4L4SA

Structural characterisation of the nadh binary complex of human lactate dehydrogenase m isozyme
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase A chain
publication title Structural characterization of the apo form and NADH binary complex of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 331
sequence length 331
chains with identical sequence H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4l4sA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4l4sA02
5TJHA 1LDYA 3ONFA 4I08A 4HBGA 4CMHA 3IDSA 5JC8A 1OMOA 2XXBA 3LVFO 2X5KO 3HFGA 4MVJM 3H3JA 1S7CA 4OXNA 3RC7A 2D1YA 3E5RA 4M89A 1BMDA 4FBGA 5L4NA 1ZEMA 3PFFA 4HUJA 4EEXA 3GMSA 1GUZA 1C1DB 1X0XA 2OBYA 3WGQA 3KETA 1N8KA 4L73A 4Y67A 5CDSA 4TVBA 4XYEA 2Q3EA 1T4BA 4DXHA 1NHWA 2X86A 1JKFA 2QZZA 3KSDO 2Y1EA 1EVYA 1PL8A 4Q39A 3ITKA 1ZH8A 5DBGA 1JKIA 2C0CA 3OSUA 4HNHA 1XHLA 3IJPA 1J5PA 3GAFA 1E77A 4TRJA 3ZU4A 3GG2A 1GAEO 4WCFC 5A02A 5KJCA 5IDWA 1O0SA 2JAHA 4JCOA 4XJSA 2Q2QA 1PJQA 2Y1CA 2O3SA 3AM5A 1UAGA 1NAHA 3CIFA 1P44A 2D2IA 4MVJG 3FNFA 3I1JA 3VH4A 3AU9A 1GU7A 2NTNA 2HK7A 1TT7A 4EI2A 4FW8A 3DZFA 3F6YA 1J49A 4OIMA 1V6AA 3NT5A 4S1VA 4RO0A 2CVZA 3ETGA 3ZNNA 4K28A 1EMDA 3I5MA 3VAZA 2HMVA 3DEYX 4YBZA 1ENZA 1HYGA 1ISFA 2A92A 4HKTA 3EVTA 1I2CA 4KQWA 1SEPA 1G0OA 3TDKA 1ULUA 4YRBA 4FCCA 1LSSA 1U7HA 4RVFA 1UXKA 4L74A 3GEGA 3ETEA 1PL6A 1KEVA 3G79A 1Q0HA 3GZ4A 1I3KA 4ZD6A 1DBVO 2R2GA 4MP8A 2FN7A 5IDYA 3O4RA 2WD7B 3WQQA 1Z7BA 2CSUA 3ANNA 5G0VA 5IDQA 1ZJYA 1T4DA 3PHJA 1LC0A 4B7UA 4NNJA 2HSDA 2QW8A 2W98A 1U3UA 4PLYA 1D1TA 4Y6PA 3UVEA 2X5JO 3Q0EA 3SC4A 1P77A 4BOYA 3CMMA 1VJ0A 3AOGA 3NTQA 4MVJP 4U7WA 5HRUA 1O5IA 1BXGA 1TEHA 1Z75A 1DO8A 2BGKA 1QYCA 2H9IA 3ROKA 2Q1WA 4IY1A 1RM5A 2R6JA 2EP7A 4GX0A 4GX5A 3F4LA 2X9VA 2XF8A 3WYCA 3VPXA 4ONEA 1VKOA 2GRAA 3UUWA 2GO1A 1G1AA 3C1AA 4K9DA 2RCYA 5JS6A 2GASA 3ST7A 1R37A 3I9JA 5C7LO 2NVUA 3HFSA 5G0WA 1PIWA 2GN9A 3WWZA 2GDZA 1ISIA 1BVRA 3OIFA 1N1GA 4ZQEA 2YHUA 4QEDA 1JAXA 5CP8A 4MP3A 1ADCA 1LDGA 2C7VA 1A72A 3VTZA 1J0XO 1I01A 3WTBA 4FFNA 4R5HA 1EVJA 4B3IA 2J3HA 3DFUA 1PS8A 5GY7A 4ZRNA 3U4CA 3QWHA 1GPDG 3WFIA 2NV6A 3AOEC 4OJNA 4TKLA 2HMUA 2IYPA 1LTHR 4MVJF 3OFSA 4EUHA 4UVHA 4EJMA 4J2HA 1EUDA 5JMWA 3TZ6A 2GSDA 2JJYA 3TF5A 4XZ3A 4G81A 5A3VA 4BNNA 3S1LA 1NFQA 4U6SA 4UUNA 4Z3DA 4CV0A 1E6EA 3HE3A 4LW8A 3F47A 2HUNA 1ZK3A 2OFPA 4EYEA 3SLKA 5A5EA 1LRJA 3W1VA 4NBWA 1P1KA 1FDVA 2BFAA 2X23A 3GHYA 3KOUA 1E7YA 2Q45A 3S8MA 1C1DA 2ZB7A 2X0NA 3LDHA 3WFJA 4LMRA 5I7SA 3VVBA 1UH5A 1Q7CA 2EKPA 4J4HA 3LT0A 2RHRA 2Q46A 5IAAA 4J0EA 1DXYA 4DMLA 5DZSA 1U3VA 4CM6A 4OYRA 3ONEA 4MPDA 1VRWA 4XB2A 4G2NA 2F1KA 3H2ZA 4Y6SA 3BA1A 4M86A 1JKJA 3K6JA 4HXYA 3CUKA 5IF3A 1LSJA 5IZCC 3KEOA 1MG5A 4OGWA 4B4VA 4HWKA 4FD3A 4MINA 2NTJA 1HRDA 5DF1A 3PGXA 1RYDA 4NMHA 3B70A 3JYQA 1UP4A 4HFNA 5F5LA 2O3JA 4I9NA 2X6TA 3QVTA 1YL7A 4QXMA 3K2EA 1NX6A 3FPCA 1OC2A 4J4TA 4R01A 5KWEA 5JO0A 1ADGA 1DIGA 1EDZA 2FPGA 2FWMX 4E5PA 1DRVA 1ZMOA 1T2DA 3IJRA 1YO6A 2DUWA 1PQUA 3QJ5A 4Z6KA 1M67A 1F8FA 1FDWA 3H9GA 3EK2A 1JWBB 1NYTA 1IL0A 4RQUA 1JWAB 3OF2A 1LRKA 2UVDA 4Z9FA 5JBIA 2HK9A 2ZIZA 1TLTA 4YT8A 4ZQHA 2VOEA 5JLAA 4BKRA 1K3TA 2FPPA 3HDHA 3CZMA 3A4VA 4Y8VA 5B37A 3RKRA 2EW8A 1PWXA 1ZK1A 3DO5A 3WGTA 4LK3A 4J4BA 4CM3A 4FJ0A 3QHAA 1E1NA 4WLUA 5B4VA 2RHCA 1KVTA 4E5NA 2I76A 3A06A 4BNGA 3UH1A 2Y93A 3JQ9A 4ALLA 2HMWA 3IP3A 2Q1UA 1RM0A 3I52A 2P2SA 4J7UA 1I30A 2E48A 1YBVA 2AQHA 3AW9A 3PHHA 1OC4A 4R69A 3AUTA 4RF5A 3LT2A 5I7EA 4DBZA 4AJOA 1EFLA 1KERA 5CEEA 2ZB4A 2QRKA 4CMCA 3DBLA 1EFKA 2RIRA 2IYOA 1NPTO 4P4NA 3U4HA 1R0KA 1T2FA 1NXQA 3ROPA 3UKOA 5B4TA 5JYDA 5ER6A 3ZHYA 1HXHA 4OMUA 2P91A 3SX2A 1U5CA 4DREA 1E3JA 1AHHA 3JD3A 1I2ZA 5A1TA 5MDHA 3GRKA 4ZICA 1JLLA 1LJ8A 1VSUA 5CPBA 6ADHA 3G0OA 2Y1FA 1ZO8A 4ND5A 3Q9NA 2JHFA 2IE0A 1IYZA 1KVUA 5FI5A 1V3UA 1NQ5A 3KEQA 1E1LA 3AY3A 4XJTA 1I3LA 1UZMA 3LF1A 3PLNA 3LYLA 2Q4EA 1NVGA 4AJEA 2J3KA 4AJ2A 2NADA 3A28A 3OETA 4J43A 1Y1PA 4XQ9A 1GYQA 3KTDA 3UHAA 3K92A 5CEFA 3WGIA 3H7AA 1BSVA 1EUCA 1HL3A 4DIBA 3DZHA 1M6WA 5EMHA 2W4QA 1YH3A 3Q3CA 4YXFA 1ZNQO 1EQ2A 4CQMD 4DL9A 1VL0A 3WICA 4NR0A 4QECA 3KSZO 2O3RA 1M75A 3I9KA 4GX1A 1ZVMA 4WPGA 4HY3A 2I67A 1U8FO 3ADPA 4R9RA 1HE2A 4DWVA 3L07A 4FGSA 2OL4A 1A4IA 4Q3CA 3NTRA 2JCVA 1X1TA 2IZ0A 5EQFA 2QYTA 1KVQA 1W6UA 1PWZA 4WLEA 4R1UA 2DBVO 4C4OA 1MA0A 4L8VA 3ZHZA 1YKFA 1U3TA 4DPLA 4AJIA 3QWIA 1B16A 5G0SA 3H8VA 2NSDA 3ZWYA 2C07A 3FR7A 4UULA 1KVRA 3BMOB 4IDCA 3OBBA 1H94A 2RBEA 4N5LA 2ILTA 4BO0A 6LDHA 4Z9YA 4CMEA 4EITA 1OOEA 1R16A 3OICA 1V35A 3PJEA 4CM8B 4CL3A 3FI9A 3MOGA 1YQXA 3D5QA 1D4FA 1I33A 3SBOA 1B14A 4J9UE 4CODB 4WEQA 3EUWA 1X1EA 2I3GA 1X14A 4NBRA 4YPOA 2IDZA 2YZ7A 2QIOA 1NWHA 1UP6A 2HAEA 2O4UX 1LDMA 3BHJA 1BXZA 5G2OA 4AJPA 5IZ4A 2IRWA 2JD2A 1PR3A 5C5IA 5TJ9A 3I4CA 4AJHA 5ENVA 3LC1O 3HDYA 4N18A 5TT0A 1PGOA 4Z9XA 1PJTA 2B5VA 3NDJA 3F4BA 1EDOA 3GDFA 4Z0TA 1ZBQA 4KUGA 3SLGA 1QV7A 4D3FA 1R6DA 3TZCA 4E2YA 3GVXA 2YQ5A 3GFGA 3RBZA 4BQRA 5G4KB 3JQAD 4NG5A 4MKZA 3BHMA 3P2OA 3WG9A 2PFGA 1ENYA 1I3NA 1MG0A 4CQMB 4YT4A 1KEUA 3U9LA 3FCOA 1DIBA 3KV3O 4CLEA 