4E14A

Crystal structure of kynurenine formamidase conjugated with phenylmethylsulfonyl fluoride
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
299
Chain Sequence
HMYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kynurenine formamidase
publication title Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase/hydrolase inhibitor
total genus 121
structure length 299
sequence length 300
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e14A00
4Y2VA 1X2BA 3L1HA 2WIDA 5HKBA 5AIAA 1CUSA 1HL7A 1THGA 2Y2VA 1FFAA 4WFKA 1BRTA 3HABA 1JT2A 2Y6VA 1EB8A 3E0XA 5HK9A 5E2IA 1YR2A 4MWTA 4BZWA 5J3JA 3PICA 4U2BA 2O7RA 5KWJA 5HZGA 1QONA 2HFJA 2XMQA 3AJAA 3IUNA 1ZGCA 5AHXA 4QWWA 1W52X 4BBZA 4P9NA 2WUEA 3HC7A 4BB0A 2H7YA 4DMFA 2ECFA 3R3YA 4G4JA 3WLAA 1H23A 3FSGA 5DYYA 1GPNA 3H04A 1PJAA 2QMQA 5LZ9A 2CUTA 1WB5A 4MYDA 1XZFA 4CCYB 3O9VA 4MEBA 3R0VA 4G9GA 5AOAA 4Q34A 4QDUA 3DDUA 3E4DA 1MAHA 4H77A 4QE3A 1LBSA 3M81A 5CT8A 1UK8A 4CCWA 4O08A 1YAJA 3PF8A 4W1PA 5CURA 5DYTA 1NX9A 1E8DA 2XUOA 1TKRA 3IA2A 4A16A 1W1IA 5D3KA 2XMGA 2HA7A 4BVKA 1DX4A 1CVLA 3PFCA 1CV2A 5EIEA 2C4HA 2QKYA 1CUFA 3R3WA 3DS8A 4UFPA 1D07A 4KAJA 3FLBA 3WIBA 5IVIA 5EIHA 1ZD3A 2QM0A 4OYYA 2J4CA 4W63A 4KRXA 1LZLA 5CH8A 3QMVA 3WWOA 4EY5A 5LZ2A 3GROA 1K4YA 3WL8A 5FXMA 4AN1A 4CI9A 4B6GA 4X6UA 5JALA 4BTLA 3F98A 4F21A 1J1IA 3DLTA 1B6GA 4N5IX 3FSGD 5DNWA 3WWEA 2WU3A 4G4GA 1WPXA 1JKMA 1TCAA 1QIGA 3I2IA 5I7UA 1H22A 4BCCA 2OGZA 4BRZA 1RYYA 4MEAA 5K5EA 3GFFA 3VVLA 3DYIA 1Q84A 4KJXA 4ZI5A 1UFOA 2ROQA 3EQ8A 3T4UA 1VE6A 5A7FA 3C6YA 4QZVA 3HACA 2WFLA 5LLSA 4BATA 5ALPA 5ALZA 4AZ0A 2HRQA 5FOQA 1OILA 1XZCA 3DKKA 3UMJA 4G9EA 2PSFA 3DL4A 3SC2A 2I78A 1A8QA 2OCIA 3HLKA 2XUFA 1CUDA 2ZVDA 2XQGA 4LIPD 5CTAA 2XMBA 3ZI7A 2VJBA 5K3DA 1H2ZA 3BIWA 4JUIA 5IVHA 2QUBA 4BTVA 4UHDA 3ESCA 4U2GA 1Y7IA 2VA9A 4CIBA 3DYVA 3W05A 1XZMA 2JGMA 4XWGA 1G4HA 5FPPA 3HI4A 1DX6A 1AQLA 2EDAA 4AMZA 1XROA 5D6OA 5HFAA 2B9VA 3H2JA 4AO8A 3HYSA 2DQYA 5JIBA 1W4LA 3DOIA 5CBKA 5LKAA 1I6WA 5A6VA 4C01A 4QLOA 5AI0A 4EBBA 3BE8A 5A2GA 1CUUA 3O0DA 3X3HA 2JIDA 1JJIA 4CG1A 1DT3A 1XQYA 1YS1X 5BWBA 3K2IA 3CXUA 1L7RA 4G5XA 2DSNA 2HA0A 5A62A 2JGIA 4Q3KA 4AQDA 1YCDA 2AJDA 1YSCA 5LIPA 3VKFA 1KU0A 1XRMA 4K5QA 4B83A 3STUA 1GT6A 3ICWA 2PKYX 1YS2X 2HL6A 3FYUC 3ZV7A 4M0FA 5A7GA 3C5WP 3V1MA 3L1JA 5ALFA 3WJ2A 1HKHA 2HADA 3IB3A 1LPNA 3G0CA 4JEIA 4K2AA 1WPRA 3I2GA 3WI7A 1QIIA 2VJDA 4LXGA 2WUGA 1F0PA 1QIEA 2HRRA 4PO3X 4DNFA 3WZMA 3SWWA 2C0QA 1W6RA 3W2TA 1MU0A 3C43A 4OU4A 3WKCA 1K6EA 2ZJ7A 4RNCA 1YA4A 2DR0A 3W9UA 3LIIA 1ORVA 5AI6A 4C4XA 2RONA 1K5PA 2PL5A 5C7YA 2JEZA 4K6GA 1FFDA 1PV1A 2YYSA 2J4FA 1DQZA 4FLFA 3IBTA 5ALRA 4KE9A 1C4XA 4UHBA 3JW8A 4FOLA 1IZ8A 5HF8A 5AK4A 2C58A 3WWDA 1WCYA 2RAUA 3G9TA 5JARA 2DFPA 4J0JA 4MJ3A 2DHCA 1HQDA 1O6FA 4C6HA 4G8BA 3FYUB 1TRHA 1JJBA 3R3XA 2PU5A 3RM3A 2BAGA 4AO7A 1H2WA 3DCNA 1SOMA 4MYSA 4NS4A 2BUCA 4H7HA 1AURA 4B0PA 1N8SA 4OU5A 1YB7A 1HLGA 1R88A 2BCEA 4E11A 4KE7A 4OCZA 4AZ3A 3OG9A 1IUNA 1CUVA 1XZDA 3OPMA 1UWCA 3D4LA 3QZUA 5ALUA 4C89A 5C8VA 2WIGA 5AICA 5ESRA 1XZGA 2AXEA 5HF6A 1LNSA 3C8HA 2WJ4A 4HRYA 3S8YA 3QM1A 3I6ZA 4BC0A 1N1MA 5ALJA 4HVTA 4YX9A 1KU6A 4GWLA 4BCBA 1QFMA 3B12A 1QZ3A 1JU4A 4X6YA 2D5LA 3PF9A 2WHPA 3I2HA 3W9BA 4BVLA 3FCXA 3V1KA 3GUUA 3R41A 2QOEA 3GA7A 3T52A 3I6YA 1XZEA 1VKHA 1ISPA 4PF1A 3V1LA 1MNAA 3E1GA 4UBLA 3G7NA 3QYJA 1MTZA 4WCVA 4QNNA 3ILSA 3C8DA 2PSDA 1GKLA 1L7AA 2OG1A 5ALVA 1BCSA 1RWQA 3IUMA 1LPOA 1WOMA 1VZ2A 3F67A 4M0EA 1XLWA 4H7KA 1FFCA 5K3CA 1ZI8A 4D9JA 1QFSA 4HXFB 3IDAA 2GYUA 4EZIA 3YASA 3QITA 2XB6A 3V9AA 1ZI6A 5HKAA 1QTIA 4H0CA 4Y2RA 5K3EA 1DU4A 3UUEA 3CN7A 2XT0A 5AI4A 3I2JA 4IH9A 1LPPA 3FBWA 5FPQA 4KR0A 3WK9A 3U0VA 4X91A 1JJFA 4IH1A 2ZYIA 2ZSIA 1QO9A 4GDMA 1ZD4A 4KRYA 2GYWA 3D59A 5FUMA 2WTMA 5HCUA 4FDMA 4NZZA 4AO6A 4DTCA 2GBCA 2WJ6A 3WIOA 3WK7A 1IUPA 4W9RA 1X70A 4INZA 3L1IA 2VT6A 1EX9A 1BU8A 1XZBA 3ESAA 4GLBA 4CCYA 2XUKA 2XLCA 3ZPXA 7YASA 4OPMA 3I1YA 2Y6UA 3S2ZA 3Q0TA 2O2HA 3AIOA 4BC1A 3H1AA 2JEYA 2G5PA 5AK6A 3AZQA 3STVA 4Q3LA 2V9ZA 2E3JA 1Q0ZA 1XLVA 4C88A 3OURA 4JNCA 1FFBA 5D7BA 3MUNA 1R1DA 4CFSA 2X76A 4XIIA 5AK3A 2WM2A 4CG2A 4UBJA 3KD2A 5EHQA 3H1BA 1F0NA 4FKBA 2QZPA 3IVMA 5ALNA 5KREA 4GHWA 3V48A 1JI3A 4X85A 5AJHA 4DNQA 1XQXA 5CT5A 4E14A 4P93A 2C7BA 1SCKA 5AIBA 1BEEA 4J0KA 5AI8A 2H7CA 5ALOA 4HZGA 4UPDA 2VAXA 4BE4A 2XMCA 3VDXA 2XUHA 3BWXA 5HQ3A 5E4YA 5ALLA 4JH0A 1OCEA 1Z68A 1CEXA 3WKDA 4A23A 3C87A 3O9MA 5LP1A 3O95A 1MO2A 5AOBA 1M33A 3A70A 5E4JA 1EDDA 2VJCA 4K6HA 2XUAA 5DNUA 1XKTA 3F96A 2QXTA 4EHBA 5DNVA 2OXEA 4OB6A 4GEGA 3DQZA 3PUIA 4X92A 4BZZA 3C70A 1WM1A 4CIAA 2OGTA 5FP0A 2VAVA 5JADA 3AUKA 2IX9A 2WJ3A 1U8EA 1A88A 4M0MA 5A7HA 5EHXA 3DOHA 1Q83A 4E46A 3QMWA 4HTAA 1IZ7A 6YASA 2IIVA 3H0CA 1EDEA 2OLEA 5AM3A 1WHTA 1BCRA 2V96A 1EH5A 4U2FA 5KWIA 3H2HA 3LIPA 2K2QB 1WB4A 2DCMA 4PSDA 5JAOA 3LS2A 4IHAA 4Y9SA 3RLIA 1XKLA 1F8UA 2XQIA 4I4CA 1A7UA 1HDEA 4DMHA 2H7XA 1UOPA 3CCCA 1P0QA 1QE3A 4B9AA 2WG2A 2WSLA 3WYDA 3JYHA 2ES4A 3STTA 2C5FA 2WKWA 4ETWA 4UFNA 4BAUA 4BDSA 5C8XA 5LZ4A 4X90A 4XJVA 3FWHA 2XQJA 1SCQA 5I8PA 