3CC8A

Crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
211
structure length
211
Chain Sequence
AVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVSHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative methyltransferase
publication title Crystal structure of putative methyltransferase from NDP-N-methyl-L-glucosamine biosynthetic pathway (NP_977653.1) from Bacillus cereus ATCC 10987 at 1.64 A resolution
rcsb
source organism Bacillus cereus
total genus 63
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3cc8A00
4CKBA 1NE2A 5DM4A 3C3PA 3G2QA 2IH2A 1JG3A 3P2IA 1WXXA 3R0QA 2ZTHA 2G72A 4A6EA 3TM4A 5DSTA 4DCMA 3NVMB 4XUEA 4GQBA 3EMBA 4GC5A 1YZHA 2QRVB 4E70A 3HA5A 2DPMA 3GRZA 1L3IA 5ICFA 3B3FA 4E30A 5CVJA 4R6WA 3V97A 5K03A 4RTLA 1H1DA 2VS1A 4CWAA 4EKIA 1M6EX 5U4XA 1IXKA 4QPPA 4RVDA 1JG2A 3DMGA 3KHKA 2QE6A 4OQEA 4CTJA 1B42A 2HTEA 3IHTA 1XCJA 4ER6A 4H0NA 4KW7A 2VDWA 3LECA 2P40A 4QVKA 2HNKA 1AV6A 3UBTA 1X19A 2HMYB 4X61A 3FPGA 4BP1A 3DP7A 4C4AA 1QANA 1RJGA 4HTFB 1RJFA 1NT2A 4E31A 2UZ4A 2C7PA 1RJEA 2HV9A 3TQSA 2FCAA 3PT9A 4X1OA 3T7SA 1HMYA 2IDKA 1RI1A 3P2KA 5FADA 3R3HA 4GOMD 1ZQ9A 2CMHA 4IV8A 4P7GA 2GB4A 3EMDA 5EVJA 5CVVA 3LX6A 3KU1A 1PJZA 2P8JA 5E1OA 3M6VA 3KR0A 2OYRA 4R8SA 2QY6A 3EVDA 2OKCA 1O54A 3G2OA 3OE4A 3RODA 2B2CA 3PVCA 5DX0A 2ADMA 2B9EA 1QAQA 3CBGA 5FULA 3T7RA 2Y1WA 3ELYA 3FRHA 3KPVA 3R9XB 1YFJA 1VE3A 3C6MA 3Q7EA 1AQJA 2EG5A 3SM3A 3NVKI 1L3CA 1ORIA 5CVUA 2KW5A 5K0NA 4U7PB 5T64A 1KPHA 4QTTB 5CUQA 3ID6C 5EHGA 3A7EA 3TM5A 4YUWA 2BM9A 1X1CA 4U7TB 2JG3A 3UJCA 5F2KA 2GS9A 1KHHA 1UWVA 2IFTA 2PLWA 3FUUA 4RVFA 3THRA 1XXLA 3HVKA 4PCLA 2NXNA 5LQNA 3GIWA 2OO3A 5EQJB 1D2HA 1NV8A 1VP3A 2AZTA 2P3OA 4PYKA 3O4FA 3SSOA 3O31A 2AOUA 1KIAA 4RSRA 5E8RA 5FA5A 2PX8A 2JHPA 3HM2A 5P8WA 2PXCA 3NDJA 2PX5A 4Y30A 4X63A 2UYQA 3IV6A 3VYWA 4DKJA 4C03A 1KXZA 2ONZA 3BKWA 4QQNA 4QVGA 2ZBQA 4MQ4A 3EGEA 5DWQA 3B3GA 2Q41A 4LG1A 4E33A 1G6Q1 2PWYA 4HSGA 2ZSUA 3KQTA 5EMKA 4F84A 1EG2A 4AZSA 1WY7A 3HCBA 1AF7A 3JWHA 3KPWA 4FZVA 3UA4A 4LWPA 3A26A 4YUXA 3KPJA 2OB1A 3ELUA 3I9FA 3T0IA 5BW4A 4V0QA 2IH5A 2JH8A 1N7JA 3TPZA 3IYLW 2JHAA 2FK7A 3BGIA 1VQ1A 3K0BA 4GBED 4HG2A 3I58A 5HIIA 2I7CA 3LBYA 4WXHA 5DT2A 2XVAA 3KQWA 2ZLBA 3NWBA 4FSDA 4PGGA 2ERCA 3DR5A 5IKMA 4M36A 5GM2A 4EQZA 5LQAA 4XUCA 1P39A 5FCDA 5DM1A 5LQKA 2P41A 3DMFA 4GOOD 4RTPA 3ELDA 3BGDA 4LECA 5DRYA 2XBMA 3A7DA 5HIKA 4RTMA 3ER8A 5K0LA 2HR1A 3PX2A 3SR4A 1NBHA 1U2ZA 3TOSA 5LR6A 1YF3A 4B17A 4HGYA 2I62A 2OZVA 3LHDA 1L1EA 5EKXA 3FZGA 1Y8CA 2G8NA 4CKEA 3GGDA 4HH4A 2AVDA 5EOVA 4CTKA 9MHTA 3OFKA 1EQAA 2ZIEA 3G8AA 4KRGA 2CL5A 2PX2A 4EK9A 4DA4A 3Q87B 1R18A 4PIPA 3BXOA 4G56A 3TR6A 4CXMA 3MQ2A 3CJRA 1HNNA 1ZHFA 1SKMA 1T43A 3FRIA 2ZULA 5DTRA 4PONA 5DX8A 4XCXA 2CWWA 4RVHA 1FP2A 2B3TA 4FP9A 1R74A 3FTDA 4ER7A 1I9GA 1N2XA 3SVZA 3G89A 2PXAA 5EEGA 1EAMA 3M6XA 4DF3A 3DXXA 2B78A 2PT9A 5HZMA 3F4KA 3GXOA 4MIKA 4GC9A 3GRRA 3ERCA 3DH0A 4AZVA 5G02A 4IKPA 5E1BA 4AZTA 5CVDA 5B1SA 2PXXA 4RTJA 4GF5A 1G60A 3E23A 3PS9A 2V74B 2EJUA 3BWMA 4KWCA 3TRKA 3ER9A 2ZZNA 1I4WA 3M70A 4YMGA 4C04A 4E2YA 2VP3A 3UJDA 1RI4A 2QRVA 3AXTA 5KQSA 1VP9A 2P7HA 3B3JA 2G1PA 1SQFA 3QOWA 3P2EA 4KDRA 2AN5A 2O07A 3HTXA 1TW3A 3OU6A 4X60A 3OZRA 3UJBA 3HEMA 4ZTBA 2PVCA 4Z2YA 3KR2A 3M4XA 5DTQA 1JTEA 2AOVA 4OX9Y 3VSEA 4M7RA 3DOUA 1AQIA 4AUKA 4OA5A 2EFJA 3L8DA 1NKVA 1EIZA 3GU3A 3T7TA 3GRUA 1DCTA 4FT2A 3RW9A 2LD4A 4E2WA 4YV0A 3BUSA 3OU2A 4PYOA 3P97A 4X41A 1FP1D 4E2XA 2XVMA 3SSMA 3HCAA 4BP3A 4RTRA 1UFKA 2R3SA 2IBTA 3G5LA 1VPTA 3LDGA 3MGGA 5EC8A 5E9JA 1FPQA 2YX1A 3CJTA 4GOLD 2PY6A 5FWAA 3DTNA 5DXAA 3EVGA 5BW5A 2NP6A 1NW3A 3K6RA 3OE5A 3OFJA 3SGLA 2BH2A 3AJDA 4V0RA 2BZGA 2HWKA 4OBXA 3NJRA 5GM1A 3PLAE 1X1AA 5DTMA 1D2CA 3PFHA 2EJTA 5EMMA 2YXEA 5GP1A 3VC2A 3OU7A 1KYWA 2GH1A 4P7FA 5LSAA 1FBNA 2PGXA 4OQDA 4RVGA 3I64A 3UJAA 5K0GA 1TPYA 2NP7A 2B25A 5C1IA 3G2PA 3C6KA 4ER5A 5ICGA 1WZNA 3KPUA 2FYTA 4QTUB 1NW7A 2CMGA 2OXTA 4A6DA 3JWGA 4PYLA 2AOWA 2FK8A 2IDJA 3BWYA 5HILA 2IH4A 3IEIA 1XDZA 2WA2A 2XYVA 1SUSA 2JHCA 3MB5A 3WSTA 4QPNA 4EMSA 3KQMA 2IGTA 1BC5A 4EVIA 5E1MA 1SVUA 3I5UA 4IV0A 2V7EA 4UOEA 2ZIGA 4DMGA 10MHA 3KR9A 2CKDA 2Y1XA 2ZCJA 2EX4A 5EZQA 4F86A 3HCEA 4ER0A 5KS2A 3EVFA 3OPNA 3RIEA 1JQ3A 3DLCA 2AOTA 2VDUE 3HVHA 4GOND 5HEKA 3LCVB 2AOUB 3ORHA 2DULA 2QYOA 3P9NA 5EIWA 1I1NA 3HVJA 1YB2A 5E1DA 1N7IA 4YV1A 1VLMA 2NNWB 2ZBRA 4FGZA 3TLJA 5K0BA 5EHIA 3OZTA 5F2OA 3P71T 2H1RA 4PCAA 4QQKA 5CIYA 1RI5A 2F8LA 3E7PA 3P9IA 1IY9A 3CGGA 1SQGA 3LDUA 3LSTA 2OY0A 2FHPA 4ISCA 5E2BA 3EPPA 5EG5A 2JH9A 2YXDA 1V39A 4ATNA 2YUIA 1KPIA 3KQSA 3VC1A 4KIFA 4RTNA 5DSXA 2AN4A 2PBFA 5JUWA 3V8VA 1MHTA 4PYNA 2PJDA 3FYDA 5MHTA 2WK1A 2YR0A 2YQZA 2C7RA 3GCZA 1YUBA 3G8BA 5M5BA 5DPMA 4RTSA 3FUVA 3BWBA 2OPBA 3P9KA 2ORED 4MTLA 3AWIA 3BWCA 4POOA 5K0EA 1Q0TA 3NW9A 3REOA 2IIPA 2UYHA 3TKAA 2ONYA 3TFWA 2R6ZA 5FWDA 4AZWA 2NXJA 2YTZA 5EPEA 5FQNA 1Z3CA 1INLA 1X1DA 4WVLA 4Y2HA 3B5IA 1MJFA 4E32A 1JTFA 3GWZA 4RWZA 5EMLA 3EEYA 4FS8A 5EMJA 2P3LA 7MHTA 3HCDA 4GEKA 3FTEA 2P1DA 1G55A 5K05A 1G8AA 1KR5A 2IBSA 3X0DA 3EGVA 3LCUA 5EEHA 3A4TA 4L7VA 