3CC8A

Crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
211
structure length
211
Chain Sequence
b'AVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVSHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
molecule tags Transferase
source organism Bacillus cereus
publication title Crystal structure of putative methyltransferase from NDP-N-methyl-L-glucosamine biosynthetic pathway (NP_977653.1) from Bacillus cereus ATCC 10987 at 1.64 A resolution
rcsb
total genus 63
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3cc8A00
4EMSA 1WXXA 2ADMA 3FTFA 3CCFA 3UA4A 3LDFA 3PFHA 5K0NA 1JQDA 2R6ZA 1MJFA 3BT7A 3R6TA 4PONA 5BP7A 4XCXA 1JG3A 2ZFUA 1QZZA 3LBYA 2NP6A 3MCTA 3EGIA 4HGZA 4F84A 1QAQA 4RTRA 5HIIA 4GQBA 3A4TA 5C1IA 2HNKA 3HCDA 4R6XA 3LPMA 4NECA 3LDUA 3HA7A 5E1BA 5E9JA 3DLIA 3HA3A 2KW5A 5FADA 2EX4A 4HC4A 3KQPA 1G6Q1 5ERGB 3K6RA 3A27A 3UJ9A 3KR0A 3MTEA 2Z6AA 5E1OA 2CMGA 1L1EA 5BXYA 5GM1A 2PGXA 3REOA 2PXXA 2GPYA 4O29A 4R05A 4P7GA 4GBED 3TLJA 3SSOA 3UBTA 1R74A 1IXKA 1RJEA 1NV8A 4QPNA 3DXZA 4C08A 3EVGA 4X41A 1VIDA 2JHCA 2AOUB 2NXNA 3KQYA 2P8JA 2FYTA 1KR5A 2PT9A 4C07A 2JG3A 3M70A 3SVZA 4YMHA 2PXCA 1NT2A 3GRVA 3ELYA 4FZVA 3CVOA 5FCDA 3OCJA 5ICGA 3KR9A 2PV0A 1ORHA 2AVNA 2HV9A 4E70A 3E05A 2K4MA 3EVZA 3GRZA 2GH1A 2PJDA 3U81A 3R0QA 2E5WA 1XCJA 4QDKA 1ZGAA 3MQ2A 2H00A 1NE2A 3NWBA 5IH3A 3Q87B 4PWYA 4KWCA 2QYOA 4HGYA 2PX8A 2AN4A 3EVFA 3HNRA 3I9FA 4IWNA 4X60A 4AZWA 3HVKA 2PX2A 4RYLA 1FP1D 5C0OE 3UJ7A 1YF3A 4X63A 1SVUA 2JHAA 2WK1A 3BWMA 3C3PA 4GF5A 2EG5A 2F8LA 3KQWA 2NXEA 4RTPA 2AZTA 3KQSA 4E2WA 2OPBA 4HTFB 2PX5A 4OQDA 3QOWA 5DRTA 1HNNA 2BR5A 2JH8A 3G2OA 4ER5A 3KKZA 3HEMA 3K0BA 5HIMA 4AX8A 2UYHA 4RX1A 3OFKA 4KW7A 2O0LA 5CVVA 2C7PA 1HMYA 3FPEA 2YQZA 3SGLA 2AOUA 2B2CA 2ONYA 2P7HA 3LDGA 2IGTA 3KQOA 4FS8A 5CCXA 1EJ6A 5KQSA 4YUYA 3DMFA 3P71T 5DT2A 3DLCA 4WVLA 2IPXA 5EEGA 3EPPA 3SMQA 2QE6A 3PLAE 1X1BA 2QRVB 1TPYA 1VQ1A 3KPUA 1JTFA 2P3LA 4Z2YA 2OB1A 5CVEA 4KVZA 1BOOA 3A26A 3BGDA 1R6AA 4AUKA 1VE3A 1AQIA 3KHKA 2IH4A 5DSTA 3HCEA 3LKZA 3ID6C 4QPPA 4U7TB 5LSAA 3GWZA 1XCLA 4E2YA 1VP9A 3UFBA 3PTAA 4C03A 4CXMA 3B89A 3R24A 1VL5A 2BR4A 2P7IA 1JQEA 4MIKA 4YV1A 5FUBA 2HTEA 2VP3A 3FRHA 3LBFA 1KIAA 5HIKA 3GRUA 1O54A 2CMHA 3E8SA 5FHQA 2ORED 3T0IA 4PYQA 4FP9A 3SR4A 3I53A 5GWXA 1WG8A 2IP2A 2P35A 4P7JA 3CGGA 2AN3A 5FHRA 3NDJA 4PIPA 4OBXA 3TQSA 1R18A 1ORIA 4YUZA 3ELUA 4HSGA 1XVAA 2ERCA 3P8ZA 3UJCA 2PWYA 4A6EA 3R9XB 1X1DA 3GCZA 