXA 5B58C 1H65A 2CNWD 1CEEA 1G291 3VNUA 1WB9A 1KTVA 3L0IB 2XOKD 3ADDA 2OBNA 1ZIOA 4AYXA 1EFHA 2V9PA 2AX4A 1C4OA 2IYTA 1P5ZB 1ESMA 3GJ5A 3WY9A 4A8JB 4BPBA 5KPDA 5FPHA 1R8QA 1KAGA 3T5DA 3AP3A 3QXXA 3MWJA 3VQTA 4TZ6A 5GVSA 2QM7A 4M8NE 2B7BA 4KAXA 3KQLA 1VYTA 2ZSEA 1DAKA 1J8YF 1CP2A 521PA 1QHSA 3KJGA 4QHTA 3SQXA 3QPUA 1JR6A 1JAIA 1RE0A 4KYUA 4LJ9A 5FPSA 4DSNA 1OKKA 4CEHB 3NDBB 1G7RA 2ZSBA 2V1XA 1UEIA 5KDOA 4MYUA 3LH5A 1N6NA 1KMHA 4XWKA 1WRBA 2FDCA 1E1RA 3NBXX 4C0KA 2B8WA 1IJFA 2WSSA 2N42A 2ODWA 3H2YA 4QFMA 2OILA 2V7QD 1X6VA 4DC9A 1DADA 5FOUA 3GJ6A 3E2IA 5IT5A 2QG6A 3QBVA 1AQYA 4JVMA 5JECA 5CB8A 2H7VA 2VHTA 4LHWA 2ORWA 1P2SA 2F7SA 1WF3A 2ANBA 2IWHA 4EDHA 3PEWA 2R6GA 4WVFA 4LHYA 3H84A 1G17A 3OE7D 1RZ3A 3CZPA 4NCKA 5JHHB 1CTQA 1YR8A 3LW7A 2ZROA 1XWIA 3LX5A 2E9SA 3LRPA 2P5TB 1U0LA 1UKEA 2C96A 2FOLA 3EWAA 3KKQA 4HB2A 4PANA 5JCZA 1Z63A 3C14C 1PLLA 2EFGA 1NI3A 5KYKA 2GBLA 5J4LA 1ZUNB 4KFRA 1A4RA 1XMVA 2VSXA 1Z83A 1G4AE 4RZXA 3EC2A 4EFLA 4ZIRA 1P61B 1EFRA 5KSYA 4MGIR 1E2NA 4NZYA 1RRGA 2LKCA 2CVHA 2RGBA 1XMSA 3K1JA 4FWTA 2ZRLA 2PCJA 2A30A 2WV9A 4F7WA 4N3NA 5H68A 3AGPA 1E2JA 4JJZA 3CPHA 5EE5B 1ZM2A 2IS4A 5TMPA 1G20E 3MMPA 1E9FA 4ACAA 3EW9A 4PPQA 4FMDF 2BBTA 5EJEA 1W36B 1MV5A 3OIUA 1N0WA 2QT1A 4KLZA 5FH9A 5LB2A 1KI1A 4R71A 5KNCA 1KMHB 1UKZA 3GLGB 3PENA 4HYYA 1GWNA 4XWAA 5AWFC 3EPLA 1KYIA 1SXJB 2WICA 3AF2A 1FNNA 3GMTA 4RVCA 5AUNB 2ZANA 3OIVA 3RSLA 1RRFA 3VR4A 2QRNA 2ZITA 3PCRB 2O8EA 4HUQA 2BEJA 4Q4AB 4HSEA 4RSGA 5HCNA 5JRZA 1MRSA 5B2ZA 2BEKA 2N1BA 4M22A 5JFGA 2RCNA 4S35A 2GF9A 2ZRBA 2ORVA 2H16A 1HQYE 3U44B 2ZJBA 2JJ2D 4CZ2A 5B57C 2WWYA 5DHFA 4KSBA 4OQXA 3OF5A 3THWA 3LXXA 5FR2A 2IYLD 4KVGA 2BHRA 4YMUA 4YONB 1JECA 2FE4A 5A4JA 2A5FA 2BM1A 3DHWC 4LRWA 4O3MA 1XD2B 3QPVA 4O2LA 3UANA 2Z4RA 2CK3D 1OXVA 3ZZUA 5JI3E 5JJKA 2WMNB 1MT0A 2BCGY 4DDTA 1GSIA 4ZDIA 1Z6YA 2QAJA 3A4LA 3K53A 3L2OB 3QUSA 2JJ8A 4LK2A 2BJWA 4URYR 3T1VA 3QXCA 4B2IA 3GLFB 2ERXA 3LQQA 1UBFA 4V0NA 2PL3A 2OFWA 4FCVA 4ASUA 1LF5A 3BFVA 4WZ6A 5BYKA 2GVDC 1XEWX 4H9GA 2NO9A 1EX6A 3GJ3A 3KFVA 3ICQB 1ELOA 1PUJA 3DOFA 3KUDA 1AIPA 1U8YA 2R9VA 1D9XA 2ZRKA 4AIIA 1BMFA 3BB1A 3IGFA 1XF9A 4EPTA 1E9EA 1EFRD 1PLJA 3VKHA 2HJVA 1W47A 1RJ9B 2D4HA 3N2IA 5E4FA 2QQ0A 1M74A 3AH8A 4JLOA 3IQWA 2DB3A 4PPNA 4ERNA 1JAHA 3NKVA 4L8GA 4Q4HB 2OXRA 4MUBA 3T61A 1E9AA 3HR7A 4Q4AA 3VFDA 4KVAA 2IBMA 3AV0B 4HUQB 4QL3A 4B73A 5JRJA 2XZPA 3W3AA 4DCSA 2WIBA 2J3EA 1WXQA 1YZUA 2ZJ2A 3FYHA 3NH9A 3GEEA 3SS8A 1FQKA 4QGAA 3SI7A 2VYFA 4Q1AA 3WYGA 4JT2A 1IY1A 1F2UA 1XTRA 1MO4A 4OHZA 4URXR 3KQUA 2G6BA 1OFHA 1AK2A 4FD2A 3MUFA 4DHEA 1T3LA 4B2LA 1A1VA 4V0OA 5DI3B 4AKHA 1D9ZA 4BASA 2HJGA 4JVSB 3FMFA 3VR2A 1KY2A 4TMTA 2AWOA 5K8IA 2PX3A 1FOEB 1I4TD 4TT3D 2XSZD 4B75A 1AGRA 4C0HA 3PEVA 2WPDD 4A36A 1IAQA 1YVDA 3OESA 4QJ4A 2ORIA 4M2LA 2HV8A 4TYYA 3V9PA 5FI0B 1BOFA 1I4LD 2J46A 5EE3A 2QQEA 4KO8A 3IBGA 1XNJA 5CK4A 3QNUA 1P72A 3QE0A 1D5CA 4RD4A 1UKVY 2GJSA 4BLRA 4Q7LA 1YZKA 1OFTA 1T3SA 2R6AA 4QM7A 2JLWA 3B1YA 2BIFA 3A1UA 3AQ4A 3CRMA 2HT6A 3VHLB 5LBIA 3I1FA 4M1YA 1N6PA 3SOPA 4EKDA 4MH0R 1NG1A 1R4AA 2ZREA 2R62A 4CGZA 4B3GA 1GL6A 3FKSA 2ZSDA 4M4SA 1E99A 1TF2A 2ZR9A 1T8UA 3EC1A 2R8RA 2D3WA 2W2VA 5FBLB 3D31A 1U81A 3PUXA 2Q0HA 3M0EA 4QJ3A 1N6IA 2A5YB 2V8OA 4JS0A 4DT1A 5IHPA 3VU9B 4E07A 3PFIA 4C9BA 4XIGS 5E3HA 3PJRA 4EQ6A 2F1IA 4A9AA 2CL7X 5KTYA 4Q4JA 4BLOA 2FSFA 2IS2A 2EFDB 2Z4SA 1KO7A 1KI8A 2QSYA 2VP0A 3QBTA 3EIHA 4I1SA 4F4IA 4IOLA 2XZLA 2FFAA 1JEEA 4DLTA 1LB1B 1ZIPA 2ZYWX 3B5JA 2GKSA 5BN5A 3TK1A 1NG9A 3R7WB 2OBMA 1HE8B 2NPFA 1NIPA 2ATVA 1TPZA 2G83A 2G3YA 4I1VA 2NMVA 1R0WA 1LV7A 2JJ2A 1VTKA 2P5SA 4RJLA 3RRZA 4B32A 4PZYA 1XBTA 2PZGA 4YMWA 1OXTA 3LAWA 4UNNA 2PH1A 4B3FX 3QI2A 4JL5A 3QKRA 2ECKA 2FNAA 2GXUA 3I32A 5AR1A 1OHHD 2WBLC 2ZJ8A 1P75A 1RW4A 2QA5A 1T3HA 1GFIA 2ZR0A 4KFTA 1XTQA 1CRQA 3CRW1 2GZAA 3HR8A 4EAQA 5FL7A 4DXAA 2VEDA 3BB4A 3OEHD 3QKUA 1RC8A 4OQMA 4R9UC 3TR5A 2BKEA 3BFXA 4D6PA 2WJVA 1XXHA 2OO7A 2WJGA 5L3QA 1Q1EA 1Z3IX 1XPUA 3EWSA 1Z07A 4KJZA 1D2EA 3O8BA 4TQ9A 5CJPA 3R9IA 3SC3A 1JJVA 1OFUX 1BMFD 3VKGA 3AVVA 3K0SA 4LWZA 4RD3A 2F9MA 4W9MC 2ZI4A 1QHHA 