1RI3A 1M6YA 1XCLA 2PSSA 5FHQA 1X1BA 5GIOE 2ZZMA 1NW5A 5JR3A 1XDSA 3M6UA 2O05A 3PX3A 1JG4A 2O0LA 3D2LA 3JWIA 3MCTA 1O9GA 4HGZA 1FJXA 3ANXA 3DLIA 3HNRA 5CVEA 3B7PA 3BZBA 3SX0A 5K8VA 5LQUA 4M38A 5DXJA 4O29A 3MAGA 3PB3A 5LQCA 5LQJA 1NW8A 1KPGA 3MERA 2AVNA 2BR3A 3E05A 4OA8A 2GAFA 4P7KA 2AR0A 1EJ6A 4M37A 4BLUA 2IPXA 2PKWA 3DUWA 4R6XA 3FYCA 4PYIA 5E9WA 5D1HA 5DLYA 2YXLA 3UJ7A 4RX1A 2H00A 1VIDA 3HVIA 2JJQA 3P8ZA 4RTOA 1YZ3A 1NW6A 1F3LA 3DMHA 4LWOA 5T6BA 3C0KA 5GINE 1XVAA 1R8XA 3LPMA 5LQRA 8MHTA 1DL5A 1YFLA 4P7JA 3UZUA 4DQ0A 5E8JA 3KQVA 3EGIA 3MCZA 3O7WA 1R00A 3DXYA 5DX1A 5K01A 1R6AA 3I53A 2FPOA 4HTFA 3FUXA 5HOQA 5ICCA 2FRXA 3LDFA 3U81A 5K09A 4QDJA 3TKYA 3FUTA 2PT6A 3FUWA 1WXWA 1RI2A 4KIGA 5KQRA 1O9HA 3LGAA 2G71A 1UIRA 3NTVA 4RTQA 3FPHA 4DCGA 1WG8A 3FTCA 4C05A 5CD1A 2P35A 2XYRA 3NWEA 1G38A 3G88A 4IWNA 2ZIFA 4JXJA 4C06A 3SMQA 5EZSA 2YVLA 3M6WA 3EVBA 2C7QA 1PRYA 1L3BA 3EVZA 3BGVA 1P1BA 5E2AA 4PINA 3EVEA 5E9QA 3ELWA 4PYMA 3P9CA 3NDIA 4GUAA 4AX8A 2NXEA 1WS6A 4FSXA 5IH3A 5ICEA 1NV9A 1JSXA 4ER3A 3KQYA 2K4MA 5D1NA 4YMHA 1KP9A 5C9ZA 2NYUA 3FTFA 1BHJA 1JR4A 1NBIA 2G70A 1Q0SA 2GA9A 2UYOA 3FPEA 3CKKA 1P91A 4OBWA 4EKGA 2VDVE 3HCFA 1XJ5A 4C07A 3KQOA 1L9KA 5T67A 5FTWA 2ESRA 1D2GA 3B89A 1ZG3A 4PWYA 3KPYA 3M33A 5K0CA 3CVOA 3QV2A 1ORHA 1XTPA 2WA1A 3CC8A 3HA3A 4K6MA 1VBFA 2E5WA 2ZVJA 3NMUF 2GLUA 3QOXA 3ME5A 1BOOA 1QYRA 1VL5A 4DZRA 2P3QA 1JQEA 2ZFUA 1QZZA 1R8YA 2BM8A 3AXSA 3G2MA 1QAOA 4P58A 3UJ8A 2GPYA 5GIPE 1JQDA 2N47A 1OR8A 5HIJA 5EGSA 5BXYA 2ZZKA 3THSA 4R8RA 3GRYA 5EKUA 3GNLA 3E8SA 1F38A 2PV0A 1ZKDA 5DRTA 5FHRA 4KDCA 5HIMA 4RV9A 5K0JA 3KQPA 2O06A 1DUSA 4PGHA 5HFJA 4RYLA 5KVAA 2AS0A 4HC4A 1JG1A 3JWJA 3LCCA 1JSZA 5H02A 2I9KA 1KYZA 2O57A 5KYGA 3DXZA 3PTAA 3UJ9A 3LBFA 4RTKA 1TW2A 4CKCA 2AOTB 2AN3A 5C0OE 5ERGB 5EIFA 3SXJA 3MTEA 3HA7A 2Z6AA 4BLVA 1QAMA 3H2BA 3GO4A 4R05A 3KR1A 4DM3A 5K0FA 2Z6QA 2UYCA 3BT7A 3HP7A 4PYQA 3UFBA 3UJ6A 3PFGA 2NXCA 4XUDA 4YV2A 3BKXA 2H11A 3S68A 1SG9A 3GJYA 3LKZA 1ZGAA 2ZWVA 4FT4A 4YUZA 3LL7A 4YUVA 4QDKA 2C7OA 3HCCA 4MHTA 3TMAA 3OZSA 3GRVA 5BP7A 3FPJA 5FQOA 3UA3A 2I6GA 3C3YA 1XDUA 4NECA 3R6TA 5DM0A 5CM2Z 4PIMA 5F2NA 2Z6UA 3G5TA 1P1CA 5GWXA 3KQQA 4MWZA 2IP2A 4FR0A 2ZW9A 3R24A 3OCJA 5FUBA 5GOZA 4BLWA 2P7IA 3DULA 5DM2A 3MHTA 3CCFA 2VZ9A 3UWPA 2A14A 2BR4A 3AY0A 1G8SA 4BY9E 2AOXA 2BR5A 5CCBA 3CJQA 4PYJA 3EVCA 1ZGJA 4F85A 3EVAA 3GDHA 4HRAA 5FA8A 1RJDA 3A27A 5CCXA 2OB2A 3LKDA 2QM3A 3EEOA 1EJ0A 2ZWAA 3G7UA 3KKZA 3A25A 3MTIA 1SUIA 2ZBPA 2PWPA 4YUYA 2XYQA 2PX4A 1IM8A 4C08A 4E2ZA 3FPFA 3SSNA 4KVZA 2OBFA 1BKYA 4PNEA 1M0EA
chains in the Genus database with same CATH superfamily
4PZ9A 3RUHA 1CZUA 2J1LA 4W7HA 3J81A 2Z4RA 5DV9A 3R5JA 2WINI 4K5QA 4AWAA 2W5UA 2E4UA 1RHJA 1CB0A 2E4ZA 2YHAA 2ZR8A 4MZDA 4YAJA 3V8QA 3VMFA 3L6DA 4L78A 3EX7C 1TTTA 1BMDA 3DGFC 1KRXA 5AI5A 3WQHA 4WCFC 3DBRA 1L3IA 1QH9A 2R5WA 2RC6A 1Y3AA 1OB2A 2QQFA 3KB1A 1G42A 3F7TA 1FS4A 5CFRA 4L5JA 3BGWA 1GNVA 3HYCA 1JG2A 1JGTA 1B0AA 3VZCA 1WU8A 1QCYA 1T4CB 2WJIA 1XCJA 1XOIA 3PXBA 5ALUA 3WLLA 4H0NA 3H16A 3JZDA 5HJEA 2GZRA 2J41A 2VT2A 3LECA 2OHJA 4B76A 2PYZA 3BORA 4HDKB 1XPOA 3DMTA 4LOJA 3MZ0A 2BE7A 3B12A 4E31A 3W9YA 3QFRA 2AQIA 3KSBC 4BNVA 2JFNA 2FCAA 4HAVA 1PZXA 4X1OA 4CR6A 2IDKA 3P96A 2DQKA 2Q9BA 4D5EA 3T1TA 2OFXA 1V8ZA 2ZE8A 4XKJA 3TQHA 3FYTA 4JBHA 3RC2A 2ZKIA 1DGQA 4JSTA 2NO5A 4CM3A 1R8JA 1U0JA 1XMVA 1P7PA 3AFMA 3AO0B 4GI7A 2I8LA 2IYNA 1JXQA 1K3TA 1KAQA 4XIIA 1A04A 4N47A 3ZWBA 5HF9A 4QZVA 1G20A 1F12A 1KFKB 1XGKA 2WYWA 2ZSJA 3BQNB 3L4BC 3E1KA 4QOGA 3R9XB 4LDNA 1ES9A 5K0NA 1JMYA 1Z17A 1WF3A 3KHSA 1D1PA 4U7PB 5CB6A 2FJUA 3FA2A 5K3AA 4Y9RA 1NR5A 5B55A 3CUSA 5ECGC 5HDQA 1OFGA 1S2IA 4W8OA 2OYSA 3TD2A 2QYSA 5TXGA 5DNEA 2WD7A 1KHHA 3WGGA 4HPJB 4QUDA 3RWOA 3M34A 1FXWF 4AMBA 4BB0A 4Y9UA 1XRPA 3GJTA 5FBVB 4KPYA 1K7FB 4MS3B 3PGLA 5SZJA 4YBZA 4XAQA 1FUIA 5TT1A 2AZTA 3AVOA 3TG2A 3K6SB 3MM4A 4BKOA 2BMDA 4QJ5A 4R0MA 1VYVA 3C4JA 4AO6A 3D1VA 2G6TA 3O75A 3EGOA 3P9QA 4HDOB 3TD9A 2WNSA 2XRFA 4CT0A 4LHSA 3ZN2A 1SOMA 3NBQA 4DC9A 1Z8DA 5KMGB 3RR2A 4YP9A 3LUGA 3DTVB 5JAHA 2CLCX 2IF2A 4AN1A 4JT8A 1Z74A 3ORYA 2XBLA 3PD0A 4MQ4A 5FLEX 1JIQA 1ZJYA 4EY8A 4PBRA 3UMCA 2LW7A 1UMCA 5ALKA 3C5WP 1SKYB 4BZPA 3UAXA 4BXOB 1KI1A 1QFSA 3AF0A 3DWIA 3MCAA 4KI0A 1ID1A 1O94C 4FE3A 2UU9B 3H5AA 4I1SA 2ZWOA 4YAGA 5HE8A 1GL6A 1VFNA 4M8KA 4PS1A 3M1LA 1W75A 1XRSB 2X86A 5C5CA 1RWNA 1ULAA 2H0AA 2VEOA 4JQSA 3U4GA 1IPEA 3G8CA 2GOYA 1F7UA 4JLWA 3OPYA 2NSJA 5TMPA 4UCQA 5IXSA 4GE3A 4MVJH 1DT3A 2C61A 1UPAA 1KQPA 1L4GA 4G0YA 1EFVA 5SZKB 1TUEA 1OKKA 4FYYA 3RCBA 4OMFG 3QF4A 1BWQA 5B1IA 4UTPA 1TMGE 4FI3C 4MHSA 3TOSA 1RYDA 3E70C 4H7FA 2RG1A 2WKSA 3H2KA 4HWTA 3VDQA 4JKIA 1QIJA 1GAQA 1G5QA 2C07A 2OVFA 4QBTA 3FPCA 1K27A 3GGDA 3PQ2A 3T9CA 4AVYA 5L95A 1X2EA 2MSNA 2ZUDA 3WWYA 1MDFA 3ESQA 2O2IA 5AVVA 4OHKA 1RXCA 5IKXA 1KY4A 3H7IA 3WXBA 4Z0PA 4O2BA 1G17A 1LNZA 1NXWA 2A9OA 2HF2A 3INNA 2X6RA 4KPGA 1F6DA 3PGXA 1QONA 4R2HA 5DX8A 1SD1A 1GPKA 1JSRA 1OTXA 5ESWA 1NG1A 5AXCA 2PWZA 5IASA 4LW8A 2PT9A 4P38A 1WNTA 2MWMA 3GFQA 4G25A 2WT8A 1EK5A 2XT0A 2LGJA 2WI8A 3JR3A 4BJ3A 