1LB1B

Crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide exchange factor DBS
publication title Structural basis for the selective activation of Rho GTPases by Dbl exchange factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 59
structure length 178
sequence length 178
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lb1B00
1W46A 2J0QA 2JJ8A 3T34A 2FSHA 4B34A 1GG2A 4YMTA 4Y0VA 3I4LA 4E22A 2QUZA 2ODEA 4TSFA 2OT3B 4TMVA 1B23P 1RKBA 2YINC 1S4QA 4I1UA 1JR3D 3CNOA 4TLAA 2CXXA 4UJ3A 1LV7A 5EE0A 1U0HC 3A1WA 5B58C 1XXHB 1H8ED 1N25A 1EG7A 1R0ZA 3W90A 1FUKA 4AKGA 3LBNA 3TVDA 1A2BA 1NVVR 2VEDA 5AUNB 4LI0A 1ZNZA 2JCSA 1F3OA 1XF9A 2JIZD 1DO0A 2DCUA 3GJ6A 1SVSA 4LV6A 1WE2A 3SDZA 4HDQB 4Q4JB 2FX3A 4GFDA 2OLKA 1G8GA 2JJ1D 4WXRA 3A58B 4JBWA 3DL0A 3O8CA 1IBRA 1P75A 3SJAA 1ZIOA 4DZZA 2ZI6A 4LHVA 3ZJYA 2NO0A 5L3SB 4LHYA 1YZTA 1G18A 2HYDA 2RGNA 1N6IA 4NYMR 4B74A 1KKMA 3W3AA 4Q66C 5FL7D 4BGDA 2AX4A 3TSZA 1SXJE 4ZIRA 2GJAA 3SHFA 3HPQA 3CONA 1GRRA 2ZRGA 3F8TA 4FMDF 2R44A 5JEDA 4J0QA 5ELXA 3RS7A 3W34A 2VP6A 1ZCBA 3Q8XB 4U00A 4V0KA 5C1BA 1D6JA 4B2LA 3RRMA 1N6OA 1XRJA 5C2JB 3HDTA 1TPZA 3QOFA 5HKKD 3UWKA 4YXWD 3QQ5A 1KI9A 1Z8FA 4TMZA 1Q21A 2QTHA 3QENA 2ZRCA 4Q48A 2VP0A 3OEED 1AS2A 4RFSA 5LDDC 3HYRA 1NVUQ 1J7KA 1UJ2A 1E1RA 4D2IA 3ADBA 1IN7A 3S1AB 1COWA 3UWOA 4IDNA 2I4IA 2JA1A 2W2XA 3ZYCA 1FTSA 2CK3A 3CX7A 3SJBA 3IIMA 3O47A 4UQOA 2WWXA 1Z6TA 4R71A 2OFWA 5JBQA 1X1RA 3EZ9A 2PLRA 1VECA 2IYTA 1UDXA 1U9IA 2F1JA 1UDWA 4UNRA 8OHMA 2V3CC 1QHHA 4NMMA 4LBWA 5GJCA 1DAIA 1GKUB 4G0NA 3T15A 4QM7A 1M1YE 1RVDA 1VG1A 2IS4A 2VF7A 1XEXB 3RAPR 4H1UA 1TF7A 1S2MA 4MDFA 4PZZA 5E7JA 1IOZA 1GDDA 4KSBA 1MRSA 3BB3A 5B64A 2ERYA 2ZE8A 1YKSA 2R8RA 4O2LA 5FPKA 2DPXA 5KPJA 4Q7MB 2MMGA 4LJ8A 1E79D 4EJSC 2C2HA 4CZ2A 3I72A 1F2TB 1KK2A 5LD2B 1UF9A 2XNDD 1G291 4Q1EA 3LWNA 1DAMA 4B3DA 1Z28A 4IOLA 1KZ7B 4MH0R 1EFRD 1VYVA 1XP8A 2ORVA 2OAQ1 2JGNA 5FUXA 2J45A 2IXFA 821PA 5F3WB 4ZCLA 4X8HA 1E9EA 2B6HA 1U0LA 4H1VA 3AF1A 2XB4A 4Q19A 4PSKA 3SFZA 4PC7A 2CLDX 4Q9LA 5FOWA 4ZCMA 3THWB 1TNDA 4M53A 4B3CA 3OE7A 3VR3A 1OH5A 3A1TA 3U44B 3B1WA 2DWOA 1HY3A 2VSFA 3LAWA 1FX0B 1J99A 1GP2A 4L9WA 4M1KA 3WRXC 2AK2A 3K0EA 3UIEA 1IY0A 2E9SA 1W2HA 3L0OA 3PUYA 4CRWB 1Q12A 3SU8A 4IKEA 1UKYA 4WZ6A 1SXJA 4Z51A 3R9XA 1M34E 3UATA 2QTFA 1DG1G 4KVGA 5DN6A 2XITA 1KO8A 1KK0A 2LKCA 4Z1MA 1Z2CA 4EPTA 2OG2A 1GL6A 3CLVA 3RS4A 5TARA 1L8QA 2QENA 3EC1A 1OE0A 2JDID 1NNEA 5JS7A 2EVWX 2XJ4A 4MUAA 1GILA 3AUYA 2ZYWX 2XTZA 3HU1A 4ZKDA 3CPHA 1OFHA 1EX7A 3FB4A 4DT1A 1QDEA 2GCNA 3KQKA 1TQDA 4FCVA 4WXPA 3RS0A 5IT5A 4Q18A 1XMSA 3P1JA 1B0UA 4IDPA 2A5FA 4I81A 4Q7KA 5FPSA 5LB4A 4BWYA 5G40A 4TZ0A 3SYLA 1GNPA 4JL5A 2VIIA 5TXGA 3TE6A 4YONB 1SXJB 3KQUA 3MWKA 1RRFA 5EZ5A 1S3GA 3T5DA 2FFAA 5P21A 1FL9A 1KSHA 2ECKA 3CZQA 1OKKD 3SFVA 2BMDA 4US2R 2YOFA 4NCJA 4HUTA 2WOJA 2C9YA 3HWSA 5AWFC 5G3ZA 3AVWA 2FF7A 3IO3A 2Q9BA 1MO4A 2REOA 4DLRA 1KY3A 1CJVC 2QE7A 1IAQA 3EZ7A 2F9LA 1E9SA 2FPMA 2CCKA 2ZJAA 4HLUC 1N6RA 3BS4A 4Q1BA 2EFGA 4JYBA 4BFSA 3ASZA 4LCBA 4PZYA 4DT1B 4XJXA 4HAUA 1LVGA 4GMXA 3PFIA 5G3YA 1DEKA 3KTAA 1KDRA 1FMLA 2BMFA 3VR6A 4BFWA 1WB9A 1U0JA 1R0WA 4C2UA 2YC2C 3LBIA 2QBYA 3R8FA 2IXGA 3K0FB 4ZI3A 3DM5A 2ZR7A 3BERA 1SKQA 5FOVA 4G3XA 4NYJR 3KKPA 1E2DA 4ARZB 4POAA 3ZVNA 4N3NA 5CDFE 3R9WA 2BM0A 4R9UC 3VR2A 2GILA 5SZKB 2G6BA 2JLYA 4AKEA 3WBKA 4CEIB 1VKJA 3QE0A 2QAGC 3GLFA 1A82A 3C14C 4EDHA 1ETUA 3M6AA 1R2QA 1ZNXA 1TQ4A 2DB3A 4PZLA 4DIDA 2BDTA 4C0LA 1P60A 2C03A 1Q20A 4HAWA 3UG6A 1E0KA 5EE5B 1M74A 4ERNA 1YZLA 4A2PA 4PTLA 4IRUB 4M1WA 3OAAD 3TUIC 2P3SA 2ZJBA 1N6PA 2O0HA 4US0R 2AWNA 2AWOA 3FKSD 1ZW6A 4PSAA 5HTKA 1KAOA 4A0FA 4E5UA 2GVDC 5JJKA 2FFQA 5B2ZA 2BV3A 2W6ID 521PA 1V5WA 2IW3A 1MABA 1R0XA 2DFKB 3LVRE 3V00A 1Q1ZA 3VHXA 1UM8A 1NG1A 2ONJA 4A9AA 4TT3A 4B3GA 3CKLA 2G88A 3QIAA 5AK0A 4HZUA 2ZSFA 5EE1A 4PQYA 3K0AB 1Q1BA 2IS6A 2D2EA 2J7PA 4DIEA 2CL7X 2FGKA 3CBQA 4MRSA 3EPJA 3C5HA 1IN8A 1N6KA 4QGFA 5KDLA 4YMWA 1X86B 2PEYA 2VSOA 3TUZC 2AN9A 5DIFA 2LKDA 3FKQA 4LJ5A 1ODFA 1BYIA 3U61B 1OFIA 3NDPA 5IK2A 3U4QB 3NBXX 5AJZA 1GFIA 4JIMA 2CE2X 2HV8A 3P4XA 2AKYA 4A6XA 1F60A 1WXQA 4HYYA 3SC3A 2Q3MA 1N0UA 3KJEA 1RW4A 3K09A 2WAYA 1N5KA 2GWHA 4K8OA 4A4DA 4PAQA 2J0UA 4B2PA 5FUYA 3T12A 2JLQA 1OXTA 3OESA 4HLQB 4PPNA 3RC3A 4Q47A 1Q1EA 3K70D 3QPUA 4D4JA 3D8BA 2WJHA 3MD0A 1CU1A 2P5TB 4GI7A 1NLFA 1Y63A 4V0MA 3KB1A 3LLUA 5K8TA 1XJCA 3A4LA 3U6BA 4MDEA 4KO8A 1TU3A 1E32A 4MGIR 4DCVA 4LRWA 4XVUA 2QT0A 3FMPB 1TQ2A 1XZQA 1GM5A 2XGJA 2GTPA 1T8TA 2I1QA 1N2CE 3PEVA 3QKSB 4G5GA 4UXIA 5DE3A 2ZRDA 1IJFA 1XCMA 2B7BA 2FFHA 1KDOA 2UZIR 5FBLB 3IDQA 2LCFA 2NGRA 4QKQA 2N42A 4Q4AA 1BS1A 4B3XA 3KX2A 1DAGA 3A37A 1P3JA 2NZ8A 5FBWB 3GFPA 5CDFA 2WTUA 4RD6A 4JZKA 1N5IA 2VBCA 3K9GA 5E3HA 1H65A 1LS6A 4QHTA 2CCJA 3GLHE 1XMJA 1IM2A 2RGNC 1MT0A 3BJIC 4PPGA 4M1MA 4HSEA 3CNLA 2ZRIA 3PEUA 1RYHA 3GLIB 1JR3E 1FP7A 1OXVA 1E2GA 2QQ0A 2VA8A 3U7HB 2R6FA 3WMFA 2GKSA 1E2IA 1ZAKA 3BH6A 3AGPA 3LLMA 2ZRMA 1Y3AA 2VF8A 4II7A 3U60B 4A15A 5HPYB 1XDBA 2EWVA 2IYUA 3U3JA 3MRSA 1E2LA 2WWGA 1NL3A 2CMKA 3PIRA 