4E14A

Crystal structure of kynurenine formamidase conjugated with phenylmethylsulfonyl fluoride
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
300
structure length
299
Chain Sequence
HMYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords kynurenine formamidase
total genus 121
structure length 299
sequence length 300
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e14A00
1MNAA 1ZJ4A 3DL4A 2OXEA 4AO7A 5KREA 1UK7A 5CXXA 4P92A 3A2NA 5AM3A 2J4FA 5HZGA 1YASA 2WG0A 1DINA 4ZREA 4AN1A 4J7AA 5JASA 3DKKA 5FDFA 3DS8A 4LYEA 3WJ2A 4N5HX 1BN7A 2OGTA 2VT7A 1UOQA 1LGYA 4BZWA 4ITVA 3CN9A 2ACKA 2OPHA 4AZ3A 2O7VA 5HKBA 3ESDA 1YAJA 1CUVA 5JZSA 5ALTA 1DX4A 3A2LA 4L9AA 4WY8A 1CUFA 2HL6A 3H2KA 1MTZA 1CRLA 4U2CA 4X92A 4ZI5A 4G4IA 2QXTA 5ALIA 1W4LA 2V97A 3TRDA 4RE6A 1IZ8A 4GI1A 5AKJA 4BDSA 3H19A 1UKCA 4DGQA 3NOXA 3IA2A 3H1BA 3IVMA 3QITA 4PO3X 2OCIA 1GQRA 2AJLI 4KE9A 4I19A 3DQZA 3STYA 1UXOA 5JYCA 5JZBA 3S8YA 4X6XA 4BB0A 4KAJA 4DIUA 2O2HA 2VJBA 3GROA 2C4HA 3K9BA 5D6OA 2JGIA 2H1IA 2CKMA 1SOMA 4CIBA 3QMWA 2C58A 5LZ5A 1JU3A 1D07A 4KAAA 2VF2A 4PF1A 4DNQA 4Y2QA 5ALUA 3SC2A 1YSCA 3PUHA 3RM3A 4GXNA 2XQGA 3LLCA 1DTEA 3BE8A 4UBMA 3RLIA 2XMRA 4M0FA 3I6YA 1CUYA 1HL7A 4QNNA 4CG3A 5CH5A 1QIDA 4GLBA 4F5ZA 1Q0RA 1XRMA 3MUNA 4YX9A 3I1YA 4HRXA 1WOMA 2ZJ6A 3IURA 2VQ6A 5IVIA 3JW8A 4GECA 2CUTA 2B20A 1XZDA 5FOQA 3AZPA 3FCXA 1T4MA 2GZRA 1HPLA 2WUEA 5SYMA 1R9NA 4UFPA 4UBJA 1UKBA 5CT4A 1THGA 2WJ4A 1A8SA 1E8DA 5DYYA 1LPBB 2ECFA 3GUUA 3D5EA 2XUHA 1LZKA 1CUCA 2XB6A 3T52A 3STTA 2GBGA 5AKXA 5HCUA 3QYJA 4G8DA 2WU3A 4HZGA 1ZD5A 1AQLA 4FBMA 2VA9A 3K2IA 3P2MA 4FNMA 2HU8A 1VA4A 2Z8ZA 2QZPA 1QO7A 1XLVA 3OURA 1ACLA 1UK9A 1Y7IA 1QIJA 2BUAA 2WG1A 3F96A 1EDDA 1XZBA 4FTWA 1LLFA 3VDXA 4MJ3A 4CCWA 5D3ZA 1CUWA 2Y2VA 2IIVA 4RGYA 3N0TA 1A8UA 4X97A 3DLTA 1CUSA 2PU7A 4TGLA 3OOSA 3ZV7A 3WIBA 2WUFA 1K63A 1B6GA 1VA5A 3KD2A 2JF0A 4INZA 3LCRA 4A23A 1ZD2P 5JIBA 2JGLA 1ORVA 5C81A 1QOZA 4XWGA 2XUAA 4GEGA 2DQZA 4UBLA 1BROA 1XZGA 2JGEA 4GDMA 4RE5A 2D0DA 2ES4A 4DSAA 4ROTA 2XUGA 4EY7A 4AQDA 3RKSA 2XQFA 1A8QA 1MO2A 2BJHA 1MAHA 1WHTA 3WMRA 5BWCA 3WYNA 4QDTA 3CXUA 3HABA 1DWPA 1G5FA 4WCVA 4Q3LA 5K3AA 4BYMA 4OYLA 2HU7A 4ETWA 3WL5A 4UFNA 1EB8A 4KRXA 1CIJA 3WZMA 2ACEA 2C7BA 4AO6A 1K6EA 3R3ZA 4W1RA 1DT5A 5HK9A 2HRQA 2WM2A 4QZVA 4DNPA 4Y2XA 3CN7A 1TAHA 4FOLA 2DQYA 3PE6A 3WKAA 1P0IA 4A16A 2BGNA 1MT3A 1P0MA 2QOEA 4H7IA 5AK3A 3AFIA 3C8HA 3HJUA 2R11A 5AICA 3BDVA 2Z3ZA 1ODTC 3VJKA 3MUOA 3PUIA 2Y2UA 3QH4A 3GELA 1WB5A 5DYWA 1L7AA 4OCZA 4C6HA 3WLAA 2QTBA 2WUGA 1EI9A 1F0NA 3PF8A 4XX1A 2QMQA 4YK7A 4BVLA 1JFRA 4PV7A 1H2WA 4BCCA 5ALRA 1TCBA 4PNZA 4ARAA 4BATA 3BWXA 3IUJA 3DOHA 5AOCA 3AJAA 4G4GA 5ALDA 4K2AA 1THTA 2VJCA 1LBTA 2WFMA 4Y2VA 3G0IA 4EHBA 2VJDA 4V2IA 3WK6A 3ANSA 5DTJA 1K4YA 2Y6UA 1K8QA 5A7FA 1XZCA 5A2GA 1X2EA 1EVEA 3FYTA 2IX9A 4BBZA 1VLQA 2QVBA 4B81A 5K3DA 1OILA 4GWLA 1ETHA 3ZLVA 4KE7A 4OB6A 2YXPX 1IVYA 2PUJA 3AIKA 2HA3A 4FKBA 3NUZA 2EDCA 1JI3A 3EQ8A 4NVRA 5AI9A 4B80A 1EK1A 3O9VA 3VISA 2WHQA 4Q1VA 2HU5A 1CVLA 3F98A 1BE0A 1ZGBA 3I2KA 3BIWA 1BEEA 2BCEA 2WU4A 1XRPA 3BDIA 3ZLTA 5LKAA 5K5EA 1VE6A 2XDWA 4FBLA 1EX9A 3G0DA 1MX1A 4TPKA 2BUBA 2V96A 3U1TA 1WB4A 1AGYA 4EY6A 2Y6VA 1ZD4A 2W22A 5AKZA 5DJ5A 1N5MA 1KU0A 2XUKA 4B7ZA 3FYUA 5E4JA 3PFBA 1MAAA 4NMWA 4J03A 4FLMA 5AI5A 4KAFA 3F67A 4BAUA 1CUUA 1SCIA 5C7YA 4J0IA 4O08A 5EIHA 1BRTA 4X71A 2CB9A 1AURA 4G9GA 2DHDA 5HQ3A 1G4HA 2I3ZA 5IKXA 1H22A 3AIOA 2H7CA 3C6ZA 2IITA 2DFPA 5F4ZA 3QPAA 1Q83A 3O4IA 5J3JA 4AMYA 3VJLA 1EH5A 3BXPA 2QUAA 5I8PA 1QO9A 1R3DA 1CUZA 5EI5A 2G63A 3HRHA 2OCKA 5K3CA 4ARBA 3W9BA 5HFAA 5I7UA 2VATA 1DX6A 1YAHA 3KOOA 4X3CA 3CCBA 2QUBA 3LIIA 5JAOA 4L3WA 2QJWA 3M83A 1BEZA 2VAVA 3OC0A 1GKKA 1FSSA 2VEOA 4BE9A 1UOOA 4JUIA 1E3QA 2JGFA 5BOVA 4FWBA 2GBIA 6YASA 2HRRA 2FJPA 3BL8A 4WY5A 2XE4A 5EHXA 2PSDA 5IVKA 2YH2A 3R3WA 1CR6A 5HFNA 2PBLA 1H23A 2XMQA 1CQWA 2ZYSA 3OG9A 2ZSIA 1IUNA 2DR0A 2JEZA 2B61A 3R3VA 3T4UA 1XLWA 4G8BA 3PDCA 5AOBA 4H7EA 3D2AA 3H04A 4LKOA 3KSRA 3JWEA 3H2IA 4KR0A 2OQVA 3OM8A 4RNCA 2Z5GA 1FFDA 5ALNA 1L7QA 3C43A 1WPXA 4B0OA 2OAEA 4JYMA 4MYDA 1AC5A 1XZAA 2WIJA 3OPMA 1CUJA 1P0QA 2XUFA 3D3NA 5CW2A 4Q82A 5ESRA 3O4JA 5ALFA 2OQIA 4Q3OA 1J06A 3EQ7A 2HM7A 3QMMA 4YPVA 4LHEA 3ILSA 2Z8XA 4BCBA 4GHWA 3HEAA 5AI6A 3DD5A 5A6VA 4FLEA 2XUPA 1R9MA 4S0XA 3VJMA 2NW6A 5K3BA 5AKHA 5JARA 1XQVA 3V1KA 2C5GA 3G9XA 5EHZA 1SC9A 1H2XA 4H7HA 3I2FA 5AKLA 5DYTA 5CBKA 5CMLA 3WWOA 2PSJA 2XQIA 5AK6A 5A7GA 3G0BA 4HAIA 4H7KA 2CJPA 1FJ2A 2OLEA 1AX9A 1ZD3A 5HF6A 5AKYA 1MN6A 2ZYIA 2GZSA 5FV4A 3G9TA 1RYYA 1W75A 5T4FA 1ZI6A 3V1NA 1XZMA 1LPSA 4W1PA 1JU4A 1QJ4A 4UBOA 4AO8A 4DSZA 3WA7A 2X8BA 3WK4A 4JH0A 3JYHA 4G5XA 4HXGA 4LXGA 3F9CA 1Y37A 3QZUA 5ALSA 4GW3A 2C0PA 3V1LA 4PSUA 3WL8A 4EBBA 3O4GA 3AZOA 4J0DA 4Y2JA 2I78A 3B5EA 1WM1A 2GYWA 4K5QA 2PUHA 3LS2A 4U2FA 2WUDA 5HK8A 5SYNA 1CUGA 2WIDA 3FWHA 1QTRA 1EB9A 3VVLA 1G66A 5DTIA 4BAZA 4OU4A 2WIKA 1GQSA 4XIIA 3PICA 1QE3A 5C8VA 4UBKA 1QONA 5ALLA 5ALPA 1ZGCA 5AKIA 5LZ7A 4H7JA 3O4HA 3KWFA 1JJFA 5AK4A 2WJ3A 2J3DA 1XRNA 1QIKA 1QIGA 1AZWA 