1MLDA 4BMVA 1DIAA 5KTKA 2DTEA 3PHGA 4LVCA 3GZNB 2V65A 4BO3A 2DBQA 1HKUA 4BO1A 1EVIA 3ZZNA 2A35A 3GVHA 3NGXA 2B35A 4IINA 3VPGA 5H81A 4NBUA 1RYEA 2WJPA 2OBNA 4Q3EA 4HFMA 4W7IA 5BT9A 4JBGA 2GPTA 3GPIA 3ON5A 3NYWA 1KOLA 3HSKA 1U2DA 4XCVA 4ZRMA 3TPCA 4L4RA 3JQ7B 1YS4A 3ZNQA 2FSVA 4E30A 1YXMA 2R00A 1GYRA 3IMFA 3H5AA 2YFQA 3WSWA 3WWYA 3D5TA 4IDEA 4XYMA 4YA6A 4LGVA 1JVSA 1XYGA 4RPGA 1I32A 4OKIA 2WEKA 1WZIA 2GN6A 1DJNA 4MDHA 3V1TC 3DB2A 3WGOA 4RDIA 1I10A 2D8AA 2FZEA 5KKCA 1UXJA 3ZV5A 3AUUA 3WIDA 4FC7A 3R1IA 4M55A 1T26A 2Z1NA 2D5CA 3GAZA 1PZHA 1Z74A 4DIFA 1M66A 2J3JA 1U1IA 4AG3A 5T8KA 1EBFA 1M76A 1W0CA 2FHSA 4OAQA 2ZTMA 4U6QA 2V7PA 4KUHA 3B1FA 2BLLA 3ONDA 5DBIA 2XPCA 3WBFA 3QWFA 2ZB8A 3K2BA 4C7JA 3WS7A 3JQCA 3RAJA 1QLJA 4IQ8A 3KO8A 2UDPA 4Y6RA 1H0KA 3GVPA 3HNPA 1EUZA 1QP8A 2H63A 2HDHA 3OIGA 4G5HA 3LT1A 3QIVA 5GMOA 2DLDA 2DQ4A 4YQZA 1WZEA 1UXHA 1T1SA 5KKAA 2GLXA 3WJAA 3UICA 2E37A 2CDBA 3QP9A 3TL2A 2WWRA 4IQGA 4WE3A 2BH9A 1PQPA 3C3XA 2GF2A 2X4GA 1W8DA 3I9MA 1NTOA 2VUTA 3BMOA 3DZGA 3ZGYA 1ZSYA 3INTA 5JNLA 1P1HA 3ULKA 2O23A 5CFZA 4UVGA 1X13A 1HE3A 3JD2A 5EERA 4G65A 4Q3BA 3KLPX 5KOIA 4GMFA 5AXAA 2VYND 4D3SA 1E0DA 1HF3A 4CM8A 4BV9A 4GLLA 1ZIDA 2HMSA 3GPDG 4O0LA 1K0UA 2Q2VA 4W7HA 4DLLA 2HRZA 3GNTA 1WVGA 3AK4A 4KWIA 4BO2A 3T7CA 5MGBA 1F12A 1ZJZA 2DKNA 3PWSA 4XGKA 5COBA 1SB9A 1YJ8A 3UCEA 1UDCA 4R41A 5I8WA 1I2BA 4BL5A 5ADHA 3UFXA 4RLHA 4NBVA 4LSMA 2NVBA 1N1EA 4DC1A 1PQWA 3OQ6A 4NBTA 4BS9A 3GEMA 1UUFA 4AJJA 5LC1A 5B12A 3F1LA 1DFIA 1NNUA 1GEGA 2A4KA 3UAGA 1L7DA 1R66A 4J7CA 1SB8A 1PJ4A 2IZ1A 3NDRA 4OHUA 4R1SA 3S55A 1PS9A 3FR8A 3DHEA 3E1KA 3PJFA 1PJ3A 1XKQA 2HO5A 4IGEA 4AICA 2JCYA 1D8AA 2P9EA 2VTEA 1X15A 4DUPA 4IXTA 3W8DA 1QG6A 3WMXA 1LRLA 2AW5A 3RKUA 3JD4A 4KTVE 4MO2A 4HP8A 5AQ1A 3HHPA 4CQMA 2ZYDA 5BSHA 3IKTA 3R3SA 3RC9A 2AG8A 4JX8A 2E49A 3BYZA 3GNSA 3GZNA 1C0LA 1NQOA 2YYYA 1PR9A 1TB4A 4CPDA 3MJTA 2BHLA 1CERA 1Q0LA 2HLPA 3PP8A 1U28A 4B4WA 3WIEA 5HTOA 3DDNA 2EV9A 4PLTA 4J9VA 4K6CA 4ALJA 5JCJD 4GAEA 5A05A 1XQ6A 5A06A 2GGSA 4Q3AA 4I5DA 3JQ7A 2PGDA 4NK5A 4XQGA 4ITUA 1K5HA 1PSDA 5JDIA 4YJHB 3ZN2A 4P22A 5BQFA 4CLHA 1XEAA 3D3EA 1LU9A 2NNLD 3DOCA 1ZCJA 1IPFA 4OOEA 1ONPA 3PZRA 1R0LA 5DP2A 3BTSA 3DAFA 4ID9A 4PIVA 4I5EA 2Y1GA 3PFWO 4WKGA 2A9FA 2J8ZA 4ZA2A 1KEWA 2DU8A 1HE4A 3PK0A 1GZ4A 3MTGA 1VL6A 2Y99A 3Q6IA 4GL4A 4JIGA 5GZ6A 5LDGA 4Z0HO 5L53A 1HLDA 4YT5A 1TVEA 2NACA 3INGA 4XIJA 5GZ1A 2Q4BA 2PA3A 3E5MA 1DPGA 4BNKA 2VHVA 1GD1O 3OM9A 2Y1DA 2JHGA 2NU6A 1QLHA 4KDEA 1BHSA 1DIRA 1DLIA 1ZXLA 2I66A 4IDBA 3KHUA 3E03A 5KNLA 2VZ8A 2ZATA 3AI2A 4J1NA 1O94A 1DAOA 2BFMA 1B3RA 1V8BA 3OQBA 3QVWA 4CM4B 4ZJUA 4J2OA 3M2TA 4RF4A 2PZMA 1MFZA 2RH4A 1NQTA 4IDAA 1ZSNA 3RCBA 1LSOA 1Q7GA 4U5QA 4MIEA 1VC2A 2VTDA 4ZQBA 4DQVA 2AHRA 5KJ1A 1LXCA 2AQKA 2PK3A 3OJ0A 1Q1NA 5BSGA 1RPNA 1C14A 5L9AA 1GQYA 4B8ZA 3CH6A 3WR5A 3AI1A 2PNFA 2FMUA 4WGGA 1YB5A 1AN9A 1PJBA 4RDHA 4CV1A 2V6FA 4E3ZA 3JYNA 3MWEB 5G4LA 9LDTA 1VPDA 4AJ1A 3FHLA 3L6EA 3C1OA 4HFJA 1E7MA 4CMJA 3F9IA 3L9WA 3BAZA 1E6UA 4H3VA 1AXGA 4B7XA 2PZKA 4E6PA 4OQZA 4BB5A 4FOSA 4NPCA 3K8ZA 3DFZA 1CQIA 3KYDB 1XQ1A 4II2A 1ORRA 1QORA 4R4JA 1TXGA 3TOXA 4ALMA 1K6IA 1BWSA 2G0TA 3PQEA 4J1SA 5FF9A 1HDGO 3SXPA 5T67A 3GMDA 4RVHA 3GK3A 4R16A 4D46A 1DDOA 5JMPA 3CINA 3G1UA 4PG5A 4U0KA 3RIHA 3EDMA 1ISGA 1DRUA 5CEJA 2PY6A 3ZNPA 1HZJA 1HYHA 1U3WA 3C7DB 4GWGA 4IMPA 5L4SA 4FSHA 1E7QA 2BRUA 1UDBA 4FN4A 4IQ0A 1BW9B 1U2GA 3WYEA 4D44A 1E92A 1C1XB 3JD1A 4UVDA 4CMKA 1HWYA 1PZFA 3RUIA 4WUVA 3PEFA 4NJMB 4A7PA 1E7RA 2X8LA 5BR7A 1QYXA 1CJCA 1Q7BA 2GD1O 3GOHA 2CUKA 1T1RA 3NTOA 4D79A 4BO4A 3V1YA 4D0RA 2Q1SA 2Z5LA 4FOOA 4LRTB 2GUGA 2BFOA 4B3JA 3JQ9C 1FDUA 4NH4A 2FRDA 3MJEA 1H5QA 3SVTA 4B79A 3DHNA 4WK6A 1WPQA 5EINA 1A9YA 1EE2A 1C0PA 2Y0DA 2DFDA 1NASA 4W99A 2OMEA 5JDCA 2EJWA 3DTTA 4YCAA 1DRWA 5J23A 4YRAA 5L4LA 3OP4A 5GZ3A 1QKIA 3V5NA 4FFOA 3LF2A 4IZHA 5I7VA 4TROA 2AE2A 1ZFNA 3WYBA 1PX0A 1H2HA 1YWGO 2C59A 2O3UA 3E9MA 3HDJA 4ND2A 5A3JA 5I8ZA 1OFGA 4XRRA 4IDGA 1AUPA 1U8XX 3TWOA 5A9TA 4BO8A 4OO3A 1A9ZA 4YR9A 4PG7A 3BHIA 4I1IA 1LNQA 4J0FA 5TF4A 4BNMA 4YJHA 2IEDA 1RM4A 3ANMA 1KBZA 1PZEA 3PTZA 4NFHA 3VH2A 4BO6A 1SO8A 2AA3A 1ZZEA 2X9GA 1DFHA 2VYNA 1UXIA 3I6QA 5IFLA 4Q3DA 3JQ6A 4OKNA 4BMNA 4OM8A 3U49A 2X1HA 1ZEJA 4PG4A 1DC5A 2VWPA 3DHYA 2HQ1A 4PG6A 4FIZA 2AQIA 1K89A 3PPIA 3NJ4A 2VWGA 4IJUA 4KTTE 5HS6A 1W73A 3W6ZA 1SOVA 1Z45A 4E33A 1PJ2A 5I9LA 3UGKA 3CMCO 4NFSA 4R54A 4CMGA 3E48A 3L0DA 3NDIA 5EL0A 1Y5RA 3IOYA 4I9UA 3M1LA 4CQLB 1IULA 4WLFA 5CHEA 4CM4A 3TOZA 3IIEA 3RSHA 3D1LA 4PLWA 4WEOA 5L7YA 3H9EO 4UUOA 4CM5A 4XDZA 3FTPA 1N92A 2D5AA 1EEHA 2GZ2A 3LSYA 3K73O 4GH5A 1D3AA 1HDZA 1ID1A 4XKJA 2VNSA 1NQAO 1R15A 5DCWA 1DC3A 3NKLA 4BGIA 3KZVA 3V2UA 3VDRA 4IDFA 2PKQO 3VZSA 1HDOA 3IQDB 4XQCA 3R6DA 3STHA 1TI7A 2P4HX 1JA9A 4ND1A 1BG6A 2BD0A 3E82A 3RWBA 3NEPX 1VJ1A 1O8CA 2B5WA 1B3BA 4L0QA 4CMEC 1Z7EA 4YAGA 3CSDA 3GN1A 3KYDA 3WLEA 5AXCA 2IXBA 2WD7A 4TMFA 5JCJA 3NT2A 3OMLA 4DIOA 1LC3A 3R3JA 3QVXA 1PJLA 2BI8A 2Y67A 1DAPA 2IEBA 4FFLA 1YDEA 1HTBA 1QYDA 1WDKA 3GRPA 4IS2A 3EZLA 2D4AA 2HKIA 2I99A 