3PV0A 4TTQA 4C2TA 5DGXA 3K9LA 1W1WA 1L7VC 3B7GA 4OQLA 4ZCIA 2CHQA 3NH6A 4A82A 2OO7A 5EXPA 1KNXA 4LHWA 1VTKA 4R2HA 2K5UA 2ANBA 3KQNA 2V6IA 2PBRA 2HT1A 4F4CA 2A3RA 1FFHA 4TTRA 3EG5A 2HEIA 5LD2C 1N5LA 2C98A 1HURA 5D3QA 1AKEA 3TUJC 4B73A 2OXCA 3A4NA 2BJVA 2W00A 1P4SA 1X8LA 2J87A 1CIPA 3B82A 4UXHA 3LD9A 2ZSEA 2DYKA 1JNYA 2GZDA 1U9IC 3GPLA 2FH5B 5DYIA 1R7RA 2GJ8A 3KUCA 1RRCA 4B47A 1JECA 5M04A 3ZGXA 2TMKA 1NKTA 3SOPA 2C9CA 5KU1A 1CJKC 5EZ6B 3BB4A 4Q9JA 4NU0A 3LDAA 3Q9LA 5JFGA 4KXFB 1Z2AA 1KO4A 4W5WA 1YR9A 4NCKA 1AKYA 2BBSA 4MYHA 1E9CA 2IC5A 5HCIA 5AJYA 1NRJB 1X1SA 3WP1B 3NIBA 4KHZA 4BFTA 1UKEA 1VPLA 4OK6A 1Z63A 1XJQA 4PC6A 4RKEA 4EPWA 1QG4A 4P33A 3PUXA 3ECCA 1T9HA 3PUZA 1G3UA 2FSIA 5FPYA 3EXAA 2ZANA 2QGZA 4D26A 3ZZTA 4D80A 1CBUA 1U94A 3SQWA 2FDCA 4BE7B 4QRHA 4Q1DA 1A1VA 3MJRA 4LOAA 3B60A 1OXUA 4NONA 1M7BA 2KSQA 2B8WA 1GNRA 3GLHA 3K53A 1VCNA 1TF5A 4RY2A 3KFVA 2IS2A 2IT1A 1NI3A 2GVZC 4M1SA 5DNYB 4JVNA 4BLOA 1SXJC 1R4AA 2BMJA 5BXQC 4A2WA 2Q0HA 4O2RA 1IJEA 4Q4HB 1DVRA 1G8YA 3P20A 4F93B 2WPDA 1W36C 4LJAA 3RNLA 4A0GA 4B75A 2CNWD 2CL6X 1F2UA 1SKYB 2ZRLA 3EASA 2AD5A 3G5UA 3OEHD 4MGKR 3KL4A 3W6OA 1JQLB 2XTMA 3HP1A 3NVAA 1YZKA 4LX0A 2V4ZA 1GL9B 1GOTA 1A7JA 1G9XA 4EQ6B 2KI5A 2XSZA 2QPAA 1RZ3A 4L9SA 3ZIAD 3JVVA 1NVXQ 3QJYA 4JLJA 1NBME 1Z47A 4L4UA 2P0EA 2V55B 1XEWY 2H16A 2IYQA 3LNCA 2JJ2A 1W4AA 3TSWA 5BN4A 4FD2A 2PX3A 3CRW1 4BECA 4LSGA 1D5CA 1KI6A 3TRFA 2Q21A 1E9FA 3E70C 2PX0A 4GOKA 2RB4A 4TTPA 5JLJA 1ZM2A 2W6JA 3R7WB 4M1TA 4HLCA 2FPKA 4DCSA 4AY2A 1XTRA 5DLQC 5J5CA 2OESA 5G53C 4ASUA 1G20E 4URWR 1X8KA 4IEIA 5KNDA 3BOSA 1M6NA 2R6AA 3HR8A 2ODWA 5GADl 3Q7PA 4V0OA 3AKYA 3GP8A 1K5GA 1N6HA 4IHQA 2WJYA 5C46F 2CE7A 3FFBA 2YWHA 2P5SA 2QT1A 3CPJB 3EA5A 1RIFA 5DSZA 3IKJA 1YR7A 3GEEA 1VYUA 5EP1A 4CEJA 1C9KA 4B3FX 2FV8A 1JEDA 2VPPA 1DE0A 2EFEB 2QNRA 1NKSA 1ZVQA 2GETA 4FWIB 4QBFA 2RGAA 2FG5A 3T1VA 4TQ9A 4QGAA 4DCUA 2ZRAA 4LC0A 1JPNA 3ZVMA 2NTYC 1ELOA 4US1R 5DI3A 3THXB 1L4UA 2W0MA 2ZREA 3DMDA 4PC3A 2HCBA 4LYHA 5E7IA 2IYXA 3IQXA 5H70A 5DYGA 4LYJA 4DC9A 1P73A 2ZE7A 2OV2A 1EX6A 2GAOA 2J59A 4BUJA 2XZPA 2D62A 5BN5A 5BWMA 1GNQA 3L2OB 5HZKA 2WJIA 4F92B 4URVR 5CK4A 1FUUA 2QORA 4IJMA 2J1LA 5EJEA 2RHMA 4E09A 2B92A 1QHSA 1OJLA 2P6RA 1EESA 1SVKA 3N2IA 3L0PA 2H7VA 4L8GA 3AVXA 3ND9A 2R65A 4ITRC 3TSOA 4GSYA 3VU9B 4B6EA 2IUUA 1PUIA 3X1WA 4BQSA 1YJ5A 3WY9A 4N1AA 2ZROA 4Q4JA 4HDOB 1EFUA 1JAIA 3BXZA 4I99A 3KQHA 4BZXA 4KYUA 1QBKC 2JLUA 4JMPA 1J70A 3PITA 5L3SA 2BEKA 1MR3F 1EXMA 3AKEA 2PH1A 3GLGB 4MGYR 4HB4A 5JI3E 3VR1A 1XPOA 3MAAC 2A5DA 4G5SA 2PLFA 3H86A 4WVFA 2BBTA 4H9GA 5E95A 3P27A 4D82A 1NBMA 5EP4A 1D2NA 1T5LA 5FTLA 2HDNB 1S96A 1TF2A 3LVQE 2G9NA 3RHFA 1KO1A 1U81A 3QKUA 2WM9B 2YZ2A 2ZYUX 3KJIA 2G77B 1ZD9A 2IHYA 2VLIA 4DKXA 3K09C 4Q9IA 4ZKEA 4C0SA 2GK7A 1VCIA 2ONKA 4HAYA 1US8B 2JLZA 4JLAA 5B57C 4DB2A 1Z0JA 4M8NE 1XD2A 5FUWA 1M7GA 4QJ4A 2ZE5A 1I2MA 1EFHA 621PA 4JYCA 3W6NA 2BWJA 2W0SA 3S1AA 3DZDA 3AF2A 3E1SA 3TH5A 2RGBA 2ZRBA 2O8DB 4ACAA 4DLWA 2Z4SA 3CR7A 1W0KD 4EFMA 2NZJA 3P26A 1OT3A 1PZNA 2QN6A 1IY1A 3OF5A 1IXZA 4U5XA 3NHBA 4TWZA 4HAXA 3SYNA 1E2FA 2NIPA 2MSDB 4AI6A 1Q0UA 1DPFA 2H8KA 4A8JB 121PA 1XEXA 2QSYA 3PVSA 2IWRA 3SEAA 2WWHA 2OUKA 4HEJA 4IW3B 1TUIA 5HE9A 3MJHA 1ZU5A 1JQJC 3MMPA 4RFVA 2QM8A 4EFNA 2HF8A 4MRVA 1W7AA 1ZD8A 3B1ZA 3JZAA 3EPHA 5JCPA 2P67A 2Z83A 4CW7A 1N6NA 1XD2B 4M21A 3KXLA 3C7KA 3QF7A 3RRNA 4KFUA 1JR6A 1E9RA 1CEEA 1CP2A 2GCPA 2JATA 1F2TA 3VAAA 4U02A 4FI3C 3REFA 3ZVRA 4AIIA 2D7DA 5C4MA 1BYUA 2WWWA 3KJGA 3VKWA 3Q5EA 4ESVA 4LHXA 2HF9A 3LRPA 4B2IA 5JWHA 1TEVA 2IWHA 2V8OA 1GKIA 4TLDA 3C5CA 5AUPB 2DBYA 2PCJA 3FMFA 2XEXA 3H2YA 3MWJA 1KMQA 2B7CA 4I4LA 1ZM9A 3U2QA 2QMEA 4CT5A 4W7SA 2HLDA 2WBLC 1OH6A 2CVFA 3AKCA 1KOFA 4JJKA 4OL0A 3THWA 2YV5A 1Z0AA 2IA5A 1YHNA 4LYFA 2QEQA 1MRNA 3NBYC 2D06A 5EQTA 3RC8A 4TYYA 4LYAA 3U44A 2IXEA 4G5RA 2FE4A 5CLLA 5FI1B 4KFSA 3KXKA 1FX0A 4FN5A 3SR0A 1II9A 4DWJA 3RS3A 4U7DA 1P9WA 3AKDA 1XJ0A 4TYPA 2P6NA 3D6TB 5KUTA 1FQJA 1G4UR 1KK3A 4LJYA 4C0AC 2J0VA 3A1SA 3EZFA 5FBRB 3WYGA 1KTVA 1K6MA 2JLRA 1YR8A 4CT4B 1KKLA 1TADA 1MH1A 2BCJQ 5CJPA 4JLBA 2E87A 2ODBA 1Z22A 3RABA 421PA 1HA3A 2ZPTX 4ESHA 2OAP1 4Z54A 1BIFA 2EU8A 2O8BB 4KAXA 1CS4C 1SVLA 5FBVB 4CEHB 3FYHA 5CB8A 4A1FA 3W3ZB 2F1HA 3I3SR 5FR2A 1UEJA 4D4KA 1HE8B 2O5VA 3IPXA 5J4HA 4OJQA 3SI7A 3RS2A 4TQUS 3TW8B 1E96A 1JALA 4MKFA 1OHHD 5KSZA 4QM6A 2IK8A 2P2LA 5KNCA 1DO2A 1AS3A 2OM2A 5AUQA 2ZR9A 2EFDB 1J8YF 2O0JA 4QHSA 1ZUHA 1X8JA 1NJFA 1P61B 2IL1A 4TLCA 1V43A 4KU4A 4F4IA 2O8EB 2IEYA 4E03A 2VHJA 3GEIA 4XWAA 3BH0A 3BRWD 2DWPA 2R9VA 2ZEJA 2QP4A 3KJHA 1E1QA 1Z6YA 2QMOA 3IQWA 3VNUA 3AVQA 1BMFA 3TIFA 5JS8A 3I73A 3T1TA 2ZVQX 3PG5A 2GJ9A 1KI7A 2IYYA 2ZRPA 2OCYC 2PZGA 2ZI9A 4QBGB 2NO9A 1Z0IA 3IBYA 1ESNA 2P6UA 1OFUX 5TY0A 2JLWA 4AKHA 1AGRA 1Q57A 1W0JA 2IUSA 3MUFA 1SQ5A 2FFBA 4P32A 4PAMA 2GBLA 3RDPA 2WIBA 3WHKA 2QP3A 2ORIA 3K0FA 2ZR0A 1H8HA 3I5YA 3UMFA 4DDWA 1N0WA 3TBKA 4ARZA 1KJZA 1CJUC 2EFHB 2R6CA 3WMEA 2ZRHA 4B48A 3EPLA 1QHNA 3ZD6A 221PA 1DADA 1VCMA 4NH0A 4B44A 2CJWB 5FUVA 4IXMA 1LY1A 2ZS7A 