2D7CA 3FPAA 3OEEA 3AB3A 3CWZA 1HYQA 1XTJA 5HE8A 5SZHB 4HZUA 1G5PA 2CE2X 5IRCD 3T34A 4FWIB 4PHHA 1KK0A 3P20A 4G3XA 4BRUA 5KSOA 1LY1A 3GLIB 1ZU4A 1SVIA 2B6HA 4M1MA 5CB6A 1II9A 2YWFA 1S2MA 1KZ7B 4EFMA 5J40A 2G1KA 3S1AA 3T1OA 1VCIA 3MGCA 3CF2A 3I3SR 4X8OA 1G19A 5F98A 4JYCA 2VA8A 3W6NA 3FOZA 5EE0A 5F3WB 3BK7A 2O8EB 2F1RA 3R20A 3R9WA 1KIMA 4LV5B 1QZXA 3U4QA 2QAGC 4JVNA 2GDJA 4CW7A 3J81k 1Z22A 3T1TA 2C78A 1PUIA 4FMCF 3GP8A 3SHFA 4HDQB 4CIDA 4OHWA 2G9NA 3MRSA 2CL6X 1II0A 3K0CA 4Y0VA 2GEDA 3TQCA 1UBGA 1G8FA 2CCGA 3AF1A 4P33A 3D6TB 2AFIE 4QNRA 5EXPA 1NBMD 2ZRAA 4LJYA 5HZKA 2H18A 1ZINA 1KK1A 4M1KA 4ZV4A 1YZTA 1UM8A 2ZRNA 4XD7D 2QM8A 4I99A 4MRSA 3EIEA 4H1VA 1G3QA 4M9XA 3Q9LA 2P0EA 4CF7A 4MITA 2Z43A 1JNYA 4D0LB 3B1WA 4MDEA 1T5LA 2PJZA 2VH5R 4GL2A 4AG6A 1VYVA 2AXPA 2HDNB 1KJWA 3GJ0A 3BBPA 4AKGA 4KU4A 1OE0A 4IKEA 1NN0A 1COWD 1QHHB 2WZQA 2FSHA 4B35A 2RB4A 1L2TA 4EIWA 3B9QA 3C5HA 1S0UA 4IJMA 4TTPA 2CLCX 2YV5A 4UQOA 1ETUA 4TL9A 2REBA 3GLGE 2C2HA 1EXMA 1GL7A 2NO7A 3I8XA 3MLEA 4B3CA 4UJ3A 3EAQA 4RCZA 1ZCBA 2VP6A 2REXB 2I4IA 2XEXA 4KHZA 2WWIA 1SZPA 3A8TA 3KL4A 5EP2A 1KDOA 2X77A 1T91A 4IDOA 3RS7A 4RD0A 2GJKA 1DAIA 4R7ZA 2GJ8A 2BKUA 4NU0A 2Q9CA 2Q9BA 4C2TA 4QXAA 3RS4A 4DB2A 5EP1A 2IS6A 4Q1DA 4MRRA 3TJZA 3E70C 2V55B 3ICEA 2H92A 3WBJA 5SZKB 2IUUA 4XTRA 1OH5A 2WOOA 3X1YA 1CULC 3U7FB 3GPLA 3A6PC 5KDDA 5KSPA 4Z1MD 1KO4A 3PUZA 1F5NA 1LS6A 1UEJA 2EW1A 1GKYA 4NPHA 5BWMA 2F6RA 4DLZA 1ZUHA 1DVRA 3E1SA 1DAMA 3FFAA 4B33A 1SULA 3NTUA 2UZ3A 2NG1A 3HU3A 1LS1A 2E87A 3CW2A 1SQ5A 5TVKA 4LCBA 4DLXA 3I8SA 2WSSD 3PVSA 2V4ZA 3REFA 4CEIA 4NCIA 1Y3AA 4A2QA 3FMIA 4A82A 3QEJA 1D6JA 2W58A 4PX9A 4XH9B 4DEYA 3HPRA 3WYFA 5HKKA 2P6NA 1JXMA 3IQXA 4B43A 3A4NA 2X2FA 2J87A 1TF7A 3SJBA 4Q1EA 2IX3A 2J41A 4AYTA 3KDSE 3M1IA 1E94E 1HT1E 621PA 4R2IA 3TSWA 2GK7A 4TMWA 5DN6D 5K8LA 2GXQA 3B9PA 1OYWA 5LPNA 4URZR 1CBUA 3NDPA 2JLXA 1FX0A 1Z0JA 1G7SA 3Q7PA 4GOKA 1KI7A 4NYJQ 3WXMA 4C2UA 3Q5DA 3B13B 3ZDQA 3AVXA 2ZE8A 1YHNA 4AG5A 2AFHE 2P65A 3T5GA 3LVRE 1TQ2A 4GNKA 5FUYA 2QSZA 4JVLA 1L4UA 2I1QA 3LLUA 3ZH9B 4RFSB 3NHAA 2PBRA 1ZNYA 4OHVA 1HEIA 4C0LA 4IVQA 4DDVA 1S4QA 3U7HB 4NCJA 2C03A 3CH4B 2J0SA 1XEXA 2JATA 3RRNA 2ERYA 2IYRA 2W83A 4Q7KA 4D4LA 1KNQA 1E2QA 3VX4A 3QQ5A 4RKEA 4US0R 2IF0A 4DLUA 2DFNA 2GF0A 4L5BA 3IBYA 1F6BA 2HT1A 2QY9A 4O0MA 1ZU5A 4DB4A 2HCJB 2KWIA 5E7MA 2FSIA 5KOYA 1P60A 3IO3A 3I62A 1TMKA 5C18A 2OE2A 2RGCA 1MH1A 1C9KA 5DLQC 5DE3A 1CIPA 2TMKA 5FTLA 2JGNA 4JL8A 4DSOA 1DTSA 4TL7A 1QDEA 1TX4B 3A36A 4IVRA 2EYUA 4TQAA 1Q1BA 1G8HA 4CRWB 4ZCIA 3BE4A 1QG4A 2I3BA 2ZRJA 2CCJA 4GOJA 5DNYB 1RIFA 3CRQA 1DAFA 1S9HA 4HB3A 4GOXA 1N0UA 5FBRB 3ZZTA 2AD1A 4G5SA 3WP0A 4V02A 2FG5A 3KUCA 3FVQA 5KPJA 1QHYA 1ZJ6A 2W0MA 1N6OA 3W5JA 1NBMA 4M0LA 2CDNA 2XJ9A 4TLCA 3LFUA 1IXRC 2OEPA 2ZRGA 5FOSA 3PXGA 4BZQA 5JMTA 4P32A 2F43B 2FU5C 2ZI9A 1AKEA 2J45A 4YQFA 2J9RA 3OEED 1ZYUA 5DSZA 5TXGA 1VECA 3LA6A 1H8HD 3F3YA 4U7DA 1SHZA 1OH6A 1CJUC 3K0AA 1W48A 1Z6AA 2QE7A 2JA1A 4FMBB 2OLJA 3EIQA 4NKRA 4C0BA 3GQBA 1BYIA 2JASA 3DZ8A 4BFSA 3THYB 2ZAMA 1N5KA 4CVNA 4ZDWA 3HYTA 2XXAB 2ZQ5A 1SXJE 3V4RA 5K8UA 5FBWB 4HAVA 1W0JD 3A58B 3O8DA 2GEUA 4RD2A 5EP3A 2WJHA 2EFEB 2WJIA 1CJVC 2IXFA 3K0EA 4TLBA 4UXHA 4NYMQ 3X2SA 2ONJA 5KUTA 1H8EA 1GRNA 3FMPB 1XB2A 1OYYA 4ON9A 1DPFA 4EUNA 2ZYUX 2YVUA 4OHXA 3TMKA 3RS2A 1X1SA 2J0UB 4CDGA 1UF9A 2ZS7A 1P9NA 4LYHA 1XP8A 3B1VA 1W4CA 3KFXA 4Z8XA 2IC5A 1KI9A 1DELA 2ZYTX 4Z51A 1MKYA 3ZS9A 1N2CE 1W46A 3FMOB 1ZC4A 1M7GA 1AS2A 1GL9B 1ZMXA 2QRZA 4RZ2A 1O3YA 3K09A 4PQFA 1CJMA 2D7DA 4W5JA 1XTIA 2B7CA 2VSOA 1NVVR 1GM5A 1KI4A 2OCYC 3AVQA 4LHZA 4DJTA 3ZGXA 1NLYA 1GG2A 3T1QA 4M9QA 4AI6A 1IY2A 1DE0A 3QG1A 4IDQA 4DCVA 1TEXA 3JVVA 1VKJA 1COWA 2BV3A 3TAUA 1DAHA 2BWJA 3B6EA 3SFVA 4GFDA 2GWHA 4BEJA 2MSDB 4PC3A 4ZDKA 1WBDA 3K0AB 2WWFA 4RD6A 1U2RA 1XMIA 2JLRA 3K0FA 3KQHA 3ZD7A 1FTNA 3B78A 4YMVA 1B0UA 3K9GA 4X8LA 2XSZA 2KJQA 4EJSC 2ZRCA 1N3BA 1RRCA 1E2GA 4PFSA 1NSTA 5L3QB 1E79D 4QBIA 3R8FA 1OXUA 4JLNA 4LZZA 4P3YA 3SBDA 4QJ5A 1ZUIA 5FUWA 4ABYA 2GXSA 4X8HA 4LBZA 2ZJ5A 4Q01A 3UWOA 2SHKA 5FL3A 3TR0A 3MWYW 3DPUA 1EK0A 2O8CB 1RYFA 4KV9A 3AVOA 