4ZHSA 5TIIA 1HDXA 5KIAA 3A1NA 4XGIA 5JC1A 4RF3A 2BI7A 2BELA 1BW9A 3VOSA 4B4UA 3ABIA 3PDUA 5F5NA 1C1XA 3JQDA 1VKNA 4URFA 4EEZA 4RVSA 4H7PA 4II3A 4NJMA 4GMGA 1FDTA 4D42A 4DVJA 3HB5X 3N58A 2FSSA 3K9QO 4ZGWA 1C0IA 1P1IA 4JP3A 3ZHXA 3WX0A 2CY0A 1D1SA 4O6VA 5CDTA 1YONA 3ZHBA 1QSGA 1QV6A 2TMDA 5KVQA 4J6FA 2D0IA 4E12A 2HJRA 1GFSA 4EUFA 2QRJA 2VHYA 1H9BA 2X58A 5ITWA 3ANLA 5C3MA 2BGLA 1M2WA 4DLAA 3U5TA 3LT4A 1L7EA 1KY4A 1Q2XA 2A94A 2H5LA 4PLVA 4QSMA 2QYSA 3GR6A 5ES3A 2EXXA 5ICSA 2WMDA 3DBVO 4XIYA 4AVYA 4EDFA 3QRWA 1DB3A 4QT0A 3KM0A 1HDYA 1G6KA 3AI3A 4L4XA 3RQSA 4GKVA 3M6IA 4DC0A 4O5OA 1WDMA 3ITDA 2VUUA 1O95A 4PZCA 4A0SA 3H5RA 1J6UA 4JLWA 1WNTA 2NQ8A 3WSVA 5TS3A 4K6FA 1WW8A 2VWQA 2R00C 1JAYA 4TRNA 5A9SB 3PIIA 3D4NA 3GUCA 2O2SA 4NU5A 4TRMA 1F14A 1WWKA 4FC6A 1GTMA 2PLAA 5JAQA 4F3YA 2C82A 1GADO 1FXSA 3HB4X 4A03A 1IE3A 2IZZA 1VE9A 3TQHA 3O03A 1E7SA 2V6MA 4QFCA 4GVXA 4IJKA 4JQCA 4AJ4A 2B4QA 3GY0A 4D41A 2FZWA 2W2KB 2P4QA 1LA2A 1ADBA 3D4PA 3VTFA 1P74A 4PZDA 1O9BA 4TWRA 2G1UA 3BMQB 4PLCA 4F6CA 4QO7A 1IPEA 3WGGA 2H6EA 3OA2A 1P0FA 4HX5A 5T8KC 1P45A 2W2LD 1Y6JA 2HJSA 4YJFB 2ZYAA 3I3OA 5IN5A 4CQLA 1LDEA 4CV3A 2E4AA 2VCYA 5FWNA 2X22A 1ZMTA 3P7MA 3UW3A 4BKPA 4O1MA 1GEEA 2QHXA 2YDYA 3CEAA 3JYLA 4FJ2A 3WGYA 4PN3A 3FBTA 3JQBA 3VHRA 3V2HA 1IY8A 4JJGA 4IBOA 4WASA 1LDBA 4J91A 3EW7A 3WOHA 4DPKA 1LBEA 2QX7A 2YHIB 2P68A 1MC5A 1GQ2A 5JAZA 1QYVA 3EHEA 3HQ4O 5I9NA 2C20A 5EN4A 4MVJD 4OH1A 2E6UX 2V6GA 1VM6A 1JU9A 3L6DA 2B83A 5CDGA 3QWBA 4UUMA 3RC2A 3LZ6A 3NJ8A 1Y9AA 2PZJA 3KB6A 2DBZA 4TKMA 5A03A 3EGOA 1XR3A 2PD6A 1AE1A 1NFFA 4PVDA 1YBAA 5TNXA 2VUSA 4CMAA 3H5NA 1XCBA 3DR3A 3NGLA 5C7IO 3ROMA 3W4JA 3ZV6A 2Y0EA 2AEJA 3FSRA 4U8GA 2DVMA 3ZNOA 1A5ZA 2POQX 4CR6A 5H83A 3BTUA 2JD0A 3ENNA 3QLJA 3FTNA 3W8FA 2YUTA 4IXWA 3ZWPA 1S6YA 4XYLA 4ZVVA 1XDWA 3PJDA 3ZU2A 5T5QA 3FF4A 4WECA 1T24A 1XIVA 4ESOA 5JCXA 3PWZA 1H2BA 7MDHA 4YRDA 1B15A 1P1FA 4GQAA 4CM9D 4D3DA 4A10A 4GVLA 2G5CA 1T25A 1E1KA 1GCUA 5JY6A 2VN8A 2P9CA 3JQGB 1A27A 1H6DA 4NFYA 4YACA 3CPSA 4KQXA 1O89A 1FDSA 2VQ3A 2BF7A 2WSBA 3OHSX 4KWHA 2X9NA 3FWNA 4WNIA 1U4OA 3TRIA 1FK8A 2PH5A 2OP1A 3UCFA 2EKLA 3WNVA 3C7AA 3PQFA 5TT1A 3JYPA 4QQRA 4N5MA 4ZU3A 5TLSA 2PR2A 1SPXA 3VDQA 1FF9A 1ZUD1 3PYLA 4W9NA 2PH3A 2Z1MA 5CAEA 3DAPA 3OQ1A 4PLZA 1MB4A 4YAJA 2B0JA 4TSKA 3FWZA 1NPYA 4RL6A 4WJZA 3PYMA 2J5RA 1UR5A 4BGUA 4L4SA 3DZIA 4FGWA 4MIYA 3VC7A 3BIOA 3MWDB 1LSUA 2VHXA 2LDXA 4UVIA 2OP0A 3OEWA 4E0BA 1YDWA 1B0AA 3DBHB 4TZKA 3U4DA 2NTVA 5A9SA 1Q0QA 1HYEA 4ZQGA 3OECA 5JDIC 3DMYA 3C85A 4BGVA 3TFQA 1NAIA 1TA4A 1VL8A 1ZW1A 3ZWNA 4AFNA 4LVUA 1GPJA 3CTMA 1PGQA 4RPKA 4ND4A 4IM7A 3ZWXA 2CNBA 2O2YA 4B4OA 1QR6A 1ONNA 1E3EA 5L45A 4UEJA 1EE9A 1TT5B 3E8XA 2W2KA 3GFBA 4MVJE 2VZ0A 1WXDA 4GI2A 4EJ6A 2NWQA 4BKOA 5L51A 3MTJA 3BMQA 3ZV4A 1PGNA 4YAEA 5H82A 1E3WB 3O9ZA 4Y9DA 1ZSVA 2VRBA 1A7KA 4CUJA 4ND3A 1PGPA 3GGOA 4K26A 4FDAA 3ZU3A 4EGFA 4YJFA 3L9XA 5IN4A 1CYDA 3KUXA 4PGFA 2YV3A 2Q50A 5L7TA 3JQAB 5DT9A 2GR9A 4RGBA 4W6ZA 5KJ6A 5FFFA 1AGNA 2I65A 2DM6A 2NQTA 2ZB3A 4LCEA 5B1YA 2VOJA 1FJHA 3K5PA 5K6AA 1IB6A 3L4BA 2OHXA 3AWDA 2C5EA 3VPFA 2NVWA 3G1TA 3C24A 3H3FA 1ZKMA 5EESA 2YW9A 5AVOA 1LX6A 3QV1A 1GZ3A 1E5LA 4XX0A 2VYVD 3ZI0A 3DMTA 4P4LA 5BSFA 3WBBA 1AHIA 4A2CA 3H9JA 3DWFA 4O59O 5AXDA 2I6TA 9LDBA 3P5SA 3COSA 4JN6B 1V3VA 2B37A 3PXXA 5DOZA 4XWYA 2HRBA 4XA8A 4F46A 1MXHA 3DC2A 8ADHA 4UUPA 1L1FA 4XYBA 2I9PA 1OZAA 1P1RA 5B4UA 1Y7TA 3AY6A 3T4XA 4BGEA 4N54A 3QQPA 5COQA 2NM0A 2CDCA 1I5RA 2GERA 4FFMA 4BIIA 1N2SA 1T2AA 2Q49A 4ROSA 4JBIA 5G4KA 3N7UA 2JL1A 4O63O 1N7GA 1XELA 2J5KA 3IAHA 4NK4A 3R0IA 2VRCD 2DTDA 3JQ8B 1ISHA 4JK3A 2EIHA 5JO9A 2DAPA 1YOVB 2BMAA 4EBFA 4BMSA 2VNAA 2WYWA 1RKXA 1U4SA 2EERA 3JSAA 3OIDA 4JJFA 2DTXA 5BNIA 4XRGA 2I5PO 4PVCA 4E2ZA 3F46A 1YRLA 2AE1A 4UVEA 3JQGA 5DP1A 1DSSG 5IJZA 1MP0A 2QQ5A 1GUYA 1QRRA 2X0RA 5DBFA 1SMKA 4XD2A 3PDJA 2C2XA 4RJTA 4P8RA 2ZTVA 4A73A 1PGJA 1E5QA 4Y98A 4IPTA 5EIOA 1VLLA 4RVGA 3HN2A 3RC1A 3WTCA 4QTZA 5EJ2A 4A5OA 4RPJA 3JTMA 1N9GB 1XWFA 1QXSA 4IGFA 2PWZA 4LRSB 5HA5A 5JDCC 3TFOA 1GV0A 1WAMA 2EF1A 3MOIA 3ZWMA 1ENOA 1W4ZA 5TSDA 3I83A 4PRKA 1BRMA 2AEFA 3HG7A 3PVZA 4FFRA 3ZDFA 1YQDA 3AU8A 4ZN6A 2DPHA 3NV9A 4WLVA 3DBHA 5IDXA 4UEKA 4BHTA 3JQEA 3PIDA 3I4FA 3OJLA 3OH8A 4QX6A 4PFJA 4CUKA 5KVCA 4Q3NA 4MVJI 3E9QA 5I7FA 1GYPA 3ZWWA 2BFPA 4ALIA 1MFPA 4MKXA 1I3MA 1Y5MA 4NHEA 1K6JA 3VZRA 1KC3A 4D0SA 1MX3A 2CDAA 3GG9A 3HDQA 3RBXA 1ENPA 2BGMA 4CM7A 1UXGA 3RFTA 3AFNA 1I0ZA 1TT5A 1FMCA 4J1TA 2GN8A 2DUUA 4BO7A 4E5KA 1YVEI 4BNLA 4JROA 4HADA 2YJZA 3U4IA 1I8TA 4NIMA 2FR1A 2OO5A 3QSGA 4WCFB 1HETA 3TZQA 4HV4A 4R68A 4OOFA 1E3WA 3GN2A 3WGHA 3T4EA 2G76A 4QUKA 2VHZA 5F21A 1D7OA 4JP2A 1UAYA 4RZIA 2D59A 4WLOA 4FPXA 1DOHA 3ADOA 3ZV3A 4ALKA 4YAKA 3GUYA 3M2PA 1T2CA 3LQFA 3PGJA 4M49A 3JQAA 3MCVA 4DYDA 4BUCA 3EY4A 3GDOA 4TVOA 1P1JA 1NFRA 3AUSA 3MJ4A 2X0JA 2ZJ1A 2ZCUA 4E21A 4CMBA 2B4RO 4CM9A 1HT0A 3D7LA 3H2SA 4Z3KA 3HZZA 4BNIA 1R4NB 1Z6ZA 2WTBA 4MOWA 2BKAA 2OOSA 3I9LA 3LLSA 4P4GA 4JXKA 3O26A 4XEHA 5IXSA 3IP1A 1R0SA 3VVCA 5JE8A 5THQA 2ZKLA 2JFGA 3DZBA 5K9ZA 3O8QB 4CLDA 