4LV8B 4CYMA 1I4LD 4CEIA 1E4VA 4MITA 2A7QA 3AQ4A 3LFUA 2RGDA 4Q1AA 4DUGA 4O0MA 2ZJ2A 1T5IA 3PEWA 1MOZA 4HAZA 2CHGA 2BEJA 4K81B 3NG1A 4LJ6A 3GLIE 5EXTA 1XPRA 5IF9A 3B8HA 2IF0A 1CR2A 2V7QA 5UKDA 3K70B 2NO1A 4LJ9A 1BKDR 1G8HA 3QVVA 3DPUA 4OKSA 3D31A 1E0AA 2ZJYA 1E0SA 2H18A 3H4MA 2BM1A 3QEJA 1Q22A 1S9HA 4M0LA 3QXJA 4DEYA 1ZUNB 3C41J 1E1RD 2XJ9A 3CH4B 1G5RA 1OW3B 1COWD 2NPIA 3CX8A 5TDHA 2A5YB 3K0AA 3UMSA 4C9BA 1R0YA 3NC1C 4GNKA 4LK2A 4S2EA 1R5OA 1XB2A 2VP9A 2DR3A 1T3HA 1E98A 2FNAA 3K9NA 1DS6A 1T91A 3EIQA 3UKDA 5JRZA 2A5JA 3KKQA 2ATXA 2OXRA 4M9ZA 2GEDA 4DLUA 2EYUA 2XZLA 3HU3A 2GHIA 3L8YA 2PJZA 3U4QA 3F5FA 1ONBA 1P2SA 2F43B 5SZHB 3A8TA 1T8UA 2CEAA 4NCNA 4PFSA 1TEXA 4WZAE 1UBEA 1LNZA 1W5TA 4I1VA 4X8MA 5DISB 2QM7A 2ZSDA 1Q44A 3W6PA 1UAAA 3PQCA 4ON9A 2BBWA 2AL7A 2G0TA 3VX3A 4JBXA 1LF5A 2I1VB 1QVRA 4MKGA 3R8CA 4Q7LA 5FTKA 3QKRB 5JWOA 4OI0A 1FTNA 1D9ZA 4EAQA 3AVYA 3LW8A 4GRAA 4OHVA 1WA5A 4RJLA 3LQQA 4Z8XA 3R9IA 3SE0A 4C0KA 2E1RA 2XOKA 5JI2E 3AB3A 2Y8EA 3REGA 1WCV1 4W5HA 4P0TA 1PLJA 2OZEA 2OBMA 2MSCB 4PO9A 2QZ4A 3UG7A 4C0BA 5TMPA 4DSNA 4M1OA 1TUEA 2ZI7A 3DVLA 3BE4A 4QFMA 2VHQA 5JHGB 1YR6A 4JSYA 1Z6AA 3QKSA 1VYTA 3MFYA 3X1YA 2CDNA 2KB0A 4BLSA 2GCOB 2VP5A 5CYOA 5FTJA 4DLZA 3ZD7A 3PEYA 4P3YA 3KKMA 2R2AA 4JL8A 2OSBA 2BKUA 3OE7D 4XWOA 3PCRB 2JEOA 1PLLA 1QF9A 2AHOA 3RVBA 4BFXA 2XNSA 1U98A 3DHWC 4V0LA 2Z5FA 1IN5A 1WF3A 3H0KA 1XEFA 2ZUBA 4OQXA 3AVVA 4A36A 3AM1A 1C4OA 4XSHA 4RZUA 2YHSA 4TN1A 2QA5A 4RD1A 4ILEA 2J9RA 2WKRA 1R8SA 1SXJD 3Q72A 4OQNA 4P4SB 3NTUA 1W2GA 3QVUA 3TAUA 5DN6D 4AYWA 3A36A 2EYQA 2FEOA 1YRBA 4B76A 4Z1MD 3GLIA 1ZINA 4KI0A 2R6GA 2C5LA 3I61A 4BLPA 4JKYA 2J5XA 5GJBA 3TW4A 5C4GB 4LGMA 5B30A 1NY6A 1XEWX 2WSSA 2H1LA 4NBSA 3ZDQA 1BO6A 4DSUA 1SKYE 3AH8A 4LJ7A 3IBGA 1HEIA 2O8CA 1HTWA 2ZS9A 4HAVA 2PEZA 4F7WA 1XD9A 3AF3A 3WXMA 3NKVA 2GAAA 2A30A 5CIWA 1JPJA 5LB2A 1CR4A 4NCIA 4A0RA 4GL2A 1HUQA 4NP6A 1KSGA 4D0NA 1TL7C 4MA4A 4ABYA 1ZU4A 3THYB 5A0FA 2VSXA 1SVWA 2Q9AA 3FDIA 1QRAA 5FOTA 2IYRA 1NMZA 2AD1A 4TL9A 4I1OA 5TV2A 4D81A 1DAEA 2ERXA 5CK5A 2QI9C 5CM9C 1TQ6A 3CRQA 4JLNA 4JBYA 4V03A 5BYJA 1CRQA 1T3SA 2QE7D 2QP9X 4MYUA 4A2QA 4DHEA 1M7HA 1MV5A 1R5NA 1JEEA 2AR7A 4JKIA 2G83A 5KSYA 3RWMB 3SBDA 1GWNA 3QXXA 4PAOA 3RRZA 1D2EA 4PSVA 3T61A 1G3QA 2O8CB 4EPRA 2WJJA 4XTCS 1SZPA 3E5HA 3AF4A 4ZPXA 2EWWA 2WKQA 2CBZA 3OFNA 3MWLA 1YQTA 2C78A 4GPTA 3HJNA 2DHRA 3GCGA 5EUMA 1VDZA 4KLZA 4C0HA 2VHUA 2A9KA 1AZSC 4Q5IA 3TGPA 2NMVA 3BFVA 3BIFA 1FW6A 3C16C 4G01B 3U3KA 2ZRJA 3HU2A 4V02A 1P2TA 1P2VA 2XAUA 4CGZA 1U8YA 3B1VA 3CX6A 2ZJOA 2IS1A 1KMHB 1NIPA 2PT7A 2ZRKA 3VR4A 4AD8A 5GVRA 3DZ8A 5F98A 1W49A 4DLYA 4YMVA 3CRMA 2YNMA 3FWYA 4D25A 5JMTA 2OBLA 3QSYA 4GOJA 2WWIA 1UBCA 5H68A 4LZZA 3VQTA 4DLTA 2WWYA 1KDTA 2C96A 5FL3A 5J4VA 1PV4A 1VHTA 3EPKA 1NF3A 2Z6VA 2GEUA 4IDHA 3PJRA 2ASEA 4FCTA 1MO5A 4CDGA 1KK1A 3CRRA 3NC0C 1LF0A 2ZYVX 4M9SA 5F9HA 4OHYA 4OJKA 3W5JA 4AKIA 3ZVLA 1EFCA 4AWXA 2YJTD 5E7MA 5HR5A 4TT3D 4Q9HA 2ZUDA 3OIUA 4NL4H 4L5BA 1OLOA 3QBTA 2B8TA 2D2FA 3TKLA 2J7PD 4Q03A 1E9BA 2D4HA 3LY5A 3CNNA 1OXSC 2F3RA 4XD7A 4Q4HA 3RRYA 3V4RA 1G64A 4IEEA 2G3YA 2LWIA 1R6BX 3LBHA 4QXAA 4QBIA 3RSLA 2ZETA 4UNQA 4KODA 4JLVA 5H8WA 3C4JA 1OYWA 1FOEB 2ZTSA 5IK2D 3GLGE 4DLXA 2ZVPX 1P6XA 2R62A 3K1JA 3TR5A 2V54A 2VYFA 4PPFA 1ZM7A 5J4LA 4EQ6A 1EWRA 1SGWA 1LTQA 4D4MA 1JXMA 1GUAA 1L4YA 2QSZA 1AZTA 2D3WA 1AN0A 4JLKA 3QF4A 2QU8A 1GRNA 4WIAA 1OB5A 4B43A 2VO1A 2AFIE 1BH2A 3LH5A 4IVRA 3EA0A 2BOVA 4B6FA 5L3QB 3GQBA 4HLDA 4IOJA 3LA6A 1W4CA 4OQMA 4F4JA 2O8FB 4YDHB 3FGNA 4RZXA 1JR3A 1HE1C 3QNUA 2X1VA 4QG7A 3R7WA 5IHPA 3IUYA 2ZUCA 3F0TA 3TK1A 5HZHA 3CF2A 2QY9A 2X77A 1H8EA 4M2LA 1Z6GA 3ZS9A 4JLMA 1E69A 4UKDA 4NZYA 2WMOB 2DFNA 2F1IA 1IY2A 1E0JA 1IHUA 1GITA 3AP2A 3MGCA 4WAUA 3H84A 4XVRA 2JIZA 1UPTA 5K8IA 2RGEA 1HT1E 4URZR 3EARA 4LUCA 2JJ1A 4IXNA 1TX4B 5HCNA 5CM8B 4EPYA 4DDVA 3QF4B 1DAFA 4IFBA 2GF9A 2VH5R 2GBLC 5FL7A 2UKDA 3X1DA 1XMIA 1MO6A 1P72A 4W5JA 1Q1QA 1OV4A 1I4DD 3IIJA 3GJ4A 4V0NA 1F5NA 1XX6A 5BW8A 3D7MA 3CB4A 3X1XA 3K0CC 5AJXA 1KAGA 3THXA 5FOUA 4LJ4A 5SZJA 1NVVQ 1VG0B 3NWJA 1AIPA 4CIDA 1KJYA 1WBDA 5HKKA 4XIGS 4FXPA 3DMNA 4JVMA 4YXWA 3PUVA 1QVAA 2XXAB 4N0DA 3OEEA 4LBYA 3SS8A 4DLSA 1E4YA 4D0LB 1TU4A 2KJQA 4NYMQ 4RSGA 5L3VA 3FMOB 1CR1A 2CCGA 1Z29A 3K0SA 1U2RA 4NHOA 3VU9A 4HB0A 1KI4A 3WHLA 2H17A 4KBGA 3KUDA 2H57A 3AP1A 2O52A 4Q00A 1E2KA 4XTRA 3LXXA 4QC2A 5IRCD 1KY2A 2YWFA 1S8FA 2FU5C 4O25A 1YRAA 4XH9B 1DG3A 3NHAA 2N1BA 4YC7A 1FQKA 4C30A 4QOSA 1P7CA 3EAQA 3GLGA 1U8ZA 4GBMA 1RRPA 3X2SA 2CHVA 3IEVA 4FINA 1QHIA 3CZPA 2YVUA 1UEIA 1E79A 3ICEA 1E2MA 4AG6A 3NXSA 4OYHA 1G3RA 1T4GA 2XNDA 2WZQA 1RFLA 4HB2A 1VG8A 2FPLA 2ZRNA 5EP2A 4ZDJA 2SHKA 5JHHB 2QAGB 4IVPA 2FGJA 1OB2A 1EFRA 1U8AA 4KLNA 1Q3TA 1AS0A 3ZZUA 3SYKA 4KFRA 5KOYA 3CO5A 1US8A 1K5DA 2EQBA 2H5EA 4HUQB 1OPXA 1II8B 4R98A 5LBIA 1CXZA 2ZAMA 5FFMA 1G21E 5EE3A 1JJ7A 3AVOA 3EWAA 4FMCB 3KKNA 3KXIA 1NLZA 2ZSAA 1DAKA 4G1UC 1G19A 2G1KA 3FFAA 4BPBA 2XX3A 1W4RA 3GD7A 2O8DA 2ZQ5A 4IFEA 1KI2A 2ZYTX 3F3YA 3T1OA 2VHCA 5JJLA 1KO7A 4RD0A 5AJVB 1CJMA 1KSJA 3M4YA 