5DM0A 3KPWA 1I4WA 3B5IA 3G5LA 3PB3A 5HILA 1G38A 9MHTA 5JUWA 3CJRA 3EVDA 5F2KA 1NKVA 4PYMA 1G8AA 3GJYA 4KRGA 3P9NA 3P2IA 2G71A 1TW2A 2FK8A 5E8JA 3LCCA 2BZGA 5G02A 3P9KA 5GIPE 2UZ4A 5EZQA 1AV6A 1QANA 4XUEA 3FUXA 4P7KA 4MTLA 3DOUA 1SQFA 3ORHA 3KQMA 3MCZA 4C04A 4E2XA 1D2HA 3EGEA 3VSEA 2YVLA 4PCLA 4PGHA 4IV8A 1M6YA 5DWQA 3C6MA 5U4XA 1JG4A 3TM5A 4GEKA 4IV0A 3A7EA 1WXWA 4QQNA 2O05A 4HG2A 1JQ3A 4PYLA 2UYOA 4QQKA 1F38A 3CJTA 3SM3A 3SSMA 2ZZNA 3M4XA 4BLVA 1H1DA 3VC1A 5DTRA 2O06A 4DF3A 4PYNA 3BWYA 1DCTA 3DULA 2FPOA 1BC5A 2YXDA 4PGGA 2Y1XA 2NNWB 3BKWA 1EAMA 5HZMA 5K0BA 5DRYA 3OE4A 3GXOA 2JJQA 1UIRA 5E9WA 5D1NA 5EZSA 2Z6QA 3FTCA 1X1AA 5E1DA 5FA5A 4LECA 5FULA 1M0EA 2AS0A 1XDSA 2OB2A 3EVAA 3LGAA 2IH5A 3I5UA 1D2CA 1YFJA 1UFKA 1VPTA 3AJDA 4ZTBA 5KQRA 2ZCJA 3G8BA 3BXOA 5GM2A 1UWVA 3FYCA 3PX2A 2VS1A 1SKMA 4P7FA 4IKPA 1FP2A 3AXTA 5D1HA 3NVKI 1NBHA 2B78A 3PFGA 4OA5A 5GP1A 3TRKA 4CTJA 3LCVB 4YMGA 2ZBPA 2NYUA 3NW9A 1KYZA 3OU2A 2OY0A 5T6BA 2FRXA 2NXJA 4RSRA 5KS2A 2GA9A 3JWIA 2ZSUA 3T7SA 1N7JA 4YV2A 5JR3A 3BGVA 5K8VA 2B25A 1QAMA 5FTWA 5EMKA 5FWDA 5KVAA 4OBWA 2AOXA 3CJQA 3EVEA 2PWPA 2ZIEA 1ZKDA 1BHJA 4CTKA 1XTPA 5CIYA 4V0RA 3WSTA 2CWWA 5HIJA 4E2ZA 2Z6UA 1JSZA 4KIFA 2ZBQA 2GB4A 4QTTB 5CUQA 5E9QA 3EGVA 2BM9A 4QTUB 2C7QA 1VP3A 5MHTA 4BLUA 3KPYA 3TKYA 2XVAA 2ONZA 2ZBRA 2ZZKA 3QOXA 1L9KA 3HCFA 3A7DA 4GOOD 4HH4A 2PLWA 1KYWA 2HWKA 4RVGA 1L3BA 3VYWA 1XDUA 4PNEA 2OXTA 3PX3A 1O9GA 4AZTA 2VZ9A 4QVGA 3EVCA 2PT6A 4UOEA 3EEOA 3P2KA 3KQQA 2ZVJA 3PS9A 2PBFA 5E1MA 4CWAA 2B3TA 5E2AA 2PKWA 3JWGA 4KDCA 4EKGA 2XYVA 3DR5A 3GU3A 4C4AA 4EVIA 5LQJA 4U7PB 4M36A 4Y30A 2BM8A 3I58A 3C3YA 3DXYA 4RTLA 1JG1A 3HP7A 3TR6A 4ISCA 5EKXA 2VDVE 3KQVA 1JR4A 3O4FA 5CM2Z 2I6GA 2QM3A 2ZLBA 3FUUA 4RVHA 5CVUA 3TKAA 3BGIA 4G56A 5EVJA 4EKIA 1NW8A 3P2EA 3HA5A 1R8YA 4M37A 4HTFA 1XDZA 5EHGA 2XYRA 2ZIGA 3BWBA 5BW4A 1KPHA 1V39A 2PVCA 3UWPA 3THRA 3G8AA 3OPNA 2A14A 3VC2A 2GAFA 3MTIA 3V97A 4RTMA 3BZBA 2AOTA 4V0QA 4E30A 2P3QA 4B17A 2DPMA 1EIZA 1Q0SA 1PJZA 1EG2A 1DUSA 1PRYA 2Q41A 4GOND 4MWZA 4RVDA 5E2BA 5FWAA 3O7WA 4GUAA 3UJAA 3OFJA 5DXJA 2XVMA 1WS6A 1R8XA 2AN5A 3PVCA 5DLYA 5EMJA 2G8NA 3KU1A 3BWCA 3RW9A 3DXXA 3HM2A 2LD4A 4L7VA 3FTEA 2WA1A 4ER6A 3GGDA 2HR1A 3R3HA 3LSTA 3FUWA 2I9KA 3IV6A 3Q7EA 3E7PA 5T67A 2EFJA 1Q0TA 1RI5A 4P58A 4DQ0A 4PYJA 4R8SA 3LHDA 3PT9A 4DA4A 1NW5A 3AXSA 3FUTA 4M7RA 5K0CA 2PSSA 2V7EA 5K0GA 1I1NA 4AZVA 1WY7A 2DULA 5DX8A 3ELWA 3M6XA 1I9GA 4CKEA 3CBGA 3D2LA 2AR0A 