4O4JF 4IKPA 1IY1A 1GPBA 1V95A 4C89A 1SXHA 3DOCA 3ABRB 3FUCA 4B84A 4DA7A 1U8EA 1G66A 1Z9BA 4I4LA 4Q03A 4RHUA 1XHFA 5CX4A 4ZVVA 3TRKA 4DYVA 3RVOA 1NQAO 2X0KA 1D1TA 2H1HA 4RQAA 1CFZA 3U40A 2G1PA 2R8ZA 1F6WA 4MQEA 3COWA 4ADSG 3GDWA 1SXJA 2IEYA 3A14A 3G9UA 4H6XA 4RE5A 3PLRA 2BEVA 3UBMA 4AJ2A 4BVEA 2A0UA 1Y1SA 2FEKA 1CYEA 2C3YA 4OX9Y 1NBAA 1WUTA 3DOUA 3KJGA 2ZR7A 3C8MA 1MIHA 1OE0A 3Q3HA 2DQSA 3BE6A 1SBTA 3QJGA 5C8XA 4V0ME 2B35A 2ZI5A 1VA4A 3LGXA 4II3A 3O5AA 4FT2A 1EEHA 1LSOA 1DCTA 4J7UA 5J40A 1RCTE 2AL7A 3VKVA 4X41A 2EJCA 2YVKA 1G5TA 3U3OA 3GIDA 3KVVA 3HCAA 5EIOA 1A76A 3H1BA 4ZMSA 4NIMA 3NJ8A 4B44A 4EVQA 3ZWCA 3HRKA 5FWYA 1E20A 4XX0B 2CE7A 2ZRGA 3QPVA 1NUQA 2MIIA 3SY8A 5KYUB 1HH4A 2X0RA 4CM7A 4YO8A 3TX2A 4XLTA 3AH8A 4WLEA 3RK1A 3WYEA 3OFJA 3ZNPA 4XR4A 3V8RA 4EH1A 4V0RA 3ZHBA 2BH2A 1VPDA 2H4WA 3DHNA 4B6OA 2WDZA 2ONCA 1B2RA 3N74A 4LYFA 1EWYA 1U0LA 2ZUSA 3MRVA 1YQGA 5AOVA 1Y4DE 5K8JB 1XL1A 1JH9A 1T9AA 3HADA 3AYXB 4IHJA 3DMTC 3TH5A 1AGNA 2FYTA 3GEGA 5HF8A 3A1WA 1H5NA 2IEGA 2ZUWA 4HEA6 2AB0A 1L5MA 1UJCA 3FB4A 4MVJF 4M1MA 4PZDA 4UZSA 1I7PA 1ZNXA 3BWYA 4IIEA 1AB5A 2HJRA 2K6GA 4TYYA 4EI7A 4FCTA 2BOVA 4JIMA 1PX0A 1SVUA 5TPWB 5IJWA 3KR9A 2BKXA 2QG9A 1UH5A 4F6LA 3BH6A 2X1MA 4NBWA 3CR8A 3QKWA 4UEQA 2AOTA 4JL6A 4PAGA 1NN5A 3KLNA 3P9NA 3OKFA 5GONB 1OFIA 2KBFA 3NG1A 1LNSA 1MKYA 4GYYA 1YB2A 2C31A 2CY0A 2FFQA 3F8TA 2FE1A 3H5TA 4Q4DA 3IDQA 3ROPA 4EHJA 1ECFA 4E1AA 5F2OA 3E3LA 4ID3A 5KNCH 1UAYA 2WHQA 2V59A 2P5YA 2VT7A 4LXXA 3T3MB 3U7QA 2Z98A 4DL9A 3MUOA 2YZKA 4DCCA 1NW9B 2RBKA 1FSPA 2RHDA 1FC0A 3OIWA 2FHPA 3OICA 4XX1A 1PQUA 5THKA 3V1MA 5D87A 5EG5A 3ZE2B 3ZWXA 4L57A 3ZWMA 1JQJC 4KIFA 4RPHA 5IMBA 1N34B 1J97A 1RPTA 1GAWA 1ZSVA 3O03A 4IG4A 1Z4LA 1JB1A 3NIDB 4JLVA 3FCEA 1KJQA 4HBGA 2BGIA 4YWJA 1O0CA 3FUVA 2DOKA 3PHCA 4NK4A 3AWIA 3M4NA 1LB1B 1PL7A 1IBSA 3M83A 2G8LA 3TSAA 3OQMA 2WU0A 1BXRB 1KMHA 1T3GA 2CF5A 2DR3A 1Q3KA 3KAQA 2HHHB 4I6JA 5M3BA 1RCUA 3QYFA 4LFAB 2XKKA 1YJAA 3A9WA 5TV2A 4J3JA 5TQ2A 2XJ9A 3LRPA 2Q3CA 1EMDA 4MVJI 3MD0A 5IC6A 3RUIA 4XGRA 3ZIAA 2R60A 3EEYA 1M83A 3HZOA 1NGSA 1XMPA 4KYTA 4MV8A 4Y2UA 5G1OA 7MHTA 3OAAA 4GEKA 4RVNA 4CM4B 1PHPA 1G8AA 2C54A 3JYPA 1WQ4A 1EUZA 4M7WA 3SIWA 2R6JA 2XD9A 1KEEB 2VSNA 1X1BA 4IQ0A 4RY9A 5JS6A 2XSZA 2F8TA 3L7CA 4NU6A 3A9RA 1PX2A 5C32A 4GDMA 3OX1A 1HRKA 4O8ZA 2FEOA 3QY9A 3RT1A 5HS4A 3X1JA 3TUZC 1P1RA 3RSZA 5LQUA 2FXVA 3H86A 4E5VA 2EFGA 3RKRA 1IG0A 1PJSA 2HDNB 3G59A 3U37A 3C70A 2SKDA 4OHVA 4QU9A 1ILEA 3L8YA 4OKNA 3I09A 5HMLA 2P91A 4U63A 1RC8A 2ZIWB 4FHGA 3EGDA 4ZXFA 1UMKA 4JI3B 4JHXA 4D5GA 4I66A 5K8CA 3KZXA 1TLLA 1IXSB 3C0KA 4BNGA 1MVOA 1DUIA 2LIPA 2FU5C 3LPMA 4MGHA 4M1KA 2J3QA 1YFLA 3UZUA 2FSSA 3UPTA 2G17A 3KQVA 1Q7TA 2JEOA 3M5DA 4H1HA 5DX1A 4GPTA 4HX9A 4K9LA 1H22A 3BC1A 3ETGA 5K3OA 3U4MA 5HOQA 2XAUA 5DOVA 3U81A 2BSXA 2VUSA 4UDOA 5JNLA 2O1EA 3RK4A 2AF4C 4TV9A 5AJHA 3QVTA 4DMMA 3KKOA 3RIYA 3X1DA 2QVBA 1O9HA 3GGPA 3K30A 3LUPA 1BS1A 1C30B 2OHVA 4WZAE 2WJ4A 4XIYA 1EM8B 4HFJA 2W58A 5CEFA 1QVVA 1SKYE 1U7DA 2JFOA 3FWHA 1JHYA 4MR7B 4Q66C 2ATVA 2A4KA 3K0KA 4JDPA 4YRLA 4I4TA 4YPVA 2LBPA 1KFEB 1NPTO 1QG2A 3QA9A 2UUCB 4BO4A 1L8QA 3VAYA 1RVV1 3JX9A 4M7PA 2I54A 3EVZA 1NVDA 1K6XA 5A4IS 1U7HA 2HF8A 1A27A 1SXJC 4MYHA 2LIVA 4R1MA 2FW1A 1P5RA 1Q6YA 1IWBB 1GHTA 1KP9A 3LC2O 4PBSA 2HCTA 5KJ1A 2QXUA 2YQ5A 3HPQA 2C2OA 1Y5RA 1ZM7A 3A4MA 3L7DA 1KO7A 4IDBA 3T35A 4HGNA 4E3ZA 4TTRA 1V6CA 1KORA 2EP7A 2KM1A 4NFYA 1PL8A 3ZVNA 1Y4AE 3EIWA 5FTWA 4CF7A 2QZJA 4ES6A 1CF4A 3O8RA 2PKYX 3GH1A 4P0PB 1AQUA 2DVMA 5JAZA 3AZOA 2IYWA 1OT5A 5K8TA 2E5WA 1G6KA 2B9VA 5JJBA 4RM2A 3ND5A 2A0WA 1DIOB 1KAHA 2X19A 2Y1OA 3JZIA 4QOIA 4TL6A 5ALTA 5FD8A 1SC3A 3ZKWA 3ZCPA 4K8RB 3ZHSA 4GSLA 1NDUA 1MX1A 1C3JA 4FFBA 3SJUA 2QE7A 1W0CA 2N47A 1X1EA 3IEKA 3QG5A 1TJ5A 4XH9B 3VR4H 1W8IA 4DBZA 1ZBQA 4RUKA 2WHPA 4E5SA 1KEWA 3GNLA 4TMYA 1WO8A 2PSFA 1S2NA 4KDCA 5ALGA 4DLTA 4ENTA 1ZAKA 4X92A 4DT1A 3VDRA 4KXMA 3LCCA 1QE0A 1Z5UA 3I8XA 1QLJA 2ACWA 2AKYA 2MSEB 5FL7A 421PA 1P72A 1VJCA 3BVPA 4TROA 4DRXB 4C20A 1RWOA 1X1RA 4B87A 5C0OE 2DFLA 3PQFA 5TVGA 3ZS8A 3MCWA 4PVDA 2JCBA 1WXFA 3HA7A 2W98A 4KJXA 4HFRA 1HFJA 2O7SA 3WKBA 1ZK0A 4C2TA 4N9WA 5LMZA 3Q85A 1U9JA 3LO5A 1PEKE 1I3NA 4KGVA 4D57A 1HL7A 2RGDA 4DQKA 3N3BC 3P27A 3GPDG 5I9LA 1EP3B 1IY0A 4FN4A 1DP4A 2X2FA 3U16A 4D74A 2I3DA 4PZ0A 3HCCA 3HLYA 1XCBA 1Z2OX 2D1QA 3U48A 4Q9IA 1E2FA 2NWQA 3GRVA 4XZ3A 1ZRHA 3RRZA 3T9BA 2E7ZA 3IBGA 3TZCA 2XCIA 4WNYA 4YP1A 5FQOA 4B83A 3GP5A 3SZMA 1BN6A 2F3SA 3ZXXA 3L4EA 1TK2A 4YXWA 4I1RA 1GYQA 1P1CA 3LT2A 4WBNB 3BGSA 5J47A 2OESA 3LFTA 5C80A 4BVBA 4BLWA 2EKLA 2IIVA 4H2DA 2YXBA 4Q9DA 4BV2A 1JFVA 5LP6F 1O03A 2PZAA 2FVYA 5EXTA 3K15A 3FGNA 1OH5A 2IPNA 1S2DA 3IKVA 5KVCA 3Q6NA 1M66A 4V2UA 4AUMA 1ESDA 4L2IA 5HQ3A 3EVAA 2BELA 2VUTA 3A27A 5T4EA 3WOVA 5KU7A 1U1GA 3L1UA 2I4LA 1ZISA 1RYFA 2Y76A 1P19A 5CDYA 2W6IA 3A2MA 2QT9A 3O47A 1ORWA 4KK3A 3KC2A 2YFQA 1YB4A 4HVTA 3NALA 4LK3A 3SHQA 1ZVVA 3LH5A 1SC6A 3TGWA 1DU4A 4CNBA 2QV7A 4MVCA 3RS0A 3EEQA 3Q8MA 4EFDA 1LQUA 2IH2A 5K7SA 2BBSA 2C5GA 3DUFA 1PQWA 5HSGA 1NNEA 1PJCA 4F7WA 3AUSA 1ZUIA 2W6CX 4FWTA 