2Q0XA 2YYSA 3STVA 1JJBA 2I3DA 3G7NA 4EB0A 1AUOA 4HXEB 4B85A 4BC0A 3C70A 2DHEA 3DYVA 5IVDA 1HKHA 4IO0A 3NWOA 1WPRA 4P08A 3I6MA 4HRYA 2GBFA 4X95A 4WDQA 2G4LA 1XQYA 3Q0TA 4A5SA 1DQYA 3DJYA 2GYVA 2PL5A 1XRLA 4C87A 2VTVA 3R40A 4K6GA 5EGNA 1GPNA 4OPMA 5AM4A 3AIMA 4D9JA 5AJHA 1SCQA 5AHXA 1FFAA 3G02A 2HDWA 1LPNA 2OGSA 1Z68A 4QE3A 2XUJA 3QVMA 3H17A 2WTNA 2V9ZA 5ALKA 4UHCA 5JAHA 3ZI7A 2G5PA 5CT5A 2OCGA 5T4EA 4CIAA 4KEAA 3AUKA 3L1IA 5K3FB 4Y2RA 1M33A 3ICVA 2FUKA 1F6WA 5C8XA 1CUAA 4W63A 1I6WA 3WZLA 3WWPA 5ALQA 1Y7HA 2XT0A 4BP9A 2WG2A 4AMZA 1DWOA 3WYDA 4NS4A 5AKKA 3TEJA 3UUEA 2HA4A 2HFKA 3ICWA 3A6ZA 3FAKA 4YASA 1K5PA 3D2CA 5EHNA 3WKCA 3TJMA 4PSCA 1C7IA 5ALZA 4C4XA 3FVTA 1GXSA 3RARA 3WJ1A 1LBSA 1R4ZA 2H9YA 1EK2A 1VJ5A 1LZLA 2QR5A 2ORYA 3GFFA 5DNUA 2AJ8A 2PKYX 4WDRA 4F0JA 1TCAA 4BTVA 1ZICA 1J1IA 3R41A 5EIAA 4QDUA 4IQ4A 2ZYRA 1CQZA 4Y2SA 3NGMA 3C87A 1XQWA 5FKJA 4MWTA 4BRSA 5LYYA 5CT9A 1EDEA 2HADA 1SCKA 5ALWA 4BDTA 1CFJA 4XJVA 1ZJ5A 2WILA 3I2JA 4J0HA 4XVCA 4MQLA 4KE8A 3FSGD 4AB1A 1BCSA 1HQDA 1UZAA 2O2IA 3E3AA 4U2GA 2WHPB 1TKRA 3GZJA 4H7FA 2JBWA 3N2ZB 1KU6A 1U2EA 4K6KA 1E66A 4OYYA 1ACJA 3I6ZA 1IMJA 3AZQA 2J4CA 1NU8A 4QEKA 3DEAA 4B6GA 5CXUA 3ZWQA 1XFDA 3CCCA 2QRUA 1T2NA 1XLUA 5AKGA 2XLCA 3IIIA 5ALEA 2JGMA 2JGKA 3WK7A 5AI8A 1B41A 3WKEA 4C4ZA 3I2GA 4OB7A 3EF3A 4C89A 5ALXA 2XQJA 2ROQA 3STWA 4EY4A 2WTMA 5IVHA 3ESAA 5ALVA 4I3FA 3I28A 4B0PA 2QS9A 5FLKA 2X5XA 5IH7A 2BKLA 4UUQA 3E4DA 3IB3A 1QIIA 1MX9A 2PSHA 3WA6A 3C5VA 4KACA 2XMZA 4MEAA 4BE4A 1LPOA 3DKRA 1XZKA 4BRZA 3HYSA 4P9NA 1EVQA 4FMPA 1AKNA 5CRIA 4E46A 2HIHA 5JADA 1W1IA 2QJRA 4CCYB 5I9IA 1R50A 1DU4A 7YASA 1CEXA 4J0JA 1GT6A 3F8SA 3HXKA 2RHWA 1LPAB 2I03A 4F21A 5FXMA 2H7YA 2P8SA 2VT6A 3FYUB 3WK8A 1XZEA 5JD4A 4DLNA 4MQMA 4H35A 1ZIYA 3QMVA 1MU0A 4M0MA 3WL6A 3KXPA 5A71A 1JMYA 5FP0A 4N5IX 5LP1A 3PI6A 5KBYA 1VOTA 1WB6A 3KWJA 2WHPA 3VVMA 2WFLB 5ALYA 4DNFA 1N5RA 2JEYA 1W6RA 3C45A 1J2EA 4X94A 2RGUA 3A70A 1PJAA 1EINA 2XMSA 1IUOA 1XRQA 3ZPXA 4OUKX 4LXHA 3BJRA 1GPLA 3EIOA 3W05A 5JD6A 1FFBA 4RPCA 1EA5A 4KE6A 2WFZA 2WQZA 4W9RA 2V98A 4G9EA 1CUBA 3D7RA 4HVTA 1VKHA 5CTAA 4J0GA 4W1QA 3BJMA 1LPMA 3G0GA 2FX5A 3MGAA 3WL7A 3G0CA 3DCNA 3I2HA 1J07A 1ZOIA 3W04A 4PW0A 1F8UA 1C4XA 3GA7A 3O0DA 3DDUA 3SK0A 4FDMA 1CLEA 4W1SA 4WFIA 4OB8A 5CT8A 2X76A 5CH3A 2XMCA 3IBTA 2PPLA 2EEPA 2PVSA 2WKWA 3M82A 4N8SA 4Y2YA 3DOIA 4H18A 3GBSA 3M3DA 4Q05A 4H7DA 1X70A 1QIFA 2QM0A 1L7RA 1ODCA 2WIGA 1O6GA 5K3FA 3LIPA 4X90A 5JANA 3OTQA 5DNWA 4BCDA 1QFMA 4X85A 3SWWA 3H2GA 4Y7DA 2XUIA 5AM0A 5CH8A 2LIPA 3R3YA 2OG1A 4Z49A 3VXKA 4F60A 5HKAA 1SFRA 3FLBA 3ESCA 4HTAA 1H2YA 3FYUC 1W52X 5HF5A 5DLPA 5LLSA 3MVEA 5BWBA 4H0CA 2RIPA 5AP9A 1ODSA 5ISMA 4UHHA 2O7RA 4I4CA 5ALOA 4BC1A 5AI0A 3R0VA 3I1IA 5FPQA 3V1MA 3QPCA 4Y2UA 1TK3A 3DNMA 4J0KA 3PFCA 1IUPA 2WJ6A 4PSDA 5T4HA 3WKBA 5AIBA 2CBGA 1U8EA 1CPYA 4OSEA 5KWJA 1DT3A 1LPPA 2DHCA 5AM1A 1YB7A 4ZRDA 1XZFA 1YA8A 4FNGA 2CEKA 5BV7A 2RONA 4Y2PA 4EZIA 1UT6A 4MYSA 1GPKA 3WWCA 2J3QA 1UK8A 2HA5A 5JZ9A 3QM1A 5FPPA 2D5LA 2BFNA 2ZSHA 5EIEA 5LKRA 5K3EA 5D7BA 3ESBA 2C5FA 1QIHA 4JEIA 1QFSA 1GZ7A 1RP1A 5A7HA 3STUA 5ALHA 2BGRA 3FVRA 5KWIA 3C8DA 5LZ9A 2VJAA 3UMJA 5AKEA 4CG2A 5ALJA 3EQ9A 2RI6A 2Y1KA 5FRDA 2EDAA 3K6KA 2ZJ7A 2OGZA 1VXOA 4M0EA 3R3UA 3IUQA 4J0CA 4CI9A 1C7JA 3D59A 3FBWA 4E15A 2ZJFA 3B12A 2HHAA 3H0CA 5E4YA 3FLAA 4G1FA 1CV2A 5LIPA 4X6UA 2AXEA 4J3JA 1G42A 3F97A 1TCCA 4DNOA 3DL7A 1F0PA 2WSLA 2HFJA 1YR2A 3D0KA 3WWEA 1GKLA 4IH4A 2HA0A 1PV1A 1O6FA 5T4BA 3BF7A 5AI4A 4UBNA 1CUDA 2AJDA 2E3JA 2OCLA 5C8ZA 2DSNA 3W2TA 1EDBA 5ALGA 4ZXFA 1BS9A 1UK6A 3R3XA 3HACA 4MXDA 1DQZA 5EFZA 4X00A 5E4TA 3HC7A 3WWDA 2JIDA 4N8EA 5LZ8A 5AOAA 5AH0A 4FHZA 5JATA 5LZ4A 1UKAA 3E0XA 1MJ5A 3AINA 5JAUA 1CUXA 5AM5A 3I2IA 4BTLA 3G8YA 1NU6A 1ZI8A 1UFOA 4OD0A 1XZIA 5FUMA 4B9EA 2GBCA 4KJXA 1YB6A 5JD5A 1IZ7A 4X93A 4EY5A 5DWDA 4JYPA 4EA6A 5H3HA 3A2MA 3H2JA 1JT2A 3STXA 1QLWA 4UHBA 2W6CX 4BVKA 4G4JA 4QWMA 4QWWA 4B84A 3ANTA 1AMNA 4UPDA 1A7UA 5LZ2A 1N1MA 2XMDA 2VSQA 4E11A 1TQHA 1VZ3A 2XI4A 1MX5A 3B3QA 4JNCA 2XUOA 1ZI9A 2UZ0A 1JJIA 1MPXA 5JALA 2AJCA 4CFSA 1BCRA 4QDZA 3G9UA 1RWQA 5EHQA 1WCYA 4MEBA 1BN6A 3FLEA 1Q0ZA 3WK9A 1ORWA 3IUMA 3C5WP 4DM7A 1W76A 1TRHA 2Z3WA 4QA9A 2PSFA 1YS2X 3RK4A 1E89A 1BU8A 1Q84A 3Q8WA 2WFLA 3IULA 3V48A 4P93A 1YA4A 4KRYA 4BP8A 4U2EA 4ZWNA 4U2DA 2ZYHA 4DMHA 3LP5A 5D3KA 4AX4A 1XZLA 4TVKA 3BIXA 1A88A 1WHSA 1LNSA 4DYHA 3L1JA 2H7XA 3FCYA 1VZ2A 2OAGA 3ZLUA 2B4KA 5AO9A 1XROA 5AK5A 3FOBA 1QTIA 4OU5A 3O9MA 4QDXA 1OXMA 4WFJA 4K6HA 2RAUA 5AIAA 4CCYA 1R1DA 2PX6A 3H1AA 3D2BA 4GBGA 3HI4A 1CUIA 2QXUA 2HA6A 1JKMA 4MWSA 3UUFA 2XQKA 1KEZA 2WIFA 1PFQA 4C88A 2O2GA 2QKYA 3W06A 1S8OA 4Y2TA 2XMGA 4DMFA 4NZZA 2FJ0A 2PU5A 1XKTA 3S2ZA 1EHYA 2G5TA 3EBLA 4FLFA 2B9VA 5HQ3B 1CUHA 4B9AA 1R88A 5E2IA 5DNVA 1YCDA 4Y9SA 1HBJA 3QPDA 3SX4A 4PQEA 2ZVDA 2R8BA 3HLKA 3YASA 1DWQA 3E1GA 4ZV7A 3IDAA 2YASA 1X2BA 1XKLA 2GYUA 4C4YA 4AZ0A 2ONCA 5YASA 4BZZA 2CMFA 1UWCA 4LYDA 3WK5A 1GGVA 4CG1A 1CUEA 4UBIA 5CURA 3H2HA 4LIPD 4UHEA 2C0QA 1VXRA 3H18A 3WI7A 3WKDA 4U2BA 1UOPA 4AN0A 4UHFA 3VKFA 