3BZUA 4DYVA 4D7AA 4BO9A 3WDSA 5L3ZA 3W6UA 3VZPA 4NU6A 5DDIP 3RUFA 2PGLA 1E3LA 5KJEA 4L75A 1BDMA 2QG4A 4W4TA 3GHHA 1CEQA 4E5MA 5U9CA 1PJCA 1Y8RB 3L77A 1SEVA 4M8SA 4R5MA 3U0BA 2ET6A 4D43A 4M1QA 3KLMX 4F45A 3FNGA 3P19A 4OL9A 3PJGA 5L40A 3RUEA 2FP4A 4AJKA 1NVTA 3PWKA 4YJGB 5LCXA 3Q11A 2FR0A 1V0JA 1AXEA 4TZTA 1QMGA 3E6AA 3E18A 4MJLA 1B8VA 3HN7A 2UYYA 3TZKA 5K0ZA 3INRA 1H6AA 3S2GA 3EC7A 3OEYA 4WCDA 5IXYA 2C29D 3JV7A 1HDCA 5JXWA 1KVSA 3SC6A 5C37A 5TRTA 3JQFA 4ALNA 5A5FA 3I6IA 5THKA 1DEHA 3JQ8A 4GGPA 1E6WA 3SJ7A 1YOVA 1YGYA 4EJ0A 2DFVA 4KZPA 2YV1A 3RUDA 1OAAA 3FD8A 4FB5A 2GN4A 4RORA 3GQVA 3Q1LA 4NZ9A 4D45A 3ZWVA 1PTJA 1DJQA 2GZ1A 2PD3A 3WB9A 1NR1A 4LCJA 3DBLB 5DCUA 2O3TA 3X2FA 3DZKA 5DCYA 5F3RA 2FOIA 4K1LA 2O7SA 1Y81A 4RF2A 4I9HA 4PZEA 3G17A 1CRWG 3ZCXA 5G0TA 1N9GA 4YJDA 1F06A 4H15A 2HCTA 2AXQA 1MGOA 3UF0A 4W82A 3GGGA 1ML3A 1I24A 2JCXA 1E1MA 1WLYA 2DPGA 3OA0A 3UCXA 4CL8A 1EVZA 1G0NA 4LSWA 3HADA 3TN7A 3TSCA 4CLRB 4CMIB 1BXKA 1BDBA 2JFHA 4IMRA 4RQTA 1JQBA 3F3SA 5EQDA 3NRCA 4A26A 3GC6A 4GLOA 3GEDA 1ZK4A 4X54A 3D0OA 1GZ6A 2VYVA 4Q9NA 3GNQA 3QY9A 2RH8A 3FPLA 2ZQYA 3G3EA 5ENDA 2O7QA 1YL6A 3MJSA 1LLCA 4ILKA 2VT2A 3BMNB 3TJRA 3BXXA 3V1UA 1EK5A 4PCVA 4RVUA 2LDBA 1U9JA 2IXAA 1XLTA 2W8ZA 3PLRA 3SEFA 1WMAA 3H9QA 3TNLA 1SC6A 2HU2A 1LLQA 3ROQA 3PRJA 4ZQFA 1GQQA 2EJVA 2YQ4A 4UREA 1HSZA 4WCFA 2EKQA 2Y68A 1EZ4A 1NM5A 4GSLA 2PKQP 1LEHA 1H6BA 3GF4A 4U0JA 1CF2O 3F5SA 1M6HA 2J5QA 3P2YA 4BQPA 1R12A 3C8MA 3DBRB 1H93A 2DBRA 2UUPA 3F5QA 2VWHA 4IJWA 3HJAA 1B7GO 4B7CA 2PTGA 1DHRA 2HMTA 2VRCA 3H6KA 5HBRA 2X0IA 4B3HA 2JD1A 5IG2A 3M1AA 1YQGA 3MJCA 2ZK7A 3VPSA 5HS4A 4OQYA 5TC4A 4E32A 2C2YA 1R4NA 4XYGA 1EBUA 2Y1OA 3AFMA 1XGKA 1WP4A 4IDDA 4R51A 3F1KA 1ARZA 1P0CA 1F8GA 1K6XA 3U3XA 4E4YA 3JQBC 1MC4A 5CPFA 3VH3A 3O8QA 1T2EA 1ZXBA 3CKYA 1DC6A 1R4MB 4DBVO 1JN0A 1ZK2A 1LDNA 3D4OA 1Z82A 3RJ9A 4BO5A 1SNYA 4XGNA 3UXYA 4GWKA 2NLOA 1Y8RA 3EZYA 4DLBA 2P5YA 5JPIA 1KY5A 1UZLA 4Z0PA 3WGZA 4R3NA 1A71A 1N7HA 2RAFA 2WE7A 3MEQA 3EMKA 4C7KA 2WYVA 2EGHA 4J3FA 4YJGA 4R1NA 1IZ9A 2EGGA 4GGOA 4I8XA 4BVAA 3AY7A 1IHYA 1KC1A 3O38A 4OXYA 3RD5A 1A4UA 5BNFA 4R1TA 1IOLA 3B6ZA 4FQ8A 3KYBA 4UEOA 3TL3A 5BNTA 2O4CA 5TX7A 2O48X 3ASVA 1XSEA 4DPMA 3JD0A 3EYWA 3KYCB 1MUUA 3WXBA 2V6BA 3D3WB 4RPHA 1F0YA 4LMPA 3RROA 1JTVA 3DONA 4R3WA 3RU7A 4WOKA 2P5UA 3N74A 3WMWA 2ZJ0A 5CG2A 1B2LA 5ITVA 1PL7A 2G17A 5JAMA 2EW2A 5C7OO 4KDFA 2HK8A 3NX4A 1XG5A 2PZLA 4YDRA 3FBGA 3ZWOA 4IUYA 2WM3A 1RM3A 4XR4A 4WOJA 1HDRA 4PRLA 3A9WA 2GNAA 2D3TA 3RI3A 1GY8A 2YFHA 2EP5A 3WQSB 4B8WA 3IC5A 3FN4A 1P9LA 2Q99A 2UV8A 2JFFA 3EVNA 5JYEA 2CD9A 1YB4A 3AOEA 3FRJA 2FY8A 2GCGA 2YY7A 1XU7A 1E7WA 5AOVA 3ZWAA 5JY1A 5JAIA 4F6LA 4CLXA 3ZW9A 5FEUA 3H65A 1CDOA 4BNWA 1HLPA 2OORA 3UOGA 3BTOA 4BNXA 3IL2A 4W9NC 1SBYA 4YVFA 4CMIA 4CLRA 4NQZA 4FS3A 4PG8A 3L4SO 3LLVA 1E3IA 2Y0CA 2AQ8A 2GZ3A 1X7HA 5A9RA 1IUKA 5U4QA 5F1PA 4BNHA 1RWBA 2NU7A 5TGDA 3X2EA 4BNFA 1H6CA 5TQVA 4E5YA 3I9OA 3KBOA 4CLOB 4OSOA 4DQXA 7ADHA 3BMNA 3RFXA 4AL4A 4PLHA 1Y8QB 4J7XA 3VKVA 3ZWCA 4BB6A 4XDYA 1DFGA 4BNYA 2CZCA 2QRLA 1YE3A 3KRTA 3OJOA 1ISJA 4E2WA 2ZTLA 4QO8A 3RVDA 2NU9A 3GGPA 3SJUA 2WDZA 4AJLA 1SZJG 1LQTA 5KJFA 3H4VA 4CR7A 5ILOA 3CXRA 1HE5A 5IZCA 5CDYA 3DBRA 1X7DA 3PYXA 2CVQA 3U09A 3K96A 3FNEA 2G82A 2CF6A 2PKRA 1PEDA 2XOXA 1F17A 3FNHA 5FI3A 3MJVA 4YT2A 1WMBA 1B8UA 2WD8A 4M54A 3HWRA 1KS9A 3Q2IA 3PHLA 4M87A 1GDHA 1NR7A 3VKUA 2UUOA 3H9UA 5A04A 3DAGA 4JGBA 5K6AC 5AXBA 2UAGA 4TQGA 3DL2A 3L4BC 3LU1A 1NHGA 3AUAA 4WLNA 5T57A 1V3TA 2PD4A 3EAGA 1R4MA 3BMCB 4BNVA 4KOAA 3WLFA 4E13A 1N5DA 4LN1A 2B4TO 2CFCA 1IZ0A 2Q1TA 3RUAA 3DMTC 1P33A 1GCOA 5KVVA 3KVOA 4IIUA 1LQUA 2FPIA 4IJVA 1KYQA 2Q2WA 4IZIA 4XQEA 3WQRA 3UN1A 2Y05A 3LC2O 1LI4A 4GBJA 5HWSA 4I5FA 3PZBA 1U5AA 4XR9A 5EPOA 4MP6A 3RJ5A 4FR5A 3OJFA 5I9MA 4TRRA 3W8EA 2DT5A 3GLQA 3NAQA 1KEPA 4DA9A 1EQUA 4YYZA 3IKVA 1B8PA 4JBHA 2ZTUA 5F1OA 4BNUA 1CWUA 1KIFA 3KSUA 5JFOA 4KUEA 3KYCA 4R9SA 4FFPA 1DC4A 1O6ZA 3I9NA 3D3WA 1NVMB 3WJ7A 3DOOA 4BKUA 1BGVA 1X7GA 1CIVA 3B1JA 4NJOA 5DOVA 2PGJA 3S2IA 5LDHA 1BVUA 4FJ1A 2H1SA 2AG5A 3G49A 2J6IA 3RASA 4KMSA 1E3SA 1SOWA 4GPD1 4BNJA 3Q9UA 1Z73A 4PLFA 3I23A 3LK7A 3Q2KA 2FR8A 3OJEA 4GX2A 4IS3A 3LC7O 1ADFA 4JNKA 3PI7A 2J3IA 1ONOA 3ICPA 4P38A 5ER9A 2GYYA 1VJTA 5BSEA 1NP3A 4YWJA 3IS3A 3PQDA 2C5AA 1DIHA 1B26A 2VHWA 4OXKA 2CF5A 1KETA 1LUAA 4S3MA 8LDHA 5KCZA 3QVOA 3B20A 3AM3A 1CQJA 4L76A 2PV7A 3S2EA 2AEMA 2F00A 4KP7A 2P9GA 4J1QA 4RVDA 2CMDA 3E9NA 3KXDA 2O50A 1YL5A 3JYOA 1X0VA 3TZHA 3A14A 1YJQA 3RBVA 1JDJA 1WDLA 5CG1A 1MV8A 3RUCA 3DTYA 4N5NA 4CUZA 2CVOA 2IODA 3VPHA 4A27A 1BTOA 1PJSA 4L9RA 3GVIA 3HUDA 4CLOA 4J90A 4I5GA 1SAYA 2EEZA 3ICCA 4MVJH 1SCUA 1MXFA 2VT3A 4RLSA 5JSFA 4BV8A 3ETDA 5F1KA 1JVBA 2JKVA 1Y8QA 4PLPA 4AJNA 4JJIA 5JW6A 3RFVA 3NT4A 1UDAA 1OBFO 4DMMA 4YEDA 1J4AA 3AJRA 1HZZA 4WNCA 1H9AA 1NPDA 1QYWA 3CE6A 2ZYGA 3GH3A 2OZPA 1HEUA 4H16A 5HM8A 4CR8A 2OGUA 4BKQA 4MKRA 4GKBA 5COAA 1C0KA 1UJMA 4PLGA 2SCUA 2YHIA 1ZK0A 3QWAA 4LISA 5T64A 2YDXA 3K30A 3U62A 5A4DA 1V9LA 2OXIA 3ZH2A 5CDUA 4INAA 1PS0A 4CJXA 4DQUA 4DRYA 1P31A 