4Y7DA 5EIAA 1QIJA 5JAHA 2R11A 1NU6A 3E3AA 4G8DA 4DSZA 1SC9A 4Y2YA 3NGMA 2RIPA 4KACA 4KEAA 4Y2JA 1J07A 2Q0XA 2CB9A 1UKAA 3IURA 1LPAB 3D2BA 1K8QA 3A2NA 4FWBA 4AX4A 4PV7A 1RP1A 1SCIA 3W06A 3AIMA 4H18A 2WFLB 3N0TA 1AGYA 4F60A 2YH2A 4G8CA 3MUOA 1MAAA 5CXUA 1AX9A 4J7AA 2VT7A 1LPSA 1QIMA 4H7EA 3BJMA 4J03A 4BP8A 1QIHA 3FNBA 3GZJA 2D0DA 3C6ZA 1DQYA 4DNOA 3D5EA 3G0BA 1TCCA 2V98A 1C7JA 1L7QA 2HA5A 4FFVA 5CT4A 3OOSA 1EINA 3BF7A 3B3QA 1EVEA 1OXMA 2JGKA 3WWCA 2HU5A 5C8ZA 5LYYA 5ALHA 5ALTA 1E8MA 1JFRA 3SX4A 3PI6A 1DWPA 4UHFA 2OAEA 1GKKA 5EI5A 4WY8A 3STYA 4FHZA 4UHHA 2QR5A 5CXXA 3AZOA 3EBLA 4U2EA 3EF3A 1J2EA 3N2ZB 1EA5A 2WHQA 1VJ5A 5HK8A 4W1QA 3Q8WA 4RE5A 4XX1A 2HM7A 1QTRA 1ORWA 1N5RA 4BAGA 2J3DA 4BAZA 4WFIA 1ZD2P 3G9XA 5EHZA 1FSSA 1P0IA 4WFJA 5AKXA 5EGNA 1A8SA 4AMYA 3DL7A 3QH4A 1WB6A 3WL5A 1QOZA 1JMKC 1R9NA 3BJRA 4QDTA 1BN6A 1GZ7A 1CUCA 2JGFA 1QGED 1K63A 3WYNA 5JATA 1U4NA 4L72A 5SYMA 4OUKX 1CUWA 2WQZA 3G0GA 4FBLA 3WQHA 4Y2UA 4Q82A 3HEAA 2X8BA 3BL8A 4UFOA 1CRLA 1EHYA 1VZ3A 4TGLA 4K6KA 4BCDA 5K3FA 2H9YA 3FYUA 3H19A 1DTEA 1EXWA 5BV7A 4H7DA 1TCBA 1VE7A 3QPCA 3WA6A 4X95A 1ETHA 3ESDA 3CN9A 4J0IA 4HXEB 5AM4A 3KSRA 3H2GA 1ZJ4A 1CUGA 5AKLA 2RGUA 4UUQA 5JD5A 1YASA 2QTBA 2PM8A 3WA7A 2WTNA 3FLAA 4X97A 5IVDA 4DIUA 3R3UA 1QIFA 4DSAA 4QDZA 5ALQA 5LZ8A 5LZ7A 3STXA 4GXNA 2HFKA 3WKAA 2QT9A 4B84A 4P92A 3DNMA 4IH4A 1UKCA 4U2CA 1BROA 3MVEA 4FBMA 4LYEA 4BE9A 1S8OA 1AC5A 4CG3A 3AZPA 2XUDA 3A2MA 3WL6A 2PSJA 5BOVA 2O2IA 2OQVA 1CQZA 4X00A 3WZLA 3DD5A 2VQ6A 4KE6A 4FLEA 3I1IA 2ONCA 4ZXFA 3FCYA 2HDWA 1CLEA 3HZOA 3V1NA 2HU8A 4BYMA 2Z3ZA 5DWDA 5KBYA 2CZQA 3K9BA 3ICVA 3WMRA 3A2LA 3PE6A 3M3DA 4BVJA 4AXBA 5CH5A 4L3WA 4WY5A 1CIJA 1JMYA 1ZD5A 2WFMA 3ED1A 5JAUA 2CEKA 2FX5A 3QVMA 2R8BA 1UT6A 2ZYRA 1ZGBA 4FFWA 3K6KA 1XRLA 1ZOIA 1YAHA 2B4KA 4L9AA 2QVBA 4UBKA 4ZWNA 4B9EA 4HS9A 5AKIA 1LPMA 3IIIA 2HA2A 1UK9A 4EY7A 2XLBA 3VVMA 4F5ZA 1MN6A 1P0PA 2XUIA 2PUJA 5T4EA 5DLPA 3I28A 2HA6A 3WJ1A 1KEZA 1H2YA 2OQIA 2HA3A 3CCBA 4RPCA 3H2KA 3AIKA 3NWOA 4LXIA 5C81A 2RHTA 3DEAA 5BWCA 1PFQA 1B41A 4MWSA 2WHPB 4H7IA 1UOQA 2HHAA 4EB0A 3BDIA 5JZ9A 5T4HA 1W76A 5AKGA 1A8UA 4Y2XA 3C45A 5DTIA 3M82A 3R3ZA 3FLEA 4Z49A 4HRXA 1R50A 1XFDA 1ODSA 4EY6A 4YK7A 1CUHA 1H2XA 1CUBA 3KOOA 4Y2QA 4J0DA 4C87A 2DQZA 2QJRA 4MXDA 1G42A 1MJ5A 3H17A 3WK4A 2Z5GA 2Z8ZA 2XQFA 2GZRA 1AMNA 3FYTA 2QRUA 1Q0RA 2C5GA 4AN0A 5LKRA 1IVYA 2GBGA 4QLAA 5AK5A 1AKNA 1VXRA 1ZJ5A 3FVTA 4KAAA 1DT5A 1XQWA 4WJLA 2BGNA 4B85A 2AJBA 4Q1VA 1XRNA 4ZREA 4KYVA 2X5XA 3STWA 4ARBA 2PSHA 4UBIA 1BE0A 1CUYA 4H7JA 1CQWA 4V2IA 2BJHA 2WFZA 1GGVA 3AINA 4WDQA 4Y2TA 1GXSA 4G1FA 4BP9A 2OCGA 5AO9A 4HXGA 5IKXA 1NU8A 5AM0A 1ZICA 4MQLA 1R3DA 3R40A 4JYMA 5SYNA 3B5EA 3NOXA 2FUKA 1CFJA 1SFRA 4FTWA 1F6WA 1LZKA 1ODCA 3WK8A 3KWFA 4ZV9A 2VJAA 3I6MA 2XUPA 2XMSA 2PUHA 5AP9A 1TIBA 3F9CA 5ALWA 1CUEA 3UUFA 3GELA 1XRQA 3FVRA 2VF2A 4BDTA 2BGRA 1XZKA 4X93A 2CMFA 3BXPA 4UBMA 5YASA 3RK4A 1C7IA 1CR6A 3PDCA 4QEKA 4J0CA 5EHNA 4H35A 5ALYA 5JANA 3D0KA 4PNZA 5AKEA 1QLWA 3NUZA 5AOCA 5AKZA 2CJPA 1UK7A 2OAGA 2OCLA 1LLFA 3OTQA 2WILA 2EDCA 4FNGA 5F4ZA 2G4LA 2BUAA 1MX5A 4DGQA 3IUJA 4FMPA 1XZLA 3G02A 1TK3A 4ITVA 2WUDA 4XVCA 4N8SA 2Y2UA 4WDRA 1LPBB 1UK6A 2DHDA 1W75A 4DNPA 5E4TA 5JZSA 3VJLA 1ACJA 1AZWA 2NW6A 5HQ3B 4EUSA 3RKSA 2XUJA 2FJ0A 5EFZA 3D2AA 3G9UA 4ZGBA 5CH3A 2AJCA 5A71A 2RI6A 5CT9A 4QA9A 5ALGA 2PSEA 4GI1A 2WG0A 3ZLTA 4X6XA 2RHWA 3RARA 5FKJA 4W1SA 2O7VA 2HIHA 4KAFA 3VJKA 1CUXA 3O4HA 2OCKA 4P08A 4U2DA 3C5VA 4KE8A 5T4FA 3KXPA 4DYHA 1MT3A 3DKRA 4L0CA 4X71A 4H7FA 2CBGA 3H2IA 3EQ9A 1DINA 1R4ZA 5K3AA 2GBIA 2WG1A 4OSEA 1UXOA 2GBFA 1EI9A 2JGJA 4B81A 4TVKA 2QJWA 3D2CA 2OPHA 1VLQA 3BF8A 3FOBA 4I19A 2YXPX 2XE4A 4B82A 5ALIA 1IUOA 1R9MA 3WKEA 1TQHA 3M83A 5AKJA 4GBGA 4HAIA 2W22A 3W04A 3I2FA 4NVRA 2HU7A 4YPVA 4G4IA 3C6XA 4MQMA 4TPKA 5JASA 4I3FA 2VSQA 3BDVA 3TGLA 4ARAA 1CUAA 3A6ZA 2W6CX 2BUBA 4Y2PA 1UZAA 5AKHA 1Y37A 4EY4A 3VISA 2VTVA 5JZBA 4Q3OA 1E66A 4W1RA 1QIDA 2ZSHA 1MX9A 1XLUA 3BIXA 1GPLA 2PX6A 4J3JA 1ZIXA 4DLNA 2ACKA 3QMMA 1T2NA 1ODTC 2UZ0A 4B80A 3QPDA 4PSUA 4JYPA 5HF9A 4UHEA 2YASA 2V97A 2VEOA 2I3ZA 4UBNA 1EK1A 2PVSA 1IMJA 4RGYA 3KWJA 1VA5A 2HA4A 5AKKA 1BN7A 2JGLA 3D3NA 1THTA 1VA4A 2WUFA 1CUZA 2XUQA 3QBJA 2WHRA 4IQ4A 2ZJ6A 1AUOA 5D3ZA 2GYVA 1EK2A 1QIKA 3ANSA 1O6GA 5FRDA 2XDWA 1USWA 1XRPA 1GQRA 5DTJA 1GPKA 2ZYHA 4ZRDA 3LP5A 1XZJA 1U65A 5ALDA 5H3HA 3QPAA 1LBTA 3WL7A 4OD0A 3F97A 4F0JA 4DMCA 4A5SA 4NMWA 1MX1A 1E3QA 2XI4A 4N8DA 5AI5A 3G0IA 5CW2A 4IO0A 5CRIA 3C6BA 4EY8A 2JBWA 1YA8A 5HFNA 4QWMA 2WIFA 4LYDA 1JU3A 5ALSA 2WLSA 1EDBA 2Z3WA 3ZLVA 5AM2A 2JF0A 1G5FA 5LZ5A 3F8SA 3HJUA 5ALMA 3OC0A 5AH0A 3P2MA 4OYLA 1QJ4A 3SK0A 2C0PA 2ZJFA 1LGYA 4PQEA 3IULA 3D7RA 3MGAA 3ANTA 3O4IA 4Y2SA 4N8EA 4Q05A 4RE6A 1MNQA 2I03A 1WHSA 3O4GA 2EEPA 1GQSA 4DM7A 4QDOA 2J3QA 5K3FB 4DMKA 2BKLA 1E89A 1T4MA 2CKMA 3VXKA 1FJ2A 1ZI9A 1MPXA 1HBJA 3O4JA 5FLKA 3R3VA 4GECA 1CUIA 1DWQA 2ORYA 2DHEA 1EB9A 5FV4A 2ZYSA 5JD6A 1E5TA 1XZHA 3AILA 5JD4A 3EQ7A 1XRRA 5I9IA 5ISMA 3G9ZA 5CMLA 4S0XA 1UOOA 4ROTA 5AM1A 4C4ZA 2XMDA 3HSSA 1HPLA 3ZWQA 4GW3A 2O2GA 