4E14A

Crystal structure of kynurenine formamidase conjugated with phenylmethylsulfonyl fluoride
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
299
Chain Sequence
HMYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords kynurenine formamidase
total genus 121
structure length 299
sequence length 300
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e14A00
4K6KA 4W1RA 1ACJA 3HZOA 4A23A 1MPXA 2OCKA 1QIKA 1CV2A 2Z8XA 4J0DA 3ANTA 2RAUA 1Q0ZA 5AKZA 2AJDA 1X70A 2HA2A 2HU8A 5AK4A 1G66A 5EIHA 2XUGA 5HQ3A 1Q0RA 3R0VA 2BUBA 3DKRA 5AM3A 1WHSA 4ROTA 3GA7A 4X6YA 3KD2A 1KEZA 5D3KA 2IIVA 2ZJFA 2HFJA 3D59A 4X85A 2ZJ7A 3HYSA 5JANA 5LIPA 3WA6A 2HRQA 3VDXA 1WPXA 3HRHA 5DNVA 4C01A 3WYNA 1A8QA 3CN9A 1P0MA 4JYMA 3WWDA 3W05A 2HA0A 4BAGA 4G8BA 5HZGA 3AIOA 1JFRA 4LIPD 2WUGA 4QDZA 3S8YA 3WYDA 3ZWQA 5KREA 5K3FA 4QDXA 2YYSA 5BV7A 4BTVA 4HTAA 1QOZA 2CMFA 5CURA 1X2EA 1G42A 3AZOA 3N0TA 3D2BA 4J7AA 1K5PA 5LLSA 1O6FA 2WSLA 2HA5A 3HJUA 4G5XA 1VA5A 1XLUA 1MAAA 4LXIA 3WK5A 3G02A 1XLVA 4NMWA 1ZJ5A 4N5HX 5FPPA 4BAZA 2IITA 1LPSA 1JU4A 4OD0A 2FX5A 2AJBA 2R8BA 3PF8A 4FLFA 5HKBA 4Y2YA 2WTMA 1CUUA 2QS9A 2P8SA 4KR0A 1VKHA 3IA2A 1WHTA 4OSEA 4XWGA 1BEZA 3BE8A 3BJMA 1QIGA 2FUKA 5DNWA 4M0FA 1UWCA 3C6XA 5ALUA 4BVJA 5ALPA 1AMNA 3DD5A 1WPRA 1GKKA 4J3JA 2VTVA 5I8PA 1P0PA 2FJ0A 4JEIA 2DQYA 4W63A 2VAXA 5AI0A 4A16A 2O2IA 5JD6A 2K2QB 3FCXA 3I6ZA 3R3YA 2XQFA 4GDMA 4EB0A 2RIPA 1EK2A 4DNQA 2G4LA 1XRLA 4ETWA 3WJ2A 4AN0A 4C6HA 5DYWA 2XMCA 3UMJA 1ZGBA 4P08A 2VF2A 5E2IA 4I3FA 4NZZA 3I2IA 3D5EA 1JT2A 4WDQA 2OGTA 2CJPA 4X90A 4EY6A 1QIHA 3KWJA 3QPAA 3PDCA 3FOBA 5CRIA 2HA6A 3I28A 3ZI7A 4M0MA 2Y2UA 4EHBA 4L72A 2QUAA 5JATA 5EGNA 4X71A 5FLKA 2CUTA 2Z8ZA 2ES4A 4CG2A 2EEPA 5ALZA 5BOVA 4AO6A 5A71A 1PFQA 1QIJA 2WFMA 2V9ZA 2HU7A 4I4CA 4BYMA 5C8VA 1UK6A 4RGYA 1ZD4A 2AXEA 1K4YA 1ZGCA 1YR2A 1DX6A 3IURA 4O08A 3AIKA 2DCMA 4EY8A 4ARAA 3G0CA 4KAAA 1Y7HA 3I6YA 3QVMA 1MNQA 4X3CA 2ZYSA 1BU8A 5JZBA 2BCEA 4H77A 1XQVA 4XVCA 4Q1VA 2JGKA 3DYIA 2GBGA 3JWEA 5JADA 2EDAA 4CG1A 1H2WA 4G8CA 3ZLUA 2XQIA 3BIWA 2QMQA 3WKBA 2QOEA 2XMBA 3D4LA 2AJCA 5K3AA 1B41A 5CT6A 2XUKA 4F21A 1YB7A 3I6MA 2NW6A 1IUNA 2WG2A 1YAJA 3LCRA 5AKLA 4FBMA 4I19A 2QXTA 3ZLTA 1YASA 2AJ8A 2FJPA 3A2LA 3OM8A 3G9UA 1F8UA 2BUAA 5AM1A 1MT3A 1T4MA 2HM7A 3TJMA 4JNCA 1H23A 3VISA 3WMRA 3RLIA 5AI4A 4FNGA 5ALEA 1QIDA 2ORYA 5AKHA 1A8SA 1IUOA 1GPKA 3I2KA 4Y2QA 4U2CA 1AX9A 3Q0TA 4QWWA 4JUIA 3H2GA 2PSFA 4KE9A 1UFOA 1ZICA 1XZBA 3STXA 2I3DA 1IZ8A 3IUNA 4IQ4A 4PV7A 4BCCA 4LHEA 3WKCA 4L9AA 3QPDA 2R11A 2WG0A 4UBLA 4INZA 1W52X 4B83A 5HF8A 2V97A 2O7VA 3O9VA 2WLSA 2HADA 1F6WA 3G7NA 3C5VA 4JYPA 4RE6A 5E4JA 4UHFA 2JGLA 5CT9A 1USWA 1LPOA 3LIPA 3QH4A 5CW2A 3FWHA 2HIHA 3H2HA 5YASA 4WJLA 2DQZA 2VJBA 4RE5A 1E5TA 3AZQA 2XT0A 5AM2A 1QE3A 2PVSA 3CCCA 4Y2TA 1QFSA 1BEEA 5LP1A 3GFFA 3STWA 3I2FA 1CIJA 2WUFA 1CRLA 4WDRA 3WWCA 2WTNA 5BWCA 5K3DA 5HKAA 2GBIA 1W4LA 5AHXA 3S2ZA 4UBIA 5JIBA 4Y2XA 1Y7IA 3NUZA 4Y2PA 4DMCA 2XMZA 4FLEA 3GELA 1TCCA 4H0CA 2XE4A 3STVA 5FUMA 2EDCA 2Z5GA 2GZRA 3CN7A 5SYMA 1SFRA 1EDEA 2I3ZA 1OCEA 2HFKA 3E4DA 2W22A 2YH2A 1IUPA 3IUMA 2X76A 4G4IA 3PI6A 5C8XA 3EQ9A 2WJ4A 1P0QA 1ZD3A 2XMRA 3H1AA 1WB6A 1CUEA 5KWJA 4MJ3A 2GZSA 2WFLA 2OQIA 1EH5A 3FVTA 2OGSA 1EXWA 4JH0A 1EA5A 3L1HA 4X94A 4E11A 3WZLA 1UOQA 3KXPA 3WK8A 1XRMA 4PQEA 5FV4A 1FSSA 3KWFA 5ALHA 3F96A 1E89A 3SC2A 2ACKA 2HRRA 3FYTA 1FJ2A 1GZ7A 2OGZA 1HPLA 3VJKA 2XQKA 4ZWNA 3BL8A 1L7AA 2QKYA 2WIJA 5CT5A 2WM2A 2ECFA 4GW3A 3VKFA 1YB6A 3DCNA 1N5MA 5AIAA 3M3DA 3MUOA 4CI9A 2DHCA 3W9BA 2WFZA 5AM4A 3AIMA 2WHQA 1CUWA 1XZKA 1KU6A 4CIBA 5IH7A 1WB5A 1F0PA 3V1LA 1Z68A 3K2IA 3P2MA 4OYYA 4HRYA 2H7YA 2HA4A 4ZRDA 4QZVA 4IH1A 2BKLA 4K6GA 5AK5A 3VJMA 2XUFA 5A7GA 4OB6A 4PSCA 4BCDA 4PW0A 3SX4A 4B9AA 3G9TA 3ZLVA 3NGMA 1YSCA 3C8HA 1K6EA 1CUBA 2UZ0A 4P93A 1XZEA 1TAHA 4K6HA 4PO3X 4N8EA 6YASA 2LIPA 1C7IA 1EB8A 1YS1X 1AZWA 4OCZA 3ANSA 5CH8A 1EINA 3X3HA 1YS2X 1QLWA 5T4BA 3BF7A 1MU0A 5JD5A 1RP1A 4Q3LA 1XZFA 2WUEA 3EF3A 1CEXA 5DJ5A 1TIBA 3NOXA 2Q0XA 2JEZA 4AX4A 3DL4A 5FDFA 1QIMA 4Y2RA 1XZLA 3STUA 2QVBA 3C6BA 4Q3OA 1QJ4A 4DMKA 4E46A 3CCBA 4BB0A 4YASA 1LPAB 4Y2VA 4Z49A 1ACLA 4DM7A 5SYNA 1TCBA 1ZI9A 4OU5A 1DWOA 3IUJA 3V1KA 2WQZA 1H2XA 5EI5A 5LZ5A 5H3HA 2PU5A 1A88A 1TKRA 1C7JA 1ORWA 4ZV9A 1HKHA 3H19A 3QITA 4HXFB 4N5IX 4FFVA 5DNUA 3GBSA 4EZIA 2WIDA 1VE6A 2CZQA 4ZI5A 2BAGA 2QUBA 3AJAA 1W1IA 3T4UA 1ZJ4A 5AKKA 3GUUA 4Q05A 1AKNA 3QMVA 3F97A 3K6KA 2JGMA 1DT3A 1THGA 1N5RA 3DYVA 5ALIA 3DLTA 5T4FA 1QO9A 5AJHA 1JMKC 1VLQA 5AKEA 1JI3A 1ODCA 1K8QA 2HHAA 1SCQA 2VJDA 4A5SA 1B6GA 2JBWA 4K5QA 1MX1A 1ZD2P 2QJRA 2XLBA 1GQRA 2XMQA 2DHDA 3YASA 2PL5A 5DTJA 3WWPA 2E3JA 5AH0A 5LZ8A 2BUCA 5ALFA 1ZI6A 4H7IA 4OB7A 4EA6A 2DSNA 4PSDA 2CKMA 1CUYA 2QRUA 1U2EA 1DT5A 3WL8A 4G4JA 4CFSA 3H2JA 2C4HA 2QXUA 1XZDA 3F67A 1CLEA 2HA7A 3G9XA 5CMLA 5JAHA 5LKRA 1GKLA 2PM8A 3WK7A 2WU4A 4EY7A 3BWXA 3ICWA 4B81A 4PNZA 5ALNA 4OU4A 1AC5A 4MQMA 1FFDA 1J07A 5JARA 3BIXA 2OAEA 1EHYA 1WCYA 1VJ5A 2PUJA 4P92A 1QTRA 2WFLB 4BTLA 5F4ZA 1BN7A 4QLOA 2VEOA 3R3XA 3I1IA 4W1SA 2HU5A 3D7RA 4B7ZA 