1AQJA 5CCBA 2ZW9A 4GC9A 2AOVA 3P97A 5F2NA 2IDJA 1MHTA 3P9IA 4ER0A 1RI4A 4RTNA 1DL5A 2YX1A 3T7TA 5LQNA 2R3SA 1NW6A 4ATNA 4ER3A 3FRIA 3THSA 3H2BA 3RODA 2C7OA 2IBTA 3GDHA 4X1OA 5DM2A 3O31A 5DSXA 4E33A 3FPJA 4EQZA 3B3JA 1SG9A 5DTQA 3GIWA 4YV0A 3C6KA 1P1BA 4MQ4A 2P3OA 1WZNA 4YUWA 3L8DA 4E31A 5EPEA 1RI3A 5K0EA 5GINE 2EJTA 4RTOA 2UYQA 3GNLA 2PY6A 5DM1A 3G88A 2ZZMA 1FBNA 3EEYA 5K0FA 1SQGA 4PYOA 4KDRA 2ZTHA 3HTXA 1L3CA 1ZHFA 1ZQ9A 2HMYB 2I7CA 2WA2A 3FPGA 3NJRA 3OE5A 1RJDA 3G2MA 1L3IA 3LCUA 4C05A 4POOA 5LQUA 2FK7A 2I62A 4BLWA 2OBFA 5DTMA 2IH2A 1X19A 1RI1A 5DM4A 1INLA 3AWIA 3ANXA 3G2QA 3HCAA 4PIMA 5KYGA 3UJDA 4DCMA 4BY9E 2B9EA 5IKMA 5K01A 1BKYA 1Z3CA 3MGGA 3FTDA 3AY0A 5EEHA 2EJUA 3UZUA 4FSXA 4RV9A 5EGSA 3CKKA 1YUBA 1P91A 4RTQA 3NVMB 3LX6A 2QRVA 2ZULA 1NW7A 3A25A 3OU7A 2YTZA 3DUWA 4FGZA 4EK9A 3ME5A 4A6DA 2JH9A 5DPMA 3G2PA 3LKDA 5EKUA 2VDUE 4FR0A 1RJFA 2G70A 5EC8A 5T64A 4GOLD 3UA3A 4PYKA 4RTJA 3HCBA 3G89A 1JSXA 1G8SA 3B3FA 3FPFA 4PINA 4XUDA 1M6EX 1FPQA 4K6MA 3GRYA 3HVHA 2PXAA 4LWPA 3JWJA 2IFTA 2N47A 1ZG3A 4PYIA 4OX9Y 2H1RA 3FUVA 1EJ0A 1YFLA 1KPGA 4XUCA 1R00A 3KR2A 4QVKA 2PX4A 3HCCA 1RJGA 4R6WA 3SSNA 1IM8A 2CL5A 3UJ6A 3F4KA 5FQOA 4M38A 4YUXA 4BP3A 2O57A 2OO3A 4CKCA 2YXLA 1N2XA 4KIGA 3V8VA 5GIOE 2XBMA 4MHTA 1QYRA 3SXJA 4DCGA 3IHTA 5FQNA 4BP1A 1EQAA 1VLMA 3KPJA 3KR1A 3OZSA 1KHHA 2IDKA 2OZVA 5BW5A 4OQEA 4RVFA 2G72A 2GS9A 1YB2A 3M6UA 5HEKA 3S68A 3LECA 4X61A 2FHPA 1F3LA 2YUIA 4FT4A 1O9HA 3FPHA 3TFWA 3TPZA 1TW3A 3KQTA 2P40A 3NTVA 7MHTA 3JWHA 1FJXA 1AF7A 5M5BA 5EOVA 1NV9A 1P1CA 2VDWA 4C06A 4RTKA 2NP7A 2AOTB 5EMLA 4F85A 4RWZA 4WXHA 5GOZA 3BKXA 4DM3A 4F86A 3ER9A 5B1SA 3TM4A 5ICCA 5EHIA 1T43A 3KPVA 3UJ8A 1VBFA 1XJ5A 3EMDA 3QV2A 4LG1A 5E8RA 4E32A 2JHPA 5CVDA 1QAOA 5ICEA 5K0JA 3GO4A 3OZTA 1OR8A 5LQRA 3IEIA 2OKCA 3MHTA 2XYQA 2ZWAA 4R8RA 2IBSA 1N7IA 5DX0A 3EMBA 3G7UA 3T7RA 3TOSA 1Y8CA 2ZWVA 4PCAA 2H11A 2OYRA 1JG2A 4OA8A 3E23A 4DKJA 5FA8A 1G55A 1D2GA 4H0NA 5EG5A 5LQAA 1SUIA 2BR3A 3DTNA 3MAGA 3RIEA 3HVJA 3NWEA 2CKDA 3OZRA 4Y2HA 4QDJA 5K09A 2GLUA 1RI2A 1U2ZA 1XXLA 3I64A 5K0LA 4YUVA 3SX0A 2IIPA 4GOMD 4DZRA 5HOQA 2C7RA 3IYLW 3GRRA 5H02A 3P9CA 5P8WA 1SUSA 1ZGJA 4DMGA 3EVBA 3NDIA 4JXJA 1JTEA 5C9ZA 5CD1A 2ZIFA 3B7PA 3X0DA 4HRAA 1B42A 3MB5A 5DXAA 5EQJB 1KXZA 2YR0A 5HFJA 3TMAA 4RTSA 3HVIA 1YZHA 3UJBA 4AZSA 3ERCA 3NMUF 3ELDA 1X1CA 3OU6A 5DX1A 2P1DA 2P41A 1NBIA 3LL7A 2AVDA 2BH2A 3DH0A 4FSDA 1YZ3A 2O07A 1KPIA 3B3GA 3C0KA 5ICFA 3M33A 5EIWA 4GC5A 5K03A 5LQKA 5K05A 2AOWA 2Y1WA 3M6VA 4FT2A 1G60A 5LR6A 3BUSA 3MERA 3FYDA 2ESRA 1P39A 2V74B 3DMHA 3ER8A 3CC8A 2FCAA 2QY6A 1KP9A 4LWOA 10MHA 5LQCA 5EIFA 3DMGA 8MHTA 3M6WA 3G5TA 4CKBA 1IY9A 1NW3A 3DP7A 2NXCA 3FZGA 5EMMA 5F2OA 2UYCA 2YXEA 5CVJA 2G1PA 4ER7A
