4L4SA

Structural characterisation of the nadh binary complex of human lactate dehydrogenase m isozyme
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Structural characterization of the apo form and NADH binary complex of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 118
structure length 331
sequence length 331
chains with identical sequence H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4l4sA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4l4sA02
4BQRA 1CQJA 2LDBA 2NM0A 3COSA 4QEDA 2Q50A 1IPFA 5ITWA 3KSDO 5CAEA 3ZWVA 5A9SB 3NAQA 5IN4A 4J90A 2CDBA 1A4UA 2DBVO 3EVTA 4LSWA 3CE6A 4F3YA 4RL6A 5F5NA 3ZHYA 1Z75A 4E5MA 5BSGA 1ENOA 3QVTA 3E48A 1H94A 2HRZA 2JJYA 1AXEA 2RAFA 3KTDA 4FPXA 2Y93A 4XQCA 1E7WA 3I9MA 3BHJA 5JAMA 1E3JA 1N1EA 3NJ8A 5DBFA 1DRVA 4OHUA 5DN9A 4EEXA 1WDMA 1ADFA 1X0XA 1JN0A 3IUSA 1ISJA 4NR0A 5TJ9A 1ZCJA 1DC3A 2JD1A 5GMOA 1M6WA 3CMCO 2GCGA 4MOWA 1WP4A 2YV2A 3WG9A 3JSAA 4HXYA 1LQTA 1R4NB 1NPTO 1P0CA 5KJEA 1JTVA 2VYND 4GKBA 1V3VA 4AL4A 1PGOA 4NIMA 4PLWA 1NWHA 3TFOA 3RFXA 1H6DA 1V0JA 1C3VA 4L9RA 4QQRA 3TOXA 4NJMA 2B69A 1SEVA 1M67A 4R1UA 4UVGA 2W2LD 1H9AA 1X0VA 1UAGA 2FN7A 2OXIA 2GO1A 2OO5A 3VH4A 3U3XA 4BIIA 4CMCA 2J3KA 4YQYA 2B37A 1B8VA 3GUCA 2GDZA 5F1OA 1XQ6A 2NACA 3JYQA 1N92A 3KETA 3H65A 4S1VA 2ZJ1A 2VTEA 2GN4A 2G17A 4OSPA 1DLJA 2IDZA 1PGPA 4WEQA 3H5AA 2X1HA 3DZGA 5IN5A 2AEMA 1HYGA 2ZK7A 2J3JA 1NPYA 1ZK0A 4JCOA 4B7UA 1B2LA 3ROQA 3EY4A 3D3WB 2BGKA 4XYGA 2NVWA 2D5CA 3GGOA 4OSOA 5EIOA 4B7CA 3PQDA 5AXBA 2Y99A 2BKAA 3MZ0A 1FDUA 4FIZA 3LT0A 3WJAA 5TX7A 4HV4A 5HM8A 3CXRA 3OH8A 3V2UA 1CJCA 1GADO 3F3SA 1ONPA 4QT0A 1I2CA 4BMVA 1X7HA 2H5LA 3AFMA 3DOJA 5EMHA 5JDIC 2X22A 4EZBA 2CVOA 4J0FA 5IDYA 1NVTA 2ZKLA 3E9MA 4N54A 5AXAA 4GKVA 1YB1A 2Y0CA 2CF6A 1K3TA 1R6DA 3GEMA 1NASA 3WIEA 1K6XA 3RKUA 5KVVA 3VKVA 1R4MA 3NX4A 2VT2A 3MTJA 3CIFA 2X58A 3IIEA 4XWYA 3RWBA 5HS4A 5GZ1A 4Y6SA 4DQUA 5HBRA 5EL0A 4WGGA 2WWRA 5F1KA 5A3VA 1KVRA 3ZWYA 4JJFA 4D3SA 3U9LA 1HE4A 1OMOA 4WASA 5GZ6A 4BL5A 1FDSA 2AHRA 4UEKA 2OMEA 1N9GA 3INGA 2J5QA 4D45A 3WBBA 3KO8A 5CHEA 3IUPA 3EGOA 1IZ9A 5T57A 3SC6A 1ZJZA 2YFQA 4KQXA 5JS6A 1HDCA 3W8DA 3UKOA 1A9YA 4WJZA 1PR3A 1OBFO 4QO7A 4RQTA 1NAHA 1RKXA 2HSDA 3DMTC 3LU1A 5A06A 4XRRA 4MIYA 2ZB7A 1L1FA 1LLDA 1FJHA 3UH1A 1ZFNA 3ZI0A 5L4LA 5IF3A 4FFNA 3K92A 1BDBA 3FHLA 2DVMA 2NTJA 2GUGA 3JYPA 4I9NA 4J91A 4RZHA 5TF4A 3LT4A 1MG0A 4DYVA 3UCFA 7ADHA 3QV1A 1EVYA 3DONA 2JCXA 2X23A 3HWRA 4HP8A 5ITVA 4YACA 5CDYA 4HFRA 1RJWA 3U4HA 1MC5A 1TI7A 3T4EA 4JIGA 1VSUA 4PVCA 4KWIA 5MDHA 2OBYA 4ZRMA 4EEZA 1U4OA 3ZWXA 2R00C 1YVEI 1RM0A 4YJHA 4DLLA 1MLDA 2UUOA 3ADPA 2H9IA 4JJGA 3VAZA 3F4LA 4NH4A 3LSYA 4K26A 4I9HA 4OKNA 1Q1NA 1XCBA 4B4WA 4HWKA 1DOHA 2VN8A 3BMQB 1O94A 3U62A 1GR0A 4AJKA 1ZIDA 3I6QA 2WD8A 4L75A 3ZNOA 3D5QA 4NFYA 5G0UA 4IJVA 3O8QB 4ALLA 2FR8A 3EAGA 1PEDA 4NMHA 4AJ2A 2H6EA 4RF5A 1HDRA 2Y1DA 4IGEA 2ZYGA 4BQPA 3V1TC 4MVJP 4Z9YA 4YAEA 4E31A 2WE7A 1D1TA 2VTDA 1HKUA 2JAHA 3DHYA 2DAPA 2E82A 4R4JA 5JPIA 5K6AC 3BMOA 2IRWA 1A9ZA 4Z0PA 1ZMTA 1DEHA 4UVEA 3FPLA 1BTOA 2PKRA 2BRUA 1P1IA 3VHRA 5A9SA 4BNFA 1PJBA 3JYLA 5JDCA 3VZSA 1MV8A 2C20A 4FFRA 4I8XA 1AUPA 1Y5MA 4RVSA 4GH5A 4UUMA 1JKIA 4YAGA 3VVCA 2A92A 1E7SA 1QR6A 1EUDA 4U6QA 4E5NA 1O6ZA 2O3QA 3C7AA 1MC4A 4MDHA 1EUZA 2AQIA 2Q49A 2HO5A 3RUHA 3LZ6A 5IXSA 5EESA 1LSSA 1QRRA 5COQA 1QORA 2HQ1A 3RUFA 2DPHA 3JTMA 1O95A 2C5AA 5BT9A 3ROPA 2I9PA 5EINA 4BKPA 1ID1A 2D3TA 5BSFA 5A03A 5JCXA 4J0EA 4PLGA 4UUPA 1LBEA 2I5PO 4BO0A 4TVOA 1R4NA 1HSOA 5KJCA 4M87A 3RI3A 1O5IA 2EP7A 1JDJA 5AYVA 4W7HA 1PJ4A 4GL4A 2EG9A 2W2LA 3D1LA 2PNFA 3KYCB 4QTZA 3U4IA 4YQZA 1NHGA 3AJRA 4WLFA 2FP4A 4QECA 4URFA 1Z82A 3HN2A 1EUCA 4UVHA 3VPHA 4BOYA 4MP6A 3ZWWA 2ZTVA 4J6FA 5ICSA 2C2XA 4WCFC 1B8UA 3P7MA 5BNTA 1JW9B 3UN1A 2ZQYA 1ZUD1 2R6JA 1ZEJA 2DFDA 2OL4A 1N7GA 2JHGA 4ALMA 4A27A 1P74A 4YT2A 4ID9A 3ASUA 4IXWA 2ZTUA 4J16A 3VZQA 2B4TO 3AUSA 1PIWA 5L53A 4R1SA 2PD3A 1N2SA 1ZXBA 1DHTA 4W6ZA 4XYEA 4JK3A 5DT9A 1KOLA 4FOSA 5IZCC 2NADA 2O3SA 5TLSA 4BNWA 4YPOA 1YKFA 2P5UA 5CPFA 5L3ZA 4D44A 1HDXA 4BV8A 2LDXA 4FW8A 4B8WA 3F1KA 3RFTA 2Q45A 2NTVA 2PTGA 3D3WA 4PGFA 2VYVD 1Q7GA 3FRJA 3L07A 5HA5A 2YUTA 4B7XA 3HQ4O 3NV9A 3H5NA 1N8KA 4DPKA 3ZHBA 1PZGA 3F5QA 1Z73A 1UZNA 2EF1A 3GT0A 5BNFA 2IZ0A 2Y68A 3O03A 2ZCUA 5FI3A 4HBGA 4BNJA 2EKQA 3F6YA 2ZCVA 4UUNA 4EDFA 4M54A 4NK5A 4II2A 3Q0EA 1T4DA 3CZMA 1BGVA 3MOIA 1JKJA 5JAZA 2PD6A 3WOHA 1QG6A 1TT7A 2W98A 4YRBA 4ROSA 2Y1OA 3CTMA 3GVCA 2EGHA 2ZYDA 3U0BA 5J23A 2VWQA 2C5EA 4PLFA 4XQ9A 5B1YA 1DIRA 4MIOA 3LDHA 3TOZA 4J1SA 3JQ6A 1X7GA 3QJ5A 4RCVA 4WCFB 3OA2A 4B4OA 1EVIA 4CR7A 4EYEA 2EXXA 4E5PA 3PHGA 2C7VA 3ZH2A 1SAYA 3DBRB 4IS2A 4XIYA 5CEFA 3UXYA 4F46A 5A05A 1I5RA 4BNZA 3GMDA 3ASVA 1HT0A 2V6BA 4DC1A 4Y6RA 3ANLA 1FDWA 3QRWA 1E7RA 3JCZA 5TGDA 5JMWA 1V6AA 3A28A 4GLOA 1KEWA 1UP7A 1VJ0A 4CMBA 3SLGA 5B4UA 2D1YA 2AEFA 1F8GA 1JLLA 1WWKA 3G3EA 4YJFA 4D3FA 2NUAA 1GUZA 5KJ6A 2RBEA 5CEEA 3DMYA 2B35A 1R15A 4W4TA 4JROA 1XLTA 2VZ9A 4A7PA 3RC1A 3BTSA 4JQCA 3OETA 3X2EA 3CSDA 3ITDA 3WXBA 4YWJA 3KEOA 3W4KA 2QRJA 4OH1A 