5IVKA 3R41A 1MTZA 1YA4A 3R3VA 4GI1A 3I2HA 1UZAA 4BP8A 1XROA 2H7CA 1FFAA 3DOHA 3DQZA 4E15A 3O95A 1CQWA 2JF0A 1XZAA 5JD4A 3AZPA 1L7QA 3PICA 2ZSHA 2VATA 4AZ0A 1LPNA 1XZJA 3VVLA 1XKLA 2G5PA 1XZCA 4GEGA 3M83A 2HDWA 2V96A 5ALQA 1EVEA 1YCDA 1DWQA 1PJAA 3D2AA 1QONA 5AP9A 1A7UA 1GGVA 1JJBA 1AGYA 4BCBA 2XUQA 3G0IA 3C6ZA 3WK6A 3ED1A 2WIGA 4BDSA 3SK0A 4C88A 2DFPA 4EUSA 4YK7A 1CPYA 4GECA 2Y6VA 4J0GA 4FOLA 2QZPA 3H17A 1SC9A 1CUFA 1Y37A 2ZYIA 1XZIA 3WI7A 4FBLA 5E4YA 5AKGA 3K9BA 5EHZA 1AURA 3D2CA 5LZ9A 3H04A 3HLKA 4WCVA 3L1JA 4AMZA 5DWDA 4UPDA 1CUZA 3V48A 4N8SA 1VZ3A 4UFPA 5ESRA 2C7BA 2OAGA 2WU3A 3WQHA 4WFJA 1DINA 1IVYA 1CUGA 5HFAA 5LZ2A 1R1DA 2C0PA 2OG1A 4YPVA 5K3BA 4J0CA 5DYTA 7YASA 1BN6A 4U2BA 4TGLA 4B0PA 3M81A 3V1MA 5ALMA 3FLBA 3PFCA 4V2IA 4LXHA 2H1IA 1J1IA 2J4CA 1OXMA 4B84A 4CIAA 3WWOA 1XQXA 1H22A 5IVHA 2PX6A 2XDWA 1MX9A 2VT7A 5KBYA 4QDUA 2CEKA 4PSUA 2XQJA 5T4EA 4WY5A 5ALTA 1R9NA 2J3QA 1EI9A 4AO7A 4E14A 1T2NA 4GXNA 4Y2JA 2JGFA 4NS4A 2ONCA 3LP5A 2OCIA 5HF9A 4X93A 1PV1A 4J0HA 4DNFA 3U1TA 3WZMA 1CUCA 4ARBA 3PUIA 1W75A 5EHNA 2XUDA 3BDIA 4KRXA 1Q83A 3QBJA 5FP0A 4QA9A 3W04A 3WK9A 2O2HA 4U2DA 2XUJA 2VQ6A 2RHWA 1K63A 2X8BA 4L0CA 2XUOA 2B61A 5BWBA 4DSAA 2PSDA 4C87A 4X6XA 1JMYA 5AOBA 3MUNA 5JYCA 4WY8A 5D6OA 3OURA 3I2GA 3KDAA 5J3JA 4PF1A 2X5XA 4BATA 4BBZA 3A2MA 3H0CA 3LIIA 2OLEA 5LKAA 1IZ7A 4DGQA 2I78A 2PSHA 4AN1A 4DYHA 1NU6A 3FCYA 3OC0A 3IUQA 3DOIA 3HEAA 5HF6A 1CUDA 2QT9A 1O6GA 5DTIA 3LS2A 1R3DA 4UFOA 4IHAA 2XLCA 4KAFA 3WK4A 2RONA 4NVRA 4QLAA 4OUKX 3ICVA 4AMYA 4DTCA 3G0GA 4IH9A 2YASA 4X95A 3HACA 1SOMA 1R50A 3FLEA 2CBGA 4KYVA 4HXEB 4M0EA 4TPKA 5AKIA 3TRDA 4K2AA 5IVIA 4CCYB 4MWTA 3M82A 1BE0A 2PKYX 1HDEA 5AIBA 4GBGA 5AI5A 1E8NA 1JU3A 1ODSA 1OILA 2QR5A 3WL6A 1D07A 4BE9A 3D0KA 2Y6UA 2B20A 4H35A 3O4JA 5ALVA 2WJ3A 4CCWA 3FLAA 3CXUA 1MNAA 2C5FA 4CCYA 1R4ZA 3WKDA 3WIBA 2AJLI 1QFMA 3F98A 4WFKA 4FDMA 1QTIA 1XZGA 2RHTA 2XMSA 2WUDA 5JZ9A 1UOPA 3FSGA 1CUSA 3BF8A 3H2KA 1KU0A 1EB9A 3BDVA 3HI4A 4FWBA 5C81A 5IVDA 4KAJA 3F9CA 4Y2SA 4MWSA 3QMMA 4QDTA 3AFIA 4Y2UA 1DQZA 5JAPA 1G4HA 2GYUA 5D7BA 4WFIA 4DNOA 3C8DA 4BVKA 2J3DA 1CFJA 5AM0A 4IH4A 3GZJA 3D3NA 3F8SA 3FYUB 4OPMA 2B4KA 5E4TA 1DQYA 4H7FA 2ZSIA 5AO9A 3DL7A 1LPMA 3FSGD 5D3ZA 4OB8A 1LPBB 3UUEA 5JAOA 1LNSA 1VE7A 4H7EA 1BROA 4J0IA 2PPLA 4ZGBA 4RNCA 4F0JA 1QIFA 1U65A 2ACEA 2YXPX 2B9VA 5A6VA 1FFCA 3IBTA 4QE3A 4AXBA 5JAUA 3L1IA 2D5LA 4LYEA 1XRRA 5A62A 1CUXA 3KSRA 1EDBA 3PFBA 5K3CA 2BGNA 4EBBA 3U0VA 1M33A 1ZD5A 4HAIA 3A2NA 1XLWA 5EFZA 1YAHA 5AK3A 3B3QA 4UBMA 3G8YA 5HCUA 3WA7A 1EK1A 1LLFA 4UBNA 5HK8A 1QIIA 2ZVDA 3BXPA 4MEAA 1TK3A 2VT6A 4QWMA 2Z3WA 5ALDA 5CXUA 3VJLA 4ZREA 1LZLA 2XI4A 3QYJA 5K3FB 1HL7A 3I2JA 4AQDA 3FBWA 3DDUA 1E3QA 1VXRA 2PSJA 1SCKA 3IIIA 1Q84A 4GHWA 1L7RA 1UK7A 4P9NA 4UBJA 1UK9A 2WIFA 1YA8A 4X92A 1FFBA 1TCAA 4HZGA 4MEBA 4UBKA 2XUPA 1BRTA 4DMFA 3C45A 2PU7A 3I1YA 4L3WA 4Q3KA 1ZI8A 3ILSA 5AKJA 3EBLA 1LGYA 1EVQA 4MQLA 4AB1A 3UUFA 3ESAA 2O7RA 1MN6A 3O4IA 1GT6A 2QJWA 5AICA 1BCRA 5LZ7A 3QM1A 2WKWA 1U4NA 3OG9A 5JALA 1ETHA 1TRHA 1LBTA 2Y2VA 4Q82A 4C4ZA 3DS8A 1A8UA 5HK9A 3V1NA 4W9RA 4J03A 2PBLA 2HL6A 1VOTA 3H18A 1E8MA 3T52A 3R3UA 5CH3A 1WB4A 4LXGA 4QDOA 3FAKA 1MJ5A 2G5TA 5CT8A 5FRDA 2OCGA 3QMWA 4ITVA 4KJXA 4W1PA 5CTAA 2VSQA 1DWPA 5ALYA 3R3WA 1XQYA 1MAHA 2WG1A 5A2GA 3HABA 1DU4A 1LZKA 4UBOA 4BC0A 3JYHA 4X97A 1JJIA 3GROA 4BZWA 1U8EA 4QNNA 1E66A 2W6CX 1UXOA 4N8DA 3WL5A 5JASA 1R9MA 1MX5A 3B12A 5EIAA 1J2EA 5FPQA 4DNPA 1RYYA 3C43A 4BRSA 1LPPA 1NX9A 3IB3A 2RI6A 3RKSA 4RPCA 1XQWA 3C87A 1JKMA 5K3EA 3C6YA 2HA3A 1GXSA 3RM3A 1H2ZA 2WHPB 1CVLA 5T4HA 4C4XA 4HRXA 5IKXA 4DIUA 2Z3ZA 5JZSA 1W76A 3QPCA 1UOOA 2VJAA 4H7JA 2ZJ6A 1X2BA 3AUKA 2OCLA 3LLCA 5CH5A 4UHDA 2XUHA 2VA9A 4B80A 5K5EA 4KEAA 3VVMA 3C5WP 1EDDA 1ODTC 5CT4A 4G4GA 5AOCA 2WILA 5AK6A 5AI6A 2GYWA 3G9ZA 3C70A 1R88A 4CG3A 4FKBA 3IULA 3ZPXA 1SCIA 3W9UA 4H7HA 5ALKA 5DLPA 2JIDA 1CUIA 4W1QA 4Q34A 3MGAA 3FYUA 3WL7A 1UT6A 5DYYA 2I03A 4MXDA 3NWOA 5C7YA 5AOAA 3H2IA 4FLMA 4HVTA 1VXOA 2QM0A 1I6WA 3R40A 2CB9A 5HQ3B 2XUAA 4HS9A 1CQZA 3WLAA 2OXEA 1N8SA 5CBKA 4X6UA 2DR0A 5ALGA 1ZIYA 4XJVA 3ESCA 5ALJA 3W2TA 4OYLA 3G0DA 5ALOA 4G9EA 1WM1A 1HLGA 1N1MA 1XKTA 4DMHA 3E3AA 1UK8A 3KOOA 3STTA 1W6RA 3HXKA 2G63A 3BJRA 4G9GA 4U2GA 2JGJA 5ALLA 2C5GA 3WJ1A 2VJCA 1ISPA 2C58A 5ALRA 4G8DA 1G5FA 4GLBA 3TGLA 1XRPA 3PUHA 1IMJA 5EHQA 5I9IA 1F0NA 3W06A 3IDAA 2PUHA 4UHHA 1DX4A 1GPNA 3FNBA 4XIIA 5EHXA 1EX9A 5KWIA 1TQHA 4U2FA 4BRZA 4LKOA 1WOMA 5LYYA 1QZ3A 5ALSA 4KRYA 3DKKA 4KE7A 4KE6A 4QEKA 4J0KA 1AUOA 4HXGA 1ZIXA 4X00A 1J06A 3ESBA 3HC7A 4BP9A 4FTWA 4TVKA 2PSEA 5LZ4A 3E1GA 4BZZA 1H2YA 2XQGA 2JGEA 4BDTA 4S0XA 2GBFA 1JJFA 2DHEA 3H1BA 1UKBA 4B85A 5FXMA 4B82A 3RARA 3AINA 4DSZA 4J0JA 4GWLA 3FVRA 4Y7DA 2Y1KA 4H7DA 3TEJA 4BVLA 2XB6A 3DNMA 4B9EA 2JGIA 3EQ8A 3EQ7A 3WKEA 3IVMA 4KACA 2H7XA 3O9MA 1LBSA 3SWWA 2C0QA 4F5ZA 4F60A 2ROQA 1ORVA 1XRQA 3Q8WA 1XFDA 1ZOIA 3JW8A 5AKYA 5AKXA 4B0OA 2QTBA 1HQDA 5FKJA 1HBJA 4C4YA 5ISMA 1E8DA 2XMDA 5HF5A 1UKCA 4FHZA 3O4GA 3N2ZB 3B5EA 3PF9A 1UKAA 3A70A 2VAVA 2XUIA 1P0IA 2WIKA 