5HTKA 2MMGA 1H8HA 3QIAA 1NP6A 3X1XA 3RAPR 3KXIA 4Q7MB 1OJLA 2JLVA 3MWLA 1N5JA 2QMHA 4WXPA 1IQPA 2DHRA 2FFQA 3TVTA 4IRUB 2VHJA 2WJJA 3EX7C 3MJRA 2OLKA 5D3MA 1Q1QA 4HAUA 2WWWA 1W5TA 3DMDA 4IDPA 1RPZA 3RDPA 1I2MA 4D82A 2R2AA 1QHIA 1KI2A 1N6KA 1VIYA 3I5YA 3KXLA 1YZQA 1XJQA 4TSFA 1IONA 3NXSA 3CRRA 2DWQA 1IHUA 4JJKA 3WNCA 2Q21A 5JSZA 4Q19A 3BD9A 3W3ZB 3B85A 1K5GA 2A9KA 3EZFA 1AS3A 4M1TA 4UNPA 1ZNXA 2NGRA 3N5CA 1OB5A 1KOFA 2OESA 3UK6A 2YKGA 1YKSA 3SJCA 1E2HA 1XXHE 2P2LA 2HEIA 3CLVA 4JLJA 1EWRA 4J0QA 2WVJA 2YJTD 4JBXA 3RWOA 3U3KA 1NLZA 1IN6A 1EX7A 4NYIQ 1NKTA 1XCGB 3N70A 1NMXA 5DN6A 5FOWA 3AP1A 2XB4A 3VTKA 4DSUA 4DCTA 1T0JB 3AKYA 3KKNA 4Q1BA 3M6AA 5CM9C 1JQJC 1KGDA 2ZI3A 2AR7A 4II7A 4B6EA 1CR2A 1K6MA 2MMCA 3THOA 1KNXA 1OPXA 1ZBDA 1OHHA 2QORA 2ZUCA 3C5CA 5JWHA 6Q21A 4LJ5A 1L4YA 1J70A 1W4AA 3A4MA 2C04A 2QU8A 4IVPA 3BOSA 3EA0A 4BRWA 1X86B 5LD2C 3HJNA 3UMFA 5BYJA 4DVGA 3TRFA 3OFNA 1XCPA 1T9HA 3O8RA 5DH9A 4ILEA 1F48A 3SR0A 2CXXA 4OL0A 2GXAA 1AJEA 1KKLA 2FV8A 2C99A 2ZJYA 3EPKA 1JBKA 1TU3A 3QF4A 3LO5A 3ZS8A 1VHLA 2VIIA 4R98A 1TU4A 2BMDA 2FPLA 2ZE5A 4QC2A 4IDHA 3SNHA 3LDAA 3ZD6A 3S1AB 5GJVC 1XPOA 2IEZA 1JR3D 1YR6A 4F4CA 4LJ4A 4GT1A 1W1WA 4MGZR 1WA5A 1FMJA 3PUWA 2IYUA 2QP9X 1W0KD 4DBLC 1PZNA 3F0TA 1GOTA 2JLUA 1Z8FA 2Q3FA 2LWIA 3BB3A 4Q1FA 4Q02A 4B76A 4DUGA 1IXZA 3QKSA 1KDRA 4WOPA 3F8TA 2VO1A 1M6NA 4IHQA 4GMXA 5BQ5A 2RH5A 4TWZA 3L0SA 4LGMA 5K8TA 1OH8A 4LSGA 4QHSA 2IW3A 2ZJAA 1ZAKA 4A0HA 1XXHB 3IHWA 1NF3A 2WMOB 4LJ8A 3THXB 3FKSD 3U7EB 3QOFA 1FL9A 2E1RA 1GITA 4A0GA 5TB5A 1TF5A 1CR4A 1M1YE 4YMTA 2D2EA 2WM9B 1N5LA 4PSVA 2HLDD 2BBOA 4IXMA 5GADl 4ZI3A 3TLXA 5JS8A 3C41J 4WZAE 3P32A 4G5GA 4V0MA 3IHLA 1DARA 5H1YA 1FUKA 3LV8A 4QKQA 1G8GA 1JJ7A 2Z83A 3NVAA 5HZHA 4Q5IA 1GUAA 121PA 1UADA 2QPTA 3QF7A 3GJ4A 1E3MA 1GVNB 1J7KA 2OFXA 5J5CA 4IOKA 2A3RA 3SJAA 2IYWA 2ATXA 1XFAA 1YZLA 2CNWA 4G5RA 3RRYA 3HP1A 5H8WA 2YWHA 4PHTA 2IUTA 5EUMA 3R7WA 3ADKA 1Z28A 1N6LA 3VAAA 4ACBA 1E0JA 2D62A 4JT4A 4D0NA 4IXNA 2ZRHA 1MABB 2G1JA 2VHCA 1VYUA 3CF0A 1BO6A 1OF1A 4WAUA 2ZAOA 3SQWA 4LPKA 2JLSA 1X8LA 4RKFA 1QBKC 1MO3A 2OBLA 4H1UA 5JI2E 1QG2A 3NH6A 4C4PA 2RGNC 2GCOB 1VMAA 4A0RA 1YZNA 2YNMA 2XTNA 3TGPA 1P2VA 2DBYA 1V5WA 3W9YA 3V00A 3WHKA 2PMKA 1CLUA 3CX8A 1W0JA 4A2PA 1U94A 2YHSA 2IUSA 3VHXA 4TN1A 4DLVA 1E98A 2ZE6A 2OHFA 2QGNA 4ESHA 1KY3A 1WBBA 4PXAA 4ZCLA 1XCMA 3CM0A 2V7QA 1XDBA 1H8ED 3LVQE 1E32A 4YDHB 4MRNA 1A7JA 3BGWA 4BFWA 5L8VA 2IWRA 2VP2A 2DFLA 3THYA 1TAGA 3CRVA 1Z06A 1NL3A 3CZQA 4I1UA 5FFMA 3L0PA 1BYUA 1Z0FA 4NBSA 2VQSA 4JSYA 1WDTA 3ADCA 2XTZA 1E1QD 3NEJA 4HATA 4MKIA 4FMDB 3ASZA 5D3MB 2HXSA 4MKGA 3CBQA 3UWKA 1U0HC 3LW8A 5L3VA 2BJVA 3OE7A 1UAAA 1QHGA 3IEUA 1F2UB 1KJZA 1OIXA 1GNPA 4CT4B 4BE7B 1M2OB 4D26A 1VPLA 3TAHA 4DLRA 3U3MA 1N6RA 1W2HA 2OUKA 5AJZA 3EASA 3EARA 1FNMA 2ZS9A 2JJ1D 5C4MA 1Q0UA 2Q3MA 3BFKA 2ZXUA 4OQFA 2L0XA 2IYYA 2BOVA 5BXQC 4KFUA 2FWRA 2Z0MA 3AUYA 2BVNA 1ONBA 3L82B 4FMCB 1F2TB 1OIWA 2CLDX 1K5DA 2QAGB 2VP9A 2X2EA 1M7HA 2I1VB 4M9ZA 4QOSA 3KTAA 4OI1A 1YRAA 3FTQA 2A5GA 3LBNA 5AJXA 2AKYA 4QM6A 2ZR7A 1JB1A 3LNCA 2GESA 2ZM5A 1M34E 1JALA 1I2DA 2R6DA 4NH0A 2H5EA 2Z5FA 1GRRA 2EVWX 2X8AA 4M9SA 4PHFA 4DRZA 3DKPA 4UNSA 1II8A 3LXRA 1SHKA 3EZ2A 3PV0A 2OCAA 2V1UA 5EE1A 3P27A 4URWR 1GAJA 1Q1ZA 2AK3A 821PA 1R5OA 3ZVNA 3BXZA 2CHGA 4MYHA 1UBCA 4NHOA 4YMSA 2OAQ1 4PAQA 2XB2A 4BZPA 3GLHA 4NYJR 1TNDA 3I5XA 2W2TA 4HZUB 1SKYE 1ZP6A 3QVUA 4Q47A 2OFOA 2QP4A 1OV4A 5CLLA 1ZD1A 2WAYA 2WJYA 4TMVA 1P9WA 1FW6A 3CKLA 4EQ6B 1AA9A 3FGNA 3K9LA 1E2PA 4P4SA 1Q12A 3LLMA 3M4YA 2CHVA 2F1JA 4L15A 1XEFA 4HEJA 3GFTA 4FW9A 4W5HA 3U4QB 1ZM4A 2C8VA 2NIPA 4XWOA 2IT1A 5H70A 4ITRC 2QMUA 1P7CA 3A37A 4YC7A 2YINC 4A8JA 2JIZA 4IEIA 4JKIA 2ZUBA 4B47A 3CIOA 2C77A 1T6NA 4B3DA 4FIDA 3Q72A 1G64A 1QHNA 1GKIA 2GILA 4HZIA 3K70D 4V0LA 3ZVRA 3UG7A 4AK9A 3MFYA 4OJKA 2EQBA 1CKEA 4OK5A 1Z08A 3B7GA 1T4GA 3IO5A 3QXSA 1SXJA 4PAOA 5FUVA 3G0HA 3B60A 4PHGA 4A6PA 1W44A 4ASUD 3GLIA 4A0FA 4TYQA 1F2TA 2MSEB 3NEYA 1XRJA 3MCAA 1DBSA 5FL7D 4Q4LA 1MABA 1Y63A 2BC9A 2ANCA 1CR1A 2RGAA 4KFSA 1HT2E 3K70C 3H86A 1DG3A 1E2MA 1O87A 5DIFA 3GJXC 3U44A 1WP9A 