1F06A 4EUFA 1GCOA 2EHDA 3D64A 1GPJA 1VL8A 4YXFA 4GPD1 2XXBA 3H6KA 3R6DA 3VKUA 4HNGA 4AJIA 3AU9A 2P91A 1ZK3A 3BTUA 2A94A 4KZPA 3QLJA 3L6EA 4LN1A 5C7OO 1KETA 2FSSA 5C3MA 5F1PA 5B37A 3NT4A 1E6WA 5F3RA 2X6TA 4RORA 2GLXA 5JDIA 5JYEA 3GUYA 2Q1WA 4FOOA 5IZ4A 4A26A 4FJ1A 2C59A 1I0ZA 4FFLA 3C1AA 1GEEA 4L0QA 2OHXA 3S8MA 4YCAA 1V8BA 4ALKA 3AOEC 1CERA 3ZV4A 2H63A 4OQYA 2CF5A 5KTKA 3UCXA 3NEPX 5C7LO 4BB6A 3A4VA 4MP3A 1HDYA 2EGGA 1NQTA 2HMWA 3QWAA 5BQFA 1NQAO 4BUCA 4DPLA 4E3ZA 3LF1A 2FZEA 3I9OA 2WYVA 3O8QA 1QP8A 4ZQEA 1E7MA 3QVOA 4U0KA 1XR3A 1KS9A 3KRTA 3FNGA 3R1IA 4J1TA 3WFJA 1NVMB 1SC6A 4ZQHA 4O5OA 4ND2A 4YJGB 5DCWA 3ZWBA 1VLLA 4DGSA 5U1PA 4F6CA 2FOIA 3LQFA 2YJZA 3DMTA 1LSJA 4CL8A 2O3RA 1ZK2A 3GAZA 2E48A 1LLQA 2GD1O 3I23A 3W4IA 5L9AA 1OOEA 1BHSA 4X54A 4L73A 4JN6B 3GVXA 1EZ4A 3AI2A 5T8KC 1NFQA 3I52A 4EJMA 3GMSA 1VE9A 2CVQA 3RUCA 4J4TA 4NFSA 4TKLA 4U0JA 4Y6PA 6ADHA 1UR5A 3PJFA 1H9BA 4GI2A 1U2DA 3RCBA 5I9NA 4A5OA 3VZPA 2B36A 4XKJA 3IOYA 5KVSA 4PLCA 2R00A 3H9EO 3KXDA 4BMNA 3E18A 3LF2A 1AN9A 4YRAA 1CETA 2E4AA 1AHIA 1JU9A 4KP7A 4QX6A 3LVFO 4RQUA 4CUJA 4I1IA 2DQ4A 4L76A 3TFQA 4RPGA 3W6ZA 1BVRA 1HLDA 1HL3A 1PU2A 2OFPA 3CMMA 2I67A 1HDGO 3OHSX 5KVCA 3ZGYA 3PDJA 3OMLA 5KJ1A 3RD5A 3TZQA 1QSGA 2DU8A 3IDSA 3HDYA 2CY0A 9LDBA 4BVAA 1FMCA 3DTTA 3WNQA 1W73A 3BTVA 2GSDA 3FR7A 1ARZA 1GV1A 3GFGA 3H3JA 2GN6A 3MJSA 2PK3A 4ZU3A 1MX3A 3K31A 4EBFA 3ZU4A 2PKQP 2P9EA 4GSKA 4IDFA 1MGOA 2BHLA 2JCVA 3QW2A 4XIJA 4D41A 3WGQA 4KQWA 4CM3A 4R41A 3C8MA 3H9GA 4R1NA 4XDZA 3WYBA 1BXGA 4MVJM 5K6AA 1R0LA 1U9JA 3WICA 3GH3A 2VYVA 3OQBA 4EUHA 5JLAA 3SLKA 5CDSA 1V3UA 3C7CB 4FB5A 1YBVA 2YV3A 3H2SA 3EDMA 1T24A 5A1TA 1Z6ZA 4IZHA 1PJLA 5JE8A 4WKGA 3ORFA 2HU2A 1LA2A 3DXFA 3R3SA 3HZZA 3ZW9A 5L95A 3DWFA 4NBVA 3GDOA 4RPKA 1M2WA 1CRWG 3K2BA 3M1AA 4GVLA 1GYPA 1IY8A 1GAEO 4CUKA 1T1RA 1HTBA 5HWSA 5DZSA 5HTOA 5KOIA 5TT1A 4K6FA 3MOGA 4IMRA 4AJHA 1GZ4A 1XELA 2QYTA 2EW2A 3V1UA 4P22A 5CDUA 4BNTA 1Y9AA 3DBHB 2WM3A 3UW3A 3DOCA 3OICA 2HAEA 3LLVA 4TMFA 4YAKA 4BO5A 2X4GA 1L7DA 3FPCA 5A9RA 4R3WA 2O48X 1UXGA 1YQGA 4R1TA 4TVBA 1B0AA 4GX2A 1XQ1A 1LSOA 3G0OA 5L45A 3EZYA 3WGHA 3RIHA 2VHXA 1E3SA 5I7EA 1DRWA 3DZFA 3O9ZA 4IINA 4LVUA 5F21A 2POQX 3OIDA 3DBRA 1PL6A 4NDNE 2Q46A 1BMDA 3JD0A 4IDGA 3GHYA 4DC0A 5GZ3A 2CSUA 3GVPA 2QRKA 1X1TA 1PGNA 4R69A 2EEZA 4Y8VA 4IGFA 3FD8A 1PS9A 2XOXA 5JBIA 1UH5A 4ZJUA 5IZCA 1TA4A 4FR5A 4YT5A 4CLDA 1T2DA 1E7YA 4DUPA 3ZN2A 1JAXA 1F8FA 1SBYA 5JC1A 5L40A 4NBTA 1B7GO 5L4NA 2BFOA 4QXMA 1NNUA 2O4UX 1P31A 3ZWOA 1T2FA 3PJDA 2WMDA 5FI5A 3NDIA 5T67A 5DF1A 2B0JA 4ZICA 1Q2XA 1RM3A 4MP8A 3BA1A 3DBLB 4WNIA 2GERA 3ZDFA 3HE3A 2X7HA 1VJTA 1P44A 2JKVA 2O3UA 2V6GA 4R54A 1N1GA 2BI8A 2DUWA 2ZQZA 1ADGA 1WXDA 4UULA 4MVJI 3EZLA 1E5LA 1V35A 4D0RA 1VC2A 2GZ1A 4CV2A 2Z1MA 5A4DA 4BNXA 3GEDA 5JAQA 4BKOA 3GZ4A 2DT5A 1PS0A 1SOWA 4WLOA 3PYLA 1ENZA 1GD1O 4IY1A 4S3MA 4RDHA 5CPBA 5CG1A 2HMVA 2ZB8A 4XR9A 4JBGA 4K9DA 1SPXA 4LCJA 4PRLA 3V5NA 2X0NA 4YT4A 1LJ8A 1NTOA 4PG6A 2DKNA 1Y7TA 3M2TA 4RGBA 5KJFA 2VHWA 5JMPA 4XEHA 3U4DA 2HUNA 2PGDA 3AFNA 3GNSA 5IJZA 5U9CA 1MFZA 2AQHA 2F00A 3U4CA 3WJ7A 4M1QA 3K73O 4M89A 3JQGB 5FYDA 3HFGA 4H3VA 4YJGA 3GG2A 3RQSA 4A10A 2UAGA 1LRLA 2NVUB 2Z1NA 3WB9A 4B79A 5IDQA 5K9ZA 1LDGA 3PWZA 2IZ1A 2P9CA 4CQMD 3K5PA 1C1XB 4PZEA 3E8XA 2GN9A 2FZWA 3DEYX 4TRRA 5C7IO 1YJ8A 3PYXA 3HFSA 4A2CA 1QYCA 1N5DA 3CUKA 3WS7A 5K0ZA 3KB6A 3VDRA 3CH6A 3HNPA 1LQUA 5JO9A 3L77A 4WCDA 3SX2A 4IDCA 4QSMA 3OQ1A 1PWZA 1D1SA 1KEUA 3L6OO 4EUEA 5TRTA 3JD4A 2F1KA 1NR7A 1E3WB 3NDRA 3B70A 4CLOB 2EERA 4O1MA 4RVHA 3TN7A 3V2HA 5IXYA 3HG7A 3UOGA 2GZ2A 2HJSA 3HSKA 4AG3A 3DFZA 3ENKA 5I9LA 5JO0A 4FBGA 4JBHA 3FBTA 4CM6A 1E77A 3QWIA 1U7TA 1UP6A 4HFMA 4UEOA 5AXCA 3WMWA 1QYVA 2ET6A 2XAAA 5IAAA 3GZNB 1PL8A 3Q6IA 3LT1A 4XYMA 2VHVA 3AOEA 3AY6A 1MXHA 3MJCA 1OC4A 3RUEA 4ND3A 3RROA 1ZMOA 4IPTA 3PJGA 2IODA 5JFOA 1QYXA 1MP0A 4IJWA 5TNXA 2C82A 2ILTA 1DC4A 3RU9A 1HSZA 2Q2WA 1IOLA 1AXGA 2PZLA 2VWPA 3H4VA 3TL2A 3PTZA 4MKRA 3KYDA 1PX0A 2YQ5A 3FF4A 4IZIA 3EW7A 3AM4A 1CQIA 3H3FA 1E1KA 2V6MA 4OMUA 4KDEA 1K6JA 5LDGA 1H2HA 3HDJA 1DRUA 3RJ5A 2IE0A 3ZWAA 1KVQA 4CR8A 4DXHA 1EBUA 3GF4A 1XEAA 4BNHA 2CUKA 1D3AA 4B8ZA 1ZSNA 1NP3A 2VUSA 2YFHA 3AUUA 3GY0A 4Z9XA 1K5HA 2DLDA 2WDZA 4HY3A 4L74A 2UVDA 5JSFA 3B20A 3L9XA 2YDXA 1UUFA 3ZWCA 1VKOA 5T8KA 3D4PA 2IYOA 4N18A 1DFIA 4J9UE 1SMKA 2P9GA 3UAGA 3IC5A 3EUWA 3JQAB 5TQVA 1WZIA 1E0DA 2X86A 3QSGA 3RSHA 4UUOA 4TSKA 1MA0A 1RYEA 1F0YA 3L6DA 1ML3A 3R0IA 4XR4A 2CZCA 4TZTA 3WFIA 1XYGA 4ZQFA 3JQAD 2PA3A 1BG6A 1HRDA 1S6YA 2CDCA 2FSVA 5JC8A 4E6PA 4LMRA 1CEQA 1WMAA 3OEWA 5G2OA 3WYCA 1P3DA 3DBHA 3KHUA 1NX6A 2W2KB 4YYZA 1PJ3A 2FPPA 3PJEA 4PFJA 2FRDA 4IS3A 1X15A 2AQKA 4DWVA 2DM6A 1WLYA 1WZEA 3VH2A 1S7CA 2V65A 3TF5A 3ZWMA 2PGJA 1ORRA 3QVWA 3TL3A 4DIBA 1E3LA 3RFVA 1UXJA 1E3IA 1MUUA 3NYWA 4JXKA 3OIFA 1W0CA 3W1VA 3HUDA 3JD2A 3CPSA 3P19A 1PR9A 2BFPA 1ULSA 2Y1GA 3ONEA 3JQBC 5LDHA 3JQFA 4C7JA 1SEPA 1CYDA 3RUIA 3EC7A 1GQ2A 3FN4A 2QG4A 1LX6A 2P4HX 4I9UA 1EDOA 1R16A 4E30A 3ABIA 2YW9A 4BNLA 3KEQA 2HCTA 4BMSA 3FCOA 4R9RA 2AG8A 4XB2A 4R9SA 2Y1EA 