3VX4A 3AEZA 1I2DA 1G8FA 4PC1A 3BORA 3X1ZA 3IILA 1X3SA 2GXUA 4JLPA 4A8JA 4JLOA 3ZLJA 3KFXA 1RJ9A 1W36D 3QBVA 5KSOA 3GJ0A 3DKPA 4I1SA 2BJWA 4IDOA 4OK5A 1G8PA 4RCYA 4FW9A 5DO9A 1OSNA 1J90A 3CM0A 1G3MA 2ZE6A 2GXQA 3VFDA 3VKHA 3KDSE 4Y0AA 1E2NA 2JDIA 1D8TA 1KI1A 2IUTA 3U7GA 3CWQA 1WDTA 4ZI2A 4TYWA 3W9YA 2IX3A 2KWIA 1VCOA 3BD9A 3CPEA 4LY6A 1S0UA 2WPDD 1XTSA 2R6DA 1U90A 1XCGB 3UK6A 4OK3A 3ETLA 2PZEA 4GP7A 3FMIA 3VKGA 1OIWA 1XMVA 4QNMA 4HZIA 1A4RA 1XFAA 3B6EA 3Q85A 4AURA 1VMAA 1T0HB 2AK3A 3DKVA 5BN3A 4ACBA 1Z6XA 2XSZD 2HJGA 2HJVA 3A6PC 1E9AA 1RJ9B 2WJVA 3I92A 2JJ2D 1OKKA 1ZD1A 2RAPA 2JLVA 2YC4C 3TNFA 4QGGA 5FR1A 3ADDA 2GF0A 4URYR 2PL3A 1YZUA 1RRGA 3IIKA 3U7FB 3BH7A 4Q21A 4EIWA 4KBFA 4KJZA 3D3QA 2W6JD 3TAHA 2NO7A 2AXPA 2WWFA 4M1YA 4ASUD 4M4SA 1E9DA 1SVMA 2ZU6A 3O8RA 4PHTA 2OCAA 3Q7QA 3VMFA 1II0A 3PUWA 1VIAA 1RC8A 1WQ1R 1ZM4A 1MO3A 4AYXA 2JASA 4HATA 4QJ5A 2O8BA 3EZ6A 3GJXC 3TQCA 5CLQA 3U5ZB 4CEHA 2OCBA 4TZ6A 2O0KA 2CL0X 4RD2A 2VL7A 4RVCA 4AK9A 3VR5A 4JVSB 3WNDA 5LPNA 1P9RA 4ZIRB 1NN3A 1TAGA 4PO1A 4GZLA 3RLFA 3NBZC 1HH4A 4DBLC 4DDTA 1OH7A 4TMXA 2JAQA 2GJKA 4E07A 2J7KA 4BEJA 5FPHA 3A4MA 1OF1A 2J41A 5J4YA 3ZQJA 1QHXA 5FOXA 1ZM3A 3IHWA 1PJRA 3QXCA 4KV9A 3WBJA 3UMRA 2O8EA 2D7CA 2WSMA 3OAAA 4HI0E 2QAJA 1Z07A 2Z4RA 5EXSA 1E6CA 5BQ5A 3FKSA 4TL6A 3B5JA 3OIYA 2W2VA 5FBQB 4NYJQ 3FHTA 2IYLD 4DCTA 4DJTA 5FOSA 2GA8A 1Z0DA 2W6IA 4RFSB 5FPTA 3TLXA 1ZCAA 1JJVA 2YOGA 3ND8A 1XBTA 2YWGA 4N0EA 1E99A 3G0HA 2C95A 1NN1A 4OI4A 1S9DA 4PXAA 5AR1A 3QPWA 5K8LA 1XTKA 1XNJA 3B78A 4NTZA 1N0VC 1SVIA 4DB4A 3RYTC 2A78A 3RS5A 1Z3IX 3OZXA 2VRWA 1Z06A 4JSTA 4DVGA 3GLFE 5HE8A 3TVTA 2G0NA 3AF0A 1YZNA 5SZIA 4C7OA 1QHHB 1G7RA 1UADA 3W8RA 2P65A 1EGAA 2CJWA 1NSTA 2OHFA 5DHAA 3T1QA 3NDBB 1CR0A 3AVUA 2ZJZA 3Q3JB 4TSFD 1NP6A 3SJZA 2GEVA 4XWKA 4XOIA 1I4TD 4Z8YA 4BASA 4C4PA 1EWQA 4TMTA 1OFTA 1HV8A 1HQCA 4UNSA 2V9PA 2GDJA 5J47A 1LB1B 2WICA 1ZC4A 1NBMD 5FTNA 2J0SA 2XB2A 3B13B 1FPMA 2VP4A 2BKEA 1UBFA 2WOOA 4RCZA 4UNNA 5JJIA 4NE2A 1R8QA 4DEXA 1RE0A 4ZDIA 2FMXA 5KDDA 2J3EA 3BK7A 1LW7A 2F1RA 1G17A 3FHOA 2IEZA 1UKVY 2WKPA 3QG1A 3ZS8A 4A0HA 4ZDKA 4LBZA 4C7OB 4CF7A 1OH8A 2Q3FA 4IOMA 3RSOA 2IBMA 3AVTA 5TB5A 4L15A 1S1CA 3K0CA 4IVQA 5GJVC 4L16A 2VQSA 3IEUA 3T35A 5A4JA 3EX7C 2Z43A 4PHGA 1X6VA 3VTKA 3EC2A 5D3MA 3W8NA 2FOLA 2Z0MA 3BGWA 5DI9A 3DM9B 1N3BA 4O3MA 2DY1A 4JS0A 2WVJA 5EE9A 3FVQA 3KKOA 1KGDA 2Q6TA 1A2KC 1IQPA 2QG6A 2N46A 4IOKA 2F43A 3W5IA 4X8LA 1WRBA 3MCAA 2GESA 3QXHA 4JVLA 3VNVA 1D9XA 1OIVA 2C8VA 1KZGB 3G82C 2X2FA 2RH5A 3B1YA 5EXXA 1T6NA 1OIXA 4UJ5A 4V0ME 4LHZA 4Q9KA 1O87A 2X2EA 2WAXA 1WP9A 1VG9B 1R10A 2RGXA 1G5PA 3SZRA 1OYYA 2ODNA 3UXMA 4EFLA 1F6BA 2HT6A 2RGCA 2CK3D 3QKRA 3QPVA 2BCGY 2D74A 2PCLA 1G1MA 2ZI3A 3GEHA 2ZI4A 1AQUA 3ZQ6A 3B9PA 3BAFA 3N5CA 3PR1A 3LQRA 4LPSA 4Q4LA 3P32A 2Q9CA 5D3MB 4OHZA 4OHXA 4BFZA 1G7TA 1DOAA 3CWZA 4MQBA 4WBSA 3U7EB 4WOPA 3HYTA 4KVAA 1NMXA 2RKOA 3CUEF 1FP6A 4BFYA 5JEEA 5JCZA 3CIOA 1Z08A 3B9QA 2HLDD 2GXSA 2GCOA 3V9PA 1PLKA 4YDSA 4DSOA 3MWYW 3L0SA 5KO2A 3NBFA 1ZYUA 4YQFA 5AUOB 3I1FA 3H1TA 4W9MC 2OFOA 1DELA 2UZ3A 3ADKA 2ZM5A 1ZJ6A 3TQFA 3MLEA 3WNBA 2FA9A 4BLQA 4P31A 1ZP6A 4P4TA 1G5TA 2DFTA 5GJWC 3CR8A 1GAJA 2FN4A 1UKZA 1TMKA 1IXRC 1ZNYA 2BMEA 3DEFA 3R20A 1CF4A 2VTKA 1U99A 4P4SA 3LO5A 1GRQA 1ZC3A 3VHLB 1IXSB 1SHZA 3A1UA 3BB1A 2GNOA 3KTAB 4JL6A 1C1YA 2GRJA 1G6OA 2WHXA 3T5GA 3BWDD 4GOXA 4C3ZA 4PPQA 3ONWA 2QBYB 3K9HA 1AGPA 4MKHA 1G7SA 1XWIA 3WNCA 1ZRHA 2MMCA 2WV9A 3EZ2A 4FMCF 1A5TA 4PQFA 2ANCA 2OILA 2FJUA 3GFTA 3MG9A 4NKRA 4PANA 4D6PA 1ZBDA 5KHOC 1W44A 3TR0A 1RPZA 4Q1FA 1HQYE 2BC9A 4C0QC 3GLFB 5FTMA 3EW9A 1FNNA 2KBEA 5KPDA 3CF6R 2ZXUA 4LC1A 2RHDA 1RYFA 1G7CA 2L0XA 3DO6A 2ZJ5A 4PC2A 3TJZA 3IO5A 4DLVA 4OBEA 3THYA 1WMSA 1HT2E 1NJGA 4TL7A 4GP6A 2HXSA 4FWTA 4OHWA 1JXOA 4QNRA 2UVQA 4M22A 3SJCA 1AK2A 1AQYA 1E1QD 1G3IA 1Q3HA 1E2QA 4DCNA 1BMFD 1ANKA 4TL8A 1MABB 4ZO4A 2F7SA 4G5QA 4B3BA 4F91B 4P4UA 2GXAA 4NYIQ 2QL6A 4X8OA 3HPRA 1JB1A 4K46A 5CIQA 2AKAB 4HZUB 2VP2A 5H1YA 4TYQA 4A8JC 3O8BA 5CITA 3QI2A 2GK6A 3L82B 1W0JD 1KJWA 3O8DA 4PHHA 2F55A 3I62A 3UANA 3IPYA 3FHCB 4Q1CA 2JLXA 4MRRA 4URXR 4NDZA 1H8HD 1KI8A 1N6LA 4BFUA 3NH9A 2EW1A 2ZSBA 2NO6A 2CNWA 5CB6A 1W4BA 3OEHA 1KNQA 3QEOA 1E3MA 2KBFA 2GZAA 1AM4D 1YZQA 2GZHA 1O3YA 2IYWA 3AVPA 4ZDWA 1KDPA 3ZIAA 2MSEB 3T06B 3I8XA 1D2MA 3EIEA 4R2IA 4DUGD 1KMHA 3FPAA 1TTTA 1S3SA 1XTIA 5E4FA 2BVNA 2QTVB 3U6KA 2J0UB 5A5GA 1ZUIA 1NVWQ 4EPXA 4TMWA 5BYKA 1BOFA 2HXYA 4GZMA 4G5OA 2V7QD 3WYAA 1P9NA 2DFLA 4EPVA 1CLUA 4FMDB 4NCHA 1KI3A 4QGHA 3OIWA 2RGGA 3ASYA 4Q02A 1R5BA 1OXXK 2BBOA 3CH5A 4B71A 5FH9A 1F48A 3L0IB 2QPOA 3KB2A 3FTQA 3GFOA 1M8PA 2IF2A 1G6HA 2WIAA 2OEPA 4URUR 5KYKA 3RWOA 3B2EA 4BZPA 4D4LA 4MYCA 2BHRA 4WZBE 1NN5A 2W58A 3SNHA 3U3MA 2FWRA 1NMYA 5L3RA 4CVNA 2HCJB 4MRPA 3A1VA 4Q4AB 4B32A 4BRUA 2NPFA 1CJTC 3HR7A 4BEBA 1KYIA 3LV8A 1E2HA 4TLBA 4AG5A 2FZLA 1W5SA 5DH9A 2PJRA 1PVOA 4OI2A 1W47A 2HUPA 2JLSA 2A5GA 2QQEA 4JLDA 4EJSA 1FNMA 3CW2A 3K8YA 3BBPA 3AP3A 2BIFA 3LXRA 5TVKA 4UNPA 1W48A 2FSFA 2QRNA 2RCNA 4MUBA 1XCPA 2OLJA 4LV5B 1KHTA 