2XNDA 1KKMA 4B71A 4C0JA 4IDNA 5EUQB 1T0HB 1ZD8A 3NC1C 4Q03A 2FEOA 1BH2A 4ZPXA 2O8DB 3AVPA 1DG1G 3PEUA 1R10A 2EU8A 2PT5A 3B1ZA 4PO9A 3ZZ0A 2ZRFA 4DUGD 1XJCA 2A78A 2G0NA 2H1LA 5DGXA 2PJRA 1SVKA 1P3JA 1E0AA 5E7JA 2IHYA 2W00A 5DI3A 2CEAA 1GP2A 1E4VA 3B8HA 3REGA 3KJHA 4KSCA 2OXCA 1HUQA 1WCV1 4LBWA 1G5TA 2IXEA 4BFZA 1CU1A 3H1TA 1NY5A 2QN6A 3WNBA 4HUTA 4QBFA 2QUZA 5L3RA 3SHWA 3IILA 4P0TA 4GZLA 1UFQA 2QENA 4AD8A 4EPWA 3C8UA 5ANRB 1KMQA 1MO5A 2C9CA 4EPXA 1YQTA 1ZM7A 4LHVA 2HLDA 2GCNA 2OZEA 1SKYB 3AF3A 3JZAA 3OZXA 4HLUC 3RS5A 4DIDA 4BFUA 5ELXA 1CRPA 3HU2A 4R2HA 1S96A 1P2UA 2N46A 3NBYC 4OK3A 1YZGA 3D8BA 2IF2A 4RFVA 2ZRMA 5CIQA 1DEKA 4CT5A 4DCUA 2P3SA 3U3RA 3PEYA 1CS4C 4LYJA 1W0KA 3AVTA 4ZO4A 1M8PA 2R6FA 3DZDA 5JCPA 4QGHA 1N25A 4XSHA 4QG7A 2FMXA 2PMDA 1HQCA 1HTWA 1R0YA 2ZUDA 3RYTC 4RFSA 1VG0B 4F38A 3WMEA 3TUJC 3CNNA 4MDFA 5DYGA 2JJ1A 2DFKB 1US8B 2YOHA 4Q21A 4TMXA 2A7QA 2AL7A 2QTHA 3CB4A 3SJZA 1ZC3A 2G0TA 2WKRA 3JZMA 4Q9IA 1Z2AA 1WMSA 3D7MA 2QE7D 2FZ4A 2WHXA 3VNVA 2J7KA 3BAFA 3KJIA 1PLKA 4PZLA 2O52A 1IN7A 2O8DA 2DPXA 1WE2A 1RKBA 2JLQA 5GJBA 2FN4A 2OCPA 4BEBA 5FPYA 4LY6A 3QENA 1FP6A 4HAYA 2XGJA 1Z5ZA 1TUEA 5G3ZA 3C4JA 4I4LA 5FPKA 1SVWA 1NRJB 1FPMA 1W4RA 4QBGB 4BLQA 4FI3C 5FTKA 4YLGA 1D2MA 1XZQA 3SYKA 4B2PA 2ZJOA 2A5JA 2PLFA 2Q9AA 4QHYA 1TQDA 2QNRA 4BFVA 3T06B 8OHMA 4Q18A 4EFNA 1L7VC 2AD5A 4GP7A 3Q5EA 1TTTA 1G6OA 3U5ZB 3BJIC 2CHQA 1KO5A 2QPAA 1SVSA 1QRAA 2H8KA 1E9DA 1AS0A 1IN4A 1J2JA 2NZJA 3NC0C 4C0SA 2DWOA 4GSYA 3ZYCA 3PIRA 1IBRA 4RY2A 4UKDA 4Y0AA 3LY5A 2IYXA 4DDUA 5JS7A 1MOZA 5KDLA 5P21A 3QKSB 4DCNA 4JLAA 2C9YA 1ZNWA 4LI0A 4LJ7A 2OG2A 2RHDA 3U61B 3KKOA 3W34A 2O8FA 1Q57A 4EJSB 4E5UA 3AEZA 3Q85A 3P4YA 5AK0A 1E6CA 1E1RD 3D3QA 2AKAB 3DKVA 1JXOA 4I1OA 5J47A 3FHTA 1IJEA 4Q00A 2YWGA 5F2EA 1ODFA 2PEYA 1U8ZA 1D2NA 3GLIE 2O8FB 1W49A 3PUYA 3W8RA 4MQBA 3SYLA 2VSFA 1UJ2A 4M1SA 4O2RA 2J59A 1TEVA 1S3GA 4ZI2A 3UIEA 1YRBA 1Q21A 1TUIA 3QXJA 2O8CA 2FFBA 4I81A 5EZ5A 2EFCB 1Z6TA 4OK6A 1E2EA 2BMEA 2HYIC 2V3CC 2V54A 4EPRA 2GZDA 4U02A 4HB4A 1Z0DA 4JYBA 4UXIA 2BDTA 3QPWA 721PA 5J4HA 4KLNA 3WBKA 2WWHA 5FPTA 1E0KA 3TW8B 1LVGA 4LDJA 3IPYA 2R6CA 3EXAA 2O0KA 3WMGA 2KE5A 4Q9JA 5KU1A 3HU1A 1DS6A 1GIAA 4K8OA 4B74A 2BCJQ 3RNLA 3KQKA 1XTKA 2J7PD 3FDIA 4LJ6A 4PC6A 3BRWD 4B3BA 5CYOA 1XZPA 4DLYA 1KHTA 2CMKA 2DYKA 3KKMA 2EWVA 2JLYA 1L8QA 3K70B 4XVUA 4NP6A 4HDCA 1OH7A 1EFUA 3B82A 2NPIA 2P6RA 3T15A 3P4XA 4JMPA 3DEFA 2WWXA 4JL6A 1Q20A 1E2KA 1AN0A 2J5XA 3HPQA 3EZ9A 1F3OA 3ADBA 1RRPA 1NBME 4GZMA 4WIAA 1JPNA 2VLIA 2ZSFA 3DM9B 2YZ2A 2WKPA 5F9HA 3RABA 2ZEJA 2OCBA 3BS4A 4MYCA 4JLDA 2ZU0C 2AK2A 2YOFA 2X1VA 3CWQA 1E96A 2HYDA 4M53A 4A4DA 3QG5A 1JEDA 3WYAA 2BM0A 2UVQA 4A1FA 3JVUA 1GNRA 1UDWA 4XSGA 3WHLA 1VDZA
chains in the Genus database with same CATH superfamily
3OBIA 1KQPA 4L75A 3W0LB 1P39A 2GM9A 4F2GA 4DV0B 3PQCA 5DEOA 3ZY2A 1R8YA 2JD0A 3E82A 4KITB 2AXQA 1SIWA 5C8VA 3R7DA 3OU6A 4FGWA 4P4SB 2BFBB 2ZRPA 2AOWA 2IDKA 1IQ0A 1XA3A 3B51X 2R79A 1WCYA 2VNSA 3IIKA 4Z1MA 1KAQA 4L0CA 2RGNA 2CJPA 5GONF 3AIOA 3EQ7A 4R1SA 3I9OA 3UFXA 1QPBA 4E2FA 1EGHA 4FFBA 4HNSA 3EPHA 1GGVA 1ZRSA 1KAOA 2FEMA 4L7VA 5FWDA 2FSGA 2DQ4A 2QMOA 3F5FA 1NJ2A 2OGTA 1SCUA 3CR7A 1Z73A 3L06A 4ND1A 2NQ2C 4O5AA 1L5YA 3BQNB 3OLQA 5KJCA 2EWWA 4L9RA 1A4UA 3QVXA 2RHLA 2YXNA 5BNTA 2FPGB 1R8SA 3D1JA 1XNQB 1RDFA 1FDVA 5HWSA 1NQVA 3DCIA 3NBFA 3RC1A 1KBOA 1DWOA 5EIHA 3BK1A 2PL1A 4ZVNA 2FZVA 2C7BA 3WGNA 1KYZA 3CRZA 5FR1A 3A4IA 4PN3A 5IH3A 1DEOA 1GNQA 1M8FA 2DPMA 4MJXA 1KORA 4MW9A 2PCLA 5CH5A 2OZVA 2Q50A 4LYDA 4MGKR 3L6DA 1E4EB 1E9CA 2GCIA 4O5OA 4NR0A 1J99A 4NQRA 5D85A 3DAHA 4F3RA 1JYSA 3M3DA 2PFSA 1TYBE 4ZQIA 2G08A 3ZQJA 4FYKA 3K0FB 1JQDA 4KODA 2DR3A 5CTJA 2NT3A 3C3AA 5IAEA 1S8NA 2AHRA 3DE7X 3LWZA 3TO5A 1NMYA 3PQDA 4FOLA 3Q2OA 1RKQA 5KAPA 2FHSA 4BQOA 3GFBA 4PSAA 1JG2A 5DW3A 2OZLB 1CZLA 1J2EA 1NVUQ 4RAQA 1XD9A 4JB3A 4JT8A 3BKXA 1KE2A 4DIEA 4EG0A 2TMGA 4A8JC 1JG4A 3A6LA 2BLLA 2GLTA 1G2OA 2WNHA 3C8DA 3E61A 1IY0A 2CYBA 1MIOB 5SZIA 2XCTB 3PGLA 1JR3A 1DI0A 3VR5A 3DZJA 1C0LA 1JFLA 1EVEA 4MDYA 4W1SA 5AJVB 5EQJB 3ZIUA 4RF4A 3DMNA 4FUQA 2WHEA 4EF4A 