chains in the Genus database with same CATH superfamily
2D0IA 3NNDA 3U6KA 1ZHHA 4QNRA 1H2FA 1W5BA 2D1QA 3M7IA 1ORVA 1R27A 3AH8A 1RAAA 1Y5MA 4CLOA 1JJIA 1FDRA 4OGKA 1ND5A 4BLQA 4X94A 1BGWA 4DIKA 5JCJA 3KD2A 5ALFA 5PNTA 2ZAIA 3VYUB 2W2PA 3EGIA 2VT6A 3F78A 3M82A 3QVKA 3DL4A 4EGCB 1KP2A 4DJTA 1TQ2A 3VHXA 1V5FA 3BYZA 4ARUA 1S3SA 4YT5A 1VZ2A 1TO1E 4WY8A 3ZE0B 1U1DA 3KJXA 2R7MA 1E0DA 4AJ1A 4E21A 5JNTA 1YD7A 3JARA 1VIYA 3OUZA 4FYMA 4P35A 1YVEI 5FADA 4A0GA 5LVAA 1IZ9A 3JQ9A 1EFVA 5ERGB 3BDAA 3DZJA 3IO3A 4XVQA 1YI0A 3H9UA 4ZHQB 2Z6AA 5HKKA 3NRJA 1Z36A 3VAYA 3CLTD 3RPEA 4QARA 4EMBA 3OKPA 1KTVA 3AB3A 4IPTA 2QVXX 2ZRBA 4S04A 3DHVA 5LXTF 1RRVA 1R74A 3FNRA 2MCFA 1GG2A 4ZMBA 1J1UA 3LPDA 3DDNA 2VI5A 1SCKA 3DF9A 4XOIA 3BD6A 1NNI1 1VOTA 1CR0A 3ZR4B 1RYZA 2HGSA 4KQWA 4GXNA 1J1IA 4DQVA 4O59O 3ZOKA 4C4PA 1GAJA 2PV0A 4TV8B 3W90A 4MLCA 1N0VC 2Y9PB 3JVVA 3IOYA 4MQFA 4OYRA 5SZIA 4WW0A 1LJLA 4JU8A 3JY6A 3GQBA 1UM8A 2XY4A 1E8NA 2J33A 3I5YA 3JQFC 1QE0A 2AIRA 5F5LA 1E2NA 5DYNA 5JRDS 1QPZA 2VHYA 2FOLA 1TKAA 5B58T 4OAOA 2PX8A 4JI5B 1K6XA 1T5IA 5DISB 4GE0A 3LPLA 4R69A 5AVJA 2AUNA 2GJAA 4GF5A 3DEZA 3D0RA 3ENQA 1W5EA 1O97D 2EL7A 4BJ6A 4HKTA 1VSUA 4OQDA 3RADC 4IX1A 4UUMA 2GESA 4Q24A 5JPCA 3R2JA 2OHIA 2O1EA 2JH8A 1SOWA 1A82A 3HWRA 4Z1MA 4CKWA 4BNDB 3GLVA 2VXBA 5CLFA 5LMZA 3DV0A 2Q5QA 1EBBA 1ZRSA 1NF8A 2VK8A 5HDBB 1YB6A 4C0AC 5D3ZA 2L69A 2VZ0A 1W8DA 3ZDEA 4LF6B 1AXEA 3P0FA 1SBHA 3HP4A 3IBTA 3UUGA 1QK3A 1SHUX 4QQRA 2Q6LA 3SPXA 1T1IA 1SXIA 1C50A 1XZCA 3PQ4A 4EH1A 3M5PA 4KGDA 1DO2A 5CG1A 3G0HA 3QLTA 1TNDA 2D2VA 3MWDB 2CHFA 3UOGA 4L02A 4RY2A 4XVUA 2I03A 4ZXPA 3R77A 2I7TA 4ZJYA 3Q9LA 3VX4A 4DR3B 4QECA 5LSAA 4B31A 2D5AA 3EGXA 3VO1A 3MSCA 4J0HA 2N9UA 4C03A 4CXMA 1MP0A 4E4TA 3N8DA 4G9EA 1R9MA 2OCDA 5FUBA 4CT4B 3QKWA 1HRKA 5HIKA 1G38A 5FHQA 4Y1RA 2GM3A 2QTNA 2ZQZA 1NI4B 1WG8A 1JEAA 4QYWA 3VR2D 3W6NA 1IOLA 4P81A 4CMAA 4EJMA 1E66A 3JYNA 5C5DA 3W5BA 1DGQA 3MAAC 4RKYA 3P8ZA 2QBYB 2QKYA 5FV7A 3HYNA 5D6NA 1N5DA 3PL5A 2VTBA 4B3RB 4ED9A 5LP6F 1RAFA 2VAMA 3KK0A 1KZ4A 1NUTA 1C4WA 1X2BA 5EE3A 3ETHA 1RHRA 2JAXA 2WYIA 4B7UA 5I3ZA 2X86A 4PZ0A 1DADA 2QYSA 8ABPA 4PPQA 3VI3B 2VNJA 4XA8A 2JVJA 1WM1A 2X15A 