5ES4B 4W6ZA 3JQRA 4DC1A 4UTVA 3GJ4A 1DT5A 1DVRA 1FTNA 2FW6A 2PRKA 1REQB 4KE9A 2O0KA 2GFHA 2HUPA 4BYGA 4E70A 3GT4A 1LBTA 2QROA 3V7NA 1CUGA 3TK1A 3ZR4B 4LDPA 4OHYA 3O3CA 3V97A 4AG6A 1H1DA 1YK0A 1QFYA 2NV2B 3GC6A 3JSAA 4OI1A 3IIMA 1YVRA 5A1JA 1EHYA 3PEYA 2IGBA 1B1CA 3B38A 3BBLA 1OLSB 3QEKA 4A03A 3GPCA 4J07A 4KL8S 5B7GA 3QMMA 3AF6A 2ZRPA 3SMVA 1ODIA 4RIEA 1E4OA 1CPYA 4FLEA 2FDCA 4RADA 2IXEA 5CXUA 1R4NB 3DFUA 2ADFA 3IUEA 4KMRA 2JLZA 4GXNA 2FR0A 1G8GA 4LCBA 5SYMA 3ZK7A 4ESVA 4WXEA 4KR6A 1L4NA 1EK6A 3EF1A 4LZOA 5B2FA 4K46A 5AHRA 3ZHZA 2FG5A 3UK7A 1G7CA 5KNCD 2Q6OA 3KU1A 3SEAA 5E1OA 1ENPA 1RPZA 4D9MA 1HE4A 2I4MA 2AN1A 1OFUA 4GH5A 1O54A 4MQ6A 4F5WA 3O2SB 3OE4A 4QTXA 1AU9A 2Y27A 3ZHRA 5FULA 4ALMA 5EGNA 1C9NA 3ELYA 4B5LA 3OFVA 4EG5A 4YI5A 4ZYYA 5GJVC 3E0QA 2XUKA 5ILQA 3C3WA 3BZWA 1WBDA 1IYZA 4WNIA 1IULA 3OM9A 4NOMA 5EQFA 2LR0A 4E14A 1TM5E 4L7QA 2B92A 1BW9B 2V6IA 3ID6C 1AZSC 3ZBTA 1YA6A 1RYHA 3NAQA 5IVPA 4FOLA 4Q7LA 3L8MA 5GV8A 5MN5A 2O2YA 3NORA 1JHVA 3THRA 3K9FC 5I4BA 1NNUA 4IOMA 1WB9A 1PNOA 1WOYA 1U5BB 1KXJA 3RHSA 3GN2A 4TZTA 3AVTA 4FB4A 3PENA 2AW5A 2IY7A 4S1WA 3WMFA 5EQJB 1DKOA 2HJ9A 4IDPA 1T2EA 1PJ8A 1S8OA 2PKRA 4DCOA 1OC2A 3UWMA 3AU8A 4KYVA 4CIYA 4DILA 1Q84A 1I36A 4O08A 4V0MA 5HGJA 4XYBA 3HM2A 5FPPA 1F8UA 1I01A 1Z4OA 1UDWA 4J49A 2HQOA 1SRRA 2XDAA 4RF4A 3FVRA 5AI6A 3TX6A 2VTBA 5AH0A 4BASA 3IAAA 1VRVA 4PGAA 3FZQA 4AS2A 2GZAA 2Q41A 1Q16A 1PFKA 2JIRA 5BYJA 1EG2A 1QH1A 3ESRA 1OFTA 3T99A 1AF7A 3FKJA 1USKA 1SZPA 1Q11A 2AUTA 1ULSA 1M0WA 2H0RA 3FVVA 3JWHA 4JJIA 4LWPA 5FA6A 5HCUA 2OHFA 3EHDA 1KZ9A 2ACEA 4U2GA 4BP8A 2L69A 2D8AA 4TM8A 1OCEA 4HQLA 4HG2A 4UTOA 3S3TA 1D6SA 4HMQA 5BQPA 4Y6SA 1DIBA 1SVWA 1U3UA 3NWBA 4FSDA 1O5TA 1GNSA 4LCJA 5BVHA 3N2NA 1XCOA 5GM2A 5EI5A 2IV3A 2IWRA 1XA4A 1EZ1A 1WR8A 1P39A 5IYZF 3NHKA 4RXMA 5DM1A 3HQ4O 1TEXA 5JDCA 5CEEA 4HH0A 5ULLA 5CIWA 1GSOA 1ZSNA 2GBFA 4Q3DA 1CHDA 4Q9LA 1YZNA 2DJ5A 5F5LA 4LSWA 1E9RA 3DBLA 2R1VA 2NUPB 3JYQA 3H8WA 5F7JA 3PNQA 1H0RA 3H9CA 4M0EA 5DI9A 4OO3A 1SY7A 4PPYA 1WBJB 4O33A 4RK1A 3ZV3A 1V1MB 1JHRA 4LKRA 4O4HF 4R1QA 3MTAA 1AQLA 4B81A 1GGHA 1NLUA 1I24A 4JEIA 5CDFA 4DMUB 4XYMA 4PC3A 2DETA 4JBIA 4REQA 4C4ZA 4F2HA 3MQ2A 4YMTA 1ZLXA 4C9BA 1RP7A 5BRNA 1F06A 3NHSA 4Q9NA 2AXPA 5DTRA 4PONA 1K4MA 1N9GB 4XCXA 2CWWA 3D1LA 1XMQB 1GQYA 4MX8A 3S8MA 3OECA 3WGJA 2P5UA 4DUZB 1KL7A 3VR3D 1PVDA 2F1IA 2PQ6A 5DYWA 1X7GA 2WWTA 3O2NA 4X7MA 1STOA 5FTLA 1NVKA 1SEVA 4MITA 3DCYA 4JDUA 1XE3A 1P5JA 3M6XA 3RARA 1BMTA 1CR6A 1SHUX 3VVCA 4QLBA 1OI4A 1KIFA 2Q3FA 2MR5A 3HZHA 2WWXA 5EAIA 3AYZB 4ZQIA 2H3EA 3VU3A 2YIDA 4BMDA 3JQ7B 1XEXA 1JEJA 4Y6GB 4AZTA 4TVSA 2GPJA 2ZETA 5ECWA 3UO8B 4IZOA 3VOTA 4BPRA 4CUKA 2RIPA 2Q5EA 3EMVA 1SMKA 1CK4A 3CNHA 4JCCA 5BSEA 4XGKA 2F00A 5BWLA 3V33A 4C04A 1RAHA 3WHLA 1NONA 2CXPA 2V4ZA 4UARA 4M7OA 3TL3A 2N0SA 5B64A 4TT3D 4A1OA 2E4XA 2PFGA 3AC0A 1I80A 5TQJA 3W9UA 1WF6A 3EAFA 4FYWA 4DSTA 2YJ5A 3IDSA 5KOJA 2AWOA 3M4ZA 1P7CA 1ZWKA 4Y0AA 5HKOA 3VSEA 4NWIA 5CEJA 2CMKA 1TAQA 2F59A 2JAHA 3JS5A 2WTAA 2BKVA 1RAGA 3GJ7A 2XT6A 1D2EA 2QW1A 5DBFA 3TXYA 3BJIC 1CUXA 1ZJZA 4Y2SA 5L45A 2LRHA 2IPMA 5CGQB 5JU6A 5HG0A 3IUPA 4RZXA 1CRZA 4AFNA 3GUZA 2AG6A 2VDWB 2XVMA 2B4RO 3F6BX 3BWEA 3UW3A 4P4UA 1SUCA 1UJ4A 2B61A 3PPXA 5HQTA 1HLDA 1P29A 1ZLYA 1NUAA 1J7KA 3DLPX 3SC4A 2HLPA 4C4XA 3LPCA 3GJSA 4CHGA 1JLRA 4ED9A 3DTNA 2HHJA 2Y0DA 1E60A 1MB0A 1T36B 3DGEC 1YC5A 4NYMQ 1BJRE 2R87A 5CITA 3SGLA 3TLCA 5EIEA 2Z6VA 4BRUA 1WVMA 5AFSA 3LVRE 2G9QA 5A04A 3DW1X 5AVZA 1FB5A 3WB9A 1BAPA 3E84A 5ITZA 4NCNA 5JAUA 4P7FA 3EDOA 3A6GA 3HL4A 1CERA 1U0FA 3ROFA 3QXCA 3TZLA 3LUCA 3D7NA 1QVAA 2JB9A 3D0QA 5AUNB 2WF5A 4OJTA 4WAUA 3VTFA 1GCGA 3Q6MA 4S1VA 3WIUA 3O74A 3PBKA 1NR1A 1C1DB 4P08A 2B69A 2JCGA 3MTJA 4TMZA 5E7MA 3VOBA 5F23A 1NG9A 4NICA 1EFLA 1BDHA 1M34E 3KQMA 3H3FA 4GSYA 1G3UA 2B21A 1E92A 2V7EA 2XA2A 1P5HA 3ZBPA 1H4TA 3SKVA 1YCFA 2PA3A 2W6OA 5HUJA 4TTVA 1LXCA 1V45E 3FCSB 1JF8A 1XZGA 3O4RA 3R3UA 2C2MA 4RPLA 1XJQA 3KE9A 3ABZA 5BWMA 4WZAA 2WFLA 3HL0A 4L6CA 3DYBA 2IHUA 2X4GA 4YRIA 5FDFA 5KX5F 2W2OA 4H0CA 3JAMA 4BXOA 1TRKA 5L3SB 3A3PA 3A32A 5CNIA 3OZTA 1CVLA 2GKGA 1X7WB 4XSGA 1RBZA 1RI5A 1IY9A 1IJKA 4JLSA 4KMOA 4NK5A 2Q3HA 1WZIA 4YJFA 5FOUA 3IX7A 4BGUA 3H2HA 4ZVLA 5KJCA 4QBIA 5AW7A 3KQSA 5AXDA 2AJ8A 4ZV9A 1B43A 1IATA 1TUIA 2IYFA 3X43A 5JUWA 1L6IA 1WU7A 3AOEA 4H0FA 3ZKAA 5JW6A 3ZBQA 2PJDA 1CY4A 3NFRA 4CEHB 1NZFA 3U26A 5B58T 3G02A 3G8BA 4KREA 1FNBA 2J0UB 2JIPA 4M76B 1L4UA 4ZRDA 1O94D 1PR5A 2JJ2D 1L1FA 1Z0IA 3DKVA 1QHNA 1DHRA 2IKQA 1GOTA 4ZO9A 3RTBA 3LGSA 3COVA 3M49A 2K7ZA 4FJ1A 4TVBA 1RFLA 1A9SA 3KVRA 1UZNA 3F78A 1Z3CA 1K8ZB 5ES3A 1AIPA 5CBPB 1DJLA 3EH1A 1MV8A 1IN5A 3QYJA 3QHAA 2O2JA 2BM0A 3MK31 3QBDA 2QM0A 2D5IA 1T26A 3ICQB 1WB6A 5JZOA 2P1DA 1GUFA 2YMMA 4AJ1A 1KR5A 5I9MA 2YHIA 3U3MA 4C43A 3GLGB 3HBJA 2YYYA 1P3JA 2OAEA 4D26A 1AZWA 1GFWA 3H5WA 2BFEA 2VP0A 3QXHA 1U8ZA 5JDCC 3SVTA 1DX6A 2C95A 2GN6A 1WL8A 3D6TB 1M0SA 4CFSA 3C87A 3OWOA 1IK4A 3SX0A 4EKNB 4YWHA 3QE0A 5KYWA 2OOKA 4BUZA 3PB3A 1HGXA 2W71A 3JATA 1Y4UA 5DYNA 2ZUVA 1Z37A 1OBVA 2BR3A 2JC3A 2Q62A 4F8JA 4GM0A 3NBMA 