4W5QA 3WWCA 3DOOA 4EGCB 8MHTA 5JS2A 1RKVA 4L9SA 3PLNA 3R3UA 3SYNA 4K6FA 4J3JA 2Y9MB 3DFUA 4O25A 4EPVA 1E5DA 2AA3A 4YCBA 1QTIA 2GHTA 3MJHA 5IC5A 3R7NA 4F2PA 1TFUA 4S0ZA 3FROA 3VYTB 4JZKA 1Z2CA 1QONA 5B64A 3WOHA 3CVVA 2OCGA 3AP2A 4NMMA 5YASA 1IL0A 1MEEA 1W36C 1VPDA 5BVHA 3ANYB 1SRQA 5AVOA 1KU6A 3QA9A 1G8PA 2J0UA 3T3IA 3PDJA 4LC1A 3UPDA 5CA1A 1Z29A 4ZZ0A 4J0KA 1SVLA 5L95A 3DVLA 4J1NA 5KYUA 2ZU6A 4F4UA 1SD1A 4YLYA 3NANA 4CKWA 4MGYR 1BJKA 3NG1A 2X9QA 4DA9A 2GZ2A 1RBMA 3FUUA 3K2EA 3O2SB 1C4KA 4OH1A 1I10A 4OPMA 2X0DA 2QX9A 3LSTA 2G4LA 1HE1C 2KSQA 4NAUA 4TSKA 4UUQA 2QSJA 3I0ZA 4MS4A 1L3BA 4PSCA 1ZD9A 1BCSA 2GYYA 2WOJA 4TLLB 1Y98A 4NESA 3KB1A 4R7GA 3S81A 3TVDA 1VRWA 1Y82A 1IIRA 2JLBA 3BH6A 2EL7A 4JMLA 4XVQA 4YO7A 5FOVA 3DW1X 4BVEA 1K6XA 4DLSA 3EEYA 4PC2A 5L7WA 2FN3A 4JXZA 2HSGA 3B12A 3KP1A 5B6IA 1ZXLA 5H82A 5BOSA 2GTHA 4YPOA 2WR8A 3DW3X 4N49A 1AB5A 1YIOA 1ZEMA 2GQ0A 2GPAA 4HLCA 4NDZA 4DNPA 1Q15A 3CF4A 3OZCA 5E7QA 2QTVA 3ZK8A 1WOYA 1CNMA 2BFFA 1KE1A 1CY2A 5EXXA 5E6RA 4M88A 2I87A 1E9SA 4MP8A 1B4DA 2W6ID 1JHUA 3B2EA 2XCUA 2CKMA 4LRYA 4KXFB 2W48A 1J2UA 2B69A 3PXDA 5F1OA 1ZMRA 3IHTA 3VYUB 4C3ZA 5BP7A 4TXNA 4NMHA 4C6HA 3JALB 1IZ0A 3QNWA 3WAKA 4CCYA 5LR6A 4DUYB 1Q22A 2VHUA 2BSAA 3HQ4O 3RJMA 4O6VA 5CNIA 3THXA 1QB8A 3O03A 3PHIA 4KBFA 5DCYA 2FSUA 1YQGA 4J3FA 2GK6A 2WF8A 3FVTA 3WYEA 4DF3A 1IEQA 3LBHA 4PAMA 4DYHA 2XTMA 1KDPA 2O1SA 2EKDA 4JQYA 3DTVD 2FKNA 4IINA 5E9QA 3TQHA 1RXWA 3IKLA 5AHKA 5KWEA 1RHMA 1WHTA 2H4JA 4QEKA 3EXEB 4QBTA 1U99A 5BVHB 1QJCA 3MSXA 3CUEF 3CNBA 1SXJC 1OLSA 3HM2A 4HDOB 4EYOA 3TW8A 3ZYZA 1AGPA 1XLVA 4C5BA 3FMVA 1TQ6A 3PSAA 3RWMB 4BNUA 1FUUA 4KQGA 3GEIA 4OVKA 1N1EA 1HURA 1GT6A 4BB5A 3LUFA 1K6EA 2WKQA 4DEXA 1VE1A 2P3OA 1NASA 5AFSA 3G0OA 2VH1A 5TT1A 4DJDC 5KU7A 1Q19A 1P62B 2F1HA 3P52A 4NCHA 2DY1A 2ZULA 4CR7A 4NXMB 1BKDR 3V6MA 5H3LA 4DM3A 3SIRA 3FCYA 3C3PA 1W7AA 2WSLA 2IXDA 2VUSA 3M6FA 4W8OA 4YWHA 3QQPA 5DWDA 3DWEX 5FLYA 3SHQA 2UZ4A 3A6KA 5FB3A 2PVSA 5GJWC 5DRYA 4N0EA 5IM4A 1YJ5A 1GTRA 4PQYA 3RS0A 1F7UA 3BMOB 2VF8A 1SJ9A 1O95C 1P5JA 1OREA 1BEZA 2OC9A 2J7PA 5BURA 2WU8A 2HRCA 4BB0A 4G1UC 4K9LA 3OH8A 5TDHA 2W8BB 2VWHA 1RMTA 2IOQA 2PT7A 3UCFA 2Y4OA 2JEZA 4ADSG 1VG8A 4I55B 1RZVA 3U0BA 4AZVA 1F7VA 2WD9A 1KJYA 1P91A 2X58A 4HQ6A 4RK4A 4ZAXA 1JDBC 5AJYA 3TQSA 2QRKA 1G55A 1LTKA 1XTSA 2JPDA 2WP8J 1UP6A 3ABRB 3GEHA 4MGEA 4YRRA 2LTAA 5AUOB 3K9CA 3DO6A 1IOZA 2QPLA 4JASB 5DI9A 5TQ0B 4MKFA 4JIMA 3FNRA 1NU6A 1KEPA 1UC9A 1HC7A 2H0RA 1W8DA 3OZSA 3VTZA 3IEVA 4E5YA 4E33A 2PZMA 1Z6XA 3FPBA 1QLWA 5JCJD 3W5CA 1NKSA 2PSEA 3UJ9A 3IAFA 4OBEA 4RD1A 1CF4A 1GAEO 2C5HA 4ZIRB 4P4UA 4G26A 4DRXB 4IMRA 5IZ4A 2IV2X 1I3MA 4XA8A 2G63A 4EKEA 2G82A 3IAAA 2Q3HA 4KGDA 5FTMA 3DZKA 2OK8A 3Q7QA 2OVFA 2B2NA 1ZCAA 1XGKA 1TVCA 2H54A 5B4UA 1PWYE 1TTHA 1FBNA 2AC2A 3EWNA 3RLFA 3LUPA 3ZWXA 3EA5A 4ARCA 4K6KA 1I2BA 3AEKB 2Y1KA 4H59A 4E5PA 2OXTA 2PSDA 3MOSA 3TE6A 1QQ7A 4ALIA 1A5TA 4Q0MA 1PFVA 3BORA 1M2OA 3O8OA 1KR2A 4BE4A 2V6IA 1CD5A 1AF7A 3RF6A 1TZJA 4ML3A 1VMDA 2PPVA 4L5YA 1ZN9A 4LUCA 1US8A 3EEBA 3HSYA 5IX8A 4QELA 1WM1A 1WS6A 1P1JA 4P86A 4HV4A 3FDFA 3AC0A 4TS3A 2DCUA 4X3CA 5COAA 4KI0A 1N2EA 2M1ZA 1E66A 2O2DA 3LC0A 3TKYA 5KYTA 2V5AA 4E4YA 3M34A 2RJNA 2G9ZA 1Q7TA 2J6HA 3O4JA 1NW8A 1YNOA 4KO3S 1W59A 1T29A 3DKKA 5K0BA 1YE8A 1EWQA 4ZOLB 1F51E 1CY0A 1VYHA 5FWNA 4RTMA 2FR8C 5A4KA 1PTJC 3PUVA 2RGDA 2DOKA 3CW9A 3K09C 3QW4B 4KMRA 5LA6B 1PVOA 2OCKA 2RSLA 1WEKA 5JBQA 3HHEA 1W581 1DX9A 3KLMX 2VUIB 5HA5A 3RYIB 1E8DA 1KSFX 1HPLA 4BUJA 1WCWA 3OKPA 2FCAA 3IKTA 2VBIA 1S3IA 2CNLA 3QE4A 1WMFA 3U5TA 2QUBA 1Q0PA 2DPGA 4H7PA 2OORC 4MVJG 1Z62A 4QPCA 4S3MA 2HXYA 2ONKA 3C7KA 3D8NA 3NDRA 5K0JA 4Q48A 2BONA 5ES4B 4GU5A 3FUXA 3I64A 3ECCA 4YRNA 3CNOA 4LOHA 2A8YA 5I5EA 4OHYA 4E21A 5ILQA 3KAKA 2HDHA 4B87A 1QE0A 2X41A 4D9HA 2ZIWB 2B35A 2EF0A 3FB4A 3EVGA 3RVBA 1MTOA 3PKJA 4HH3C 1CJTC 1EIZA 2CXPA 2HDOA 3ONWA 4KWEA 4UTRA 1NAHA 2GCPA 1J7JA 2HU7A 7MDHA 4MR9A 4C7OB 2F4VB 1YR7A 4R1QA 1R6VA 3OZUA 3VDMA 4JJ6A 5J5AA 4UPVA 2GVZC 3N74A 1PV1A 1E64A 2YMPA 1D8TA 3KRTA 1NVBA 221PA 1LX6A 2A84A 1B6GA 1GTL1 2Z3VA 1M67A 4KZPA 4HAWA 4IMJB 