4UHDA 4KYVA 3FNBA 4ZGBA 2K2QB 1H2ZA 4LXIA 3G9ZA 4QLAA 4DMKA 1QIMA 1HDEA 3C6BA 1E8NA 3BF8A 3WQHA 1NX9A 1XQXA 2WLSA 4BAGA 1TIBA 4Q3KA 3V9AA 2QT9A 4Q34A 2XUQA 4H77A 3W9UA 3KDAA 4HS9A 3FSGA 2HA2A 2PM8A 4L72A 3C6YA 2RHTA 3M81A 2XMBA 5HF8A 4EY8A 2BAGA 3X3HA 4QDOA 4FFWA 3AILA 2HA7A 4FFVA 1XZJA 4E14A 4WJLA 4B82A 5CT6A 1EXWA 5HF9A 2JGJA 1QIEA 4IHAA 4AXBA 4X91A 4C01A 4IH9A 5JAPA 2CZQA 3ED1A 1VE7A 3QBJA 2AJBA 1OCEA 4N8DA 3C6XA 1ZIXA 3L1HA 4G8CA 1JMKC 3U0VA 1U4NA 3WIOA 1E8MA 4EUSA 3HZOA 3HSSA 3D4LA 4WFKA 5ALMA 4ZV9A 2XUDA 4X6YA 4DMCA 4DTCA 1FFCA 4IH1A 1E5TA 4B83A 1XRRA 2DCMA 1P0PA 1QGED 1MNQA 1YS1X 1FFEA 2XLBA 4QLOA 3PF9A 3IUNA 5AM2A 1QZ3A 3TGLA 1U65A 3O95A 2PSEA 3DYIA 4UFOA 4X7BA 1USWA 4BVJA 4HXFB 1XZHA 2WHRA 4L0CA 5A62A 1ISPA 1HLGA 2BUCA 2VAXA 1N8SA
chains in the Genus database with same CATH superfamily
2WTAA 3WGGA 4E09A 1GQFA 1QB7A 2JA1A 2EP5A 1MNAA 2AE1A 4FMBB 1ZJ4A 4MP8A 3DL4A 1SXHA 5A05A 2OXEA 2YY5A 1WOYA 4I1IA 4V0KA 2PMWB 5CGZA 4AO7A 4HCJA 4CM3A 1SG9A 1TVKB 3WRYC 4PYKA 5AVUA 5EJ7A 1UPUA 3A3OA 3D6TB 3IQHX 4RVUA 4EW6A 2IUEA 2IHJA 4TYNA 4B3SB 1G7SA 2W6ZA 3A2NA 3ET5A 3I92A 5ESDA 1B0ZA 2ZB8A 4QAQA 3E7XA 5CUQA 5AM3A 3NGLA 5A5GA 4F3TA 3B9BA 2EG5A 1YASA 3NYRA 4ND5A 1DINA 4AN1A 1JFLA 1LEHA 2FSFA 1QV7A 3T1OA 4J7AA 1SJ9A 2GEFA 4DUGD 1PZEA 2PD4A 1J8DA 3DKKA 3TPCA 5AXAA 2LTAA 4LYEA 1XMIA 4MMXB 3KSMA 5AW1A 4FDLA 5I4CA 3AHFA 3NHAA 1KEWA 1V11B 3OUZA 1AKUA 4IIUA 4JIGA 3RS8A 3LDHA 2XYHA 1T2DA 3V4LA 5TE9A 3FX2A 3EFEA 4LVNA 5JD3A 1F38A 3IJ5A 4CM4A 4DLBA 4KOEC 4ITVA 4AZ3A 2ACKA 1DAFA 2JJMA 3AF5A 1NVVR 2V5AA 2ZRNA 1O58A 4BQRA 3U49A 3V4FA 2QORA 5J58A 1LH0A 1JKXA 1PTJA 2GN4A 4MQ5A 4C03A 2KX7A 3PQ8A 1YAJA 3KVRA 5TR9A 1XO1A 4XD7D 1FJXA 2XBMA 2P0AA 1HC7A 5IKOA 3EK2A 1XVVA 4L9AA 2VRCD 4L4RA 5C1PA 5JYEA 5A02A 1CUFA 3GJ3A 3H2KA 5GAJA 1JRLA 4E31A 4IF4A 4IDNA 5DU2A 4G4IA 1CZKA 1NQ5A 4MUXA 3D8TA 3FPLA 3FZGA 2QUKA 2ZKLA 4Q9HA 4CU2A 4CEJB 2IS1A 4ICIA 1D4FA 3IKTA 2NXCA 3PHJA 4NBUA 2I1QA 1N6PA 3SS7X 2V97A 1ATIA 2YJTD 2XCTB 5JNLA 3FCCA 5E2AA 1DIBA 3AY3A 3I8SA 1SKAA 4IDGA 3B9QA 4UUPA 2OCAA 4D80A 1WCV1 3S1SA 3DQQA 1KDPA 1LSJA 2JASA 4O1IA 3T9DA 2PO7A 5AJXA 1NBOA 1Q2UA 5JVDF 3QELB 1NFFA 5H70A 2HMYB 1RXYA 4UATA 2VUTA 1VHLA 1QV9A 4PSKA 4XVHA 3AUYA 3H19A 4M7PA 3NBZC 1GNSA 4LQLA 5T6MA 1UKCA 2QQ5A 1ZH8A 3AJ9A 4DGQA 3EX7C 1N78A 2JBHA 4D7AA 2FPGA 2HJSA 1FY2A 3A1WA 3K0EA 5I9LA 4RCZA 4JI4B 3GRFA 2OCIA 5CB4B 1XKQA 4P38A 4EUEA 3KPVA 2BGKA 4I19A 5LOVA 1OXKB 1IONA 3DQZA 3ET4A 2QU7A 1J33A 1IY0A 2N75A 5K03A 2VZLA 4I6EA 3DPUA 4QUBA 2JI6A 3OFJA 3KQKA 1E4YA 3LW8A 4HN2A 5I7VA 5JZBA 3S8YA 3ESYA 4CQMD 3A9TA 3KJIA 3L7LA 2GETA 3K16A 3B52X 3BJEA 3DPIA 3KYCA 4IQGA 2MOKA 4H7PA 2XNKA 5CHEA 4OHVA 2MR6A 5BYBA 2VTKA 1MCZA 4RLFA 4EUKA 1HYEA 2J1LA 3DBHB 4PNEA 4G0VA 3K9BA 4GMHA 1SD5A 1VPLA 3HFSA 4R0NA 5CP8A 1Q14A 4OHBA 4GZ3A 4KN5A 2C7GA 2JGIA 1LQTA 3GRPA 4YRZA 5CG1A 1ABFA 4QOGA 1RHMA 5F51A 4FEAA 4DJTA 4BVEA 1YI1A 1SU4A 1GSIA 2V6GA 3I53A 3WLOA 4HLQB 5LZ5A 1RKUA 3OTWA 4RANA 4UM9B 1B16A 3EZXA 3M6FA 5EQFA 3TBHA 3DF9A 1V6CA 4D5GA 1FW8A 3ADPA 7REQB 4UARA 2A9VA 4D9BA 4ZU1X 3T7IA 1I6KA 2VK1A 3A10A 4OFWA 2VF2A 2V1XA 4R7GA 4RPIA 5CA0A 3RJZA 4DTIA 4DCNA 2VPZA 1TF7A 3E3LA 3V4SA 4CQMA 4NCHA 3SC2A 3GDGA 4PM4A 1J5EB 1CQJA 1J1UA 4CEHA 1JLLA 1RE0A 1ADBA 1ZYUA 5PNTA 2LDBA 3A2KA 5EE9A 4B76A 4BO9A 2J9RA 1M7GA 1AXGA 4Z2YA 1PW5A 3OM9A 1Z4JA 3IIKA 3QP9A 1G6KA 4PPQA 4GXNA 4TQUS 3T3MB 1WXFA 2VPQA 3PFNA 3UKJA 3V8VA 3J80A 1K97A 3GJSA 4OV6B 2AOVA 4GGOA 4XOUA 3ZE6A 3PEFA 4JA0A 5AVSA 1SKQA 2EP8A 1HFJA 1W4ZA 3PGVA 1FX0A 5JS1A 2HUNA 4H4CA 5C8YB 1SBNE 3P5SA 4BQPA 1XOIA 4FR2A 1ESDA 1S3GA 1SVIA 3WV4A 4MVJD 1QFYA 2PZMA 1NM5C 4NYMR 4UM9D 2TECE 4YNBA 5T57A 1CVRA 1KKLA 3HMQA 4KO4S 1U9IA 4QNNA 2IZ5A 2XT6A 3ZDCA 4R3UC 4WMLA 3KPUA 4H15A 4XPIA 1XEWX 3TL3A 1OWNA 4KFUA 2B78A 1Z33A 1J20A 1Y8QA 1JG4A 2W4QA 2Z58A 4F5ZA 1XRMA 1A2KC 2XWPA 4PLPA 4TL7A 5LNK6 3LXMA 3IV9A 4FM9A 2ZJ6A 3IURA 4EH1A 1RM3A 2O2CA 2LNDA 3AF3A 3H9GA 3NVAA 1RKXA 5A6SB 5JCOC 1Y7TA 3H4MA 3CB4A 4ONEA 4WKGA 4ZZ0A 2BF7A 3NC0C 3AW9A 3C3BA 2AR7A 4PQFA 3TLGB 1I6LA 2OQRA 3VC3A 2AC7A 2FVYA 5L51A 1NVWQ 1I7LA 4JBXA 2GZRA 2ZQYA 3CJQA 3LDUA 3A9RA 2IDMA 1C2TA 2H59A 2WUEA 1HT1E 4HYYA 3EPKA 4GZLA 1X74A 3H9CA 4UFPA 4K3UA 2R1TA 4KREA 1GCAA 4OL0A 1THGA 1KAHA 3ADKA 2C07A 3MUFA 5U4XA 2YOHA 3VNBA 2CL7X 4DIMA 2B1JA 5C4IA 4DB4A 2G8LA 2NO4A 4UU1A 2KYRA 1IPFA 1IBRA 5BW4A 5CB4F 2AQIA 2LP4Y 2OG2A 2W6OA 4PG4A 5D85A 2JPDA 3DO6A 3MSCA 2WQ7A 5K2MA 3KYCB 1DDIA 1YU9A 2GZ3A 4R7ZA 2D0PB 3PVCA 1CUCA 1C1XA 2I4TA 2P9JA 2XB6A 2ZT7A 3QVTA 4NYJR 1VBFA 4P53A 4PC2A 4XIJA 4NWIA 5FX2A 5HOEA 1J4AA 2GWRA 4ZZ1A 3KOMA 3VX4A 1JIVA 2GBGA 1U0HC 1I0ZA 2P9CA 3E2MA 4IJVA 4TYQA 1TKCA 1LDBA 1X92A 4MPTA 3QYJA 4JOSA 1NBWB 6Q21A 4IMIB 4OXKA 3T9EA 4ID3A 4P32A 4BO1A 1COZA 4IDHA 4FBMA 3L9WA 3L4KA 1ECFA 3GO4A 4ZOLF 5FLEX 1A9SA 1XB2A 4D9NA 5HBRA 4PAGA 3KZ1E 3GUYA 3K0CA 3OURA 1ACLA 3HVJA 4LRXA 4O5AA 1Y7IA 2BUAA 4JV5B 2XKJE 4C4AA 1VG1A 1ZCAA 2XYVA 1F0YA 3EFOB 4XEUA 4OJMX 4EI2A 4XVUA 1HY3A 3NTVA 1YCGA 4L4XA 2GZAA 1TM1E 1LLFA 4LFCB 4MJ3A 