1QO7A 2XQKA 3I2KA 2PU7A 3G0DA 2B61A 2G5TA 4C4YA 4BRSA 1X2EA 5IH7A 2WU4A 2ACEA 3VJMA 4X94A 1BEZA 1ZIYA 3PFBA 3G8YA 2QXUA 1Y7HA 3ZLUA 5FDFA 3JWEA 3GBSA 2XMZA 3LCRA 2P8SA 2G63A 1N5MA 4UHCA 1VOTA 2Y1KA 4QDXA 4FNMA 4PW0A 3LLCA 5HF5A 4B0OA 5AI9A 3EIOA 2WIJA 1J06A 4EA6A 1EVQA 5CT6A 4X3CA 5K3BA 5AKYA 3DJYA 4LHEA 4PSCA 3U1TA 2XUGA 4J0HA 1YB6A 5AM5A 4N5HX 1E8NA 1FFEA 3TRDA 1DWOA 2B20A 1XZIA 4FLMA 5T4BA 2OGSA 3WKBA 2QUAA 2IITA 3WK6A 2BFNA 3TJMA 4ZV7A 3OM8A 4OB7A 2PBLA 3TEJA 4AB1A 4LXHA 5DYWA 3HXKA 3PUHA 2WIKA 2FJPA 3HRHA 5ALEA 5ALXA 3IUQA 2PPLA 4B7ZA 1ACLA 3ESBA 4LKOA 4E15A 1CPYA 2GZSA 4X7BA 4J0GA 1P0MA 1VXOA 2AJLI 5JYCA 3KDAA 2H1IA 1XZAA 1U2EA 2AJ8A 4OB8A 3H18A 3WWPA 5IVKA 2Z8XA 2XMRA 2QS9A 2JGEA 5ALKA 4UBOA 1BS9A 2I3DA 1UKBA 3WK5A 2VATA 1CUJA 1G66A 4YASA 1XQVA 2LIPA 5DJ5A 5JAPA 3FAKA 1TAHA 3AFIA
chains in the Genus database with same CATH superfamily
4LW8A 4YO8A 1EG2A 3L1HA 4BWYA 5BXQC 2O8CA 2FSFA 1MEJA 3ONDA 4U7HA 1L5NA 3JYPA 2EOAA 2RI0A 5AIAA 5HKBA 4QEDA 3V4RA 1MFPA 2OCPA 1CUSA 1THGA 1B93A 3HXTA 1D6NA 4FZ3A 1FFAA 4CMKA 4WFKA 1BRTA 5ERYA 3HABA 3BXEA 3DMNA 2C4VA 2Y6VA 2VL7A 4NHOA 4DUZB 3E0XA 4I4LA 4CKBA 1V9SA 3AEYA 1ZX1A 3BN3A 2IHKA 4JOBA 5E2IA 3WGJA 2QTNA 3AI7A 1TB4A 5IDXA 1GCGA 3JQFC 1MQ8B 1WCXA 1NX6A 4WOJA 1HYQA 2DULA 4ARVA 1CJBA 2W2LD 4WOCA 2FPXA 2E4VA 2WNIA 3RTCA 2BWJA 3AHCA 3A9TA 1ZH6A 3N2LA 2CMDA 1IRXA 1RQ2A 3FCCA 3PICA 2O7RA 5EWJA 3N8KA 1PUJA 2ZI3A 2BI4A 3P5SA 1WKVA 4L4RA 1V8DA 1MOSA 2DTDA 4MV0A 1MO6A 4UAVA 4YAWA 3OE5A 3OZCA 1KSGA 4U7DA 1GPH1 1FNNA 2Q27A 2XZDA 5B58T 5L7YA 3USES 1I80A 5JNTA 2RH4A 2ZUSA 1IVNA 4JDPA 3MLBA 4DRXB 4EABA 4PANA 2GK6A 5J58A 4Y1EA 2Z5LA 1IDOA 3ICPA 2FPIA 3P7MA 4BB0A 1DVRA 1Y82A 4LDPA 1F1JA 5JSQA 2ZWVA 4R1SA 1X7DA 1ZGGA 2IK8A 3CUVA 4RELA 4EG5A 1MABB 2E87A 1EFTA 1H23A 4DJ5X 4HNAB 4CEHB 3S2SA 3EODA 3HYTA 1L9XA 1SVSA 2VO1A 1IXZA 1NTOA 2B8NA 3GD5A 4YPOA 5BUCA 4U8HA 1T9CA 5CLFA 1T5LA 1GR0A 1CEEA 1Q0UA 3H04A 1S2NA 4FC7A 4DV0B 3MJDA 4OMDA 1RYNA 1U4OA 1UF9A 3KSUA 4C76A 1PTJA 2ZULA 1TA9A 2J45A 3PHLA 4NMLA 2F90A 3KQUA 1R4NA 3FSRA 4MYDA 4MV3A 2WIBA 3RASA 5MF6A 1A2BA 2ZVQX 2QD3A 1NURA 3EZFA 4MZDA 1IQPA 1B00A 2QZZA 4IXMA 5AOAA 4NESA 2Q4BA 4Q34A 2NUAB 3KPJA 1Z2EA 1OX4A 1PG2A 3HS3A 1NN3A 3N2EA 5JEDA 1CB7A 1NVVQ 1QFZA 1G9SA 5JYBA 3GLIE 3WO1A 3GCXA 1CS0A 3E4DA 1DAHA 1P9RA 4PG7A 4BQNA 4C7JA 2OV6A 2V6JA 2OVBA 1DARA 3CTPA 5IHPA 2PFKA 2IU0A 1GXSB 1XTSA 1ESDA 1H4VB 1D1QA 4M1SA 1YF3A 2GHRA 1RVDA 2AFHA 1XO1A 4W1PA 2P8JA 3K0FA 2Q50A 5CURA 2C1EA 4YJFA 2IS1A 1NX9A 2VIIA 3NXSA 5IP5A 5KYUB 5EXDA 2C9MA 3MTGA 1V9LA 3OETA 2HCFA 1AUVA 2GHTA 3QG5A 3IL2A 3D6JA 5FBHA 3DHVA 4QJBA 1E2IA 4R1UA 3RIEA 1KS2A 5MFPA 3ZWDA 5FPSA 1TYAE 2ZR0A 1TEXA 4R69A 3JQ9A 3D8RA 1MTOA 3HUTA 1LLCA 2C3PA 1JWLA 4D56A 2FLVA 3ONWA 4N40A 4X61A 3PFCA 3IQFA 4JROA 1CV2A 4ZKDA 1W1WA 1W48A 4IO1A 4RV4A 4Q12A 4V3BA 4MPRA 3ZVMA 5L9AA 1IXSB 1WDWB 2FQ1A 3T5CA 1CUFA 3DEJA 3R3WA 1H2BA 1CG6A 4QOHA 1D07A 2VNJA 4KAJA 2ABWA 2FETA 2WJPA 1FDTA 3GGPA 1GTRA 2VPQA 1H9AA 1TYEB 2Q9UA 4EEZA 2ONYA 4JT9A 3UUGA 3WIBA 1JQAA 5C37A 3HZZA 3DO8A 5LA6F 5TJHA 1II8A 2D3WA 4B73A 1I13A 1QH8B 3G2OA 3AI2A 3ENKA 3Q5DA 2Q3EA 4W63A 4KRXA 4B4KA 3OX4A 4DZRA 4R1PA 2FN8A 2J5RA 4I4IA 2B82A 3ZGYA 3DLIA 4PRYA 5GM2A 5LZ2A 3D6UA 4AG6A 2AN1A 2DUWA 2BI7A 2OAP1 2UZ1A 2D54A 4WADA 5LA6A 4WE3A 3EGDA 2IEZA 1USKA 3IKJA 3UXEA 4QYIB 4B6GA 4X6UA 3DPUA 2YV5A 3Q3GE 1P1HA 5EZ6B 1ZPDA 1L5ZA 4OX9B 1Y7LA 1RYMA 1B6GA 4YUZA 1FJGB 3UGKA 1SCJA 3UATA 1P33A 1NXQA 2QORA 2PLNA 2UXDB 1AU9A 4JITA 4HQNA 2QV7A 3PC3A 4OJMX 5EZYA 1OXBB 1LW6E 4II3A 1H22A 2H48A 4GU5A 1B0AA 2OGZA 4DIBA 5KTKA 3OWHA 1RYYA 2TRSB 3QOWA 4MEAA 1GM5A 1NNLA 1M76A 4I5GA 4DQLA 4EW3A 3RC7A 1J0BA 1XE3A 1OYWA 1V7CA 2VQ3A 2I2XB 2F3RA 3DM5A 4HGZA 4MKHA 5HDBB 3VNBA 3OAAA 5K8CA 1U7WA 1WPGA 1NQXA 1P9WA 2PS9A 3CNNA 4QXQA 5JE8A 3DW3X 3QVTA 3IPAA 4IJQA 3AI1A 4BLSA 4EBFA 1X7WB 3KLBA 1JT9A 3LPMA 3T4UA 5L7TA 1VE6A 2H9AA 4EHAA 4W9NA 5AVYA 5K0ZA 4MKIA 1MG0A 4QZVA 3GXBA 3HACA 3MHPA 3T1NA 3GT7A 2RGNA 4F11A 4XYLA 5LLSA 3F3KA 4FYVA 4R1TA 4FYYA 2C84A 3NAZA 5KJCA 5E6SB 1BDIA 4FQ5A 2HSGA 2C9DA 2X0RA 1Y8QB 3JRNA 4IF4A 5ALPA 4ETIA 2HRQA 4O2AB 4Q3AA 3U3XA 4ZYXA 2HLHA 4DCJA 3EZ9A 1YZKA 4LEIA 5BV0A 4LYGA 3RC2A 2GX6A 5CP8A 2VA8A 1ZNXA 4GYKA 3I5YA 2ZIUB 3H84A 5CM9C 3GGOA 1RP7A 3HLKA 3DE6X 5E1MA 3KJXA 4CTMA 3DEZA 1IPFA 4Q5IA 1J0XO 3TS1A 4IUYA 2XQGA 4IV0A 4LIPD 5CTAA 1H9CA 3DMHA 1V3TA 4G01B 5CVUA 1EXDA 2PUWA 3CRMA 3ZWYA 2V6MA 1SK8A 4PEVA 1P8AA 3RSFA 2VJBA 2ZRCA 1AB6A 1SK9A 1G20A 3SXUA 2VPYA 5L8VA 1MC5A 2F6RA 3E4CA 4GC5A 4OHCA 2B35A 2H5EA 3C3XA 3G2HA 5B4UA 1O95D 2NTVA 2XA9A 2O20A 1CZHA 3IPRA 4ZC8A 5LC1A 4XYMA 5JO0A 1WSWA 3DB1A 1BKDR 3D6TB 4W5OA 3UG7A 1AOXA 4DCSA 2B1IA 5LQKA 2JD1A 3G59A 4U2GA 4WKCA 1MXHA 1H4QA 2AZXA 3K8OE 1WY7A 4CIBA 1JLLA 1CJSA 1N92A 3W05A 3AY6A 2VAWA 4PHFA 4BGUA 1SD5A 4PZZA 4GMDA 1PQ4A 4UEWA 1XTTA 1J39A 3GRYA 4JHLA 4AMZA 4ZT5A 2QN7A 5JSZB 1G3IA 1X1TA 2G80A 4NR0A 2ZYTX 5FI0B 4XQ0A 3N07A 2GCNA 2B25A 5JYEA 1CT9A 1PNTA 4KPUA 3CLTC 3UMRA 4CKEA 2R7NA 1E1CB 1VP9A 2Y1DA 3ESYA 1Z07A 4NOKA 2OPBA 