4N7RA 5DNAA 2VZ9A 2B69A 4EW6A 1A7AA 4OSPA 4EZBA 4HFRA 3W4KA 4UAGA 3BMCA 3DXFA 3QVSA 1XU9A 2JAPA 2WE8A 4XB1A 1UP7A 1JW9B 1LLDA 1PU2A 1K2WA 3GDGA 3GVCA 4RV9A 5ILGA 3ZU5A 1P3DA 2QZ9A 5DULA 3QA9A 3C7CB 4DTIA 1C3VA 2WYUA 5L7WA 5KVSA 5DN9A 2ZCVA 3PHIA 4IIVA 1NWCA 3GA0A 1OI7A 2C54A 3D64A 1XA0A 4E31A 1GL3A 2EG9A 2Z95A 4YB8A 1GUFA 3VH1A 2ZQZA 2C7GA 3DZJA 3C1TA 4RCVA 4J49A 4MIOA 2B36A 2NUAA 3BTVA 3S2FA 3QE3A 2X7HA 1ULSA 3CZRA 3L6OO 2XAAA 2XXJA 1VI2A 2EWMA 3WNQA 2EHDA 2W90A 3T7EA 1BXGB 3ENKA 3DQPA 5FYDA 1CETA 3V8BA 4YAIA 5L95A 5ICMA 4HNGA 1YB1A 1NBOA 3NUGA 1DLJA 1DHTA 2OUIA 5G0UA 2X5OA 5AYVA 3JQFC 4RZHA 3AM4A 2O3QA 1UZNA 1LLUA 4J16A 2I3AA 1VSVA 3JCZA 4NDNE 1PZGA 3ZW8A 3DOJA 2W2LA 2TMGA 3K31A 2NVUB 4YQYA 4GSKA 4CM1A 1RJWA 4DGSA 1GR0A 1ISMA 1U7TA 3IUPA 3ORFA 3ASUA 2YV2A 4BNTA 1GV1A 1YBMA 4E2XA 2NU8A 3RUHA 1Y9EA 2AMFA 3ZWBA 1I36A 3W4IA 4BNZA 4CV2A 3QW2A 3B1KA 3GT0A 4QFDA 3V2GA 4NI5A 5U1PA 1IHXA 1EK6A 4RPLA 3VZQA 5T6BA 3RU9A 2DC1A 4YTEA 4MVJA 3MZ0A 3IUSA 2Y66A 4EUEA 1HSOA 2E82A
chains in the Genus database with same CATH superfamily
1Q15A 4HN4B 2IYFA 2RK6A 4UAJA 4HBGA 4CMHA 1IY0A 2J5XA 3Q6MA 5B64A 2QGFA 5C7YA 2YJ4A 5J2TF 1P4HA 3IDSA 3VPDA 2IY8A 2PWYA 4GUDA 3EX7C 1OMOA 3LVFO 3R8FA 4QM6A 5BYBA 4EQ6A 2JCBA 2IOHA 1X8LA 3O8DA 5ALGA 2O8CA 1RTKA 4M89A 1BMDA 2DPXA 4O8CA 4HUJA 5ITZA 2QUAA 1C1DB 2OO7A 5LU9A 1O8BA 4LWZA 2PR7A 5CFRA 3WGMA 4XB6B 5CA0F 3E0QA 1N8KA 3L8HA 5J4HA 1NVFA 5IS2A 1IH8A 4XYEA 2Q3EA 2GCIA 4K6OA 4ZGBA 1S2IA 5EXDA 1PBNA 1W4CA 5IC5A 4CTMA 2PHZA 3RS8A 2FSIA 4ZK6A 1NHWA 1NI4A 2CMFA 3FOCA 1C7IA 3P9QA 2X86A 4JP5A 4RY9A 5CXQA 1JKFA 1QFXA 3N2ZB 2Y1EA 3PKIA 3HNRA 1PL8A 1XLTC 4JENA 1ZH8A 4F38A 3HZHA 4FI3F 2C0CA 2Q6KA 4LDZA 1UZAA 4XTCS 3R41A 4GOJA 2G9NA 1T8UA 1IY9A 3GG2A 4IIYA 3C0KA 3TB6A 4C14A 5A02A 1O0SA 2HU7A 4RADA 1NM5C 3IULA 1JR2A 4C22A 2XEXA 3Q7IA 1MTZA 3HKCA 1FP1D 4KMMA 3SZMA 1WV0A 1NAHA 2AMYA 5E6RA 5EKDA 4D8UA 2D2IA 3UANA 2A14A 2C7BA 3AU9A 4RIGA 3JVVA 4RFSB 2FAXA 3DZFA 1VSTA 3EIXA 3F6YA 1E4OA 4OIMA 4S35A 4QWMA 4S1VA 5B2FA 1QONA 3T5PA 2JGAA 1DCMA 3FY4A 4QFBA 2WAMA 2LCIA 2OGSA 5FXMA 2NAPA 3TLBA 2J85A 5GINE 2UVQA 3LCUA 3W6OA 4K28A 1C2YA 3VAZA 2HMVA 2BTQA 5F12A 4RVNA 1S4MA 1E89A 2A92A 4KQWA 4URXR 4QU0A 5AKYA 4RETA 1SEPA 2ZT7A 5EHNA 5I7WA 4HN9A 2H1HA 1GGVA 3PNPA 3GLHB 2E5LB 4TZ6A 3OKAA 1LSSA 4IIBA 2QMZA 1J90A 3KUDA 2W70A 5E6SA 2PLRA 3U4MA 1PL6A 3HU3A 3UMJA 2XCUA 1S2GA 1U11A 2JGEA 1I80A 3GZ4A 3V7NA 1A88A 4PCUA 3D8HA 3O9VA 2ID7A 3RFUA 1VHLA 5HE8A 4P0TA 1Z7BA 1ZGBA 4BEVA 1X8JA 3T95A 1NMXA 3G2KA 1M2FA 2N47A 1CB7A 3RT7A 5IDQA 2DKFA 4HDQB 4JLJA 1ORTA 3QVMA 3UG6A 4B7UA 4DIKA 5LQCA 4CM8A 3H5WA 3QVLA 3UVEA 5ES4B 4HNRA 4MW0A 2FX3A 3F67A 3ZCUA 3Q0EA 1P77A 1B4DA 3P97A 1E9SA 1C4KA 3CMMA 3AOGA 3R9KA 4BOYA 1DKLA 5HX7A 1RWVA 1IUNA 1CHDA 3BT7A 3DXXA 2SNIE 1UBNA 4KC0A 3ROKA 1IIBA 1LK0A 4INZA 5TDHA 1F0PA 3TDNA 3LUBA 2QG9A 4GX5A 4JLOA 1MHPA 1NBWB 4K05A 4TMXA 5I7VA 5TS2A 3VPXA 2PVPA 4OBXA 4BAZA 4F3RA 4MWDA 3Q8WA 3IVCA 4AS2A 4KX3A 2OECA 2HZ7A 2YJ3A 3ST7A 4MV0A 2WYOA 4QUJA 3I9JA 2JFVA 3DNFA 5FFMA 5SY9A 3ZHQA 2NVUA 1RLMA 4MPPA 4IYJA 5G0WA 4KFCA 1NZJA 2GN9A 2P2GA 2PYIA 4DDHA 2GDZA 1ISIA 3OIFA 4B5KA 3ILXA 1YR3A 4NYIQ 4ZQEA 5B1SA 4LJSA 4BP9A 2YHUA 2AWOA 1JAXA 2YWXA 1A9TA 2C7VA 1N9KA 3A2MA 3VTZA 4DCNA 2PUVA 3MWFA 5DTRA 3SFVA 3W5DA 5EKXA 4B3IA 5K20A 1RXEA 2J3HA 2YOHA 3VR6D 3PB3A 3RC2A 1PS8A 4FMCF 3I0MA 5F4BA 1N5RA 1SKBA 1ZESA 1ORWA 3QWHA 1A97A 1MIOA 2R87A 3HP1A 4PZLA 3OQNA 3AOEC 4OJNA 1T0JB 2IYPA 2B1QA 3A4LA 1ZNZA 4O2BB 2VJKA 5G1OA 5A0VA 5JMWA 3N86A 5LB2A 3TZ6A 2GSDA 4DJFC 2AMJA 2Q29A 3S1LA 1NFQA 4Z3DA 4UUNA 1CZUA 1DEKA 3FDZA 3WLLA 2QUKA 7YASA 3HE3A 3HU5A 1NJ1A 1ZK3A 3OCZA 1EI9A 1MN6A 3LWDA 1DZ3A 1NG1A 1SVSA 5EZQA 1EUCB 1E9DA 1QJCA 3GLFE 1LRJA 3W1VA 5C2JB 1YFLA 1BA3A 1HH4A 1AV6A 1LWNA 3FX2A 3QU2A 2BFAA 3M6XA 3DLHA 2I29A 4G84A 4YBRA 3I2FA 3PUXA 2Q3MA 2Q6OA 3V3KA 5ALQA 2D4HA 1AY0A 1Y6FA 2YH2A 1P61B 1WA5A 4H59A 3WFJA 4LMRA 3SDZA 2O5EA 4HB2A 1ZNYA 1SCQA 2EX1A 4NVRA 4A8JB 1UH5A 2LNDA 3IDQA 4C30A 3OD1A 1U7XA 4Q7LA 2VH5R 4KXVA 4M9CA 3RSOA 5B6IA 5JWOA 1JEYA 2HF7A 2JARA 1C7JA 4OYRA 3KQKA 3C43A 2REQA 2OGZA 3MUEA 2Y6VA 4IF4A 3KOZA 4P3YA 3H2ZA 2G8LA 4A8HA 1XZHA 4QQFA 2GCEA 4K2HA 2JCGA 2ZT8A 2PZ8A 2FG6C 2H07A 1JKJA 3CRMA 1U8CB 1DJPA 1RPTA 2VXCA 3K6JA 4FMBB 4HXYA 4BWVA 2EBHX 5HZHA 4F3CA 5F2KA 3IJ5A 1H1LA 3BVPA 3KEOA 3T54A 3T0FA 4S2UA 3MRSA 1KK2A 1SBQA 3JVIA 3K94A 2YVKA 3DE1X 3R20A 4YS6A 1XZPA 1SXJA 2EX4A 2NTJA 3BJZA 1E1CB 3THWA 1SCDA 5HK9A 3JVUA 1I4LD 3G13A 1NVKA 3NIWA 1Y5IA 1DG9A 3OUTA 3CO5A 3CWQA 1XAHA 1QWSA 3VHLB 4R01A 4BFTA 3IVXA 1UBJS 4CCSA 2FPGA 5JO0A 4HDKA 1XPRA 4R8LA 1DRVA 3DAOA 4G0PA 3OE5A 4OK5A 2KM1A 4LYFA 2JJQA 3RE1A 1E4EB 3T1TA 4RTPA 5HF9A 4ROTA 3DHVA 3EF0A 2HGSA 3GT7A 5BVHB 1IL0A 2J4CA 3MK31 5IKOA 3BF7A 1VL2A 3DMRA 1LRKA 4AN4A 5JBIA 4PWZA 3VGPA 3R09A 3UC9A 2AT1A 3PKJA 1X94A 2I8LA 4OY3A 1A9QA 4ZQHA 1YD7A 4YASA 4AKIA 1JPVA 1QGED 4BKRA 1QIKA 2FPPA 3CZCA 1E59A 1PNQA 2QPAA 3CZMA 5E4TA 4CCAA 5GTDA 3A4VA 3DG9A 3AVUA 2EW8A 1PWXA 1ZK1A 3DO5A 3E58A 2G72A 3PQ4A 1V47A 