2P7IA

Crystal structure of a sam dependent methyl-transferase type 12 family protein (eca1738) from pectobacterium atrosepticum scri1043 at 1.74 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
225
structure length
225
Chain Sequence
NFDFDVMHPFMVRAFTPFFRPGNLLELGSFKGDFTSRLQEHFNDITCVEASEEAISHAQGRLKDGITYIHSRFEDAQLPRRYDNIVLTHVLEHIDDPVALLKRINDDWLAEGGRLFLVCPNANAVSRQIAVKMGIISHNSAVTEAEFAHGHRCTYALDTLERDASRAGLQVTYRSGIFFKALANFQWDQILQTDILSKEYLDGCYQLGQQYPDLCASIFLLCEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_049838.1) from Erwinia carotovora atroseptica SCRI1043 at 1.74 A resolution
rcsb
source organism Pectobacterium atrosepticum scri1043
total genus 81
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2p7iA00
4YUWA 5KQRA 2NNWB 3LKZA 1JTEA 1N7JA 3FUVA 1NBIA 2ONZA 3BWBA 1SKMA 4GC5A 3FPGA 1RI2A 5ICGA 5EIFA 4RSRA 3BZBA 4BLWA 3BGVA 2UYHA 2DULA 2IP2A 4ZTBA 3DMHA 3U81A 1ZKDA 1L3CA 1HNNA 1NW5A 1QAMA 3A7EA 3KQSA 5U4XA 5K0GA 5LQRA 2VP3A 1O9GA 3K0BA 3SXJA 3UJCA 4X61A 4RTNA 4PCLA 3I9FA 1JG3A 2ZULA 3LPMA 5EEHA 1SG9A 2JHCA 2AOVA 2O06A 2HNKA 1PRYA 3EVGA 3GRZA 3IHTA 5E8RA 3EMDA 3HCCA 4BLUA 1XCJA 2P8JA 3B3JA 3HCDA 1YZHA 3O31A 2YXDA 1FPQA 2Q41A 2PX8A 1DCTA 5DSXA 1P39A 5GINE 2IBTA 1FBNA 1YFJA 1TPYA 2O07A 1BHJA 3G89A 5EGSA 2PWPA 2IGTA 5CD1A 2NXCA 1B42A 1R00A 3KPWA 4MHTA 1JQEA 4RVFA 3T7TA 3KQWA 4RTKA 1X19A 1X1DA 2IPXA 2YXEA 2PY6A 2BM8A 1JQ3A 3LBYA 4MTLA 2ZSUA 3LSTA 3I53A 1G55A 3G88A 4QDJA 2P41A 3EVZA 4LECA 2ZFUA 2GA9A 3PB3A 3FUXA 3R24A 3ELDA 5KYGA 5EQJB 5EMLA 3CJQA 3SSNA 2ZTHA 1UIRA 2ZIFA 5CVDA 2C7RA 4HRAA 2IH2A 3TFWA 1NBHA 4OX9Y 1JSZA 3OU2A 4B17A 5K05A 2OB1A 4V0QA 3KPYA 2H00A 4ER6A 4POOA 5K0BA 3LHDA 4ATNA 2CKDA 2YQZA 3ER9A 1NT2A 1BKYA 2YVLA 3JWHA 2PSSA 2AOTB 1VL5A 5HIIA 1P1CA 3GRYA 3TKAA 3UZUA 5DPMA 4MQ4A 5DSTA 2YX1A 1KPGA 4YV1A 1BC5A 3DXZA 4IWNA 5DRYA 1ZG3A 3EVBA 5DX8A 4ER5A 2PXCA 1Z3CA 1G8AA 1RJFA 2XVMA 1JG1A 3M6UA 4WVLA 4X1OA 1VE3A 2V74B 3KR2A 3UJ7A 1XVAA 4AZVA 5D1NA 4H0NA 3IYLW 2NXNA 1AQJA 1QYRA 3DR5A 4YV2A 3P8ZA 4XUEA 2C7OA 3ORHA 1N2XA 5E9WA 5CIYA 10MHA 5LQKA 5MHTA 5K0LA 3D2LA 1XDZA 5K0JA 5FUBA 5LQUA 4RTQA 3ME5A 5K0EA 1VPTA 1XDUA 4X60A 3AWIA 2FHPA 1RI5A 2OBFA 1MJFA 3DMFA 2BH2A 3FPHA 2AOTA 1JG2A 3NDIA 1VLMA 1ORHA 1AQIA 2AOWA 3P2KA 4FZVA 2IDJA 5E9JA 3MTEA 4UOEA 1WXXA 2IH4A 3A7DA 5CUQA 3G2OA 4M37A 2ERCA 4QTTB 5FWDA 4YV0A 2GPYA 3HCFA 3VSEA 3HP7A 3UJ6A 3C0KA 1WS6A 2ZZKA 3PX2A 3NVMB 3P9NA 4P7JA 3THSA 2G71A 4DM3A 2YTZA 3G5TA 3BWYA 5GOZA 2QRVA 3B7PA 5DTQA 4C06A 2NP6A 1F3LA 3BKXA 5KVAA 4OA8A 1N7IA 1X1BA 2PJDA 3NW9A 5DWQA 3KQTA 4IV0A 5DM4A 4DF3A 4DCMA 3CGGA 3RW9A 1FP1D 3KPUA 3MCTA 3NDJA 3JWIA 5C0OE 4RTRA 4PYNA 5FWAA 3SM3A 4RTMA 4RV9A 5FA8A 7MHTA 1XJ5A 5CCXA 3AJDA 1QZZA 4YMGA 4AZWA 5BXYA 2NXEA 2I62A 4ISCA 3BUSA 2IFTA 4PCAA 2YR0A 5K0NA 4V0RA 4ER3A 3GRRA 3BWMA 4PIPA 3OZSA 3GRVA 2P35A 3TRKA 3LDFA 4ER0A 3DLCA 3OE5A 4P7FA 1L1EA 5FA5A 3C6KA 3KKZA 2OPBA 2DPMA 2ONYA 5CVVA 3HTXA 5CVEA 3KR0A 5EMJA 4R8SA 2A14A 3G2PA 5BW5A 5K0FA 1BOOA 5DLYA 3B89A 3NJRA 2FRXA 3MCZA 5DRTA 1FJXA 4R6WA 4KDCA 2PT9A 4HG2A 4CTJA 3FRHA 3A25A 3LDUA 3CJTA 1NV8A 4FSXA 3BGDA 2PX4A 3SX0A 3KPJA 1NW6A 5EG5A 3B5IA 2C7QA 1KHHA 3MQ2A 3X0DA 1IM8A 3LCVB 2ZBQA 5HIJA 5K03A 4OBXA 4MWZA 1ORIA 1AV6A 3PVCA 2P3QA 1AF7A 2P40A 3FUUA 1FP2A 5H02A 4BP1A 2UYQA 2CWWA 5HZMA 3P71T 3DP7A 3GCZA 2EJUA 3QOWA 4MIKA 3FTDA 2P3LA 3R6TA 5T6BA 5F2OA 1JG4A 3DLIA 3HCBA 3FTCA 2XBMA 1X1CA 2AVDA 1O9HA 2AVNA 2YXLA 4PIMA 2HTEA 3HM2A 3PX3A 2ZIGA 3Q7EA 5EZQA 1XXLA 4DMGA 1IXKA 3LKDA 2HR1A 4RVGA 2B78A 4KRGA 2G8NA 5F2KA 4OA5A 2PVCA 4GQBA 3TMAA 3EEYA 1KYZA 3BWCA 3HVJA 1R8XA 3P2IA 5CM2Z 3AXTA 2PT6A 4GC9A 2JH8A 3CVOA 1SVUA 2H1RA 2VS1A 3H2BA 5LQCA 4QVGA 2O05A 3SR4A 1M0EA 2OY0A 4M7RA 3UFBA 3C3YA 2XVAA 3P2EA 2OB2A 3FTFA 5G02A 1L9KA 4EK9A 2IBSA 3GNLA 3T7SA 5FCDA 5K01A 5M5BA 2UYCA 3LX6A 2ZWVA 1NW8A 2PGXA 5C9ZA 4PYQA 2B25A 5DXAA 5K8VA 5DM2A 3M6WA 4KWCA 3OFKA 2UYOA 3KQPA 2OZVA 3VC2A 4CKEA 3AXSA 5HIKA 4CXMA 1RI1A 2WK1A 1WZNA 3M70A 2ZZNA 1SUSA 3FUWA 3KQMA 3OU6A 3HCEA 2ZBRA 4FSDA 3TM4A 4RTJA 4OQDA 1Q0SA 1NV9A 3LDGA 2EG5A 1G6Q1 1NW3A 3GXOA 4K6MA 3GIWA 1QAQA 1SUIA 3TOSA 2Y1XA 2I7CA 3GDHA 3DOUA 3DXYA 3SSOA 4LWPA 5E1DA 5EHIA 2ORED 4RTOA 3EPPA 3VC1A 3UJ8A 2AS0A 2QRVB 1HMYA 5EIWA 3UA4A 3DTNA 1YFLA 9MHTA 1SQFA 1WG8A 2QE6A 4IKPA 4CTKA 3A4TA 4M38A 1G8SA 2P3OA 3M6VA 3PTAA 1I9GA 3E23A 3P97A 1RI3A 3SVZA 3HVKA 4HC4A 1ZQ9A 3HEMA 1UFKA 5GWXA 1YF3A 4QTUB 2B2CA 3G2MA 3GGDA 4BLVA 3IV6A 1VBFA 4RTPA 2FYTA 2IIPA 2AZTA 2BR5A 4C07A 2YUIA 3CJRA 1YZ3A 2EX4A 3KQVA 5DXJA 4E2WA 3ANXA 3ELYA 2I9KA 2ZVJA 4E31A 4YUYA 4R05A 5F2NA 3G5LA 3EGVA 2PX5A 3BKWA 2XYRA 3WSTA 1D2HA 5FULA 3V8VA 3NTVA 1KPIA 3TLJA 3PT9A 3O7WA 4CKBA 2P7HA 4QQKA 1RI4A 1RJDA 4PYJA 2AN3A 5DT2A 5T64A 3UJ9A 4KVZA 4GEKA 4U7TB 3UJBA 3OU7A 3B3GA 3UA3A 1O54A 5LQJA 3M6XA 1SQGA 5GP1A 4AZSA 3DULA 5IH3A 2R3SA 3RIEA 1D2CA 3TPZA 5JR3A 1I4WA 5CVJA 2G1PA 3UJAA 3PFHA 4YMHA 5LQAA 2ZWAA 1YB2A 3ELWA 3P9IA 2JHPA 4G56A 4RWZA 4DQ0A 1EJ6A 1NE2A 3C3PA 5C1IA 3TM5A 2PX2A 2G70A 2AR0A 4XUDA 5DX0A 3THRA 2JH9A 2PBFA 2NP7A 3NVKI 3P9CA 1IY9A 1JQDA 2ZLBA 4LWOA 5FQNA 