3COYA 3TOSA 3UWSA 4N65A 2OHGA 2RI0A 4LOAA 3RRFA 4COKA 1P6XA 3ITEA 3TSYA 2O5CA 2JCGA 1R4MB 2OGUA 3DFZA 1JSLA 2CYAA 1KU0A 3W8NA 4B6FA 3L9XA 1XVUA 3QVOA 2FWPA 3VR6D 1XZMA 2NSDA 4ZVRA 1O54A 2GLUA 4YROA 4FFDA 1M2NA 2J5RA 3I6YA 4WT7A 1CRWG 3GHYA 3UMSA 1BS1A 1PJRA 3C5EA 2EEZA 5CFMA 4RY8A 4CCYB 2CFRA 4ZJYA 5DMXA 2GHIA 4HADA 3LQ2A 4R9RA 1TK2A 3I73A 1RWBA 2X7JA 1YE5A 3DDCA 2M98A 1RI4A 4NMXB 1M72A 2P2CA 3GEBA 3I1JA 4LXHA 1ZM3A 3SQMA 4IIJA 5AQ1A 3P0IA 5LA6A 1FU7A 4Y6PA 1JQ5A 2JHGA 4OJQA 4I4CA 3E53A 1Z2OX 4GECA 1VFPA 4IXWA 5FV4A 3U2QA 6ADHA 4IFBA 2D06A 4LZLA 5AMXA 2PRJA 2GNOA 4M7WA 3EDYA 4OATA 1PS0A 2Z95A 3G13A 4YXWA 3W5BA 3G2MA 4ID9A 4OOFA 1JYEA 3M6UA 4Q4HA 3CT4A 3WMFA 2VBCA 3AVWA 4PZPA 3B5EA 5DYIA 3WO0A 4RPJA 1MU0A 1ZOPA 3AHDA 4X6LA 3EF0A 2MHCA 2C3MA 2HV9A 2PTHA 1RYEA 1YBAA 3IKJA 3P9XA 3N6XA 3BTVA 3LPLA 3F8SA 2FA9A 3K5IA 4K9PA 4R68A 1XZKA 1Z5GA 2VDWB 5LLSA 1SBYA 3QWHA 4UBNA 3H9UA 4WZBE 5C4GB 2DWUA 4EF5A 1I0ZA 1EUQA 5T6BA 1E6LA 1J5PA 2AUTA 1JQEA 5GJCA 1TJNA 3HXKA 3MIIA 5D8DA 2DGDA 2UVDA 1G8YA 5FV7A 2VXCA 2GT1A 4OLFA 3ONEA 4X7MA 2Q5EA 5KHOC 2D1RA 3NHFA 1C80A 3WRYA 2H2GA 4ARZA 5JCOC 3FOAA 3QSYA 1UMDA 3WLKX 4DLBA 1Z5WA 3Q1KA 3INRA 3GFVA 1YE3A 4M98A 2OT3B 4DTIA 2BKVA 1B1CA 1P2TA 1JR3E 3IR7A 2WJPA 3O8NA 5EGNA 4CF6A 5CITA 4YX9A 4AQ7A 1MX9A 2FQWA 1CR6A 2F9LA 1L7BA 3BZWA 3H0EA 2R1VA 4RO0A 3EXHB 4REMA 2GVNA 3PFBA 2Z9BA 4NMWA 2KBEA 4JWKA 3ZWYA 4E22A 4Z9XA 4EELA 3KPYA 1OR8A 1U7WA 1BN7A 1HA3A 3R0VA 2B1QA 2QN2A 3KT3A 1WW8A 4TZ0A 3LZDA 1GA6A 4HJXA 4BLTA 5ALJA 3CPEA 1REQA 3A0UA 3CNLA 3AM5A 4ZYTA 1GZSA 3LUAA 4YCSA 1U63A 3FG9A 2HF8A 5AQEA 3B1KA 4HLUA 5FA5A 2QG9A 2FXVA 1U80A 1BXRB 1QRUA 1M2EA 1E69A 1EH5A 1TI7A 2ZJ4A 3R6DA 4O2AA 3JSXA 2HHAA 3R5FA 4HX5A 2IXAA 3AKCA 4GC9A 2XLBA 1CVIA 3B3AA 2XT0A 3DH0A 1C8LA 3QYFA 3R5JA 5JDCC 4ENPA 5I4BA 1JB9A 3WIUA 3CVXA 3EGDB 5JY1A 1YK0A 5FPQA 1OIVA 1UWLA 2JK0A 4O2BF 3P0HA 4XGRA 1FQWA 1VGQA 1TAUA 4HGZA 3HS3A 4LRXA 4RJJA 2WWTA 3GZ4A 3JQ9C 1QH1B 3JXEA 3NB0A 3FHOA 4YN3A 3RM3A 2F3QA 4E09A 5SYMA 3ASVA 3DTTA 4BNDA 2O8BA 3FJ1A 1EDBA 2Z6VA 4RJKA 1OYVA 2C8JA 4E03A 2ZI6A 1TADA 1RM4A 3KPUA 4YHBA 4KE9A 4JU9A 3A1VA 1TYCA 2XRYA 2QUKA 4N3AA 3I04M 2IXTA 3LWNA 3UATA 4N0QA 4C7OA 3CEAA 3IH5A 4UCXA 2C95A 5AJHA 4B6QA 1MXHA 3FYUB 1WXEA 3JRWA 3QKTA 4XD7A 3F4LA 1GPMA 1V8ZA 4GMHA 4PG6A 1GTMA 5DK4A 4O8CA 5LSAA 3MWKA 4RV4A 3BTOA 3L1HA 2LCFA 2P79A 1EJ2A 3IOCA 2PEZA 3GA7A 2E4UA 4RGQA 5FHRA 4PYRA 4C03A 4N40A 1UANA 2Y1EA 1KZGB 3R0ZA 3W1VA 4A3SA 3KZVA 4B4VA 1YAHA 4F84A 1U4OA 1VKRA 4MI3A 2Q0QA 3LFTA 4P2BA 3NIBA 5E7IA 2AUNA 3D7NA 3CEHA 3JALA 1I3OA 2AMYA 4J9VA 2I99A 1CUJA 3H0CA 1XVIA 2RGXA 4RA6A 1RRVA 3BILA 4X1IA 4YYEA 1JKMA 3HYSA 3B2NA 5E95A 3WS7A 1UKYA 2HSZA 3IIEA 2MYPA 2ZE7A 5T4BA 3OLYA 1G6HA 1CUHA 3HFGA 5AVQA 1FZTA 2CJWA 3AUJB 4XSVA 5M04A 3V7YA 2XZOA 4TXMA 1VJRA 3BCSA 1U8AA 1DBRA 1GPUA 1IN5A 2WNIA 2B92A 2XQKA 3J81A 4FUTA 4CMKA 1QGOA 3ODPA 4KXQA 1TLFA 4AS3A 5BWCA 4MUMA 2J31A 5JNRA 2VRNA 3OLZA 1FMFA 2CJWB 3ZWAA 4FIZA 1ACJA 3SFZA 3ETNA 2VAXA 3CVWA 3AUXA 4LPSA 4BVHA 3NIGB 2DTDA 1GILA 2HF9A 2IPAB 2YOGA 1P4JA 5KMGB 4JROA 2ZBVA 2IDMA 2ZJZA 2C5LA 3F3MA 4M0MA 4N9QA 5JO0A 1KO1A 3HFRA 5EJGA 3FUCA 5CXXA 4CIYA 2WT9A 5TQ2B 1VLVA 1B76A 2FWIA 1XTTA 5E6UA 4XUEA 5JOQA 3CUWA 3IUYA 1RABA 1X87A 2DE0X 2B4RO 2UYOA 1ADBA 3BTSA 4M37A 3GFFA 2HQOA 2XAUA 2C97A 2YMQA 3G5UA 5KNCH 3GLGA 1M5RA 1DWUA 4QFDA 4C08A 2NTYC 4X90A 1Z74A 5AHOA 3WO1A 1I6KA 1NIJA 4G01B 2IH5A 1E5VA 3N0VA 4CL2A 5J4KA 3DZCA 3ETCA 2XOXA 3P2JA 1U6KA 4CM4A 3LC7O 2HA4A 3PJGA 1WXHA 4DSTA 2NTNA 2JLAA 4ZVSA 10MHA 1EMDA 4MRPA 4KR6A 4C7XA 4Y2JA 4HLQB 2RHWA 2XMQA 3EH1A 3P9CA 5KNDA 1OB2A 1U8UA 2PBFA 3DEAA 3CCBA 1KQOA 5EN4A 1U0EA 2GYVA 4R2WA 2Q1SA 3KDAA 2QQGA 3QRWA 4NZZA 3RJTA 4DY6A 2G28A 4M38A 4CEJB 2GEVA 2MIIA 4HWSA 1WZIA 2VDVE 5I7OA 1X9IA 1NURA 2FHPA 3FIJA 1LNZA 5CR9A 3E48A 1KSJA 5ALLA 1KWGA 2ZVPX 5BSRA 3HR4A 4RCYA 4QGFA 3RKUA 5EINA 3AF4A 5IFLA 1JEYA 2YC4C 1E62A 5LP6B 4GPBA 2PQ2A 9MHTA 5DW0A 3QHQA 1PG0A 1PNQA 1R9GA 1YB1A 4BFXA 4ZYVA 5BN1A 2IJGX 2CNWD 1DV2A 1HXHA 2C4VA 1YASA 4MUYA 3MSCA 3QLUC 3RUHA 5CA1F 5BOVA 5BVGB 4CKCB 