4CM3A 1TTTA 4JD5A 3DBOB 4UM7A 3AFHA 3WJ1A 1XROA 1A82A 3GJXC 1UOQA 4P2BA 4RA9A 1KBQA 4ENWA 3VR6H 1E1NA 2AXNA 5B4VA 2A0YA 4KE6A 1EWTA 3NPAA 3VKHA 5AI0A 5BW8A 1CCWA 3WL7A 3A06A 3UH1A 2Y93A 5B30A 2WU4A 2A0XA 3G8AA 1KAEA 1JDBC 1NVVQ 3G6KA 3KJEA 5G1NA 3LK6A 1AHNA 3GEBA 4LE0A 2QMYA 5EJIA 3G59A 1CS0B 1SXGA 4KHZA 3VNUA 1RM0A 2AK3A 3I52A 2VJDA 2E48A 1NUSA 2QF7A 3PXUA 4G1EB 4G0ZA 2PBLA 3WYDA 1VSQA 2O8EB 2HBRA 3L0SA 5ADWA 4RF5A 4JEHA 5I7EA 5JSZA 2ZSHA 2O7NA 4JVLA 4FFVA 4M37A 2B0CA 3DBLA 1EFKA 1YHNA 1G8GA 4P4NA 3EIHA 2H48A 1W36D 2XZDA 2FRVA 2L69A 4BMCA 3TLYA 4D96A 1A2KC 1J06A 3WLHA 1TUBA 2VSFA 4OMUA 1TLLA 4Y2XA 4CTOA 5K4HA 2Y8EA 1R50A 3TINA 3CKKA 4CEIB 3I76A 3LLMA 1E3JA 3GBPA 3LLUA 4UQOA 5C5DA 3WL6A 4B48A 1I2ZA 1WMFA 2VDRB 1WXIA 1ZKDA 4ZICA 5A1TA 5CPBA 5GAJA 4CBVA 4I4TB 5IWCA 3G0OA 2YC4C 3KPWA 1N4AA 3TSAA 4ESHA 5IYZB 5FI5A 1N75A 4MYHA 2HTEA 1V3UA 1NQ5A 4EGJA 4C2AA 4BP3A 3EFHA 3G2JA 2BZ0A 4TS9A 4XPIB 1CUCA 3AY3A 1JE0A 2B8JA 5JTTA 4EKGA 1V4BA 3SS9X 3PLNA 3L46A 4OAPA 1UJ2A 1NVGA 1JMYA 3SWWA 3SQNA 1QTQA 1KEZA 4EDHA 3OETA 1Y1PA 3DV2A 4XQ9A 4LHVA 1CY4A 2O54A 5CD9A 2MDTA 3B1XA 2RJOA 4GE3A 4NZOA 5F7ZA 5JVDF 3WGIA 4AN0A 4DIBA 3JR3A 1K3UB 4Z51A 5FCDA 4H4EA 4JLSA 3V7WA 4D1YA 3Q3CA 4HMOA 2O05A 3H05A 3IPLA 4OLAA 4KRFA 3O6VA 4JFAA 4ACBA 1MB9A 2IEGA 1BWPA 1VP3A 1CNEA 3WGVA 5LQSA 1Y42X 4WZAE 3WICA 3M4ZA 1SR8A 4QBHA 4REQB 5GJVC 3KSZO 1VPWA 2PGIA 1PKXA 3IHKA 2WTXA 3HYNA 4JMPA 4G4SO 4GX1A 2DEUA 4HTFB 2FMKA 1Y6GA 3AHIA 4ZI2A 3ADPA 3WKEA 4DWVA 2F8LA 4QGBA 5G3ZA 1ANKA 2CSXA 3E35A 1RXWA 1RLTA 2GD0A 4WINA 1A4IA 3KLBA 3H04A 2IZ0A 4LHZA 4DZTA 5DU2A 2QGZA 2QUHA 1W6UA 4DLKA 3HXKA 5E3HA 1GU1A 4WLEA 3FNQA 2XNKA 4LAFA 1T4GA 5EP1A 4C0WA 5K3CA 1BHO1 1VPLA 1AMNA 4KPEC 2BKLA 1W76A 2ZSDA 4AJIA 3T3MB 4I7EA 5JQGA 3MA0A 1TZMA 2GRUA 2JAUA 4EELA 1U0NA 5F4ZA 4JU9A 4LYEA 2QIPA 4LYHA 4KMRA 5TPZD 3ZDBA 2NSDA 2PSSA 3R4VA 421PA 3BFXA 2NZUG 2P41A 2QQEA 5KYYB 1GR1A 3Q88A 4BO0A 2ID4A 4OMFG 5FA8A 3VMMA 4HYQA 2VYCA 1PL0A 2BP7B 3IR6A 1II8A 2XKJE 5EXTA 3ZR4B 1QNLA 5ALHA 2J31A 3UWPA 5EJEA 1R16A 3NHBA 3OICA 4A0HA 1YJBA 3Q98A 1AOXA 3FI9A 1S0UA 1NONA 4IGAA 5LBUA 3S0JA 3GA5A 4KZKA 1Y9JA 3D5QA 3Q7SA 1X3SA 2EFCB 4QASA 3NRBA 1WCYA 4XLTA 3VV2A 5JAHA 1H3EA 3T15A 4M7RA 2A86A 1X1EA 4Y6GB 3K16A 1E0SA 1CIPA 5L3SA 2C3UA 3R6TA 4XFKA 4TYNA 1RHKA 6GPBA 5AW7A 1GFWA 1T0IA 4Q93A 4YPOA 1KP9A 4C2UA 3VR6A 1NWHA 1QYRA 3FETA 4JGIA 1LDMA 3BXFA 3PCTA 3PGKA 5FLKA 2WPNA 5IZ4A 2H5EA 5TJ9A 4AJHA 3PG5A 3GL9A 4KV9A 5P8WA 4ZHQA 3ONNA 4V0SA 3TMYA 2H1RA 4N03A 2IHUA 4CIXA 3HDYA 3SR4A 5TT0A 2TRSB 4Z9XA 4CRWB 2I6XA 1MVLA 2QE7A 2ZSEA 3TL6A 1XZCA 4TTVA 4HVTA 3A05A 1NBEA 4Z0TA 1W4BA 2QZPA 4DM4A 1VI5A 1OWLA 1ZBQA 3CKLA 4KUGA 4DR2B 1ZONA 1E6MA 3W06A 4PHTA 4JI1B 3SKXA 2J3LA 1GQOA 1P2UA 1H5NA 3BGIA 5G4KB 3RRBA 4D4MA 3BHMA 3FVQA 1EVLA 4LZJA 3AX6A 1EXWA 1MG0A 2I7XA 3THYA 1YDMA 4HUTA 2NZ8A 2G1KA 1DIBA 1OFVA 2E18A 2I87A 3FPJA 3HKEA 3HJCA 2G9UA 5KWSA 1EHIA 1ZI6A 1DAEA 4HAUA 4WADA 3AHJA 2DTEA 3NHLA 3EXIA 2FCAA 3PHGA 3Q5GA 3BRCA 3GZNB 1NURA 4INPA 4BO3A 4C88A 5J5CA 5F9FA 1E2HA 3RK4A 1X1QA 1HKUA 2BHTA 1Y37A 1WQ1R 4GGMX 4MLPA 3ZZNA 5I7AA 4EW1A 4A0QA 1FFWA 5A1JA 3VPGA 3GD7A 4EG7A 4KNYA 3KXPA 3QK7A 3QKRA 5DTEA 4Q3EA 2RGDA 3ZDCA 2NSLA 4YO7A 4G0QA 2PX8A 2P40A 5P21A 4TV8A 2GM3A 1TADA 3TPCA 4GM4A 4RGQA 1SK8A 4BEBA 1OJ7A 1YXMA 1V16B 4E14A 2BI4A 2C77A 1WD5A 3H5AA 4RK1A 2YFQA 1BS9A 2FRXA 3FKQA 3LP8A 4YUXA 5LNK6 1T0PA 2EBUA 3RG2A 5F98A 1GTL1 4LGVA 4NY1A 1BMQA 4FLFA 5JWHA 4BJ6A 1XYGA 4EKYA 1ESNA 1I32A 4S04A 3DCIA 3RAFC 2IBTA 3FJYA 2WEKA 2ON6A 3LGXA 5CA1B 1R6TA 2GN6A 4H4CA 4AY3A 5K1ZA 4D99A 4MVXA 4P5PA 1I10A 1V8ZA 2D8AA 2O2HA 1H0RA 1T2NA 3LVBA 3ZV5A 5KKCA 3ET4A 3WIDA 1ODLA 2ADOA 1RJGA 4FC7A 2J5BA 1WUJS 3ZJTA 2AMLA 1S02A 4JJ6A 3G0GA 4KNVA 4WOCA 4H27A 3O1IC 4QBFA 3W2TA 1YE5A 4G0YA 1RWQA 3KQSA 1YJAA 1I7NA 3THSA 1U1IA 4A6DA 1M76A 1W0CA 2FHSA 2RBKA 3K2IA 2AOWA 3IRUA 4G5QA 4OAQA 4U6QA 2CHVA 4ZQCB 2OCAA 3UJAA 4TX1A 3WKDA 3GFFA 2ZR8A 4J1TC 4MV3A 5AQEA 3LECA 3REQA 1YFJA 2ZB8A 5LP6A 2YZMA 1E8NA 2IIVA 3K2BA 4EMUA 4U8HA 3D5EA 3RAJA 4AQDA 3K1AA 2CB9A 3Q3EA 4EJSA 1CZOA 4Y6RA 1A5TA 3COPA 4RHCA 3T1YB 4UOEA 3GVPA 3NKFA 3KWMA 5ALUA 1QP8A 2H63A 4C5CA 5IHXA 1RMYA 2BFCB 2FCRA 2ICAA 3LZCA 3LT1A 2ZFUA 4GC5A 3C7TA 4EZIA 4YQZA 4C29A 4BCDA 1LS1A 1T1SA 3GFQA 4L8LA 1MW9X 5KKAA 3WJAA 5JH7A 4Y0VA 1DAHA 2EAUA 2OHIA 2ZJ6A 3KU1A 4JCCA 4L8FA 3UICA 5JD6A 2CDBA 4BTLA 4HDMB 3LQQA 2ES4A 3OLXA 4WE3A 1TK3A 1N2OA 2BH9A 2PGNA 3NOVA 1RFGE 3RV3A 1XFDA 2PTHA 4KYVA 3ZK7A 1KIAA 3ZYZA 3IELA 1YMVA 2X4GA 2DXIA 1BE6A 3I9MA 2LE0A 2A9PA 4GP6A 1U8AA 1ZSYA 3DAYA 4GQIA 4OHRA 5EHXA 2V5VA 4P84A 3Q8LA 4N7JA 3ZEIA 3GYGA 4GMFA 3QUBA 1AGRA 4S2EA 4AWXA 4S1WA 3ZVRA 1HF3A 2MIIA 4Y0NA 3U7QB 2Q5CA 1ZIDA 1OI3A 3BIXA 4GLLA 4BV9A 4EA6A 4FE3A 1C8LA 3GNTA 1WVGA 3AK4A 4BEJA 4BO2A 1RI3A 2PUFA 1F12A 1ZJZA 2DKNA 2WA2A 2ODBA 4BRWA 3LUJA 5COBA 3UCEA 1UDCA 1XEFA 1J0AA 4BN5A 3LY5A 4KL8S 2BMDA 1OH7A 1CF4A 4A36A 1JHZA 2IT1A 3LRXA 4ZCIA 4DC1A 2FSPA 2IEZA 3L6RA 4GICA 3F97A 2H4HA 4WBXC 5ED0A 4TS3A 1CLUA 3EVBA 4ZHQF 2RBGA 5JCPA 3Q8KA 