4P7KA 3OE4A 4O29A 4DCGA 3EVDA 3GRUA 4EKIA 1I1NA 3MB5A 4NECA 5ICFA 3ER8A 2NXJA 3UWPA 2GAFA 2PXXA 3F4KA 1T43A 3REOA 2CL5A 5DTRA 5FADA 1ZGAA 4OQEA 4EVIA 1VIDA 1Y8CA 2GLUA 1TW3A 2AN5A 4DKJA 1OR8A 3OZTA 3LECA 2QYOA 2HWKA 1UWVA 3FYDA 5DM1A 4E2ZA 4YUVA 2VZ9A 3A27A 5KQSA 2JHAA 1YUBA 4EQZA 2BZGA 4HGZA 1WY7A 3C6MA 3TQSA 4AUKA 1R8YA 4GF5A 3NWEA 3TR6A 5BW4A 1R18A 5ICCA 2IDKA 2PLWA 2NYUA 1EG2A 3FPJA 3KQYA 4P7GA 1U2ZA 4A6DA 1G38A 5GIOE 2P1DA 2PV0A 3KPVA 3V97A 4PWYA 4QVKA 4E2XA 2IH5A 3DXXA 3IEIA 1INLA 2GH1A 4E70A 4DZRA 3T7RA 1JTFA 1XCLA 2R6ZA 3ID6C 4LG1A 2VDUE 2Y1WA 4IV8A 4QDKA 5FHQA 4AX8A 5FQOA 5GIPE 2EFJA 3HVIA 3G8AA 2O0LA 4FS8A 3TKYA 1WXWA 3LL7A 3E7PA 1ZGJA 1G60A 5BP7A 1KYWA 1L3IA 2GS9A 4FR0A 3KR9A 5E2BA 2OYRA 2LD4A 4PYMA 2C7PA 1EAMA 3R0QA 3LGAA 3MTIA 3OCJA 4GOLD 4PYLA 2FK7A 2VDVE 1X1AA 3E05A 5P8WA 4YUZA 4C04A 1D2GA 3I64A 2WA2A 3Q87B 2QM3A 3B3FA 2B9EA 2OXTA 1EQAA 3HA5A 3P9KA 4X41A 3FRIA 3PFGA 1DL5A 3L8DA 3KR1A 4R8RA 2OKCA 5E1MA 5E1OA 1L3BA 1RJGA 4KIFA 5E9QA 3LCCA 2JJQA 2ZW9A 1NW7A 4HGYA 3CKKA 1P91A 4L7VA 4HTFA 4E32A 4YUXA 1DUSA 4A6EA 3EGIA 3FTEA 1VQ1A 3OZRA 3OPNA 3MGGA 3EMBA 1XTPA 2ZIEA 3KQQA 4F85A 3EVAA 5IKMA 2QY6A 4AZTA 5LQNA 4X63A 3MAGA 5EMMA 3HCAA 1V39A 3M4XA 3GO4A 4HSGA 4JXJA 2F8LA 4PYOA 5EHGA 5EVJA 1Q0TA 5FHRA 4Z2YA 4BP3A 3CCFA 3CBGA 3QOXA 3PLAE 2HV9A 2EJTA 3R9XB 3KHKA 4PYKA 1XDSA 1TW2A 1R6AA 4EMSA 3BGIA 4XUCA 5CCBA 5HOQA 2CMGA 3G2QA 5EEGA 2K4MA 2KW5A 5HFJA 3S68A 5EMKA 3DH0A 3BT7A 2AOUB 1KPHA 3KQOA 3AY0A 4F86A 1NKVA 3SMQA 3QV2A 5EZSA 1F38A 4QPNA 3LBFA 4RTLA 1JSXA 5LSAA 2ZCJA 4WXHA 3MERA 3I5UA 5K09A 3K6RA 4KIGA 3NWBA 4PYIA 4PGGA 4RVDA 4GOND 5K0CA 2H11A 5LR6A 4KW7A 1H1DA 1EJ0A 3O4FA 2V7EA 3OFJA 3HA3A 5E2AA 1MHTA 2PKWA 5HILA 2E5WA 3FUTA 5CVUA 2JG3A 5FTWA 1VP3A 3FZGA 1KR5A 5HEKA 3GWZA 4FP9A 5E1BA 4FGZA 2P7IA 4E2YA 3EVFA 3HNRA 2Z6QA 5EKXA 3VYWA 4PNEA 3FPFA 3FPEA 3T0IA 4E33A 2XYVA 4ER7A 3ERCA 4FT2A 3NMUF 4M36A 2I6GA 5EKUA 4PONA 2AOUA 2B3TA 1ZHFA 2Z6UA 1JR4A 2ZBPA 2GB4A 4F84A 3FYCA 4FT4A 2VDWA 5EOVA 1M6EX 1QAOA 2N47A 3EVEA 2PXAA 4BY9E 5DM0A 5B1SA 3EGEA 2AOXA 2ADMA 3BXOA 4PGHA 3LCUA 4Y30A 5GM2A 5T67A 3SGLA 4CWAA 3MHTA 3G8BA 2PWYA 2CMHA 4OBWA 2HMYB 2G72A 2OO3A 3M33A 5D1HA 4KDRA 3JWJA 5ICEA 4C08A 1KP9A 2UZ4A 4C03A 2ZZMA 2BR4A 4RVHA 4XCXA 2ESRA 3PS9A 4RYLA 3KU1A 2FCAA 3CC8A 2XYQA 5GM1A 2Z6AA 3RODA 4C4AA 1P1BA 1KXZA 3UBTA 3ELUA 3G7UA 3DMGA 3SSMA 4HH4A 3JWGA 5DTMA 4RTSA 3EEOA 5DX1A 1KIAA 4QPPA 8MHTA 2WA1A 5EPEA 2AN4A 3A26A 3GJYA 5ERGB 5HIMA 5EC8A 4C05A 1M6YA 1R74A 4QQNA 2BM9A 1QANA 3HVHA 3E8SA 3I58A 4P58A 5KS2A 1VP9A 4DA4A 2FPOA 3HA7A 4GBED 1PJZA 2O57A 4RX1A 4Y2HA 3UJDA 4CKCA 5JUWA 1RJEA 3R3HA 2FK8A 4EKGA 4PINA 3GU3A 4GUAA 4HTFB 4R6XA 3EVCA 4GOOD 4U7PB 3DUWA 4E30A 2BR3A 5E8JA 1EIZA 4GOMD
chains in the Genus database with same CATH superfamily
1G2QA 2NNWB 4F21A 1PJAA 3PFNA 3AF1A 3SG0A 3ZPXA 4I4TB 3DLBA 2PGJA 2B8WA 1I6KA 3VI4B 5D2CA 3ENKA 4C0JA 5BWMA 4BLWA 4WL0A 4BLQA 5ABPA 4AX4A 4HX2A 3U81A 5EI5A 3WHPA 7REQA 6ABPA 2GZHA 3RSSA 3CT6A 5L95A 3EC1A 3Q8XB 4F45A 3O4GA 5DI9A 2O0MA 2DC1A 2PZAA 3RFXA 1JUDA 2Y1KA 3WNDA 421PA 5GOZA 1B14A 3OWXA 4KO4S 4LHSA 3EDQA 3NOQA 4Q48A 5B37A 1V2HE 3T35A 3OIGA 3TBFA 3AVWA 4OU4A 1J2YA 4PNPA 1COWD 2PZMA 2A9PA 2JK0A 2JC3A 4H3VA 3O31A 4PHFA 4RQUA 5T6MA 3P2YA 1L6IA 2PX8A 2QPOA 2ZRKA 1DCTA 4BFSA 1C30B 5ITWA 4AJ9A 4MVJG 1SOWA 5F78A 3WGVA 1H8ED 1MIOB 3DT6A 1XPOA 2UXBB 2QQ5A 1AKEA 2ACVA 8AT1A 1NQOA 2C4MA 4KPGA 3U9TA 4MHTA 1ZOOA 4GZ5A 3KQWA 4MTLA 4Y1FA 3VR4A 3H1BA 3JVUA 2IHUA 4A6XA 3DZFA 3G0OA 3UKDA 2HV8A 1MX3A 3A3PA 1L8XA 1QHHA 1QYWA 5F3WB 4IQGA 2ZFUA 3R24A 1NZDA 3ND8A 2KWIA 1LK0A 1VC2A 2AMVA 4HLNA 3MWYW 3GARA 2VTVA 1DT5A 1EDBA 1UPBA 4AD8A 2C7RA 2VWHA 3DDOA 3FFTA 1NBHA 3OU2A 1JS1X 1N1DA 1P2SA 2Q6VA 4BTVA 2JFPA 2IPNA 4P7BA 4LJ7A 4GT1A 4FDUA 4XGRA 1AKUA 4K9LA 1NLZA 3JWHA 1BGVA 1GZ6A 3ACBA 4AWBA 4EUEA 3FMPB 5TNXA 3CFYA 2WWWA 5AKIA 4IFIA 4M89A 1QH9A 2P1ZA 1JI3A 3GBPA 5BY2A 2WSIA 1F2VA 3F9IA 1W1UA 3DBHA 3N0VA 2QRPA 3PQ2A 1RWPA 1LTQA 2WICA 3P2JA 2GUWA 3L7AA 3ITKA 2BRUC 2B9VA 1F5NA 2C1EA 3IFSA 5K3SA 3O4RA 5LMZA 1E89A 2P9ZA 3PR1A 1IHUA 1E3JA 1AKMA 1K2WA 4F6RB 1AHNA 3LS2A 2ABWA 2AW5A 2NYRA 3DR5A 1AKNA 4HWTA 3W4IA 3DFZA 5L8VA 3ORHA 5T8KA 10MHA 1PR1A 3DD5A 4IXMA 3ME5A 2W98A 3NEAA 4P82A 3FPAA 3P32A 4IZOA 4KB5A 4OB8A 2HK8A 4Y7DA 5FUWA 3IIIA 2BH2A 3FPHA 4M0DA 4KV9A 2HGZA 4U2FA 3C6YA 1JG2A 3NDIA 3A0RB 1VLMA 3O8QA 1YUMA 5AI0A 1L5VA 2FQ1A 2NZ8A 4PLZA 4F3TA 2UXCB 4M1SA 1DRWA 3WK9A 4EYQA 5HUQA 4HMQA 4GPIB 2BMFA 4LDAA 3LC2O 3WNVA 2JGMA 4DM3A 5BPFA 2VTBA 4KMMA 3U40A 1DTWB 1IHYA 4D5EA 1PNQA 1XPUA 4JVLA 3W8RA 1F8FA 2RBGA 3NW9A 4LZJA 3MIIA 4OY3A 4B4VA 1K06A 1XTRA 4TTIA 4RTRA 2FSVC 5H68A 3ZDYB 4UFNA 1USIA 1ZK3A 3F4LA 4OD0A 4X71A 3ZE2B 1J9GA 4FYKA 3K9CA 4O2RA 4OI4A 2R87A 1LWNA 2I67A 1FW6A 3K1ZA 3T1QA 1OXXK 1LUAA 2ZREA 4YCAA 1I6MA 1NP7A 4ISCA 5BYJA 1MH9A 3QYPA 1IOWA 1OXBB 3PG5A 2ZATA 4D46A 2IHNA 4DLNA 4UAGA 4XSHA 5DHSA 3RVKA 4N76A 5B30A 1ZJ5A 2OHOA 3OH8A 1DBRA 2DPMA 1P4GA 4G2NA 4GIBA 3T1HB 4JD5A 3V4ZA 1U0LA 2W37A 3N05A 4LTNA 4LYAA 5IK2D 2R8ZA 3C3XA 1XZGA 1UQRA 3PR3A 3WICA 2TMGA 3HXPA 