3CVOA 1E94E 1G64A 3L84A 5E6RA 1R10A 2Y2VA 1W44A 2GEVA 3AX6A 3TSOA 3EEQA 3BTOA 1DBSA 3VDQA 5HR5A 4YCMA 3TB6A 1WUIS 2I9KA 4X97A 1CRPA 3DLTA 1ACMA 1L6RA 2PGLA 2WFAA 3TD9A 1CUSA 2NO6A 4LJ6A 4LZZA 2PU7A 4MPJA 2ONYA 3OOSA 1GTL1 2GD2A 1PYDA 4OO3A 2I29A 2YJ5A 4FFDA 4M46A 4P3YA 2I33A 4PX3A 3NYWA 3CNQS 3PWSA 2WUFA 5FULA 1K63A 4LKRA 4DGSA 1P6UA 5EZSA 4IZ6A 4EOGA 3BD6A 2DXIA 1VA5A 3KD2A 4KYUA 2BEKA 1T1GA 1UMBB 2QM8A 3WSVA 5JIBA 4IVRA 3WNQA 4WCDA 3SMVA 2RCNA 4IZHA 3K9FC 1KEPA 1R9GA 1Z4OA 5LPNA 3LQFA 1K7CA 3FF1A 4KQ6A 4M53A 1KOLA 4ZOCA 4DQVA 5KAPA 4RVDA 1AQJA 5IJWA 3OTHA 2YRFA 2XUAA 2BC9A 2B1QA 2OBFA 4M0CA 4EUHA 4AF6A 3KKEA 1R8XA 1VP3A 3EXHA 4PY2A 1QU3A 2XADA 3WHLA 1AS2A 4CR7A 4EKEA 2WMOB 3VDMA 2ZRDA 1E2FA 5KWSA 4D02A 4JQSA 2JGEA 2FR8C 1TEXA 2ES4A 2GPAA 1YRHA 2WF8A 3RUCA 4P3PA 3WXBA 1X7XA 2XUGA 1NXPA 2I67A 3BX1A 3NRCA 4AJEA 4ARZB 4CMIA 5IZCA 5K4GA 3OAAD 3T3HA 2XQFA 4R2MA 4KN6A 4E88A 2IZZA 3QOWA 4DHEA 4JEUA 3FN4A 3OZBA 1ZCJA 2ILVA 2NN3C 1JQKA 1H2EA 1PJTA 1GPDG 4G0XA 4B2LA 3ZD7A 3JV7A 3C3WA 4EP1A 3NASA 3CPEA 1ITZA 1G5FA 1NQOA 4WCVA 2H3EA 2Q3DA 2NTVA 3G2MA 4Q3LA 3VR6D 3CT4A 4B35A 3ZCVA 1UOEA 2CNOA 2OC9A 4KIJA 3HCDA 3QNWA 4MIEA 4EW1A 3O4FA 3CVJA 1QRSA 2I3GA 1EB8A 4KQWA 3P0EA 3FYDA 4EG8A 4PAQA 3PFHA 1QHXA 4GGMX 4JS0A 3MT8A 4MW9A 4B6PA 4EFKA 2QMEA 2BFDA 5HM6A 2O0KA 2ERCA 1K6EA 3EZ2A 4LVCA 2WU1A 4RDHA 4D4KA 5BNZA 5K8TA 1KQGA 4ALMA 5SYAA 2WM2A 2Q1SA 5LFAA 1E60A 2BHRA 3VR2A 3KSZO 5BSFA 2NO0A 1EK0A 3N75A 5KVSA 1J70A 3OX1A 4DNPA 4X64B 1Z0AA 3LSYA 4A2CA 2CV0A 3J7AC 2MDTA 1WVIA 2YZ2A 2OWDA 6ADHA 1SZPA 4YA6A 2AK2A 3UATA 4IKPA 1A7KA 1NJFA 1Y63A 3I42A 4YCLA 1D6JA 3OCCA 3WKAA 3UEOA 4Z9BA 4RENA 2RGCA 3C3DA 4FGKA 2QTVB 4A16A 2BGNA 3E35A 4RNDB 1GNTA 4JLOA 4KXFB 1KSFX 3V8NA 2R0QC 3OJ0A 2HH9A 2O0JA 4H7IA 4KW7A 3OUTA 3LPDA 4C76A 5DYGA 2VSFA 3AFIA 3BGWA 2BFCB 1RCTE 2JLQA 4CDNA 3LD9A 1F8XA 2MT9A 3LCCA 1X0VA 3OX4A 4HP8A 4YS6A 3NHWA 1POWA 4FHGA 2H48A 1NN3A 2EWMA 3OT5A 3O8QB 2AW5A 4OHPA 4YJGB 3N6XA 3SXUB 3VU9B 3QY9A 2CLEB 1V8FA 3MWEA 5D3MA 3I23A 3RU3A 3RVKA 4GYJA 3WQRA 2OBXA 2NUPA 1UJ4A 4RQUA 2Q2QA 2QTAA 3CH6A 3C1UA 4ER7A 5CVCA 4DANA 4PZZA 2IPAB 4REQA 2VC2B 3PUIA 3DKIA 4GPAA 4K9LA 4JLDA 4FE3A 2N47A 4EF4A 1V2GA 2QI9C 1ADGA 1TX4B 3WNZA 1TT5A 1L7AA 1X1SA 2YCLA 1JQ3A 1NVBA 1PDWA 1ZVJA 4I4TB 5JC1A 2EYQA 3DXZA 5F2NA 2DBVO 3ZE0B 2QX6A 3PC8C 4QL3A 2OBLA 5BSKA 2CDBA 4RVHA 5KJEA 1S7CA 3JAKA 1H2WA 4HQ6A 4N54A 1NR5A 1KO4A 4FFMA 3WGVA 3ACDA 2XZPA 4BLTA 5J2UB 4DR2B 1VJCA 2A59A 3GJXC 1MGPA 4M1QA 5HE9A 3RANA 1QNLA 4JB8A 1GA6A 2BEUA 4W8HA 2RD2A 3CVYA 3MD0A 2PS9A 4BLUA 4ZDWA 2EERA 2VWQA 5JDIC 3JQ6A 3U5TA 3FHCB 1VFNA 1R64A 2MJLA 4Y2VA 5FFMA 4BNLA 1BG6A 4E5UA 5FBVB 2R7LA 1QGUA 3HVHA 3RFXA 3T5DA 1HWYA 1ZD9A 2H65A 1EMDA 4AKHA 3CIOA 3KB8A 1D7AA 3M9LA 2IZ6A 1K4YA 1LBEA 4C14A 4CT0A 4UMVA 1NE2A 3EHEA 4EB3A 3MJCA 4BJ1A 1MJHA 5FI1B 1W5SA 1UAYA 1E0KA 3GW8A 3OHSX 1X2EA 5KINB 1SOVA 3NC4A 4HGQA 3FYTA 4QULA 4F5DA 4F1WA 2IX9A 4X8MA 1OBOA 1VLQA 3T9AA 2J5RA 1J5XA 4OI1A 4B81A 3EQZA 2QAGC 1L7DA 1ETHA 3ZLVA 4AWXA 5EQTA 4B87A 3PX7A 5B1EA 1KFBB 3CX3A 1B73A 1HQCA 1UBUS 2J5XA 4OQDA 1ZY2A 5TARA 1YQWA 2H31A 5I7RA 1MP0A 1UZUA 4ERXA 4US1R 1V6AA 4WZBA 1MABA 1RKBA 3U61B 1RJFA 3IT1A 3WFJA 4V3BA 4D43A 1JI3A 3EQ8A 4ZVQA 3ILXA 1Y4UA 2YJ4A 5ADUS 4B3DA 3VISA 4ZYLA 1JE1A 4IJ5A 4HD8A 4W8GA 3QMPA 4Q1VA 5AHKA 1CVLA 2TMGA 1XDDA 3SZMA 3LHKA 1HA3A 2JLXA 2RGYA 1RABA 3EBPA 4DJEC 1V25A 1G3UA 2Q50A 1D6NA 1YDEA 2RGNA 2R62A 3I9MA 4KBYA 2B3TA 4AZ0B 1E9BA 4DT1B 3ILYA 5TT0A 2WU4A 2ZRJA 4P4GA 4DLTA 3JTMA 4NESA 5LBUA 5JAMA 1SKYB 4L76A 5LKAA 4GX1A 2BP7B 3HI6A 2DCUA 1E9DA 1WS6A 4CODB 4TLDA 2HGSA 1G4AE 3GFOA 3GDFA 3KL2A 4NI5A 4NV3A 4PTLA 4G5OA 1AMOA 5IRCD 3K71B 3ZGZA 4RXUA 3RK1A 1QAOA 3FFBA 3VR5H 2YZMA 5K0TA 8ATCA 2JZOA 1F2TB 1XDUA 2AG8A 2REQB 2EXXA 2WRZA 1MX1A 3G0DA 1KRWA 1A8PA 4OHRA 6REQB 1ZPDA 3OE5A 4L73A 3F90A 5KSOA 3KEFA 5ER6A 3H5WA 4FOSA 1E4VA 1XV5A 3NVDA 5AKZA 4G84A 1IBMB 4XEHA 1DLJA 1R5JA 2ATEA 2WZQA 1M9NA 4OH1A 4OK3A 4G2NA 4R1OA 1ULTA 4C21A 2G1PA 1S2DA 1SEPA 2Z30A 3OJEA 3IXQA 1A69A 2VDQB 3P5BA 4B7ZA 1DOHA 1PNQA 3QKSA 1T10A 1T3GA 2AFHB 3Q1KA 1WEHA 4IFIA 4CBVA 1FJGB 1IIRA 1BC5A 2NTEA 2QIPA 1MAAA 4IOMA 3UB2A 1EDZA 4YBZA 5ES4B 1FU7A 5CA0F 4LBYA 2NVOA 4QUHA 5AI5A 3TZLA 3F67A 1Q57A 1UC4B 1RYNA 3LWDA 4RJ2A 5C7YA 1ZLYA 3G6WA 4I0WB 2IV3A 2IXGA 1ZVVA 1RM4A 2C4WA 1SUDA 4E5DA 4O08A 4XUDA 3LUPA 4BFCA 3GD5A 2A0UA 4DL9A 4Y30A 1YE8A 1C9DB 1H42A 2J0UB 2C4KA 2H8KA 4G9GA 4URHA 4DABA 1H3FA 1QM5A 1ZIDA 5TV2A 1ZUNB 2QENA 1WUJS 5HQ3A 3KKKA 2R79A 2VFAA 3DEIA 1MO6A 5BSRA 5IKXA 5AD1A 2QW8A 3V32A 2WAAA 2ZUSA 3AEQA 4OL9A 2TRSB 2OOSA 1JHDA 4BASA 1E7SA 3IKJA 1Y1PA 1YZVA 2F7SA 1ZNXA 3JYLA 2R86A 1W5AA 3EARA 2DFPA 2ZSJA 3CF0A 4WASA 2XXJA 1T4GA 3CF2A 3QPAA 5B3LA 3IR5A 1C8BA 2VUSA 3OJOA 1Y48E 4OAOA 1R6TA 2PRZA 2G1KA 1HE4A 3PJFA 5FBWB 3VJLA 3WMFA 4ZI7A 1EH5A 3BXPA 2QUAA 3MPUA 4D98A 3OCZA 3ER8A 4D9MA 3QVGA 1EX6A 1R3DA 3PYMA 1M34A 4KDCA 4W7HA 1SURA 3VKVA 2IE0A 2G63A 5EI5A 3PEWA 3F6BX 2RH5A 3IVAA 1CZLA 1A96A 3QWBA 4FW9A 4PU0A 1OYVA 1CK4A 2B4TO 3GB9A 4PBTA 