1W49A 1XNGA 2RKWA 4UUQA 3RVRA 5DHTA 1Y8AA 5A6SA 3C41J 1ULTA 4WLUA 4AM8A 1DX4A 3E5RA 3N6RA 3LY5A 4IRXA 1F3LA 1VKOA 3K4HA 3AU9A 3EGCA 3L93A 3UG7A 4LOLA 1EESA 1NVVQ 5I9IA 1M5RA 1AF4A 1Z0ZA 3W2FA 4DC0A 4GBGA 3GJ8A 5J43A 1ZONA 2PX6A 4H59A 1M8FA 2WYHA 2YOGA 2AI2A 1BFKA 2J9FB 3DT9A 3Q1LA 5C7YA 5ICCA 1A1VA 1XYVA 3ROZA 3D6JA 2WF7A 1PLKA 1PJRA 2C84A 2AQ8A 3A11A 3DOJA 4P83A 4Q1CA 3QE4A 2QQEA 1Z0SA 1Q15A 4JZKA 4JU8A 4NFSA 4L5IA 2PO7A 1TT5B 1U7WA 3LBAA 3VH2A 1W6UA 3GA0A 4GPEA 3DZIA 1UIRA 4PSVA 1UMBB 1BRTA 2WVAA 3DOOA 3DMYA 3LDAA 3PGKA 1UJMA 2HXSA 4G81A 3G23A 4PSAA 3ZDXB 1XKQA 2B8TA 1V5FA 1JECA 1FA9A 1VLLA 1E9FA 2JAUA 2R96A 5J2UF 4GPIB 4UTRA 3T5BA 4HXEB 4B7AA 7ABPA 4G8JA 4RZIA 3W5CA 2X9NA 2RI0A 3EVTA 1TEHA 4PLZA 1CJKC 2OQIA 1JEAA 4GUAA 3K1YA 2NXEA 1GTVA 2BW0A 1H9CA 2K4MA 3G82C 5GGYA 3U49A 5C9ZA 1I3OA 1EH5A 3LG2A 1SCIA 1FFXB 2GA9A 2HMWA 4PNEA 4ZAVA 3FGZA 5IDWA 3JAWA 4ZYVA 1VHLA 2ACVA 3LLSA 1RZVA 5J2TA 1RLIA 4NRDA 1Z5VA 3ZJ4A 3QYPA 4B6FA 1T2CA 3K2EA 3S8EA 1BCRB 1F8GA 1ORHA 2EZ9A 4J0QA 2EQBA 4JUFA 3H05A 4B45A 2C9YA 2VQEB 3NMUF 2Q4DA 3UXEA 3L79A 1QYRA 4ANFA 4QE3A 2X0DA 1CJBA 1X9GA 1YE3A 2JHFA 2ZJOA 5K3SA 3LW8A 2XVXA 4B2LA 2ZYIA 1B74A 1Q74A 3H1AA 5J4VA 1T5SA 4HATA 1W29A 1WDTA 2C5BA 4EGSA 2QBYB 3B5EA 2VH5R 3BRWA 1BXKA 2ZZKA 1U8AA 1K89A 1URPA 2MYPA 3OTWA 5G4KB 3VNRA 4R8RA 2W4IA 4GSKA 2JA1A 3W8EA 3ZPXA 3V2HA 1BNCA 1SKAA 4LC0A 2C5AA 4CU5A 1M1YE 2ZYRA 2IHNA 4DIEA 4H7EA 2X76A 3I28A 3EF0A 4YYZA 5T7BA 4N5IX 1JQAA 4CL8A 4HRXA 4L8VA 4D4IA 3CLRC 3PTAA 2KE5A 2NW6A 3ICEA 3FRJA 2GWHA 4AWBA 1ISJA 2IYRA 5EIFA 3MTEA 3CIFA 3LF1A 3NBUA 3WLHA 3GLFB 2Z6AA 3PDUA 4IW3B 1CD5A 2HO4A 1CY6A 4OL0A 4HGRA 3UFBA 2EHJA 3ESAA 3HJAA 1JU4A 1Y48E 4MA5A 4ARAA 3NATA 3T34A 1SG9A 1D9XA 4JB3A 1UAAA 1SIUA 1UP7A 4NOJA 4M8LA 3LL7A 4YUVA 1NMYA 1E1RA 1NN1A 2JS7A 1UZAA 2C2BA 3DO8A 3LWBA 3KVYA 3V8EA 4PE5B 4PSDA 1Q1EA 5IANA 4HWGA 2BJVA 1NJ8A 3T1HB 2AWNA 4GRIA 4RIIA 4CMKA 1YCGA 1EWTA 1ZN2A 2P68A 1XAGA 3MPOA 4UM5A 4KQCA 4ZCIA 1RWQA 1JQLB 3L6RA 1R12A 3JAKA 3K70C 1OWNA 4RGBA 5GAJA 1LJ8A 1LW6E 1L5VA 3MUEA 3OCJA 4RGVA 4Z7NB 5BQ3A 5JJKA 1ADCA 2G63A 1SULA 4R40A 3GY0A 4L07A 3DDWA 4DWOA 1G8SA 1HDXA 2AOXA 1Y1RA 2L19A 3IT2A 4G4JA 4D0SA 3DMRA 1DWUA 3CYFA 1PR9A 4O2AA 4QSMA 3CQ9A 2PSEA 3KYDB 2OB2A 4YJHA 5B3AA 4A6XA 4N0QA 5JWOA 2XB8A 4W1RA 1KEEA 1TM4E 1R7RA 3AOEC 3OIUA 2PWBA 4XRRA 3PT5A 5IJAA 5E4JA 1L7MA 2IZ1A 1ECGA 4RVSA 2XYQA 2PX4A 2JIQA 4D44A 4KVZA 3RTEA 4DLPA 5C34B 1DG1G 3H5IA 4E09A 2R6GA 1D1SA 1C9MA 1WUIS 4L4SA 1PYGA 3PHJA 3F7NA 5DN9A 1PEDA 3ZZMA 1EUDB 1USWA 3CSUA 4QNRA 2WIDA 2HSWA 1VBMA 3EQ7A 3MIZA 4RGYA 3ZDCA 3CINA 2WU3A 2NNLD 1QRDA 1GRVA 1XHEA 2CW5A 2HNAA 2XBUA 4GC5A 4JLBA 4ZO7A 3LS2A 3G9XA 1N57A 5DN6A 3VO8A 1RYZA 3HA5A 5LN1A 2O8NA 1TK9A 1OKKD 4PCVA 4BFVA 4EY4A 5DM70 2AE1A 3KYCB 5LQSA 2XQGA 1CWUA 2D54A 4AUEA 4ZI2A 1ML3A 1RLTA 3IBCA 5A3JA 3P4XA 4S24A 1JAIA 1G21E 2QE6A 3PDJA 4TVKA 4UFOA 1JEYA 4G0XA 1PE0A 2VG8A 4HB2A 3UGQA 3U6KA 3NP7A 5EYPA 3U5ZB 1NXOA 3BD8A 2YWGA 1NXQA 3H1PA 2C4KA 3ZE1B 4OHZA 3ZDAA 1RHRA 5BV2P 1YC2A 1TM3E 5F7XA 3B6ZA 1KJZA 2PNFA 2MOKA 2QN1A 3VPBA 2WEKA 1I9CA 2B98A 1RNLA 4QYWA 5KJFA 3L43A 5EVJA 3BJMA 1KF0A 2P2LA 4RZ3A 5FR1A 2O2EA 1VHDA 4XR9A 7MDHA 3GHYA 3KR0A 1B0ZA 3FLAA 2X1HA 821PA 4YROA 1T6NA 4S2UA 2B9EA 2HMUA 5EINA 3QX7A 1MDBA 1X7DA 1VE3A 2ZCVA 4LUCA 4QOFA 1KK0A 5HM8A 2J0EA 5EWMB 1NJSA 4UVDA 4MROA 3NYQA 3WX0A 4XCQA 3A1FA 2FLWA 1EHIA 2CUZA 4IDGA 4QAQA 5KDLA 3CUKA 1TC1A 3GN1A 2J0SA 1II9A 1UC8A 3G13A 3OQJA 2BM9A 1X1CA 5LZ7A 4BQIA 1IN1A 4QBFA 1N2BA 1X9IA 4C0HA 5E6UB 2ZJBA 2YOFA 3OCZA 3AIIA 4LMBA 1VSBA 4Q4JA 4Z4HA 3ZK8A 5JI2E 5JYEA 5DIFA 1SXJD 4JJAA 4PC2A 1AKMA 3QUSA 3F3SA 1RRKA 3LY8A 4LE0A 2GRUA 4X1KA 4YRRA 5BRJA 4CEJA 1XMIA 1LS6A 4PYKA 3SC2A 1MABB 4V0LA 1H93A 1MV5A 5DBIA 2VO1A 3RREA 1PD0A 2I33A 3KXIA 4J7XA 4BB5A 2F9LA 2XA1A 3VI3B 2BFAA 3A6LA 1DRVA 1TO1E 3UCEA 4H1WA 2O59A 1G3IA 1BXGB 2ONKA 2GCOB 2XA9A 4RA9B 4OXRA 1C80A 2IQ5A 2Y99A 3GX1A 3F8WA 4HS9A 2OFFA 3GLGE 2H9IA 2QENA 2X7JA 2C82A 5DWQA 1EUYA 2FOLA 3BCUA 4UEOA 1G6Q1 1I3MA 2ZSUA 3E3OA 2XMZA 4MDFA 1FX0B 1WY7A 2GJSA 2FUNB 2GCNA 3ENKA 4GKVA 2QD4A 4HUJA 5DNDA 3WNDA 1JWLA 2JDIA 1LH0A 4Z0HO 2CFTA 1X7ZB 5A3SA 5A02A 3TSZA 4G5SA 2EG9A 4RANA 1HDRA 1RKVA 1XZCA 3KTOA 3W6OA 3UT5A 1GLGA 4Y98A 4PX2A 3IBTA 4FYXA 3DAFA 2ZLBA 3MTQA 5CK5A 5IHPA 3A6PC 2Q2WA 4CI0B 4TRRA 4BMXA 3C43A 4US1R 4OKSA 1VE7A 4BUCA 3JQGA 3GNSA 1OUMA 1I14A 1TZ2A 3ECSA 4LSZA 4UTZA 4LF7B 1UWLA 1GCAA 1ODFA 3A7DA 4L1KA 3I12A 4LXYA 4EWLA 2HR1A 4DDWA 4PQEA 3IXMA 3V4FA 3FHJA 5CVCA 4HPWA 2IW3A 2ZEJA 2D00A 5G0UA 1N1GA 3FLBA 2QMOA 2Z1DA 4TTTS 2XB6A 3DDHA 2OA0A 2MT9A 5FUWA 1M34A 2AQKA 3OEED 1QP0A 3KOXA 2XZPA 4YMVA 3ESXA 1KDVA 3WK7A 1ZHFA 1IB6A 2O3JA 1CNMA 1VKJA 2PQ0A 3USES 3D2CA 3OLWA 1JZQA 2IU6A 2JIDA 3L6EA 3V1YA 4FFMA 4ECEA 3F6YA 1KH3A 1G3RA 3ZHOA 1YHYA 2Q2NA 3C6BA 4LY6A 4ZREA 4JJZA 2PXAA 5DGDA 4EY6A 4YONB 3UGTA 3MINB 2D4AA 1YDGA 2VNJA 5K3CA 2DKFA 4GC9A 3KZKA 3K20A 1IXYA 2F43A 5CT8A 2AYZA 2WJ3A 2QPOA 4BLOA 4YAEA 3AF3A 1AKWA 1D0IA 3OSUA 4XB1A 1U5CA 3ZLUA 4DCNA 4MJ7A 3BXZA 1P81A 2CUNA 3HDYA 1P9WA 