3O38A 3VOSA 4G65A 1M75A 4W9NC 4D7AA 1LXCA 5G4KB 2WD7B 3DAPA 2IXAA 3DBLA 3CZRA 5EJ2A 2OZPA 4YAJA 4J1QA 1ZK1A 2EKPA 1EVZA 1AHHA 3PFWO 4LSMA 4Q3EA 4JNKA 1EDZA 4UVDA 4YDRA 4B4UA 5HS6A 2HKIA 2VYNA 3BIOA 1BDMA 3OQ6A 2I6TA 2EJVA 1QLHA 2R2GA 2GR9A 3JQCA 5JXWA 1UDCA 2A9FA 1ZVMA 4CMGA 3LC2O 4CLXA 3IKTA 4GBJA 5CFZA 4YAIA 4AVYA 3UFXA 3ZWPA 1WMBA 3QIVA 3PHIA 3DR3A 1C1DB 3ZNQA 4CJXA 2CD9A 4XYLA 2Z95A 3SC4A 2X9NA 3BMNB 4II3A 1DIHA 1GZ3A 3H9QA 2PZJA 1J0XO 3CKYA 2EW8A 3FWNA 4C4OA 4E12A 3DTYA 3OM9A 2C0CA 9LDTA 1IPEA 4KWHA 3RVDA 3TJRA 3VPXA 2FWMX 2AE2A 2Y1CA 4PLVA 5G0WA 4AJ4A 4RVGA 4DBZA 1QV7A 2OP0A 1U3TA 3JQGA 1XHLA 3PIIA 2GASA 3QHAA 1ZKMA 2NVUA 5G4LA 3FTPA 1YGYA 3DQPA 3WX0A 3OEYA 2YY7A 1YB4A 3JQ8B 5BR7A 4ESOA 1FDVA 2GN8A 3EHEA 4XGNA 3G79A 3K30A 2CDAA 1I3KA 2EIHA 2Q4BA 2DC1A 2YV1A 4J7XA 3DAGA 2I65A 2W90A 4GWGA 4FJ0A 2RH8A 1GYQA 4HADA 4NK4A 4P4NA 5LCXA 3AI1A 1PQUA 1I10A 4RVFA 1SZJG 5AXDA 4ZQBA 5A9TA 5CDGA 2O3TA 4XYBA 1UJMA 1E3WA 2GGSA 2W8ZA 2YHUA 3RBXA 1A72A 4HFJA 3RAJA 2GYYA 4CLOA 1R12A 4O59O 5C37A 4R5HA 1RPNA 3M1LA 3RC7A 3AOGA 4PLPA 3RJ9A 3H7AA 4RPJA 1WW8A 4EW6A 1NR1A 1DJNA 4E21A 4Q3CA 1I32A 2X9GA 3PP8A 1VI2A 2Y67A 4JLWA 4J43A 3GZNA 2FY8A 3JD1A 1ISGA 3AM3A 5CDTA 4OXNA 4Y9DA 3GA0A 1YWGO 1OAAA 4CQLB 1IB6A 3GVIA 1LDEA 1QLJA 4GX1A 5BSEA 1WPQA 3DHNA 2XXJA 5DCUA 4XGKA 1NFFA 3DZKA 1GPDG 3OA0A 1P1JA 1PJSA 1LRKA 5F5LA 2NTNA 1QXSA 5B4TA 1K89A 1KIFA 1VPDA 5DOZA 3RUAA 4KUGA 4D46A 5DBGA 3EMKA 4N5NA 5ES3A 3ULKA 4KTVE 1LLCA 4IDDA 4TRMA 3UUWA 1YQDA 1EK6A 1P33A 2IYPA 1O8CA 3U5TA 3ZCXA 3WQSB 1D4FA 3RBVA 1KVUA 3NT2A 5H83A 3S2IA 4MVJE 1C0KA 3EYWA 4E33A 4Z9FA 3KV3O 3PLRA 5ER6A 2AMFA 3IJPA 4XB1A 1KY4A 1DJQA 1LDBA 3PWKA 5ENDA 1ZXLA 3AY7A 4RF4A 2VOJA 3NGLA 2TMGA 1GQQA 1SCUA 3RC2A 1O0SA 3GPIA 1LEHA 2QYSA 4OGWA 3Q11A 5ENVA 3ROKA 1ISHA 4XJTA 1YL7A 2NSDA 3VZRA 1D7OA 2A35A 3PQEA 4OJNA 1I2BA 1HE2A 2RCYA 1J5PA 4OAQA 4DRYA 4U6SA 3QWBA 1U1IA 4IIUA 4AJ1A 2JD0A 2RH4A 4E32A 4OO3A 1D8AA 3PZBA 3WGZA 2O7QA 2CFCA 4YJDA 3JD3A 1VKNA 3BHIA 1T4BA 3ZV3A 1W8DA 3TZHA 2P2SA 2VZ0A 4P8RA 1T25A 2DFVA 2PH5A 3BMQA 3WWYA 4DQXA 2BMAA 2FHSA 4GSLA 3OJ0A 1KC1A 4LW8A 4R5MA 4XD2A 1K0UA 4RVUA 3G1TA 4IBOA 5EQDA 1QYWA 1SO8A 1WAMA 1Y9EA 2Z5LA 3HHPA 1Y8RB 5ILGA 2GPTA 2DBQA 3OJFA 4PLZA 3D3EA 1C14A 1LC0A 1IE3A 3OJEA 4UREA 1P1RA 4JP2A 2NLOA 1U4SA 3UVEA 4E2XA 2CNBA 5BSHA 2PH3A 3BTOA 4DTIA 1H6AA 3K96A 1KC3A 4UAGA 3IKVA 1Q7BA 2E37A 3PHHA 3PXXA 4IM7A 2EWMA 3C85A 3JYNA 3V1YA 5BNIA 4U5QA 4CMKA 4D42A 1CF2O 2D0IA 1NPDA 4IXTA 4KMSA 3ICCA 1H0KA 3E5MA 3JV7A 3JYOA 4RLSA 3I9NA 4K1LA 1B3RA 3I4CA 4J4BA 1XG5A 1WNTA 1KY5A 1U8FO 1BSVA 3F5SA 4CMEC 1OZAA 3EVNA 2CVZA 1GEGA 3NTQA 2IXBA 4IDBA 1Z7EA 1I30A 3M2PA 3PRJA 3KYBA 1X1EA 4RZIA 5DBIA 5I7FA 2YHIB 4IQ0A 2VNSA 4RDIA 2UV8A 3ZZNA 5HRUA 1P1KA 3GQVA 1DC6A 3KOUA 4YRDA 1A71A 1YH3A 2PFGA 4ZQGA 4BGVA 3Q2KA 4IUYA 4Q9NA 1A4IA 4FD3A 5IFLA 3V2GA 2E6UX 1BXZA 5KWEA 1KVSA 4AJEA 1HDZA 3FNHA 3H8VA 3AI3A 4LVCA 3FBGA 3RU7A 3VPSA 4C7KA 3VPGA 3HADA 3ZV6A 2HK8A 3ETEA 3HDQA 3KYCA 4PCVA 4BNMA 3ANMA 2OOSA 1C1DA 4J7UA 4CLRB 5A5EA 3ONFA 1J49A 4HUJA 4J1NA 4IIVA 2CMDA 3BMNA 3LT2A 1UXKA 4BO7A 4BGIA 1ZW1A 4FC6A 4XX0A 4I5DA 3K9QO 4E2YA 1DXYA 1HXHA 2BGMA 5COAA 3NJ4A 5IDWA 2J3HA 2Q99A 2BI7A 1I33A 5ADHA 2TMDA 5DP1A 2VNAA 2EP5A 4MO2A 5EERA 4WEOA 2QIOA 1YQXA 3T7CA 5MGBA 3QQPA 1A7KA 1JVBA 3H2ZA 1BVUA 4CLEA 1XA0A 3GNQA 1ENYA 1UZLA 1IUKA 1OI7A 4MVJD 3RC9A 1SB9A 4M55A 1Y5RA 1DIGA 2RHRA 1Q0QA 3KBOA 1EE2A 3JQ8A 4MJLA 3GAFA 5L7YA 4PLYA 4MVJG 1A5ZA 2X5OA 3HB5X 3P2OA 1GYRA 2W4QA 1DPGA 1PZHA 1ZH8A 2NQ8A 4OXKA 4J4HA 3HB4X 3IJRA 2HMUA 3E5RA 4DIFA 1WDLA 5FEUA 2EJWA 4D79A 4GX5A 5IDXA 2UDPA 3GN1A 3PLNA 4WK6A 4RO0A 4Z0TA 3D0OA 2PD4A 4Q3AA 3KZVA 4W9NA 4HX5A 4OQZA 4GVXA 3M6IA 4Q3BA 5TIIA 2I66A 5JCJD 1LC3A 3I83A 3QVXA 1H6CA 3F47A 4E2WA 2AXQA 1NQOA 2ZTMA 4RF2A 1N7HA 3CINA 4CM4B 5JDCC 3GHHA 1JWAB 3NGXA 2DPGA 4M8SA 5I7SA 4LGVA 3S2GA 3NUGA 3A14A 1HETA 1DAPA 1G0NA 1ONNA 4U8GA 3WDSA 2YQ4A 1GFSA 2ZYAA 2NU8A 5L7WA 4TKMA 4Y98A 2VT3A 1UXIA 4E2ZA 3DZIA 3MJTA 1Y1PA 4UEJA 4XZ3A 5JY6A 4PIVA 1U5CA 3DB2A 4MPDA 1F14A 4CQLA 4DMMA 3D7LA 1P9LA 4KOAA 4RVDA 4PG8A 4NJOA 4WCFA 2BH9A 3TQHA 1EFKA 1YRLA 1C0IA 4K28A 1PSDA 5KKCA 4NBUA 1ZEMA 1JA9A 1YXMA 1B3BA 1E1NA 2I3GA 3FR8A 3BXXA 3SJ7A 1I24A 1NM5A 4GLLA 2QQ5A 2QRLA 4FSHA 1L7EA 1G0OA 3A1NA 4FQ8A 4RPHA 1XKQA 2XF8A 3KLMX 3VPFA 3JQ7B 1G6KA 2UYYA 1BXKA 1F12A 1EQ2A 1JWBB 3UF0A 2HDHA 5I7VA 2VQ3A 3GPDG 5I8ZA 1LI4A 4EGFA 2WJPA 3B1FA 3P2YA 4GGOA 2I99A 4TRNA 3S1LA 4DQVA 1HZJA 2HMTA 2OORA 3N7UA 5TJHA 5LC1A 3WGIA 3ONDA 2C07A 2P68A 4WPGA 4OOFA 1I2ZA 1I3MA 3OECA 4NU5A 5H82A 5U4QA 4DLBA 4BNIA 2RHCA 3W8EA 2O2SA 2NU7A 1DFGA 1PQWA 4PG5A 2JD2A 5CP8A 4BO4A 1TT5B 3OP4A 5I8WA 5KIAA 1R37A 3E9QA 2DBZA 3HN7A 3GC6A 4P38A 1WVGA 2NU6A 2Y0DA 4DL9A 3WGYA 2Y1FA 2WYUA 3GG9A 1W6UA 3LC1O 3KSUA 4ZN6A 4G81A 1E5QA 3WGGA 4XJSA 4PVDA 4D3DA 2Q4EA 4XQGA 2Y66A 1GTMA 2UUPA 3WNVA 4AFNA 3ITKA 5FF9A 2FPGA 2QZZA 4NFHA 5THKA 4R51A 2Y0EA 3NTOA 3PVZA 4OOEA 3ROMA 2O7SA 3I4FA 4B3JA 4ZA2A 3G17A 1PJTA 3DBVO 2VZ8A 1GV0A 4FS3A 4G2NA 4CUZA 4P4GA 1NVGA 