3CUEF 5KDOA 2NNLD 3UW1A 3NANA 4F45A 3WLKX 2VATA 2ZYWX 1DX6A 4L5CA 1ZD8A 3AVTA 2G0AA 3BRWA 1B7GO 4X3CA 2DECA 3QTTA 2QUBA 4OLJA 2ZPTX 3Q11A 1TAQA 3B20A 3OC0A 1C8VB 3M6IA 1LSSA 1OLUA 2B8WA 3EGVA 2W71A 3ZD9A 5JSUA 1R3UA 3EUWA 2OZLA 4OHFA 4OFZA 2BELA 5K6RA 3UJNA 4LF7B 5SZJA 4AICA 1E3QA 4JYCA 2D7JA 4LJ4A 5D5QA 1DEHA 2JGFA 3CH5A 5BOVA 2RHMA 4JX8A 2HRRA 4JBYA 1C3LA 5LP6A 3BJIC 3F4KA 1L7OA 1O5IA 3GMSA 1N5KA 4I5GA 4Z4EA 1QU2A 1Z25A 3E0QA 2GEBA 2X41A 4CWAA 1V8ZA 1I94B 3R0ZA 4DJAA 2ZOSA 3BFKA 2JFWA 3DAYA 3TFQA 1QH1A 1D2EA 1JTVA 4AYTA 5FOWA 2YH2A 3GLUA 1U7TA 3BRWD 4WINA 4KQJA 4OXRA 3FPSA 4DV0B 1E5QA 2JVJA 1LDMA 2UUOA 3OZAA 2PH1A 1NHWA 1Q7TA 5FPYA 2GA8A 4EEKA 1WMSA 3OG9A 3EFOA 5HBGA 2X5JO 4O4JA 4U7GA 1JR6A 4M37A 2MIIA 3AU8A 4ES6A 2IBTA 2CVOA 2X0NA 3MFYA 4C3VA 3O7MA 4K1LA 3T1VA 4UVGA 3T5BA 4C6TA 1J1ZA 2O8VA 3IHWA 4ZDKA 2CW5A 3AP2A 1WDLA 4Z9AA 1T6YA 2H54A 4KPFC 2O2EA 3ENZA 4ARUA 1O9GA 1UP7A 1LI5A 2P9ZA 1BTOA 3HUFA 3R3VA 4H6VA 4MCAA 3ER6A 1GGKA 3TW6A 3ZDYB 3NIBA 4HDOB 5BURA 1QF7A 2CEAA 3ANNA 3IMFA 4TS9A 4W9NC 4G8BA 1PI3A 2IEYA 3IT0A 1RWBA 1XA3A 4HDRA 4PG6A 4WI1A 1KZ7B 1WSWA 1ZUHA 2Y1WA 4LKOA 1Y7LA 3KSRA 2FWAA 2FZEA 2WAXA 5JPIA 5CDGA 2RHOA 1O94C 4OXNA 4URVR 3RSZA 5B6JA 2XWSA 3FVVA 4KR0A 4ZGWA 4LJ7A 1C3OB 2PMDA 1C1YA 3MC1A 2Z9DA 1G2QA 3HVIA 4YMTA 5FFNA 1MO4A 1YJQA 3X1YA 2FPPB 1HSZA 2TMDA 5EWLA 5EYPB 3TIFA 4B0OA 1S2IA 5TMPA 1P2DA 2D1YA 4QQRA 4YREA 3SSNA 3BJZA 3GLVA 4HQFA 2FN9A 5LP6C 4MYDA 3T6KA 1GPBA 4CU5A 1FUEA 1XZAA 1YUNA 3DW3X 4RTMA 2YW2A 4G1CA 4FYXA 1QOQB 1R00A 1VL6A 5CW2A 3KL4A 3LBHA 1Z7BA 4PZ9A 3IJRA 2HBQA 2WWFA 4II7A 4NCIA 3REQB 5ALFA 1NNI1 2EZUA 2OQIA 3EQ7A 3ABOB 3VPHA 3IE0A 2ADMA 5IDYA 1I24A 1L4BA 4S24A 1ZJ6A 3BMXA 3S2YA 2VRBA 4XM2A 5D51S 3T7RA 4MKGA 4NPCA 5CJPA 5T3UA 4BUJA 4BCBA 1NTOA 3F9IA 1ULHA 5K7SA 5DBEX 1X7ZB 3D6MA 2FZGA 3UHAA 2JC3A 4MZXA 4GHWA 3S2EA 2CVPA 1OAOA 1VPWA 1CERA 1GKUB 1UFQA 2IZOA 3HEAA 3DD5A 5H4GA 1HT0A 3RS0A 4UNNA 5JSHA 3TVTA 4F8EA 5MN6A 2XUPA 3ADBA 1GTMA 2OV6A 2IYZA 4HLUA 3UT6A 4ALNA 1NQWA 5K0GA 3TIGA 4S0XA 4DC0A 2ALJA 4YFYA 4MICA 4CTJA 1KC3A 4MHTA 4EPWA 5DK6A 2H1CA 1RHQA 3KVOA 4CEIA 1KDTA 2ZW9A 3AM1A 5AKHA 1ADCA 4BQNA 3LO8A 1L4LA 2WIAA 3GNSA 1NZJA 1Y98A 1WETA 5C8YA 1CY8A 1H5UA 1NT4A 3RC1A 1H2XA 2Q46A 1ZW1A 4H7HA 4KIGA 4DEXA 5AKLA 2FVXA 4DBLE 1RBQA 2I54A 3AUJB 4DLKA 1SB8A 2Z2JA 3IVCA 1F2DA 3ADOA 3C39A 3KC2A 4N0DA 2JL1A 3PX3A 1NSYA 1DIHA 1LVHA 1QK3A 3KWLA 3WWOA 1SHLA 3IAFA 3IV7A 5BPHA 4L50A 3LRTA 2J6CA 1A76A 2C82A 3I9LA 1B4DA 2IU4A 4JWKA 3WLPA 4COKA 2HYIC 5AK6A 5A9SB 2CXQA 1JNXX 2EYUA 5IG2A 1CNEA 1WQ3A 3M1YA 3TRJA 2GHIA 1UBNA 5KUTA 3GRKA 1H8HD 4UASA 4R6XA 2CJPA 5JO9A 4JP1A 4GOND 4QDKA 3CWQA 3CEAA 4ZVTA 2DT5A 1JDNA 2V7XA 3AR2A 2A3NA 3Q5EA 3R0QA 4C2TA 1ULZA 3IODA 1LRJA 2V7GA 5BN4A 2AUTA 2I87A 5FV4A 1EFKA 1RYYA 2POCA 3TAHA 4O2AF 4DR1B 3OJLA 1H93A 1XD9A 3T38A 2F1OA 1NV9A 3ZR4B 3ZY4A 3KPJA 2VO1A 3DDSA 3ZHRA 1AKVA 3CVWA 3F5FA 4W1PA 2JJQA 5E9JA 5EKUA 1JU4A 1I7NA 3BWYA 3RHFA 4RD6A 1YJCA 2FZLA 4ROSA 1FA9A 4WA7A 4XSVA 4GOKA 3WK4A 1IRIA 4F97A 2NT3A 4ABTA 1SIBE 1U0EA 5IJZA 1A9ZA 1Q15A 1JT9A 3QVSA 3P9CA 4HXGA 1KVRA 3M3HA 4CNBA 3OU6A 1NT2A 1TI7A 5FA6A 3UICA 3K70B 1QFZA 3EZLA 2X8JB 4L8LA 2RG7A 2GM4A 3CNNA 3H42B 3HZZA 1RZUA 1RNLA 3MWYW 5EUBA 4ZU6X 4HLNA 5ALSA 3AHGA 4PS1A 1V6SA 2C0PA 5CYOA 5KS2A 5IM4A 4PSUA 4EBBA 3DXYA 5CB4A 1QS0A 1GEEA 2NM0A 1XXLA 1NBHA 3GFTA 4IDAA 3K70C 3C7CB 1I2CA 2I78A 2P5SA 3FNHA 4YCNA 1SR8A 1OA0A 1CF4A 1WW3A 1AS3A 4M8SA 3HXMA 2VCEA 1GAWA 4ANFA 2OEPA 1N2OA 1XU9A 3JWIA 5ENVA 1Z6XA 5EUQB 3W5DA 1A1VA 1L5OA 3NIFB 2EQAA 1H9AA 2PUHA 2WUDA 3RS9A 3ZDEA 2EATA 1U1FA 3E4CA 1U7WA 1CUGA 5EWMA 1AV6A 5L3SA 4D0GA 4BO4A 4F85A 1F8FA 4DQKA 5E3IA 5REQA 2IKQA 3F5SA 2C3PA 4CLOB 4A0SA 2RIRA 1B8NA 3GJ6A 4RY0A 4DM3A 1GILA 3MLEA 2NU8A 5MN5A 2AZ4A 1HNWB 1EGQA 4LW8A 3ZDZB 1QLJA 2JBAA 4L4UA 3RUEA 5F52A 4DV2B 3WFZA 2GS9A 4FB5A 4JJFA 4RZUA 4C22A 4D5EA 3KXLA 1Q0SA 4XIIA 3UHOA 6GPBA 1CJUC 3PRHA 1Q95A 1Z0KA 4UXIA 5D1HA 3ZDQA 3CH4B 4UBKA 1QONA 3AF1A 3D8HA 5B1SA 2FSVC 4XM0A 5ALLA 5M5BA 2E2WA 1J09A 5EEGA 4EJ6A 2JD0A 4OQQA 3AWDA 3QX7A 4H7JA 1AH2A 1IQRA 3MTBA 2VQ3A 3TYXA 3KWFA 4UAJA 4AZ3B 1U90A 3LPNA 3K15A 3MAJA 4CTKA 1SCBA 2J3DA 4QVIA 3MS2A 5TQ0B 2FRDA 1D1PA 3ENVA 1RQLA 2ZIFA 4OP3A 2JHFA 1OQAA 4M0DA 4D57A 2YYSA 4M54A 1QQTA 2FKNA 5AW7A 4HXEB 1XE3A 1XZNA 2EBUA 4DDHA 3U1VA 1B23P 3Q7QA 4WNCA 1T9DA 2JW5A 1XTIA 3CNLA 3Q5DA 5JXJA 1FDOA 2GXSA 4TWJA 2WD7A 2FW9A 1YZ3A 4MWGA 1VTKA 3PHBE 1FNBA 1GLVA 1NR7A 3NALA 1J90A 1X1CA 3H87A 3CEPB 4PLZA 4YT5A 5K8VA 2C61A 1E1QD 3ND5A 3UWOA 5HZKA 1LDGA 1KHTA 2Q3MA 1J7JA 3DWFA 2GAJA 3D6JA 4WDQA 3T7SA 5JFGA 4UCFA 1OIXA 1HYQA 4MW7A 4BN5A 1K8YB 2R6ZA 4NCBA 3DNFA 3VR4A 2FUEA 3BMCB 3NETA 4GVXA 3IALA 4L2IB 5A5FA 5ITZB 5TQVA 4A5SA 4QGSA 2P9BA 3H8VA 2DFVA 2WZDA 2GYVA 3BCSA 3LMKA 4NZ9A 4ZCLA 4UNRA 5KTYA 3KJGA 3H3XA 2P2DA 1DKUA 4TV8A 1OTXA 3QHPA 2NV2B 2A9RA 4LWQA 4UTOA 5GWXA 4DSOA 4AJJA 5JS8A 5LD2B 1YA6A 5HIKA 4U63A 3IMKA 4XX0B 3NEPX 3FXAA 4TKZA 2VTVA 3AVUA 2BMAA 5IKEA 1ND5A 5HTKA 5EGNA 3VOAA 3BXXA 3EEBA 4OPMA 4XYMA 