3BE8A 2X8JA 3C5WP 3E5NA 3FN4A 3SBDA 2P11A 2COKA 3LUAA 5GIPE 1QANA 3L7DA 3CVUA 1H2WA 1GCOA 2GD1O 1I01A 1KK1A 4YRMA 1E2EA 4M1ZA 2AFHE 4LMRA 1XG5A 1JP7A 4B35A 1A1VA 3ZV4A 3A7EA 1F38A 4AUMA 3PF8A 1H1DA 2CBXA 4ND8A 1K27A 2CL6X 5CAEB 4P84A 3DULA 4ASUD 5ALNA 1EFRA 2YXDA 5AQ1A 3GEDA 3QQ5A 1PBNA 3BKWA 3BMQB 5KKAA 4X93A 1H2HA 1E7RA 1S1MA 3NWOA 2OZEA 4P54A 4NZOA 5IC5A 1IHOA 3NLLA 2HPZA 3PJGA 4C6SA 4EHLA 1UFKA 4IOLA 2XUKA 1I6KA 4R16A 5BNTA 3QSYA 4X20A 1AUOA 1QO7A 1U0FA 1Y7HA 4GNKA 2WTUA 1QLHA 4O4HF 2E4AA 1TIBA 2K5UA 4P7FA 1JT9A 1M0SA 1GILA 3WOVA 5GP1A 4JS0A 4L5YA 1NI5A 2N46A 1E9SA 2ZJZA 3OESA 2IYOA 2NYUA 4CN9A 5K0TA 1QHHB 2OY0A 3OZBA 1KI3A 3U16A 3H1TA 2OV4A 5IJZA 3ZEIA 1E20A 3QE3A 4X92A 3W3AD 4B47A 2O8CA 2Q45A 3KTOA 4WOKA 1JB1A 3C45A 3T7SA 4D25A 4W5NA 5JR3A 1N36B 2OORC 2PRZA 4ND7A 2VP6A 5K8VA 5BORA 3ZD8A 4LWZA 2IVFA 1SCDA 2UZAA 3Q7SA 1ISJA 1K5GA 2HMVA 4TTSA 1J97A 4NKRA 5CLJA 1XKXA 1OI2A 4JC5A 1ZMOA 4QTTB 5F98A 1FUYB 4JC4A 5TMPA 3ZWNA 4FZ5A 3FUCA 4DSUA 3QMWA 2QTLA 2ONZA 2KPOA 3DV2A 5BW8A 3F46A 2O5VA 5IJWA 5KJ1A 2AQKA 2QN3A 4IHAA 3K8QA 1SKYE 2Y9MB 3K9WA 1UZUA 4HH1A 1BE0A 2F43A 3AI2A 3AOGA 1B1AA 1P6QA 5AM1A 2VLIA 2BKUA 1VKJA 2H1HA 2WFZA 1TM4E 2ZYRA 3C5CA 3LCMA 3GWGA 4MYUA 1IYZA 4UOEA 5CVTA 3SVTA 3B85A 1GSAA 4FE4A 5CDGA 1CY8A 3H2SA 4LI0A 2CXQA 3NBQA 4MP3A 5E2AA 2GQ0A 5TT1A 1QYXA 3T7IA 2UKDA 4HNRA 5B1YA 2QT9A 5C1BA 1T36B 1TUBA 1XO1A 1EFVB 3QFFA 4GYWA 4M9XA 4NYIQ 4OFBA 5C80A 4IYJA 1SBCA 1OT5A 2VTDA 3R3YA 1XCOA 2J3MA 1OW3B 3GFOA 5BW6B 5AIAA 4N76A 1PJTA 2YY5A 5EKXA 3ZZTA 3ZIUA 5ALWA 3ZK9A 4EVQA 4OGGA 3AI3A 3KDSE 1YOVB 1XP5A 1NA5A 4M21A 4XDHA 4FFSA 3I6BA 3P2EA 5EJEA 4J07A 1X13A 2HU7A 1MQ8B 2WJGA 2ZPTX 5DLPA 3N0XA 4YI3A 1XDZA 3C7CB 3M83A 5GMOA 1H66A 5ESRA 1N5IA 1SAYA 4J03A 1I4DD 2HHLA 1C30B 4CUZA 3L77A 1AHHA 1VM6A 1OGIA 4TVOA 3V4LA 4HJRA 2DVMA 3LQ2A 1DX4A 1U1FA 4J4BA 4CFZA 3ELBA 3JQ8B 2Q2VA 1XTRA 2I34A 3GHYA 2CD7A 2Q8PA 1EIZA 5JVDA 2Z3VA 4EW3A 1E2BA 2UYGA 1DUSA 4EQ6B 3G6KA 3B1YA 4ICIA 4AYXA 3O3NB 5DXJA 3WBJA 2VJCA 4R3NA 3ZBQA 1BROA 1GGKA 4V24A 5F73A 3AM4A 5HMLA 2EHJA 2QX9A 5LB2A 1PIWA 3I5AA 3GEMA 3U4AA 3I61A 4KQIA 4IO1A 1KBQA 4G0QA 3RVRA 2OSBA 4NOMA 1HYHA 2I9KA 2EKZA 3IV6A 3V34A 1EEXB 4BAGA 4NBTA 3VV2A 3DZBA 3BM5A 1MDBA 3LY5A 3V7UA 4ZDIA 4NU5A 3E22A 1H1LA 3THXA 1TYDE 4CMEA 1JS1X 5FUYA 2EEZA 2LVBA 3GZ4A 3GJRA 2PZFA 4JB0A 2O1WA 4G5RA 4K3VA 4NMLA 3RQIA 5A3QA 3HSKA 3C7KA 4QYTA 2A9VA 3M6FA 5F2NA 3A58B 4OLJA 2NACA 2PO5A 3D4OA 