3B89A 2VP6A 4XEUA 1QE0A 2RGDA 1CUUA 2VHVA 3DV0A 3SX0A 2ZJ0A 5IXYA 1JWLA 4QUAA 3ZLJA 4B82A 3BA6A 3RAJA 5DSZA 2GD1O 2ZUSA 5K3OA 1XELA 1IM8A 3PHCA 3EIQA 3I2KA 4JBNA 3BCHA 1RPZA 3GLSA 3TO5A 4EJSC 4FD3A 4ZKDA 2NIPA 4Q66C 4TKUB 3T34A 1ZVQA 3DP7A 3T7EA 4KL8S 5C51B 1PJRA 1V5FA 3K9HA 1W5AA 3EZ6A 2CK3D 1NBWB 2H92A 1I3NA 2UYGA 3R40A 4Z86A 2QQ0A 3SP1A 4DGQA 1X7GA 3SJCA 2D0IA 3GNQA 5GQSA 3LRXA 1PGNA 4EFMA 4DMGA 1FTNA 2DQKA 2IYRA 1R12A 2Z1NA 4W8GA 4YA6A 1CP3A 1IZ7A 4YS6A 3WLLA 4GXTA 4UE3S 3LQFA 4OJKA 5ALIA 5F2KA 1SXJB 1R5BA 2BW0A 3AWDA 1OYWA 1XXHE 5T4FA 4EG4A 5C80A 4CEIA 4RMGA 2Z3WA 2Q1TA 4GQBA 4K26A 4KI0A 4TN5A 1UBSB 3FCOA 1T3HA 1G41A 1RPNA 1DIHA 2ZI6A 4J8PA 5J43A 1L4EA 3P2IA 5AOVA 3UW3A 2O54A 3L06A 1VPEA 2DSNA 4MJLA 4EBFA 5F7XA 1NXQA 3BTVA 2PLNA 5LD2C 5LZ4A 1JR3A 3E3NA 3L8ZA 1A7KA 2I5PO 1GNSA 4OQFA 4QEZA 1VJDA 3E9QA 5ALXA 3LY5A 4UDOA 2DPLA 1OMOA 5C4MA 1E2JA 1C1XB 4AL4A 3FSGA 1FQWA 1C9KA 3AI3A 1Y37A 3SHOA 1CRLA 1TADA 2MR5A 3CIOA 3ZVLA 3PT5A 3C3MA 4J3JA 1LJLA 3I4LA 4Z4FA 4HNSA 5CVTA 5BR8B 3FVQA 4OL0A 3G5AA 1UZUA 2Y1EA 4LE2A 4QD3A 4W8HA 5CH3A 4RIEA 2MR6A 4KPEC 3MUFA 4R4JA 3HSSA 1Y5MA 1XGKA 3V4FA 2I2BA 2OP1A 4FDLA 4Z0HO 2UXDB 2EX0A 1MC4A 1QGYA 4IZ6A 4NJMA 1GNVA 4HGRA 3NZEA 2FLKA 2ONCA 4WBXC 2IV2X 3H1PA 3FMVA 1ZINA 5F1KA 5C8YF 1GWNA 4C4PA 4LF8B 4TN1A 4JB0A 1SUIA 3RHFA 2QTTA 3IEMA 2HM7A 4B5LA 1RHQA 4GI5A 3FAKA 5ALFA 4LWPA 3UUWA 1ENPA 2REQA 5FYDA 4CV2A 3T7AA 3EPPA 1A88A 3PZRA 2J7PD 4RH3A 2GGSA 1NQXA 3OCUA 1OILA 2PNFA 1SQFA 3BQ9A 3KVOA 1ZK2A 2A92A 2Q5LA 5DLDA 4E12A 1ONBA 3FSJX 1SC6A 3OIWA 1W35A 2QORA 1DOAA 2BZSA 2GDZA 3PNVA 1WVMA 4TWIA 4B7ZA 1Q1AA 3HRHA 4UQOA 2RC5A 4L5YA 1MAWA 1MRSA 2K2QB 3IV6A 4INJA 1YQ9A 4MRPA 4LY0A 3RARA 1L5OA 2Y2VA 3TQQA 1SUEA 1U8CB 2CZGA 2F1IA 2V4MA 2A58A 3NCTA 2OSVA 4G5RA 1KYVA 4JUBA 4RUKA 5IN5A 1L7AA 1XK7A 3DLAA 4RSHA 2I3BA 4JLWA 1U2DA 4OKSA 1TM7E 4UM9B 5EZ6B 1KE1A 4ZEWA 1OAAA 4EA7A 2FPXA 2PX5A 2QMUA 4J4TA 4DDMA 4YXWD 1F8XA 2PMCA 2PRKA 3O7WA 1CJCA 2VAVA 4IYJA 4OAQA 4QQKA 3OQIA 3L4SO 3P20A 1VYVA 2HADA 4Q7EA 4V3BA 3ZHZA 3VGJA 2HZ7A 3ZWDA 5CDSA 1B3BA 5DIFA 1EWRA 4NZ9A 4O4JA 1M34E 4DM7A 1V8FA 3I9KA 1FP7A 3PIDA 3NEYA 1DOHA 4I9NA 3W3ZB 2ZS7A 3ZI0A 2MWMA 1SCNE 1Y7IA 2QRNA 5KJEA 4N54A 1LLDA 4WKPA 4EEXA 3L1VA 4IGFA 2BMJA 1C9NA 1TEHA 1YZFA 3HEBA 3N74A 4OB6A 4B0OA 1RAEA 2OHVA 4C0HA 3MJFA 1ZM2A 4AUMA 1HORA 5FUMA 5EJMA 1MDBA 3H83A 5M3BA 1NDHA 3K09A 4D6XA 2RAPA 4CLRA 4TMVA 1KI7A 8LDHA 4EDFA 1D1QA 1JQDA 3BMNB 3IOMA 2BP7A 2MMCA 4NFYA 1HE8B 1E96A 1HSZA 3MB5A 4NAHA 1JQLB 4RPIA 2YV2A 2ZJOA 4I3GA 5L3QB 1GNQA 2WZBA 2VT2A 1P2FA 3RIHA 3O2JA 1HFKA 4LW8A 2RE8A 3HY4A 4BS9A 1VIDA 1USUA 2ASEA 3IXQA 5EZ5A 3FVVA 1SG6A 1OR8A 3NHJA 3F3MA 4IG4A 2NUBA 3WV4A 5ITSA 4PPNA 4Q1CA 4XM2A 1XLTC 5KTMA 3O8RA 1DOZA 1U7HA 2IK8A 3JAKB 4M22A 1ULSA 2YY7A 2FPMA 3DHYA 3N87A 5F7JA 4HHEA 4TOIA 4GF5A 2R66A 3NWEA 2J5XA 3QZUA 1A9XA 5IHXA 2FMFA 3LRTA 4BMXA 2RJOA 3V97A 3RRYA 4XIFA 4WE3A 2A1TR 4N7MA 4X6YA 1DQSA 1YJQA 3LHFA 4OSPA 2NTEA 1JTFA 4TQGA 5I4BA 2FA9A 2J32A 3UBTA 3OJFA 3UMJA 3NWPA 3HVIA 4NOMA 4FEGA 3PKIA 1H66A 1JBKA 3KKEA 1K3TA 1KEUA 4UM7A 4Y2RA 5DDIP 1FA9A 3KR9A 4OGGA 5JEDA 2JFXA 2FPRA 2HPAA 3DP9A 3GH1A 2LV8A 5A2GA 3T3DA 3ZG6A 4JZYA 4Z5XA 3E05A 4NENB 1XRQA 3W1EA 3CLUC 2HA5A 2QM3A 3BHNA 2XQFA 2MSKA 2CVQA 2WIJA 3B3FA 4KFUA 4WLVA 4Q03A 5DGHA 4S1WA 1FNBA 4YRQA 3A4NA 2C98A 4TTRA 4JYZA 2RHBA 4RVSA 2A1IA 3OTQA 5JQGB 1L4MA 1CD5A 4UQPA 1L3BA 4HLUC 4QNNA 1PS9A 2HXGA 4QJ5A 4XWGA 3G2JA 2IHZA 1E9RA 2JJQA 4CM4A 2AHRA 4UNSA 5C7YA 1G6KA 5K6AA 3UAWA 4N12A 4M8LA 4J3FA 2GILA 3LV8A 1B26A 2X3FA 3ZWCA 4PGAA 5G1NA 5HYVA 4HVLA 2QY6A 1E1LA 1N8NA 5EJ7A 1DWUA 5C8YB 1F1JA 1N5JA 3OG9A 1FNNA 1QZTA 4DDWA 2VJCA 3DLPX 3BCSA 4AROA 3BFXA 3U16A 2HK9A 4UUOA 1QNFA 2QAGA 2DR2A 3QVUA 1G42A 3FPBA 5BMVA 4KQMA 2HA7A 3T4UA 3U39A 4YMWA 4HDRB 3R9XB 2OFWA 1BS2A 2HMWA 1PJSA 3BHJA 2N46A 3K2QA 1HDZA 1ZVMA 5CBPB 1CUAA 1VRVA 2XNDD 2CMGA 3DJFA 3CUWA 3WHKA 1GCUA 4ZCMA 4EUKA 4FHEA 1IH8A 3AR5A 3WWZA 5HZGA 1GZSA 4KAFA 3FLEA 4X1YB 3O0TA 1M74A 3N7AA 4LY3A 4OUDA 4W9RA 4EW2A 2JA2A 4FGWA 3QPWA 4B47A 2QE7A 1VKRA 2X22A 3I5UA 4CE6A 3VOBA 1Y3AA 2D13A 2I1VB 4L8FA 3DEAA 1KAGA 2J6CA 2VF7A 3M0EA 5HK9A 3A31A 4IDPA 1DXHA 1C80A 3MSCA 5F73A 2E5WA 2JG3A 2H31A 2YUTA 5HDBB 3AEKB 5B3AA 3V9AA 2HLHA 4EY6A 2JLUA 3ZKWA 1JZTA 2QLFA 1DS6A 3DQZA 4IIYA 4MYCA 4DDUA 4FGZA 4RA6A 3TNDA 3F74A 3JQ8B 1CETA 3CM0A 2ST1A 3LE8A 1JLSA 1X92A 4MNTA 3W5UA 4LDNA 1I5EA 3QU5A 4HWPA 4F2PA 3OVMA 1JHAA 4OMDA 3SHQA 3SIPA 3IE0A 3FSEA 1OFVA 4P3NA 1NBME 2B3TA 4LYEA 4B3DA 5L9AA 4YRLA 2ZT8A 5L6MB 1CZNA 1FS5A 1IK6A 3FHJA 2GRUA 2QR2A 4G0OA 1ZD9A 2OPHA 3RS0A 5B7PA 3KNZA 2P11A 2EXXA 3PGXA 5JFGA 3Q41A 4Y1GA 4NEGA 3G9XA 4M6WB 5AHKA 3DMNA 4XPIB 1JL3A 1DC7A 1R64A 2FF5A 4AMZA 3OPYB 1ICIA 1BS1A 4EGSA 4RF3A 5JCOA 4C08A 3IKJA 4MW0A 2PL5A 4JH0A 4P08A 2DUJA 1CK4A 3TLYA 1JEJA 3ZH9B 1MENA 1D6NA 3D3NA 5FEMA 3M2PA 4UPDA 5KYUA 4Q4AB 1XN1A 1GTSA 5FI3A 2ZUEA 4BEWA 3AGPA 4UZEA 1NXXA 4UHKA 3H5WA 1WW2A 5FBHA 1TGVA 1WLSA 1ISSA 2NZ2A 3AZPA 1W49A 3W9SA 3OICA 4B4UA 5CYGA 1QGUA 3CY6A 4NQRA 5FO0A 3VKFA 4F96A 3VDQA 1WOYA 5JY1A 3B2NA 1FYEA 