3MJFA 5LC1A 2EW8A 2J8ZA 4RENA 4AU1A 5CDGA 3OCVA 4CYMA 2R00A 4WZZA 4YACA 3ABIA 2I78A 1I6KA 2E5LB 4FCVA 5CX1A 5B4VA 4WCVA 2P6MA 2O07A 4G07A 1KI6A 2YY7A 1U4NA 2WU4A 3AY6A 3OZRA 1ZCBA 4QJIA 5JNUA 1DWPA 3IS3A 3UAYA 2BGMA 2HMVA 3SX2A 4UQLA 3AEYA 2VHEA 2BEUA 5JYBA 1WUHS 3QV1A 2N46A 4C5BA 1Z0KA 2CXQA 4AUKA 3NBYC 1S4MA 4ZVQA 1BGXT 1NKVA 1H65A 1PQPA 2FLKA 1XZFA 3LZ6A 4M49A 4GXQA 1D2RA 1AZLA 3DO6A 1K8QA 3HGQA 3HH8A 1R4NA 3I2KA 1E96A 2W2TA 2EBFX 2HXGA 2VJQA 3WISA 1DSSG 3R74A 2AK2A 3P97A 2GZ3A 2BGNA 4AX4A 4ZRNA 1UC9A 2JI6A 4BP3A 3VTZA 4DNQA 4EJSA 1PZGA 1CX9B 3OAAD 4G0MA 2BHNA 4NQRA 4F2DA 3MGGA 1TYCA 2HIMA 3ZI0A 3K0HA 2WAXA 4ZQHA 3GLFE 4FFLA 3THYA 1DAOA 4GXTA 2PMKA 4MR8A 1C2TA 3ZG6A 3U7GA 1EE2A 4HEA1 3ZV7A 3AW9A 2HJHA 3E7XA 2XSZD 4TKVB 3QKRB 4ZDIA 1OAAA 1DQSA 1NMSA 1PR4A 1IOVA 3AJDA 1ZUD1 3VR6A 4FGWA 2NO0A 1UFOA 2IEBA 3TGPA 5LD2C 4I6GA 5K3FB 1KRHA 1PK8A 3VR2A 1BW9A 1JDSA 2EBWA 2DMRA 2PGXA 4RVGA 2DUJA 3TRIA 2M6KA 3R9KA 2O20A 4FE4A 4C0JA 5JPIA 2E2WA 3DKKA 1PNTA 4Q4HB 1EBFA 1QG4A 4M22A 1VMKA 1V6AA 3QTLA 5ALPA 2AJBA 4N8EA 1XZDA 1XEWY 4DY6A 2H92A 3NBZC 3NTRA 4RNDB 2FEWB 3A0UA 2J33A 3B6IA 4W5WA 1RQLA 2WA2A 4XWYA 4DEXA 1SUSA 3NEYA 4OBEA 1G0OA 3IMEA 1M7BA 4D4KA 2A92A 1C41A 3BULA 2XOKA 4IV0A 4MEAA 1HR0B 1T5BA 4NG5A 2R7AA 1DAKA 3CN9A 4DAEA 4GL2A 4JKOA 3SHFA 4P4LA 2VKQA 1KOLA 1E2UA 4EW1A 2BFWA 2F8SA 2Z9DA 5HEKA 2PFKA 1KS2A 2VDUE 2AOUB 5BW8A 3LLCA 5AVYA 2OHGA 2RJOA 2C92A 5CIQA 4XI9A 5E1DA 1Y9DA 1D0VA 2VCEA 5K0BA 5KNDH 1DO2A 1ZZGA 3TLJA 4RK7A 1W36C 3VGPA 3NPMA 3SXUA 3GT7A 4IKOA 4RAQA 2B2NA 4AIIA 3GUYA 3GB9A 1SQGA 3LDUA 4NKRA 4WQMA 3RAFC 1NQUA 2HCRA 3OBBA 5CT9A 4CLOB 1LSSA 2IODA 4E1BA 3CWCA 4EL0A 2QHXA 2AN4A 4QFMA 5CVTA 3WB0A 4XPZA 3V8VA 3HGTA 1DC3A 4MS1A 2VHWA 4LXIA 1CDOA 3FYDA 1L5QA 4FFSA 4I1YA 4OXNA 4TKUA 2DERA 2A1UA 2ZTUA 3NHUA 5JMTA 3W9SA 3R9WA 4FXPA 4IIJF 4U7WA 1Z4KA 2ZAYA 2F67A 3GPIA 4Q48A 2HOQA 3OUTA 2UUBB 1E8MA 2ZYHA 4FCWA 4WDQA 2J48A 5KDDA 2VRNA 2YWEA 3FI0A 4MQMA 3QI2A 4K9KA 4LYDA 1VPVA 4MVJG 1QHHB 4BO2A 1HT2E 2XE4A 4BZQA 2HIGA 3WK9A 1P4GA 1F5SA 2QE7D 3FSGA 4ZVRA 2P2NA 2PA0A 1JVSA 4NH0A 4RGQA 2CXNA 2NU9B 3PXDA 1UXIA 4MRAA 5K05A 1ZD1A 2X9QA 2I66A 1M1YA 3HFGA 1DC6A 1KVTA 1W4RA 2FWMX 4LFBB 2V7TA 3H0CA 4ND1A 1YD7A 4JK3A 4K6CA 3A6FA 4NCHA 4QDUA 2BI4A 1Q1QA 2JATA 2R8YA 3QUTA 4KRYA 5AI4A 5FL7D 3RV3A 5JTUA 4LOKA 3JQ8A 3ZBUA 3DDUA 3AI1A 1PR2A 4BFYA 4EHIA 2B82A 4O4IF 1U8XX 2GNAA 2RHWA 2HRZA 1T5OA 4O29A 2PMFA 1KJYA 4RF3A 2Y0CA 1WB4A 1ULUA 3MEQA 4FGSA 2Z8ZA 3TBHA 1OFHA 2NO1A 4JXZA 4QXAA 2XNJA 3GMDA 4G5FA 1QHXA 2J4CA 2Z1NA 3BK2A 3C74A 4U7JA 2YXLA 5I7SA 1JEOA 1QOQB 3E22B 4PR0A 1U6JA 1HT3A 3PHIA 1WHSB 1EGMB 5H7XA 4J7CA 2JGLA 4OI2A 3II6X 3FSJX 3SG0A 3TW6A 3DT6A 4M0MA 4OFZA 3WP1B 1G64A 2PZMA 2QY9A 3PGA1 3LPAA 2ISCA 1XZLA 3JWEA 4WINA 4ZAXA 4LRSB 1R00A 4ICIA 1IUOA 1J0EA 1FYXA 3KKLA 4B4WA 4B85A 4CM8B 5A1TA 5IEJA 2NSYA 1FJHA 5FX2A 2BI7A 3FUXA 4UATA 5B3JA 4YT5A 1VKZA 2UYYA 5I7RA 3TOXA 1DEAA 1ADFA 2WPNA 3CLUC 2X5KO 3S27A 5L4SA 2JFGA 3QVMA 3QKUA 5A4JA 2IITA 2O1XA 1S89A 3LOUA 4C76A 3TSWA 1ISSA 1PG2A 1NKTA 1UDBA 1ORVA 1PT6A 2J87A 2P4QA 3EB9A 5HCIA 3ZDRA 2VF2A 1HYGA 4Q3LA 2GXAA 2ZROA 3HHEA 1VJTA 2ZIFA 4YHBA 4GLBA 1ADGA 2FN4A 2R00C 1X92A 1XDWA 2ECKA 4KQ1A 2DB3A 1MLDA 1PRYA 1L3BA 1POXA 3GVCA 4N7BA 4RSGA 1RYEA 4UVHA 3TYXA 2B8NA 4MV5A 5ECDA 1YR7A 1GZVA 2W6ID 3WJ2A 2D2EA 5KX5B 1TVCA 3ZHXA 3VPAA 4DJFC 3Q1KA 1BDIA 2IHYA 1T8UA 1C7EA 2NZVG 1BHJA 2Q1YA 1FRNA 1KI3A 2QQ0A 3I8SA 3RIEA 2YMPA 5DHAA 1LRJA 1U4OA 3K0AA 4XVHA 1C8BA 2PJZA 3MGBA 3CZRA 2W6MA 3AZPA 3KQOA 4TRNA 5DASA 4Z9BA 3ZX4A 4CRWB 5T67A 4D42A 3KWLA 3H8VA 4EO9A 5HR5A 1LI4A 4ZOBA 1QO9A 4PO1A 1LD3A 5ERYA 3ROXA 4DIKA 5AIBA 5D7BA 3K0FB 4LVNA 3CVOA 2GAIA 2V6MA 3QF7A 4Y9TA 4C0SA 1SAYA 1N5DA 1OV4A 2HHAA 2JFHA 1UODA 4XVRA 2JRLA 3EFOB 5P21A 4C3VA 3ZGXA 4YUAA 4EJSC 1XV5A 2OR3A 4ID9A 4XSVA 4U6SA 3RT7A 3ED1A 1TA4A 2CNWA 4IH4A 2PIDA 2E6KA 3B7WA 2BM8A 2E4VA 3L7IA 5IWCA 1G21A 4LHVA 1E9VA 2OPHA 5GIPE 3KJZA 1WCV1 2RI1A 1IN6A 1DAIA 3WICA 5AW6A 1SNYA 2WVGA 2BJWA 3D4LA 3GRKA 3KEOA 1LLDA 4NE2A 2LCQA 5FHRA 3U0BA 4AMVA 1A7UA 4AXBA 4XRGA 1PFQA 3UUFA 1GZ4A 3KQPA 2JCXA 4FB5A 5JD4A 4E4TA 1V8BA 1H94A 5E0KB 1EWRA 1HQYE 1J8DA 4K05A 4W6QA 2B20A 1P4HA 1YONA 4KWEA 4D6XA 4WT7A 1Z6ZA 5IRCD 4U00A 1ZI6A 5AHXA 4EFLA 2R6HA 5C52B 3CNBA 1XZJA 1LA2A 3ABSB 3AHJA 2V03A 3B1ZA 4JB8A 5E6RB 2R6R1 2Z6QA 1P9RA 1UBFA 1PZMA 2C8VA 3DT8A 2C3MA 1IH8A 3WWDA 1E2GA 3ANNA 1I0LA 3F3YA 4MP8A 4PFJA 1KY5A 2ROQA 3V48A 4AJHA 1R64A 1HUQA 2PGNA 1B26A 4DHWA 2XKAA 1ZM2A 4MHTA 4E5MA 1VJ0A 5D5QA 1HG0A 2J0UA 3IT1A 3M6AA 4FU0A 3R0JA 5B4TA 3DZJA 1VSUA 5H9VA 3T54A 5EA2A 1ADBA 1Z4NA 2J3JA 3V7UA 5I7OA 1M2OA 4NATA 4O4LB 4QU8A 5CLQA 5DM0A 5F21A 4X1IA 2QTVA 3G5TA 3SKYA 1QRTA 3I9MA 2ZANA 2RGCA 2PKQO 3AOGA 4PG8A 4I0WB 2D4HA 3CCFA 1XTSA 1K2WA 2QDKA 3O4HA 4V0SA 3OHMA 2BLLA 4L76A 3U09A 1FRZA 3SEZA 4Z7QB 3IQZA 4CN8A 3U7HB 5IT5A 3ADDA 2A88A 5HFAA 4IX9A 3GDHA 3AJ9A 1YDHA 2YN2A 1WQ1R 2QD5A 4R8KA 5F9FA 3E4DA 5I9SA 4E4YA 3FF4A 3EEOA 3G7UA 1RE1A 1NP6A 4BBAA 5LP1A 1ESZA 2B1GA 1C3LA 1J25A 2PRJA 1VE6A 1RPJA 2GSDA 4R2WA 5FO0A 