5ALXA 2ZYRA 4X91A 4FMPA 2H9YA 2JEYA 4XX1A 1RWQA 2OQVA 1CUHA 3A6ZA 1THTA 4D9JA 1MO2A 4X7BA 4U2EA 1FFEA 4AZ3A 2WJ6A 5CXXA 4H18A 1GQSA 1VA4A 2GBCA 3ZV7A 4BAUA 1XZMA 3RK4A 5C8ZA 4BC1A 3DEAA 1BCSA 1QIEA 2O2GA 3O0DA 4UUQA 1S8OA 3OPMA 2V98A 3MVEA 4YX9A 2XMGA 2RGUA 4MYDA 3R3ZA 4Y9SA 4DLNA 2ZYHA 5I7UA 3O4HA 4H7KA 3PE6A 1BS9A 1CUAA 2IX9A 1CUVA 3STYA 4EY5A 3ESDA 4LYDA 1QO7A 4UHBA 3DJYA 5A7FA 3WIOA 3EIOA 1AQLA 1GPLA 1DTEA 1QGED 1NU8A 4AO8A 2WHPA 2BGRA 2GYVA 2D0DA 3QZUA 4BE4A 1CR6A 5AI8A 4MYSA 4UHCA 2J4FA 3AILA 3WKAA 5EIEA 4EY4A 3V9AA 1C4XA 4G1FA 5A7HA 5ALWA 2BJHA 3HSSA 3VXKA 4FNMA 3WWEA 3FYUC 3OOSA 3G0BA 4UFNA 4B6GA 5AI9A 2OPHA 1VZ2A 4FFWA 3OTQA 3E0XA 2WHRA 1CUJA 1XZHA 4ZXFA 5FOQA 5AM5A 4UHEA 4C89A 4ZV7A 5HFNA 1XRNA 2BFNA 4KE8A 4IO0A
chains in the Genus database with same CATH superfamily
3NM4A 4BO5A 2R5NA 2ZIWB 3RKRA 3GLSA 1JKXA 2JJ1A 3STHA 2F1OA 1SURA 2PZFA 3FGZA 3H11B 3GVXA 1UDBA 4L4SA 1HKUA 3OU6A 4A82A 3GPLA 3HZOA 2B2XA 4PLTA 1W0KD 2BKUA 2RARA 3MAJA 4CEIB 4HLDA 1J9GA 1NSFA 2Y68A 3HKEA 2Z8XA 1KETA 3MJRA 3AR5A 3NBYC 3VVBA 1Q11A 2W6JA 3R6WA 2ZRHA 3X1WA 3ANTA 4EFMA 2RAUA 1RHJA 4HWRA 4E0BA 3QHQA 1NE7A 1UM8A 1BD4A 2VT3A 3FSRA 3H3FA 3Q7TA 3Q98A 2LBPA 4RY9A 4AZWA 3L4BA 4FJ1A 3CUYA 1B14A 3NBFA 5BT8A 5KTTA 1UINA 2ZVPX 2XUGA 3S1LA 1GZSA 4YCNA 3MJ4A 1A2QA 1BWRA 2BUBA 4EB6A 3N75A 4HLCA 1Q3HA 3DKRA 1XU9A 3SJCA 4YUZA 1E9EA 5ARCA 3I8OA 2GZMA 1PYGA 2GFIA 2EZ9A 4QC2A 3OHPA 4WFQA 1PJCA 1KEZA 2V1UA 3MD0A 2I9KA 4KXXA 2WF5A 3RK1A 4F3KA 3ZZMA 3D59A 4HJRA 1BMFD 2LCFA 2C83A 1JIJA 2ZJ7A 3HYSA 4P81A 3WMXA 4M8LA 3TLCA 2PGNA 2I4OA 1L5WA 1D7OA 2IGBA 2Q8NA 2TMYA 1F3OA 3HRHA 4IS2A 3RHTA 3WYNA 5I7EA 3A9WA 3LT5A 3OOJA 4IIJA 1LDBA 4JYMA 4MVJM 1RAIA 3HI6A 4M1EA 2IFTA 2YIVX 1X86B 3T9DA 3ZDZB 1JFRA 2FW8A 4DM3A 1W25A 2WUGA 5I47A 2C9BA 2WYVA 1UODA 4PYMA 5FBQB 2ZUFA 1YL6A 1S2OA 3KPUA 4QDZA 5FPHA 3S8YA 3MB8A 4O33A 4Q1CA 1EHIA 2OXFA 5K3FA 5BW4A 2E5LB 4QDXA 4NH4A 2YYSA 4R1SA 2EERA 4XYEA 1YZ3A 1YE3A 4HTAA 2BV3A 2I6GA 4F56A 1WO8A 2QP3A 1N6PA 3CSUA 3LQQA 3PFHA 4N49A 4UEKA 5BWLA 2DMRA 5CM9C 3WTBA 1ZP6A 3D2BA 3NO4A 3MPOA 4MKHA 4TV9B 1XXLA 3SYLA 3PVZA 3T7JA 5F64A 3HJUA 1RC0A 1WSDA 2EKQA 2HLDA 4KW7A 3V2HA 1ZUNA 1VPWA 2FN7A 1VA5A 1F60A 1AY0A 1PT6A 1NNI1 3C7KA 3D8NA 3PUKA 4G0ZA 4IHQA 1J2UA 2CLFB 2HOQA 2YHBA 3L8EA 5U1PA 3LUBA 1Y5IA 1EK0A 3UXEA 1R18A 1YFKA 3CPHA 5FPPA 1VHWA 1JU4A 1O6BA 2FX5A 1D0SA 2IYOA 3PDIA 3TNFA 2H4HA 2W8BA 3NPAA 5JCZA 4GF5A 1ABEA 1I3MA 2AOXA 5KQRA 5AMXA 3QX9A 1CUUA 2ZZNA 2QMZA 4JFRA 2Q4TA 4WNCA 2SKEA 4G1UC 5ETJA 1BEZA 2O48X 1K7CA 1PJLA 2IY7A 4NBVA 3D3JA 4IDDA 3BJMA 3ME5A 5JXIA 1QIGA 2JCXA 2RAPA 2FUKA 3KZ1E 4WLOA 3SSAA 3U6KA 1TZCA 4M0FA 1JP7A 3LECA 3H9GA 3Q7RA 4LYGA 1RS0A 5FWYA 1A5AB 3JV7A 1GR1A 4PG4A 4TS4A 4TSFA 5ALPA 2WB4A 1DJQA 1N2EA 1J97A 4BVJA 1N2IA 3DD5A 1BQ3A 2IYXA 4JJIA 5C8YA 3T9BA 1Q17A 1OWOA 1RPNA 2GO1A 4AY2A 2ZI7A 1H0RA 3DV2A 4W6ZA 2EU8A 4TYWA 5G1OA 2YZGA 4OJMX 1IXYA 3ZQ4A 3FOZA 2F1HA 3CW2A 3Q3VA 2Y0EA 1U8CB 3A6DA 2JH8A 2FJ0A 4MQFB 3TVDA 1X13A 1VMEA 4W9NA 2FZWA 3UB3A 5I8PA 3K2EA 1MG5A 1G17A 4ABYA 4NBLA 2C82A 4YR9A 3GAZA 1DJMA 4YJHA 3ZCRA 1PYDA 2NZVG 3D8UA 1T2DA 2UU9B 2IYUA 3D4PA 1ONBA 4XIFA 2O2IA 4GSYA 5L6MB 2PVCA 1UR5A 5JWHA 4BFZA 1B0ZA 1QH1A 1P7CA 3FCXA 4OTZA 4V2UA 5ED4A 1T8PA 2FPWA 2VPIA 3BHNA 1HNNA 5A4KA 2RB5A 5DNAA 2ACWA 4RHCA 1NXPA 4OG2A 4GDMA 2RIPA 3ZHBA 4QTXA 5TQ2A 3N70A 1M10A 4H16A 4ZTUB 2Z2JA 1PR6A 1EFDN 1B15A 1Y7TA 2GCNA 2AQ8A 2BR3A 5LOVF 4UATA 2G4LA 1J8FA 3EXFA 1X1SA 3JQFC 1GRRA 2FFAA 1G6HA 3RB8A 3ZK9A 5HP4A 3ER8A 4AN0A 1DBPA 2BONA 3FPCA 1W2HA 1D03A 2PKEA 3K1TA 3GCGA 5J4KA 1BXRB 3KZVA 1WEHA 3NKLA 3MWGA 3UMJA 4DIOA 4E1AA 4NMMA 4FX5A 2L18A 1PBTA 1SZDA 4UOQA 5CCDA 4I3FA 3RAGA 3UWOA 4NZZA 2H2WA 3I2IA 4WERA 1KRHA 4MR8A 5CYFA 2VRBA 3I8SA 4C7KA 3UF0A 2X2FA 4XUDA 1IULA 1JFTA 1AH2A 2YOHA 1LTQA 2I1WA 5IBQA 4PCVA 4X90A 4WV3A 4OHWA 4U3JA 4O4IA 3SJAA 4POAA 3T0FA 2RGWA 3TGWA 1BKSB 2VH1A 3I32A 4PG7A 3BWCA 2HA6A 4H31A 3ZI7A 3Q3HA 4D0SA 2XXBA 2IYSA 4M0MA 4OI1A 4PC6A 1NVFA 2V8BA 1KRWA 4EHBA 4CBVA 1HZZC 2PGDA 1ZH4A 3OF2A 4PICA 4ZDJA 3CIOA 1RHUA 3L6RA 1NF3A 3AM5A 1SZCA 4OLFA 1V8FA 2P2GA 4YBRA 4F97A 5B6PA 4RGBA 5JATA 5JPCA 2ZJZA 3V8BA 2AN1A 4DCMA 1JHPA 4FC7A 3UM9A 4BLTA 1JE0A 4ESHA 9LDBA 1XNRB 1NUPA 2IYPA 3RS9A 1J0BA 1BXRA 2WKSA 5JS7A 4YRNA 1EFVA 4TMXA 3U13A 1KI9A 5K8IA 2PS3A 3N8GA 5COAA 2I6TA 2QTVA 4ZP1A 3SM9A 1O03A 2WFMA 4IYJA 2V9ZA 4BYMA 1ZD9A 1H2EA 1RXYA 3D8RA 3OE7D 3F7TA 4LJSA 1UK6A 1ZD4A 2ODBA 1W5TA 3COSA 3WO1A 2LIVA 3DGFC 4O4IB 3O8QB 1SA0A 3ZWOA 3UV3A 4N7RA 4IEEA 4RH3A 3NHAA 5F5NA 4XD7A 3RS3A 5JSKA 1K4YA 3OQIA 1BCSB 4DVJA 1FMTA 1L5MA 2NO5A 4F91B 1E9FA 1P33A 1Z7WA 1TD9A 1C1YA 5K3OA 1ZGCA 1DX6A 2GCPA 1NKTA 3ESQA 4KQ2A 3LUDA 3ENKA 4EO7A 3VH4A 2EQBA 3PNYA 1II8A 3G0CA 1QVRA 4E4YA 2QRQA 1Y7HA 1E18A 2WJJA 1EQAA 4WESB 1BVHA 5CPBA 4BO9A 4G85A 3WLQA 1VI2A 5I6DA 4N5DA 3LF1A 1ZL2A 3H99A 4TXJA 4XD2A 4FM9A 4X3CA 3FPHA 2ZCVA 3KZMA 4B33A 3FCSB 5KOHB 3C3EA 4YFYA 4H77A 4MR7A 1MT0A 1TVMA 1XQVA 1GGMA 1SUCA 2E87A 3DM5A 4BP3A 3PIIA 3DYIA 5DIFA 2GBGA 1OYVA 4BX8A 