2ZE6A 2ZRPA 1DFIA 4LF8B 1NNUA 3N87A 1DUVG 1KMMA 3ETHA 3O1HB 4J0IA 1GEGA 3ZLVA 3D2AA 2A4KA 3D3NA 4BX3A 4E6EA 2VTKA 4CIWA 4B35A 2I2CA 4J7CA 2NT4A 3F8TA 3NDRA 4R1SA 1CR2A 1EB8A 2OK7A 3FGNA 5MN6A 2XRMA 2IYVA 2OAEA 3Q5EA 3E1KA 2QRVB 5KO2A 1ECBA 1YDHA 2XUIA 2X9LA 1PRYA 2F4NA 4IGEA 4RK0A 2JCYA 4NBKA 2P1ZA 2VTEA 4GW3A 3IUNA 3LKVA 3RKUA 2EHJA 3CF2A 2DH5A 3FNBA 1R6XA 3W90A 1AMUA 4LYGA 1BYUA 4ECAA 3IKTA 2BDTA 3LG2A 3R3SA 4Q9KA 4WVLA 2AG8A 4JX8A 3WJ2A 4TQ9A 2C8LA 4FBLA 1SJ9A 3KFVA 2E49A 4DR4B 1RAGA 1ATIA 1ZLXA 1ZN2A 1W9HA 2IEIA 5TEWA 1PHPA 3R74A 1X7ZA 3GNSA 2LP4Y 1A8UA 5EJ7A 1J9EA 4O2AA 1PR9A 1Y4DE 1YZTA 1FP7A 1Q0LA 3EXAA 4Z5XA 2JJMA 1GG9A 4WMLA 5IM5A 2HWWA 2CNWD 1BA2A 1EP2B 2Q0XA 3PP8A 4GMHA 1U28A 4WN9B 5IMBA 3RHSA 4ER7A 2RARA 5CCDA 5IEJA 2CYAA 2EV9A 4J9VA 4K6CA 2YVLA 1EFCA 1X8XA 3HHEA 4KACA 2YXLA 2REOA 2IP2A 3LSTA 1QQ7A 4GAEA 5A05A 1QCDA 3WHLA 4AZTA 4KBYA 1Z3IX 3JQ7A 1G7RA 4MLCA 2K5UA 1R8YA 3SC2B 5TPZA 5BV1A 3QX7A 5AJXA 3VBCA 2IXTA 5HBGA 3CSSA 3VDXA 3ZN2A 4P22A 1P0PA 4V2IA 5CW1A 2DG2A 3J81k 3RDPA 3IQGX 3DOCA 3EDYA 5DP2A 3PZRA 4HEA6 1R0LA 4R8SA 3K53A 1JTEA 3DAFA 5CLIA 3TRJA 2P6RA 2XXAA 3V8PA 4C0JA 4EY3A 1NXTA 3FWHA 4PIVA 2Y1GA 4I4IA 1KEWA 3HB0A 1O97C 3NUZA 1GZ4A 4QGHA 1KYWA 5LB4A 2UYHA 4JIGA 4GL4A 3L7LA 2IC5A 4UTOA 3VO2A 5K8IA 2AVDA 1W59A 5EIHA 1JXQA 1K4MA 1E9EA 2OQIA 4P80A 2NACA 3ZUGA 1Z18A 3LY7A 1GGMA 3STTA 5BY2A 5GZ1A 2PA3A 1DPGA 1GPH1 1L4FA 2OCGA 5HZMA 4OK3A 1QLHA 4KDEA 2IPAB 4JL5A 4TPKA 1DLIA 2WZQA 3KHUA 1LVUA 4HEQA 1UBLS 2VZ8A 3IAEA 3TCNA 3TZEA 4I50A 4G85A 3X1WA 5FOQA 4J1NA 2PQ6A 5E6UA 4YRRA 5EPUA 3OOHA 4RF4A 2BFNA 2HF2A 2IUSA 1NQTA 4C3UA 1RR6A 1WF3A 3H4MA 2D2XA 1LSOA 2H18A 1CUDA 2XD4A 2Z56A 1MT0A 1VC2A 2ODNA 1TVKA 4FYWA 4GMKA 4MIEA 5LA6B 3S8YA 3I53A 3L0PA 1UM9B 1J8MF 2IX9A 3R4CA 5HDQA 1M54A 3GCZA 1P1BA 1Q1NA 2FXVA 2PZEA 1H0SA 2UVPB 3D3KA 3V8VA 5BSGA 3H19A 5L9AA 3JPYA 1GQYA 2W6PA 4KR7A 4TLMB 2OCXA 5AICA 3OCWA 1ZVJA 1BMFD 2DWCA 1FQOA 4QSHA 1Q3KA 4OI0A 1QGUA 2FMUA 3L7AA 4HAWA 4CV1A 5K5EA 3JYNA 2GTIA 2OAGA 3LX6A 1JSRA 1UPFA 4G0UA 5TB5A 1HOXA 2RGAA 3FHLA 4XW2A 3DLCA 2FMXA 4MLDA 1VB3A 4BN0A 1SXJC 3L9WA 3ELBA 3BAZA 2ONKA 2I54A 3PL1A 1JH8A 3OPYI 2QRQA 3L49A 4KH0A 2GESA 4Q47A 4OQZA 4B7XA 2QUZA 2OM2A 3K8ZA 4FOSA 4NPCA 1STOA 3WMEA 4R4JA 5EZ5A 4DCMA 1FNDA 5JD3A 1BWSA 3C5EA 3ZZ0A 5HILA 2VAXA 4UBJA 3THXB 2IDKA 2F55A 4WD3A 4KFUA 3L1UA 2B6NA 1YKSA 3GFRA 1L4YA 4RVHA 2APJA 3GK3A 2BT4A 2SKEA 3PQ5A 2IHVA 4D4IA 4X5OA 4KN9S 3CINA 4U0KA 2HI0A 1ZISA 4J8PA 3U4QB 3ZNPA 4G0VA 1U3WA 2IX3A 5FUQA 5LZ4A 1E69A 4XGRA 2D06A 5L4SA 1DQYA 1S2DA 3KQQA 1E7QA 2BRUA 4IQ0A 121PA 1BW9B 2QXTA 1NT2A 3MWGA 4G37A 5CH3A 1E92A 4TL6A 4PZPA 3JD1A 4GPTA 5TY0A 4CMKA 4HNAA 3Q4GA 2PMKA 4M8NE 4RK7A 4C2BA 3PEFA 4A7PA 2B99A 1ZVQA 2A57A 1T4CB 1CJCA 2CUKA 3E81A 3EQ7A 3NTOA 3T41A 4RCYA 1MEOA 2A1TS 1CY8A 3REOA 3UWMA 1HE8B 1QTIA 3GRUA 2Z5LA 5CLLA 3FPAA 4MYTA 2GUGA 2BFOA 3WK7A 3QG1A 4B3JA 1PYDA 1FDUA 2VSYA 2ZAGA 1GOTA 2ODPA 3DHNA 1T13A 4WK6A 1NE7A 1WPQA 3QTBA 4O2AF 5BNWA 2DHRA 1C0PA 4KWCA 3E3OA 3IT0A 1MAHA 5AJHA 4OI1A 4S0XA 2HJ9A 2OMEA 2GI4A 3OZXA 4QXAA 5C5EA 4E5UA 1DRWA 5C1IA 3VC2A 2G8NA 2RG7A 1XZBA 2FWAA 3UENA 2BR3A 2Z8ZA 5L4LA 3KIPA 3QUQA 3C15C 4BQFA 3V5NA 4FFOA 2Z1DA 2HHAA 3LDAA 4IZHA 4M76B 2ASVA 2AE2A 3GFOA 4ZREA 3ZE8A 4B84A 3MD0A 3GLFB 4ND2A 4QPDA 2C59A 1ST2A 5A3JA 5BN3B 4Q7QA 5CFMA 1Z2OX 1LTKA 4R05A 4EL0A 1AUPA 2FPWA 5IH7A 2QTLA 3TWOA 4UNSA 1T5LA 1G8FA 3RT9A 1RJDA 4YR9A 4J0FA 3EEFA 4HYYA 5JSQA 3R0ZA 5IASA 1C1HA 1Z0IA 5LYJB 1V41E 5KQGA 2IEDA 5CX4A 3ANMA 3K0FB 4Q7KA 1PZEA 3BGWA 2J3DA 4D0LB 4E03A 4LHWA 3PF8A 4TGLA 2D8MA 5A6VA 2AA3A 3FCUB 2X9GA 4WFIA 1OWMA 2ZKIA 3EEYA 5CVJA 1SUWA 1QE0A 4BNDA 3I6QA 3W9YA 1I6KA 4JEMA 2DPMA 2Q6IA 3GJ4A 4BZPA 1QC5B 2C8VA 2WJAA 4O29A 5KX5B 4IWXA 4ZEOA 3BXZA 1YUBA 3IQXA 3U49A 4IVRA 5HUJA 4PRZA 4B3SB 2PEZA 5JYBA 3UFBA 3UXHA 4BE7B 3BD7A 4IJUA 1Z4NA 2XUOA 4FINA 2PLWA 4QRIA 3W79A 3IXLA 4EARA 3PE4A 3UGKA 1CFZA 2H06A 3P1JA 4I19A 2I6QA 4XIIA 2ZBDA 3LHDA 1ZM4A 3L0DA 1T1JA 2XE6A 3NDIA 1LPBB 5D2CA 5IT9A 4ZOQI 4TYMA 4G5SA 5CM8B 3AERB 1PV4A 3QJYA 4ZANA 4Y6QA 5CYFA 3TX6A 1ZD8A 2PWPA 4LJKA 5K0BA 1QU3A 3L92A 3V1MA 2VSQA 1IBSA 2W93A 4X97A 1N92A 2D5AA 4HPWA 3LSYA 1N2CE 5JS2A 4ENPA 4MWTA 5JJBA 1OLUA 3K73O 4QUGA 3UC5A 5CNJA 4AMUA 1V96A 1Q1GA 3G23A 1RC0A 1HDZA 1ID1A 4XKJA 2VNSA 3VDMA 5LQAA 3W5BA 3NKLA 3KZVA 2H29A 4K8RB 5HM6A 1VCHA 5ICCA 3HBFA 2QB5A 3IQIX 4XQCA 4YRCA 3STHA 1TI7A 4B3XA 2JC3A 2P4HX 4Q7EA 2XB8A 3MWEA 4KRGA 2CLSA 4ND1A 4ZOBA 2C9DA 1BG6A 2CEKA 4DABA 2RHWA 4JYCA 1G2IA 3ICEA 4LHXA 3MTAA 4U1RA 3DA8A 2QGNA 5CR9A 5EPEA 1EBBA 4BWFB 3SS7X 1AKQA 2CNWA 2ZZMA 4ND8B 4YAGA 2PCLA 4NATA 4Q4JB 3KYDA 4BVHA 5HRCA 5AXCA 4BMYA 2QMUA 2BEWB 1DZIA 1OGYA 1XMXA 4TMFA 4X7BA 2QP4A 4DIOA 1Z17A 3OMLA 1LC3A 1ZITA 4M98A 3RYIA 4RM3A 4CIBA 4LOLA 3H2GA 1LKZA 3G6WA 3QVXA 2OESA 2EQ5A 3J80A 2QVYX 5F51A 1HTBA 1PT9A 3DW3X 3RF6A 4CHGA 1QYDA 2BJWA 3D1JA 1NI5A 4OHBA 4PE5B 4PTZA 3AR2A 1X6VA 1T6BY 3ES9A 2D4AA 2HKIA 2CNOA 1NSTA 3ZIAA 1NY5A 2Z98A 2W6JD 3KP1A 2CLHB 5FOVA 4CKYA 3A1NA 4XGIA 3KPYA 3KCQA 