5CBKA 2ZETA 3WB2A 4MKZA 4KQ9A 3OEYA 2CWWA 1NAIA 1Z06A 3GVIA 4GKBA 2NVWA 3BCUA 3ABQB 1F0KA 5A2GA 3DXYA 4IRMA 1NVVR 2O1WA 1CUUA 1V6AA 2BRUA 4AP9A 3JZDA 3TXYA 1SQ0A 2HREA 2XITA 1X6VA 4J3NA 3PUJA 3ZY5A 3CBQA 1UPTA 1X0VA 2WPDA 3WQBA 1L5HB 2VRCD 3LBFA 3WGNA 2IS2A 2D59A 4JBIA 4JLKA 5I7AA 4CM7A 1EUQA 4R8VA 1AB5A 5A4IS 2H4FA 1X1EA 2P5YA 1WBDA 4Z9BA 4RF3A 1YZGA 2A86A 4LXXA 1Y48E 3FGPA 3ZY3A 3CT6A 4XJXA 4TZ0A 1XQYA 1F9EA 1U0LA 2DLDA 2P4EA 1KYXA 2ZRPA 3GEDA 4H6VA 3ITKA 5THQA 3UCFA 2IPMA 4CODB 3CXUA 3H9GA 3V7NA 3N0WA 1WULS 1Z16A 2H31A 5ICGA 1QWOA 1E96A 1A71A 1M8JA 1VFNA 3DV0A 3OWXA 1PFWA 1XTRA 4ND6A 1C3JA 4OKSA 5LIPA 1ZR4A 2UYOA 1KU0A 4DDVA 2ZZNA 2G4CA 5SZKB 4K5QA 3ORSA 5DX1A 2D8MA 3RRFA 4B83A 4KBFA 4ENUA 3F47A 4FPXA 4WUTA 4UM8B 3BHNA 3STUA 3IQIX 4AJOA 4ZOQI 1U9IC 3DNFA 3W34A 4CM5A 3ICWA 1AY0A 1FFXB 1KJWA 1LB1B 1T35A 2ECOA 2R2AA 4M21A 4AJ1A 3H9JA 4HS4A 1PLLA 2IUYA 2W6QA 3TZCA 1KRXA 3HDHA 3HKBA 2GTPA 1MC8A 1KFCB 1WW3A 3FYUC 2BM0A 1V45E 1YT5A 4Y3UA 1O89A 2Y0CA 5A7GA 1YK1A 1F1BA 1XP5A 3LRXA 3L1JA 2KJQA 4GYWA 4LZAA 3AY7A 2FEAA 4L6IA 3V1MA 4KTVE 5ALFA 1OWOA 1X87A 2JW5A 1GZ3A 1XAIA 1XKXA 3U5TA 3DTTA 3CG4A 3RSQA 2HADA 3KXDA 4UTPA 1EHIA 3LKBA 5TXGA 3LUHA 5FOSA 2AOUA 1Z6QA 1PT6A 2I2AA 3M4JA 3OLZA 4JEIA 5ESXA 3CSSA 2XVZA 4YONB 3OQVA 4LV6A 2IV3A 3I2GA 3T9DA 3MCVA 4Z6KA 2FPKA 4N39A 3DH0A 3UAXA 4CTKA 2GD0A 3WOVA 3T5DA 4ZVOA 4FYMA 3UOWA 1V7PC 3M3HA 4IDAA 1EFRA 1IYZA 2HD4A 3HUEA 4OGKA 3VHXB 3PFIA 4R9UC 1DOAA 3TL3A 3GLRA 4Q1DA 1EFPA 4DNFA 1WVMA 1E61A 4IIBA 4RACA 3ZGVA 3B1VA 2C9CA 2WOJA 5EXXA 3VH4A 2OLKA 3QKSA 2GK7A 2XOKD 3EOBI 5DLDA 1U7ZA 4H2DA 3VU0A 4BU0A 3GEBA 1Q3TA 1WZCA 1K6EA 3FDZA 3OZTA 1D9XA 1PWXA 3ABRB 1O94D 2CNOA 2ZUEA 3W5VA 2D06A 3IS3A 4JGIA 4M6WA 1BDJA 3LT0A 4FDVA 3K8ZA 3WHPA 4BVAA 4F3KA 4FHGA 2VJNA 2QI9F 2IVFA 2SHKA 4JQCA 2BW0A 2RONA 4B47A 1KJJA 1K5PA 1CZNA 3FHJA 3HJHA 5HS6A 3M5PA 3UGTA 4QPDA 3O92A 3VV3A 2H0RA 1FTGA 4AN4A 1Q6YA 2NZWA 1CTQA 3UMMA 1LDBA 3E9CA 2GBLC 1C8LA 3ENNA 4J07A 1K08A 3D8BA 3E8MA 4Q9LA 3SZOA 4BVFA 1WR8A 4FLFA 5BRAA 3THXB 2FG5A 2AFRA 2CYAA 2FQXA 1AF4A 2ZTUA 4HWKA 3D02A 3FWKA 3IBTA 3NUGA 2FK8A 4RSHA 4HVLA 4FZ5A 1KKUA 1X13A 2O8VA 2RK6A 4P4UA 4YI3A 1C4XA 4Q37A 3A9VA 2DWUA 4B8YA 3F74A 3WHKA 3B3AA 3U2QA 1IZ8A 3DBRB 4KLRA 4PQGA 3RB8A 1XWFA 5HJ5A 4XE5A 1Y8AA 4WBSA 4M7OA 3RADC 4DILA 1H94A 1F17A 4ENPA 3X2EA 3QNWA 2XV1A 3IODA 2OCXA 3MPOA 4N82A 1BTOA 1OREA 3F78A 3QEKA 2HGSA 1WCYA 2JEOA 2QX6A 3CH6A 2L19A 3H87A 3M6FA 4K9LA 5CX4A 3JU3A 3ECCA 3IQDB 3LQQA 1P7YA 1P18A 4TZKA 2Y92A 4J0JA 3EWNA 5EYPB 3C14C 3EIWA 5DIFA 1RRPA 2JFYA 2GN9A 3A9WA 4IXTA 1GAXA 3THYB 2PZBA 1NHGA 1BHQ1 2Z9DA 3WIUA 2PY6A 1YDMA 1UBUS 3GVCA 5HILA 4O3FA 2RBKA 4YJGB 2Y1OA 1TRHA 3FZYA 3OUTA 4IZOA 1MVLA 4PZDA 4XQ9A 4ZT4A 3U9TA 3D8HA 1RKXA 1W88B 3R3XA 2MINB 2MSCB 2Q5OA 2VTEA 1XKQA 2Z9BA 5G0VA 3SEQA 2D0IA 3ZU3A 3HO8A 2Q62A 5DYGA 3PGA1 4HY3A 1P75A 1N0WA 2R4UA 1WZIA 3L40A 5AJZA 2R66A 1AHHA 3PUKA 1SEVA 4JVNA 3NP9A 4RHCA 1OTHA 1YBHA 1WOYA 1F3LA 1IK6A 3ACBA 1LWNA 2BUCA 3FKSD 3PPWA 3HZHA 4TSFA 4U3JB 4EGQA 1E1DA 1DV1A 5JVDF 1FOEB 3OLCX 5CA0B 4TMFA 2EU8A 4B0PA 4OU5A 1OGYA 3NEAA 5HE9A 2EJTA 2P6NA 4XUGB 4YYEA 5IT4A 4ALKA 4OCZA 1KVUA 4FFBB 1TM2A 4H3HB 3OG9A 5DE3A 5AUNB 1GV0A 3K0HA 4HR7A 3P9SA 4P84A 5TV2A 3X1KA 2J85A 2MR6A 2ASVA 4R2MA 5FQOA 3L7CA 3NBQA 5JI2E 1A7AA 2LW7A 3JVUA 4F8YA 5JVDA 4KQFA 3DT8A 1G7SA 1X14A 4F3CA 1H69A 1O2DA 1OYOA 4HNGA 3D4LA 5KX5B 5ALUA 5CEFA 1J2RA 1JTFA 2V7EA 2REQA 1HWYA 1EK6A 2DPGA 3NETA 1EM8A 1K4KA 2Y0BA 3SJAA 3U3ZA 5AICA 4JLDA 2CK3A 1EE2A 4UD2A 4WNAB 5ESRA 1XZGA 1IBSA 1J00A 3HP1A 4QECA 4UQPA 4M0LA 2VQEB 3QE2A 5HF6A 2OKCA 4E4YA 2Z98A 4TVBA 3AF0A 4GM1A 4YALA 4FFOA 2ZVPX 3UV3A 1OIVA 4ASUA 1XNQB 1V71A 3HADA 4Q7EA 3S8YA 1KY5A 1EP2B 3CURA 3AEQB 4NFSA 4K9QA 5JAMA 2XXAB 3T5TA 4EVSA 4NLLA 1QRTA 4IZHA 2QT0A 4JX9A 4V2UA 2YYZA 3VR6D 2C9OA 5ALJA 4KYIB 3TTVA 4NEGA 2PS1A 4HVTA 4YX9A 2B4TO 3ND8A 3KQYA 4M87A 4ZO6A 1QZ3A 1JU4A 1TU3A 1YOBA 4X6YA 4YAFA 3JQGA 2IJGX 4GZ5A 1SUIA 2WHPA 3KVNA 1G0OA 3UH0A 3LUFA 3C3EA 3LOPA 1G7RA 1GCAA 4BVLA 4PGAA 3FCXA 1AUXA 1J7JA 1ODFA 4DAOA 3DXFA 3OQJA 3FDXA 2HXSA 3N58A 2Z0MA 1LSSA 4HUQB 3G79A 4LAFA 3T52A 5HX7A 1FLNA 2DECA 2GCGA 3I6YA 4V39A 1NUAA 1ZD1A 2XCIA 1E1QA 5E7IA 4EHFA 3O03A 4DLRA 4ZV4A 4QD3A 1ISPA 4BECA 4F2HA 4ZJZA 5AW2A 5JCOC 2QV0A 4V1CI 1PFGA 4PIVA 3PNKA 2ZJBA 1UODA 3V1LA 1JXQA 2KHZA 4YAKA 5M7EA 3E1GA 3ZHQA 4UBLA 4O3MA 3GD7A 3MIIA 3C6MA 3ETEA 3G7NA 3ICOA 4R1MA 2PD4A 1ZONA 2GAFA 2WC1A 1TEZA 4WCVA 2IF0A 2OD2A 1VL5A 3ILSA 4HLUC 1KK1A 3FLMA 3C8DA 1TAGA 3MAJA 4X7MA 1GKLA 4PFJA 1Y6FA 3LQFA 3H8VA 1RWQA 4JB2A 8ADHA 5BOSA 2YZ7A 3PQ6A 3PYLA 3PFGA 421PA 1LPOA 3AHIA 5TIIA 5BWNA 2YV2A 1BG6A 1WOMA 4HZUB 4OVKA 5KNCH 1L7XA 2JCXA 3MWJA 2FMTA 1VL1A 2OXRA 2Z95A 3F67A 4M0EA 4IIUA 3FMVA 3GRAA 2F1KA 3MYYA 1YQXA 4KU4A 4EG6A 2GPAA 4XUCA 1VTKA 3ICCA 4QREA 1T9ZA 5K3CA 2X4IA 2W2NA 4U7FA 3WJAA 3ZCXA 3IQGX 1RM5A 2Z1NA 2VRWA 1Z15A 1G2IA 4MAFA 3FB4A 1AGNA 5IM5A 5A0VA 1Y4AE 5BNZA 3QITA 4L0MA 4HDKA 1K7SN 1ZUHA 1K9SA 4RHXA 2PXXA 5FA8A 1U9JA 3DSRA 2VF7A 1E2JA 1MDBA 2KMLA 