1HYEA 3WYEA 3AUAA 1Y8RA 1ADBA 3I9KA 1PZFA 4ZVVA 2DTEA 3AK4A 1DO8A 4XDYA 1U3VA 3VTFA 2B83A 2A4KA 4CQMB 1ADCA 4CV1A 3ZHXA 1UDBA 4CM8B 1ISFA 4WNCA 3K6JA 4ZRNA 1DB3A 1YS4A 3SJUA 2VWGA 1NFRA 3DHEA 4FFOA 4MINA 3OJOA 1R0KA 1Y81A 1Q0LA 2WYWA 1IYZA 3IAHA 1PWXA 2PWZA 3F9IA 1QKIA 3NDJA 3NKLA 1H5QA 4G5HA 2B4RO 2H1SA 2O23A 4IQGA 4QO8A 4W7IA 5JY1A 3PWSA 4BNUA 1U7HA 2QX7A 3C3XA 2OUIA 5T6BA 2FR0A 4BO6A 3PGXA 1P45A 1ZK4A 2O3JA 2YHIA 3PHLA 1DC5A 1EVJA 3DAFA 1YDEA 5AQ1A 3E6AA 2J8ZA 4CM5A 3L4BC 2D5AA 1KEVA 1H93A 5ILOA 1XU9A 4B3IA 5L51A 3GLQA 3PK0A 4ALJA 4BKRA 4JBIA 2VCYA 1BWSA 3RASA 4EJ0A 1PGJA 4WLUA 2BLLA 3GOHA 4CMIB 3WQRA 4XRGA 4BHTA 1I8TA 3JQ9C 4AJLA 1LLUA 2V7PA 4D43A 1TVEA 4ALNA 1E1LA 5A3JA 1KYQA 4CLRA 1HWYA 2YYYA 4JJIA 5ICMA 4QUKA 3B1JA 1LU9A 3O4RA 2Q2VA 4OXYA 2PR2A 4FN4A 3TDKA 2PLAA 4E5KA 3GR6A 4J49A 3N74A 4BNKA 1T1SA 4K6CA 4OIMA 4WOKA 1E6UA 2JFFA 4MVJA 1C0PA 2WE8A 5CEJA 1MB4A 4EJ6A 5DOVA 4I5EA 4MIEA 2HJRA 3E03A 4CM1A 2JAPA 3PDUA 5TS3A 4YA6A 1A27A 4IDEA 3MCVA 1FK8A 4CM9D 1YL6A 1E3EA 3TZCA 2QHXA 3KLPX 2RIRA 3S2FA 4AJPA 3W8FA 3GGGA 2Q1SA 1M66A 3FWZA 3FNFA 4MVJH 5EPOA 5T5QA 3SXPA 3ETDA 2O2YA 1BW9B 1MXFA 4ZGWA 4B4VA 1RM4A 4CMAA 3A9WA 2JL1A 3KSZO 1ENPA 1HLPA 4CPDA 4BS9A 2P4QA 5JCJA 4CMEA 2G82A 1T2EA 4OL9A 4CR6A 1LRJA 1DLIA 1IHYA 1XGKA 2P5YA 2WTBA 4YJFB 3C1TA 2GNAA 2VOEA 2JFHA 3OBBA 4JP3A 5COBA 1P77A 1C0LA 2D59A 3W6UA 4WLVA 1IZ0A 3K8ZA 4BNVA 3TZ6A 2Q3EA 3IQDB 1HEUA 4CV3A 4YTEA 4CM4A 3MWDB 3VC7A 4EI2A 1X7DA 5B12A 1UP4A 1LUAA 2X0IA 4N5MA 4DMLA 1P1FA 2EV9A 3PGJA 1V3TA 2AQ8A 3I9JA 1Z7BA 4GWKA 1GUYA 3ZNNA 4LISA 1Q7CA 3IL2A 1M76A 1HF3A 1XDWA 5FWNA 3WSWA 4NU6A 1K2WA 3AM5A 3ON5A 3C24A 4NNJA 2YZ7A 1RM5A 2X9VA 4LCEA 5B4VA 3PI7A 2X5KO 3NTRA 4YR9A 1ZSVA 1AE1A 1EMDA 4YVFA 1P1HA 1R66A 2G76A 4FFMA 1DIBA 5KNLA 4KUHA 5JYDA 3IP1A 2X0RA 3JQ7A 4A0SA 1H2BA 1XIVA 1GZ6A 1DHRA 2AA3A 4ND5A 4BNGA 1M6HA 1J4AA 2VHYA 4PRKA 2C2YA 4H15A 2J5KA 1GUFA 1HYHA 1GDHA 4U7WA 4AJOA 4ND4A 3ST7A 3WBFA 3WTBA 1CDOA 4DYDA 1GY8A 1VRWA 4I08A 3GN2A 3I1JA 3ETGA 1OC2A 2PKQO 2VRCD 4KUEA 3I6IA 1J6UA 1YO6A 3WR5A 5EQFA 4YEDA 1TT5A 1KEPA 1O9BA 1P0FA 1TXGA 1ZBQA 3D4NA 3I9LA 4WUVA 1B26A 4QFDA 3FTNA 1DIAA 3OJLA 1HE5A 4F45A 5JAIA 3D5TA 1E7QA 4W82A 1PJQA 4UVIA 3TZKA 4BO3A 3NRCA 1QYDA 4R16A 1U2GA 3FSRA 3PIDA 3KM0A 2IZZA 3PPIA 1JQBA 2ZTLA 4LRTB 1T26A 1DSSG 3WLFA 4RJTA 5AOVA 4HKTA 3DO5A 4E0BA 5A04A 1UDAA 3V8BA 3INRA 3QY9A 3AW9A 1NXQA 1PQPA 2BFMA 1X13A 1GL3A 3VDQA 1EE9A 3GVHA 1YB5A 1O89A 4LK3A 4NHEA 1VJ1A 3GGPA 2NV6A 4Q3NA 3ZWNA 3JQEA 3BYZA 3ICPA 2IEDA 2JFGA 4GMGA 5TT0A 1U5AA 3DZHA 1BRMA 4J9VA 1FDTA 4J3FA 4CLHA 4DVJA 4CQMA 3ZNPA 1QMGA 4O6VA 4BKQA 4AJNA 1HZZA 3DFUA 3DZJA 3KVOA 2SCUA 4CM8A 6LDHA 3IP3A 1SOVA 2WSBA 4BO8A 3T7EA 3UGKA 1C1XA 2GF2A 1TEHA 1X14A 4WECA 1CIVA 2BF7A 4CL3A 4R68A 2J6IA 3T4XA 1LNQA 3QE3A 1WDKA 1Y8QB 3OSUA 3VTZA 1T2CA 3AY3A 3H9UA 3PYMA 3D4OA 4PG4A 3L9WA 2B5VA 4RF3A 4WOJA 4MVJF 1BXGB 3N58A 2D4AA 2OP1A 3W4JA 4M49A 3C7DB 3ANNA 2I3AA 1PTJA 1AGNA 1VM6A 4D0SA 5L7TA 3SVTA 5DCYA 1V9LA 3ZU5A 3UHAA 3WGTA 1PJCA 2VRBA 3GFBA 4AJJA 3B6ZA 2GZ3A 1ZZEA 2AEJA 1YE3A 3U09A 8LDHA 1E92A 3L4SO 4L8VA 4BNNA 4P4LA 4CODB 1PZEA 1RWBA 1U8XX 4QFCA 4A73A 4CMIA 1I36A 5CG2A 2NVBA 4WLNA 1MFPA 1PGQA 3BMCB 4F6LA 4ONEA 3VH1A 1JKFA 3HDHA 4Z3KA 3I3OA 3PZRA 4YT8A 3RBZA 5G0VA 1FF9A 3ZHZA 3HJAA 5TC4A 3MJEA 1Z45A 3WSVA 3BZUA 3Q3CA 1B15A 3G49A 2VWHA 4FJ2A 1NWCA 5GY7A 4CM9A 4WLEA 3WIDA 3ZU2A 1TLTA 3I5MA 2C29D 5DNAA 4XQEA 3U49A 1DFHA 2O4CA 2WEKA 1ONOA 2DBRA 3FNEA 5AVOA 1E6EA 1JAYA 1UAYA 2D2IA 4I5FA 4PZCA 3IS3A 1ISIA 4BO2A 1DDOA 1YOVB 1EFLA 2ZIZA 4CMHA 1DAOA 2X0JA 5KVQA 1BW9A 4B3HA 4DBVO 4PG7A 4GX0A 2HMSA 3OFSA 5JW6A 4L4RA 1PJ2A 2NQTA 1ZSYA 4WE3A 1R0SA 3RUDA 4IJKA 3LYLA 1XSEA 3LLSA 2J3IA 3UICA 3JQAA 1I3LA 3G1UA 5DP2A 1GCUA 3LK7A 3TSCA 4MKZA 3F1LA 1FXSA 4J2HA 2G1UA 1OFGA 4BKUA 4NG5A 4DREA 4ZD6A 2VUUA 5EN4A 5A5FA 3L4BA 3MJVA 1JVSA 2G5CA 4Q3DA 4FGSA 3QP9A 4FCCA 1GQYA 5ER9A 1F17A 1PS8A 4FC7A 3AU8A 3QVSA 3E82A 5JNLA 4PN3A 4ND1A 4OKIA 2JHFA 2FPIA 5KKAA 1K6IA 3JQ9A 4BO1A 2W2KA 4XGIA 1VSVA 1U3UA 2E49A 5DDIP 3UCEA 3JQDA 4BB5A 4NBRA 2YDYA 4NI5A 4TQGA 3SBOA 4Z6KA 1NAIA 1IULA 2XPCA 3B1KA 2AE1A 4Z0HO 1B14A 4E4YA 1GU7A 3RKRA 1NQ5A 3TPCA 4LMPA 1KBZA 2BD0A 3F4BA 2BGLA 3OIGA 4NJMB 4JGBA 1RYDA 4PLTA 3MEQA 4GMFA 2QW8A 3STHA 2PV7A 4TROA 4ALIA 4NBWA 1T2AA 4LRSB 1W4ZA 4O63O 5A02A 4NQZA 4O0LA 1KVTA 2VRCA 3IMFA 5KCZA 2G0TA 4DLAA 3K2EA 3BHMA 1Y6JA 2AW5A 3VH3A 4TRJA 2OGUA 1YBAA 1VL6A 3DOOA 5IG2A 4W99A 3SEFA 1ZJYA 5G4KA 2WD7A 3TNLA 2J5RA 1LDYA 1PL7A 3DZBA 4CMJA 4IQ8A 3GDFA 4ILKA 2B5WA 1ULUA 3WLEA 1IL0A 2Y05A 4I5GA 3O26A 3P5SA 3E9NA 3FI9A 3ADOA 2HK7A 1KERA 3ENNA 3LC7O 3PQFA 4FFPA 2Q1TA 4N7RA 4TZKA 4KDFA 7MDHA 4BO9A 1YONA 2FMUA 3VVBA 1UZMA 2HK9A 5L4SA 1U28A 3ZU3A 1I3NA 4J2OA 4INAA 3TWOA 3Q9UA 3MTGA 3Q1LA 2JCYA 4TWRA 3F46A 2HRBA 5I9MA 4GAEA 5G0SA 5H81A 1YL5A 3H5RA 3R3JA 1QV6A 1R4MB 2PGLA 1ZNQO 1SB8A 1ZO8A 3NT5A 4NZ9A 3ZV5A 3WWZA 2Q1UA 4CV0A 3L0DA 3OF2A 3INTA 5TSDA 2X5JO 3E1KA 1LDNA 2C54A 3GEGA 3WMXA 4BV9A 3S55A 3JQBA 2D8AA 2Q2QA 3PFFA 4MKXA 1N9GB 1NBOA 