3O8RA 3MT8A 1CUSA 2XCIA 3JPYA 1CHNA 2Y93A 1ZC4A 2YJ6A 1E99A 3C3BA 3HYTA 2FW8A 4M86A 4ZODA 3THSA 4HV4A 4LF8B 4CU2A 1P0PA 2BFBA 4IRUB 2WWXA 3SHVA 2WP8J 2CXUA 4GZMA 2C2GA 4HUQA 3REFA 4AM8A 5HUHA 4TYWA 4DEYA 2AKAB 5BN4A 4LE0A 3L8DA 3D6MA 1U3GA 1QYVA 2AQIA 2AZDA 4BYMA 3RYFB 3K2IA 3R7WA 6REQA 4Y2QA 2QAGC 1KXJA 2X4DA 2YINC 4XRGA 3LZDA 4Q9HA 1SQGA 1HZZC 3CLUD 5K8JB 4JLKA 2HMYB 5E2IA 4YNBA 3RVKA 3D7RA 4NI5A 5AHOA 1FFDA 3BS4A 1EA7A 4XWKA 4JB8A 5DTMA 1GA4A 1SURA 4DV1B 3QYAA 4H4EA 2XUFA 4QOGA 3UKOA 1AKWA 2LNDA 1DRWA 3LK7A 4BB6A 3DOOA 1DAIA 2ZAGA 3IALA 3ZWWA 1BKYA 3FTDA 4IDPA 5EEHA 3SC4A 3CG4A 4EP1A 1D1TA 1G9SA 4GLBA 4KV9A 3F6PA 4XWTA 1YUBA 3AHFA 4OK3A 4UMEA 1QIHA 3O3MB 4RESA 4CNQA 2H7YA 4F04A 1JUDA 2JIOA 4U7HA 4WASA 1KGDA 3NIFB 4C4RA 3FBTA 4KITB 3A4YA 4DSTA 3FNFA 1EESA 1QHFA 2IUTA 4HX2A 1E1CB 4X8HA 4FUQA 5DPMA 3LQKA 3MF4A 1V9CA 1SCBA 2XCUA 4JOSA 4EJFA 2EC5A 1AE1A 3Q5EA 5ULLA 1PR9A 3DE0X 1HL3A 3GP3A 1OXUA 3ZDXB 5BUSA 3FMFA 1DC7A 4C7KA 1M2JA 1LW6E 1AKNA 1XALA 2GZ3A 4PYIA 4BNMA 2G5PA 1WUHS 2VPIA 4ETWA 3VR6D 4HBZA 1KTIA 4XFKA 1R5JA 1MXHA 2VHXA 5SYAA 2A6PA 5EJ2A 5IHPA 2BN4A 1EJ2A 3LQ4A 2R65A 4YCSA 2WV7A 5B1DA 1GFIA 3WIBA 4OLHA 1OBFO 2JAPA 2W6PA 1OAKA 2Y6UA 3RU3A 5FX2A 3I05A 1GDTA 1ZI6A 3ILHA 3A3OA 3IULA 1EE1A 1G20A 2D62A 1SXQA 2JGDB 2D7CA 3E9MA 4MVJH 2SCUB 1TZKA 3EC1A 4H60A 4JFAA 5DB4A 4ENWA 1Z68A 2ZXFA 3HDJA 5DH9A 3K2BA 3CN9A 2PL1A 3F1KA 4HLUC 4QE3A 3U7HB 1E5DA 2JRLA 3OD1A 2ZYWX 3S68A 5JMWA 3SS7X 3T7CA 3ROMA 3IT1A 2IOFK 1FYVA 3T7EA 4UEJA 4ALJA 3UC9A 1SUEA 1VDMA 2QV0A 1YZUA 3D2CA 5AI8A 3WL6A 4B9EA 4D3SA 1OB5A 2WJPA 2PBRA 4IDGA 2BFFB 4RQTA 4B9AA 4KO3S 1X7WA 5ICCA 4RZUA 2DCMA 1YOBA 4XJXA 3W4JA 5A4IS 2FUG6 3EG5A 4LTDA 1QQAA 2JZOA 2J7PD 2OFXA 2R7AA 2W2TA 3AB8A 3SKVA 5KNCD 1WPQA 1YQQA 1QHXA 1Y48E 1CZRA 1I1HA 1V9SA 3QBTA 1I5RA 4E4RA 4P3NA 1QDLB 1M33A 3TOSA 1KOGA 3UK2A 1RC1A 4YJ3B 1RJ9B 3F7OA 3ZNNA 4F2PA 2DLDA 1EZ1A 3C8ZA 1E2FA 1UEJA 3EBPA 4TWRA 1EP3B 3E0XA 1GKLA 3PNYA 1OWPA 5GQSA 5U4QA 3ORQA 4XUGB 2JLWA 1BVUA 3LWZA 2MTBA 4FYJA 2PD3A 2QG4A 3K2EA 5M7EA 1NAHA 2GPNA 3HN2A 3ZVNA 1U3CA 4QUEA 1F2TB 3GN1A 3ZV5A 3I64A 4OJMX 4L57A 3R7FA 1QFZA 1U9IA 3L6UA 4C6TA 4ZIRA 1TTQB 1ZK1A 3ONNA 2ZRJA 4LF9B 4XYGA 3GVXA 2W6QA 1L7PA 3MLAA 4MVJD 5IX8A 3BQNB 2ZBEA 5CH5A 1KFBB 3E70C 5DEOA 1Y1KE 3TMAA 1KXZA 3NMUF 5JROA 2X8BA 1AGNA 1BE1A 4TGLA 5I9NA 1OBOA 1HFWA 4ESOA 3L05A 4DWJA 5JH7F 1NM5C 3OURA 2AVDA 3LP8A 2C5HA 1GYRA 2CXSA 2G9ZA 2X3YA 3AY7A 4NPHA 