3GJYA 1DRJA 1U5BA 4LTDA 4FYPA 4CGZA 1YVPA 3U6KA 3LQKA 3VAAA 3KG2A 1MQ9A 2X4LA 2XMRA 4KQIA 1GLNA 1E2QA 1AHIA 1LPNA 1PT9A 4KSBA 3VR6H 3I8OA 2BBSA 3O92A 4RX1A 3GRPA 4D41A 3CZMA 4XW2A 3PNSA 1WQ3A 2FK8A 1N6LA 5A9SA 2UUPA 5IVDA 3VBCA 1XMSA 1ZH8A 1P4AA 4GOOD 3DUWA 4NF2A 1TA0A 4FFVA 3R7WB 1YBAA 2BFEB 3ZDDA 1IBSA 4FXPA 1VLQA 1K08A 1VDMA 1Y34E 4FZRA 4J76A 1SKMA 1OTYA 4AI6A 1BXZA 4FNMA 3I37X 2V97A 2F62A 3ACCA 3A6ZA 4XSGA 5DBIA 1VJTA 5J5AA 3VH2A 1YO6A 2WQZA 5A4MS 1CUEA 1C0EA 2HCJB 2XVXA 1XZBA 1OLUA 4ZTBA 3KSRA 1E1MA 4K3VA 5IMBA 4MKXA 3KUXA 2A35A 2CL7X 4HDSA 2O7RA 4HYEA 1TC2A 1AURA 1SKYB 4X61A 2CHQA 2CL6X 1O6ZA 5A03A 5C8VA 4IQFA 2X8WA 1GUFA 1YS4A 4YAFA 5EEHA 3PLAE 1BE1A 4Q02A 2OENG 1Z16A 2R4UA 4GKAA 4IKEA 2F9LA 2XI4A 3CUTA 3I4FA 4KOAA 2I4NA 4C7BA 3QH4A 2YFYA 3PCXA 4MSUA 1IWPB 2GBPA 1GVNB 1SO8A 1VJGA 3RKSA 1PJTA 2AR7A 2VNKA 2ID9A 2P9CA 2O6HA 2IYPA 2Z30A 4HN9A 4Q47A 3USZA 4BVGA 2WYIA 5LDDC 3KOZA 3NBYC 3RPEA 2C77A 1I7LA 4JXXA 2NXCA 1W25A 1R00A 1HZJA 4RGBA 3EQ8A 1A8HA 1KEVA 4KP7A 1FFEA 3RG8A 5EWLA 4D9BA 1JRLA 1YS1X 1X1DA 2C97A 2QD5A 3T3HA 1OGYA 3LBYA 3K9WA 4JLVA 4EG5A 2EW8A 3AF3A 4P80A 5EPOA 2X9GA 4AN0A 4NHEA 2FUNB 3B13B 3ROPA 3IBFA 3RBXA 1RJWA 4OO3A 1CZOA 1T9BA 2A0XA 2VATA 2D1FA 2C42A 2R7KA 1AS2A 2VBGA 2IYTA 4U2BA 4A2WA 1UIRA 5HX7A 1RFGE 2DERA 2IH2A 3ORSA 3DW1X 2X2FA 1GL9B 1N1GA 3A6GA 3AFHA 3OCWA 2JDIA 2ZBFA 4P38A 2HQOA 1JKFA 2YMQA 3C5EA 4PHCA 1BE6A 4OL9A 4ZYUA 5LNK1 3OE7A 2GVZC 4DJ5X 1J7KA 1VCMA 1VL5A 1UC8A 3ES9A 4R7GA 4RD1A 3H0KA 3UGKA 4D9MA 3DE3X 3N2GB 2MYPA 3WYEA 4BLTA 3UPUA 4EUHA 2JH3A 4AF6A 3ZI7A 4HXGA 1KOFA 4D92A 4Q4LA 2HT6A 4PO1A 3CVJA 1TVMA 2XVMA 1JG1A 1JEYA 1MFZA 1R4MA 1DEOA 3LZDA 3RBAA 5JJKA 3DEKA 1H9AA 2VK2A 3JASB 3QU9A 2QRHA 5GZ1A 3C1UA 1GCGA 1Q3TA 5FPYA 3KR2A 1XQ1A 1E2PA 4TLAA 3W6OA 4M4SA 4UXJA 2PKRA 4MYHA 1N0HA 2R84A 1QV9A 4MP8A 4NVRA 3M9WA 2CUKA 2H54A 5JG7A 2AXPA 2RHWA 5U4QA 1O89A 4WECA 5SZKB 3F5FA 6GPBA 4M76B 3UWMA 2VDMB 3ZNQA 4BVLA 2EOAA 5B4TA 1WBJB 4FZ3A 4NIMA 4X60A 5IJ0A 1FJGB 1QF6A 1AA6A 3QG1A 1MV8A 2RB5A 4NYMQ 5E7IA 3TDMA 2XTZA 2GO1A 2I4MA 1SK9A 2WI8A 1KI4A 4MINA 5AKLA 4LYDA 3SEAA 1C9EA 1DC5A 3NNSA 1EX9A 3JQAA 3QVLA 4UOEA 1L1QA 4HWSA 3H7AA 3KETA 3GQBA 3P9XA 5EJ2A 1M6VB 1OD6A 2ZZKA 3UJ6A 3OQJA 3UJHA 3ZLVA 3NVMB 2WWYA 1UJ4A 1X86B 1FRNA 3FOCA 3ZY2A 4RVNA 1N2CE 5KQMA 1DJMA 4RIGA 4IV0A 1T5IA 2R7MA 2G9NA 1WUKS 2Q5EA 3HA2A 3AK4A 3EGWA 5KSYA 2I71A 3ILYA 3FDFA 1EZ4A 4FGLA 1PZGA 3C3CA 2BOVA 2OV3A 3GZJA 3I04M 2POCA 5CA1A 1VYHA 3G49A 1TK2A 1QZZA 2ANBA 3Q3CA 4QDOA 2FJPA 4BC0A 1ZBDA 4DUGD 1Y8ZA 2OORC 3ZZMA 4WZAB 4FR2A 3FA2A 4MQFB 1PEKE 2ZT7A 3DE1X 3JQ9A 1RAAA 3ONDA 3V7WA 4G1BA 3PYXA 1CUZA 4BCCA 4UTRA 3K9FC 2JCXA 3VFDA 2ZB2A 2JCVA 3EZGA 4QYIB 1ITZA 4MR8A 3A8TA 2QL5A 2FV8A 2XMDA 3KEQA 2QG6A 1PK9A 5CVEA 2J9YB 3WDLA 3ZEAA 5L7WA 5C35A 2WG0A 3AZOA 1JDPA 1C0LA 1L8AA 4TL8A 5D8DA 2ZDQA 2X0DA 1KY3A 4TKMA 3UG7A 2HJWA 3E27A 3FB1A 5T3UA 1A9ZA 1ZVKA 4JOSA 4XVHA 2O1XA 1JHQA 4D8VA 2OV4A 5BMOA 1POXA 4PWZA 2HLPA 2AMJA 1KHHA 3HN7A 5DTJA 4U39A 2NU7B 3ISTA 5FL3A 5C1DA 3UJ7A 1EWVA 3LCVB 5M29A 3JSXA 3OCXA 1LTHR 2PAFA 2VPPA 2SKEA 1EEHA 4P4TA 1UM9A 2B7CA 3REQA 5L4LA 3THWB 2F1KA 2UYQA 4YRSA 1NF8A 2QTVA 5A0FA 2HSJA 3N9IA 1CYDA 1I10A 4IMPA 3SJAA 2WG1A 5JS2A 2OCPA 3PXCX 1LPSA 2PZKA 1J2UA 2VCEA 4LXXA 5ARDA 2F55A 4L1KA 1E99A 5AK5A 4RSGA 1X1CA 5JS7A 2XBMA 4KN6A 2XKKA 1KC3A 1QRUA 1E0KA 1R6UA 3SXPA 4C5BA 2JLQA 2GPBA 3OHPA 4A82A 1Y3FE 4E88A 1LBHA 2ACWA 3DB2A 2FETA 4BNHA 3AIIA 1NSYA 4ND3A 3SY8A 2FGJA 1UMBA 3N39C 1DAHA 4H7IA 4FMBB 4J0DA 3JVVA 1LSJA 4EJ6A 2Q3CA 1EK5A 5D3MA 3QXXA 2CHFA 3BWCA 4G5YA 4MO9A 1L7NA 4GC9A 1F6BA 2PT6A 2ZS9A 1E63A 2JAUA 4ZQFA 1KEPA 1Y4UA 2IYQA 2XE8A 5C4GB 4DREA 1CY6A 3UFBA 3I8XA 3AW8A 4GXQA 1E9DA 2D3WA 2P6PA 4J7CA 5KNBH 2PUBA 4W9NA 4XDZA 1RPJA 5BORA 3AM1A 4QHSA 5FBKA 2V7PA 2EIHA 3H5TA 3LA6A 3GW8A 3L7DA 3S5UA 3RS5A 1O3YA 2VL7A 4F7DA 4RKRA 2YWEA 3A2NA 3LP5A 4PC3A 3TD9A 5C9ZA 5D3KA 2CJPA 2HXYA 2XV1A 2QL7A 2REXB 2WU3A 2VHXA 3LPDA 5J4VA 1EA7A 3N0TA 1T4GA 1SUSA 1ILWA 1M3SA 3G68A 3NIDB 4QQFA 4UEJA 3QVVA 4DXHA 1HEUA 4QM6A 4GPD1 3VOTA 5TQ0A 4I50A 1B76A 1H2AS 3OEHA 3KTFA 4K6MA 3OOSA 1G4HA 4DLSA 3OF2A 1R0ZA 1B6GA 3DDCA 3LLUA 2UZ1A 3NGXA 3P4XA 4Y9TA 4BUCA 5ESWA 1OTXA 3N6VA 4R0NA 2ORED 2QRZA 4DNXA 4X64B 1YFLA 3NFYA 2NSHA 5D84A 3OQBA 5I4IA 3AIMA 1CVLA 2H9YA 4D8TA 1GZVA 4G8BA 4XJSA 3BD7A 5CLLA 4DM4A 5KQGA 4FDVA 4W1RA 4JI6B 2IZ5A 1E79A 1GA6A 2QKYA 4MVJE 5TT0A 4UXHA 3GGDA 4IGAA 5EIAA 2C61A 1TL7C 3T5DA 1IQPA 3C3EA 3VAZA 1HYGA 4DAOA 3UXHA 1PNVA 1XC7A 3LY8A 1YZ3A 2DQ4A 1K4MA 2D5CA 2ODBA 3S81A 4CIDA 4KV7A 2TRSB 4OP2A 2Q0HA 1WL8A 3UUFA 2H5IA 2VVTA 3C8ZA 3DBIA 4A5SA 5JZVA 1NUTA 4RQAA 2GA8A 1I13A 4HMOA 1Q0RA 2BMAA 2VJLA 3K7EA 1RM0A 3KSDO 3L04A 3O4IA 3QE2A 4EVRA 4J0IA 1RI4A 2H5EA 5AKXA 1N5LA 5AYVA 4II7A 1XVTA 4U7TB 1EK1A 4CMIB 3EK2A 3F5SA 2KQUA 1CY2A 4I1IA 4MGYR 3PCRB 2IKQA 2R8EA 4R83A 3SJZA 2WJYA 1F7VA 1ZNXA 1ZXXA 4QOIA 1XLVA 3WGIA 5IMSA 4NMHA 2BKEA 1A50B 2D2EA 1BXRA 3CURA 4YI5A 5BNWA 4Z4GA 1MV5A 5J40A 3PFHA 1KO4A 2Z04A 1X8XA 1T2EA 4WXRA 1TUBA 2YRFA 5AW9A 4C6HA 2FWAA 1DJNA 4NYIQ 4CIVA 1EJ6A 4QG7A 