1G291 1NOJA 4BX9A 1RHJA 2YIDA 1J8QA 3L0IB 2FR1A 4O4HA 3BX1A 1Y89A 5JYDA 2OBNA 1ZIOA 1LX7A 4UDXX 1QNFA 4CTKA 3SWWA 1UPUA 4P82A 4H6VA 4HMQA 4ZOAA 2W4QA 2E2WA 1C4OA 2VYNA 4BRZA 4D99A 1ESMA 4G1BA 5K8LA 1H6BA 3SBOA 1ULZA 4UVGA 5B1DA 1VLJA 3CPSA 1D2RA 4A8JB 1TEZA 4PGAA 2P9HA 4EMUA 5EMMA 1BSVA 1WLSA 4C1BA 4WESB 3T5DA 1FW8A 3QXXA 1O4WA 3RJZA 1L7OA 5AW6A 5F7OA 3IMEA 2JI8A 5INTA 1XI2A 3H9BA 4TZ6A 3M5CA 3CFYA 2NO4A 5GVSA 5G2OA 3JQ7A 4M8NE 3KQLA 1ZL2A 3RBXA 4DHWA 1JAIA 4QGSA 4E31A 4KYUA 2CD7A 2HWYA 2V03A 1I6WA 5A3RA 2ZSBA 1UEIA 5KDOA 1QS0A 3CLUD 4MYUA 2FDCA 2RKBA 4D6YA 4I5IA 3OOJA 2B8WA 3WFIA 2CMHA 3C4VA 4E12A 1GPH1 3ED1A 1MF7A 4FYWA 3MEQA 1M1YA 3STVA 4DC9A 2AW3A 4M1ZA 3N8KA 3E2IA 5CRIA 3KK0A 1ZFNA 3GZNB 4JVMA 3WK8A 1Z4MA 2Y71A 2H7VA 1GDHA 3AHFA 3RQIA 3RFVA 1B26A 5DBOA 4LHWA 4RVHA 1YZFA 1XRPA 2RK6A 4KXLA 2A0KA 1WF3A 4DQVA 5JSHA 3MRVA 4EDHA 2X0JA 4WVFA 3JD4A 1E6UA 3AJAA 3H84A 4KRYA 5B53A 4F9FA 4JITA 5A7FA 1K89A 3QU2A 4KIFA 5TPZA 1CTQA 1LFAA 2OHXA 4M9CA 1PNTA 2IGTA 1K68A 3ZDXB 3RK0A 1TT7A 2E4AA 2Q4OA 3GDWA 4UU1A 3BMQB 2HRZA 1WKCA 4HB2A 3H17A 4PANA 4XKJA 5T3YA 1SKAA 3HXOA 5CDTA 2GBLA 3GT3A 1LI7A 2P62A 2V7XA 2WZBA 3SHOA 4RZXA 3EC2A 5AT1A 2PYZA 3F1KA 3O92A 2PD4A 5KSYA 1Q2XA 2A57A 4NZYA 1I94B 1EQUA 1L4MA 4FB5A 3H1AA 3N86A 2BGWA 1U7PA 3GLVA 1YIDA 4KQ1A 4F5WA 1P5HA 3FXAA 3WK6A 4YCLA 4MVJH 1U7UA 2PGNA 3GZJA 4HY3A 1TZKA 5KNBH 2PCJA 1Q7BA 4OLJA 1V9LA 1QBGA 2A30A 4AX4A 3N2YA 4R8SA 3T3HA 2CYCA 3AGPA 1E2JA 3MCTA 5EE5B 1XC7A 3IAHA 3S99A 3LPCA 4CKWB 4I6GA 2G1AA 4Y1EA 3T7AA 3LCUA 4B7CA 4BNFA 2I29A 1I1QB 5IBPA 4M7RA 1E9FA 1FVXA 1SM4A 1Z6ZA 2EP8A 4PPQA 1W1UA 2GTIA 3LX4A 4DPLA 1U5BA 3PYMA 3UXEA 2C0CA 1MPXA 1V6CA 2J9FB 2G09A 4UAVA 2ZZMA 1HWYA 1K9SA 1IZ7A 1SHTX 2QT1A 4KLZA 4W1QA 2Z6UA 3LK6A 2YW9A 2B1JA 3X2EA 3GLGB 3ZEIA 2ONCA 5U9CA 2HA2A 1LDMA 2JGFA 3MGAA 5AWFC 1USKA 1T4MA 5JTTA 3OIVA 4QDOA 3RSLA 1RRFA 1Y4DE 3PCRB 1CE8A 1G4HA 4IQFA 5HCNA 4CODB 1KH1A 3C3EA 1M33A 2JIPA 3ADOA 3RG8A 3RO7A 4A5SA 4TYMA 4O1IA 3CNQS 5D86A 2I66A 1OGYA 4QDUA 3HDQA 3A2LA 3S5JA 2GF9A 3EVZA 4FNAA 3WQQA 1HL3A 3I0NA 4BRSA 4F86A 3M5PA 2FP4B 1DHRA 4L4SA 1RM0A 2BR4A 2VFAA 4AO6A 5L4LA 4R0NA 3A6ZA 4KSBA 4IGKA 4IH1A 2R7LA 3VR5H 1M76A 1TCAA 3FWKA 3I28A 3LXXA 4KIGA 1XL1A 3LTEA 4RTQA 1NBOA 3FSGA 3KYCA 4RY9A 3QZUA 1L7NA 2AZTA 2HN9A 2VJLA 1O9BA 1JECA 2FE4A 4YONB 1XN4A 4AZ3A 5A4JA 1O97D 4OF4A 2WSBA 1QDUA 3MRXA 4IWYA 3U3XA 4C4ZA 5MF6A 2V97A 4OU4A 1EB9A 1Y4UA 2Z4RA 3M70A 4MW1A 5MHTA 5JJKA 3I9NA 3KR9A 1QFXA 3GCWA 2XHEA 4ZDIA 4QUJA 1OAAA 4J4TA 1LLDA 3LU1A 5KC9A 5JV5A 1DOHA 3G2PA 3PXBA 2CJXA 1P1FA 2UV8A 2RB5A 3PLRA 4Y9TA 2C0PA 3U7IA 1F2DA 4AM8A 4N7RA 4RQBA 2GPJA 3OTWA 1ZWKA 1B8NA 1ZVMA 2FF5A 4P98A 3BFVA 4WZ6A 2PUAA 2GVDC 3MMSA 4H9GA 4J75A 3L8HA 5AXCA 3PWSA 3GF4A 3NORA 1VCHA 1OX5A 3DOFA 3KIPA 2H3HA 3A7DA 3C8HA 5C8YF 3O8QB 2ZRKA 5ILGA 1TVKA 3G9XA 1WUTA 3OVMA 3BB1A 3IGFA 2Z58A 1YF3A 5BN3B 3VKHA 1W47A 4Z6KA 2D4HA 4Z7OB 3N2IA 4ZO8A 4OXRA 2NZYA 3DF9A 1RBYA 3NM6B 4RA9A 4YIKA 2BFBA 3X3HA 2WLSA 1OWOA 5IH7A 2OXRA 4RE5A 1ODTC 1LPPA 3T61A 3HJGA 3JWIA 5M2QA 3HR7A 3E8MA 3K1YA 4MMYB 4O0LA 4RIEA 3VFDA 3AV0B 1A04A 4AFNA 3NP9A 3GT0A 1JKJA 1G5QA 2QW8A 1LBHA 3W3AA 1NF8A 3GY0A 4N7JA 4UBMA 2QVXX 2J3EA 3LGAA 1FCJA 2A9JA 1K75A 2QYTA 2ZJ2A 1VE5A 3WWDA 5AM2A 3KQQA 2C3PA 3G2NA 3NJ8A 3WYGA 2AJLI 4BVJA 2N75A 3VPAA 4JJ4A 1C41A 1T2AA 2OR3A 3NTLA 3KQUA 2G76A 1WABA 3CVYA 4B6OA 1USVA 1NZFA 3MUFA 2PWPA 5AM0A 2J6IA 2L2QA 1TMYA 3UEOA 1EE2A 4AKHA 1D9ZA 4O63O 4CKEA 5KVAA 1KP9A 1NPYA 3DDZX 3ZWNA 2PGLA 3D8RA 1O6ZA 1U7ZA 4TMTA 4TKLA 1ESEA 5HNKA 3M6XA 4R2LA 2P35A 1V0JA 6REQA 3KOMA 4HAIA 5EI5A 1QU3A 1DDIA 4PYJA 4RJ2A 4B75A 1LEHA 1JIKA 1OAOA 2O1WA 2HQBA 4CCWA 3PEVA 2WPDD 3QX7A 1IAQA 4FN4A 2JGRA 2HGZA 1Y1TA 3LE8A 2X5XA 3LC1O 2D7JA 2QRVB 3ENWA 2I2FA 1XQ6A 2ZSKA 3AFIA 4L8YA 2J4CA 4M0FA 5AK6A 4DR3B 4TYYA 4I55A 1VHDA 1ZH6A 3CUYA 1HG0A 3ZLBA 1AQLA 1NUQA 2QQEA 5LJLA 5A0VA 3L84A 1N3LA 3QNUA 1OX6A 1IUPA 1P72A 3DQZA 1D5CA 4MZXA 4RORA 4Q7LA 1UBSB 4HNAB 3VZBA 1CUCA 1SFRA 2PX5A 4EI8A 3AQ4A 1V2GA 3L79A 1NYQA 3K20A 1Q0ZA 1XMOB 3VHLB 5LBIA 3I1FA 3W1EA 3O6VA 1DXQA 3MCWA 