3B1XA 4YLGA 5JECA 2HYIC 5EP3A 4TLEA 3ICQB 4NPHA 2A2ZA 2I3BA 1M2OB 4PHFA 1ZMXA 1XU4A 2QGNA 1JAHA 2FEMA 3ZH9B 5L3QA 2YKGA 2O8FA 3AV0B 4BRWA 1YVDA 2XOKD 1ZIPA 2C77A 3M1IA 2OBNA 2H92A 4PR0A 2EFCB 4JJZA 3N70A 2PMKA 3BFKA 3C8UA 1S1MA 2OFXA 2V1XA 4B33A 2ZRFA 2NOAA 1GZSA 1FMJA 2YYZA 4EJSB 5C18A 1CRPA 1IN6A 4EUNA 2ZITA 4QL3A 2ZS8A 5J40A 3RANA 3GMTA 1NG9A 1J8MF 1SULA 4NYIR 5CJ2A 1CULC 3PXGA 2V1UA 5ANRB 1MKYA 2YWEA 2IYSA 3I5XA 5F9FA 4MGZR 2QPTA 3N2EA 1AJEA 2ZIAA 1JBKA 2OCPA 1SHKA 4M9XA 3WRYC 4RZ2A 4BFVA 4R7ZA 3QG5A 3Q5DA 5JRJA 2IYVA 2FSGA 3SHWA 3WMGA 3KQLA 2F3TA 1NIJA 4TQAA 2W2TA 3DOFA 5KTYA 1GVNB 4YMUA 3SBEA 1GSIA 4IDQA 6Q21A 3CRVA 4GT1A 1Z0KA 4AC9A 2B21A 2VHTA 2REXB 3QKTA 3WP0A 1XXHE 2CLCX 2WSSD 1VHLA 3ZZ0A 2ZU0C 5G41A 3CF0A 1NLYA 4DXAA 2XXAA 4D0GA 1QZXA 4C0JA 3K70C 4LBVA 1YZGA 4DDUA 1GTVA 1J2JA 1PUJA 3FE2A 4OI1A 4XSGA 4PO8A 1JI0A 1HYQA 1E2JA 1IN4A 3J81k 5GVSA 3DDCA 4JT4A 2F9MA 1W0KA 3E2IA 2ZI5A 3AUXA 4KCGA 4KYIB 5CYPA 3WYFA 1GKYA 5F2EA 3TMKA 1T3LA 4LPKA 3JVUA 4F38A 4QJ3A 4XVQA 4HLUA 3OIVA 4PX9A 1UBGA 2CVHA 3THOA 4QBHA 1LS1A 3U3OA 4MKIA 1XTQA 4GDFA 4LWZA 2PT5A 1XPUA 2QMHA 1Z0FA 5KNBA 1UFQA 2IYZA 2X19A 3UPUA 1W36B 1VIYA 5AJWA 2ZJ8A 1FZQA 2DWQA 3M0EA 3GLHB 4BZQA 2F6RA 4KFTA 1E2EA 4S35A 1DTSA 2X8AA 1XD8A 3AGQA 2WMNB 4OQFA 4A92A 4BLTA 1K8RA 4YMSA 2W83A 2YOHA 2OE2A 1SVOA 1YE8A 1KIMA 3OFND 3V4FA 1QHYA 2QAGA 1E94E 1G41A 1NSFA 3QXSA 2CLSA 1P5ZB 3L8ZA 3LX5A 5DHFA 3C15C 1N5JA 4HDCA 5JZVA 3JZMA 1F2UB 2ATVA 2V6JA 3GJ8A 4Q7JB 2XZOA 3EWSA 3FOZA 2FZ4A 4MYTA 3L43A 2GJSA 4HUQA 1NN0A 2ORWA 1II8A 1KSFX 1GIAA 5JWRA 3NEJA 4RZ3A 5JSZA 1DARA 1ESMA 3LW7A 4GMDA 3KZ1E 2AXNA 4FCWA 4RD3A 4BLRA 1CKEA 3B85A 4Q01A 3ADCA 1T0JB 2PZFA 1QHGA 3I32A 1WBBA 3GJ3A 4KITB 4WW0A 4FIDA 4LDJA 4ZV4A 1ZNWA 2QRZA 5J4KA 1KI6B 4TMKA 4TYNA 3LX8A 1DBSA 5K8UA 3SQXA 5KSPA 4AYTA 1Z83A 3BFXA 1EK0A 4B35A 2PMDA 5L8VA 4DRZA 1EFTA 1XZPA 4QHYA 4M9QA 3QUSA 4RKFA 1XTJA 4PQRA 3GJ7A 1E2PA 1G16A 1P2UA 5KDOA 4MRNA 2J46A 5FI0B 4JT2A 1KO5A 2C04A 4A6PA 3I8SA 5JSZB 721PA 2C9OA 3QY0A 1AA9A 4UXJA 2QMUA 3U3RA 4CEJB 4XD7D 3GJ5A 5IDVA 2C99A 2XTNA 1NY5A 1XXHA 1YU9A 2AFHE 3P4YA 4KSCA 3EIHA 1GL7A 2NQ2C 2RMKA 1Z5ZA 1QG2A 3BC1A 4WA7A 2KE5A 2Q3HA 4RD4A 3PENA 3MSXA 2IHBA 3IGFA 1LFDB 2WJGA 2G1JA 4HB3A 1G4AE 1OHHA 2QROA 3SN6A 1L2TA 3IHLA 3DOEA 3NEYA 3OHMA 4EKDA 2ZAOA 5DI3B 1IONA 4FMBB 1CTQA 1DAHA 2NG1A 2REBA 4DSTA 5EUQB 1P62B
chains in the Genus database with same CATH superfamily
1P74A 2JFUA 2Q0XA 4MVCA 4O4LF 4XB2A 2WIFA 2P2SA 1QGYA 3LCVB 3C39A 3PNSA 2VDPB 4Y0VA 4YMTA 3BRWA 2ODEA 3PHIA 2MSWA 1B23P 1CQWA 2PL9A 2H1WA 1P2GA 1J97A 4KGDA 1TEZA 1S4QA 4Y9UA 4I1UA 4R54A 1JR3D 2VSNA 2WIKA 4XR9A 4RA6A 1RAAA 4UFOA 6YASA 3M6XA 3DJFA 1F9EA 1PEAA 3A1WA 4IH4A 5B58C 1XXHB 1TKRA 1N25A 1R0ZA 1EG7A 1SC9A 2C3PA 2HCRA 1FUKA 2ONYA 2I7XA 2YHBA 2XDYA 3UO8B 4AKGA 3ESAA 5D00A 2C31A 3HFJA 3II6X 2OZVA 4EGFA 1X7DA 2E18A 4LI0A 5LMUB 2QXYA 2ZIGA 3QM1A 2JI8A 4V3BA 1A0OA 1XF9A 2DBVO 1LZLA 1W59A 3FNGA 4MTLA 4QVIA 4BGVA 1R6TA 3WO0A 1CYDA 3WLAA 4GSLA 2FX3A 4WXRA 2L18A 4OUDA 3IALA 1KZ1A 3Q6IA 1T9ZA 3T54A 3WSVA 1YB4A 3HXOA 1M6YA 4OYLA 3RYCA 4GW3A 4M8LA 4MHTA 3BCHA 2ZI6A 4XPIA 3ZJYA 3WL8A 5L3SB 3EIXA 2PBZA 3WXBA 1N1DA 4Q66C 1WBJB 4R4JA 5FL7D 3HXLA 2NP6A 2BCEA 1EHIA 1S2LA 2TMYA 2LBPA 1MXHA 1PNVA 1ZMRA 3MAJA 2B8EA 4HSGA 3L7MA 4CHGA 1GRRA 3ZE8A 2EXXA 2X14A 1VPVA 4JXJA 1DC3A 2IQIA 3W34A 1ZCBA 5IBRA 1F6DA 3N07A 3RRMA 3BA1A 3D5TA 1XYYA 3FTNA 5CHEA 4TV8F 1TPZA 5HKKD 3A6JA 1ZGCA 2A94A 3MPUA 3OIFA 3T3NA 3B6MA 2O5CA 4ARCA 1Z8FA 4YV7A 3NOXA 4B81A 2HWXA 2C9ZA 3P0JA 1K9VF 5BV8A 4Q48A 2FQQA 2D1TA 1QHFA 5HP4A 2Q3EA 1ORRA 1PGJA 3JARA 3HYRA 1J7KA 2X1MA 4PNEA 1C4XA 1X74A 4FSHA 1IG3A 1W94A 2C9DA 2JK0A 2SECE 2YY5A 3UWOA 4IDNA 3WYDA 1LPMA 2JA1A 2W2XA 3M6MD 4QSHA 3ZDYB 1NVFA 1XNRB 3IIMA 3IUJA 3O47A 4HRXA 4UQOA 2HZBA 2ST1A 2WWXA 3D6AA 4ZXPA 5DX1A 1MPTA 1G21A 4MV8A 3EZ9A 4G9GA 4J0KA 2BFOA 5E38A 1UXHA 1U9IA 2O23A 1UDWA 4UNRA 3DMPA 5LYJF 4FI3F 1SPXA 3IH5A 2YJ6A 5FNZA 5TEVA 2JBHA 2OHIA 4W4TA 3T4PA 4ZYLA 5B2EA 4BB6A 4QAJA 3RIYA 2POQX 4Q9AA 3K9CA 1XEXB 2GD1O 2GYWA 4C4SA 2VZ8A 4LK3A 2OAEA 2MIIA 3AUAA 4JR2A 4HYEA 1AKVA 1E92A 1MRSA 3P9QA 2EF1A 2ZE8A 2GBFA 4BGIA 1YKSA 7ADHA 5KYWA 3OA0A 1V2GA 5KPJA 5K2MA 1NKVA 2Q7XA 4NMXB 4R7TA 2C2HA 4HADA 4CZ2A 3I72A 1KK2A 3DV2A 5LD2B 1UF9A 4EW1A 1IJBA 2P9YA 1N7IA 4B3DA 3ON5A 2M6SA 4YRJA 1KZ7B 2LUOA 1NXWA 3GEDA 1RHJA 2RHJA 3L6CA 3DEJA 2BGGA 2JGNA 3N86A 3PL5A 2CUKA 2OBXA 4RAOA 4N6OA 1M33A 4WMLA 4F97A 5I51A 2IOQA 3VO8A 5F3WB 4X8HA 4UMVA 1WUTA 4G8CA 4QUDA 2AFHB 5KKNB 3SYTA 3TBFA 4H7KA 5D87A 4YRBA 1ZH0A 2WVAA 3HA3A 3AF1A 4YJGB 2BH9A 3NANA 4JN6B 1JVNA 1VP3A 5DF1A 2ACVA 5AVOA 2Y1OA 2MU1A 1BJRE 1GR0A 2CLDX 3C3AA 4KQFA 2CYCA 3SFZA 2HMTA 4RHEA 3OE7A 1P8JA 2PKRA 4LKRA 1JSLA 3ZV7A 3IS3A 1R37A 3H5LA 3O4VA 2PAFA 3U44B 3Q10A 2R4TA 1HY3A 4C0WA 3DTVD 4CG0A 4O4JF 1GP2A 4L9WA 3AUJB 3WRXC 1PI3A 3K0EA 3EEIA 3ONEA 4LGVA 1IY0A 4JJAA 1ADCA 4EB6B 3F5DA 2I5PO 4XI9A 5E7QA 3TF5A 1LKZA 1UODA 1MEOA 1K89A 3DVAB 3VSEA 3R9XA 1A4XA 3UATA 3LHIA 3UK2A 4TKVB 5HQJA 