3JPYA 3QEMA 5DCLA 2VDLB 3EY4A 4I5FA 2PWAA 3U7HB 4LV8B 1GGMA 2WYUA 2E1PA 5BUSA 1KWGA 5C34B 5C5CA 2IQ5A 1WCXA 1XF1A 5A02A 4P7KA 3GLHB 5LVAA 4K7JA 3GRUA 4WNAA 3ER8A 1WF6A 3ZZUA 4WK0B 4LPKA 1T43A 3BMQA 2C1ZA 1RSZA 2Y4NA 2ZR0A 2ZRMA 3E35A 4QARA 3WJ1A 1FSFA 4ZGGA 1HYBA 1MT3A 3ESAA 1TJ4A 3IT0A 4TQAA 3ULKA 2HWKA 4C01A 2C9YA 3C3KA 4G23A 3EEIA 1PUIA 2BI4A 1XJ0A 4M9ZA 2H7VA 2OLJA 1USGA 3G0IA 3ELBA 4HGZA 4LY9A 5CB4A 3GLGE 3CF4G 5AVJA 3Q4GA 1CS4C 4A8JB 1SOVA 2P1DA 1WF3A 1GCOA 1HDXA 2W00A 3GLIB 4I8IA 5TARA 4C7XA 1Z4IA 1KY4A 4ENTA 2VYFA 1G2OA 1G8MA 5GMOA 1BQ4A 1JKIA 4YGXB 5KVSA 1NU8A 4Z7OB 1LV7A 3ZYCA 4OQNA 2FZWA 3UC5A 2V6GA 1JI0A 4FCVA 1T36A 5L4SA 2YYAA 4DMFA 4Y18A 2XDQB 4E1AA 2DWCA 1NQWA 3ZTTA 1NG9A 2IOQA 2I8CA 4IEIA 5JSUA 2VTKA 4RJ2A 2OCGA 3E9DA 1K5GA 5IDVA 5TT1A 1T6YA 2PCLA 2CE7A 2R6GA 3FKSA 4MYSA 3HKDA 4DRYA 2D6FA 2LUOA 5D51S 3PC6A 3PFGA 3SZUA 2FJUA 1WMAA 1VSUA 1YVUA 2XIJA 4YMLA 1K5PA 4JJIA 4E5YA 1E3WB 2VRCA 3FJ1A 3DWIA 4RVUA 1YZYA 4G26A 3TLKA 1HQCA 5L7TA 3QPAA 1GPNA 4KR9A 4A5OA 1X9GA 2YZNA 1G0NA 3IO5A 4A6EA 3RUHA 4OFBA 4CMGA 1IXRC 1UXJA 2QDXA 4NK5A 1ZISA 1NOIA 5CGZA 4YCSA 4B3TB 3H42B 3R0ZA 1KBQA 4LKRA 2I2CA 4AY3A 3NKLA 4FM9A 1W36C 2WU1A 3HCAA 1FTWA 2HNAA 4BNZA 5AUQA 4V0NA 4EJSA 2GFHA 4PS1A 2C9CA 1QP8A 3ER6A 3RIYA 4EELA 1YI8A 4V39A 2J9GA 2HFKA 3DZ8A 3O0DA 4HWKA 4X9XA 3TVTA 2WTNA 3PP8A 3R5SA 3N58A 1VG1A 1R6AA 2GNAA 1APBA 4R1OA 2QGNA 2DY1A 3FW1A 3PHHA 3PNQA 4MS4A 3D1JA 3MINA 3T4EA 4DJTA 5FBRB 2PGNA 3E2IA 3KQOA 4G9GA 4OQQA 4F86A 4R0MA 2OCAA 4JBIA 2YBDA 1QG0A 3FNFA 3QV2A 4RDHA 4F3CA 2Q1SA 3OBIA 5LSAA 4JUDX 3ZLTA 4WXHA 4FLEA 3B6EA 1IVYA 2J5BA 4RLHA 2WMYA 3LQ2A 2DPYA 4M86A 4RPKA 4Y2QA 2H11A 5DNVA 1UMCB 2HF2A 2C5SA 2DKFA 4G3XA 4UNQA 4J1TC 3KRTA 3E3OA 3L7CA 4NDZA 3RRMA 2DHRA 1W85A 1OFUX 4G4JA 5K20A 2J8ZA 5KSOA 1GM5A 2R6HA 3G0CA 5CVUA 3VPFA 1YL7A 3EH1A 4K3UA 3VZDA 5HHTA 1SUPA 2PUVA 3Q7PA 4EYKA 1GPDG 2GX6A 2QM7A 2HZBA 5EPUA 1JFTA 1PS8A 1MNQA 2XMPA 4C21A 4C29A 3FE2A 3EIHA 3JALA 3T0IA 3ZBUA 3FNQA 4R7TA 5K0SA 1NQUA 3I5AA 4M36A 4L15A 2CHUA 4MRMA 4I0WB 3U0VA 3UM9A 1M2EA 2R6CA 4H0CA 1DV1A 2AF4C 2BUAA 3PXDA 2WQ6A 1HLFA 3DE0X 5EOVA 3WADA 1J23A 4CVNA 4GE0A 1KNXA 4F1KA 3MRTA 2ZYGA 1QFXA 2G08A 2QTWB 2F1OA 4FFOA 1ONPA 3AR7A 3W04A 1E6UA 4L5JA 1TD9A 2CLLB 2H1HA 2MINA 3OWOA 4K9KA 4EEKA 1CPYA 2BEUA 3HWWA 1I4DD 1LI5A 2IYEA 3EZLA 3LOQA 4UOQA 1Z83A 2X86A 3C5CA 1FVHA 1RLTA 2CVZA 3PXEA 2I2XB 4L2IB 4DUPA 1NLFA 2IOFA 3D43A 2AG8A 3VHLB 1XO1A 4DARA 4DNFA 2FX5A 1KZ7B 2OV6A 3W5AA 3BL8A 3P2MA 3AY7A 3PEFA 3K2BA 3OHSX 1U8TA 4NY1A 1PR0A 4ESEA 4WOJA 3HDTA 2EFEB 4RK4A 2FFRA 2AQIA 4EFDA 2PSFA 2Y6VA 2HIHA 1XU7A 3N8DA 4P81A 1PG5A 1NG1A 1YKGA 2A1UA 2PH1A 4NCJA 1OZFA 4Y6GB 4B7XA 5CFOA 2JI6A 4DQUA 3GIDA 3M4ZA 3NBXX 4KTVE 3SZOA 4CETA 5JHGB 1XFAA 4TYNA 3KVRA 1BG6A 5FUYA 3R8FA 1AGXA 3IIJA 4S12A 2R86A 1QG4A 1BMQA 1X13A 3DAGA 1ECGA 3E5HA 1L5NA 4BJ5A 5BSFA 5JUWA 2HH9A 4PRZA 4PINA 3WGKA 2YQ4A 3QWFA 4FILA 4A23A 3OY7A 1XL1A 4QPJC 4BX2A 4E30A 5JYCA 5IKOA 4IAOA 5K2OA 4Y1EA 1Z2NX 5BVHA 3H1TA 4HAYA 4ZAVA 5TPWB 8ABPA 1LW6E 1X7DA 1ULAA 3CPSA 3NM5A 5HA5A 2XUIA 1Z63A 1U5CA 2ZIXA 3ZCVA 1HFJA 4HB4A 5AJXA 1FC0A 5HRUA 4KQ6A 5EIXA 1I6LA 3BDVA 3EPRA 4KXQA 3WWCA 1YR7A 2JFYA 3QMWA 4HDQB 2ZYUX 4J0FA 4W5QA 2C3UA 1C3OB 2WG2A 4M0KA 4TQ9A 4FBLA 3R3XA 5LQRA 3ZGZA 1E7YA 1UMDA 1IY0A 1SCDA 3C4VA 3LDAA 4ITUA 1PKEA 3LI2A 4W82A 1YHYA 2EKPA 4QOJA 5ERXA 3HR7A 4LRUA 1R0LA 4GPAA 1G0OA 2VP5A 1KEKA 5HCIA 5C7OO 1X7WB 1HMPA 3ON5A 2BZ1A 2JCGA 3OBBA 3AR2A 3U4AA 1WB9A 1NQAO 2O3QA 1H6CA 1VJ0A 3ZCTA 1IJEA 1IBMB 2D1SA 2ZRAA 4IXTA 5EP1A 4B71A 1W19A 2G5TA 4QELA 3SBOA 2PWPA 3K30A 3EZYA 4QOFA 3EXFB 2BFBA 3Q3VA 2XAAA 3DZCA 1AGPA 5EIOA 2W48A 2P8SA 2DWOA 3Q1KA 2NUPB 4O2BF 2YIVX 4Q1VA 2ZUDA 3IMKA 1N5DA 3TQRA 4ASUA 2RHLA 4KLAA 1OXTA 4DHEA 1GKKA 1R5JA 1SVMA 1UFVA 3PC3A 4JP1A 3G88A 2ZYWX 4QDJA 4LGYA 2JBAA 3DDUA 3RYIA 3DHEA 3TB6A 1BJTA 3VDMA 3ESCA 4UHDA 1YA8A 1KRXA 1HT2E 4HVTA 3CE9A 4ZVVA 3RRBA 4Y9UA 1E7QA 4M9XA 5LQSA 1CS0B 4RS4A 1HG1A 3HCOA 4PHTA 4WZBB 4NU5A 5T4HA 3SJUA 1PE0A 1W88A 3K4PA 2IZ0A 2C4HA 1FUUA 3BRSA 3COVA 4QL3A 3U80A 1BKYA 1ATIA 1FE8A 3TSYA 2AOTB 2DR3A 4BJ3A 3FZYA 4BLSA 1P1CA 2M6LA 1D4AA 2Y3IA 3GRYA 4EQ6B 3R3JA 2Y4OA 3FWPA 4EEZA 3VTFA 1BRMA 2F90A 3GHYA 1NFQA 1V11A 3PHIA 3QELA 3DT9A 5TS2A 1GUAA 4EO4A 4LQCA 4HLUA 3AFOA 2O8CB 4RFVA 4EVQA 1YJ5A 3G0GA 3A9TA 3DA8A 4QQRA 6CHYA 3E81A 2XUJA 4H7FA 5KNLA 4WJKB 4BB5A 3ZXIA 4QXAA 2W2KA 3P9SA 3WLOA 4PE5B 3OZIA 4E0BA 3IVRA 4BJ6A 3H4MA 5LQKA 1M0EA 4R9NA 4JFRA 4RZSA 1KAQA 4FHDA 1QG6A 3RSZA 4PSVA 2AUTA 1NJ2A 1BCSB 5AM3A 4TYYA 1H0RA 3HBFA 1OAKA 3QG5A 1DO8A 1EESA 1U3TA 3ZE8A 2GEVA 2QU8A 1BWSA 1U8AA 4KU4A 4MEAA 3Q1LA 5JWHA 1Z2EA 2EQAA 1IXSB 1OLSA 1NZJA 3C0KA 3CW9A 2WJVA 3RAGA 1BMDA 3W2FA 2GCOA 3A06A 3JZFA 1YT5A 2RAVA 2OBNA 1II8B 3ONVA 4C5CA 2E6KA 4M55A 4EG0A 2W2PA 1SPXA 2ZSHA 5DWQA 3V8EA 4Z7JA 1OA1A 3B36A 1DINA 1CQWA 5F1OA 2J3QA 5TVKA 2QTFA 1PJBA 4MICA 1WNTA 2EHJA 3QW2A 4N8EA 4YVFA 5JNWA 1MFPA 2BFCB 1E4VA 2D0DA 3AHIA 3T1OA 3T94A 3ZHCA 4ZJZA 7REQB 2V1XA 1CF9A 3PFFA 5CCXA 1BDIA 3WZ2A 1Z0FA 2IY8A 4NE2A 4QXMA 1U81A 1LBEA 4DIOA 4OHWA 