1N34B 3AIMA 4FGLA 2PGDA 3FNGA 3WB2A 3ZWKA 1M1ZA 1DCMA 3GLQA 3IQFA 3CLUC 3TSWA 2M9MA 3SBXA 4OLFA 3PNLA 3NM5A 1ZNQO 1HFWA 2J67A 1ESNA 4FK8A 2ATCA 2AOUB 4NU5A 3NX4A 3G02A 3TLJA 2ZBQA 2ZU0C 3VUFA 4KQ9A 4AG3A 5T6BA 4AL4A 1NONA 1AHNA 2VNJA 4UZSA 4QE3A 3K53A 1YI8A 1OHHD 3LYAA 3FBTA 2WMDA 1C9MA 1MEJA 1SK9A 5G40A 1Q1NA 3VHQA 3O94A 4YV0A 5IULC 1VKOA 2ZJ4A 3DVLA 3PHIA 5LCXA 3N9IA 4YAEA 3K0AB 3AKCA 2H6EA 4LTMA 2OK7A 3GEMA 1MB4A 1J0BA 4CIAA 5IUNC 4KEAA 1SIUA 3P32A 5DI3A 3VOSA 5K3FB 1K4MA 2NV6A 1DTWA 4MUGA 4Q18A 16PKA 2Q6OA 4E3ZA 1H6AA 2PCJA 2M6LA 3FI9A 3K1JA 3LOPA 3OPVA 3LP8A 1ZSVA 2H4FA 1T6XA 1EYZA 1K5GA 3NHUA 3PD7A 5C2JB 3FMIA 2OBNA 3N6RA 5ALQA 1ZOPA 2FKAA 2BWJA 2IS2A 1QV6A 1JKJB 2X58A 2O20A 2GQ0A 1BU5A 4BGVA 1FXWA 1H1LB 3IPRA 2EW8A 5KVAA 1J0XO 1FDIA 4FU0A 4NS4A 4Q5IA 2QTHA 4K6CA 2A5JA 1TNDA 3M6LA 3D02A 2P7HA 5F9HA 3KLMX 4WBNA 3E9NA 1M34E 3A3YA 1I3LA 3FAKA 2F8MA 3T3EA 1FFYA 4R5HA 3L7IA 2JCGA 3P2KA 4K9OA 2LW7A 3CNEA 2O54A 1R0XA 4DILA 5JZVA 2Y1DA 4LAFA 2GJ4A 3RI3A 4PSCA 1IVSA 1W36C 1IZ0A 1US8A 2HN9A 1GU1A 2P6PA 4M98A 4KYTA 4RAQA 1ONSA 2VSNA 3GLTA 3N28A 5EERA 4B40A 1VHTA 3ABRB 1R6UA 3DUWA 2G77B 1L5MA 4EYGA 1HORA 4MQ6A 2PQ0A 1FYFA 3AI2A 1GNQA 3G9QA 1YBVA 2UXBB 4J2OA 3MINB 3O47A 4LHVA 4Q6BA 4FOPA 3A0RB 1C30B 1EVLA 3ZWYA 2W43A 3GFFA 4KXVA 1GEGA 4IEIA 1SIOA 4G1EB 4X54A 2Q5HA 1FFGA 4R1UA 4MPPA 2VQEB 2AI2A 3SXJA 3Q7PA 5GMOA 2JJ2A 1BX0A 1JSLA 3H9EO 3K9NA 3Q15C 1PUIA 3E9QA 1UXIA 4GG1A 4PFSA 4S1PA 4XIFA 1X1TA 4TMKA 5EIAA 2F9MA 3TECE 4OQMA 3FDFA 4QDUA 1Z2PX 4IQ4A 3HLTA 3E8SA 3PIIA 1N3BA 1CQZA 2WNHA 3BGOS 5CDTA 4WEQA 4D74A 3JALB 5E7QA 1GZ5A 1EJ0A 1GTG1 1XQWA 3BMOB 5FKJA 5IABA 1KO5A 4BRSA 4G3XA 1JZQA 4YRBA 4N7RA 2I2DA 3EGDB 3CUTA 5LYYA 2E1PA 2BPOA 3W6PA 2HADA 5G41A 1HR0B 3NHLA 1N5LA 4EJSB 3BEOA 5ALWA 3S29A 3HH8A 1TAGA 4YRFA 4MI6A 3WYEA 1QP4A 5KO2A 4JB3A 5JFOA 1A5ZA 2Z1MA 2WILA 4F6LA 4CTNA 2QM3A 5A5DA 5JS2A 4XVCA 1E3JA 2PLFA 1M2HA 3WLSA 2O0HA 4MQLA 2XCIA 4BN4A 2QYSA 3HU3A 2WVAA 4Q6WA 4DW8A 1SBYA 1ZRSA 2DJIA 1HQDA 1HT3A 2I80A 2JJ2D 1HOTA 2NQTA 2O2IA 1Y8RA 3DEHA 3E3AA 4OTZA 1SUAA 3ZWPA 1BOOA 4U2GA 1XTRA 1KJIA 2WHPB 3SR3A 1YU6A 4EPTA 2IHZA 1K7EB 1S7GA 2ZXEA 3NLLA 4TLCA 1FFXB 1C3VA 3M70A 5LP6B 4JI2B 4TTIA 1M76A 1NI4B 4MLDA 1EXDA 4Q47A 2GCEA 4RSGA 4RM2A 5E1DA 1PF7E 1NJ2A 4W82A 2O59A 2J5QA 3AUAA 1GTRA 4HTFA 1HMPA 4MZDA 5FWDA 4EEXA 1PYOA 4WESB 3TQHA 1SHUX 3EZ7A 1KO1A 3JQ8B 4KR9A 4KMRA 3A9VA 1VDZA 5F2OA 3LL7A 3OTGA 3S81A 1YR3A 4QEKA 1FRNA 4OREX 3BCRA 1U98A 2XRYA 3DEAA 4Q4AB 1XFDA 3CCCA 2QRUA 3DAHA 3GVXA 3OKCA 2CLLB 4RC9A 3RAJA 1T2NA 3BMQB 4FNOA 4KXXA 2XLCA 5AKGA 3IIIA 2ANCA 2VHYA 2OECA 1DO8A 4HT3B 3D3WA 3GARA 4NCNA 3UAVA 3UK1A 1IOWA 3IUPA 2AZDA 2JGMA 3WK7A 4ZTZB 4L5IA 5FPHA 2BSQA 3OCUA 3MFQA 1FPQA 1NUHA 3NGXA 3HZHA 4S35A 2F1KA 2GVDC 3WKEA 3H7IA 4C4ZA 4BX3A 2GK3A 3WZ2A 4ZT4A 4R69A 4OB7A 3E2PA 2R85A 2XXBA 2NXJA 1YXMA 2XQJA 2IXDA 3BRSA 2ROQA 4A8PA 3LX8A 3NS7A 4EY4A 4DBVO 2FPKA 5A4MS 3ZHOA 1W4RA 2OKGA 1A72A 1Z74A 2BF4A 2HF8A 1DFGA 3I28A 3MN1A 4I3FA 4IJWA 3LUKA 3RC8A 4B0PA 2PYIA 4AD8A 1WSBA 3PXAA 1XTBA 3DCYA 3IB3A 3UA3A 1I4LD 4MWZA 1J2RA 4WQMA 1QQAA 3SSOA 1XPRA 5FTKA 2GGSA 3C5VA 5KYWB 4V1CA 1SVOA 1TZMA 3P96A 5ENZA 4LY6A 9LDBA 5ICGA 3DKRA 3EC1A 2JLVA 4CLRA 2EG9A 1WXXA 4UTXA 4Y8VA 3EXIA 3T8YA 4TRRA 1KI9A 1P9OA 3U3RA 3RWBA 3VMMA 3W8FA 1T5SA 2BJWA 3IP9A 3WHIA 1WBBA 3R6DA 2DBYA 3PIDA 4FI3C 4NCXA 4QTUB 2WJVA 2POQX 4RYLA 5CITA 1JYSA 1QGZA 4IIHA 1EVQA 4EG0A 3K3PA 4FMPA 4RMIA 4U02A 3U4DA 3N53A 4IOJA 2XZLA 4TTPA 2J4DA 4U7HA 1BXRB 4N5MA 1QH8A 5DHFA 4HNGA 1W88A 2IV7A 3ROFA 2CNBA 1W1IA 4EB6A 4QUGA 3O2QB 1HI9A 3KVVA 2PWBA 1GUZA 3RFCA 1OT5A 4CCYB 4EI9A 2EEZA 1DU4A 4FCCA 4YAIA 3EAQA 4D4JA 1OFTA 3QLUA 1VB3A 3NT4A 4J0JA 5CCDA 3V4PB 5B2EA 1KZ4A 3T3OA 5I9NA 4D9KA 3PT9A 3K4HA 2H7YA 2P8SA 2ZGVA 1YZFA 4TXJA 4GUAA 1DEKA 2VNSA 1KDVA 2X8AA 4HF7A 2CLMB 3SHVA 2F3RA 3WK8A 2JFYA 2P2LA 2Z2XA 1G8HA 2E4XA 1UKYA 4M89A 2D7DA 1OFGA 3D7KA 4Z7QB 1E2KA 3WWZA 4ZPXA 1H6CA 1E1DA 4Q4HB 4MQMA 4RMHA 2JAUA 1NUSA 2HNKA 4WW0A 1EP9A 4AYXA 1MU0A 3R5XA 4A7PA 1B0PA 1LU9A 3K1AB 3ZGXA 2J9YB 4XCVA 3QW4B 5DLYA 1OBHA 4J2TA 1M5RA 1JMYA 2YV4A 3R7WA 1T9KA 1JH8A 1OFUA 5FP0A 3E9DA 1LTHR 1OW3B 3IE1A 3EUEA 2IELA 2L69A 3A3KA 4CLDA 1TF5A 2C59A 4LX8A 1N3YA 2YUTA 4MYTA 1CZHA 2WJWA 2B5WA 3KWJA 1WB6A 3RK0A 3OMWA 1SRQA 2B4YA 3E8XA 5HILA 3EH1A 3TZQA 4MUNA 5E38A 4KQFA 3D3WB 3R0XA 1ZUD1 5FUVA 3MEQA 3SYTA 5E8JA 4IDFA 4DAEA 5KWVA 4BYMA 1TO6A 1DAPA 3E48A 3MERA 3AM5A 3DLCA 1J2EA 1GPMA 3AV0B 2CL5A 3BHJA 2D2EA 3GUCA 5DOVA 3MMXA 3CX6A 1JEYA 4XD7A 3R0IA 1VL1A 1NP7A 2CVQA 3EMKA 2P5TB 5EFOA 4PWZA 2VRCA 1X9HA 3DE4X 1IBCA 4WESA 1G2PA 5KIAA 2IYTA 1XRQA 3LLUA 4MW5A 4GFDA 4G4SO 2JIMA 3GJ7A 1GZ6A 1BCRB 2C9CA 2B5VA 3AO0B 3CEMA 1P7YA 3FFTA 4JVLA 2K5UA 3KKLA 4GS5A 4MKHA 1PN3A 4BNHA 4OUKX 5ILQA 3M89A 4YR9A 3HDJA 3HJBA 4B46A 1VLJA 3WL3A 1AA9A 2PT9A 2X5OA 3W34A 2V58A 2I9PA 3BJRA 3O6VA 3U60B 1Q1QA 1KO7A 3BBLA 4DDVA 3EJ6A 2YINC 4FBGA 5IDVA 3D4OA 5DM1A 3UNXA 2GXAA 5F7ZA 2PKWA 2QN7A 2BKEA 1SPBS 3HWRA 4HRVA 3GL9A 3ISTA 2X2PA 4M1MA 3TRHA 4W9RA 4F9EA 