4R31A 3H5OA 4CMHA 1B8NA 1VLLA 2GA8A 2PWBA 3UUEA 1WEHA 4KMRA 4ME6A 5JLJA 5F5XA 4MA0A 5BSUA 3HV2A 3ROZA 1RRGA 2EP5A 2XE7A 3EWSA 4KOAA 3UT5A 4CR7A 1SKMA 2G40A 2H63A 4GNKA 1CRPA 4KR7A 3NT4A 1U8UA 1C9NA 2AUMA 4IHQA 1GRNA 2BEWA 4IUDS 5AW9A 3TXAA 4IH9A 4C04A 4WV3A 4AZWA 1BMFD 3I58A 4ZHQA 3L6RA 3PXCX 1U2GA 2ILTA 4EYSA 1N25A 3ME5A 1N6KA 1YVRA 5FPQA 3BFJA 1YR7A 1TU0A 2RJ3A 3MWDA 3WK9A 4OHXA 3DCJA 3RAGA 1L8QA 1Z0AA 1AXEA 1S1CA 2PR2A 2ZR8A 4EVQA 1M1YB 5KDLA 821PA 3AVYA 1Z2NX 1RTKA 2J7KA 3O3CA 4NZYA 1R8QA 1QH1B 2QAGA 2JZNA 5G3ZA 5IAGA 3WLIA 1D4ZA 1NC3A 2PUVA 4XFKA 5ENZA 4ZKEA 4TYPA 1SQFA 1Q0HA 1RAIA 1U0TA 4KFSA 1XQ1A 2HSDA 3VNVA 2P62A 1RKUA 1G3QA 4D80A 4FC6A 3PDIB 3WLOA 3BC1A 4R41A 4GDMA 2XHEA 1UQRA 3GZTB 1KYQA 1SHKA 1Y8RB 4QVIA 3D59A 1SWVA 2ON6A 3AKCA 4E5SA 5FUMA 1Z5VA 3LHDA 1RMQA 5EJIA 3ZIAD 2C82A 4JC8A 3WV4A 3V1YA 3ZCUA 4IKPA 5JAQA 4ENWA 4FDMA 5L4NA 4NZZA 3MS4A 4GOLD 5JWOA 4X60A 1EX6A 3A04A 3GJ8A 5FCDA 4DTCA 2VYVA 3TECE 2VDJA 4W5RA 5ARCA 3M6AA 4O8ZA 3RRBA 1ECGA 3RS7A 1PUXA 3ILYA 4ZJYA 1THMA 2WJ6A 5JXJA 3PXBA 1M1ZA 2IQIA 3V4OA 3NHFA 5GOTA 2HQOA 2OMKA 1P2DA 3L1IA 4KVFA 1SB8A 3AUTA 3F1LA 3ZU6A 3QHPA 4PLHA 5JEEA 3JWIA 3NONA 1T9HA 1A82A 3TNLA 4DBZA 2VT6A 2ZQYA 4G07A 1TEVA 2ETVA 2ZJ0A 3AJDA 2OA0A 4KDRA 4BXOB 1BU8A 4UOEA 4MP6A 5GJWC 1XMXA 4PAQA 7YASA 1YOVB 4OPMA 3V2UA 5FOXA 2Y6UA 4DCVA 2ZE5A 3QLUA 1J2TA 4G85A 3COWA 1AUPA 2N0SA 2QTCA 4GICA 4DCGA 2I1LA 3PFHA 4FOPA 4DABA 4LZLA 2DCUA 2X7HA 1TVMA 4Q24A 4Q48A 2G82A 4DJDC 5LDDC 1NW9B 1QWSA 3O3NB 3ZHZA 4QC2A 3IUBA 1C3XA 5IC6A 3DJFA 2C4TA 2E3JA 2FSUA 1GUZA 2JFZA 5BN4A 2AFIB 4F6RA 1INLA 1PF7E 2HYIC 1KSFX 2Q1XA 1WDMA 5IFLA 3CW9A 5HPYB 5A02A 4JB8A 1O4WA 3HTXA 4TMTA 1PR4A 1RYDA 1P9NA 1FFBA 1EUCA 2VP6A 1DPFA 1R1DA 1WJGA 4LCEA 2VWGA 4YRIA 4TV9F 1Y1LA 1LI7A 4CHTA 3IAM6 3ZYCA 5IU6A 3LRTA 4I2VA 2AXPA 1H05A 2QVGA 4OKNA 2X76A 1DUSA 4DQUA 4ER0A 1GP2A 3U6BA 3UY4A 3PU6A 3UHFA 4CG2A 4QGAA 4US1R 4EKYA 5E9AA 3BK2A 2G9RA 2VSNA 3TZBA 3VTAA 1Z33A 1EBBA 4FI3C 1NJSA 3O73A 5EHQA 3U19A 3PE4A 1F0NA 3H2SA 4FD2A 4RSRA 4FKBA 3AVUA 3L0OA 4TV9A 5EINA 4D92A 3HDYA 1ABEA 3AR2A 1ECFA 1O95C 3NORA 2TS1A 4GHWA 5JALA 2Z6QA 2Z6UA 1G8HA 4TT3D 1M8KA 1V48A 1ZMBA 3S99A 1YFLA 2DKOA 2J3MA 2TMKA 3ZGXA 4OL9A 1RE1A 1XCJA 2C54A 4BO3A 5B6IA 1D2EA 3TCKA 5IT9A 4NQZA 3REOA 2O8DB 4E14A 3ANLA 1FDVA 1E18A 1S9DA 4D7AA 4AUEA 1I4DD 1KDPA 2JARA 1EXMA 3CPSA 1I7NA 4P93A 2FFJA 3KFXA 4H1VA 4JT8A 1SCKA 3T3EA 4TQGA 2QL5A 3H65A 3P9RA 4J0KA 4E5YA 3U4MA 5AI8A 3X1DA 2WD7A 2D5BA 3PENA 3E9MA 5K20A 1U28C 4BMSA 2HCBA 4ZAZA 2E0IA 4CG0A 4EW6A 1YIDA 3M34A 2WWVD 4H3VA 2UAGA 1JB1A 5IARA 2WE7A 4EJSA 4F38A 1T8WA 2Q5IA 2Q3LA 4FHEA 4MLCA 4WRRA 2VUHB 5LOVA 1DI0A 2C4WA 4QRDA 1J8FA 3R0IA 4GR5A 5JW6A 3DL0A 4Y6LA 1XGKA 1JAXA 4BZXA 4XQGA 5IT0A 3SQXA 1T8RA 1CEXA 1UMBB 2BEVB 4KOEC 3W3AH 4B6QA 2HMTA 4EP1A 4GDFA 3BT7A 3C87A 2WSBA 3FOCA 5LP1A 3KJGA 1T4BA 3P96A 5FORA 3FN4A 1DAFA 2AR9A 5HZMA 4FYKA 2WMNB 1O97D 2B5VA 1UP4A 1ZJ6A 3VZDA 4BLQA 3DULA 1B43A 3BTUA 3ODPA 5ICMA 4WY2A 2BDUA 4DDWA 3BZBA 4O4JF 2J3IA 3I61A 3CR8A 2REXB 1XKTA 4OI0A 3RFXA 1QPZA 4FXOA 2XE8A 3EIHA 4PBSA 4M46A 2WYUA 3FFBA 1Q1NA 3H5LA 1I0LA 4JVOA 2BL4A 3TL2A 4JVMA 3ZZUA 4M36A 3QFTA 5DNVA 1GTMA 3BTSA 3MRXA 1JBQA 1OMOA 4GEGA 4UTRA 4BZZA 2Q3DA 2Q07A 1ILWA 3CZ9A 3GUZA 1RQPA 4YHBA 2IYAA 3SNHA 1LRLA 4KCGA 4CIAA 2FFHA 4O4JA 2M1ZA 3DW1X 1SQSA 4X1YA 3Q2OA 1D3AA 4CQJA 2WJ3A 5EMLA 3DBHA 3LX5A 2BEUA 2V7UA 1A88A 3RJZA 4HNUA 1A9SA 2G28A 3DHNA 2AB0A 4K81B 1XTQA 1Q83A 1QKIA 3ZWKA 5KI6A 1JEQB 4F71A 1NMXA 2IIVA 3KSBC 5H16A 2F9MA 4M54A 1EDEA 4J1TA 5FULA 3ZXUB 3OJWA 2VNIA 3DTVD 2I4RA 3ZJTA 5E1OA 4LS3A 3OFSA 1ZYUA 1B1AA 3ESQA 4MRMB 1YONA 1U5BB 1ZH4A 3IBGA 2J0VA 3Q7QA 1ZC4A 1CR0A 2B83A 2JRCA 2YHUA 2D4AA 3F2IA 4L75A 4V0ME 4BLRA 4R0VA 4BFVA 4FIZA 4WCFC 4G65A 4G56A 4BGVA 5K05A 1PR1A 1RYFA 1TKAA 3LIPA 4MB2A 1SKAA 5IJ9B 1PR6A 4QOGA 3NTUA 4F1KA 2QPLA 3NATA 2DCMA 2DTXA 5JAOA 3ZHXA 3LS2A 2BFMA 1AM4D 2OHOA 5IYZF 3RLIA 1HLFA 2XQIA 4EYGA 1A7UA 1W4BA 2G25A 5ENDA 5KYWA 1JAZA 5ESDA 1UOPA 4RTSA 1A3CA 2J9FA 1EQUA 3CCCA 3LP6A 1ECCA 4MR9B 4YBRA 1SAYA 3TYXA 1SUWA 1DXYA 1QE3A 3EG9A 4AICA 1ZHHA 2LE0A 1P7ZA 3ESXA 4B9AA 1O94C 5C4IA 1B3BA 4RPHA 3TQTA 3OPYI 3SDSA 2WG2A 1LQUA 5IYZA 2ES4A 3D0OA 4IJWA 4QT0A 2IDZA 4UFNA 4B2PA 5CAEB 1HF3A 3KQWA 2JGNA 2P6PA 2ZK7A 3CC8A 3QOYA 2XQJA 2A6PA 4MGZR 4PPYA 1XELA 5I8PA 2W2KB 1FNMA 4MV5A 4BY9E 3AKYA 5F2NA 5B6PA 3BE5A 5KB3A 2COEA 3N76A 1A7KA 2QTAA 5JAHA 4TVSA 1FFHA 1Y3HA 4AKEA 5B3AA 3JARB 5BRNA 2REBA 1Z28A 1FPQA 3A1SA 2QY6A 3NGMA 3RREA 2ID4A 2Q99A 3RU9A 2FOIA 5CFNA 2PT5A 3A28A 3QFCA 1ZOLA 3I5AA 2BGGA 4OSPA 4E13A 2ODTX 3IBCA 1C3EA 1UKAA 2CB9A 2P35A 3CVYA 3IURA 2G71A 2BTQB 1V96A 4B3SB 1K8QA 4OKIA 4EKIA 4BMDA 1TM5E 2CHFA 3GLTA 3F7MA 3NIWA 3JD1A 2PA0A 1RCFA 3PPYA 2CXXA 1F4PA 1SCIA 1WEKA 2NXEA 2P0EA 1KK2A 4H18A 1G3MA 2PA3A 4UW9A 2JFPA 1MVNA 4NC9A 1UEXC 3LZCA 4QDKA 3VC3A 3VMMA 2AOTA 4LI0A 1DEKA 3LBYA 1GUBA 1CR4A 2GPJA 3PD7A 4C2TA 1J8VA 2FZKA 3NYQA 4J7AA 1JG4A 2DVMA 4F6CA 5BVGA 4AMVA 3TW6A 1T25A 3EWAA 1GL7A 2F64A 5B2ZA 1MGPA 3KPYA 4RKRA 1NIPA 