4Z3DA 2QZ9A 3DL2A 5C5IA 4H16A 3WTCA 3S2EA 4PLHA 2ZJ0A 3KYDB 1EK5A 2FR1A 1IHXA 1Y8QA 3KUXA 1LTHR 2ZB4A 3A06A 4E5YA 2O50A 4BGEA 4EITA 1A7AA 1TB4A 1HDOA 2BELA 3JQFC 4JX8A 4Y67A 4BNYA 8ADHA 1Q0HA 4DA9A 2BFAA 4XA8A 4GQAA 3TRIA 5G0TA 1SNYA 1H6BA 1LDMA 1G1AA 4A03A 4IDAA 2AG5A 5FFFA 3WQQA 3EK2A 4Q39A 1YBMA 1UXHA 1U3WA 1Z74A 1EEHA 3GDGA 4YBZA 4ZHSA 3Q2IA 1NHWA 1YJQA 1DBVO 3QA9A 4FDAA 3C1OA 3CEAA 4R3NA 1HE3A 3PHJA 2VHZA 1XWFA 3QWFA 2NU9A 4FGWA 3DDNA 3BMCA 3GRPA 4CM7A 4OYRA 2EKLA 4GGPA 4E13A 4YJHB 5DULA 3AWDA 2DUUA 2PZKA 1B8PA 2V6FA 4H7PA 4IMPA 2IEBA 4N5LA 2PY6A 2I76A 4ITUA 1LSUA 4RLHA 3WGOA 4HNHA 3GRKA 3QWHA 5THQA 2B4QA 3GNTA 4DPMA 4AICA 3GK3A 1YDWA 3H9JA 4PZDA 3X2FA 2NNLD 1I01A 1XU7A 4XCVA 1CWUA 2ZATA 3BAZA 4IJUA 4L4SA 2OBNA 4M86A 2PZMA 4KTTE 4YB8A 1E1MA 1MG5A 2DTDA 4HFNA 1NYTA 2C7GA 1EQUA 1YOVA 3Q9NA 1VL0A 2DTXA 4RPLA 4R01A 3AUTA 4J7CA 2VUTA 3PEFA 2ZB3A 3DC2A 4RV9A 4OM8A 5T64A 1EBFA 1B16A 3MWEB 4NPCA 3MJ4A 2X8LA 2GRAA 3ZW8A 3BMOB 4BGUA 2NWQA 2HLPA 1ISMA 4DIOA 4L4XA
chains in the Genus database with same CATH superfamily
5FBQB 2NM0A 2LDBA 2NPIA 4Q4AB 2YH2A 3NHSA 4AWBA 2X3FA 1QIHA 1TRHA 5IPFA 1P80A 5ITWA 1QZUA 1CCWA 3HI6A 3ZWVA 4BQSA 3NAQA 3FUWA 5A9SB 1RIIA 1W5EA 4J90A 5E4FA 1A4UA 4LSWA 3P32A 3CRZA 4RL6A 2Z4TA 4E5MA 3GJ0A 4F93B 4JBXA 4Z4QA 2EYUA 2BFEA 3EVDA 3FMIA 3OZTA 4WESA 2JJYA 4QM7A 2RAFA 4XQCA 3HK2A 2G25A 2OAEA 3BHJA 5B1DA 3IKLA 4X6YA 4Z0NA 1NQWA 1QPBA 1DKNA 2F4NA 4QXRA 4EF4A 5BN1A 3FWYA 3HCBA 3NJ8A 4PSCA 5DBFA 4OFZA 5D86A 3FOFC 1ADFA 1X0XA 2C31A 4BTEA 1QHSA 1WA5A 3L06A 5A2GA 1M6WA 4FWBA 1CNFA 1KR2A 2CJXA 1V45E 2EFJA 2YV2A 4CI0B 2FCAA 1NYQA 4JELA 1RWVA 4K05A 1KBOA 1NXSA 4JSRA 4QLBA 4ML3A 1QO7A 1VKJA 3M4YA 5KJEA 1JTVA 2VYND 1GG9A 2C3MA 2VTVA 4KIGA 1W5TA 3CXUA 3UFXB 4AL4A 4ESOA 1NWHA 3IYLW 3KXPA 3L4JA 3RFXA 5L3SB 1V0JA 1U1FA 1VCHA 4L9RA 5EMNA 1YHYA 1FX0B 3L2OB 1ODSA 3QKSB 3HEAA 4IEIA 5H0IA 1YCFA 4HRVA 4R31A 1T0UA 3AB3A 4CFZA 4DR1B 1DTWB 3FHJA 4I4NA 4B85A 1Y5LA 1RDFA 3LBNA 2OHOA 1XD2A 3CZAA 2OXIA 4WWHA 3KB2A 1OZ0A 3C8DA 3E53A 1GT91 2G4VA 2I0FA 3N0WA 3VSCA 2ZRJA 4YQYA 1NYRA 2HFJA 4ZAXA 1I4TD 5ALQA 1UJBA 4TMZA 2G3YA 5F1OA 5A62A 3F5FA 1AO3A 1XQ6A 3HKBB 2NACA 1T0IA 3VR4H 4OGGA 1TJNA 1ZM7A 2ZJ1A 2VTEA 3VR5D 2GN4A 1JP7A 2G17A 5HEKA 1T9CA 1DLJA 4Z2AA 1NXVA 1M8PA 5BN3B 2J0QA 3H5AA 2X1HA 3B6EA 5IN5A 4DCJA 3IHLA 4DEXA 1OLOA 2AN4A 3SC3A 4ND6A 3RS9A 4B7UA 2CBGA 3STYA 4WVFA 1Q20A 3D3WB 3NIGB 1QOPB 2QAGC 4JI7B 2BONA 3WK7A 5JYCA 4I5IA 4IYJA 4Q1BA 5IBPA 1MO2A 4LA4A 1VDMA 2AMJA 3TRJA 1I0IA 5EIOA 3J81k 3PBKA 2XVZA 3SHTA 4GR4A 2BKAA 1MB9A 4EY8A 1R1DA 4FIZA 4TOIA 1ORVA 4YFYA 3CLTD 2ZBQA 4JT9A 4U3JA 1QIGA 4Y1GA 4YRQA 2X2FA 4A8HA 1UINA 6CHYA 1UBGA 3V2UA 5INTA 4P2BA 1GADO 1HDEA 2G4LA 1F6WA 2ZROA 5H70A 1I2CA 3DSRA 1X7HA 2H5LA 3OJCA 3WYDA 4BMVA 4ON9A 5J4HA 1KI2A 3DOJA 2ZSBA 4MW7A 3BE8A 2CVOA 4WOCA 4QJ4A 3O4GA 5FO1A 3OZWA 3U48A 5A4IS 5IDYA 1ZRNA 1C7ZA 2VHUA 3WSTA 2VSQA 2AT1A 4HUQA 4GKAA 1T3GA 2Y0CA 2ZYVX 3L5OA 3S1AA 2MIIA 1K3TA 1R6DA 2WSMA 3TD6A 4BE4A 3ABZA 3K8OE 2QGZA 1YU9A 3ZJTA 2HC9A 2FZGA 3VKVA 3CIFA 5CLGA 3RWBA 3SAJA 3R7BA 1XD8A 2FDRA 5JOQA 5GZ1A 5LXTB 4ZI7A 3JARA 1B0ZA 2Q7XA 1N3IA 3V8NA 1XP8A 2ZBRA 4XGQA 1JU4A 4XKJA 1PJAA 3PF8A 4QWWA 3HPRA 4G0WA 4WL0A 1FTWA 2C9DA 1D9XA 1L4EA 5GZ6A 4BL5A 2WWYA 4JXZA 2WVAA 1RZUA 3FCEA 2KSQA 3BRCA 3INGA 4CIVA 3KOXA 5JLJA 2A6PA 2PEZA 4V03A 3VU0A 4J1TC 2P3SA 2W43A 4OLBA 1ZJZA 3VGPA 4YFVA 4F84A 5JS6A 1J09A 1A9YA 1J1IA 2EL9A 2VJPA 3FFWA 1L5HB 2XRMA 1OBFO 3O21A 4WJZA 1DP4A 4WZBE 4XWGA 2ZS8A 5J5CA 4UNSA 4D3XA 5LZ2A 2NUAB 5K6TA 2HWWA 4MIYA 4X66B 4J0KA 3SQWA 2XBUA 1SUPA 3AKEA 2EWWA 3UH1A 2Q4DA 4WX2B 1IVNA 1D6SA 2CDNA 1FNDA 3FYUA 3B7WA 3Q88A 2NO6A 3DVLA 3QVUA 4E1AA 2ZB2A 3R5SA 1BDBA 3FHLA 1B1CA 1YBFA 5AM1A 5TF4A 2GYUA 3LT4A 1MG0A 2A0WA 3UCFA 4DYVA 3QV1A 4TMXA 1N4AA 5DXFA 2A84A 2GEKA 2Z6QA 1JQ5A 3PB3A 3DMDA 4EW1A 1QCZA 3LCMA 1TZ2A 1OWNA 5KJ1A 3T7RA 4Q82A 1VSUA 2IZOA 1MGPA 3UA3A 2ZVDA 3FSGD 4ZRMA 3VO8A 3B51X 4C6RA 3L93A 3RF7A 4GZMA 4UDNA 3U37A 1KEEB 1BDIA 2B61A 3ES9A 1OVGA 1II9A 2UUOA 3I1FA 3IMCA 1GZUA 1K8ZB 1WABA 3OKPA 2H9IA 1F2DA 2OFWA 4GZ6A 2WLSA 3H5VA 5HVNA 3F4LA 4YJ3B 4L8WB 4WMLA 2JI8A 4RKWA 3IX7A 4OKNA 1XCBA 4HB2A 1DOHA 3LRTA 2FMFA 1EX6A 1O94A 3GMIA 4Q37A 1KI1A 5AKHA 1AA6A 2BFDA 4AJKA 3UV6A 3RT7A 5IAOA 4L75A 1L4LA 5EJAA 1UOPA 1T15A 1YR8A 3CSUA 4EY7A 3Q3JB 4ADSG 3H0CA 4KE7A 4HJRA 4EO7A 2WIAA 4KIUA 3QK7A 3BE6A 1CHNA 1L5KA 2W6OA 3QHQA 4NMHA 3DOFA 3Q72A 4RF5A 5TPWA 4LRXA 3N53A 3Q0IA 2CHGA 4DLXA 4YRCA 3ISVA 3FY4A 3GFOA 4MVJP 2AG1A 1HMYA 1BC5A 5TPZD 3GP8A 3B8HA 3FLEA 2ID9A 1D1TA 3FPJA 3M34A 4H0NA 2FMTA 3S3TA 3KUKA 5DIZA 4Z4EA 2GM3A 4R4JA 3N0XA 3ROGA 4RJJA 3TH5A 3F71A 1MQ9A 4HDRB 5AK4A 2HHLA 1Q0SA 2W4IA 1S2NA 4IHJF 4EHKA 2QRVB 4UVEA 4JYBA 1E6CA 2PU7A 3L04A 1BTOA 2JGNA 2PKRA 3BWEA 3TSYA 4QUEA 1VJRA 3QQ5A 3VHRA 4AZVA 3ZBQA 1YZHA 4ECAA 4HWGA 3K0AA 3D9QX 4P4SB 4RY2A 3T8YA 3UC9A 1R27A 3ZG6A 1U8UA 1PR4A 1H4VB 1EIWA 1JTEA 3KTAB 4ZTBA 3VYWA 1KAQA 1U1EA 4BQOA 2AZMA 3DL0A 4RVSA 3HM9A 2GOYA 5CK4A 4YAGA 1P7WA 2A92A 2ZE5A 4HDSB 4U6QA 4W7SA 