4HDNA 3OOWA 4WSOA 4E70A 4CGZA 2IZOA 2CV1A 1OJ7A 3FKSA 4AULA 3L0CA 1ZIXA 4MCHA 3UCXA 1TF2A 1IN1A 3DS8A 1ZY2A 3OKCA 3VZSA 1B8VA 3PWZA 3JVEA 2D3WA 2W2VA 1ICEA 1PFKA 1T8RA 3ONNA 3HKDA 1T25A 4U5QA 4BNJA 2LUOA 5IHPA 4PXYA 2A5YB 4H7EA 2D0PB 4LE2A 4NICA 2DVMA 4IIUA 1JU4A 2D0OB 3AZPA 3VU9B 2UYHA 2O3QA 4C9BA 3CY6A 3P9ZA 5E3HA 3PNOA 4KLAA 1J9EA 3G9UA 4BKQA 4KQFA 1PRYA 4OA8A 3PB3A 2LV8A 4YP5A 2PSHA 1JN0A 3ZDRA 1HDYA 1KFCB 1L8XA 2EZ4A 1KO7A 1DUSA 4ONEA 1PJAA 1DC4A 3CCCA 2QSYA 3JAKB 3D0OA 4MKRA 2VP0A 3ID6C 3QBTA 4Y0NA 5ERYA 4XUCA 5CVTA 5FEUA 2XZLA 4H7KA 2P3QA 1F0NA 3PUIA 3R40A 3B5JA 4DLTA 2GKSA 1C9DB 3R7WB 1NIPA 3NX4A 4QRIA 4CIWA 2X9GA 5KQMA 3EHDA 4I1VA 1RQPA 3UFBA 5IVHA 4NBVA 4XM0A 4P3OA 4JI6B 3T9BA 1LV7A 3KYDB 1FMCA 3CKMA 1H2ZA 4QTYA 2ZDGA 4ANFA 4B32A 1L7AA 4PZYA 1AUOA 4EB3A 1RHRA 1Y1SA 2C2YA 5D5HA 3T95A 2HWWA 4YMWA 3I6IA 2DFVA 1J5EB 3QI2A 3RYCB 3LVBA 3A3YA 4W7IA 5D6OA 3QKRA 1ZK1A 3LX6A 3C6ZA 4Y1RA 1M2HA 1OHHD 3FTPA 3RT9A 3MUNA 2ZJ8A 1P75A 1WD5A 2AI1A 3ZTWA 4CLRB 1CRQA 4HRXA 2GRUA 4Y9SA 5CM2Z 1V7CA 3E7XA 1Z12A 3PA8A 4QVKA 2YUTA 1JSRA 1NF9A 5FL7A 5I51A 1MDFA 3BB4A 3AV3A 3OEHD 3QKUA 3WGKA 3TDNA 2UAGA 4LTDA 3RU9A 3VDXA 3DHYA 5CBKA 1V26A 1Z16A 1GFZA 1L6RA 1HF3A 1XXHA 2A0FA 4E3ZA 1M8GA 1VI2A 1I2CA 2DRIA 3AEQB 1Z5UA 4OMUA 2YIVX 4E94A 5L3QA 3I6BA 2PQMA 1XPUA 1PZHA 1WL8A 2A3NA 1M0EA 4BN0A 4KJZA 1D2EA 1NDUA 3W2EA 5HS6A 1MOQA 1JJVA 1LI5A 5CBPA 1BMFD 5HX7A 1PL8A 1A9XA 3AVVA 3EGCA 4LWZA 1C7QA 4WOCA 2E5LB 2ZI4A 2B83A 3RYFA 3CEJA 3L93A 3Q41A 3ZD6A 4RTPA 5AVZA 5DULA 3PYXA 4UVIA 1BFUA 1RFGE 3AB3A 1XTJA 1FSPA 3V1TC 3H5AA 5SZHB 2NSHA 4MB6A 2FMIA 4HZUA 4O4LB 2CE2X 2IQ5A 4KB5A 4B3JA 1C9NA 4JUIA 4CUJA 4EMTA 1OWPA 1PN3A 2GUGA 3KQYA 1ZZEA 1B6TA 4IJUA 4QPZA 3P20A 1G8SA 3A2NA 2XTJA 2DKOA 1YZYA 1L3IA 1XF1A 1ZU4A 3F78A 3GRPA 4RVGA 1JNXX 4XYGA 1V8BA 1L5LA 1SU6A 3L5OA 1S2MA 3AUUA 4WKBA 4C6TB 1CP3A 1Z4PX 4IUYA 1QIJA 3IE0A 1MJGM 2BP7A 2HI0A 4QJIA 1JU3A 1WPRA 3O95A 4NV3A 5LKAA 4GH5A 3JASB 3CF2A 3I3SR 1WP4A 3NTXA 4X8OA 6REQB 1A98A 4JYCA 2VA8A 3W6NA 3STUA 3RKSA 3K3PA 2O8EB 4ZAWA 3R20A 1NT4A 1JJIA 1HNNA 1QZXA 4WHMA 5BXYA 4JVNA 2YV2A 4ZMBA 1Z5NA 3WA6A 1ZJYA 1OFGA 2B5WA 5EMKA 2FPRA 4KJXA 3HSSA 4GBED 4HDQB 1SOVA 3LCMA 2YTZA 3R24A 2G9NA 2BGGA 3O75A 1SBCA 3ZE7A 3A6HA 1ZHFA 1II0A 2GM3A 4L3WA 1QTRA 2GEDA 1Q74A 2VQDA 1E6KA 4LJLA 4NJEB 4P7FA 2QV7A 1EUZA 1UBGA 3AF1A 3DPSA 3R6TA 2AFIE 5DYTA 4QNRA 3MLBA 4MDHA 3ORRA 1IBKB 3UK7A 8OHMA 4U63A 4MHOA 1B43A 4WBNF 1GGHA 4M1KA 4B80A 1YZTA 1PD0A 1RYDA 2R8BA 1G3QA 1GYRA 5LZ2A 4QX6A 1IAVA 3M5DA 4BO5A 4CF7A 3AZQA 5L9AA 1JNYA 1ZI8A 2IU0A 2FSPA 1L4HA 1T5LA 2PJZA 5F64A 4AG6A 1VYVA 1VJCA 1KJWA 3GJ0A 3BBPA 4AKGA 3IYLW 1F5SA 3ZOZA 4A73A 5CURA 4WPGA 2FSHA 4B35A 3QV1A 1U8XX 1L2TA 1BDJA 1P7PA 4GOOD 2PQ0A 4FFBB 4BUZA 4EYQA 4JFRA 4LFBB 1S0UA 4HMOA 4NX2A 4QTUB 1Q1AA 3PICA 2PJDA 3ZTYA 3S8EA 3QUBA 1N2BA 4CETA 1U2GA 1YH3A 3NU1A 1XA0A 2ZVJA 3KOOA 4ZI7B 1L5VA 3WZ2A 4FFRA 1HL7A 4KHZA 2VP6A 4BBPA 1N33B 2JW5A 2WWIA 3L6RA 4K9DA 1SZPA 1R1DA 1KPIA 2OHOA 5ICMA 3WLRA 3KL4A 5I45A 1RAIA 1V3UA 4GQAA 2W11A 3DAOA 1ZOSA 3H11B 1KDOA 5CDUA 1T91A 2WM2A 1KVTA 4B6PA 5IC4A 4BN5A 2BZ1A 1XZHA 3D2LA 4NU0A 4PYKA 1SR8A 5BNIA 2VJAA 2Q9BA 4GSKA 3OIFA 5AXBA 2OXIA 1ZOOA 3GLUA 3ILSA 1A88A 2WJ6A 4K3VA 4Q1DA 1YBVA 3EPPA 3E70C 3ICEA 1ZI9A 1ZA1A 1XLTC 1MB2A 4P7JA 3RI3A 3RK4A 2IUUA 3CEPB 4XTRA 5DXJA 3U4AA 1AUVA 3KBOA 3TTUA 4DLLA 2XCOA 2R1TA 1GGKA 3U7FB 4DFDA 3GPLA 2BLNA 5KDDA 3GLGE 2N47A 4FDLA 5BWMA 3SZMA 4DGQA 2R96A 4FOSA 3NIDB 3TLYA 2FYTA 2B1IA 1Y4ZA 3JQ8B 1DAOA 4FWBA 4DLZA 3ZX4A 5EIXA 1GA1A 3RBVA 3AYZB 1DVRA 3TPCA 1DAMA 4LDZA 5G1PA 4TWRA 3NTUA 1U4NA 1MO2A 4CMEA 1FFXA 4F96A 3KWFA 1SQ5A 3LYLA 4LCBA 5BMVF 3PVSA 5K3AA 3REFA 2AMJA 2V4ZA 3RUFA 4PCVA 3K8QA 3CLKA 1E5QA 1ENPA 1QCYA 5KX5B 5ALPA 9LDTA 2BM8A 4PSUA 3RRJA 4EYEA 4NS1A 3B20A 4M36A 2BFMA 4PLVA 4DRXA 1XZDA 2W58A 1ZJ4A 4DEYA 1UMKA 5T4FA 3TM5A 5HKKA 3BVPA 3WTBA 3J80A 3IQXA 3CUVA 1N2SA 2O5RA 5EHIA 1YRWA 2EWMA 1A5BB 3I34X 2OSVA 5EKXA 2JZNA 3CBGA 4RPKA 2E0IA 4Q1EA 1KFBB 1JQ3A 2I65A 2YHBA 4AYTA 3QKIA 3M1IA 1JTVA 1EQ2A 3MQ4A 4HRVA 4A0SA 3UAZA 1HT1E 3VTAA