4KLCA 1V7QA 4JMLA 1D5WA 2XB4A 2DY0A 3FPKA 4PLVA 4BP8A 2GWRA 1JKJA 1DQYA 2FHPA 2XCQA 3FB1A 1T2VA 1NVAA 1X9IA 4RENA 3OCUA 5JNSA 3ETJA 1ECPA 3UXYA 1J42A 5DP2A 4NBTA 4GFDA 1C7JA 1L7QA 3B1YA 4RFSA 2FHSA 3CLUD 2MYTA 4EKEA 4RVUA 1ZKMA 3K1AA 2YZMA 2XKAA 1CS4C 4OO3A 5D3MA 5JISA 1GTVA 1C0PA 4LOJA 1D0SA 1YE8A 1OXMA 2JGKA 3HWWA 1QH0A 2QTRA 3MRVA 1VLMA 5E4FA 4MWGA 5E7MA 1TDJA 1OU0A 4OXRA 5LYYA 1TAUA 1JFRA 3CZRA 4L9RA 1W8DA 1Z5GA 3CUEF 3PI6A 1DWPA 5E9JA 1GTJ1 3M33A 5BV1A 4MA5A 1U3FA 3ZX5A 4YRMA 3UANA 1SQ6A 2VP4A 2G09A 1FQJA 2V0CA 2WF8A 3TIVA 5IF3A 1U3GA 3GEMA 1BFUA 4EGAA 3PHCA 2MMGA 3KZ1E 4UHHA 1OFUX 3L05A 2PTHA 2QR5A 5KQGA 1QHEA 3LVBA 5BR4A 2GRJA 4NZMA 4K6MA 4U2EA 4TWRA 3C3KA 4EEKA 3WAGA 1J2EA 1VKOA 2E48A 2C88A 3G8AA 3O94A 2N47A 3K0CC 4KQWA 3ZOKA 3MBIA 2CLSA 3ZDYB 1XVAA 4XX1A 2HM7A 1E7YA 1A76A 1OFVA 2NO9A 2UYHA 4RQTA 2V7TA 3LCUA 1L4MA 4BAGA 3JWGA 2QSZA 5EGSA 4TV8F 2FH5B 4WFIA 1D7OA 1ZK0A 2PGAA 3IIKA 4FGWA 5C1BA 4CETA 2VPIA 1P45A 3KKNA 4O2BF 3HU5A 2GYYA 5ICCA 5KCZA 1Y1SA 1WBBA 3GRRA 3E53A 1VGRA 4YCSA 3ABOB 1JL3A 1AKUA 1K98A 2NVUB 3OE4A 2OWEA 1J2YA 1GUAA 4WMLA 2EJWA 3ROGA 3SJCA 5JZOA 3AKDA 1DC8A 1VKZA 3OX1A 2Y68A 4WXRA 4TV8A 3B6ZA 2BFDB 3HR8A 2HY7A 2IP4A 1A8SA 3BD6A 4CIWA 5A5GA 3UTCA 4XXHA 3T35A 3M4YA 4QXOA 4HGPA 3T0IA 3QH4A 4RD6A 1BVUA 1RIFA 5DHUA 4S05A 2GDJA 1TYDE 3T34A 3U17A 2HNKA 1R9NA 1ZCJA 3A1EA 1XMVA 2YWXA 3IKTA 4V0LA 5D8DA 1X9GA 3B51X 3QXXA 3OQPA 3OICA 1Z73A 2Q9AA 3T7SA 1AO0A 1U4NA 4NU0A 3T9AA 4G0ZA 4HNRA 4NP6A 2X2PA 1Z5UA 2I8AA 2NZYA 2HHHB 4AYXA 2B30A 4M55A 3G1TA 1DMSA 2XECA 2WQZA 3OLQA 1TK9A 5EQTA 3TZ6A 3OQOA 3H11B 1CE8B 2W6MA 1RWOA 2Z2YA 3E2IA 2I6FA 3MBOA 4J0QA 4JXKA 4PG6A 4C21A 1IXKA 4ZJPA 3NGLA 4I4TF 3S28A 2LXNA 4MJLA 3QVWA 1RWMA 1CRLA 4RORA 3KQMA 2P2DA 4B71A 4CM9A 2YCLA 5IMBA 2D7DA 5ICFA 1KOLA 5FR1A 3UAOA 2AR0A 4DDUA 3FYUA 2FN7A 2E1RA 3HB7A 7REQA 3TLBA 1EXWA 1GGEA 1NNSA 2PNFA 5BV7A 3MFYA 3MSCA 3RUCA 3QBTA 4PC3A 1TCBA 5LJLA 5CYPA 4I4TA 2C3OA 1JQLB 2WWYA 4MUJA 4CM4B 4X95A 3EDQA 1M2VB 3DZDA 1OIWA 2DQSA 4GMFA 2OM2A 3SKYA 5F35A 1X7YB 2EW1A 4J0IA 3NBMA 4P7JA 3WWZA 3PDJA 4R71A 1G1MA 4HXEB 1PGQA 3IBFA 4GM4A 4M1QA 1W0CA 3CUUA 4CDRA 1BC5A 2OCBA 4GX2A 5J63A 4P3KA 3UJPA 5DCUA 1D0VA 4N0MA 5TF4A 7MHTA 1WDLA 2O3UA 5H68A 3VR5A 1P44A 5BURA 5HRUA 4XGKA 2IHYA 2NPIA 4EHKA 3CXRA 3E9RA 3SYTA 3DZJA 3WMWA 2QTBA 2DR3A 1NOIA 2PDAA 1M8PA 4FJ2A 2PM8A 1SG6A 3T3DA 5BQ5A 3OCCA 4JLMA 3SU8A 2GLUA 1JJ7A 1W87A 4TTPA 4X97A 2IDMA 4ND8A 5CDYA 2AJTA 2ZW9A 4KSYA 2AG6A 2AK2A 4B3FX 2J30A 3AF1A 4JBLA 4HAXA 2JAPA 4A8JB 3I9LA 4D4LA 2SECE 1BS2A 3O82A 2FW6A 1S3GA 1RXEA 3ENVA 5CFMA 2CDCA 1W19A 1W36B 5LZ7A 2PMCA 1FYDA 3JXEA 1SXIA 3V4SA 3P0IA 1OW3B 3O4RA 4HTFB 1VB3A 2YOGA 2ODWA 3KZCA 4N6NA 2N9UA 4N7MA 2QM8A 1QPBA 3OEED 3L0IB 1JFFB 2YQ5A 3DNMA 4RTNA 2R68A 5DHAA 5L3ZA 1UKCA 2OBXA 1ZN2A 5EWMA 1BROA 1N1DA 4LY0A 2YMLA 2GPSA 4C6SA 1ZN9A 4M9CA 1JPJA 2CFTA 1WPQA 3HR4A 1Q0QA 4HDRB 4KDFA 4LYEA 1R16A 3JATA 1FLAA 1B74A 4ES6A 1S8OA 3EVNA 1NG1A 3LWZA 5BRJA 4NDAA 4Q4AA 2EZ9A 3SPXA 4MICA 2P9GA 3WL6A 4DY4A 5LQDA 3AGPA 1YZUA 4DWOA 2F1HA 2FMHA 3NOOA 4FZVA 1JQEA 4MS3A 4RQBA 3SD7A 3WZLA 2ERCA 4E6PA 5LFAA 2OFFA 3DD5A 2UXBB 3SX0A 4W5QA 1E1MA 2OFWA 2XGMA 3I8SA 3AWDA 3VZBA 3ZHRA 4F2WA 3HNRA 1BMQA 2KLBA 3QJYA 1S96A 3F5QA 3GLHB 3B2NA 4NF2A 2YFYA 4HEHA 1OROA 1CLEA 3CTMA 2A67A 1U6KA 3HZOA 3MG9A 2AS0A 3FY4A 4HN4B 4PX9A 4NMMA 3V1NA 2YINC 4BYMA 4DLPA 2Z3ZA 1C2YA 3V7UA 5DWDA 5LBUA 5TPWB 5B55A 5FBLB 3AF3A 3K9BA 4BNUA 2ECPA 2WWRA 4G0WA 4TZ6A 2I54A 3CYFA 2F1JA 3PE6A 4TSRA 5F23A 2CDBA 2P75A 2BFFB 3AL2A 5DO9A 4ZALA 1DRWA 1N3IA 1P2SA 3HG7A 4AXBA 4J2HA 1NSYA 3GZ4A 1URPA 5JDIC 4S1OA 4UAJA 5G4KA 5DH9A 4MYHA 5FOVA 4C4AA 3MMZA 5JAUA 3OCVA 3QVMA 2R8BA 2IPXA 3IUEA 4NNOA 3OZ7A 5BNWA 2B36A 1RYZA 1JIJA 3LTEA 2OK8A 1KMHB 3T15A 5LQAA 2IKQA 1YBVA 3DDCA 3QFSA 2FX2A 3KVRA 1VLHA 2J9YB 4JQZA 4KXNA 1ODKA 1XRLA 1RQNA 1Z6XA 2JJ2A 4MRSA 1H66A 5ANRB 3E18A 4O25A 1T3ZA 1UFQA 5EWLA 4V02A 1ZOSA 3TMYA 4DLBA 1DXHA 4D8VA 4KQ1A 1Y5MA 4IILA 1YCFA 1DX9A 5AKIA 1SNYA 3QE4A 2BGTA 2ZBDA 4P58A 1P4AA 5HJEA 2BFCA 1NFRA 3GRVA 3LG2A 3OPYB 2C42A 3VVMA 3EVDA 1TCUA 3GAFA 1PS0A 5WRFA 2IYNA 1P0PA 2XUIA 2PUJA 1PGPA 3QUSA 3DB2A 3TCNA 3LHFA 4F45A 3MGCA 4FX5A 5B4TA 2ZRLA 5KQSA 4OXIA 4HLNA 5K51A 4DDMA 4K6CA 3HJAA 2VOJA 4I9UA 5DHSA 1RHRA 4OHRA 1HFKA 2HZ7A 2XWQA 1KEZA 2AF4C 3L41A 1H8HD 1H2YA 1YFKA 3HA2A 2HA3A 1ULBA 3L7YA 4RPCA 3RS3A 3RYCB 2FFAA 3QSGA 2HPZA 3E7XA 4LXIA 2O1EA 1ND5A 2WAOA 5HCNA 2VP3A 3LBNA 2Q7DA 3TGWA 1U9ZA 3UOAB 5BV2P 2YIMA 2CBZA 5BV8A 4F4FA 3L7OA 6CHYA 4NPAA 3H4IA 4H15A 2XTJA 1P1FA 3GGDA 4I36A 4YY3B 4NK4A 1NBWB 3A9CA 4ZPJA 1VPEA 3AVQA 1EGQA 4RA9B 4IMJB 5LB4A 4GR9A 3IH5A 4QQNA 3LYUA 3EVAA 3I76A 1RLMA 2VEDA 3P5BA 1DFIA 2HHAA 4DZTA 2HSZA 3BDIA 5IFKA 4NIMA 1N5LA 5CM8B 5H7XA 2EQBA 3IGFA 1W76A 2W2MA 3R9WA 3G9QA 5AKGA 4A1OA 1E6MA 4A0HA 5H82A 4I55F 4ABYA 3O93A 3EXIA 3BWEA 3C45A 3MELA 4ZK2A 5JCOA 4YLGA 5DTIA 4IFTA 1R3UA 2I6UA 4YXFA 1BGXT 3O31A 2PLRA 4LHWA 4NZPA 4R2LA 3WGLA 3KQHA 3DVSX 3JTMA 4HEJA 4Q02A 2POCA 1NXPA 3UJBA 3A9UA 4DSOA 4EX6A 4EX7A 3UICA 