2B1QA 1UBEA 4KNWA 1UC5B 3NBMA 4F9FA 1OXXK 4ZHQF 4C0JA 3E9QA 2ON6A 4FGSA 3TIXB 2Q41A 4B48A 4G8CA 3ZLUA 3SLKA 1O9HA 3NBQA 5CA0F 1ZRMA 2VP5A 2XQIA 3BERA 1FSPA 1IJEA 2E6UX 3BIWA 1O0BA 3KC2A 4UEWA 3V8NA 1SUSA 3PRKE 1WV0A 1T1IA 3A06A 3WKBA 1P6QA 3ZJUA 3IEKA 3ZDAA 4UU1A 2AJCA 1UBFA 3IQWA 4YP6A 4BX2A 1BKDR 1WDMA 3QBEA 2KPOA 1G2QA 4MUMA 3UJ6A 3LQFA 4YLGA 2GZHA 2XUKA 2Q3LA 1NFQA 3G5TA 3GNQA 1OQAA 3JWGA 4Q9AA 5DLDA 3WLHA 421PA 5MN6A 1ZCAA 1GUDA 1YB7A 5CEFA 3LT0A 1ZSYA 3E8XA 4CKBB 4G07A 4RSRA 3ROZA 2NG1A 5BSWA 3LCRA 4AJ4A 4DPMA 2ZM6B 1AT1A 1FDOA 3PC3A 4FBMA 3TVYA 5LA6F 4BJ1A 3DAOA 3ENWA 2J08A 3U56A 2ZANA 5AWFC 1W5FA 3GZTB 5LCXA 2VHUA 4TVSA 2C94A 4L1KA 4LCBA 4LGYA 4R3UC 1QJCA 1E9VA 2J87A 1UWVA 1Y42X 2HQ1A 3PFIA 1SH7A 1UMDB 2F1JA 4GVLA 4EDHA 2YDXA 3RV3A 3NTRA 1WBJB 2BUAA 3PSAA 4FYYA 2L69A 1NVAA 2HSZA 1MT3A 2AQHA 4Q03A 3KKKA 3IE2A 3IVGA 3S28A 2JB9A 1Y8ZA 1I7PA 3P0JA 2HM7A 3AR6A 3TJMA 3ZCXA 3OCYA 3IHTA 4PQGA 3VISA 2KE5A 2O3QA 3GEGA 1TNDA 1Z0JA 1KIFA 4K1XA 4OIMA 3S1AA 3LWBA 4S12A 3SIRA 1JHQA 5AI4A 3X2SA 3WSTA 1XYYA 1BG6A 2ICAA 5ALEA 1K7SN 4E7PA 3BCUA 3GDOA 4Z99A 1GJRA 1MQAA 2BKAA 4EPXA 5L4NA 2PZMA 4FFSA 4O4LF 3N2KA 3BL6A 4AVYA 3BFVA 1NVMB 4ANFA 3PE3A 1KI8A 1QHEA 1M0EA 3W1EA 3A9RA 2ZATA 2ZDQA 1AX9A 3A32A 3M3PA 1MJFA 3Q0TA 4QWWA 4QTYA 1M34A 1DL5A 4RAOA 2F1RA 4Q7MB 2PSFA 4GIBA 3QX8A 3COPA 4XI9A 5KAPA 4KE9A 1RC1A 3ZWWA 4AL4A 1G5TA 3OX3A 1UFOA 5CAEA 1XZBA 2GN2A 2JLBA 2ZBPA 4BLWA 3T3NA 1TM4E 2PS9A 2WI8A 3CV3A 1ISIA 3STXA 3SXJA 3UHPA 4QPJC 2O0HA 4P1ZA 1N75A 2YKGA 1LI4A 2RHHA 3GDFA 2MINA 5KHAA 4Q7LA 3IUNA 2ZIAA 1ADCA 1J9ZA 1H93A 1GGFA 1GYQA 4U7JA 3OZTA 4PV7A 4BCCA 2ETVA 1N2SA 1T13A 2BR5A 1JEYA 2OXTA 1R8XA 1IAQA 1FNDA 4P4SA 3QPDA 4TRRA 2R11A 3EMBA 3HNRA 2H2FA 2VNJA 3MMNA 3PR1A 1I5EA 1BSVA 4RU1A 2J7PA 1AMUA 3OM9A 4YRRA 2PH1A 4BPRA 4ZU6X 2WNSA 3AETB 3EVGA 4TXMA 2ZI6A 4LDRA 1JWAB 3KT6A 3P2IA 3E3NA 4TS3A 3C5VA 4L0DA 3PXCX 1WXWA 4PX3A 4PPFA 4YV2A 4ZIRB 5JMWA 2B5OA 5HEKA 3OQVA 2PX0A 1WB9A 5KYUA 2E49A 1IRXA 3QA9A 1NA5A 1RTTA 2OMEA 2PZGA 2BGTA 3GGCA 3H9BA 1FJGB 2HMUA 4Q3CA 3A1TA 4UHFA 4KRFA 4YMHA 5BXQC 1LPOA 4L28A 4TMFA 5CW2A 4FS8A 4V0RA 1SG6A 3I0ZA 5YASA 4AF7A 1FUKA 4WJLA 4BIMA 3BGWA 3THXB 2DQZA 3ZLBA 3NVKI 2VJBA 2PKQP 3AGPA 4KXWA 4OHXA 3F8TA 4TV9A 1Q16A 3AY0A 1PP4A 3JPYA 4W9NC 4B47A 3I6QA 1WETA 1JNYA 3EODA 3JQEA 3PXXA 3TW0A 2OYRA 1XSEA 3R7WB 1QE3A 2CDBA 4YAEA 4EGFA 2SKCA 2WR8A 4PLWA 2PJRA 1J1UA 4LZOA 1E1NA 1RQPA 4Z9BA 2WVJA 2AYYA 2W6MA 5LP1A 2ACVA 3WIVA 2QQ0A 3I2FA 4DG9A 4H15A 4D82A 7ADHA 2WUFA 3JYPA 4W8OA 1Z15A 3ERCA 5GIOE 1CRLA 4HWTA 4LPKA 4S35A 4WDRA 5HKOA 2IU6A 2WTNA 2WTBA 1XG5A 1LQ2A 5M04A 4KTVE 3TKAA 3CO0S 2H65A 2BGLA 4S2UA 1Z5PA 2CFIA 2GBIA 3WRVA 2XUZA 2VJKA 4ES6A 5KC8A 2PJDA 2GEKA 4I5DA 2PS1A 6CHYA 3AEKA 5TGZA 4FC6A 5KMGA 1OWPA 3NOVA 5JIBA 5BR4A 4Y2XA 3LP8A 1Y7IA 3N1UA 3E5RA 4KWTA 4NJOA 1MORA 3A37A 1CJMA 4FLEA 4CT0A 5FWYB 1MC1A 3C3YA 3FZQA 5BNWA 3WWZA 1DJOA 1T9ZA 1GQFA 2GK4A 2REOA 3AI7A 1AXRA 3E18A 3R5TA 4MI1A 4EBFA 4Z1OA 5DXFA 1XU7A 1HDXA 2EC5A 1JFFA 2GZRA 2J4DA 4TWIA 1RIFA 1UPXA 3CNOA 4URVR 3OLWA 1L7PA 3QU5A 5A3SA 2OMKA 3UPUA 5SYMA 5F3DA 1SFRA 5GONB 3KHUA 4RELA 3IEPA 2J5KA 4F46A 5KNDD 3VR2A 3P2EA 5EJFA 1NJFA 2ZSUA 1RHRA 1DEKA 3MCUA 4MVJP 3IE0A 5CD1A 1RFLA 2P4QA 3PEWA 3MLAA 5B2EA 3KAKA 1VB3A 5BN5B 4P86A 4OQ4A 1GN9A 4PIMA 3VH3A 5MN4A 3N6VA 1A9PA 1YE8A 3LG2A 3RF6A 2ZPTX 3SC2B 2XMRA 3AR8A 2OK8A 1ONNA 2Z9DA 3TX6A 5AD1A 2WSIA 1WB6A 4NECA 1CUEA 4CODB 1G5IA 2H4ZA 2OK7A 4I6GA 4B74A 1FC0A 5TXGA 4MJ3A 4OATA 3U39A 1GZVA 1PSZA 2GZSA 1EDOA 2RGNC 4Z9AA 1E2NA 1NP3A 3TQCA 2OQIA 3K70B 1XD2B 2C2MA 1JFFB 3RSFA 4MVYA 3FVTA 2EATA 2J3MA 2H06A 2OGSA 1ZJ6A 2IZ7A 3ZXIA 4JH0A 4MULA 2XYVA 2A5JA 2PWPA 2V7EA 1D3AA 4IJKA 1TCVA 1ML4A 4NSNA 4U2KA 4X94A 4HGZA 2H6EA 2C5EA 3ZJ5A 3P45A 1HGXA 2G17A 1R2QA 3CR7A 5G02A 1R4MB 4PQEA 4OFWA 2I65A 3FB1A 4RYDA 1LJ8A 3AJ8A 5HIKA 2MDTA 2FPUA 1NV9A 4ILEA 3VR4A 1EE2A 3IT1A 1DQPA 1YC5A 3JQBA 5A3VA 2ATIA 2F17A 2JC3A 1Z6GA 1ESZA 1S8FA 4C14A 3Q6IA 4HY3A 4LG1A 1T91A 2HRRA 3FYTA 4G5YA 1GZ7A 3ANLA 1FMCA 4B2IA 4DIDA 5HTOA 1K6IA 3UEOA 3CTPA 3BE4A 4QKQA 1JLLA 1F0YA 1PR4A 3RTEA 4WBNF 1JPJA 3MA0A 5H81A 3PGMA 5A0VA 5DH9A 1L7AA 3E2PA 2GAAA 4HP8A 4DV5B 2XYPA 4FQ8A 1A9YA 5CT5A 5LUAA 4I36A 4KKXB 1SXJD 3LYUA 2C9ZA 5BO5A 4YIHA 4GW3A 1QF7A 2Q6IA 3CE6A 4Q01A 3OUUA 1F0KA 1Y5MA 1U5BB 2NSYA 3RU2A 1KAHA 1YB6A 3PYXA 1M6HA 1QFYA 4XUGB 5AIAA 3H05A 3QVKA 4LZPA 3VI4B 4XCXA 5CVUA 4YHBA 2X2EA 3WXBA 4ZMRA 2BIFA 2X7XA 2WFZA 3CF4G 5AM4A 1U3CA 3U40A 3UAXA 3W9BA 2DPGA 1EEHA 3NR2A 3OQHA 4DZTA 1A9SA 1XZKA 3GEHA 3K4HA 4AUKA 1T15A 1U04A 3DFIA 4BVBA 3LCUA 5C35A 5KO2A 3DC2A 4DVGA 4GLJA 4LK3A 1VPLA 4BL5A 3H16A 5G0SA 5LNK6 4RDHA 1E61A 1NT2A 1YKFA 4ENSA 1GPBA 1RWPA 4OOEA 5DM4A 4LOLA 2CVOA 2B7CA 1OX6A 1QANA 2RGYA 4IQ0A 4M9SA 4Q1AA 3ZN2A 3EVZA 4R3NA 1GGJA 1PFUA 4CW7A 1OBVA 3Q0IA 1PX2A 5BNTA 4PYOA 1TUGA 1TVEA 2HA4A 2PZKA 4EJSB 4LV5B 2HUPA 3HU5A 1WZCA 1L5SA 1JU9A 1G55A 2XUFA 3PNLA 1GCIA 1TPYA 3R4CA 3M5WA 4NF2A 1A50B 1IN8A 3SQDA 1G6Q1 2R84A 4OLHA 1N0IA 4OB6A 1ONSA 4ZCPA 5IFKA 