4WXPA 1C9DB 3S29A 1O6ZA 3ZGZA 3R24A 4OL0A 4ACAA 5D5PA 3GFPA 1KO1A 4ZXPA 3SHWA 2AQIA 5IXSA 3ZR4B 2QN7A 4XLTA 4C7MA 3L7DA 3ESDA 2HQ1A 5D5HA 3RUFA 3RVRA 3UMGA 2C5AA 4OHZA 4JNCA 2MCFA 1NXXA 2LRHA 4BKPA 2D3TA 1PW7A 2Y92A 2CE7A 2DQKA 4PLGA 3UAWA 3VM6A 4UUPA 2WFAA 1LBEA 2I5PO 3CH4B 3I76A 4I8IA 1JMKC 5CVCA 3FBWA 1D4AA 4DM4A 2B98A 5JNTA 1VECA 4DS3A 1FMLA 3HDVA 4LFAB 3PFIA 3PQ3A 4QTZA 5JTUA 1PYDA 3KKOA 3RS8A 3KFLA 1RZVA 1G21A 4DR7B 1W5AA 4TZ0A 5EEHA 2WIKA 3SG0A 3DXYA 1Z82A 4TWJA 5FBZA 1EUCA 1VBNA 3DH0A 3IQIX 4BOYA 3T1HB 1TUBA 2WUVA 4OHWA 1C7FA 1W5SA 2OFOA 4C01A 1IOVA 1ZQ9A 1K7EB 1AF4A 2J9FA 2VSFA 5ICSA 4Y2QA 4JZYA 3L7CA 2FJUA 1K8RA 4O8CA 4WY8A 1JW9B 1CNEA 2IY9A 2J46A 3AVTA 3NORA 4Z4CA 4OB8A 1NKVA 4N3NA 2OEPA 2FZLA 1S8FA 5TEWA 2H2DA 1X80A 2WWFA 1OI2A 3QH4A 4ZAGA 5KYUA 5JH7B 2JFNA 4P4TA 2EYQA 4YLGA 1PIWA 1ODLA 1QF7A 1N2SA 4W6ZA 3IPLA 1KOLA 5JRDS 1EKXA 2JRLA 5IXJA 2GHQA 2NADA 4N82A 3Q8KA 1E3TA 4WZ6A 4ZMRA 2ZR0A 3H87A 2P5UA 4JL6A 4PIPA 1UC5B 4XWTA 5CPFA 4B34A 2VATA 1HDXA 4BV8A 2LDXA 3QEAZ 2GF0A 1M1XB 4A8JA 4G1BA 3GXOA 5A3QA 3VFDA 1QFYA 4PGFA 3LNTA 4ENVA 1Q7GA 4ZGBA 1FVOA 2YUTA 1XC7A 1YR9A 1D6NA 3GA7A 2J07A 5T4FA 4BLOA 1GQSA 3UJ9A 2JASA 1H2WA 4GICA 3ZGNA 5FV7A 4Z2YA 1N2GA 1USKA 5C18A 3K6SB 4IV5A 3F7TA 4F3CA 5KOYA 5JNVA 3N5CA 3V1MA 1KK3A 3TGPA 3G2KA 3A1EA 4EDHA 2Y68A 3L8YA 2OM6A 1E2JA 5FI3A 2ATCA 2HGZA 2RHMA 4UZEA 4F86A 5EP1A 3RODA 5HGJA 4MKHA 3ZLTA 4BUZA 1AUQA 4UUNA 1JEYA 4LF8B 3PNVA 2XRZA 4B3TB 1W25A 3CO0S 4W5QA 1T4DA 1BGVA 4L50A 2B20A 2QRHA 4C7BA 5K3OA 4TLLB 4EB6B 2FMKA 4YWHA 3AEXA 5JAZA 2ENUA 1TT7A 2NAPA 2W98A 4KMRA 2EQ5A 4ROSA 3BSSA 3I45A 5AUPB 2VWQA 2GPJA 4PLFA 2CWDA 4XQ9A 5BXYA 3NC4A 4B4DA 6REQB 4FHZA 2E2WA 1B6GA 1IHDA 1X7XA 2YJ5A 3M5DA 4N7MA 4R7GA 5LA6A 3DT8A 4OCZA 4CL0A 4CR7A 4ENWA 1AHPA 3BN3A 2V8OA 1Z2OX 3ZLVA 4E5PA 2LUOA 3N0TA 1SAYA 3DBRB 4IS2A 1JFFA 4C4SA 2XGOA 2ZIFA 1K7SN 5GADl 1HT2E 1UBCA 3GMDA 2NSYA 3CUEF 2NO1A 4P83A 3ASVA 5DM70 1I4DD 2GXUA 4HWSA 1ZD3A 4V3CA 4HLUA 2VHQA 3EBPA 5ITZB 5AUOB 3CONA 1UP7A 1VJ0A 4CMBA 4C89A 3SLGA 5B4UA 3RT9A 5BWCA 1JLLA 1GPLA 4XH9B 3EQ2A 5G40A 1JJAA 1XHFA 3UPUA 3FE2A 1JE0A 1M2VB 3DOUA 3GI1A 1VQ1A 1R15A 4W4TA 1QHYA 2QBYA 4KSYA 9ATCA 4JEMA 1J56A 1QR2A 3UAOA 5F76A 3IVRA 3KZKA 2VZ9A 3LUAA 1O97D 4NATA 4I4TB 4CDGA 1Q17A 4JQCA 2O8FB 1YVDA 2PMKA 2GN1A 1E79A 3P2KA 1IMJA 4ZMSA 4YWJA 2PWPA 5F7JA 3S5UA 1P2DA 3UATA 3IODA 1SQ6A 4HQNA 4OH1A 1GCOA 1T5OA 2G72A 1NMXA 3D64A 3PUXA 4YPFA 1KA9H 5C35A 2OAGA 4UHKA 1E0KA 5KCMA 2D6FA 5ALFA 5DM4A 3GU3A 4JUAA 4KV9A 4AJIA 4JI2B 1KTVA 2WSLA 2BMVA 1JFRA 3I5YA 3MCAA 5C7OO 1KETA 2E21A 2FSSA 1HK7A 2ZANA 1OU4A 2QR2A 3HB1A 4MS1A 4WFIA 1OH6A 4TS1A 4ZT3A 5AUQA 4RORA 1XWWA 2I7DA 3GUYA 2M6KA 4EHIA 5IZ4A 2BHNA 5JXIA 2BOVA 1TZMA 1KYYA 1C8VB 4C87A 4CI9A 4IHQA 1DJPA 2G07A 3KQUA 2AX3A 4L0QA 2OHXA 4KO4S 5DCUA 1QX4A 1V8BA 3S8MA 4ALKA 4TV9B 5LR6A 3TUJC 4EFLA 2BEUA 4TTJA 1QF6A 1RWMA 1KZYC 4OQYA 2O5EA 1X94A 3UCXA 4BXOA 3DC7A 5C7LO 5FL3A 3GLGE 2EC5A 4I2VA 2VQFB 2KJQA 4Y2YA 1HDYA 4AMVA 4TT3D 4LJAA 3M6FA 4NCBA 2JFPA 1LPMA 3GJTA 1OCEA 4CNQA 1NQAO 4DARA 2MMCA 3HJGA 1RI3A 4NZMA 3ABOB 5I4IA 3GBVA 2BEWA 3OE7A 2QLLA 3BRQA 2WSSA 3U7HB 1LBIA 1NJSA 2JFBA 4KQKA 4LZNA 1QP8A 1P0QA 4ZQEA 5EHNA 5K8CA 1SBIA 2J0UB 1XCJA 2OD7A 4EPXA 3WK5A 3PQ5A 3FNGA 1MENA 1QFSA 2J7PD 3FIJA 5DHRA 1SC6A 1ZAYA 2XUDA 4O5OA 2JVIA 3VR2A 2AR7A 1CW2B 1F7UA 1NDQA 1T9HA 4EB3A 4JC8A 2VDUE 1DXOA 3DE3X 5CVEA 1DE0A 1KO4A 2FOIA 2REQA 4DGSA 2BKUA 1QWSA 3B13B 5HKLA 1NJ5A 4YRZA 1LSJA 5IJAA 4G3XA 4BQIA 1AY0A 5BURA 1CR1A 2H1RA 2O3RA 3R40A 3NWPA 4D9EA 5DBEX 4K9SA 1LLQA 3AIMA 3OQIA 1YQ9A 2O19A 1TQ8A 1IPHA 3DEIA 1XQXA 5JANA 3UMRA 2P6RA 1ZJ6A 3GUHA 4A2QA 4JN6B 2ZPTX 4JZKA 3EX7C 3AI2A 4R7ZA 4EJMA 2FPXA 3ELDA 3NAGA 4RPIA 4BRSA 3C7KA 2ZJZA 2WJVA 2GDJA 4CT5A 1ZWLA 2RGDA 3NAZA 4G09A 5FAKA 3ZJUA 5AKJA 4DG8A 2PCLA 1IDOA 4ZDJA 1IXRC 2FU5C 4FZ5A 4O1HA 1UCFA 4BV3A 4A5OA 1RI2A 3EXHB 2CBXA 2O14A 2YR0A 2A2ZA 2CFTA 3E8MA 3IOYA 4H18A 1NC1A 1Z2NX 2R00A 3A3PA 2ZULA 2J45A 2YJ4A 2ZBDA 3LIIA 4ND8A 3H9EO 5B3JA 2IIQA 2OENG 2QZ4A 4RGVA 3QBEA 3THXA 5GGXA 3RS7A 4BMNA 3E18A 3NBMA 1GGEA 1AN9A 4AMUA 1FVHA 5GP1A 1AHIA 3T0FA 4CUJA 3TG8A 1T5TA 4I1IA 4JUCA 2C4TA 3PV0A 5BUSA 2UXDB 1BVRA 1RJ9B 2XT6A 4HRYA 4LYGA 3P9PA 4TUYF 2OFPA 4EIWA 5BSWA 3OHMA 5F73A 2KW5A 3I6MA 5G1OA 1HDGO 1SVNA 3FCAA 3O0DA 4Q66C 3RD5A 1UKYA 2FRDC 5CDFA 3AEUB 1P39A 2AXEA 3KVNA 2QK4A 2CY0A 3HUFA 4M6WB 1ZRHA 5E8JA 1XA3A 4P7KA 4HNVA 1FMCA 1XLWA 3WNQA 1W73A 1Q1GA 3ANTA 3NHYA 1ARZA 5C8YF 3M6UA 1R6AA 2UVQA 2P30A 3D2AA 3MJSA 5K4GA 3K31A 4EBFA 3ZU4A 3C0KA 4DCNA 2J6HA 4GSKA 4HQFA 2V5UA 4ZC8A 2BHLA 1QS0A 2EG5A 3S2YA 4QGFA 2UYGA 3WGQA 1PV4A 4KQWA 3EXFB 4CM3A 5KYYA 5JJKA 3Q2OA 4P2GA 3PFNA 2BUAA 1V8FA 1AVTA 3WYBA 1V4NA 1BXGA 2WU8A 4G85A 3AERB 1R0LA 3L7LA 1K5GA 3REGA 2TYSB 3OQBA 5E0KB 1GPAA 3BFVA 4QDJA 1BO6A 5JLAA 4D99A 3EGVA 3A7DA 2ZRIA 3VMMA 3U7IA 4M7OA 4DAEA 4FB5A 1G98A 3PTAA 2YV3A 5EIBD 4MUGA 3SSAA 2ZBVA 5EP3A 3A9TA 3L79A 3QFTA 3QIAA 4LX0A 1V5WA 2HU2A 4NKRA 4WNCA 3DXFA 3R3SA 4KPUB 3FJOA 3HU1A 4QLOA 1QDEA 1GRQA 1U99A 