2HTFA 1AK9A 3LWBA 3WSWA 4JJ6A 5KHAA 4JZKA 2ENUA 1KH2A 4YK7A 4BUZA 2ATVA 3LY8A 4UTVA 2ZWPA 1XJWA 2H2DA 4BE7B 4NHEA 3BZWA 4O1IA 4BO6A 5LSAA 1P81A 1YCHA 1TVKB 2IL1A 1I2DA 1O97C 1V0JA 2AVNA 3KU1A 3QEMB 4HH4A 5DBGA 1U0EA 4HDSB 4AURA 2GM5A 4MDFA 1ZNZA 3R6DA 4AD8A 1DKLA 1NYRA 3L9WA 2W37A 1FBTA 1PJBA 1W30A 1YBMA 3IR6A 3L1UA 1KI2A 5A1JA 1XYYA 3M2PA 2GDZA 3ZWWA 1Z3IX 2DWPA 4MO2A 1IAQA 1SKBA 4A0GA 1X15A 1T8UA 3H17A 5D5QA 1QANA 2PQ0A 3OECA 2Z5GA 3EDYA 3K5HA 5HRAA 4BZQA 5HJ2A 2BF4A 3OOEA 4WBXC 1AMNA 3BB4A 3FYTA 1N2ZA 2WAMA 1TFUA 1NBME 4DFDA 1Q0RA 4M86A 1YZLA 1QCCA 3DBVO 3FROA 2C5GA 2IKSA 4NENA 5EESA 3SQMA 4JP8A 2QVYX 4NCNA 4AY3A 3QVOA 1D2HA 1ZFNA 2YJZA 1GTL1 2DPXA 1M7BA 3EFBA 5BN5B 1SR8A 2AYYA 2EZ4A 2GBGA 3DO5A 3ZDRA 2PGIA 3VNRA 4DCPA 1AKNA 1VXRA 1XDDA 1YJXA 1ZJ5A 3FVTA 4HLQB 3K2EA 4KAAA 1GGJA 4QQKA 3RROA 2QTTA 3V8RA 5M2QA 4DS3A 1G9XA 4Z3KA 2NYRA 2R6DA 2VH1A 3JVVA 2PO5A 3UG6A 1FVHA 2C2YA 3T0GA 1P0FA 1PWZA 1ES9A 4MW9A 4N1AA 4V3CA 5EXSA 2G04A 3RVKA 4B85A 4KFCA 1B8UA 3G13A 1QKJA 2IZ1A 4PZPA 4ZREA 2X5XA 4E08A 3ADBA 2Y76A 5IK2D 2PSHA 2JAHA 2A1UA 4UBIA 4G1UC 2HK7A 4JXZA 4EPWA 2H1OA 3IV7A 4KIWA 5JRDS 2WVGA 3USZA 3VX4A 1H4TA 2XNJA 2AZ4A 3SHOA 2Z9CA 5EZSA 3IVAA 4EGFA 5F98A 2BJHA 2WFZA 3U3KA 2ZI6A 1T4CA 3UK1A 2AD1A 3LC7O 5E95A 3BXGA 1GGVA 2O3RA 1JEDA 2OGWA 4LKRA 1VRCA 1P7VA 1JMVA 1CDDA 1N2CE 2G1AA 2NM0A 3AINA 5E6RA 1TGYA 3ZCTA 5ITZB 5HFJA 2X23A 4LJKA 2ZUUA 3P9PA 2V65A 1M8FA 1NW7A 1QQ6A 3DR3A 4KDCA 2WWGA 5AO9A 5LVAA 4CR8A 4HXGA 1WZEA 1ZJZA 5IKXA 1O5TA 5E8JA 1LH0A 4BMCA 3CNHA 3K35A 3R09A 4BNWA 4X20A 1GLNA 1ZICA 2EBWA 2O8FB 5ECGC 4EY3A 3UENA 4B32A 2J31A 2FPPB 2X0IA 2ARKA 3NC1C 4NCXA 1JLRA 2OEPA 3GHYA 3B5EA 3Q1LA 4EG3A 3U56A 4G36A 3NOXA 2BEKA 4RF2A 4CMIB 3ITNA 1CFJA 1SFRA 2XE6A 1K3FA 4NBWA 3VKWA 5KWVA 2A9FA 4XOUA 3AP1A 3DZBA 3AERB 3LPLA 1XVUA 2NV2B 1UJNA 2OP0A 2BSQA 1I6MA 4ARIA 3BIFA 3WK8A 1ADJA 1M6HA 4YMVA 1WX1A 3JS5A 4ZV9A 4B2IA 1BE6A 3FYHA 1HE3A 5LL6P 5FNVB 2VJAA 2RGYA 4ZT2A 3HEBA 1I4LD 3K8QA 2P7HA 4QOFA 1QP7A 3ZCSA 1A4RA 1J8QA 5AVZA 3IOBA 4NH0A 2G67A 1X7XA 4EENA 2XGJA 3H1EA 4G41A 4PCLA 3C7DB 1Z4JA 4R54A 3EBPA 4RV9A 1SGWA 1KI9A 1KYWA 3LK6A 4UKDA 2XMSA 3WBBA 3ND9A 4U7PB 4P1ZA 1ZJJA 3ZY4A 2PUHA 1PYGA 5G53C 4AJLA 5AP9A 1QB7A 1S5PA 2W0MA 2WLTA 3EW9A 1TIBA 3LYAA 4RF5A 2IC5A 2C4UA 5I7EA 4MTCA 3ZWCA 5IULC 1J90A 3THWA 2I9KA 3KC2A 2Z57A 5AJVB 3FMGA 4M0UA 3FJ1A 3EYWA 4I3GA 4M2LA 4NCKA 5DI3B 4ROSA 5EE3A 4E3ZA 3FTDA 3IPXA 3GELA 4AL4A 2QEQA 5DW3A 1XRQA 4Q03A 4Q1AA 1ZSNA 2G06A 4HEA6 4C78A 1HETA 1AXGA 2VF2A 4IDHA 2F9LA 4AT1A 4FYIA 2IHNA 2AIRA 1I6KA 4E2YA 3FPGA 4BNDB 4RTPA 1PZHA 3QU4A 2CMFA 5F33A 4QGFA 3WLSA 3WGIA 1UJ4A 4EG1A 2VUSA 1W59A 5I7RA 2PGXA 3TWOA 3RVNA 1SUAA 1C7IA 1RFGE 5TE9A 1UIMA 1CR6A 1K88A 4L2IB 1IL0A 5FFNA 3ZD9A 5B7QA 1JR4A 1U8AA 3WGHA 1SVNA 1F51E 2CVPA 1K5HA 2R8RA 3L0ZA 2OSVA 1EEHA 1PN3A 1Y3AA 2PXHA 4IDFA 1XI2A 4HT3B 3IDQA 4QM6A 3CLUC 1VE5A 1KXJA 2WYHA 3OT1A 5A05A 2ZRKA 1DIHA 3ZZ1A 1UMDA 4ABTA 4BRUA 4FEGA 4D5EA 3DYBA 4Q0MA 4MUFA 5AKEA 4DHEA 1P5JA 2GM4A 4U9UA 3IAEA 4YRJA 5JMPA 3AI3A 5EUQB 2JLYA 1RAAA 1UM9B 2CJPA 1UK7A 2H4HA 2IZ7A 1T24A 3E9ZA 3DMDA 4OXQA 5CGQB 4A0RA 1O9HA 1ORRA 4BMZA 4YT2A 2V5VA 4ACBA 3H6GA 3FBGA 1M34A 2PANA 3VPFA 3K92A 4ZGWA 1ONOA 5BR1A 1PNQA 2EDCA 5F2KA 3PX3A 1C7QA 3KJZA 3LCCA 4BLTA 4EB6A 1KDYA 4G0UA 4S1TA 1YL7A 1T2AA 2NTEA 4KQMA 2NYVA 5F1OA 4BO8A 1GTZA 1H6DA 1NQUA 3IUJA 2GN0A 2I8CA 4GPTA 4DUYB 4AW9A 3K0FB 3PKJA 1J22A 4GSYA 4WK6A 1UT8A 3SY8A 4XPIB 4QPPA 3OUUA 1MRZA 1HFWA 1TK3A 2GN6A 4FN4A 4TLLB 3UM9A 4Z7QB 1X1AA 4MVWA 1R9GA 1LA2A 3UJHA 1ADGA 3NAGA 4ZDWA 5E7JA 1G1AA 4K0RA 4YGXB 5FPKA 4D9BA 4N8SA 1FBNA 2QL7A 3MWFA 4WDRA 5C52B 5I5GA 3VOAA 5FLXA 4GXTA 1AHIA 1UDAA 1JF8A 4RQUA 4DNPA 4QX6A 3U16A 4IEIA 1DCFA 1FSGA 5I8ZA 1JECA 3VHLB 1G16A 3FTPA 2LV8A 1GAWA 1U2DC 2WT8A 4MVJE 1QG2A 1NVDA 5DVZA 3S7ZA 3GLSA 3SICE 1OAKA 2Q5HA 1XEWX 4GEKA 3CS3A 1KKLA 4EUSA 3RKSA 2ISCA 4C7MA 2DFNA 2P9JA 4B17A 5AW6A 1R0KA 1P7CA 4NCHA 5EFZA 3FHCB 3WGVA 1SKYE 1NVEA 2PIAA 2VYQA 3HY6A 5CH3A 3RHTA 2O0LA 2VRCA 4U6SA 4Y0NA 3MLEA 2R1VA 4R9SA 5HMMA 3FI9A 4A36A 1GJRA 1GKUB 1GZSA 1FC0A 2QNBA 3R6LA 4OFWA 2H08A 1ADBA 1ID8A 2HMAA 2FUEA 4Q4JA 5FAKA 4IW3B 5BT9A 4EATA 1X94A 3W5IA 3RIMA 3K09C 4GBED 4YAGA 4BB9A 4D99A 2JFUA 4FYWA 3T7AA 1N0VC 3CRNA 3L06A 3IVXA 4LSMA 1GY8A 4QUIA 4DHWA 1I94B 4P32A 4FGJA 1MPTA 2PX8A 4F4IA 1CZOA 3LQYA 1ELOA 1LC3A 4KAFA 3GNQA 3NHYA 1KPHA 5FX2A 1CUXA 1JDSA 2X1LA 3ZJ5A 2J48A 2OCKA 3C98A 2BCJQ 4N7BA 4YACA 4DMMA 4ZARA 2P69A 5HEKA 4ILEA 3DKRA 3JQAD 4L0CA 3ZEAA 5TVKA 2IYPA 1JR3A 2RBEA 3O83A 3TW8A 1M2WA 1GZ4A 2CBGA 1PE0A 3OCWA 2OMEA 3H2IA 3L1VA 1B42A 3EQ9A 1R4ZA 1N7JA 4G0XA 5HM8A 2OHFA 2WG1A 4DA4A 1PZGA 1EUYA 1UXOA 2E9SA 2GBFA 4TOIA 4AIRA 2JGJA 3KS9A 3VPSA 4B81A 5KNBH 3E23A 4Y7CA 2XHZA 5HTOA 4MW6A 1NMSA 1K1EA 1PTKA 2GZMA 3D2CA 3ZKWB 5A4DA 3AKZA 2FMFA 5CU7A 2DM6A 1T10A 3OP1A 1WZ2A 2PRZA 4S1WA 2Y0EA 1QG4A 1WUYA 4ZTBA 2CL7X 3FCUB 1I0ZA 2YXPX 2XE4A 4B6SA 4ZYTA 3L8EA 5KHOC 1KZGB 1YD7A 3AB8A 2PQ2A 3T3MB 3PFWO 3WKEA 4GKKB 5BSGA 1LJUA 2A1IA 4G23A 1JEEA 5JMOA 1U90A 3AXTA 