1GPUA 1KH3A 1VBMA 4PSCA 3WAGA 1OI4A 1QRSA 4R69A 1R6TA 2CFSA 2IGTA 3LPNA 1OA0A 2FWIA 4DV6B 1AKEA 3WYBA 1U7XA 2UZ4A 4F2DA 3UB2A 2OQRA 2DHQA 4M1KA 5IANA 4B3CA 2ZT6A 3ZV4A 1CUBA 1OLXA 2X9LA 3BHJA 3E5NA 1VJCA 3IOEA 3A1NA 2ODTX 3CX3A 3KR1A 4AK9A 5SICE 4RUKA 1GKYA 3QU4A 2WVHA 2IP1A 4WPGA 4D79A 1UWLA 1TM5E 1SU7A 5GZ1A 5LSAA 2I99A 4JEMA 2JFFA 1LH0A 5JJCA 1F9EA 2ZBGA 4ARZB 2XDQA 5GZ6A 4K8RB 1AZWA 5DMXA 3ANSA 2R6DA 4EKYA 3RAJA 4Z7QB 3DULA 5CH8A 2C1EA 1M5TA 2GKGA 3R6DA 2V7GA 3Q3GE 1NYLA 4HB4A 5K8UA 1DAGA 1QLWA 3PB3A 2ADOA 2JLRA 2O8FB 1FVXA 1DLJA 2B7LA 2QRHA 1U2TA 3SVZA 8OHMA 3BF7A 3BC1A 4RKEA 2I4RA 3K9GA 4JLVA 2I7DA 3KPVA 4JR0A 4JI6B 3ZDRA 2XHZA 1P73A 3AEYA 3NXSA 3ZTTA 4IDOA 3I9FA 2FQ1A 4NBTA 5ARBA 4Q3LA 1MJGA 3TWOA 3WLRA 1H6CA 1GG9A 3I9V1 4D3ZA 5AHKA 4BNNA 1C80A 1L4MA 2FMKA 1TIBA 2A9QA 1AUPA 1JA0A 3LTEA 1QR2A 3RYFA 2JEZA 3ANMA 3DWEX 4I1IA 5FDFA 3JSAA 4GXTA 3MWJA 3SDZA 1WXFA 1XZLA 2NU7B 2QVBA 3LLMA 4WNAB 3EZYA 4KR3A 3A1SA 3TXYA 1E0KA 3P9CA 4DDHA 3OLQA 2DUWA 1VIYA 3A4VA 4ARZA 5IRCD 1NBWB 4ER3A 3E23A 9ATCA 16PKA 3QE9Y 1F2TA 1G3UA 2B9EA 3U37A 3VAYA 3JQ6A 4F4UA 5JQGA 4Y2VA 3MTAA 4LSGA 2UYOA 4YDHB 5JRJA 4FI3F 2LDBA 3WGJA 4Y3UA 3F0TA 1J2JA 1N2OA 3VNRA 1R12A 1EX6A 4BLUA 3L46A 3ZDQA 2XZTA 5BSHA 5BR7A 3MRTA 2YTZA 2FEMA 3IUJA 4MKXA 3LLUA 1C14A 1GNTA 1O94D 4LNAA 4PQRA 3VUEA 2WQZA 3UJCA 2Z8YM 4YMLA 1H2XA 2A1IA 2H1VA 1V71A 2A1TR 4NE7A 3BJZA 1ULUA 1SB8A 4KXVA 1A2OA 1XFAA 2BMDA 4ZV9A 3RW9A 1FFSA 2BWJA 3HWX1 3SYTA 3ZY6A 1MRSA 2XNDA 2ZJ4A 5CAEB 4GPEA 2P9FA 1OJ7A 3H19A 2J0VA 5DVZA 2DWOA 2BEJA 2Z56A 5J5AA 3RODA 3T94A 3OE1A 1NGSA 1WULS 2V7UA 3OZUA 3U2QA 1DAOA 1FY2A 2M1XA 3LE8A 2AI1A 5AXDA 4EZIA 3VZPA 1JQKA 3QHAA 1BE8A 1UF9A 4FT2A 2L82A 3VRHA 1DTSA 3R5SA 2FR0A 1X7WA 1BZYA 2BAGA 3L7MA 3NHRA 2N46A 3D6MA 1AN9A 1KJZA 4D0NA 2CXSA 4C07A 2NNLD 1MO6A 4KXMA 1RYFA 3T4UA 3Q6NA 2FZVA 3AT1A 3C15C 2Q6TA 1XTQA 1BDIA 3JQAA 3RSHA 3A3NA 1PCXA 1SCUA 1AKNA 1JHXA 3CLSD 4JEUA 3EULA 3QUCA 4NV3A 4QFDA 4XPIA 4PSKA 5A5VA 3HK2A 2IEBA 3CEPB 3K6KA 4PHGA 2HQBA 2GZ3A 2WAXA 3SQXA 1JEQB 2P9CA 3ORQA 1EBBA 5D5QA 3U7JA 3LUAA 4K9OA 1TGVA 4UMEA 3OCWA 3BL5A 4HX9A 1TFRA 4WZAA 4EYSA 5L3SA 1Z33A 4IZ6A 4D9BA 1Z4KA 1KSFX 2Z9BA 3K9LA 3DLTA 3N59A 4DB2A 3GNSA 4M7RA 2PGJA 1SKYE 2Z04A 3HYCA 4YRIA 5J2TB 1I9CA 1OF1A 1V3TA 1Q22A 1JFVA 4AG3A 1JMKC 1VLQA 2UYCA 1UMKA 3ZIUA 1A5BB 1U9YA 821PA 2FLVA 4LMAA 1YTLA 2CDRA 4MYCA 4EFNA 1HG1A 3W90A 5CDSA 4TV9F 2NP6A 1ODCA 2YJ6A 4FHGA 1SXJA 3W6UA 4QBIA 2HHAA 1CWUA 3AVPA 2AOTB 3FPJA 4TTJA 3PCXA 2FE1A 4KFUA 2QORA 4BMNA 2UUOA 2VJDA 4WSOA 4A5SA 4EVQA 4G1VA 3T5CA 3K4QA 2BZ0A 4K5QA 4BKQA 4QUBA 5HPYB 1K3FA 4B75A 3FDFA 4NBUA 3Q2OA 1Z4NA 3L8HA 1M6NA 3ZWAA 2XKAA 2VDQB 1XD9A 2IJGX 4IDGA 2G9VA 4AJHA 3EZFA 1N6KA 1YZUA 1OX4A 2ZEJA 4HSEA 4QGSA 2CLDX 3M4NA 4FFMA 2E3JA 4DA6A 2OORA 3S0JA 3GHHA 3THRA 3PHBE 1CQIB 1N2HA 1OX5A 3Q72A 4KDFA 4EATA 3VZCA 1ZI6A 4H7IA 4C7OA 3S70A 3D8TA 5CD9A 1QZTA 3LHKA 3QWBA 4RD2A 2H1OA 5DTQA 4Q18A 4YJGA 1SD5A 2QRUA 4DQLA 4NOMA 5EIWA 1DT5A 1HETA 1D4FA 1ST3A 1XL0A 4WLFA 3CR8A 1EFPB 4E5MA 2OVBA 5L4LA 3T1NA 2P78A 1QYDA 3VKHA 1JZSA 1MDFA 3FR8A 3E70C 1WW3A 4FDTA 1UDCA 2C4HA 4L5IA 1Z0IA 2VJLA 3N2LA 5DGTA 1O0CA 5EZYB 2J5RA 3BXFA 1FLVA 4KXFB 3GZNB 2JRCA 2K87A 4IW3B 4WKGA 3UHJA 4PCUA 5IKEA 3WP1B 3V2IA 4B4WA 3EDMA 3TSZA 3WK7A 3WGUA 4P31A 3ADDA 1H6AA 2HXSA 4L5BA 5GGXA 3ZWMA 3NHBA 1QMGA 4EY7A 1NZFA 3ZHVA 4B81A 2HRZA 2XIQA 4PNZA 4ZVNA 2PFKA 3ZNOA 4X7RA 1T1JA 1ISRA 4KNYA 1YFZA 2WJWA 3GPIA 1J07A 4YRPA 1SVKA 1SUPA 4JLAA 3CB2A 4K3VA 2NTJA 1VJ5A 1U3DA 2BM9A 2K4MA 2RK6A 4GYWA 3LKZA 1MC5A 4M1OA 4TKUA 1XMOB 1QTRA 3VYUB 1DBSA 2WFLB 1CP3A 1YZNA 1D2HA 3H2SA 4QHSA 4DQKA 4KN8A 2DETA 3O91A 1BN7A 5F4ZA 2I80A 4U9IS 9MHTA 2UAGA 4ALMA 3VUFA 2XYQA 4IG9A 3R3XA 3BWVA 1T1RA 3BAZA 3I1IA 4V38A 3BBLA 4YS6A 4HDSA 1SHLA 1EESA 3FTQA 1EP9A 4JA0A 2BGMA 2JEOA 2YV3A 4JV5B 4LK2A 3F7OA 2SHKA 3QLUA 4XKJA 1PT8A 13PKA 1I2AA 2DRIA 3C4JA 4GVPA 4N39A 2ZIEA 4QBFA 4UC0A 1TQ6A 2QL5A 2B4YA 2KBFA 1XJ5A 4RMHA 7REQA 2NV6A 1ZK4A 3R3VA 4D4MA 4GI1A 1E59A 1UZAA 1WD7A 2ZRQA 3Q3EA 4Q4AB 5EXSA 3W8EA 4RXTA 4UDXX 4TWBA 1IJBA 4FONA 2H7CA 1IRIA 2W2MA 3ZC3A 1Y5NA 3F5FA 1I7DA 1FFAA 4KK3A 2EJVA 4HAVA 3DT6A 1D2CA 4NONA 4DCTA 4FFBB 2WP0A 4X60A 1A7JA 2HDHA 2O7NA 4JX9A 2WZBA 3W4JA 4I4TF 2Q5QA 1KS9A 4NZ9A 3GU3A 4R1QA 5JY6A 5LYJB 3AW9A 3AZPA 2PMEA 1OYYA 2OO3A 1A4UA 1XX6A 2OZVA 3DG9A 1U0EA 2VATA 1NLMA 4G3XA 2FDRA 2PGLA 3AGQA 3G5LA 3THSA 3QXSA 2GTHA 4G56A 2IHKA 4KL8S 3AF4A 3VPSA 4DM4A 3UY4A 3ZW8A 1J4AA 4GEGA 3U4DA 4BBJA 2V96A 2RBGA 3KUUA 1JIIA 3L05A 5ALQA 3TZQA 3UCEA 1H5NA 1OHHA 3UAGA 1RZUA 3T6KA 1UT5A 6GPBA 2IHVA 3UFBA 5AQEA 2FFHA 2N3ZA 1T6YA 3DZJA 3T7RA 5JAMA 3HBJA 1GGVA 2H5JA 4C2AA 3LHSA 1H94A 3VR5H 4F3YA 4MUGA 2G71A 2ZW9A 3IVXA 3N2GB 3OIWA 3C3BA 1HE1C 3WK6A 3GJ7A 3ZH9B 4EAAA 2CK3D 3G2MA 5K8VA 5EMKA 5J5CA 1ENPA 4CFYA 2RGEA 3ED1A 4LJ9A 3FPFA 1JS1X 2QX9A 2W71A 1JQEA 4RMJA 2GVNA 3W5VA 3NDJA 4PLHA 2AKAB 3GLKA 4IG4A 4CMIA 4BDSA 4D1YA 4C88A 4UCFA 1WW8A 1P6XA 3I76A 3OBBA 1ELOA 3SY8A 1CPYA 4UMVA 5CFZA 2P9YA 2AS0A 1JHUA 3G13A 3OEYA 1EFTA 