2A9JA 4I2NA 3BOSA 4JQCA 1F1BA 1HTTA 3KT0A 2WTXA 4NHEA 1DQPA 2XNHA 3AERB 2RHBA 2DP4E 2WFLA 3EC7A 5I7OA 5JQGF 4DV4B 4R2LA 2W00A 4UFPA 1QZXA 4IDFA 5HMMA 1KP9A 3LIIA 3KWLA 4XXHA 4FN5A 1Z6QA 2OBMA 1C3OB 1N3BA 2NO6A 1BDBA 3DP7A 4OV6B 5HF6A 2NV2B 3SC6A 1ZN7A 4RAQA 2BJVA 2P9CA 2VDMB 1RBMA 1P3JA 4W5TA 4BNVA 3V4RA 5F4ZA 3MXTA 2CCGA 2VJAA 1XCMA 2X14A 3P9ZA 4OJYA 4A6PA 4OQLA 1UBOS 1L7QA 4JC8A 3RE1A 2CDRA 2R97A 2QP3A 4WLNA 1DBVO 1E9EA 3R75A 1E3MA 2Q9BA 5F77A 1UC4B 3WLJA 4DDHA 5C8YB 2VXCA 3R4VA 1OWMA 3H1EA 4JJ6A 4NDAA 1H69A 2HO5A 3O92A 1EVIA 2FFQA 3H4IA 3PA8A 4XCQA 1VJ1A 2HNKA 3CHYA 4HXGA 4MINA 1JEYB 2HPVA 4HGNA 1OTHA 2E89A 3H5AA 1OH6A 3LHIA 4NK5A 4IFIA 3RSQA 1ISSA 3LYAA 3KHTA 3SFTA 1H6DA 1T5SA 3LUKA 1E8DA 3SFZA 4M8IA 2ZUUA 1ZONA 3ED1A 1BS2A 1DRVA 4IF4A 1C9DB 3DKKA 3A27A 3HGMA 3Q3VA 3ZHZA 2FETA 4F91B 4BQPA 1LPPA 1M67A 1ZA1A 2B69A 2JAOA 3AKEA 5EPOA 1Z7BA 5DW0A 3ZJUA 2W0MA 2Y05A 3NASA 4IINA 4JBGA 3RVLA 4D41A 1NKTA 3PUYA 5JH7A 4OUDA 4XZ3A 3GLUA 3DCNA 1KYYA 1TT7A 4UHBA 5AKXA 1O77A 1WXFA 2BP7B 3EUFA 4R1NA 1CZUA 1PKXA 1F8XA 4M1MA 2OFFA 1IXKA 1WCXA 3SSOA 4E3ZA 4AS2A 4G6ZA 3TL2A 4H31A 2VDQB 1CJCA 1KR5A 1RLTA 3QH4A 3VDMA 2W0SA 3GNSA 1OZGA 4UXIA 5T5QA 2W43A 4NJEB 3L7YA 2TMGA 3N70A 2WINI 4YAJA 3U3OA 1RHUA 2CYBA 4TS4A 3RC2A 5ICGA 3Q3CA 1TTHA 1P18A 3EQ6A 3HDYA 2FSIA 3IEUA 1LPMA 3QVSA 4LYAA 5CDFA 4QTYA 4K40A 1WUJS 3T1TA 1DEAA 1I7QB 2QZJA 4A2PA 1THMA 3DE7X 1LS6A 2GGSA 3GGPA 4ZYTA 3AP3A 2B3DA 1Z17A 1KZGB 3ZY6A 3D54D 2E87A 5DNAA 2V7QD 2AFIA 3EMKA 3LWDA 3L7MA 3OT4A 5JJKA 3ESDA 4GBGA 3HSSA 3I9FA 4L4RA 3V4OA 1JWLA 4C87A 2E6KA 3K8OE 4E5VA 1C30A 5L51A 5LZ5A 2R44A 1L5HA 3HXQA 1TF7A 3U9TA 4LJRA 1RAIA 3IAAA 1CUYA 1HNNA 3QVMA 5A5EA 2GPJA 3SNKA 4AJ9A 3F3KA 4O4LA 2QJWA 4MGKR 3K0BA 4BCBA 4BX3A 2KJQA 4RX1A 4BFTA 1JAXA 1PDWA 4MW4A 4UBMA 4UUPA 3FPEA 3K1ZA 3OZ7A 3L0BA 4NBNA 5G3ZA 1LPAB 2WUWE 1VBKA 1NXSA 2ZSIA 2DZDA 4FMBB 1SXGA 5AVUA 4Z4GA 5KTPA 4HDMB 1ML4A 2I33A 1AUPA 2RGYA 4RELA 2IPXA 1SQ5A 1DS6A 3R23A 2QRVB 4IDEA 4I2VA 1QM5A 4JB2A 5F9FA 3OHPA 3SMVA 1SXHA 3VZCA 2DCUA 3GROA 1FLAA 1SUWA 2QIPA 3LBHA 4Q4HA 5LN1A 3F5QA 1VLVA 4QREA 4J9UE 2J5BA 4P4LA 3ZXYA 1ZCJA 1JTVA 1JDSA 4EB3A 1PL8A 2IYQA 1EFPA 2FPIB 3ZHYA 4B6PA 4M83A 4QPPA 2WKRA 2RH5A 2XWBF 3LIPA 3O8QB 3RT7A 4C6RA 1GDDA 3H8VA 4UKDA 4W5OA 4FFNA 4G4SP 4N8SA 1TYZA 2AMYA 2GTHA 4WJKB 3ZV6A 3LO8A 4BQFA 5BQFA 4PPYA 5KX5B 1N78A 1RDFA 1RXYA 3NO4A 1XMPA 4NV0A 4XPIA 4HEJA 4DMFA 3K71B 1PT9A 2ZBGA 4BBAA 