4QD3A 3RTAA 2CV0A 3SSNA 3D3JA 2P65A 1O57A 3KJHA 4OGLA 4R51A 4S3MA 1N2EA 2VYVD 2XE6A 4RNCA 4OXKA 1RQPA 5FF9A 1A72A 2Z3WA 5CA0F 2E85A 1JG3A 3OPMA 4YRDA 5H68A 2CJPA 2PIAA 3BXPA 2X6TA 1LF0A 3D2BA 4Z0TA 4LJ5A 3W1VA 4BVGA 4EFKA 4DIFA 1LVGA 3ECCA 3SZOA 3NVMB 3AKDA 4COOA 3U7JA 5TVKA 2RGUA 1GPH1 3V7WA 3ELBA 4OJNA 4AJPA 1JDBB 4JI4B 3QXJA 5H3CA 1R5JA 1HG1A 2VF5X 2WUDA 3B36A 4KX3A 4MAFA 4TKZA 4UASA 1YH3A 4N76A 4FJ2A 1VCIA 3QOFA 1YBFA 1BD3A 1TQ8A 4DB4A 1QF7A 4J6FA 4NBKA 3JARB 1T9KA 2HTEA 3DEIA 4QG3A 1Y9JA 4XDYA 3S1AB 4BVJA 4RL6A 3WL6A 2NQTA 4BZXA 5DW0A 4BWVA 2PH3A 1SC4A 4DJ5X 3Q3CA 1SHZA 3ZDEA 4MMXB 2JI7A 3D3WA 2DJIA 4MO2A 4BAUA 4U7DA 2DAPA 1IHPA 2P67A 2VP6A 5KNDD 1JFTA 2H54A 1KSHA 3WNZA 2C59A 2BCGY 1E8DA 1F1JA 4BP9A 5CBKA 2R7KA 1VL1A 3LX6A 4IJQA 4RA6B 1DV2A 2OYRA 1U2RA 4QASA 4F38A 1MNQA 1XC7A 2JIMA 1BRMA 2C9OA 2JCVA 3OPVA 4D3XA 1OQAA 1RM0A 5KREA 1GQOA 2WJWA 3DE6X 2E6UX 3IP3A 1DKLA 2A1TS 2Y1WA 5A3VA 3KXDA 4NPAA 4D9FA 5JXHA 2RH9B 3MWKA 4M6WA 2W2KB 4Y2YA 4M8NE 2ILTA 4PQRA 2DR0A 1UXKA 1ZJ4A 2PR7A 5BSGA 3WZ2A 5B3JC 1RQXA 1Y0BA 1UC5B 3QVGA 3ETDA 4GYWA 5I7VA 1SGWA 1ISIA 2VHCA 4ZYLA 1RU3A 4KYUA 4UJ5A 3WBBA 5J4YA 2GS9A 4FQ7A 3IAS1 3CPSA 4KVAA 2GK4A 2E87A 2CMDA 2XWSA 3QKSB 3URMA 1X7XA 1GEGA 4C0KA 2X2EA 1T8SA 4IQGA 4EEKA 1RS0A 3L49A 3QTBA 3EH2A 3VU9B 3IDFA 3USCS 1TE2A 1UZUA 2OWDA 3TIIA 1YRHA 3NM5A 1KEZA 1CUBA 1A82A 1K98A 2EYUA 2PX8A 1OYVA 2JZNA 1NXTA 2KHZA 3C7CB 3I6ZA 1Y1KE 4KO2S 2PUGA 1JHAA 1NOJA 1EDOA 1L7DA 1WEKA 2IVFA 4XA8A 4EJ2A 3FWYA 3L18A 5A9TA 4DLSA 3QIAA 4D99A 1KXZA 4TXMA 1CF9A 4DHEA 2G9RA 4OXXA 3JY6A 3UKDA 3NC0C 4MRVA 4MRNA 1JPJA 1E61A 2FN9A 4B35A 3TLGA 1LVUA 1XQXA 3U4CA 3WNVA 2R97A 2CXXA 2FFJA 4M4SA 3T0IA 2HU8A 1JKJA 2RMKA 1NMEA 1N7JA 2CLSA 5TMBA 3K9CA 5BW6B 1CUCA 2FK7A 2N1BA 1V11B 2WKRA 3P4UA 4NNPA 4JT4A 1R0WA 3LBYA 5DT2A 1GILA 4DBLC 5B3LA 1T2FA 3LE8A 4M36A 2C8LA 5JNRA 3D6FA 1B1AA 3EEFA 2IYSA 1C7IA 4HD8A 4LF5B 3H13A 3X1XA 2MCFA 1NKSA 4OAOA 1FYVA 5FNVA 2A86A 2XE7A 1ZDMA 3CLRD 5HIKA 2ZM5A 3OT1B 4FYJA 4EW3A 2HCJB 1GTRA 4EHFA 2JGNA 3R5TA 4WH0A 2Q3JA 4XQGA 4QPCA 4B17A 3GJQA 2E48A 1UKZA 1ZJ6A 1C50A 2XHEA 4WXYB 1CQZA 2DH6A 3EIEA 4FYVA 2AVDA 3AG5A 3BQ9A 3LDHA 3OI7A 5IJZA 3ETJA 3IDAA 1QBGA 1JDVA 1P61B 4LNUA 4Q9JA 5DFAA 4KRGA 5E7IA 1O96A 1W88A 5FI1B 4EY3A 3HWSA 1TMKA 4B3CA 3TN7A 5AIAA 4G56A 4RMHA 3P0EA 3WSWA 3O4JA 4WK6A 4LRXA 1FFDA 1P8JA 2LWIA 4PG6A 4BNMA 3HYNA 2WHEA 4UEJA 3JU3A 3MWEB 2GEKA 1ZUWA 4B48A 2B3TA 2MHCA 4P7BA 1QWOA 1Y1LA 3HNPA 2I91A 4KQ2A 4QYXA 1GGFA 1K3FA 3LBHA 1ZNZA 5TGZA 4BQNA 3NUGA 3AR4A 1N92A 1LV8A 1ZSYA 1NQXA 3EGXB 1DAPA 3UT0A 3JYHA 1EAMA 3ZWOA 4EHNA 4OF4A 4TS3A 4ZI7F 1A7AA 1ZJJA 2NTNA 2X4LA 4A27A 1UUFA 1CS0A 3LUJA 5AM0A 4F4CA 2H4FA 2Y2VA 5E1BA 3GLQA 5CVDA 3ZVRA 1EUDA 3I8OA 5CLFA 3W05A 4M9ZA 3SCZA 2YKGA 3EA0A 3D8TA 3DNPA 4YP7A 4H1UA 3GFRA 5JSZB 5HA5A 3QMPA 3AXTA 1RIFA 2IE8A 3FW1A 1SZJG 4LRTB 4LYJA 2AN5A 1GNRA 5IC5A 5TNXA 1BQ3A 3AEUA 4U2BA 3WLOA 4DSNA 5B58C 1BFDA 2IYVA 5DWDA 3H7AA 4ZZ1A 1S02A 3FYHA 4DS3A 3W3AA 1XO1A 2O2DA 2IXTA 3VGJA 1MZVA 3Q88A 4HGQA 1UK7A 4P0TA 1E3LA 5JS2A 5CA1F 2QVXX 1TCBA 3HCRA 4ZHSA 1UZMA 2BDUA 2CLHB 4RFSB 1GNLA 3T15A 5DU2A 2WD8A 4E2WA 4G1BA 1W2GA 2EDAA 3V8MA 2WV9A 4GZ6A 2IXFA 4G0ZA 1N6PA 5J63A 3AEZA 2BZ0A 1X6VA 4BIIA 4Y2QA 4QNMA 3DDNA 4IIUA 1YS4A 1U0SY 3DL0A 3E7WA 4KE6A 1EFKA 5JQGA 3TPFA 1XPJA 4D3DA 3CJTA 1M5UA 1F5NA 2C3UA 4X54A 2ZP1A 5BW5A 1J2JA 4GMDA 1FSSA 2RHLA 4WXRA 1YKGA 1BVYF 1NW3A 5JO9A 4CFZA 3HUTA 2OCIA 4B3DA 3NZEA 2AC7A 3C5VA 3K53A 3NASA 3NJRA 2NU6B 2WOOA 3LHKA 4HDSB 4KWTA 3IL2A 3W9BA 4YV7A 1X1AA 3JD1A 5L4LA 1RRGA 3NBXX 5JEDA 3KJQA 3M1IA 4GNKA 1Z16A 1KEPA 1Y6JA 4M0KA 3UJAA 4YRZA 4Q4LA 4DIDA 3STVA 1U2SA 1M8JA 2BDTA 4D8XA 1RR6A 3AIKA 4OLFA 3C6KA 4KXVA 3QPCA 4WGFA 4E22A 3DQZA 5E6UA 4QTUB 2CMGA 3WGLA 3OA2A 2QX8A 5J4HA 4YP0A 4CLDA 4DV2B 2FK8A 2IH4A 1I1QB 1SBZA 1XRRA 1I2MA 4NV3A 3DFKA 4ZJUA 2ZXEA 3V9AA 3B6MA 1IJEA 4N7MA 1XRLA 2KYRA 4JLUA 2UYGA 2R86A 1OPRA 4KTTE 4RV4A 2D0PB 4B40A 1IBLB 2YNMA 2XB2A 1AUOA 1EZZA 4Q6BA 4ZPXA 10MHA 2B37A 5EE5B 4HDAA 2FSVA 3IUNA 4J0HA 3TBKA 4QUEA 2V1UA 1U94A 1VL6A 2OLEA 3HPRA 2JGMA 3A05A 5CLIA 3DVQX 2EIHA 4GOND 5TF0A 1AS3A 4R31A 3LCVB 3T5TA 4C0WA 3EPKA 2VEDA 2C9CA 3ZVKA 1I1NA 1KVRA 3HVJA 3IQDB 1L8LA 2Z30A 5KYXA 1ZGGA 5ETJA 1CRLA 4QPDA 4ZAWA 3I4CA 3ZCXA 2B1RA 1QYDA 5C7LO 5EHIA 3TB4A 2QGFA 5TY0A 5HRCA 5ILOA 3AJRA 4PCAA 5CIYA 4A7PA 4D9JA 3B9RA 2XKBA 1ATZA 1XTKA 2Q6TA 3PV0A 4IZIA 3CEAA 4IFBA 1PG0A 3DEAA 3RADC 4R8LA 4NV0A 3ZD7A 1C81A 2UKDA 3F47A 3DVLA 1G4HA 1QQ7A 5LXTA 4DR7B 1V39A 1RMTA 1HDYA 1NNLA 2YUIA 3EVNA 5T4HA 1GCOA 4PM4A 4DV5B 4MW7A 3G2HA 3MMPA 5DNUA 1IHUA 2FKNA 3MWYW 3O1HB 4I2VA 4C1NA 2C7RA 1BWSA 1YUBA 5JNTA 3ADPA 2Z2IA 3R3ZA 3DE4X 4D0RA 4GWKA 5KJ6A 2NMVA 1H6CA 3BWCA 3IAFA 5U1PA 3GFPA 5JYCA 1E79A 3OLQA 3VDXA 5LDHA 3HY3A 2D5AA 2VNIA 1D5WA 2IIPA 2P2ZA 1JHDA 1Y42X 2XD4A 1A5TA 2Y93A 3TKAA 3AR5A 4JMPA 1L9XA 2FWJA 3ET5A 3OMXA 1INLA 2ODAA 4HEQA 2H2FA 2ZR0A 3L8FA 1QWSA 1TZCA 1TOAA 3WL8A 5EMJA 4UE3S 3BRWD 1L5RA 2JFPA 4N0MA 3SJAA 1KJ9A 3UYLA 2VAMA 5EIAA 3P45A 2ZZMA 4O25A 4WERA 5DK4A 3WC4A 