1XTJA 4PCAA 1UOPA 3BWMA 3IR5A 1JG7A 1U9IC 2FVYA 3NTRA 2RBKA 4HQKA 4JC0A 3WLQA 3WX0A 2QMHA 3BWEA 4OHOA 1SBQA 2PFSA 3B78A 1TF2A 4BNYA 4PN3A 5B55A 1L7OA 3SIWA 1CXZA 1SVWA 4DY6A 2IF0A 1EAYA 1ZJZA 3FX2A 3KE9A 5HXAA 1PTJC 3FGNA 3U4IA 1YB6A 5G4LA 3V2IA 1PEYA 4EJ0A 4D6YA 1QR6A 3JQ7A 2WY2D 4PW0A 3SFTA 2AQ8A 4ZFNA 1QNLA 2VG8A 3FOWA 1CUSA 2QTCA 1Q0UA 2ZWOA 3MQ2A 3T06B 1GG2A 1X8KA 1G6OA 4IO1A 4DB4A 3LU1A 3ABZA 3S7TA 5I7SA 1FQOA 3EWAA 2QR3A 2P75A 4F4DA 5TF4A 4MA0A 1QHHB 2RHRA 3NG1A 4IILA 4ZO7A 5HF5A 1MW9X 1NI5A 2XMZA 3TW6A 4YCMA 5K6TA 2GZSA 1GSAA 1ZK0A 3GRFA 3WJ2A 4NJOA 1IVSA 2E55A 1CRZA 3INNA 3PQ5A 4ND6A 2VQ3A 2DT8A 1W4BA 1FTQA 2GAAA 3C5HA 1NY5A 4B2PA 4IQ0A 2V7VA 2WFMA 4X95A 1HLDA 4BNTA 2ZPAA 3OPXA 4D45A 3OJCA 1PN3A 2CBGA 4H7JA 3U56A 1YGPA 4EHBA 3RTGA 4C88A 1FXWA 3K0AA 1A1SA 2WHEA 4BVHA 2VWQA 4DQLA 4I9UA 4IHQA 1Z8FA 2FN9A 5IAKA 1ODKA 2WAMA 4BNDA 4Z1MD 2WU0A 3TMAA 2JB9A 2VHZA 3IJEB 4TT3D 4DFDA 3ZTYA 2UAGA 4O4HA 3KKNA 4XYBA 4DYHA 4F93B 5HKKD 1R8XA 1YRLA 4OFZA 1AMOA 3AXTA 3KJQA 5K3BA 4JFAA 4LJLA 2J3MA 1J4AA 2NO6A 2YHIA 4R41A 2RK4A 3P0RA 3W6UA 2FOLA 1LC0A 2PCJA 2C9BA 2WJZB 2WT9A 4FEEA 1P2GA 1AGNA 2JFUA 2NUAA 3S4YA 1EFPB 4ECEA 1ZA1A 4MRAA 4X0EA 3V1LA 2YWFA 4HNRA 3E9ZA 4I36A 4POAA 2WPNA 1SBTA 3KSZO 1Q2XA 4ZVKA 3TIGA 2CFIA 2UYOA 3PDCA 1L8OA 1L8QA 3TTUA 4FYJA 1YC2A 3I9MA 1XDBA 1XD8A 1P7YA 3MK31 1AIPA 2VOEA 3LWNA 3O8QB 4G41A 1JX6A 2H0QA 1A2OA 3KFXA 3R8XA 3TM4A 4HI0E 4AMGA 2QA5A 4D26A 1W4ZA 1NV9A 2CXXA 2PZ8A 3S2EA 1PJ8A 4WOKA 3VPXA 1E5LA 1U1EA 2WSSA 2WWIA 3GIWA 2Z08A 1U7TA 4R2HA 4LCJA 1JEAA 2VTBB 2IP1A 4N49A 2ERXA 2VNIA 2JJMA 4X7BA 3HHEA 4CI9A 2HMAA 3N70A 4JYPA 4R5MA 2HWXA 5I47A 2DG2A 4I7EA 3EQ9A 4HO1X 1KDYA 4EMBA 1MORA 1FK8A 1QTIA 4WACA 3L79A 5SYNA 2PH5A 2YV4A 2QLMA 3PIIA 1V8ZA 3NX4A 1PR2A 1UFKA 4N5LA 4O4JF 3TLAA 1M7GA 4XIGS 1NLYA 3ZHYA 1IQUA 1OWPA 3A70A 4FB4A 1P80A 1PZEA 3VNBA 1ADCA 1D7OA 1RQ2A 2JGAA 1RM5A 3PJEA 5DXJA 3SXUA 5KYTA 4ZC1A 1XTQA 1RYEA 4CDMA 1L9XA 1XCGB 5A71A 4MW1A 2QBYB 3W9UA 4RKQA 1KGDA 1RPTA 4ZCSA 4LC9A 4Q12A 1R7RA 2HCFA 3NTVA 1KPIA 2JI7A 4Q34A 5HR5A 1J2TA 1V7ZA 3IVGA 3C45A 2IXBA 4PC1A 4PYJA 4LF7B 1KWKA 1D04A 3KVNA 4TLMB 1OXVA 1VHWA 1VHTA 2P3SA 2PJZA 1YZLA 3F1LA 1BD4A 1JPJA 2WD9A 3KU4A 4NCHA 3BVPA 5I9SA 4BV9A 4HAIA 4AZSA 1Q3KA 3UT6A 1KJJA 1D2CA 3DBLB 4JAVC 2PIDA 4XXHA 3CRQA 5F3DA 3FNGA 5CVJA 4HMPA 5HTKA 3ESZA 1Q0HA 1AOXA 4DDKA 4J1NA 4RD0A 4ZCLA 1N2IA 4WBNF 1SN7A 1MOQA 1BA2A 2AG0A 2ILVA 3CZPA 1U3FA 1I6WA 1NE2A 3CCBA 1HSOA 4K8OA 1C9YA 3SE7A 2COEA 2FW0A 2X3UA 4TVSA 2OV8A 4V0OA 1GYQA 5D5HA 1IY9A 4XM0A 2ZLBA 2EERA 3PA8A 3QFSA 1EPUA 3LLVA 3HXLA 2JAWA 3QJYA 3R5XA 4GW3A 4BKOA 5JXGA 4RU1A 3NRBA 1PX0A 1OFTA 2MU1A 3HJUA 2X8JA 2GAFA 4RIFA 1YKSA 5HBRA 1GFWA 3H2KA 4L8GA 1GV0A 1RD4A 4R3UC 5HRAA 1TA4A 3SEFA 1GPJA 4RZQA 3H99A 4CEIB 1X7YA 1NVMB 4ZEMA 3IB3A 3V8QA 1SA0B 1IN8A 1E59A 1E2EA 4OM7A 1UWVA 1Z15A 2XADA 3FI0A 1N4AA 1OH7A 1ONOA 1BJKA 2GKSA 1GHTA 2IITA 2YCBA 4D9NA 4EQZA 5AIBA 2QUZA 3W1VA 3KZMA 4GGOA 4HEA6 1ESEA 4KR2A 1ZS9A 2WB2A 2RIRA 2YN4A 5IYZA 2HCTA 3G5MA 5KOYA 4ZI7A 3Q0TA 4HB3A 2JARA 2OGTA 4JYAB 1E98A 4G24A 3H8WA 1KY5A 3B6ZA 4Z4HA 5KKNB 4BFTA 3PEUA 5JRDS 3OT4A 3G8AA 4BVJA 2ZRJA 1RU3A 1PD0A 4Y2GA 2WILA 3SF8A 2SNIE 1AZLA 2QU7A 3OQVA 2FUG1 3PV0A 4J1QA 1P9WA 2XD4A 4KO8A 4NJMB 3R0QA 4ENQA 1ZH2A 4TL6A 1DKOA 2BEVA 2FR8A 2R44A 1BE0A 3C7AA 3HKEA 4LY6A 3QX9A 2C7VA 1T10A 1VYUA 2GKGA 5B1YA 4FS3A 4Q21A 4U9UA 4C04A 2HA3A 3BRCA 4UMVA 3K6KA 2A9KA 5TF0A 2Q5QA 4G0WA 1YRHA 3TH5A 4LS3A 5B1EA 4R84A 1Q7GA 3OJWA 1JFVA 1F9EA 2DQYA 4FKBA 2XCTB 3HYLA 1OJLA 1R10A 2ZAGA 4RXTA 5ES3A 3U9SA 3O2NA 4M9UA 1ZUIA 2XCIA 3RB8A 4B3BA 4N9QA 3SNKA 2J59A 5IF9A 5JTTA 4LNUB 2FNAA 2I2AA 2Q1UA 2V8BA 3GFQA 3GUUA 4TM7A 2IRWA 4WFQA 3S40A 2BEJA 1M1YE 5EESA 3K94A 3SDZA 3B7GA 2CKMA 4L72A 3CN9A 1V25A 2VJOA 4P6VF 3QOXA 4QNMA 4V2IA 3C48A 3AHJA 2ZB4A 3K2IA 4Y7CA 1D5WA 2P9EA 3G2KA 2NQ8A 3OPVA 4R8MA 4X1IA 5ALOA 1U8ZA 1NJ8A 1GAWA 1U1CA 2H2WA 3L6BA 4WNCA 3TWOA 3RAEC 2HY7A 2ORIA 5JNTA 1NJGA 4BQNA 3T1TA 2G9UA 3OQIB 1E20A 2IYSA 3L4KA 1E2UA 3OJXA 5HFJA 4ALMA 2BAGA 3FVRA 2GF2A 2W6PA 3KELA 1CQZA 2RSLA 4O4JB 3LFUA 2GM5A 2XUKA 3O4JA 2ZR8A 1JSXA 2I33A 1V48A 2VHUA 4ZTZB 1OHHD 1RMYA 2P90A 3VNUA 1A4XA 2ZIUB 1Y9JA 5B36A 1K8QA 3QHPA 4RVDA 1NURA 4U7GA 1WBBA 1FYDA 1UKZA 3P45A 3HO1A 1GKIA 1AKYA 2G4CA 1Z18A 5A62A 4DR5B 1K6JA 1YRAA 2EVWX 2UUAB 3ROZA 2HRBA 3G3EA 1EVQA 4M7WA 4RFSA 3V3KA 4WEQA 2HOQA 2FSUA 4YT2A 3K4QA 2QJOA 2ZBVA 2F8MA 1MC8A 1DG3A 1WSDA 4OMUA 4IMRA 3TQOA 1NXPA 1GRQA 4E2YA 3DHWC 4JUCA 2SCUA 3LBHA 3HNRA 2BP7B 4DA0A 4PNEA 2V65A 2XTNA 1SIBE 1P77A 3O8CA 3NMUF 2IY7A 3FIJA 4Z9BA 3CB4A 1JIXA 1R8QA 4A0SA 1RM4A 3ZOZA 1FDVA 5EINA 2WMOB 2QYHA 4CLEA 3AP2A 4FW8A 4S2UA 5GINE 2G9VA 1B8OA 1SD1A 4M1OA 3I2JA 3J7TA 3WGUA 1U2QA 4DLUA 4XD7D 2AFHA 4WLNA 1PLJA 3FGZA 5I51A 5IARA 3DL0A 1NNSA 2CCKA 2EZUA 3G8BA 4EPVA 4TLLB 5SYAA 2C2KA 4WQMA 3LT5A 1QGAA 3EZXA 3IPCA 4DNOA 4M8SA 4G97A 1KJ8A 2ZG6A 3O3MB 4OMFG 4LE1A 3TIXB 1QB8A 1C1YA 4MJ3A 1FDUA 2KX7A 1QG2A 1OIWA 2C29D 2R79A 2Y77A 2PJUA 3E7XA 3KKMA 2XYQA 1K9VF 3OFND 4IZIA 4P35A 5IVHA 1AX9A 1JMVA 1V8DA 2RMKA 4C4AA 