3AP1A 3ZLUA 5JC1A 5U4XA 2BELA 4G6ZA 2Z8YA 1B0UA 1L5OA 1GITA 1VKNA 2PJUA 4JUFA 1Z39A 1NN1A 4II3A 1L4HA 3HB5X 3PEUA 3VAAA 2PE5A 1OWPA 1WM1A 3MIZA 2EZ4A 1ZRSA 1C0IA 4DN6A 1XF9A 2VDKB 4JP3A 5K3FA 3ZHXA 5CDTA 1AA6A 4IVPA 1YONA 4OSEA 3HGMA 4LFCB 2JIMA 1GNTA 3THOA 2Z8YM 3I6BA 3U37A 3H87A 4J6FA 1LPPA 3LGAA 3RIMA 4KHPB 4CQJA 3G2OA 1MA3A 2WTMA 4F5YA 4EUFA 2BSQA 1QRSA 1QRAA 4EG4A 2V8OA 2QRJA 2WHEA 3JWGA 2CXSA 2VHYA 1YRAA 4LRQA 5ITWA 1GGKA 5FNVF 4DLAA 1M2WA 1FP4A 1UJ4A 4Y2VA 1NNI1 3LT4A 4U7JA 2G3YA 1ORVA 4OQDA 4QSMA 2ZBFA 4H6WA 5HGJA 3IKLA 2VZLA 2DHEA 2L0XA 2WMDA 3DE5X 4XIYA 2Q5FA 4BFLA 1GRQA 3KWFA 3AI3A 1MOSA 1ZD4A 2I1VB 3WP1B 2Z4SA 3M6IA 4DC0A 4PGAA 3O7MA 2C9BA 4IV0A 4TKUB 1M74A 1UDRA 2VUUA 4WZAB 1DVRA 3B2QA 4MUJA 4UXJA 4A0SA 2WT9A 1POXA 1MENA 4MKFA 3LQ4A 3QKIA 4PQRA 2OM6A 1J6UA 1J0DA 4PPQA 1WNTA 4BVJA 1BMFA 1JG2A 1EA5A 3AEUB 3FLMA 5TS3A 3WSVA 1D4AA 2YN2A 5A9SB 3PIIA 2MR5A 1C4OA 3V8RA 1F14A 1WWKA 1AF4A 3SCZA 4DY4A 1GTMA 5A2QA 1DWUA 1CJSA 5CCEA 1L5GB 5HFNA 1RLOA 2IYLD 1EHCA 3BK1A 2C82A 3CNNA 3EMVA 3EWAA 4JJ8A 4LJ4A 1MJNA 1JZQA 3LCJA 3STVA 1RMQA 4P0PB 3KEGA 2CE7A 3QHPA 3GLGA 2W6NA 1E7SA 1S96A 1SG6A 2PRIA 3VA7A 3I2GA 4AJ4A 3KB8A 4D41A 2JJ1D 1TFUA 4MV6A 2FGKA 3EW9A 5KTYA 1A69A 2BKUA 1O9BA 2N3ZA 4MS4A 3UJNA 4DUZB 4TWRA 5LD2C 1YA6A 4OHYA 4B6OA 2ZVQX 3L1JA 3OMXA 4QO7A 3EQ9A 1VHQA 2P2ZA 4EW3A 2H6EA 4HX5A 3ZX4A 5C1BA 1YS2X 3LGSA 1W85B 4FU0A 1Z06A 4YAFA 3VM6A 1Y6JA 2CDRA 3D4IA 4YJFB 5DYYA 5L3RA 5IN5A 1LDEA 3DH0A 4X6LA 4CQLA 5KNCH 5FWNA 3R9XB 3OUZA 5LP6C 4DLSA 3O1LA 1ZMTA 4KDCA 1DWOA 2WT4A 3S4YA 3RIEA 1QF7A 4LPSA 5EXEA 1V4VA 3NG1A 4EJSC 1GEEA 1XDBA 4MO9A 2Q3JA 3FPEA 2V5UA 3FPKA 1CE8B 3Q0IA 1U3FA 1HFWA 3WGYA 2X15A 3GWGA 3DPUA 2CJPA 2YWBA 4HBZA 2C5BA 2YZKA 4MYUA 5BV7A 4J91A 3EW7A 3VSEA 1PUIA 4P58A 2P68A 1C7EA 4XX0B 4UE2A 4BDTA 3VZDA 3ED1A 4MVJD 2E6UX 4Z1OA 3WRYA 3ZDQA 4O2LA 1FNMA 1L4GA 4RK4A 2I6GA 1M9NA 3L05A 1KDYA 5BW4A 1YS1X 2QRGA 3KQYA 5CDGA 3RABA 3OTWA 4QOGA 5AVJA 3ND7A 1SWWA 1Y4AE 2VKTA 2VK2A 3NJ8A 2YYZA 3HV2A 4V0OA 1Y9AA 2V7QD 4FYPA 2FETA 1QWOA 3GFPA 3NWJA 5TXGA 4BLQA 2ZJ5A 2QRNA 3TLKA 4DMRA 1XCMA 4YJ3A 2DULA 3EGOA 5CVVA 1W36C 2FE1A 1DKRA 2W00A 5TNXA 4XVUA 1CUAA 2VUSA 4L15A 1XEWX 5I9BA 4JJ7A 2J45A 3DE6X 3Q85A 4MQ6A 5C7IO 5C8DA 3W4JA 2Y0EA 1Q19A 1SBHA 1VE5A 2B9EA 2N0SA 3BQMB 4L6IA 2ZIEA 3AF2A 3BL6A 5AW4A 1NV8A 3SZ3A 1L7OA 1AQUA 2P4UA 4WK2B 2PKWA 1YU6A 4B6PA 3FTNA 2RGWA 2PYZA 1S6YA 1CZHA 4G2TA 4DG9A 3RADC 4N6NA 3PJDA 4NRDA 4YJ2B 3QYPA 4MV5A 2WM8A 1D6NA 2CMHA 4M0UA 1ZU5A 2VF5X 1CUUA 3QMVA 4L0CA 1ZNWA 1VJGA 2I2XB 1SUAA 3TIXB 4GQAA 4OQ4A 3AUKA 2WMOB 3B48A 4GZLA 3HRIA 4KR2A 4KSBA 2JLAA 2O1WA 1E1KA 3OTHA 4JI8B 2ZYVX 3T9CA 4B4DA 1K2VN 5J58A 1GXSB 4NFYA 4OHFA 1R6AA 4YONB 2BF7A 1JVNA 3MTIA 3OLYA 3OHSX 1ATZA 2IXDA 1VBMA 2CCGA 3I05A 5J63A 1I94B 1QRTA 3FWNA 1FK8A 1Y7HA 2A1IA 2MSDB 1K8RA 2PH5A 1TUEA 5B7GA 2OP1A 5LJIA 1UANA 2HGZA 1P2TA 3Q3GE 1YZVA 5FUYA 5BW6B 2P5SA 3WNVA 4H7FA 4MQMA 3PQFA 4UHFA 3F6PA 1GUDA 4FMDF 4CF5A 1OIXA 4ZU3A 1SPXA 2DMRA 2VF7A 3NC0C 5JXIA 4PLZA 5E9JA 3R7SA 3EH2A 4BLRA 1P7WA 5H02A 4MR8A 2GJAA 1NPYA 4RL6A 2PRZA 5JVDB 4YLYA 3PYMA 2AKYA 2J5RA 2NXNA 3B3FA 4IH1A 4L4SA 1JEQB 3DZIA 4FGWA 4MIYA 3T5TA 1EQAA 4U3JA 4BGUA 1GRCA 3A6PC 2YHBA 1RBQA 2G36A 1YDWA 4QA9A 2Z0MA 2RK3A 4DA0A 1ZINA 3DBHB 3KU4A 2NTVA 5HZKA 3R3XA 2CBGA 4QYWA 2B8NA 5GOTA 2XGJA 5LBTA 3EIOA 1C4XA 1YZHA 3VX3A 2EP8A 3EN0A 3DMYA 1XTTA 3OBIA 4JR0A 3H1EA 4EYSA 1GFZA 3U7EB 1QFYA 1NAIA 2QTZA 1VOTA 2W2QA 4AXBA 1TA4A 4AFNA 3ICQB 3IBTA 4LVUA 4MKGA 3CTMA 1PGQA 5HIKA 1PK9A 1IK6A 1XV5A 3MGBA 4IM7A 4EHLA 2KQUA 4NE7A 2AX3A 4B4OA 3TQCA 2P90A 3IIIA 1RLUA 1G4UR 2GXUA 4PNPA 4UEJA 2OYCA 1M10A 5HS4A 5KNCA 2W2KA 4DMCA 3UPTA 3E8SA 1W1WA 4U2EA 2X4IA 5AI4A 5DM70 3SZRA 1N5JA 2OFWA 1ECGA 1WXDA 4TYPA 1E6LA 1BOOA 4TN5A 5L51A 4HQLA 3ZZ1A 1AS2A 1IJBA 1PGNA 1T9CA 4PAQA 4F7DA 4BRSA 1A7KA 1U4NA 4MQEA 4CUJA 3II6X 4EPTA 1KRWA 4JWKA 3GGOA 5G02A 1RWOA 3P9YA 1PKEA 4K26A 4QUAA 5E7QA 1TF7A 1Z6XA 2W6JA 3LCVB 4HDCA 3HKBA 3QPAA 4PGFA 3ZHRA 2NZ2A 1Y3BE 2R8ZA 3JQAB 1U3CA 2GR9A 4OGKA 4RMGA 5D51S 1IWBB 5HJEA 4R2WA 4W6ZA 4RU1A 4PS0A 3DD5A 1NJFA 4BZXA 1HTTA 3K5WA 5K6RA 2HA6A 2NQTA 2GPAA 2VLIA 1FTQA 4C6TB 2VDWA 1AKEA 1KQ3A 2IYZA 2P8SA 3E9ZA 3PBKA 4UCQA 5K6AA 1Y7IA 5B2ZA 4AZ3B 2WFLA 2XX3A 3H3FA 1ZKMA 1KMCA 2GZHA 3IPAA 2HWKA 3IP8A 3ED5A 3KTOA 3R5JA 3QVKA 2C98A 4Q12A 3CUVA 2HRRA 2VYVD 4NCXA 4P4LA 4YN3A 5BSFA 4A2CA 1NLZA 2Y2VA 3S1SA 3BFVA 1JFFA 3DWFA 4ZOEA 4N3CA 5AVVA 4RACA 1M6VB 3GRYA 1TM2A 4QHYA 1VBKA 3IDZA 9LDBA 3FYUB 3A58B 3COSA 1XPUA 4LF7B 2VC2B 3VUFA 2B37A 1RE0A 3BCSA 3VNQA 5C80A 3PXXA 1TW2A 1SCAA 2GPBA 4BQEA 1IUOA 1AQYA 1DDGA 5EQJB 5IAEA 4F46A 4N01A 3DC2A 4OATA 3ZE6A 4UUPA 1NZFA 4W5OA 1KXJA 4BTEA 3VOAA 2R7LA 1OZAA 1JFLA 5AW9A 1FTSA 1XTVA 5BXQC 1P1RA 3I37X 4LC9A 3JZAA 3Q5DA 5JD4A 1LZLA 4O25A 1FFCA 1UPTA 1M2GA 2NM0A 3EVDA 1UBMS 2CDCA 4FFMA 4DKJA 3L93A 1N2SA 4IMJB 1T2AA 1Z5OA 1C9MA 2Q49A 3C5WP 4L95C 4DYHA 3R9IA 2EJBA 1X1CA 1GG5A 3PCXA 1YZLA 3W1WA 3WL3A 2JL1A 4O63O 2C2ZA 2J5KA 4S1TA 4BVKA 2YY5A 3QVUA 1TTPB 4O4HB 2X5NA 4UHKA