1R0XA 5BSMA 3DPUA 3GMTA 2MSKA 4FIDA 4MJLA 3PWKA 4FOLA 5BV2P 4K6FA 3NRJA 3RYIA 3SU8A 1RM3A 1Y7PA 1XO1A 1WTCA 2M1ZA 3FUVA 4P3XA 3VPFA 4BO4A 5C53B 1CP2A 3DNFA 2R60A 1MC8A 1T5BA 2JJ1D 4FYXA 4O2BA 5E4YA 5AKGA 2ZWMA 1E6MA 1Z7BA 3A6JA 2OR3A 3U80A 4WLNA 4US2R 3K6JA 1P1KA 4ZVKA 5K0EA 1L5OA 3K3PA 3WK4A 4O63O 3EG9A 1GG2A 3D1LA 2P3OA 2LUOA 2BISA 3QKIA 4F7WA 1G0OA 4OXIA 4UPDA 4GOND 1KBZA 3V1MA 1HE8B 4CN9A 5JW6A 5KX5F 4W5QA 2C61A 3FG9A 3HB5X 5FBLB 3KM0A 1KYWA 3EG5A 3OSZA 2YC2C 3SHVA 5ECGC 4GUAA 3QXJA 2HQSA 3FUUA 3MGGA 2AX4A 1ZMBA 3VMFA 5H0IA 2Y99A 3DWGA 3SEFA 2V6GA 4WFJA 3HCBA 1U7OA 3WMWA 5LZ2A 1CT9A 4OHPA 5HFAA 2C0PA 1Z73A 1M6EX 3EFOB 1RI2A 2QENA 3S1AB 4BRUA 1HNXB 2OG1A 2W9XA 1SUIA 3NM6B 2WE7A 4NFLA 4YPVA 2VH5R 4ZKEA 3LVQE 1U0HC 1U2DA 2WV7A 4J0CA 1KYZA 7MDHA 4UASA 1SK9A 1TC2A 3H0EA 3NNNA 7YASA 2QX7A 4TGLA 4URYR 5DSXA 4D43A 2B21A 3Q5GA 4CR8A 4HEQA 3NNSA 2JVKA 3DAFA 4KPYA 4YJKA 3EG9B 2J9GA 2J31A 3LPAA 4GMFA 3SEAA 4LXHA 3H75A 4X64B 1NR5A 5KWEA 1JA1A 2ZXFA 2H1IA 3FROA 3OC6A 1GPH1 4E6EA 3SLGA 4MYTA 4PHFA 4MB0A 3L4SO 3NH9A 2D1SA 3WNDA 1FP4A 4ENVA 1W46A 2GXQA 1EZ4A 2WWFA 2RAVA 2XVXA 4WECA 3RFTA 4E5SA 1OH8A 1WCWA 2W7TA 1I36A 4F60A 2ZS8A 4RF4A 1XD8A 3PNQA 2BGJA 3DOOA 4M0KA 1YQ9A 4IQGA 3ROTA 2ZVJA 3FOFC 3Q88A 2PX6A 4B7CA 1KO4A 1JHYA 3VPGA 3ZNNA 5K09A 5BVGB 1MX9A 5JQGB 3DF9A 5I7FA 4HV4A 2EBUA 4NFSA 1J09A 1V6SA 1EYZA 5LXTF 2CEKA 1I2MA 2CHVA 3ITKA 4GI3A 2B7BA 1SQ0A 2MYUA 2LCIA 4JT2A 2J41A 1I24A 1X1QA 4WY5A 4ON9A 4MPJA 4BX3A 5AJWA 5BVHB 2UVQA 4B76A 1ZOSA 1EI9A 2A7QA 2R87A 2C3PA 3BB4A 5IABA 5DNYB 1T2NA 4LVOA 1CKEA 4Y2JA 5IMBA 3FTCA 4UVEA 4YRQA 4M0CA 4YGYA 5HJEA 4NS4A 2H31A 2OBYA 2W11A 4EL0A 5BN3B 3J81k 3UNXA 3ELWA 4RANA 4WN9A 5EVJA 5HF9A 1PV1A 3PQ7A 1QU3A 4DNFA 3R77A 4COOA 4IF4A 4JLPA 3R7FA 4JI2B 3HKBA 3HUUA 1O2DA 2JG3A 3QF7A 1PR1A 4BKOA 4DREA 1CUCA 2E37A 1W4AA 5EHNA 1NUTA 1MMFB 2JA2A 2XV1A 1P91A 3HDJA 1ENYA 4NNJA 5AW5A 2IK8A 4OKSA 4TTAA 2A0KA 2HWXA 2ZI3A 4OQYA 2QNRA 2WD8A 1SIOA 2CNDA 2XHEA 1RRFA 4JJ8A 4UM9D 3X1KA 3TCNA 3W3AD 3JQGB 4J1TA 2XUJA 5AVSA 3KZXA 3DH0A 3AKCA 3L6BA 3EVEA 2VQ6A 1L7EA 1NQTA 2Q1WA 3U31A 4MUJA 1LTKA 1TU3A 4NZYA 1F20A 7GPBA 1N8TA 1QE5A 4KREA 1ZH8A 4FKZA 2Q9AA 5KSYA 3WDSA 2OCYC 4W5HA 5F5XA 4WNYA 4Z4IA 3ER6A 4CM9D 4LY0A 4RESA 3F49S 5DBHX 3T5AA 3DONA 2QT0A 4FZ3A 4DSAA 3CF2A 1I10A 4RK0A 4HUTA 4BZXA 4C87A 2A5FA 4X6XA 2Y0DA 1DO8A 3MUNA 3GDHA 4UM8B 1TO2E 4DC1A 1RDFA 2GK6A 2J9RA 2XT6A 4OBXA 4D2IA 5J2TA 5LKRA 1GO2A 1JJVA 1P4GA 3ND6A 1L2TA 4V0QA 5JYBA 2X5XA 1T0BA 4P84A 1SVIA 2Q6OA 3KLNA 1RRCA 3LHDA 5MHTA 3PVCA 4O4LA 3WNQA 4DV1B 2R00C 4BO8A 1RJ9B 2OLEA 5TPZA 2XWSA 5LKAA 5G0VA 4MW0A 2ZUEA 2H2AA 1XDDA 1ORHA 3O4FA 4YO7A 5CDFE 4YP5A 5HUQA 4Y67A 3EXFB 4CNQA 1KAQA 4IX9A 1PFYA 1NU6A 4CM4B 4IXNA 3MOIA 4TTVA 3M6VA 2Q27A 4G5RA 4I4IA 3R7NA 3AG5A 3MYYA 4NR0A 2WV9A 1JG7A 3ETNA 3G89A 2Q0SA 3HEAA 3QWFA 5CIQA 1Y1QA 5CTJA 2EWMA 1CUDA 5JH7F 3V3TA 5E95A 1A69A 3DGEC 2I2XB 2QT9A 1O6GA 4JELA 4PM4A 3MT7A 1DAEA 5DLEA 1RXEA 2XNKA 2XLCA 2ZR0A 3K5PA 1PG2A 3KTAA 3A4NA 2IIBA 2CJYA 2BBOA 4RK4A 2ZSBA 3RUDA 1BHO1 1VMKA 2GJ9A 2RONA 1NW9B 2ZRAA 3CLUD 4NVRA 4RD4A 4QOJA 4TN5A 4D4HA 3ICVA 2GEVA 4IH9A 4M37A 4XTCS 3K9FC 1H1LB 2YASA 1B0PA 1T9BA 3ESXA 2BHLA 4ID3A 1OZGA 4TTSA 4UJ3A 4PG8A 3A1DA 3IDSA 4B4VA 2BT4A 3RIHA 3C39A 2AG6A 3R8FA 4I1RA 2EFHB 4CR7A 1VCIA 3WJAA 3ICOA 4L6CA 1F6DA 2W0MA 2WKPA 5HKKA 1CQJB 1TKAA 2R85A 4JOBA 1KK0A 1J21A 2WIAA 4JI5B 5KJ1A 4DDWA 2PUAA 1WP4A 5H80A 3CJTA 3LXRA 3TEFA 5ICGA 1NVBA 1YE5A 3PD1A 2XGMA 4EQ6B 1PVVA 1NP7A 4B44A 1UPTA 2X5OA 5CDYA 3B3FA 1OUMA 1PI3A 1Y8RB 1T36A 3LMKA 2DBVO 4TPKA 4NJMB 3JRWA 4R54A 4CCYB 2PKRA 2VHXA 5HCNA 2UXDB 4OUDA 1R4AA 4MWTA 2B92A 2BZSA 3CMMA 4IVQA 2FLWA 4PG6A 4MHTA 2JS7A 4OXNA 1Y9ZA 3HVKA 4N9QA 1QGUA 2BLNA 3Q7SA 2J67A 1AD2A 4O2RA 1JU3A 1JTFA 5BUSA 1FVHA 1PJ2A 2QR5A 2GZDA 3WL6A 1W88A 3C3WA 1A82A 4PRLA 4L50A 4TT3D 2FE4A 2RC6A 2B8EA 3D0KA 3HWWA 3MB5A 1WMBA 2Y6UA 3DZFA 2QB5A 4RD1A 3OJXA 4IWXA 5EA2A 2GZ1A 3ABIA 3AO0B 3C5HA 5JJBA 2P90A 3C24A 5ALVA 1KI4A 1KYTA 4KOEC 5LJIA 2PR2A 2G83A 3E05A 2WJ3A 1P60A 2XOKD 1E7MA 3L7KA 4MR8B 5LP6C 2GM9A 3G85A 3L93A 3W9YA 4CR6A 4CCWA 4EI7A 1E4EA 4MR7B 4CE6A 3L77A 3K92A 1N6IA 4K9KA 3AXTA 1QLHA 5P21A 3EGIA 1MNAA 4OHOA 1GRCA 2QVCA 3QV1A 1YVRA 3WKDA 1T4CB 2Y9MB 5DX8A 3I2YX 2OO7A 5DZSA 4MV7A 4LNHA 4J3FA 2Y77A 3OZSA 3T3MB 3URMA 3QRWA 3TS1A 3F98A 4FDMA 5KOYA 1XZGA 2IE8A 5EWMA 2RHTA 1KEEA 4NP6A 2XMSA 1T6BY 2WUDA 5LDGA 4AM8A 4CV2A 5IBCA 3I05A 5JZ9A 5KDDA 1OOEA 1WF3A 3FSGA 4P3YA 4ZJPA 3FNEA 1C7ZA 4YV0A 1GYRA 3U3MA 2X41A 3NUGA 3BF8A 5CLQA 2VP0A 3UHOA 4KITB 5J2UB 4UM7A 3T1YB 3R2JA 2JI4A 1KMHB 3BDVA 1XTVA 3HI4A 3KOXA 1NI3A 3M4ZA 3PHGA 3N8KA 3I39X 5LMNB 3A8TA 4JLSA 5L3ZA 4ZDIA 1L3IA 4N5MA 1NW7A 5C81A 1E4EB 1VCHA 1GA1A 2N1MA 2D2VA 2WZDA 1MDBA 1W5EA 1YQGA 1ML3A 2YS6A 2G4CA 3ADOA 3GG2A 3QMMA 1QK5A 3D4OA 4QDTA 3AFIA 1J20A 2Z2KA 3E8SA 3M6AA 3MJVA 3OCCA 3PDWA 4WXHA 1YJXA 1HI9A 2IKSA 3KR9A 4IR7A 3PFKA 3TG8A 4CEJA 2ATEA 2OZKA 3MT0A 1UMDA 1ZL0A 4RTQA 4MS4A 5JS2A 3V80A 3K35A 3LA6A 1E4VA 2WVGA 1AQNA 2O06A 1KRXA 