1JKXA 1DG1G 1HF3A 2XITA 3SEFA 1FF9A 1KK0A 5LXTF 3THRA 2LKCA 1FFBA 4Z1MA 3ACBA 5GPBA 3FRJA 3CLVA 5I9SA 5CFQA 2QENA 5LNK1 2M6RA 5GV8A 3I6QA 1SBNE 3DZJA 3I5UA 4BVLA 1I94B 1QU2A 4D9BA 3DUWA 1DKUA 2XJ4A 4GX0A 1GILA 3C3YA 4NJEB 2XTZA 4YVFA 4ETIA 2TECE 3HU1A 4R1QA 4ZKDA 3O8NA 1Z16A 5A3VA 1O0SA 3YASA 3IUMA 4YRRA 5LJIA 5IT5A 1W36C 1C81A 3P1JA 1B0UA 2A5FA 4GXQA 5IT0A 1VSTA 2ZDHA 4K6KA 2Z6AA 2WD7B 3DNFA 1VKNA 4OJMX 4U3JB 4JL5A 4WNCA 1P1JA 2AJTA 2C8JA 5KOYA 3MK31 1E7SA 1SXJB 4YONB 5LA6B 1V37A 4AY4A 1D3AA 1YGPA 4BNGA 3KQUA 1E2BA 1LJLA 1IDOA 5KWIA 3CZQA 3BXEA 4WADA 1S3FA 1KFCB 3VKUA 4ECEA 4WERA 2YMQA 2PUWA 3FSGD 3LDHA 4ETNA 3PI6A 4NCJA 1REQA 2WOJA 1T9CA 2FZGA 2FE1A 5G3ZA 3TQTA 2WDZA 3IO3A 3P2OA 1BE1A 1Z8DA 1RXEA 3A25A 4FXOA 5EIBD 5EJMA 2O7SA 4P5PA 1RWQA 3CEPB 3G7UA 2FPMA 2ZJAA 4G0OA 4HLUC 3S27A 3HVUA 3T3PB 2BD0A 4C7XA 3BS4A 1CZHA 5HCUA 1U8TA 3OPVA 4XGRA 4AP9A 1FVFA 3ASZA 4QU5A 4CM1A 4KQKA 5BWCA 1YWGO 2DT5A 1LVGA 1MIOB 3GFSA 3KTFA 1K7SN 3FGOA 1D5WA 2BMFA 1LC0A 3VR6A 5A5EA 3NW9A 2G5CA 3CIFA 1ZWKA 1ML3A 3DSRA 4D4GA 1JG7A 1R0WA 2YC2C 5JJBA 1QR6A 3OPYA 3D3NA 2X4IA 2OLEA 4PNHA 5ICGA 1Z75A 1SQGA 2H4FA 4BDSA 3KKPA 2ZZMA 4POAA 4ID3A 2WM3A 4YRIA 1PZGA 4N3NA 1XZIA 1GPH1 2E4AA 3JASB 3K7EA 4R9UC 4HDMB 3SX0A 1DXQA 3QU4A 3R9WA 5SZKB 3M6FA 3Q3VA 2LDXA 2JLYA 2RAUA 2QYHA 3WBKA 2Y1FA 1USWA 2HD4A 3MAGA 2PX8A 2QAGC 2Y71A 4EEZA 4CEIB 4EDHA 1CDZA 2JAXA 2OBFA 2XXBA 2ZUVA 1JMYA 4RYDA 5LLDA 2E4WA 4UNIA 1M1YB 3T3MB 1AO0A 1WDKA 4OSPA 2ZW9A 1T5HX 1KYVA 2C03A 1R16A 3KFLA 3UG6A 2ISQA 3TSCA 2I7CA 4EENA 3QQPA 1EQAA 5I9MA 2DJIA 1NTOA 3UAXA 4PTLA 1WD7A 4IRUB 1B1AA 1GN8A 2D0OB 3N76A 3PA8A 4PS0A 4RF4A 3RHTA 2GJ4A 3QE2A 1N6PA 2O0HA 4CTOA 2O2EA 3FKSD 4PSAA 3MUNA 2BSAA 5F1OA 5DWDA 4QAQA 4ZHQB 1X38A 1C8KA 5C32A 2FFQA 2OCDA 1BW9A 5B2ZA 1Y81A 5ILGA 3WLIA 1I6MA 4BJ1A 5A2GA 1MABA 1DV1A 1V41E 3NHYA 1H4SA 2QVXX 4HQRA 1OY1A 1NG1A 1Y4AE 3ELBA 2QD5A 1XNQB 3OOEA 2G88A 3TE7A 2BGUA 3PVZA 2ZTHA 1AG9A 4ZEXA 3O4FA 5CT5A 4L1KA 4MVJA 4DYDA 1D07A 4I55A 4PQYA 3QOWA 3TZHA 2MDTA 1JKJA 2J7PA 4FEAA 1RTTA 3EPJA 2O0MA 3TPCA 3C5HA 1IN8A 1J0DA 1N6KA 5ER6A 1IHYA 1HZZA 3E3LA 3TUZC 2AN9A 5DIFA 1FVOA 3G88A 1QRRA 2LKDA 5ADWA 2YN4A 4DLAA 4UPDA 3ASUA 3PGXA 4RMJA 3MXTA 1OFIA 1FJ2A 3Q2OA 4GPD1 3ZLUA 2BKAA 2AFVA 1DBQA 1FDRA 3AHJA 4JIMA 2CE2X 3T1NA 3NVMB 2AKYA 4A6XA 2WTNA 1ZOLA 2VHZA 5DNCA 5H81A 5AKZA 3KJEA 1RW4A 3GARA 1SK9A 5F5LA 2WAYA 2XZDA 1N5KA 3D8TA 4K8OA 4BO9A 4PAQA 4B2PA 3N3AC 4HH0A 1CF9A 3PWZA 4FFWA 1SD1A 4RF3A 2G7ZA 1PFVA 2L2QA 4Q47A 5CPBA 3T9FA 1CUXA 4DY6A 3NASA 5BSHA 5FOQA 1JEQA 4PLPA 4ND1A 2WJHA 4F8YA 4O4HF 4C76A 2E82A 4EKYA 3MD0A 2P5TB 1JEYA 1NLFA 1V7ZA 2JGDB 2ZSJA 4M87A 3BQMB 5T4FA 3KB1A 3EZNA 4KOEC 3T7JA 3QU5A 3WI7A 5ELMA 4KO8A 4LWOA 4MVJG 4MDEA 4KMMA 1LWNA 3PQ8A 4E70A 1CB7A 3EFOB 5CX4A 5GONF 2VDUE 1SUEA 5B3AA 3FPFA 4Q05A 4ZT3A 3FMPB 3QYAA 1NQOA 1TQ2A 2XRYA 4HQFA 2DLDA 2XGJA 1TZKA 2QRQA 2I1QA 1N2CE 3A6GA 3P0IA 5AMXA 1TCAA 4KPFC 2UUAB 4PHCA 1JWAB 3WOHA 2B7BA 1RXWA 2G07A 1KDOA 5FBLB 2FZWA 2RGUA 1RYMA 5K0SA 3ZCTA 4BKRA 3GNSA 5IM4F 3ZQUA 3GV0A 3ZOZA 2BRUA 3R7NA 1V47A 1UDBA 1XNGA 4B3XA 4AJ1A 3KX2A 5CR9A 4S04A 1JPVA 2OENG 5FBWB 2C8KA 1YO6A 5BMVA 1V4VA 3SS7X 5IUNC 4URFA 4UCWA 3SLKA 4J7UA 3JPYA 3DV9A 1N5IA 1M5UA 3SM3A 3LLSA 3K9GA 1LS6A 5CFPA 1GXSA 3GLHE 1N5OX 1XMJA 1V3TA 2FEPA 4WINA 3TCKA 5EY5B 3KDAA 4KN5A 3BJIC 2BEVA 3VPFA 3CNLA 3NJRA 4PEVA 1FRQA 1OXVA 1NMEA 3UTDA 1IK6A 2XA1A 8GPBA 2PGOA 2CLEB 1EYZA 1XU7A 3U7HB 3V80A 2HKIA 3FZNA 5HQTA 1CEQA 1WPGA 2VZLA 5DLDA 5CD9A 5KB3A 1F0KA 2GCIA 1E2IA 2HMVA 1SRRA 4Z4CA 1M2OA 3KEMA 2PZAA 2QX7A 3GJQA 5LZ9A 3PXXA 1NXOA 1FJHA 1OLUA 4AXXA 4IIDA 2QI9F 2I8LA 1IPFA 3B8EA 3GYBA 2IYUA 2GLUA 4MPRA 4MW5A 2V4UA 3SKVA 3WDKA 3V8EA 5JDCC 3W5DA 1OJ7A 2J5BA 1X7ZA 3F46A 4WFKA 2I55A 3SXJA 5HSGA 1W85B 1UR5A 1L7VC 4OATA 3L1VA 3V46A 2CHQA 4LSWA 5KJ6A 1H0SA 5D7NA 2XAAA 3HNPA 4RDIA 5F73A 1H9BA 1M76A 2BISA 2V6IA 3HXQA 3OJXA 5DHPA 3VBCA 3GVCA 4NXMB 1K4YA 1NZDA 1FFHA 2CB0A 2B1RA 3WGJA 4MB6A 4F4FA 2C98A 2WSIA 5D3QA 5JQGF 3TUJC 2Y67A 1E5LA 1HFWA 3CGGA 4B73A 3FCSB 1K88A 1P4SA 3KCNA 4J75A 4MW1A 4W1PA 5JNVA 1X8LA 3F6BX 3HHEA 1TVKA 2HHHB 3LD9A 3WGKA 4QPCA 4E2WA 1MHPA 4L28A 1OWLA 1JNYA 2J08A 3GA5A 3OM1A 3FRIA 5T6MA 5DYIA 3ZC3A 1IHXA 2AI2A 3R3VA 2NZXA 1EBFA 3KUCA 4U1RA 1OLXA 3CUYA 3L05A 4B47A 2HQ1A 1JECA 2BN4A 4RLSA 4UQPA 4CQLA 5M04A 1M2WA 1FQWA 2TMKA 3ADOA 3UHJA 1NKTA 2ATIA 4EEXA 2LZ0A 1IEVA 4AMUA 1RMTA 4BQPA 1WOYA 3JAKB 3BB4A 3D7RA 4NU0A 3Q9LA 4Y8VA 1VA4A 3E8MA 1Z2AA 4W5WA 3I9V6 3R5SA 5IDYA 3LMKA 1JHYA 1C3OB 1UMCA 2P1DA 4J8PA 2BBSA 3IMKA 1P91A 2P9JA 4UD6A 1KDVA 1J09A 3RIXA 2IC5A 1EJ0A 3UAZA 4BO5A 1SK8A 5HCIA 1N36B 1NRJB 3DAGA 4D42A 4KHZA 2OZLB 4H3HB 2CNNA 2O2IA 3VZCA 1XDDA 4RKEA 1BC5A 4P33A 3ECCA 1T9HA 4IX9A 1ZKDA 5AI0A 4BB9A 5H02A 1XO1A 3JZFA 2FSIA 2ZRQA 4OFZA 4D98A 1QTQA 1PTKA 3CXUA 3UMCA 3EXAA 5ICFA 3IE2A 3ZWCA 5EUQB 4UCFA 3RSGA 5BQXA 1IIRA 4XDZA 2NUPB 1GTRA 5AO9A 4D26A 4GHWA 3V8MA 3OF2A 1C0LA 4ZP1A 3JQDA 5DNDA 1CBUA 3ZXXA 4D8YA 3EDOA 4QRHA 1P7PA 1NC1A 2H1CA 1A1VA 1WY7A 4LZPA 2QVZX 