4OLFA 4RFVA 1E20A 4KO2S 1R18A 2IIBA 3QPUA 3GDOA 1H2ZA 3HC7A 4BMXA 3RRFA 1RRFA 3KL4A 3SQMA 5SY6A 1USUA 2AWNA 1IY8A 3GLGB 1GAEO 1NVBA 1T1RA 4B87A 2OECA 5HWSA 3ZGXA 2YC2C 4LHVA 1QCDA 4LECA 1ZM4A 2G1KA 3FA2A 1XV5A 3MT0A 1SCQA 3SFVA 5IJWA 3PRYA 4KO8A 1QBKC 3L6RA 2C9CA 4UHBA 4ZP1A 5F9MA 1TPYA 3BJIC 3R5FA 4DIMA 2WM3A 3D02A 1KFBB 4P80A 3OICA 2HAEA 4RTMA 1FPQA 1SXQA 2O8DA 1VL2A 1A4XA 4TMFA 1L7DA 3FPCA 4NONA 2QT1A 4R3WA 1W44A 1NP7A 1YQGA 1B0AA 4L2IA 4FEYA 4EG1A 3A1TA 1OYWA 1LSOA 3G0OA 3OZDA 1Q50A 2ID8A 2OKCA 4M7PA 5DYYA 4XFJA 3RIHA 3VKWA 3U3ZA 3I92A 1Y5IA 3O9ZA 2FPMA 4IINA 4EI8A 1DADA 2POQX 1F2TB 2OAQ1 2YZGA 2ZVJA 4QREA 4PPYA 3RGGA 1G291 5MHTA 3Q7RA 3C3PA 1BMDA 4R05A 1W5FA 5F51A 4QTXA 1ZJWA 3INNA 3GHYA 3MELA 4EUKA 621PA 3GVPA 5GZ3A 2QRKA 3NHBA 4U2KA 3T9CA 2JKZA 3SS9X 1PEKE 5IUKC 2ZU6A 3WNBA 2R5NA 5JBNA 4ZTZB 2V74B 3TTUA 2XOXA 1UH5A 4WV3A 4P81A 4X8LA 1Z0UA 4QBFA 3RV3A 1OH7A 1SQ0A 1QP0A 2ZG6A 2AWOA 2XAUA 3I05A 3DVAA 3RS0A 1TA4A 4CLDA 4YT5A 5FYQA 2RCNA 4GZLA 3WK9A 4DUZB 1IN1A 2L42A 4YROA 2WUEA 1RXIA 4Q6WA 1P9WA 4X6UA 4FX5A 4RGYA 3ZN2A 3K9FC 1E2NA 1MEOA 2IZ7A 4KYTA 4NQRA 5FA5A 3ZY2A 4R71A 5L40A 2VPWA 2W71A 2ZI9A 3M6XA 4NBTA 4RA9A 5L4NA 2WABA 2IH5A 3ADDA 2QJTA 4NLLA 3H04A 1NNUA 3ZDXB 3SFTA 3F7NA 3L01A 3ZWOA 3QLUC 1RADA 2WVHA 3DKRA 5T67A 1UMBB 4MQ5A 4ZZ3A 2B0JA 2I7TA 3ZDFA 4GPIB 1PV1A 1P4AA 2FVYA 1N2OA 5AI8A 3SR0A 4YUWA 5C8ZA 1KOJA 3MPOA 4KGVA 1JA1A 1LI5A 2P6PA 13PKA 1N1GA 1RKUA 3M82A 2GZAA 4HEJA 4J0DA 1ADGA 1P6XA 3B2EA 4MULA 2GH1A 2XNKA 3B12A 3LKDA 5DYGA 2WVGA 4PYIA 3TNJA 5LP6F 2V59A 2P40A 2XZDA 2YN4A 2ZSUA 3M6WA 3MWJA 5D7NA 4DLTA 3HLYA 5A4DA 2XD4A 3B1WA 4MVYA 5CTAA 3OZXA 1OHHD 3T35A 3JQPA 4Y9TA 3DE1X 3I2JA 1CUIA 2DT5A 4NZPA 5HYVA 3CUTA 1SOWA 4IH9A 4KRFA 4E03A 4CKBA 3LA8A 1U1CA 3N2LA 3O83A 1ENZA 1NV8A 3PYLA 4M37A 4MHSA 2YWJA 4IY1A 3TLYA 1BXRB 3QKIA 4S3MA 5LP1A 1MQAA 5CA0F 3L6BA 1CTQA 5LB2A 5KX5B 4KNYA 4LDNA 3FUTA 4K9DA 1SPXA 3EXG2 3AETB 4CQJA 2JFWA 3SZMA 2XTNA 2Z2IA 4PZZA 2PX3A 4MMXB 2O1EA 3JASB 1B93A 3M2TA 4MWZA 3R0QA 1Y33E 2QROA 1CB7A 4RKYA 4H59A 2ODWA 3EF3A 1ELOA 1NN1A 4GE0A 4XEHA 4FLMA 2DLCX 3PEUA 2LR0A 1BOFA 5BOVA 2Z43A 1EFVB 1L7XA 2ONJA 5SZIA 4EKYA 1WB5A 4MV7A 3NM5A 3ACDA 4M1QA 1TMYA 1E5TA 4M89A 1M2JA 1UANA 2A4MA 4Q21A 4ZYVA 3LRPA 4H3VA 4ZOAA 3GG2A 3M5PA 3OOYA 4S12A 2HY7A 1ZICA 1MAHA 1D2NA 1JV2B 5DWQA 2Z1NA 4K2HA 1ZGBA 1XA4A 3B9RA 3DT6A 1CUHA 5JQGA 3HCPA 1AV6A 3AR8A 3RJMA 1MT0A 4C4XA 2I87A 2XYHA 2P9CA 2IU3A 4Y0NA 4CQMD 3LCRA 1BN6A 2F90A 4MRMA 3UG6A 3DEYX 1YD7A 4TRRA 4G5FA 1FJXA 4NULA 2BFBA 1TIKA 3COZA 3GCXA 1O08A 3LGXA 3CF0A 3Q5DA 5TMDA 4ZVUA 1QYCA 3P96A 1N5DA 3CUKA 1K68A 4DABA 1HNNA 2G28A 3SKYA 2AUTA 4CF4A 3SYNA 1LQUA 2PH1A 4HDKA 1U2EA 2H48A 4MICA 1EA5A 3OQ1A 2WMNB 1D1SA 3T52A 3KJFA 4BRZA 2DF8A 3GGSA 2XTMA 3MTDA 5AW7A 4X6XA 3MCUA 4Y2TA 2I2CA 2EERA 1U0OC 3ND5A 3TN7A 3V2HA 3FXAA 5IXYA 2CMKA 4PZLA 3G8AA 4H3HB 3DFZA 3HCAA 4ZAYA 4B73A 1ZJ4A 4FBGA 4EYSA 5BV1A 1V9CA 2V58A 3Q8WA 6YASA 1ZOOA 2OO7A 4OBBA 4RZXA 1W4LA 4QXPA 2DEUA 2FMHA 3F67A 3KQYA 3W04A 2CHQA 5LJIA 4ZVQA 2ATVA 2NO7A 3WMWA 2XAAA 4V3BA 2O0HA 3GZNB 4NV1A 3RHFA 2C88A 1PL8A 3Q6IA 3O82A 2CK3A 3QE0A 1PQ4A 1U7DA 4Y2PA 5GAJA 1CJTC 4U9UA 3SBXA 1FTGA 1W36C 1T10A 4G56A 1KAOA 3UWPA 3UBTA 2XXAA 3CBQA 1Y6RA 2WYIA 1QHIA 4EJ2A 4ABTA 2XB2A 4EPTA 1BD4A 2AFHE 3AV3A 4WFQA 1OWOA 1G64A 1FTSA 1KOGA 5TNXA 3ZHCA 2GBPA 1IBKB 1N0UA 4UMEA 5F2EA 4CEIB 3ROEA 3HCEA 4V0RA 3ODPA 3U2QA 5C8DA 2Q6TA 4RV5A 2DR2A 1RQ7A 2VJOA 3QVVA 5DLQC 2FAXA 3EGCA 5AMXA 5IHXA 3AKCA 4DANA 5AVKA 3K9HA 3R3YA 3EW7A 4C08A 1CQIA 3H3FA 1OASA 1JILA 3HCCA 5JASA 1BGWA 4Q9HA 5B7PA 4OMUA 1K6JA 4ZO6A 1H2HA 3VSEA 4L27A 3O4IA 3VPAA 2CLDX 1KVQA 2Q3FA 4GLJA 4O2RA 5KEIA 5I7WA 2CUKA 3X1KA 1NF8A 1KAEA 4F11A 1BA2A 3DV0A 3TM5A 4Z9XA 3HCNA 3ZKWA 4HD8A 4YAOA 2REXB 1KIAA 3B20A 4L02A 4OUDA 3D1JA 1B2RA 1NV9A 2AFVA 2Q4RA 1HG0A 1MU0A 3ENWA 5BVHA 1JEAA 1SCUB 5JD5A 4N18A 4EKGA 4J9UE 3UAGA 5K4HA 2YWEA 1EESA 4P6VF 4Y1EA 3JQAB 3V7YA 1WZCA 1NVUQ 1WZIA 4GM4A 1E0DA 3TSAA 1K3FA 5JCOA 4UUOA 2LD4A 3DAYA 3L6DA 3TE7A 3HA2A 1T9DA 4XR4A 1WXFA 2CZCA 4XIIA 4YUYA 2B6NA 4ZQFA 2LXNA 3LUDA 2PA3A 3TRFA 2VDQB 4WXEA 3FETA 4BEWA 4YMIA 3PI6A 5DM0A 1EDBA 1H1DA 1JHQA 2WJ4A 2WHRA 4LMRA 1VI6A 3OEWA 3PNPA 2VPQA 1J9EA 3DBHA 3NNSA 2PLRA 4RY8A 4MI6A 3LE8A 1CUDA 2OHVA 1OXSC 2W2KB 5A4JA 4QIHA 4YYZA 3OOJA 3ZY6A 5IAJA 2FPPA 3K72B 3DOIA 5B30A 4PFJA 3LDAA 2R1TA 3HBNA 3MB5A 1RS0A 3K5HA 5C1BA 1TUEA 5K01A 5C5DA 1TAGA 2VSYA 2XJ9A 4YI3A 1WLYA 2Q0SA 3FUXA 4R1OA 2QORA 3TTXA 4UD2A 1XCOA 4OG2A 4AMGA 1FBNA 2GJSA 2QV0A 3VU8A 1EYZA 2V65A 2J6CA 3QE2A 1UKAA 4JEHA 5IDVA 5KTNA 3RSGA 3SJCA 2I6QA 4FYHA 1ORRA 4X61A 4Y2VA 1SXIA 2GJ9A 4BASA 4DIUA 2WJHA 1YJXA 4JXKA 3OIFA 1W0CA 4EA9A 1BVHA 2WHYA 4BY9E 4EF5A 1PR9A 2FHPA 2IX9A 3UIEA 1Z6TA 4R1QA 1Q74A 1T0JB 2HYDA 3TLCA 3LPCA 3ONEA 1IWBB 1NQUA 5LDHA 1SEPA 1CYDA 7REQA 1QHGA 3E8SA 1RTTA 2WBLC 2P4HX 4KQEA 3ZY4A 1E1DA 1FFEA 1EDOA 2V45A 3PFKA 1JSXA 4WKCA 2YW9A 2FMIA 5HPYB 3A1CA 4BNLA 2I7VA 4WGFA 5KWIA 4XB2A 3P9SA 3T5MA 2P8JA 5EA2A 3X43A 5EHQA 1RAGA 3I01A 4PHTA 2RJNA 