4DA8A 1NJ6A 1SBHA 2OWEA 4RKFA 4I46A 5JXGA 2VP4A 2C31A 2ZI3A 1V7ZA 4O02B 1VKHA 4J0QA 2P78A 3EGDA 1OKKD 1G9SA 1OYWA 3GMIA 1QG4A 2AMFA 3BJMA 1P1CA 4AFNA 4D99A 3LVBA 5DZSA 4ZDIA 5JV5A 1T36A 2FX5A 2QAIA 2YVUA 3JALA 4E1AA 1NW5A 3DCNA 4I9NA 5DGDA 1QPZA 2BFBB 4AJ9A 3VTFA 4IXMA 3RFTA 5KEIA 2UVQA 5ITWA 4RLHA 2IEIA 5AW0A 2AFVA 4BQFA 2ODBA 3TLKA 4F71A 5BV1A 4Y6PA 1F8UA 3AR6A 3U1BA 3U6KA 1KGDA 2C88A 3WOVA 2BE7A 3DDUA 4IRMA 3ZXUB 1QCCA 4BVGA 5K6AA 1XZQA 1J8YF 1Z4KA 3IPAA 5EJEA 3COJA 4YJ3F 4DE5A 3ANYB 1N8KA 2ZJBA 1C30A 2QEQA 2PPLA 2QTLA 4ASUD 4B43A 2EEPA 1N9KA 2WKWA 4AJIA 4C5AA 1L5QA 1GYPA 2H4JA 3DVRX 1IL0A 1A27A 3GLSA 3SVTA 1OKKA 3GMTA 2AN3A 3MM4A 3ESRA 3NJ4A 3O9ZA 2E4AA 4H7DA 4IDQA 1X70A 1GXSB 4JI0B 1MB3A 2OHIA 4PANA 3DJFA 3L2OB 4XVRA 1H1DA 4EHFA 1ODCA 2J3MA 4MS1A 4DWJA 3THXB 5BW8A 2B8TA 1O6GA 3KFVA 3WGTA 5M2QA 3EGCA 4PAMA 5DNWA 5A3SA 1WW8A 4PYLA 1A4RA 1LSUA 5FBRB 4ZEXA 4BCDA 2I6XA 4FT4A 3UHJA 1PR4A 4LTNA 1ECBA 4YMGA 4EW3A 1QFMA 4HWTA 3L0SA 3SWWA 3C1OA 4Y7DA 5IDQA 1RJEA 2WSMA 1YBFA 2G5GX 2DF8A 2LIPA 5DOZA 5JH7F 1L5VA 1TK2A 1XQ9A 5DXJA 3IIMA 4Z49A 2FH5B 4PIPA 3VPGA 2BMEA 4OF4A 3R2JA 4W6QA 5FUYA 3RHSA 2IH5A 3UAGA 4TM8A 3SEQA 3ESCA 3Q9SA 4OYHA 4I50A 4MVJA 5HJ7A 5IYZA 4RIHA 3EZGA 3HY4A 1QX3A 3L0IB 1Z5NA 3CMMA 1TF2A 4OQLA 2DR2A 1HURA 3I61A 1TOAA 3AVVA 4GSLA 2XE6A 3HA2A 3UXYA 2JAQA 1OXTA 5EJ8A 4WNAA 1ODSA 4O1MA 1HMYA 1HZJA 1UZNA 1JZTA 3DLIA 4QXAA 1PGOA 4PZ0A 1ZU5A 5L7YA 3WHPA 3WAKA 1Z6TA 2DJ5A 1EA7A 2XNDA 3NTLA 2EJWA 2R7MA 1PJ2A 2G06A 4D92A 4JK3A 1WD7A 1X1DA 3KKMA 5AI0A 5F7OA 3R0VA 3PEYA 3I1IA 5FPQA 1UF9A 3D43A 4DMRA 4Y2UA 3SZUA 2ZYGA 2RGAA 1BWQA 2XA9A 3WLFA 2ZWOA 1A3CA 3HM9A 1XCGB 1TYZA 1T9CA 2PTHA 4O3FA 2WJ6A 2ZPUA 1EFPB 3LM8A 1FXWF 4FDVA 4A6XA 4N41A 5B1IA 3VR4H 2GF2A 2DM6A 3ZIUA 1WHTB 1JPVA 1OC4A 2PZKA 2R5FA 1CPYA 2RK4A 2WWXA 3BD7A 3CZQA 3G23A 3U4IA 4PG7A 1O89A 1WZCA 3CF4G 3N1UA 1E3MA 2PUFA 4TM7A 4TLMB 3ZUPA 2WZBA 1ZM3A 2NTJA 3KLBA 5AW8A 3DFZA 3ORHA 4ZRDA 3GAAA 4DLZA 2PGJA 3JX9A 2ZUCA 3OA0A 5J5CA 4D8UA 4RTLA 1NPTO 3FB1A 4ZD6A 3GRYA 2PX0A 3QUSA 1ISHA 2XNDD 1LI7A 2O3SA 4E2WA 2V9CA 1BFUA 1YHZA 3HY6A 5G3ZA 4TZKA 1B3BA 5F7XA 1ENOA 4Z9YA 1JW9B 1IZZA 3WWCA 3ZHVA 4ZVSA 3IQGX 3TLZA 2Z5FA 3BMCA 1V3QE 1ZKMA 3NHPA 4GM4A 2WB4A 3PQ3A 1V1RA 2B8EA 1JR2A 3REGA 3W4IA 1O0CA 4DY4A 1P61B 2BFNA 2ZSHA 3UTDA 3WICA 3HCAA 3L06A 4UUMA 1K4KA 4NMLA 1WQ1R 4LOHA 5LKRA 1JMVA 1AV7A 1EBBA 2O3QA 2R00A 4QU0A 5K3EA 5D7BA 1JHQA 2ZANA 3X1ZA 3MRSA 4GOJA 5FR2A 2KBFA 3T3PB 2A2ZA 3BQ9A 3BK2A 2C2HA 3H1PA 3OE1A 1Y4DE 3WJAA 4Z3DA 3TI7A 4DV1B 2EVWX 3Q7RA 4MITA 4B7CA 1SKUA 1UEIA 4OQXA 2EHJA 4MYHA 1P0CA 5IT5A 3AL2A 5J4LA 2X5NA 3O8BA 5A7HA 3AUSA 4IGFA 4Y6GB 4GX5A 1JALA 4N5DA 3TKAA 2WJGA 4YIHA 3C8DA 5TQ0A 2HB6A 5B1DA 3TOVA 3HGMA 2ZBPA 1HYHA 1KVQA 4PVDA 4W6ZA 3GVPA 2ZVPX 4H1VA 3EUFA 1N2CA 4LN1A 2R47A 1PJQA 2BONA 4FIDA 4OA8A 4E12A 4AMUA 1Y6QA 3B5IA 2BMWA 2RI6A 1NNUA 2VHXA 4L0DA 4FQ7A 3SBEA 2QUJA 1Z4QA 2F64A 3R4VA 4N0QA 2VWPA 2JATA 3AQIA 3QU4A 3D4PA 3KRTA 2M32A 3IRVA 3OQ6A 1CIVA 1MF7A 3TXYA 5HGJA 2OP1A 3EZNA 4KLZA 4TN1A 2JBAB 3PNMA 1BFDA 1P5HA 3E82A 2FQWA 3NEJA 1PQWA 3U7EB 2C7PA 4HGOA 3W6ZA 3QXXA 4NEQA 4QELA 3WRWA 4AJPA 1YRBA 3ORQA 4OMFG 1U8YA 1C7JA 4Z8XA 5REQB 3O3OB 4LWZA 1EWYA 2A5LA 3KLNA 4IVPA 4TX1A 2X3FA 3LH5A 2ZTHA 3F1LA 2EFGA 5EWMB 3TQFA 3ZW9A 5CIYA 1QC5B 3BSFA 3BA1A 3B12A 3F49S 3IJPA 4R1TA 1X7WB 2VDWB 5DHUA 1ICIA 1VL2A 1XP8A 1XNGA 3FLAA 4D2IA 3ZE1B 3QU5A 5LIPA 4BXOB 4X6UA 3GGCA 1RWNA 2AXEA 2E5FA 4RPGA 1ZUIA 4KVAA 1NC1A 3LLMA 1YGYA 4JSTA 4EA8A 1OZFA 2GTHA 2ZJ0A 3F97A 4HHEA 4BZQA 1BKSB 1TCCA 3DD1A 1KQNA 1TRKA 2AA3A 4H60A 1HFKA 4L8FA 5IHPA 4WA8A 4QPNA 2Y66A 4F9GA 1BE1A 1YR2A 3RVQA 1P77A 3LHSA 3UMRA 3EDMA 3KT3A 2VXOA 2PS0A 4QC2A 3QKUA 4IH4A 3U80A 2HA0A 2D2XA 4KO1S 4UHJA 3EGEA 2JKYA 2JJ1A 1O6FA 1QHIA 1Z8FA 3BF7A 1Q6YA 2X6QA 3HZRA 3NHSA 2OCLA 3HY3A 3P9XA 4M1YA 4TXLA 5AI4A 5C8ZA 1SMKA 2SCUA 2VPIA 5C5EA 1S1MA 1AG9A 4GBJA 4Z99A 1SUSA 1WXWA 3BMNB 3BQNB 5CX4A 3LYUA 4ZQEA 4TS1A 3IDSA 2PMEA 3FR7A 4K03A 4WNAB 3WB9A 5DM0A 4HB3A 1V48A 5J1TB 1MAVA 1GP2A 3SQWA 1DQZA 3VR2D 1CU1A 2X0IA 4CV1A 4MWDA 4KR7A 4YDSA 4XDHA 3TOSA 3LL4A 5A03A 1K88A 1SUIA 4LOAA 4BMSA 2VHWA 3K0KA 5BN4B 3HC7A 3LOQA 1OV4A 4LRQA 1FMFA 5GZ6A 4HX9A 2PRYA 3HP4A 4KNWA 4ZVRA 3FZYA 3OC6A 1DJMA 2JIDA 1D2MA 2FSGA 1C0PA 2KE5A 3FGOA 4O4IB 4P1ZA 1XNRB 2G40A 2ACVA 5DNCA 1KBZA 3T61A 3FMVA 4HYQA 2I99A 2W6QA 2JIRA 5LZ8A 3L1VA 4CGYA 1XTSA 1KAOA 1RI1A 5AH0A 2DQ4A 2I8AA 3IEIA 3JWGA 4DIDA 1EGVB 3SJAA 5C1DA 3KVNA 4OG2A 4QU5A 2IHYA 4DMLA 1FS5A 3DBVO 4B4OA 3AINA 5L9AA 3MCTA 1XVTA 1O9BA 1C9EA 1FB5A 1RWMA 2JFNA 1Y3CE 3KUKA 4R1SA 3JD3A 4KLCA 4BTLA 1ODFA 3QG5A 4C3UA 4IHJA 2D8AA 2RGWA 3I12A 4CLXA 4PIVA 2VPWA 4EFDA 4J1SA 1JFSA 3VZDA 1L7BA 1VPDA 1VE9A 5H4HA 1BYIA 3UENA 1ZO8A 3CSDA 1VMEA 4HBZA 1EP1B 2GBCA 3DOEA 4RTNA 4JQCA 3PJDA 5KTNA 3Q8XB 5I45A 3NYIA 3CEJA 3OFVA 3SBOA 3UUGA 1HZZA 3L4BC 2UUPA 5F12A 2I65A 1GZDA 1L5KA 2J8ZA 2JS7A 2XWJI 3KBOA 3ZLJA 2D4AA 3OZSA 1DQSA 5JD5A 1RXVA 1NJ1A 2VSOA 4NU6A 2F1IA 1IZ7A 1FMLA 1JF8A 1W5BA 4GDFA 2FW8A 2O19A 2ZBDA 3FTFA 