3RWBA 5IP5A 5SYMA 3H9UA 2C7RA 2CY0A 3LKZA 1ONPA 3L01A 4NU5A 1H3NA 3OU7A 4GEKA 2UVPB 2FP4A 4L4XA 5F12A 2XYHA 2AN3A 1A9XA 4B0PA 2KSQA 5D5PA 4B5LA 4FILA 4DA9A 1SVUA 3ZE9A 4U6SA 3V3TA 2F8LA 4RY2A 2CDAA 2I3DA 2IOFK 1Q11A 2B78A 2H9YA 4MW2A 1QO7A 2WG2A 4BLOA 1Z74A 2NZ2A 4R8VA 1U7WA 2HB6A 2P9HA 5D6OA 3PXCX 1ZN9A 3N2GA 3K8OE 1XRLA 1C3VA 4Q4HB 3P20A 5E4YA 1JHZA 2WPDA 4BUZA 1U3UA 3RNLA 1GGMA 4FKMA 3C3XA 4A0GA 4L8YA 4B75A 2CNWD 4ZCQA 2B0CA 2ZRLA 1ULBA 3EASA 1J2UA 2AD5A 4J43A 4MWEA 3KL4A 1JQLB 1TW2A 3NVAA 5I4CA 1YZKA 4UHEA 4LX0A 3QLUC 2B1GA 4YMLA 5T8KA 1G9XA 4EQ6B 1JN0A 4NS1A 1CD5A 1N2GA 2I78A 2QPAA 1RYZA 3U49A 3UHPA 3OPXA 3NWBA 4E13A 3UAWA 1NBME 4Y7DA 4NK4A 1XMXA 1KJIA 2EKZA 1DX9A 3G1TA 1T36A 2IYQA 4RH0A 3WL7A 1R4NB 4ZMSA 3KT8A 1H2AS 2P27A 1GUYA 2AUNA 2VVTA 2RBEA 4BECA 2ZUWA 3M33A 4ABTA 3KSRA 3QX8A 2FETA 3I2HA 1KI6A 3OH8A 3O4IA 3TRFA 1IG0A 4EG8A 7MDHA 4JELA 4N0QA 4TTPA 3I52A 4B83A 5JLJA 3GF4A 1AX9A 2W6JA 4MQLA 4HLCA 4RQTA 3EBPA 3VH2A 4CKCB 5J5CA 2OESA 2NZWA 2QG9A 1V35A 3AB7A 5D51S 5KNDA 3PZRA 2QD2A 1C2TA 4EYSA 2ODWA 3WOVA 3ZU6A 5GADl 2HX1A 1SKBA 1SCAA 2ZBEA 3OZIA 4UZEA 2P2DA 5KYYA 3ZBTA 3V8NA 1SKMA 4YJHB 3CPJB 3G9XA 4N4AA 4CLRB 1U1GA 1OBFO 2AOTB 2EX0A 3L18A 4XX0A 1VYUA 2CNBA 4BNHA 2Z9BA 5JH7F 3QA3E 3F6YA 3MBOA 1QYVA 3GT7A 1JEDA 4MCJA 3ETHA 1OAAA 1H2FA 2QNRA 1NKSA 1OT5A 1K8XB 3MWDB 4PG8A 2FG5A 5KTOA 1SOMA 13PKA 3T1VA 4JZYA 4KPEC 4BNYA 4XJVA 4RJIA 4BRSA 1JPNA 5A4FS 4EF6A 2JFXA 1V16B 3THXB 2ZREA 4PYNA 3U26A 1Y34E 2VUTA 1E7QA 2HCBA 4M9RA 4LYHA 5DOZA 3HB4X 1BDBA 5E7IA 4D44A 2IYXA 3IQXA 4DL9A 2P9ZA 4LYJA 3UHFA 4IXTA 4DC9A 4O8ZA 1XVTA 4HQ0A 3DB2A 4KGVA 3DXZA 4BNZA 1EX6A 3GFQA 1GPKA 4H7DA 3OHSX 3PNOA 1UXGA 4OA5A 4OMFG 3I2KA 4DXDA 2BHTA 3EXEB 2JFHA 1QG6A 1ZI9A 3M6IA 4URVR 1EMDA 5CK4A 1FUUA 2NSHA 3BGVA 1SR8A 3L0DA 1H94A 3ED1A 2RHMA 2IODA 4CI0B 1QHSA 3N2ZB 2P6RA 1EESA 1SVKA 5AKLA 4D9GA 3EULA 1WUYA 3M81A 4L78A 1YA6A 4Q3CA 5JNUA 1GPMA 4YJ2F 2B61A 3OQ6A 5K9ZA 3KKEA 3N6XA 1PUIA 2IUUA 3GDOA 4BQSA 4MYSA 1YJ5A 3JQEA 4W5QA 4Q3EA 4E94A 4MRAA 2I65A 5K20A 2ZROA 1DIBA 1NUSA 3L0CA 4Q4JA 1AK1A 4LZOA 4C22A 1EFUA 2JFVA 4X1OA 3K30A 1GV0A 2R8YA 2VPQA 1PGQA 2GNAA 2VUSA 4U9HS 1QBKC 4BZXA 3HB0A 1UZAA 1J70A 2YR0A 3PITA 3UKJA 2BEKA 2TSYB 3K2EA 5JRDS 5DM2A 4XA8A 2MINB 3K20A 4MGYR 5JI3E 4B4DA 2R8PA 3D59A 3JQFC 1GPAA 1TQHA 4RGBA 4ZRMA 2JKZA 3RODA 5J5AA 3UW3A 4CU2A 2CUTA 2PLFA 3H86A 3CWCA 4PSDA 2QPLA 5JAMA 1WUJS 4H9GA 5AKGA 3O31A 3HEBA 1CC1S 3IEXA 4ISBA 1J5EB 5HXAA 3ABOB 1D2NA 1EIZA 1MJGA 1T4BA 3IODA 5EP4A 4XJTA 4U2GA 5FTLA 3GD5A 1L1EA 4RWZA 2G9NA 4F3KA 3VYRB 3S8EA 4CL3A 4GMFA 1E3SA 1F38A 5DRTA 1RYBA 3CLUC 1U0RA 5BSMA 3K09C 3E22A 4LTMA 1X1EA 2GK7A 3HACA 4YS6A 2ONKA 3MA0A 1WDLA 3R09A 1US8B 4WGGA 4JLAA 5GONB 2ZWVA 4XIJA 5LCXA 3G3EA 1PF7E 3G68A 3LBFA 1YT5A 1T3GA 4IICA 3BIJA 4CCWA 1ZGBA 3WYCA 4EKNB 2W0SA 2NUAB 4Y6PA 1VBNA 2R1ZA 3F3MA 2ZRBA 2JFOA 5BMOA 4ACAA 4DLWA 2GQ0A 5BYAA 4MI9A 3EF1A 5IS2A 3S29A 4ETMA 2NZJA 3P26A 4BO2A 1BRTA 3LYAA 3PSAA 3M4XA 2H59A 3C70A 3OF5A 4QGBA 2HGZA 5DM70 1IHOA 4U5XA 5H9WA 4OHBA 1SIOA 2WNHA 4TWZA 4HAXA 3SYNA 1SQ6A 3D0RA 3NM5A 1XQXA 3REOA 3OJLA 1Q0UA 1VZ3A 4KE6A 1J0EA 1OROA 2HIGA 2VAXA 4KNYA 1Z9BA 3Q3HA 5GM2A 1ZU5A 1CQJA 2JFYA 1YRHA 2QM8A 3NFYA 4G0UA 4MI6A 4DNOA 2Z5GA 1E7RA 1ZD8A 2VH1A 4QJIA 1DWPA 3DDNA 4HFJA 2YZKA 1N6NA 3MT8A 5IC5A 5AK5A 3UJ6A 2PE5A 2JKYA 1GLGA 10MHA 5HA5A 3ETGA 1SUBA 3QH4A 1CZNA 1CP2A 2B4RO 2GCPA 3CKKA 2JATA 1F2TA 3I2GA 1XLWA 3REFA 4Z4HA 1GA4A 2O19A 3QMPA 4EUSA 1G1AA 1CDOA 4B4OA 1P9LA 4WDRA 2D7DA 5KTNA 4YLYA 3VKWA 2A1UA 1X1CA 3GVHA 4A91A 3EOAI 4TMYA 3NV7A 3WFIA 6GPBA 4HDSB 3E03A 2QT9A 3B3QA 3BF7A 2XWSA 3H5WA 4B2IA 5JWHA 2IWHA 5E9JA 3ORSA 1GKIA 2NU8A 1O6FA 1X7GA 2DBYA 3MWJA 3VVMA 2CHEA 4DA7A 4WN9B 4I4LA 3U2QA 1DDGA 1OH6A 3ZWXA 1EXDA 1MB4A 1N1MA 4R6WA 3VC3A 2YVAA 4EATA 3NONA 4OL0A 4RTRA 1M1XB 4JI7B 1Z0AA 2IA5A 4I9UA 4LYFA 1GKKA 1MRNA 2NQTA 2QEQA 2DGDA 4K9QA 4PX5A 3UMVA 2A0UA 2V8BA 1M1NA 2FE4A 3FF1A 1DQYA 2HK7A 3P2EA 5CLLA 5E9AA 3D3JA 4YV0A 5JNTA 1B42A 1II9A 4U7DA 1G2IA 4LDRA 2VDQB 4RTPA 5BR4A 1DIAA 3FVRA 2P6NA 4X20B 1MC5A 3SCZA 2FEAA 1MPXA 1O1YA 1PP4A 1UKAA 2X5NA 3IVMA 1MAAA 4FQ8A 3V8VA 4ZJYA 1JAZA 9ATCA 1SXQA 2AW3A 2AUMA 2RFLA 1IPHA 3H11B 5BWBA 1KTVA 1C30B 4CT4B 1KKLA 2YX1A 4ETWA 3Q9NA 1TADA 1DP4A 4CM8B 2JL1A 5BR1A 5CJPA 2UYCA 3QEMB 4AWBA 3ULKA 3NDIA 2Z3VA 4FC6A 4JIGA 5I8ZA 3RABA 1TYEB 2OAP1 5TRTA 5K0CA 4PNPA 4CL2A 5IPFA 2UZ1B 1RCFA 1CS4C 4FDTA 4G5YA 2HMSA 5K01A 3ZNQA 3I9JA 1KP2A 3FYHA 4CEHB 4L3VA 2A3NA 4Y7CA 3G9QA 3FOFC 2FW1A 4GG1A 3EB9A 4DCOA 3I3SR 5FR2A 4CR6A 1I0IA 1YDEA 2C4NA 1USIA 2I7VA 4MS1B 4EW3A 1B4DA 2OP1A 2DUWA 1HE8B 3IPXA 4YV1A 3WAGA 3EG9A 3EXHB 1UXJA 3NIGB 3VV3A 2Q41A 4MKFA 2CNLA 3HVIA 1JJFA 3FFTA 4M46A 4BNUA 3PQ3A 3T9EA 2IK8A 5KNCA 3IVGA 1CZRA 1DO2A 2OM2A 5AUQA 4V0RA 5JXIA 1NUQA 1SOAA 1U5CA 1VGVA 4FYJA 3BPSA 2JIRA 2IL1A 1QB8A 2NTJA 4TLCA 1V43A 2H07A 1IOLA 2IY7A 2Y93A 4KU4A 1EUDB 3T3IA 3E7XA 1T0IA 4KRXA 1T43A 1RWBA 4JEUA 2VHJA 1CPYA 2W2KB 1FMTA 3KJHA 2EZUA 2ZEJA 3AI1A 2QP4A 4PS1A 5CCXA 5JV5A 3L07A 3MLAA 