4K6MA 4NK5A 1P62B 1U7WA 3KU4A 4Q4DA 5IDVA 2V0GA 1QZZA 3BWDD 5EMJA 4BVKA 1CY0A 2HF2A 5AM0A 3SIXA 3UC9A 5I48A 1QZXA 2BZGA 3GZJA 1LDNA 1NPDA 3MWKA 5I4KA 3F8SA 5K4AA 4Z3KA 3W6PA 2JIOA 3NHZA 3VOSA 2YWHA 2ZUUA 4X62B 3EEBA 3K5IA 1LC0A 3E7PA 1L7BA 4YIKA 2V6MA 2JLVA 3I62A 4NI5A 1D6SA 2GRJA 2EVWX 1K2WA 2H8GA 4X8MA 3CEMA 4YXWD 3A25A 3MPUA 2JD1A 3WYFA 5D3ZA 1H85A 1J5XA 4RETA 2DLCX 1OAOC 3WSVA 3UUEA 3VU8A 1ENZA 1RT9A 4J3NA 4AULA 4YJFB 1GNRA 1DZ3A 2R8EA 4LWPA 2C3OA 1V8PA 2GXAA 5LQDA 4H7EA 3TBKA 1N5LA 5KCZA 1HA3A 4Y6LA 4F0JA 1XB2A 3HDQA 2QE7D 3PQEA 4HEA6 4JOSA 1U65A 2XW6A 4E3ZA 1S4QA 1KZYC 3ZIAD 3RTCA 3KD3A 2PRIA 3GQBA 3MIIA 4ZGWA 2AFIB 5CNMA 3NHUA 1EVIA 1R16A 1YS9A 5BQOA 1ZHHA 1MG0A 1DKUA 3D4BA 1EUDA 3M6MD 2VF7A 2AXQA 4GP9A 1J2TA 4LX0A 3IBTA 2I34A 5C51B 3WGZA 3ZCUA 3O1HB 3EXEA 1NVEA 3JALB 4KLRA 1C4KA 2Y67A 5EPUA 2XAAA 3EUFA 3URKA 1NMEA 3GP5A 4AXBA 4B6OA 2PKCA 2WVAA 4F9EA 5A62A 1FXUA 2PX4A 3OQ1A 3RYHA 2EP7A 3EEIA 2TMGA 4DNXA 4EJSC 2GCEA 4H1WA 1EDBA 3M6UA 2VTEA 1BNCA 1G8HA 1RWNA 2ZTMA 2PYZA 5FUQA 4YDRA 4N3GA 3CB4A 3PPXA 1KZ6A 2ZBFA 4C6TB 5JI2E 1TQ2A 5HRAA 5KWSA 3OLCX 4G36A 3AJ9A 1HDIA 2BGNA 1ODLA 2ODWA 4HDAA 4MPRA 4TL9A 3QKUA 5DGXA 2D5BA 4X54A 5A02A 2HLPA 4AMVA 3LYAA 3U0VA 1U2RA 1XHFA 2RB4A 5LC1A 5DV9A 3RSQA 1NXWA 1EVKA 3H2ZA 3DBVO 1G63A 1Y9AA 3FUCA 3TQQA 4EUFA 1BWQA 3G1TA 4ZVQA 1JLHA 2WZCA 4AYWA 2Q62A 3MG9A 2YJ3A 2DFNA 4UBMA 5IAKA 4OQFA 3DE4X 2PLAA 1JN0A 3PQFA 3G8YA 3SXPA 3GIDA 3OY2A 3FPAA 2O9JA 1N9GA 1L3CA 4JDUA 2ZVDA 3BXPA 4YWJA 3WO0A 5KINB 1G2IA 5CU7A 1IE3A 4QWMA 2WKQA 1PLKA 3OZDA 1P29A 2CHGA 2IBMA 3MSCA 4LS3A 3VJLA 2NYUA 4ZMSA 1I4WA 3E0QA 4OHYA 1A4RA 4HADA 2EIHA 3TO5A 3L0PA 3U7HB 2XI4A 3EVDA 3VZDA 4RQBA 4DA0A 1XDUA 3C4VA 5BN3A 1GNSA 1NNLA 1IXSB 1UFRA 3HKCA 2IEIA 3MQFA 4HDMA 1P4HA 3RE1A 2R00A 2PO7A 1YHYA 4LHYA 4DLBA 5IK2A 4B45A 1QFXA 4HG2A 1AA6A 1HL7A 4DQ0A 4AQDA 2XJ4A 4G24A 3DDUA 4QGAA 4QRHA 2BEVA 3VNBA 1RCTE 1O08A 1N2BA 4RTNA 3CVVA 2OFOA 4Q0MA 1OIXA 3C3XA 4MDHA 5TVGA 4HGNA 4C6SA 4RTKA 3IIIA 1R6DA 4LX8A 5EN4A 1G8AA 1DI0A 3U9TA 4EP1A 5L9AA 1EJBA 2QYSA 2CHFA 4FOSA 2Y76A 1YCGA 4HAUA 5I9NA 1E7RA 1ATZA 3TFOA 3K96A 4P9NA 5GJVC 3B48A 1UK9A 2G28A 2VDVE 3DBHA 5K2MA 3GLFB 1YA8A 2IHZA 1OFIA 3WC4A 2VHVA 4HZGA 3W8NA 2NT4A 3ZDDA 4ZD6A 4MEBA 2NPOA 2YFYA 4AG6A 2PZAA 1S4MA 2MWMA 5EPOA 1ZO8A 5KVAA 3JWPA 1K5DA 1QB7A 2V9PA 3C45A 3DQQA 3PUXA 4UEJA 2BMVA 4FEEA 1A5TA 2ZI9A 4IHKA 1WDWB 3I64A 4R8KA 2I91A 5B64A 1E2EA 2ZUSA 3MFQA 1KK2A 2EWWA 5BUZA 3OECA 2P40A 3AL0C 3A4YA 4Q3KA 4US0R 4TMVA 3TUJC 3GLFE 3T1HB 1WXEA 2I4NA 3K1AA 5JCJD 1ATIA 2QN3A 2EX0A 5AKJA 5J2TF 1MGPA 3U3KA 2OCDA 5IM4F 1XNHA 4CV1A 1T29A 1YFLA 1QCCA 2YV5A 1L4FA 4C7OB 1PNTA 5ECWA 3K4PA 3UUFA 4L4RA 1TKCA 2O7RA 3NH6A 4WAUA 1IBLB 4JOCA 4FFPA 1MN6A 5JXWA 2O54A 2AWOA 3NVDA 2X0JA 4DQVA 2N47A 5AICA 3AB7A 1CE8B 2AXPA 1UJ4A 4EPYA 1IVSA 1W2WB 3HNOA 1BCRA 4M0DA 1AA9A 3P2YA 1HYQA 2AZDA 2O20A 3TTUA 1TK9A 2ZJ0A 4ZOAA 3WLKX 1JEAA 3OG9A 1V7PC 3VHLB 2OUKA 1QH8A 3OJWA 3N2EA 3BXGA 4UNSA 1TRHA 1KZ4A 1L4GA 1GGHA 1LBTA 2JFYA 2Y2VA 2XTAA 4GNRA 3VMMA 2W8ZA 1XEAA 3UGTA 3V1NA 1Z0DA 3FMOB 3MLBA 1CY8A 2DSTA 1NSYA 3GMDA 4LY6A 2HL6A 2ZJAA 3H18A 1KERA 1JDTA 2Y0BA 4BFSA 3G2LA 5I8WA 4UTVA 5CH3A 3QOXA 3RRZA 4G0WA 3OFND 3JAKA 3IKTA 1FMFA 1RACA 2P9TA 3Q12A 2A9PA 1KQ3A 4PQFA 4WUTA 1F14A 4PR3A 1D2EA 5C1BA 3N39C 4ZCLA 2FOXA 1IN7A 2JDIA 2WWTA 2GJSA 4D6XA 3KQTA 3O5AA 3ZIAA 1SWWA 3IX7A 3R1IA 1E0SA 3QVGB 4M1WA 4DA8A 5D51S 4QT4A 4K9QA 1MJ5A 3TOCA 1ZX1A 3FPBA 1W2GA 3G23A 4X20A 4FKMA 3NPMA 3HCDA 2JVJA 4E7OA 1D2GA 3KHTA 4D8XA 3EPHA 5A1TA 1F4VA 1JSXA 3JVUA 2BFCA 4AP5A 4EMBA 5HIAA 1RQ2A 2ORIA 2PAAA 2VSYA 4KSBA 2RC5A 2Z4RA 5C4MA 1RU3A 1P5JA 3UJDA 1XQYA 2WG1A 5B12A 1ZJZA 1KAMA 3EK2A 1U5BA 2P2SA 3Q5EA 3D8HA 1PT5A 1RWVA 2NSHA 3O1LA 3R6TA 3GIWA 3LHIA 3RIMA 3LUPA 4B32A 2EWVA 2H59A 2Y4OA 1V41E 1VPDA 3I04M 1JJIA 4OXXA 4EQZA 1IQRA 3KLBA 1JQAA 4BZWA 4AD8A 4EY3A 4I9FA 5EP2A 2WBLC 3EBOA 1GPDG 4N0DA 1E7SA 1C9MA 2QHXA 3JAKB 2JLYA 1VCOA 2FQQA 2I6FA 5F21A 1Q1ZA 3RVQA 4YXFA 2MU1A 1K98A 4I1OA 4L8GA 4CV0A 3D2LA 1ZH6A 1DAMA 4MCAA 3ZGNA 1MVOA 2X40A 1LFAA 4ACBA 3VTZA 3LVFO 4EO4A 1ZGJA 1XMQB 1I13A 2JHCA 2QT1A 3NQ41 2YMMA 1CVRA 2YN2A 3CLSC 3DHEA 3K0AB 1GQ2A 4M89A 2HPZA 3PKZA 1HUQA 2ATVA 1GTMA 3MJFA 1JFSA 4X24A 5FPQA 3SPXA 1DC4A 4DNPA 5ESXA 3C1TA 1EWVA 4CQMD 5KTYA 1XQ1A 2YWEA 3EHDA 5CB8A 2YNMA 2B30A 1PVOA 1NX9A 4LQ4A 1H66A 3DMTA 3IB3A 4IWNA 4Z9FA 2RI6A 3CVOA 1WDLA 1NN1A 1U9CA 1A9XB 3TRJA 3HEMA 4NIMA 1V45E 4Q3DA 1XQWA 1G21B 4Z0NA 4JLDA 3AVOA 2OECA 4F3TA 1EAMA 3GCDA 1JHVA 1NZDA 3H6GA 1Y1SA 1NXOA 4GLLA 4CIWA 1CRPA 3EY4A 3OJOA 3JSXA 4J4BA 2XBLA 4DABA 2G9ZA 2YRWA 1CVLA 3ZWPA 3CH6A 2EG9A 2NZXA 5GINE 1H9AA 3GVIA 4JB2A 1JLLB 2ZIZA 3IR6A 3KEGA 3ZYCA 4Z1MD 1BHSA 4YUAA 1CS0B 5JZSA 4ZI2A 2J0QA 1W76A 1ECFA 3BGOS 5F3WB 1NBOA 1XZPA 2AHRA 1H2HA 1TYEB 2AFHB 2GPJA 4KPGA 4MVJF 5U4XA 2AB0A 3O2NA 5GVSA 1MEJA 5B7NA 1FVFA 5IJ0A 1VE1A 2PJUA 4DJEC 3L7LA 2SKDA 1NPTO 5KNBD 4QT0A 4A6XA 4DT1A 1V4NA 3NT2A 3V4VB 1W5SA 2QG4A 1UC9A 4UHDA 4AKHA 1CETA 3B7WA 2F3UA 1QM5A 2QTCA 3KT8A 4I9GA 