1TUGA 1JDSA 4D8YA 5DRTA 5H3HA 2Z4SA 1M0EA 4WLVA 2J5BA 3PS9A 1M2VA 4F6CA 4L4YA 1C41A 3STXA 4YP9A 5LYJB 3DQPA 1XG5A 2ZAMA 1XVUA 4V0LA 2PGNA 1R0ZA 5DP2A 2X0RA 4R3WA 3AVQA 4ZC1A 1QLWA 5HEKA 3EXEB 2C5HA 5A2QA 3I5UA 1WV0A 2FWIA 3CO5A 3FPHA 3WYAA 2C20A 3DXXA 1EZ1A 5A0FA 1CJVC 3I04A 5E7IA 3R9KA 2H29A 4QWWA 1FL9A 4FW8A 1BXGA 3ANTA 1YDWA 1GJRA 1KHHA 2O3UA 4DQUA 4WD3A 4PBSA 4R9NA 4DEVA 1N6KA 1PAUA 3TL6A 2QZ9A 5CR9A 5EWLB 1LSOA 1KZ1A 2HRBA 2XMDA 1KSHA 2PV0A 1LNQA 4FSDA 1JH9A 5KPJA 1FLDA 4B71A 4S05A 1K89A 3RQSA 2YWCA 1FNSA 1MX5A 1GDDA 1IH8A 2FN7A 3D64A 4IXWA 4BL5A 4DCCA 4RKRA 4F2HA 2UU9B 1QUEA 2H1OA 2KS6A 1P9WA 1XK6A 3FRIA 4ACBA 2G9QA 2B37A 1SXJB 1UP6A 1E64A 3Q85A 1VHJA 4JLMA 5SY6A 4JR1A 4LI3X 5DO9A 1JJIA 1UMCA 2XUZA 1XPJA 3PKJA 1BCRA 1VHQA 4CFSA 3RNLA 5KHLB 3AF6A 4US2R 1UT8A 4I5FA 5ECGC 3WGQA 4IWNA 2DUNA 3DDZX 4FD3A 2HF7A 4YUXA 3FLEA 2XCUA 3LXXA 2ZG6A 2C3YA 1UPTA 3J7TA 3VNSA 2ACWA 1FPMA 2R00C 3CTPA 3K1TA 3X1KA 1ORWA 3C5WP 3OO0A 5F2KA 2C04A 3D1LA 2VHQA 2Z3WA 4ECAA 1CSEE 3HSYA 3ZE8A 5JY1A 5AFSA 2A58A 3JCZA 4JU9A 1PQUA 2ZE7A 2A30A 3HJAA 4BEBA 1Q84A 4E0BA 4TGLA 4QGHA 1KORA 1GSHA 1AVTA 4Z9FA 3H2ZA 4P93A 2FN4A 3PQ5A 1F17A 4FE7A 3CZCA 2E4WA 3BRCA 3U4QB 2VHEA 4U2EA 3TOZA 1Q0QA 4GMGA 4P98A 3E3OA 1K3FA 5IM5A 3X43A 4C1NA 1ECCA 3IP1A 3OF5A 4UUNA 4J4BA 4QJ4A 4GR4A 4ZQIA 3OE7D 1MIOB 3HO6A 4PBRA 1RKVA 3NU1A 5HPYB 2ZAGA 3P26A 1GZSA 1UEJA 4BO3A 1TCVA 1NVVQ 1ICEA 4TUYF 1SBIA 1VMIA 4ZCSA 3ZDXB 1DAHA 3FPBA 2GPYA 3DO8A 4LXYA 3MRXA 3ZW7A 4RPHA 1GD1O 4NYJQ 1PYGA 1DOZA 1I14A 1IQ0A 1JHUA 2JRCA 3A36A 1Y3DE 1X7GA 2OAGA 4NBLA 1ZU4A 5EP1A 4NX2A 3K6JA 1QTIA 2P9HA 4N40A 1ZN8A 2RH9B 4JKOA 3LQKA 4QDXA 1IG3A 3ZVNA 2VZ8A 4GBMA 4HQ0A 1XL0A 1J5PA 3WYGA 4BU1A 2V6IA 4Z4IA 3BIJA 4I55A 4UVIA 5HKLA 1O03A 2WWHA 5BNTA 5B3AA 1DPFA 1UPXA 3O1JC 2RAUA 1E5LA 1EG7A 3OE7A 3QPUA 5AIAA 5JDCC 4CCYA 4I1PA 2PX6A 2VK2A 4ZT3A 3FUWA 4GR9A 3D2BA 1W88B 1CF9A 1Z0ZA 4PTYA 4V0SA 3O90A 1QH8B 3S5JA 4C07A 2HA6A 1JKMA 3RT1A 4RF2A 3QIAA 3QVGB 4BFSA 4LFAB 2DT8A 1KEZA 3KTOA 4KKXB 1DP4A 2RG1A 5TY0A 4DRXB 3L01A 4YUWA 1CEYA 4C88A 2NV0A 2PUVA 1GQYA 3VI4B 2Z5VA 3N2LA 4XFJA 4Y2TA 4YCBA 4P3NA 3C0KA 1GOTA 2XMGA 5I4KA 3KT8A 4NMMA 2FJ0A 1NVUQ 2GTIA 1Z4NA 3K0SA 1XKTA 3FVWA 4IQ8A 1EWRA 4LYHA 1CETA 1HRKA 1PFUA 4LMRA 4V3CA 2QA5A 2VL7A 2XW6A 3KEOA 5AJWA 2BGLA 1CFZA 2CHEA 3TCKA 2JANA 2P27A 4S1WA 3A6GA 5B6IA 2FW1A 3EVFA 4IIYA 4LV5B 4CRWB 1QE5A 4GEKA 4MGHA 1YFKA 4Z9XA 4UC0A 1SVMA 2ODAA 3DWEX 4L5JA 1ZUNA 3TTUA 1CUHA 4B9AA 4OA5A 5FIUA 2FEAA 4QRIA 1U8UA 4LRWA 2IOFA 3V7FA 4JWTA 4J90A 3A1NA 5EE3A 5E2IA 3ZQJA 1YCDA 1HBJA 1NN1A 1KS9A 4FFPA 2VXYA 3QPDA 3SX4A 1PGQA 3NEAA 2I22A 3LUCA 4PQEA 5DI9A 4AROA 4LJKA 5DXFA 3AGQA 5FNVB 5B1HA 4RTQA 4XR4A 1UFKA 2E9SA 1JG6A 1X2BA 3MNFA 5T64A 4HFNA 5C51B 1K3TA 1RPAA 2YWHA 1YRWA 2V7PA 1FLVA 3MB5A 4KMMA 2QLLA 4MB6A 4OMCA 1ZAYA 4CM8B 3LQQA 3KK0A 1DX9A 1LLDA 1PEDA 3M9WA 4IJ6A 4KXYA 5H80A 1UDBA 1J25A 4BZZA 5K2OA 4G1VA 4NK5A 1GRVA 1VECA 5ADWA 1HTTA 4ZQFA 2FV8A 4KH1A 2G9ZA 2YWFA 3CX7A 5LNK1 2PUTA 3L0ZA 2I7XA 2OA0A 4V0MA 5L45A 2VNKA 3I52A 3NRBA 4QJBA 1CUEA 3D3EA 5CURA 5ETJA 5KNCD 2GI4A 1ZIPA 4FFBB 2J32A 2WIBA 3BAFA 2PA3A 3DHEA 1FC0A 1ZM2A 4L85A 1OV6A 1HT2E 2FR1A 2JAPA 2NXNA 4DMUB 4P0PB 5A4FS 2C0QA 2P69A 5D6NA 1CZNA 2QLMA 1K7YA 2Y92A 3HB4X 5J4HA 3EDCA 3DR5A 1OMOA 4A4DA 4BBJA 5LIRA 2Q1UA 3CZPA 1ZS9A 2DQSA 3N58A 1UOPA 3PFGA 4L28A 4OAQA 4OKSA 4AN0A 2F1HA 2FTKE 2QDXA 4F3KA 2YUIA 3MWLA 9GPBA 1KPGA 2DBRA 5ADVA 1BJTA 1M5TA 1RAGA 4HR7A 4JX9A 4F86A 1L7XA 3V7UA 2V59A 1NA5A 1ZITA 3MJTA 4ZOLA 2I6TA 4LXIA 2FMKA 1W36B 2RHCA 2CYCA 2BMVA 1HLDA 1X80A 3G82C 3STHA 5BRAA 3E1SA 3NH6A 4UZEA 1ID1A 2E6KA 3QEAZ 1L9XA 4GM1A 1V45E 2DX7A 1OR8A 4MR7A 4EAAA 4DR6B 4MUJA 2IQIA 1ZFNA 2OCPA 4E5MA 2X7XA 4TL9A 2BKAA 1IAQA 3VKHA 1XQXA 1ZXLA 4QU9A 3HRKA 3ROXA 5DMXA 2EX1A 1AQUA 2JIBA 2WLSA 4N3GA 3WGYA 1Q50A 1E6LA 1Q7RA 2ZVQX 3KD3A 4TL8A 2IHUA 4WV3A 3T3GA 5J4VA 1CT9A 4FZ5A 1I9CA 5C18A 8AT1A 1BE6A 1PNVA 1N2CE 4Q9AA 3W9UA 5DFAA 1ZNZA 2PEYA 2VH5R 5JYDA 3LOUA 5LA6F 2CJWA 2ZYDA 4ZOLB 3TXXA 3FSGA 4AF8A 2OC4A 3ELBA 4URFA 5B4UA 2YR0A 1LDYA 1UPBA 3MJVA 5CDFA 3H84A 1BOFA 2PM8A 3ZXXA 1ORDA 8ABPA 1JBEA 2H17A 1B1AA 1E79A 3F3YA 4X5OA 1Z73A 2EJTA 3QBVA 4PRKA 2Y1CA 4YJHA 1AKRA 2I2FA 2Y4OA 4EY8A 3VSBA 4RCVA 4JGGA 4Q9IA 1OZ0A 5HDQA 1B0UA 4MCIA 5DDIP 5J2UF 4TLAA 1NG1A 2FETA 4L9SA 3GDHA 1CS0A 2IY7A 2PX4A 5DBOA 2I3AA 3BB3A 4EW2A 3ETNA 4Z51A 3DCJA 3EVTA 4JP5A 2OZEA 5TF0A 4JFAA 4LI0A 5B53A 4B6JA 4WJLA 1EWVA 1QGDA 5CT6A 5HF9A 4A6DA 5A3JA 4YMIA 1GCIA 2LDXA 5DGXA 1CZUA 1TPZA 4B34A 5A4AA 2COEA 3KQTA 4KLAA 4ZAYA 3NCTA 3RV4A 3RYIA 3TNJA 1W49A 1L7MA 3UCXA 2GBPA 2JAWA 1W29A 4JL8A 2AXNA 4ND2A 4HY3A 4HH3C 2ID4A 1IN4A 3B6ZA 4NP6A 2ZRQA 4BMNA 3W79A 4ZCQA 1E79D 1Z18A 1EEXB 4IH9A 2CNNA 2VKTA 1L9KA 2OHOA 1NN0A 3LC1O 4BFZA 3MTGA 4Z7JA 5AVJA 4RJIA 4C0JA 3VOBA 2G7ZA 5EJ4A 5IBRA 4PTZA 3GA0A 3M4YA 5FEMA 3L77A 5E1BA 3E84A 1ZIXA 5D5PA 3V00A 5JZMA 4UU0A 5LD2C 5IJ9A 4TYWA 5JC8A 1WE2A 1U4NA 1ZK4A 5LQCA 3D6NB 3JR3A 3QXHA 5K4AA 1IWPB 4ZEMA 1YV9A 3JQGA 5DVZA 1BAPA 3DDHA 5L3VA 2UKDA