4OHVA 1SR8A 4MH0R 3D2CA 1LNQA 1RACA 1XOIA 2EFYA 1SC4A 1XD2A 4HH4A 2ZRNA 4HAWA 3NASA 4J2HA 5DGIA 2NO9A 4R81A 1NXWA 3F78A 4QPPA 4Q4HB 3RG2A 3HMQA 2FQWA 1DIGA 1N5OX 4LC1A 5ERGB 2EGUA 2ZAIA 3DUFB 3JQCA 1H65A 1QIKA 1GYRA 1GCIA 4JS0A 1GQFA 1VOTA 3KBOA 1SCJA 1SM4A 1Z6XA 2GJ4A 3E03A 1CIVA 1PJZA 3WLAA 3MXOA 4EO9A 4CKCA 3ZDXB 2JLWA 3F71A 1RJEA 2WKPA 3PSHA 3P52A 3Q9SA 1USWA 4CMHA 2II6A 4QYWA 2YNMD 1Q6ZA 4WLUA 2VT6A 2GFQA 1VHDA 1Z2DA 5AI5A 2GZRA 1T0BA 3LG2A 1EMDA 1KJWA 2CNBA 1RTKA 5JLJA 4WZ6A 2KPOA 2C9DA 4E5DA 1T6NA 1Z7BA 1PTKA 5EIFA 4EZEA 3OQNA 2QM0A 2QAGB 4OYHA 1QS0A 5IXSA 2VSXA 3ANLA 2PMEA 1HNNA 3KQSA 3WS7A 4YDHB 5LXTA 1GUBA 4A8HA 4PCLA 4UDYX 4HADA 3SU8A 5BSUA 3EVGA 3MAJA 2HNKA 4GH5A 4GRIA 4XIIA 2FW8A 3HCCA 1LGYA 1MOPA 3VR3D 1XCJA 5I4KA 5EJ4A 3DZKA 3FFBA 1DQPA 2ZCUA 2BEWA 5TDHA 1MIHA 4OUDB 1T8TA 3M4YA 3BD9A 2O7VA 1A0OA 3IMCA 3CB2A 3DMDA 3HJTA 3KOUA 2W7TA 1TAUA 1DWQA 1QFYA 3C14C 3RUDA 4N18A 4HFRA 3V00A 3CRW1 5KKCA 3PU6A 2J5RA 5TPZD 3X1KA 3AOEC 4HXEB 1OSNA 4O63O 4GBJA 4NONA 2D4AA 1P6UA 3T7TA 1X19A 3I45A 4O2AA 3RTEA 2G1KA 1QGDA 1WB4A 1ZSNA 1QOQB 2W71A 3HJAA 2NU6A 1P44A 2P9JA 2HMUA 2PKCA 2ZIWB 3LX5A 1KMNA 4U5QA 5E4TA 3SSNA 4P4NA 2P0AA 2ZTHA 3SOPA 3T9BA 3VYVA 4AULA 1OZHA 1W0JD 3F5MA 3U19A 1LS6A 1U1DA 3L0PA 2P2GA 3SDBA 4DTIA 4WFJA 4WOCA 5IG2A 2IKSA 1AKQA 1KAHA 3CLVA 2WD7A 4ATNA 3GNSA 5FI1B 5ALNA 4FNGA 1L7PA 2QUIA 3MWJA 4QOHA 4GBGA 4TS3A 4X54A 4Z99A 5F21A 3VR2A 2FVXA 1FSSA 2RHDA 2RB4A 2QI9F 2C8LA 3TKAA 4O5OA 3WBBA 5DSTA 5EHQA 1QH8A 5I01A 2KLHA 3WMWA 1EP3B 2FN8A 3ZDFA 1M72A 4L50A 4MPPA 4DA8A 1ZOPA 1F4PA 3TQFA 3THXA 3RVBA 5KEIA 1TZ2A 4DLVA 2ZBDA 4OAPA 4ND5A 1VE3A 1Y48E 1QRTA 1IYZA 4C2UA 1SQSA 1XVAA 4QFBA 4Y6RA 5KYUB 5K3CA 4CF3A 5DI3B 4YYEA 3D8UA 4KR0A 1CQXA 1CZLA 5BXQC 2BKAA 2IA5A 2NGRA 2BMEA 1B16A 2ZU0C 1VSVA 1RAFA 1W581 3EFOA 3E18A 1JVSA 1IAQA 2OAGA 3Q88A 1VPTA 4EPTA 1QGUB 2Y2UA 3N8KA 3PLNA 2VLBA 4F9EA 2FHPA 2XUPA 2F9FA 4NC9A 1TIKA 4EB6B 4GPBA 3H87A 3RC3A 1P75A 1QSGA 1R88A 1U7OA 3BULA 3ET4A 4BYMA 2YZ7A 3I72A 4YP9A 3WDMA 3EDMA 3P2KA 2OLKA 1LJUA 5E9JA 2H4YA 2JIPA 2ZJ4A 1J0EA 2ERCA 2L42A 2ZSEA 5FWDA 2QAIA 1GN8A 3E5RA 5LDHA 1ZFNA 2J4FA 2Q3HA 1E2IA 1PFKA 2CXOA 2OUIA 4OU5A 5DGDA 2AK3A 1YBMA 2WE8A 3JATB 5TX7A 4DDVA 1ZI6A 2XXAA 1BXGB 1S2GA 3EDRA 3FWHA 2KM1A 3DO6A 3B7PA 3FFWA 4PBRA 3SQOA 4O1HA 3BKXA 3K8OE 1R6BX 2EFGA 3EUAA 5AK6A 2DECA 3WKBA 2O2XA 3V4RA 2VSOA 1SXJD 1A9SA 1B74A 1MG0A 3Q9UA 4P84A 5TQ2A 1TLLA 4J1TA 3UQYS 4D82A 4JQZA 2G28A 4AF7A 3KHSA 5HZKA 1OLUB 2PKQO 4X85A 5JAOA 3U09A 1KMCA 2Y1FA 2ZI3A 5DGCA 5TR9A 1H5NA 3ACDA 2BUCA 2GYVA 3AJDA 4RPCA 4XASA 4HDSB 3CF2A 1JEQB 3V42A 4DCOA 5EJ5A 5KWEA 1AZWA 3SM9A 4WXPA 3CEJA 5CEEA 4RVCA 1Y6GA 3THYB 1KKMA 3K1AB 2CSUA 1ADYA 4BQFA 4HD8A 2JIOA 2RHTA 1OT5A 1FJHA 3D7RA 3OQHA 3KKZA 4WINA 4S04A 2UZ0A 4LRXA 1RE0A 3HTXA 1HPLA 2OHFA 4ZYZA 5KO2A 1EUDB 4XFJA 3GZTB 5L3VA 2GEJA 4JGIA 4HH0A 5K0FA 1WV1A 4PIVA 1TQ6A 4GFDA 4DCSA 4MV5A 4RPHA 4R6WA 1K6IA 2H4JA 1ZHHA 2GRJA 3LDUA 1NV8A 3GA7A 5EWMA 1DT3A 3AKDA 3GLKA 1NW6A 1N57A 2P91A 3BFJA 1MXHA 1W52X 2VK8A 2CMDA 5EWLB 5LLSA 1A72A 2PGLA 4F4HA 3GL9A 1WETA 2VP0A 4B84A 1NFRA 5HIJA 5FUXA 5FYQA 2WNHA 5HZHA 3IL2A 2PVSA 5KNDA 3UIEA 2QJTA 4BP1A 2BGKA 4B4OA 1KVQA 3MJHA 4GMGA 3KJGA 1ZMOA 1XZMA 3BH0A 4MEJA 2AXEA 4RAOA 4RH0A 2P3LA 5JPDA 4QWMA 1MJGA 3FTCA 1QQ7A 1VB5A 4ITVA 4Q9HA 4PIMA 1FDOA 4QECA 5EZQA 3Q7EA 3THOA 2Q5IA 3GVPA 1PJ3A 3QQPA 4KRGA 5J63A 3HU2A 1Y3HA 4P54A 4UEOA 4KXLA 4ZOLA 3TLEA 4JJZA 1A5AB 1Q77A 1N8TA 1X39A 1XK6A 2EF0A 4GM1A 2BGLA 4AG5A 1E3DA 2GM4A 4G4SO 5ECGC 1EHYA 2BTQA 2F1HA 1Y5IA 2H1RA 3DCJA 3EEFA 1BNCA 3H2BA 3Q2KA 1DJLA 1VIMA 1LDBA 1NHWA 4QVGA 1BEZA 1A27A 4DVJA 1RQRA 3C3YA 1G5IA 2R9VA 3MTGA 3NAMA 3TXYA 1DBQA 1VXOA 3OPYI 4F4UA 4OHKA 4HRXA 2OB2A 4YRDA 4ZQIA 2FMIA 4LE0A 4YMTA 3GEDA 1WO8A 4L78A 1V5WA 5EKSA 3ZNNA 4TPKA 5CXUA 1PV4A 4BN4A 4Z9AA 4ZYVA 2FF7A 5H81A 3UUGA 1PR4A 2GESA 2ZM5A 1VKNA 1DDIA 1JHOA 3PGA1 4LK2A 1G3MA 4FSDA 1W47A 3G7NA 4KQCA 2P6UA 1F12A 3I73A 1Q5PA 3A05A 4HDNB 4Y6OA 4H6VA 5SZIA 3JQAB 1EK2A 2P68A 1W75A 5DOVA 1JH9A 2Q07A 5L4NA 1YE5A 4JGBA 3GQBB 2I7CA 3E2PA 3UGQA 1JU4A 4MVYA 1IHOA 3IEKA 3AUSA 2AH5A 3FHLA 2ODPA 2Y67A 4G25A 4XUGB 3LC1O 1HMYA 4HATA 4MWGA 4WXEA 4DIDA 4E5VA 4TUYA 1LPAB 2GEBA 4MI3A 5EWJA 4ZYTA 3UWKA 4ZHQB 1P1HA 2CLSA 3A4TA 5L3ZA 5CFMA 1YMUA 5DNWA 2P3OA 1FS6A 3LQ4A 3OP1A 3TSOA 5H82A 5HJ7A 5KTPA 1G16A 3SVZA 4C0WA 4LX8A 4CR8A 3HVKA 1CG6A 1II9A 4Y2SA 5GWXA 2I54A 4RV4A 4KXVA 1UDCA 1NTRA 1ZI8A 1Q22A 3IR6A 4XWAA 2XAUA 4PPFA 1V35A 1KK0A 2ZUUA 4DR4B 1W9MA 3CU5A 3KJHA 5BWBA 4FCCA 1EJ2A 1FFXA 1TQ8A 1Q17A 3O1JC 1Y1SA 4KFSA 1J8YF 5DHAA 5GAJA 1NMYA 4E31A 2C3YA 4I5IA 2XZLA 1E2KA 1YAHA 4B6OA 5CDGA 4MR8B 4URVR 1D2HA 1G20E 3OJEA 3TLJA 2YDXA 3L1KA 3PE6A 1HUQA 2OVBA 2H29A 4JBHA 2C07A 2ZK7A 4H3SA 2WIDA 4G07A 4CMAA 3E5MA 2VZ8A 4XYEA 1IBCA 1XVIA 3Q6NA 3KSUA 3Q3IA 2AJDA 2W2QA 5BWOA 5B3JA 1BYIA 2JASA 3A9VA 3AEQA 4YUAA 3K0KA 1EVYA 4KGZA 4KK3A 3VU1A 4AU1A 4ZHQF 1OZ0A 2PSDA 1O4VA 2XMGA 3DCYA 1I7QB 2AEMA 4DR3B 4IP0A 3BH6A 4IWXA 4P0TA 3ELWA 4UBMA 2JHPA 4OSEA 3KVYA 4FE7A 4XA8A 2QTVB 5LZ8A 1S1MA 2P5YA 1E3EA 4GLJA 