1Q50A 2PX2A 1NT4A 4I50B 4QELA 2OFFA 2HIAA 4KEAA 4LOKA 4LV8B 5EINA 1E58A 1SPBS 2QMOA 3N0XA 1MHPA 3CLTD 3OVMA 5CT4A 5TEWA 3W3AH 3DQPA 3KRTA 2WILA 4I0WB 2E4WA 4P34A 1K5GA 5AI6A 4KQGA 4HYTA 4C7XA 1WUYA 1O95A 3E03A 4GDFA 3C70A 5DSZA 4ALLA 1DDIA 1G20B 2X3YA 4RK1A 4CG3A 10MHA 1D0IA 1WQ4A 3ZPXA 1C0EA 2CK3A 4JUAA 5CFLA 2H3HA 3SKXA 2NU7A 3KQMA 4FIZA 1JDBC 3IQXA 3KVOA 3PT5A 3QPBA 1AHNA 4H7HA 4AMUA 4F84A 1NMQA 2G3YA 2JIDA 3OT5A 4W1QA 4U7FA 1FTSA 3ZWXA 1ESEA 1NUUA 1LI7A 1V47A 3BK2A 3IERA 4GKBA 4Q34A 3T54A 4A0FA 4BJHB 4MW1A 2UUBB 2VTDA 1UT6A 2XKBA 4WTOA 3T3DA 4JT4A 3VSEA 1R27A 4MXDA 3SKVA 5CHYA 2EFGA 3V2UA 4DJDC 4OXRA 1WV1A 4WK0B 5C7YA 1LW7A 3LQ4A 4Q3AA 2O3TA 3UYKA 1ESDA 3UFXB 3RVDA 4TKVA 2XADA 3D0RA 1AHPA 3LVRE 1E20A 2XZPA 3E53A 1DMRA 1DSSG 3ZV5A 2CWWA 5ITSA 4IVRA 1P4SA 4W5RA 4EF5A 2CB9A 2IOFA 3OJEA 5FR1A 4P33A 5HQ3B 1N9ZA 2XB4A 4AP9A 2CNOA 4BNWA 2XUAA 2P2CA 1GUBA 3PGXA 2E4VA 4MQBA 1IM8A 4HS9A 1A96A 1BWPA 3GUHA 4KXLA 1J6UA 3VV3A 4IJUA 4LRSB 5G0UA 1QFJA 1DIBA 4XOUA 3KDPA 1ZYUA 5HDBB 3WLAA 4B2PA 5KHLB 1T3SA 3LL4A 3VKUA 3FRIA 1NVTA 1KVTA 1YDMA 5C0OE 4ZANA 5TPWB 1O89A 2WTUA 4NXMB 3AVYA 3G3EA 1BX0A 3L6OO 3VR4D 1RRKA 4M9RA 1J5PA 1N8SA 1YCHA 3GUZA 3UJPA 1EGVB 2IS4A 1ZIYA 4AUMA 2C3MA 3QI7A 4D3XA 1UDXA 3EISA 1H42A 3WL4A 4AXXA 3T7IA 4D9FA 3GWZA 1U63A 4BEVA 2X22A 4QSHA 4H59A 1XZQA 2P30A 3CGWA 1N3BA 4ICIA 3ESCA 3ZKWB 4EFKA 3IUSA 3W2TA 3OLXA 1QTNA 2C7RA 3SC6A 1LSOA 3G0DA 3WGVA 1XDSA 2ZPAA 3RFFA 3UMMA 3ND9A 2HF7A 1NURA 2QV0A 3GEEA 4JIMA 1FP7A 4A9AA 3T3PB 5L53A 1U7UA 1WM1A 2ESRA 3QYFA 1CD5A 2JFWA 2HGSA 2PBZA 4OKNA 3UJ3X 3RFCA 5G4KB 1J90A 1VG9B 1XKTA 4UVGA 1I1OA 3HB0A 2JHPA 1OH6A 1NUSA 5ADHA 4OGKA 5HM6A 2O14A 2YOFA 4JU8A 3BMOA 4YPFA 3WLPA 4PO9A 5EP1A 1UZUA 4PXYA 2QTHA 5AVWA 3OE7A 2JGJA 2W2PA 5E7QA 1JIUA 3UVEA 4XQGA 3CUWA 2C5GA 3WJ1A 3ZWCA 4ENPA 1RC8A 1T8SA 1I4OA 2VH2A 3IOYA 5FH9A 2C2GA 4FZRA 1JKJA 5BSFA 2JLCA 2AFIE 1KOLA 3RV4A 3S40A 1VSUA 2HQOA 1J7KA 3L9XA 4I50F 1IMJA 1BMDA 1BDJA 4IV5A 1Q1QA 1W6UA 3G9QA 4A1FA 4F6CA 3A11A 1F0NA 5KYKA 1GP2A 1SVOA 3ETGA 3W06A 4OJQA 2PUHA 5FTLA 3DD1A 3H0KA 3LQRA 3CH7A 3SJ7A 5DX0A 2O8EB 3AUXA 3LPLA 1J1ZA 5G1PA 3BEDA 1W85A 4C7JA 1JHRA 2J09A 4R5HA 3KIPA 4XIIA 4ZEVA 4M22A 4JP2A 4KNVA 5JUWA 4NNOA 2IHNA 4MITA 4E94A 1CK4A 1C8KA 2CN1A 1ZKDA 1OX4B 2FV8A 2YFQA 4XLZA 3S2FA 4CLRB 3HCWA 4EEZA 1II0A 3MILA 2FVXA 2BP7A 3OCUA 5CLIA 3TAUA 4LKOA 3DMPA 1D6MA 4U6NA 1WOMA 2BMFA 1QZ3A 3UB4A 1EA7A 1ZK1A 5IK2D 1DIRA 1OD6A 3CX7A 2VCEA 2XTNA 3G17A 3GEPA 3M3HA 1NRXA 4HDNA 4MW2A 3KKLA 3UZUA 4ERNA 3QLTA 1TIKA 4KE7A 5F7OA 3U61B 3RKUA 3KB6A 2O59A 2IXFA 5AJVB 3WYEA 4DLXA 3DOJA 4PYJA 1QP4A 5GOTA 1ISMA 4JSRA 2ZETA 1CXZA 2VDUE 4HXGA 2MMCA 3DBHB 5E2BA 3W7AA 4AJ9A 2JLXA 4QSMA 1GNQA 5LVAA 3DE3X 4X00A 1INLA 1W1WA 3OZ7A 5ERXA 5GGYA 1ZVJA 3FDIA 4J2OA 1W96A 3V8RA 3V1TC 3N07A 3HC7A 4M38A 4A6DA 1E2UA 1JPNA 2PSEA 5EZYA 3ISJA 2IU3A 4QO7A 2WP8J 2FSVC 1SXJE 4DIBA 3DTNA 1L5YA 4GSKA 5IEBA 2HF9A 1ULAA 1X1CA 1FX0A 1JJFA 2GBFA 4DRXB 2ZWOA 1LVUA 2Q49A 4B85A 1ZNZA 1DIOB 2AOWA 3IO3A 1GOTA 4KO1S 2FJUA 2HMWA 2N9UA 1TJPB 2YY6A 3AINA 3RARA 4D9IA 3C3KA 5CFOA 4J0JA 1KY4A 3KKPA 4TLAA 4U7GA 1PS0A 3FVRA 3G2PA 3NHYA 3OFJA 4Y7DA 3UG6A 4K3UA 2GPAA 3BTSA 3KPJA 1WS6A 2BFEB 4H7DA 4WKNA 3ZEAA 3TEJA 2ZIXB 5IJ9B 2X8AA 3DR5A 1QYXA 2A57A 3NAZA 3EMVA 4KQWA 5J1TB 3LXXA 4BFVA 5IJZA 4KFCA 1XXHB 1L9KA 2O50A 4KFRA 3IVMA 1J39A 4KACA 2PH7A 2HY7A 4R8LA 2H7XA 3BJEA 5JMPA 1SVSA 5ITZA 3NU1A 2IYWA 2O8NA 3GT0A 3EZ2A 1XVUA 3I34X 1UQRA 5D84A 2FFBA 2V54A 1L5HB 1PLJA 2PYIA 2GN8A 1J8DA 2PYDA 3DEIA 1WXGA 1Y4SA 3FRHA 3KWMA 3R0QA 4OO3A 1F8YA 3QENA 3EJWA 5D01A 3VU9A 4XX0A 2CJXA 3BZBA 4XWOA 1GRVA 2R1UA 4BLPA 3KQKA 3JW8A 1JYFA 4X63A 5AKYA 3EEYA 3WV4A 2QTBA 4X1YB 4N3BA 2AZ4A 1HQDA 2C5AA 1L4UA 3GGJA 3OIDA 3I04A 3IELA 4GICA 4X3OA 1N78A 5J47A 2GCIA 5JD5A 4KR7A 1DIHA 4JKOA 5HF5A 4EDFA 4D3SA 2CLHB 3IJ5A 3JQFA 3WE7A 1DGQA 2JBHA 1SBIA 3RTDA 3FHOA 4WCFB 1YMVA 2VP4A 1I7LA 1TU4A 2XA9A 1NMZA 2IOHA 2YV1A 3A6FA 1OI7A 2VAVA 3AHGA 4H3VA 4KWIA 2XUIA 2V1XA 2WIKA 4KHZA 2Q29A 4FMPA 2B1GA 1X1TA 4RZIA 4R2LA 1OKKD 2Q3EA 4ZYZA 1KY3A 4CVNA 5JH7B 2PQ6A 4PC7A 2AEEA 4X7BA 1E3IA 4Q1BA 4AZ3A 2P6NA 2KX7A 2PZJA 2CVQA 4KSCA 1Y33E 5CXXA 5AW3A 2AC2A 5LDDC 2Q8QA 1RAEA 4QJ5A 3SMVA 4HMOA 3TECE 1GQSA 4RM2A 1KKUA 1SD1A 3L0OA 5ER9A 3VYSB 1WU8A 3QJ5A 1G6OA 4DJJA 2BFAA 2AMFA 2GPWA 2QJOA 4RCVA 3TTSA 4N01A 2XOKA 4DV4B 1PVDA 3PTZA 3O2JA 1XZMA 2QD1A 1U94A 3RK4A 8AT1A 1PJ4A 4TLLB 1T2EA 1LWNA 2OHGA 3JD1A 3DEAA 2OO5A 3NRBA 3NIBA 3QW4B 4F8YA 3LTNC 5NULA 4C3ZA 4RGVA 1KC1A 5JS8A 4UUQA 5IXYA 4OM8A 1SR8A 1UMCB 2JAHA 1X7DA 2QPAA 3W8DA 2XMGA 4NTZA 2D00A 2JH9A 4MYDA 3R3ZA 2XSZA 1THMA 3AF1A 2HT1A 3MJCA 2GCOA 2GR9A 1KEEB 2BFDA 1DC8A 2ZYHA 4HPJB 2ZIUB 1R8JA 5I7UA 3O4HA 4H7KA 2B6HA 1PDOA 3OTIA 3H5VA 3QE2A 4R2MA 5JZMA 3QELA 2GJAA 3LWNA 3ZCTA 4DY6A 4YVFA 1A04A 3AVQA 1Z0KA 1UFVA 1ZIOA 3F9IA 3D9QX 3ZWBA 1MABA 2WKRA 4EY5A 1SCDA 4LYDA 1QO7A 5LBTA 1I1QB 5TRTA 4Z4CA 4GE0A 4ZYTA 3WIOA 5KC9A 3INYA 4YRJA 1AQLA 2WJYA 2R2GA 4CTNA 4CKCB 1C3LA 4RIFA 1TZKA 3WYAA 1OMOA 2PZ8A 1P1IA 2X8JA