4IV5A 4HGZA 3PPWA 3D64A 4NI5A 1NVUQ 3A9TA 5DXJA 2Z5LA 4UC0A 1NU6A 3JQDA 3IMGA 4DG9A 1JXOA 3K9QO 1Q0RA 3MLAA 4OGKA 3N0XA 3F5SA 3PD1A 1E66A 3ZV6A 2GTHA 3FYCA 4NSNA 2HEIA 4X3PA 4DCSA 4RX1A 2H00A 4Q12A 4R41A 4GI3A 1ADJA 2ZJ1A 1E1RD 4EUNA 1YMVA 4JOSA 1DTWA 1ZIXA 1ZX1A 5EIHA 1KI7A 1XVAA 4ZAZA 2EP8A 3JQBA 3B6JA 5G2OA 3U3XA 1VE1A 3FGOA 1NXSA 4CMEA 5ALLA 2JAPA 3LP8A 2IPLA 2K5UA 3I23A 5FV7A 1WPRA 5JFTA 4KUEA 1H85A 2XHZA 5CHEA 3RANA 4EYOA 1XD2B 1MO4A 3AR6A 4YMSA 5AK5A 1Z18A 4JXKA 1FFSA 1IRIA 4ZHQF 3EN0A 1D7OA 1I1OA 3OLZA 3LCRA 1E2PA 2F3PA 4X94A 4GG1A 2ISQA 4K9RA 1DAGA 1PJ3A 1VG9B 4KKVA 4ROTA 4YRCA 3WGZA 1GTSA 2M6LA 1YV9A 3HUFA 1VG1A 2X9GA 3R23A 4DQDA 1JBQA 1MT0A 5FI5A 5BN3A 3U13A 4CPDA 3T95A 4LV6A 3KRTA 1WSBA 2MSKA 4RE6A 3SMQA 4EI2A 2O3QA 1JE0A 3QELB 1W94A 4C30A 3K9LA 1P7YA 5K4AA 5LKAA 2D0OB 1DJNA 2W0SA 3FHCB 2RK4A 3FROA 3I34X 4MDHA 4PINA 3WKDA 4ZVSA 1MC1A 4GPBA 2JLQA 3KNZA 4A26A 1KQGA 2ID4A 2IYEA 3T5AA 2HK6A 3TSCA 3UMJA 4JBNA 1VE5A 1V9LA 2BGJA 2EV9A 1L9KA 2UAGA 1IIRA 1FFGA 1UXJA 2GZHA 2VHYA 4IUBS 1JJBA 2J3KA 2VDLB 1PWZA 2ADOA 4QPJC 4RFLA 4UAJA 1A95A 3EXIA 3BDVA 1ULHA 3GG2A 3IGFA 4Q4AB 1D3AA 3A0RB 3WL4A 2XR1A 2C1XA 5DN6D 1Y9AA 3CR3C 3HA3A 3KE8A 2WA1A 3N8HA 1QVRA 4IOJA 2ZVJA 2CHQA 4IZ6A 5KSZA 2KPOA 3HXMA 1C4XA 4M9RA 1X8JA 1G7TA 1YASA 1Q95A 1MU0A 4WTOA 1R8YA 3AXSA 4JEUA 2A9RA 1JIIA 3KVOA 1X42A 2DHEA 1Z8NA 1TRHA 1YMUA 1M75A 1NWCA 2Z2KA 1I1HA 3EWAA 4G63A 4OQQA 1XU4A 3U7EB 2P75A 4X97A 4CU2A 3H9GA 1UDAA 1U2EA 2NUTB 3RSSA 2O8FA 2HFKA 2G5TA 4RYLA 3IR7A 1DC8A 1Y8QA 2AS0A 3FLEA 4KE8A 1P7WA 1VMEA 4XJSA 3A04A 5GOTA 1MW8X 3MCUA 3B1XA 2A5JA 1CUZA 1FRFS 1FSFA 1KOJA 2EJBA 4PPGA 3VOAA 2AN3A 2VJYA 1H9BA 5DBOA 2CUKA 2PLNA 2FUG6 5CLGA 3D7KA 2NPFA 2UZ0A 1J33A 3DCIA 4MB2A 5PGMA 4XJVA 2VZLA 4V1CB 4E11A 4BKUA 1E8NA 3E15A 3NHPA 1H2ZA 3DEJA 3LP6A 2Q1SA 3R7NA 4YV2A 2Q4TA 3IJEB 4Y6LA 1GPWB 2YHSA 3SVLA 1ARZA 1VGQA 1NAHA 3VO9A 4BJ1A 2HWWA 2J7PD 2FJ0A 2ZRCA 2YNMC 3NTQA 5BYAA 4XTCS 5T8KA 3CVVA 1P6UA 2I55A 2GHIA 3G6KA 5D8DA 3OD5A 5ECYA 3GMTA 2XGOA 3ZE8A 3E9RA 1T5DX 2FSVC 1S96A 3C5EA 3PNVA 5DP2A 3S70A 4ARUA 4WY8A 1W36D 2XADA 2OK7A 4PX5A 3ZY3A 5IDXA 5LM3A 4AW9A 1ZGBA 2POCA 1DXHA 5ELXA 2I2WA 3M7IA 3OE1A 5L6MB 4PO3X 3W7BA 3I42A 3R24A 3KOOA 5IAEA 1PJBA 2NT3A 3LKBA 3UNXA 4ETNA 1QHHA 4I9NA 2CJYA 2Y1EA 5JO0A 3RQSA 2V0GA 1KO1A 3EVCA 1RAFA 3HYTA 1JE1A 3P2OA 2TRSB 1THMA 2YWDA 1T1RA 5A4FS 1SPBS 1PTKA 1T9GS 1GZDA 3EY4A 1IXRC 4PLWA 4TSFA 5KWIA 4KFCA 5IEBA 3B1FA 3N28A 2QM3A 2VH1A 5FYQA 3LI2A 3H04A 4H15A 1XSEA 3I83A 1P80A 2LV8A 2VP5A 1KBOA 1SUIA 5JCXA 4FGKA 4GXRA 3Q11A 1Q1GA 1SBCA 2BTQB 3FPFA 1WCIA 3NHFA 3I4FA 2GBLA 2JDID 3TTXA 3VYUB 5FH9A 5ALJA 4LPKA 3CRQA 1P2UA 1XZMA 2OGZA 3CKYA 3A31A 4JVNA 3ZVLA 1L8XA 3GV0A 5AVOA 2ZTHA 5HF6A 5JASA 3UOWA 2WG1A 4OAPA 5AJXA 3BYZA 2QRVB 5A0VA 1GTJ1 1HM5A 1KEKA 4YCDA 1AJEA 1FDVA 1NVVR 3JTEA 4YASA 2YZ7A 1E5DA 3P9SA 5G0SA 3V4LA 5IABA 2AXNA 2RB4A 3MMNA 3KWMA 4OIMA 1E2LA 1GXSB 1MA0A 3U1TA 2RARA 3HSKA 1IXKA 3R76A 3QEAZ 4R81A 3OMLA 5D3MA 5FOXA 3LVQE 4QQRA 1Z8HA 1JVNA 3S99A 1N8TA 5ER9A 5KKAA 4Q39A 3VZDA 1BQ4A 5CPFA 1JI0A 1DCFA 4A10A 3F6EX 3WGKA 1XEFA 2FKAA 1MC8A 3WYGA 2G5GX 4KR2A 1R6VA 4B6QA 3DP7A 1JKMA 5D7NA 1F14A 3C97A 1T2UA 1TVMA 4Q1EA 2UZ4A 3COSA 1FP4B 3IUQA 4XVQA 1N0WA 5TQ0B 2F17A 5DB4A 3VR5H 2BTEA 3BMCA 1LLQA 1UPTA 5AKXA 1CLEA 1EFCA 4ZQGA 5CVVA 1L5WA 4HZIA 1TCCA 1TCAA 3M6VA 1W0KA 3LZDA 1J2YA 2H17A 4LGVA 3H65A 4N8SA 4NBUA 2GRAA 3UXHA 5MFZA 4I9FA 4IMJB 5EHNA 3CBGA 1K8RA 1QAQA 2XB9A 1UC4B 2NSLA 3AVPA 3CLUD 3N2EA 3SICE 4CMEC 2JBAA 3H9QA 4YCLA 3SM3A 4F06A 2NAPA 3GYBA 3LX8A 4WK0B 1L3CA 4CT4B 4BWYA 4Q18A 3VI4B 1KPHA 1SN7A 4KX5A 3PJFA 3KOYA 1C9EA 1UBNA 3JXEA 4YJGB 1L7BA 3ZU5A 1YQDA 3HJBA 3HTXA 2BBTA 2HA5A 3GEPA 3PVSA 1PWEA 4P35A 5D84A 4EA8A 1T0PA 2C4MA 3ZCRA 2IFTA 4HNVA 3FUUA 2Q9UA 1DQRA 1RYBA 1QOPB 2OHHA 3EFOA 1C7FA 1H0HA 3PSHA 5LDGA 4RORA 3SS7X 2EX1A 1FMLA 4QGAA 2XXAA 1MMFB 2NU8B 2OO3A 2PKEA 2I0FA 3FOFC 3IAUA 3O4FA 2O7RA 4NHEA 4QELA 5H80A 1GAXA 5CB8A 1DCKA 3D5TA 1ORRA 3O31A 4TTIA 1DB3A 4YLYA 3T1YB 4MUHA 1SO8A 2HJGA 1JRLA 4HAUA 1AS2A 1NC1A 1SC1A 2Q27A 1LEHA 4DVJA 4ABTA 2XUGA 1IWOA 2DTEA 4MKXA 1G7RA 5TSDA 3U44B 3E5NA 4PXAA 3D81A 4WE3A 4B43A 5I4IA 1YQQA 3EQ2A 3FFWA 2OKGA 4CLEA 4M55A 1J8QA 1UFVA 3NIBA 5ARDA 3HCBA 3KPWA 3OT5A 3BIXA 1Z2AA 3D6NB 1HTBA 3WHPA 6ABPA 4LZAA 3GAZA 4QFCA 1G2QA 2FXIA 3BL8A 4IXDA 3DG9A 1TTHA 4ZOLB 5E6RA 3CLSC 4CGZA 5EPUA 1OJ7A 4MPJA 3T5GA 4RKWA 3QWHA 4IR7A 1JEQB 2II6A 4GX2A 3ROMA 4CKCB 1F4VA 3DR5A 1JXMA 5IKMA 3VR6D 4GZMA 2X5XA 3ZWKA 3IOYA 2AXEA 3FFXA 1U31A 5D2CA 4Z3KA 1YTUA 3VR2D 2O52A 1CVRA 2O54A 1D4FA 3DV9A 5HZGA 4OYRA 2H2DA 3TTUA 1FFWA 4KEAA 4O4LA 1HY3A 3INYA 3AB3A 2VJNA 1LPMA 2WC1A 3N76A 1Z73A 4CKEA 3VZQA 2WPDA 4RCYA 3AI3A 4U2FA 4D97A 3CR7A 3QIVA 2C99A 3BB1A 3OFKA 4KQIA 3CONA 5JZ9A 4FR2A 4RXTA 3QU5A 2CL5A 4TSRA 2WLTA 4MGYR 4XOIA 4KOEC 2R6DA 5ALWA 2XOKD 5CNJA 4YEDA 3W3ZB 4TYWA 5INTA 5I7AA 2UUAB 1K7XB 3HN7A 4FCCA 1A9XA 1RHQA 1AV7A 2GZSA 3FRIA 4L8GA 3SJCA 5IWAB 4QHSA 2IA5A 3FPKA 2Q3MA 3DV0A 1YR8A 1FP2A 4X3OA 1F2TA 4RLQA 3JWPA 1JILA 2WQ7A 1R74A 2QTMA