3IURA 3E7DA 4I3GA 5AI9A 2YIJA 4R6XA 2IBTA 3CZRA 4I19A 1CF4A 1RWNA 5KSWB 2OZPA 1QCCA 1E2HA 3ORQA 5HK8A 1T2NA 1O96A 1RHRA 1EVZA 3FCUB 4YDRA 4UVDA 2XUKA 1EDZA 3C6YA 2HKIA 3TLZA 4NNOA 4HX9A 2CL7X 2CCKA 1COWD 1E2GA 2AFHB 1POXA 2EJVA 2R2GA 3C5WP 3GGDA 5SZJA 1KZGB 4B3CA 4C2BA 4QFBA 5LQMA 2J41A 2B1JA 2A9FA 4LZWA 5ETJA 1Y4ZA 3H4MA 3AEZA 2VKQA 3LC2O 3H84A 4HL6A 1S2GA 5C51B 4OQPA 1Y6FA 1PX2A 2IPAB 1RI1A 1R0WA 2JLRA 3GLKA 3HRHA 3HS3A 4PGHA 5CFZA 4JQYA 1YTLA 1AKWA 2JIQA 2OBLA 2VCEA 4TX1A 1PRYA 3IKMB 4XYLA 4P5DA 4I55F 3ZLUA 3V4RA 2X9NA 4NDZA 4RVNA 1GU1A 1J0XO 4C0HA 2EW8A 4JLNA 4RDCA 1D2RA 3DTYA 1ABEA 3OM9A 3O8OA 5JBQA 3FOCA 2VJMA 3FYHA 5IARA 1D4ZA 4D9MA 4B6FA 3O8CA 1PP4A 1S2DA 4BVBA 5ES4B 5I7HA 2FCRA 5BW4A 3RVDA 3CKLA 3C1UA 3L4EA 3PS9A 2YXEA 2RAUA 4KXLA 4D6YA 1NM5C 2Y1CA 3K70C 5B2ZA 4X64B 4AJ4A 2XDQB 4RVGA 3WFZA 2AYYA 2V1UA 3FCYA 5D3ZA 4ZCLA 4W5NA 1C7JA 1Z83A 3HXLA 1Z07A 4UOQA 4CEJA 3QHAA 3AHJA 2QMQA 2RHWA 1FTNA 3O3CA 5G4LA 3CT6A 1BDJA 1Y42X 2Q8PA 1JECA 1REQA 3OI7A 4IX1A 1W2GA 4WY2A 5FR2A 4LOKA 1FDVA 4QDTA 4YDSA 3GJ8A 3K30A 2CDAA 1I3KA 3IVCA 4HBZA 3U3JA 1YCHA 1H8EA 2DC1A 1OYVA 2OORC 2JGMA 4K6MA 3TIGA 3PFHA 3P4UA 3PPVA 4NPHA 4ECEA 2MSDB 3I39X 4IO1A 2PUAA 3KQMA 4J7XA 3T4PA 3TPZA 1Z5UA 3WMGA 1FXWA 2RH8A 3BCSA 1V16A 4CTMA 2XT0A 4NK4A 1GNPA 1R6UA 1ULAA 3EVAA 4KSBA 2GPYA 4A8TA 2O0KA 3HWX1 3WYFA 3OAAA 3QUBA 1QG2A 2Z30A 2ZUDA 3IUBA 3IULA 5AXDA 2ZVPX 4JITA 4ZQBA 4C03A 4KJZA 3HLKA 3IUQA 1CVIA 4IOLA 4UNNA 5JZMA 2OGWA 4K9PA 3A6KA 2YHUA 4IDQA 2WFLA 4HFJA 3RAJA 2GYYA 2H59A 4B6OA 4CLOA 1R12A 4O59O 2VKTA 4R5HA 1MJNA 3DBIA 3EVCA 4QSHA 3SXUA 1LPBB 1VSQA 4RPJA 4GPTA 1DJNA 4O5AA 2QIPA 4UUBA 1Z22A 5B58C 4LF5B 3AR9A 3JY6A 5DGCA 2JF0A 1ORDA 1EZ1A 4Q02A 2OVFA 1FNSA 3AEKA 2ID7A 1WG8A 2XTZA 4MR7A 5CDTA 4OXNA 2GD2A 3EVZA 3ZD8A 4M9QA 5EJMA 3SDSA 4BP1A 4EPWA 1CUCA 2IYUA 3SNHA 4BNDA 1IB6A 3DAOA 4JMLA 1M83A 3GVIA 5BOSB 1LDEA 5BSEA 1FNNA 1HQDA 1MT3A 4CV2A 2GKSA 2XXJA 2B3TA 1NBME 5ERGB 4FI3C 3F5DA 3KS9A 1GPDG 4DCSA 1L7MA 3FROA 1FP7A 3SR3A 1AQNA 4O4IF 2BDUA 2C7RA 5C32A 4AX8A 4EAAA 5B4TA 3JZAA 1KIFA 1VPDA 2AJLI 3DULA 3KQPA 4GIBA 4QQNA 5DOZA 3I1IA 1L5OA 3RUAA 1GFZA 5K7SA 4GR9A 3FM9A 5ES3A 1G3UA 1SXJD 4QJIA 5DRYA 1G5RA 4IDDA 2K2WA 1YQDA 1EK6A 3G2IA 3NBYC 2NTEA 1SIUA 4PZAA 5C0OE 4MUXA 1ESNA 2E1PA 2AG0A 2GKGA 1NVDA 1G19A 1MHPA 4DR2B 1A50B 3WQSB 2I2AA 3MINB 3BGOS 4UQPA 5DI3A 3TXYA 1XMIA 3QUTA 5IEBA 4B4OA 4LGCA 5AW8A 5EXSA 1B41A 1RCTE 3KV3O 2AMFA 3PHBE 3PLRA 3Q8XB 4O4JA 5CVVA 3X1WA 3IV7A 3C6MA 1V5GA 1RFLA 2GLTA 1JQLB 1LDBA 2R1VA 2XZPA 2QAGA 3PWKA 1ZXLA 4XLZA 3AY7A 4LE2A 4RF4A 721PA 2I91A 2X1VA 1RSZA 3K05A 2TMGA 2D2XA 4HGOA 2GN2A 2YJ6A 3UJ8A 4QBGB 4IO0A 2IYNA 3L7AA 2YINC 1RYYA 3O4HA 4LAFA 3W4IA 1X1SA 2W6NA 1M7HA 1OIVA 3P9XA 4MRNA 2GD6A 2DBYA 4R2HA 1LNZA 2QW0X 3O74A 4HXFB 4PHHA 3URMA 1ZM3A 3H13A 1USVA 4IG9A 5KSYA 1MRNA 2E7ZA 2DY1A 5CH8A 5J2UF 3CCFA 3HXQA 2BGWA 2YFKA 4NEQA 1W0JD 4EYGA 2EJBA 2BFEB 3QFFA 3OY7A 2CHFA 1GSAA 2PU5A 4OHCA 3EDYA 4WESB 4YJDA 2Z8YM 2CLCX 2JZNA 2PQMA 3BGDA 3GNLA 3DLIA 1W8DA 3TZHA 3A9SA 1N78A 1TQ2A 3EPJA 2O2ZA 3UWDA 1XRNA 4F2WA 1AT1A 2GJKA 4Z1OA 5AVRA 4U9IS 1U8CB 2FHSA 2HN9A 3O1IC 3ROZA 2I34A 5FFMA 4BYMA 4JSTA 4R5MA 2VJYA 3SHQA 2R66A 1NZFA 1N0IA 1KARA 1KR5A 1YK1A 3BXOA 5BW6B 2Z5LA 4UATA 5A2QA 1Y8RB 1PHRA 4P3YA 4RSRA 4BC1A 4D56A 2EDAA 1OLUB 2MYPA 4PPFA 4AN1A 1OAOC 1RJDA 3MJFA 3KSAC 1C14A 1LC0A 1O9HA 1IE3A 3FKJA 3MNFA 3BH6A 2LCQA 4YRFA 2PKXA 2IXTA 4JR0A 2OOKA 1NW6A 2H06A 3EDRA 3EW9A 3UVEA 4IF4A 2C7PA 5DSXA 4U2DA 2C97A 4B31A 4QARA 1I3OA 2XMRA 1H3FA 3CBGA 3BTOA 4IAOA 4DMRA 4KXQA 1AKUA 1H6AA 5B58T 2FEMA 2E18A 4X20B 2ZXEA 3VUEA 4M0PA 2E37A 3V1YA 5BNIA 1AJEA 2VBCA 1IQRA 1QNFA 2GK3A 3DEAA 4F6RA 1W34A 3W5HA 3ICCA 1W96A 4PS0A 2DXIA 1S89A 2JJ1D 3I4CA 4AMZA 1N34B 1ODJA 3DFIA 4LJ5A 1WNTA 3B6KA 3KQKA 5F3WB 3MRSA 1FFBA 3JZDA 1U8FO 5E8RA 1JXOA 3AEYA 5H3HA 4DHWA 3L6CA 3LP6A 3EVNA 2CVZA 1GEGA 2QG6A 4YQEA 1GGMA 1Z7EA 2XF2A 3Q85A 2C99A 2RKBA 4PBSA 1K1EA 1SPBS 3ZQJA 1I7SB 4GYJA 4OP1A 2PWBA 2ZWVA 2BZ1A 5D51S 3BFXA 2WJGA 3BCUA 3HVUA 4AC9A 4D57A 1EDEA 4E14A 5HRUA 5DX1A 1Q6YA 4F96A 3PUZA 1GR1A 1MH1A 3GLRA 4HZIA 3CM0A 3KOUA 1A71A 4K6OA 4OA5A 3W34A 4LI0A 4YV7A 3Q2KA 4BU1A 2FUKA 2I62A 1CBUA 4WINA 1A4IA 1JG3A 2Q28A 1Z4MA 3E15A 2XUFA 1LY1A 4WBXC 4U7FA 1JB9A 4X94A 4YRRA 5EZYA 1BXZA 2AKEA 4ETNA 2ZRQA 1YGPA 3FNHA 4ZXFA 2GARA 4EEKA 2F2TA 3GEEA 1X77A 1DXQA 4Z54A 4C7KA 3VPGA 2O2GA 4RNCA 4A91A 1OPXA 3KYCA 4PCVA 3SX0A 3N86A 1UBOS 2ZDHA 3ANMA 3DM5A 3PGLA 4LV8B 4MQEA 1PK8A 3ONFA 1J49A 1GAXA 1YMUA 2VG8A 1UMKA 2CMDA 3BMNA 3C3JA 3HABA 3A70A 3LT2A 3O4JA 3PQ6A 4A0QA 4BO7A 1ZW1A 2QSJA 1DBRA 2QNRA 3IR5A 1ORHA 4D9HA 5EYPB 3A9VA 4I5DA 4UBLA 3SJAA 1DXYA 3PC4A 5COAA 1FFYA 1QKJA 5IDWA 3PJRA 2J3HA 2Q99A 4MB6A 4CWAA 1QC5B 2PXCA 4G0UA 1H65A 2VNAA 2EP5A 2FWJA 1BU5A 2PUBA 5IULC 3PQ7A 1LZKA 4Y2SA 2P35A 2WAXA 1N2CA 3OZFA 4HDMB 5MGBA 4X65B 4H6XA 3GNQA 2EJUA 3EXAA 4WDRA 4NRDA 3ZHRA 2FI1A 5MFPA 2GF9A 3H16A 1GQRA 3HYRA 4ZO9A 1NTRA 4A6XA 1NONA 2CFIA 5BV2P 1FYDA 1Z0AA 5E9QA 1N6IA 3HB5X 2VNIA 2OR3A 1E8DA 1ECLA 1DPGA