2EWWA 4BVFA 4WA7A 2Q3DA 2AMLA 4MUKA 4ILEA 2P4QA 1GQOA 3GVCA 4LUCA 3RAPR 2X19A 3OD5A 5FDFA 2NP7A 3QGMA 3JTMA 1YCHA 4Q37A 4MV7A 4BUJA 3L82B 3OE4A 4UMFA 3EVDA 5D86A 721PA 3ZZTA 3IPRA 1NR1A 1TKRA 2BHLA 2O3TA 2ATEA 3OAAD 4KXMA 4RXUA 2N9UA 3FZQA 3Q7TA 5DTRA 1UMBB 1ZGAA 4C76A 1CUDA 4EVIA 4JK3A 2FOIA 4YRKA 5KTKA 2R8PA 2XY4A 1YL6A 3MSXA 4FMDF 5IW8A 3H16A 4DKJA 3CPJB 4MB2A 2YW9A 4LWQA 4J90A 4YUVA 5BUQA 1TUIA 1WSAA 1SBIA 1O77A 4FJ0A 4D3XA 2WPDA 5I7WA 1XB2A 2BZGA 3GP5A 3TPFA 1K1EA 1VG0B 2XB8A 5BW4A 3TR6A 1AK9A 4A8PA 2PGOA 3K8ZA 4P7GA 5FPSA 2O8DB 2Y05A 3RTAA 1IMJA 4BVBA 4DG5A 3DXXA 4IL5A 3BTOA 4DZRA 2YDYA 2H85A 3AY3A 3KXLA 4B4DA 5JVDA 1BROA 2YHUA 3N2KB 3ZXSA 3ZV7A 1E0DA 3OIDA 3KWLA 3WISA 1SIUA 1WXWA 2QLNA 5LP6A 1CBUA 1KGSA 2O48X 4B2YA 4P4GA 4EWLA 3CNQS 4JWTA 4L4RA 2OXEA 1RRMA 1CB0A 1BMFA 1TDJA 2DWPA 1LY1A 2X7JA 1Q0PA 1X1AA 1Z17A 2VBIA 3IQEA 1PQWA 1U9IA 3V46A 2HEGA 2PWZA 2YZMA 2WA2A 8ADHA 1DX6A 2B9EA 1W0KA 2UZ1B 3IIKA 3ZIAD 1EQAA 3KT0A 2BBTA 3EOZA 3AYZB 2OXIA 2FCRA 2GSDA 4R8RA 4G1UC 3IOBA 4II3A 1I14A 1PTJA 2W6ID 4Z8XA 1K0FA 2ZAYA 4MQEA 1GDTA 1H2YA 2H9IA 1M8GA 2OEPA 2D5BA 2ZW9A 4HGYA 2P2YA 4FLFA 4QHYA 5FOQA 4L07A 5B58T 1QUFA 3H7IA 2WAAA 3CGWA 3KTAB 4RKWA 3X1XA 5AHWA 1ZSYA 1ZD4A 1QIFA 1UBJS 3R2JA 3WIEA 1NOJA 5FEUA 3B70A 1NLUA 5LQNA 3JQDA 3VISA 1XJCA 3MLBA 3V6LA 5AVYA 5DHQA 3REOA 2O19A 5EN4A 4GL4A 1S3FA 2Y27A 3IE1A 3FOBA 1CKEA 4YI3A 4CTOA 5FHRA 4TXJA 2XSZD 1K4YA 2YBEA 4E5UA 4D0GA 1ORWA 2E3JA 3ORYA 4B85A 2X23A 3TGWA 2V7GA 4FC6A 1WNFA 2GZ3A 3BGIA 4JQCA 5EFOA 4BE9A 1PT5A 1KI2A 3EARA 4XUCA 4XRGA 5CCBA 4GMDA 1NUSA 4LHEA 1ZCZA 3L8CA 4IIBA 1WWKA 1Y63A 2YCLA 3EXIA 2FN4A 4K88A 3WHIA 2GYYA 1ZD3A 1WXHA 3BQNB 1Z34A 3HCPA 3JRWA 4FFNA 2H18A 1ACJA 2PPVA 4GVPA 4UVHA 1PK8A 3D6UA 3F7OA 2OMKA 3AM4A 3IBGA 3KO8A 1YJ8A 5JC8A 5L51A 5TGZA 2GYUA 3WNCA 2W4MA 4DABA 3M3HA 1XZ8A 3MCUA 4K05A 3PFCA 1ZH6A 1TUEA 5DASA 2HMTA 3HBJA 3QEMB 4PAOA 2B92A 3FUTA 5DGTA 3WTBA 2GPJA 3T3PB 3HZOA 4FSHA 4WX2B 5TV2A 1KR5A 3GEPA 3GWZA 1DX9A 1X80A 1EFHA 4KJZA 4P0PB 2G1UA 5EL0A 3ESBA 4HWOA 5EKXA 2QX6A 3VYWA 1L4UA 2GEUA 4WNAB 4ZU6X 4E6EA 3FPFA 4JA0A 5DE3A 4PO3X 5HFNA 3TOVA 4FT2A 4L6AA 1POWA 5E4JA 1KBOA 3QBDA 1OZAA 1XCOA 4PONA 4QDZA 4ODIA 2DWQA 4K6CA 1RJ9A 1KJ9A 3TD6A 2Z6UA 1ZHFA 2OAP1 1PQUA 1SU8A 4F84A 3U1TA 4RM2A 2GHTA 1DAMA 4DCUA 5JMWA 1CE8A 4GMXA 1BX1A 1FDTA 4K8RB 4BMPB 5JLAA 5I3CA 1QK4A 5CB4B 3EGEA 5FNZA 3MHTA 5TMDA 5T67A 4LTMA 2VF2A 2C4WA 1P3DA 1V8PA 2XOKA 4YP7A 3FBWA 5ICEA 4I4IA 4FI3C 1NR5A 3G9ZA 2UZ4A 1RQ7A 4V0LA 4F12A 1KK2A 1KMQA 2Q6OA 1G18A 3AFMA 3IAAA 5A06A 1I32A 1ZCFA 3D0RA 4U7FA 2YVQA 4R2KA 3RS3A 3ZW9A 5IJ9A 3ODPA 3QE9Y 1ZC4A 4FMDB 3ICPA 3IJRA 3I5XA 2FMXA 3G7UA 4M2LA 4CRWB 3OURA 1NC1A 7GPBA 1M0SA 2VUSA 3U49A 4EHHA 1HDOA 3SK0A 4AAYA 5JHHB 1J0XO 3N07A 3WWYA 1K27A 2B5WA 4O4LA 3ZGOA 4AUEA 4IX1A 3ZY6A 4G89A 1E4EA 1KS2A 4RDXA 1LI7A 2DBYA 3DE2X 1FW8A 2OO5C 4TKLA 5IPFA 2PTGA 4PS0A 1X87A 1SZDA 1XL0A 4LEIA 5B7QA 5IFLA 2BHSA 3ZWAA 1SHTX 4LZLA 4D9HA 1ZONA 1YQWA 4YJGA 1U0HC 1FLAA 2BR3A 1M83A 2E9SA 3A1NA 3OX2A 1H2RS 4I4CA 3SR3A 3TFWA 3EZ2A 4NFLA 3UMGA 4GNRA 4A2PA 2VSQA 4XRRA 2JGFA 2ZE8A 4BQRA 3M34A 2X4GA 1XAGA 2PS0A 1UUFA 1DEKA 4JLUA 4DR1B 1NI3A 1PJ4A 1QFMA 4UAUA 1RI2A 5BYBA 3FNEA 3ONEA 4YQEA 4S2EA 1V3UA 4TLCA 3ZE1B 1JZSA 2R4TA 4NEHB 3IRUA 3ODGA 4FDAA 4D9GA 5BSVA 2VQEB 4ARIA 1ONNA 4AP9A 1DCMA 1OC4A 2GARA 4LZAA 5CW1A 5REQB 3ZJUA 1QAMA 2QGFA 1JNXX 2QXTA 4TZ0A 3FDZB 3JQEA 4S1NA 2OG1A 4D3DA 4RTNA 5DNCA 1W1IA 3M1AA 2RAUA 4B4KA 2JRLA 1UQUA 2C00A 2D0PB 3MWEA 1NVTA 3V1YA 5CLJA 3R7BA 3MINB 5A0VA 3B2EA 6Q21A 1QHFA 2P2CA 1NGSA 4C5AA 1X3SA 3NEPX 5AW2A 1JJAA 1IN4A 2DBVO 1L0BA 1YZHA 4W5HA 5JH7A 2O9JA 4ENRA 5LJLA 3IB6A 1OB5A 4WJLA 3OX4A 1NNEA 3ROXA 1CJUC 3RUCA 3BFPA 2XNJA 3KAQA 1TPYA 2B36A 3U4HA 4GD3Q 2AKEA 3MTDA 5JMPA 1T5DX 4BLOA 2FKAA 3CNEA 3UNXA 3HJHA 5CD1A 3T5AA 4KAXA 1B42A 2FSPA 3O73A 1KFJB 3BA1A 4RTKA 4OGWA 2C3PA 3M82A 4NBVA 3V32A 4S05A 5DEOA 2IVFA 2C2MA 5ALUA 4Z4IA 1I4TD 2OHIA 4BGVA 1MA3A 1ZDMA 4OOFA 1VLLA 2GA9A 3FXAA 2XNHA 3HXOA 5CJ2A 1H4QA 1A5TA 4L6CA 3F90A 4BOYA 2ZIFA 3TJZA 2JI4A 3JALB 5HKAA 1EFCA 4ESOA 1I51A 3QEOA 4LVUA 2P67A 1YKFA 4MA4A 4C0SA 5FFNA 1CW2B 4ZDIA 3ETCA 1H2BA 4JGGA 3G0BA 4PAGA 2X5KO 5HMMA 3NOVA 3L0DA 3Q7RA 1LK5A 1XMIA 2RBEA 2XT0A 3RSOA 3X1YA 4B3IA 1Z39A 2J1LA 3G9TA 5JCXA 1R15A 1CV2A 2BMVA 4LXHA 1DAIA 2QZ9A 3T4PA 1S89A 1XQYA 3F6BX 4RLSA 1WP4A 4XVQA 1IIRA 3WIVA 1X7ZA 4EPRA 5LJIA 4W63A 3KBBA 4WBSA 4LKOA 5AVVA 2ZTUA 5AKGA 4NCAA 2BDUA 3W2HA 1JFLA 2MINB 4ZZ2A 4GYKA 5IDWA 1WHTB 4ZARA 1MABA 1COZA 1P0FA 5D5PA 3F97A 1H3FA 3M6IA 4GZ3A 4H0NA 1RMQA 3L9WA 5BQ3A 4YB8A 2FQYA 2XGJA 4GXNA 3PUYA 2WFLA 2BGTA 4Z4QA 1EBUA 3UC9A 1ISJA 2HJGA 1BVHA 3ABRB 1SBZA 1O4WA 1R3UA 1I2BA 1R5NA 3HACA 1BWQA 3ZY4A 3LBAA 2OBLA 3K5WA 4FFLA 3KP1A 3JD4A 1OBVA 1QOZA 4JQYA 5TMEA 1KFBB 4AS2A 3ZVMA 2AOWA 4YEDA 4M21A 4YRNA 4IHJA 3ESXA 3ZZNA 1PLKA 1DMSA 1RLJA 2RGNC 3FCSB 3NV7A 1E9AA 2QS9A 3CEAA 3FKQA 3N3AC 3RYFA 2N0SA 3TQCA 4EG6A 5LKRA 2BGIA 1QIJA 3FFXA 3N5KA 1FJ2A 1RXYA 5A5EA 4F3NA 1KO7A 1Y4ZA 2JFQA 3AFGA 2XBUA 4HZGA 5CT5A 1XEXA 3IT3A 1F3LA 1ZJWA 2VCHA 1RBYA