1KJ9A 1KR5A 1PT5A 3E2PA 4MKXA 1GLGA 2FU5C 3MJTA 4DDTA 2Q9BA 3TLYA 4RH3A 2LRHA 2W22A 3RH0A 3M9XA 2WJJA 3PLAE 2X9LA 4LRTB 4E1BA 1J8YF 2FZLA 1Y9DA 1DG9A 1MUUA 4RVDA 2CXPA 3FTFA 4OA5A 2P5TB 5CYOA 3PUYA 5DASA 3RYIA 3C6XA 5B7NA 5L4SA 1Z2PX 3D64A 1WMEA 2D2VA 1IIRA 4J4TA 3EXFB 1G0NA 2QMUA 4XD2A 3H05A 4O4IF 4I3FA 3O7WA 2VSQA 4QPJC 3QW2A 3AETB 3N7AA 1FS6A 2Q1WA 3ENQA 3L6EA 1NSFA 1HYBA 1GQ2A 3OUZA 1JZSA 2I29A 2OO3A 5H3LA 3TLGB 3IEKA 4K26A 3JAKB 3K1YA 1AG9A 3E7PA 4MUNA 2UZ4A 1JBKA 4XB1A 1JRLA 3O8OA 1GGFA 2VHWA 3OJOA 1F8GA 2CDAA 2BUBA 4Y2PA 5J5VA 4KWEA 4PYKA 1SA0B 2AEFA 4KW7A 1UZAA 2XGSA 5AKHA 1JEYB 2Q3BA 2ZI9A 4IS2A 3OLXA 4LOLA 2Z30A 2Y0DA 1R0LA 2PXCA 1VDMA 2O07A 3C3PA 4GC9A 3VISA 4YJ3B 4CLRA 3PVCA 4ARZB 2R85A 4KWTA 1ZRNA 4Q3OA 4LF4B 1E66A 4R83A 4QXPA 1C1YA 4KDEA 5FWXA 1IZZA 4CDMA 4Z7NB 1MX9A 5C7IO 3BIXA 1GPLA 5LP6B 4HJRA 1KMQA 3A6JA 2OHHA 3EEQA 4LVOA 2ZBQA 2AQ8A 3ICQB 3R9XA 4C0BA 4KGZA 2ACKA 4CDGA 3KB6A 3VTZA 1XD8A 2EFHB 5SY4A 1ODTC 1PJCA 1JGTA 3HCBA 4XIYA 1NPDA 3I5UA 4JIGA 1BJKA 2XDAA 4B3IA 3WS7A 3UMYA 4R8LA 2ENWA 5HF9A 3QBDA 5LCXA 2Q7OE 4BFLA 4ZCPA 5IJWA 3E5HA 5JCZA 2JCBA 3HXLA 2NXNA 2Z4SA 3W6NA 2C3YA 4DJEC 3B1WA 4HXYA 3REGA 2W2OA 4UBNA 4NRDA 1Y33E 2CB0A 3AKEA 4YRPA 2OCDA 2E6UX 1IMJA 1K6XA 2RHBA 5M5BA 1HOXA 2YWFA 5CNJA 4TKVA 4YRGA 2A5JA 4EI2A 3ZDFA 1H85A 1KAQA 1UPBA 5JTUA 2Y9PB 1U5CA 1Q1BA 4YJ2B 2GHIA 3E15A 2GT1A 2HBZA 2Q4EA 4ZC1A 3VOBA 5LM3A 4XWAA 4LPSA 5CX1B 4DLVA 3RS2A 1T6BY 3SF8A 2C20A 3AEKB 1Q1AA 2WUFA 3LFUA 1CUZA 4P2GA 4PYRA 3TLEA 3TZLA 1WCIA 4G1BA 2XNDD 1DIGA 4IQ4A 2ZJ6A 3MJVA 2NUTA 5F5NA 1RT9A 3GRKA 3THSA 4NCJA 2IX3A 1EK2A 4BFUA 4QO8A 2CVOA 4IR7A 4U4AA 1DGQA 2BE9A 2R5WA 2XDWA 1USWA 1XRPA 5I3CA 3VZCA 3DE2X 3D4NA 1RXWA 1QFJA 1M66A 2NPFA 1GPKA 1Z0KA 3KALA 1Z6YA 4A3SA 3LP5A 3NJ4A 3L0YA 1NBMD 1XCGB 2F59A 3B52X 4D8TA 1U65A 5ALDA 1MLDA 2Q6OA 2I4LA 3P2EA 4F3RA 1PUIA 4MLDA 3KETA 1RM4A 1LBTA 4OD0A 1H0HA 1Z8FA 2R96A 3EG5A 3HA3A 1ISFA 1Y7TA 4PX2A 3ZDZB 4GPZA 621PA 4ZD6A 3ONFA 3CQ9A 4P22A 2NSLA 4BU1A 3CF0A 4A5SA 2J67A 4NJMA 5BN1A 3FF4A 5KOHA 2L0XA 2YOHA 1FFWA 4DL9A 4NMWA 4C2UA 5LB2A 3I30X 4BVEA 5MGBA 1IY8A 2OR3A 2RGXA 2XI4A 3K70B 4MWBA 1AN9A 4RLFA 4ZEWA 4BP3A 4M37A 2PUFA 4RADA 2GKSA 1E6WA 2XDQA 4EWLA 6REQA 3JPYA 3PUVA 1KBQA 1CHDA 1RXCA 3V1TC 3TFQA 4DKJA 3C6BA 4ZTZB 4EY8A 1D2NA 3OI7A 1IFXA 2Q5FA 4IGEA 4QWMA 5HFNA 3ZGLA 3VZRA 5H4GA 2WIFA 3KKPA 3GT0A 1OY1A 1SUEA 5DXFA 3PZRA 3ROPA 1QYCA 3KM0A 3M3PA 4MRAA 4S12A 1H1DA 4LYDA 3U7QB 1CF9A 2PG3A 4OH7A 5CVTA 5AVVA 4PC6A 2ANBA 4H7PA 8GPBA 1ZRHA 3D3JA 2XKJE 4I5EA 1OVGA 2O6HA 4WQMA 1EDBA 4AJJA 2WICA 1B76A 3ZLVA 5DYIA 4YRQA 3AU8A 2FMUA 3GNLA 3VU3A 2F17A 2SICE 1JFVA 4Q9AA 5FWDA 3U3MA 3F8SA 2IOFK 1JE1A 1N3LA 3U40A 3COJA 1SMKA 4FE7A 5BSHA 5L3QB 5AH0A 3SK0A 2YIDA 2FWIA 5E3HA 4REQA 3D4BA 1LSJA 2BP7A 1GEGA 4KGDA 3ZZMA 4GMXA 2IYFA 2YWJA 1MIOA 4KREA 4ZDJA 4JOSA 5CCDA 2C8JA 1KXZA 1U6JA 4JP5A 1ZEMA 5H81A 3IAUA 4RVCA 3ADCA 1A5BB 3SAJA 3NTQA 2PYZA 1HTWA 3PR1A 1ZP6A 3TD6A 1A77A 1SU8A 2QMOA 4RIFA 1J0AA 2JCSA 3D7RA 1W2HA 4R05A 3G2JA 1E9SA 3O4IA 4IIYA 3VYTB 3PEWA 4N8EA 4BLOA 4RE6A 1EFVB 2PMDA 3HI6A 2CLLB 2C7OA 4J1SA 1CLUA 1GQSA 4QDOA 4DM7A 2J3QA 1BDMA 1AV7A 2BKLA 3GH3A 1E89A 1NSTA 1OSNA 2CKMA 2IYVA 3KJNA 3NG1A 1Z6GA 5FOWA 1T9DA 1XVVA 4ZZ0A 4PS0A 2W93A 4D3SA 1MPXA 3DOCA 1YFZA 3GRFA 3Q11A 2Y9MB 3U62A 1FUEA 5F77A 1MB3A 1WXHA 1CP2A 3G2NA 3L18A 2O3JA 1FRNA 1UJBA 2J3KA 5FLKA 3R3VA 3VYVA 1U3VA 1V16A 2JHCA 1TT5A 2OO7A 1DG1G 4NMXB 1Q3HA 2G0TA 3IE0A 2ORYA 4LTDA 2G7ZA 2RHLA 1GA6A 1ISHA 3QQ5A 1US8B 1ONBA 1EB9A 4JSTA 2DT8A 2WR8A 3X1WA 5CGZA 1KIFA 2AZTA 4PC2A 4PIPA 4KIGA 3W1EA 5B7PA 2UVPA 3QPBA 1ARZA 4AULA 1D1SA 4LSGA 4O29A 4R9NA 3PLNA 4RL4A 4A91A 2DKNA 4ZCMA 4S0XA 3RAFC 2C5EA 3K53A 2PPVA 1UZNA 1G21B 4YV2A 2DQKA 3W4JA 4IHJF 5AVUA 3FRJA 3ACDA 3PNSA 2FF7A 1HPLA 3ESZA 3HY3A 3NYRA 4MS4B 4V24A 3SE7A 1QO7A 1L4UA 2X3YA 5ESWA 4QM7A 1TMYA 1JHXA 2B61A 2G5TA 4J9VA 3OCJA 1BMFA 1E6CA 3E05A 4C7OB 3EWIA 4M8LA 1N9KA 1OZHA 2ACEA 1Q2UA 1OWMA 1UKZA 2YRFA 3NWJA 1G9TA 5E38A 3VJMA 4IHJA 2XRFA 3KUKA 4LDAA 2EFDB 2VR1A 2JVIA 1BHSA 3PFBA 1JALA 3AOGA 2WTBA 2QXUA 4EI9A 1E2HA 1JVSA 1L5YA 4WBNF 1HV8A 2C07A 1X80B 4K8RB 4TS3A 3Q8KA 4HX2A 4COKA 1C0EA 2VN8A 8LDHA 1DAMA 1II0A 3LCRA 1ZXLA 4DV2B 2A35A 1N5MA 4Q3CA 4Z4HA 4HDQB 4UHCA 2GK3A 3CGWA 3EEOA 4EGCB 4PW0A 5M04A 4J0EA 2OO5A 5HF5A 5JVDB 1YMUA 5HTKA 4CM8A 1LY1A 1FDUA 4B0OA 2GCPA 3NBYC 4LXUA 1QXSA 3TN7A 1BWQA 5AI9A 4ZN6A 4WBNA 4Q39A 1COWD 3QY0A 3TQSA 1GNPA 1R4AA 3AR9A 3RSCA 5JH7B 2PKQO 3FRHA 5KTNA 1J06A 2XX3A 5ER9A 3QEOA 1YI0A 3LF2A 4GLFA 3T1VA 3AR6A 4X3CA 5BVHB 4N7RA 4Y1GA 2GAAA 3PCXA 2UYQA 1ZDMA 1KAGA 1OBCA 3EISA 4MVJD 2GFIA 1JZTA 3DJYA 4PSCA 1JDUA 5KOYA 2ZJYA 3OQMA 1K8YB 4KXWA 4KR6A 2IYTA 5TQ2A 2XUGA 1XCBA 5C4GB 5EJ5A 2EHDA 1E2LA 4UM9D 3G82C 1P6UA 1W5SA 1NV8A 1E8NA 3SN6A 3I32A 1DWOA 4OJYA 2GF2A 2C2WA 3D7MA 3UYLA 3R74A 3RF6A 3BBLA 2GN8A 3MCWA 2OOKA 4K86A 4M53A 1CULC 2SKEA 4H31A 4LRUA 2IITA 1GCOA 1HQYE 2HJSA 1CNEA 2GLXA 4FJ0A 5SY6A 2IXEA 5KSYA 1UPAA 3DMFA 4FILA 4FMCF 4C7XA 2OZLB 4E5MA 3VZPA 3OM8A 1O96B 5C18A