4D0RA 3VNUA 1BMFA 2HFJA 1M2GA 2F67A 3N58A 4LZNA 4R1TA 2ZVQX 2WM2A 2GJ9A 2E5LB 2V4MA 3PYXA 4ZEMA 5EIXA 1S01A 3PIIA 2OCYC 3ECSA 3FNBA 3P9KA 2TMGA 4IIGA 4QBGB 4YCLA 3AM3A 5LNK6 3RYHA 1PZEA 4X1YA 3HY3A 4IO0A 3G7SA 1ESNA 4NXNB 5AXCA 1HLPA 1KY4A 3BMOB 1Z4NA 2AV6A 4KI7A 3G79A 3UBMA 5ALGA 5EWLA 3MUFA 1W0JA 1TLTA 1ZH4A 2ZR8A 4OP2A 4ZVUA 3HYNA 5IKXA 4EG4A 2FFBA 2PLAA 4N5MA 4P32A 5J2TF 3TJMA 3F6RA 3HWWA 3GRUA 3UQYS 4J0EA 4AY3A 4M88A 1A9SA 1L3IA 2ORIA 3BKXA 3UT6A 1H8HA 4EGQA 3I28A 1JA0A 1JX6A 1CDEA 3IQEA 1N0WA 3IDOA 4ND6A 4F9GA 2R6CA 4Z4QA 3WISA 3DHYA 4IILA 1G0NA 1M6VB 1QHNA 4B8ZA 1Z8HA 1ZPDA 2YBEA 2P69A 1H0RA 3H17A 2ZS7A 4CM3A 1ONSA 1I4LD 3TGWA 3BFPA 1F8YA 3W2TA 4MITA 3AQ4A 3P0FA 1BVRA 2J32A 1L5MA 2F3UA 2VFAA 3AFOA 4MMZB 2QV0A 1T5IA 2LV8A 2GZSA 2O48X 4O0MA 4QDTA 3CNEA 3INGA 4F5EA 2J3JA 1NF2A 1JMVA 3BMNB 3I9KA 3KRTA 4HAZA 4LJ6A 1QM5A 4EB8A 3A1FA 5IF9A 2RB5A 4XM0A 3L0YA 4K6HA 3JVIA 1DC8A 1B73A 1T1SA 2OXFA 3K70B 2NO1A 3H2KA 1EVIA 1XR3A 5KVCA 4LJ9A 4ARBA 3AEKA 1EUCA 3DPUA 1HTBA 3OTQA 1KZ9A 4QGSA 2BEUB 2C82A 4R2KA 1CFZA 2CXNA 2WTEA 3H4MA 5DLYA 3GGCA 3C5VA 3PRHA 4M0LA 5EKSA 1ZUNB 3C41J 3LPCA 5B7QA 2UUCB 1M73E 1UWCA 1ID1A 2AXQA 2HRZA 2XMZA 3CH4B 4UEOA 4C87A 1G5RA 1E20A 2BP7A 1COWD 4O2BA 5BRJA 3NTOA 5ITWA 1RM0A 2NPIA 3VNBA 2VTBA 3CUSA 2VTEA 1XZHA 3RYFB 2ZM6B 2QB5A 2A5YB 4HNAA 3WIUA 4C9BA 3FCEA 1R0YA 3ZI4A 2EL7A 4E1VA 1AV7A 2XCIA 4GNKA 4S2EA 3UUEA 4OSOA 1SBIA 1Z5UA 2WYUA 3CNBA 4KXNA 2C7OA 3OM9A 1DS6A 1EE1A 2ZP1A 3E3MA 3EIQA 3LC7O 1VM6A 2P1ZA 4FNOA 3OE5A 1J7JA 3O4JA 3TXYA 3U40A 4N12A 3ZDAA 1DFHA 4AZSA 4Y1FA 1ABBA 3UM9A 4RZIA 3ZU2A 1MDBA 2HSGA 3SIRA 3HABA 2JVJA 1PSDA 5KKCA 1ZD5A 2XXJA 3JQAD 5DGDA 3U4QA 3SOZA 3TQSA 5JCXA 1FSGA 2IZZA 5KTTA 1YHYA 2GN2A 1O0BA 4NCNA 4PFSA 4PZUA 4GLLA 1KU6A 1TEXA 1U2GA 2LPMA 2Y3IA 3EOBI 4I8DA 4D6YA 4I1VA 4GC5A 3GUVA 1EJ6A 4UBMA 3SK0A 1W5BA 2FZEA 3DUFA 4GZ6A 4FBGA 1ST2A 2RK6A 5AHWA 3SZ3A 3OMXA 1LF5A 2JCVA 1QVRA 1M34A 1PVVA 4EB3A 1HR0B 3JWEA 2BF7A 4ENRA 1KL7A 1R50A 1CLEA 4V24A 1IUNA 2W4MA 4DDHA 4EAQA 3E5NA 4UBKA 3NM4A 3IMFA 2E1RA 3Q1KA 1NVMB 1ONOA 2VS1A 2AUTA 2XHEA 4K9OA 1X7HA 1ZH8A 4MIYA 4W5HA 4LF7B 1PLJA 3WWZA 4R1UA 4NEQA 1XTZA 4DSNA 4M1OA 1EE9A 1H3FA 3DVLA 2HWKA 3FWHA 4LE0A 4QFDA 1EK2A 4JSYA 1Z6AA 3QKSA 3MFYA 2CDNA 5CYOA 5FTJA 3EQ7A 5CFRA 1NI4A 3CX4A 1C4KA 1TA4A 2BKUA 3R7DA 3GDGA 4NATA 1QAMA 2AHOA 2JEOA 1W8IA 2ZQZA 3PFKA 4TXMA 4BFXA 3CZAA 1JHRA 1HL3A 1K7EB 3L3BA 2Z5FA 4XFJA 1W5FA 2WR8A 1WF3A 4RK6A 2BTQB 1NXSA 1A4IA 2ZUBA 5TQ2A 1T9KA 5A9RA 3AM1A 5KX5F 4GX5A 1C4OA 2GR9A 3DBHA 4PVDA 1HEYA 4XSHA 1QS0B 4RZUA 1ECGA 2OYRA 3WSTA 4C4RA 1U8UA 2YHSA 3RSZA 4TN1A 3HJUA 3ID6C 4ILEA 1SXJD 4DMRA 1RQLA 2EJTA 2E5WA 3L7KA 4FZVA 1W2GA 4YRAA 1PFUA 2O8NA 2NN3C 2OFPA 3H7IA 1RI3A 4UE6A 3WNVA 4XOUA 2D5LA 4IDCA 4AW9A 3E8SA 3GLIA 4KI0A 2XZTA 3F71A 1UWVA 3G6KA 3IFSA 3PE6A 2BE9A 4TWBA 2C5LA 2Y1CA 1KF0A 5FUQA 3H5OA 2J5XA 4KWTA 3DOUA 1ZN7A 1OR8A 4M9UA 4UAUA 4MROA 4U2FA 4HDRA 5C4GB 4JFRA 3V32A 1LVUA 4J4BA 3AR8A 4ALMA 1D6NA 3ZDQA 3R3JA 4WCFB 3JQ6A 3I3OA 3TOXA 4CNQA 1P18A 2AVDA 1RR6A 2OB2A 2VNIA 1G5HA 1HEIA 2XDWA 1SWWA 1CE8B 4KXYA 4BMNA 3DMTA 1YJCA 2PEZA 3H5AA 2HBYA 5HIMA 4YUWA 1M2JA 2EHJA 3N8NA 3PWSA 3AF3A 1XDUA 3WGMA 3T5AA 4RH3A 4TUYB 2R1TA 5CIWA 1JQKA 4W9NC 4XM2A 3RK4A 2B2CA 2R751 1HUQA 3PNKA 4NP6A 1KSGA 4JQSA 4AMZA 3AI7A 3TN7A 1ZU4A 2C4MA 4HRVA 4ABYA 4AJ4A 5CYGA 3SMVA 2PN1A 3LQYA 1WB5A 5CXSA 1OI3A 5ICCA 3V7UA 2CJPA 3VPAA 1LQTA 3FDIA 2OBYA 3SJ7A 1G98A 2J85A 5FOTA 4P3NA 5DV9A 2IPNA 3GEBA 2R48A 1T4MA 2WAOA 3ZD9A 1KEWA 2P3LA 4JBYA 4RY0A 4E5MA 1J6UA 3HB7A 2GPAA 1F0YA 2G7MC 1IRIA 4V03A 5HEKA 2F8MA 5ALOA 5BYJA 2HUNA 4ZAYA 3NGMA 5THQA 3NNNA 2B1JA 1IK4A 2CXTA 3TTWA 5KSYA 1NE7A 1I7QB 2PUAA 4KH1A 2CLFB 1U2SA 4PRYA 2WTAA 3BWBA 3Q8LA 4OHMA 3Q12A 1D2EA 4PSVA 1G3QA 3L8FA 5LOVB 2O8CB 3AFHA 1GADO 4XTCS 1XMOB 3E5HA 4CFYA 1W88B 3AF4A 4ZPXA 2A9OA 4LXIA 2GI4A 4A6DA 1DUVG 1H2EA 3OFNA 3MWLA 2H4WA 4F71A 4GPTA 1UPAA 1VDZA 2C54A 4KLZA 4L73A 3U4CA 3OFVA 1WLSA 2FOIA 2XNCA 5K1ZA 1AZSC 1ZVKA 3TGPA 2OGWA 1T2CA 2RGWA 3VR2D 3WTCA 2EG5A 1A8IA 2X1HA 3C16C 4NFLA 2ZRJA 4ANFA 5IH7A 1V9SA 3FFWA 4GPAA 2XAUA 4RVNA 4R81A 1U9ZA 1GAQA 2J33A 4H17A 2DHDA 4I19A 3NHWA 4UUAA 1MVNA 3RTCA 1NIPA 3HJFA 2ZRKA 1KQFA 2X15A 1HORA 5F98A 3ZIDA 1F4VA 4E3ZA 1JFSA 3BGOS 3HNOA 2ZIZA 1SBYA 1ESEA 4C3VA 1YSCA 1PW7A 4Y6OA 4D25A 2MYUA 3TBHA 3QSYA 4GOJA 3BMCA 1JB9A 3DOOA 4WZAB 2Q9UA 5FNVF 2VTDA 2R1UA 2WWVD 3U7IA 4AY5A 2WWYA 1S7GA 2CXRA 5LU9A 3FDZB 5DYTA 3H2IA 4HDAA 4B17A 2GEUA 3N8DA 1H9AA 2DVMA 3EBOA 3QW2A 1PVDA 3ELUA 1MO5A 4FCTA 4CDGA 4BGUA 2ZYVX 1X13A 3W5JA 2C2OA 4AO8A 4DIKA 1Q19A 3SPXA 1V3VA 5FA6A 3PXBA 1XWWA 4RZQA 4TT3D 1VHJA 4Q9HA 1V8PA 4XW2A 5ALZA 3OIUA 3TMYA 4ZCTA 2VDNB 3FOBA 3H5IA 1ZR2A 1YR3A 1SIBE 2AF3C 2PR7A 2O3SA 1TT7A 4N54A 4IIJB 4FLMA 3S5UA 3TKLA 1V9CA 3S44A 3O2SB 5CXUA 4LOHA 2D4HA 2AQIA 4CTJA 1E62A 2F3RA 3CZ9A 2FMIA 2G3YA 2VEOA 4WTOA 4O1IA 3TTUA 2QGFA 4AJOA 3AG6A 2LWIA 2E48A 3BILA 4GVLA 4LVNA 4NE9A 1IQUA 1E5TA 4QXAA 5CHYA 1XL0A 4UNQA 1V8BA 4JLVA 2PRJA 1QKKA 1P0MA 2VT7A 5K0JA 5H8WA