4AROA 1QG0A 1Z0SA 3EXEA 4G36A 5GZ3A 4Q1BA 4MVYA 3DD1A 4EY8A 4QPZA 4OHKA 1JAZA 3I76A 3K0EA 4QEDA 2EQ5A 1XAJA 1ZXBA 3QG1A 1LZKA 1VG8A 1M5TA 3PB3A 1EUQA 1WCIA 1GP2A 1CB7A 3PD1A 4A82A 4EY7A 2QL5A 3SOPA 2YY7A 1KDRA 3HLYA 1ABFA 3EVDA 3NCHA 2IUSA 1NKVA 1XD2A 4ZI2A 3K6SA 4X20B 1FEZA 1MRSA 4BZPA 2HADA 5J4VA 3P2IA 5MN4A 1ZBQA 5E8JA 2DYKA 4ALLA 5C7LO 3OSUA 2C9CA 3M2PA 1QRTA 3CF0A 2ZB4A 4EABA 2DFKB 5H3HA 1IH8A 4JYPA 4PO1A 2QVBA 3COZA 1PGPA 2Q2OA 3OC0A 4V0ME 1U2QA 1B8VA 4C04A 1WSBA 2A9FA 4E2XA 3R9IA 2WFAA 1ICIA 4V02A 4ZJUA 3DZCA 1MOQA 1YDHA 5DWQA 2O6HA 1JSRA 3WKCA 1WR8A 4XQ9A 2FR1A 4K9KA 3T1HB 4CM8A 3SQLA 1GZVA 2M6KA 5CDHA 4HDRA 2GEJA 2XB4A 1FUKA 3CU5A 4KI0A 2CT8A 2NU8B 2P30A 3Q8KA 3N2YA 1GR0A 3PD0A 1MEEA 4ZC1A 1XRNA 4TZTA 4IKOA 1U7DA 5I4BA 4AY5A 1NRJB 2GJ4A 4KJXA 2OCLA 3RS2A 1CTQA 1YS6A 1I4OA 2AE1A 4YRIA 1XN1A 3DTVA 2AS0A 2V7QA 4E15A 2JCBA 2NSDA 3MMXA 3DOJA 3QI7A 3TLYA 3QBJA 1QTNA 3AU8A 3CGWA 2O52A 3H65A 1L7DA 2OVBA 4K2AA 3AM3A 4R68A 3AVPA 1D9XA 3WWZA 5CCDA 2QMUA 5LP6A 1OXXK 4QDXA 5K3EA 4Q00A 1TU3A 2C61A 1LBIA 3SHTA 1E3SA 2CJYA 1JIVA 3HN6A 1QK4A 5T6BA 1TI7A 2OHFA 2FP4A 4NYMR 3RAPR 2JEYA 4FYYA 3QPBA 4A6XA 2IHZA 3HUEA 2OV8A 3DMTA 4FYVA 1N7JA 2DECA 3NOOA 4YV2A 3WKAA 1Z4NA 2OWDA 3E84A 4CEHA 3GLSA 1CQZA 2NQTA 4OBWA 5DI9A 4P2BA 3TNLA 5CW1A 3VM6A 3EBOA 1O4WA 4OUKX 2NQ8A 3WIVA 1YZYA 1OLOA 1YFZA 2HC9A 1BGVA 1P4RA 3O4GA 4FMDB 3SY8A 1YV9A 2YWFA 2EARA 3NAGA 2BBSA 2ZS9A 1S02A 4C7XA 9GPBA 1MO4A 2CLFB 4V0KA 1H9AA 1UODA 4WXYB 4AMUA 2FPPB 2G25A 2XNJA 4RFLA 2XB6A 2PUWA 2R48A 2VWQA 2WSMA 3N8GA 2W2XA 4YWJA 3ZHBA 4BVEA 2C42A 1CNMA 1NKSA 3W2EA 2ZB8A 4ZI3A 4L6IA 3P2KA 1J99A 1H6BA 4YUAA 4KR7A 3P20A 2PBFA 1WMAA 1DTEA 2C3UA 2ZITA 3GEIA 3ZGYA 4AUEA 1WV1A 4XFJA 1V43A 3VNAA 1U7HA 1KE2A 1M66A 3IX7A 3VR5D 5FNVF 3UOAB 3DNFA 4M7WA 4XD7D 4F46A 4DUZB 2R62A 1W8IA 3LPCA 4D4GA 3GARA 4KNWA 1VE5A 1NZJA 4Z6KA 3KV3O 5FDFA 2ZJOA 2DQKA 1ZW1A 3EA5A 3CVWA 1GCAA 3PC6A 1Z56C 2GEVA 2HL6A 1OTYA 1ZN8A 4TXJA 5FUWA 3SC2A 2M98A 2EX0A 1RWXA 2D8MA 3ILXA 5AKEA 4MS1A 5BW4A 1D4AA 1JXQA 1IUOA 2OMEA 5T41A 1J5PA 1Y4AE 2E49A 1U4NA 3FLAA 3IAHA 4BMSA 2WF8A 5EIAA 1JECA 3X1XA 3I32A 4M0KA 1TD1A 1OF1A 3OPXA 4KGZA 5DE3A 5TQ2A 4B3DA 2I4LA 3MJEA 2YIMA 5EJFA 2EL9A 1FVHA 3IKVA 4KQEA 5FBWB 3LGXA 5ES4B 1KI8A 3KJEA 3GFVA 2ZDGA 3MGKA 2K6GA 5ARDA 5KJFA 4DLAA 3D0KA 3AV3A 3DJFA 3PVCA 2UUAB 3CRVA 3EGCA 2CUKA 1RIIA 4ACBA 4C4YA 1Q74A 2O14A 4CU5A 3NOXA 5JIBA 1CUEA 2GRAA 4QG3A 4EZEA 3CRRA 3FUWA 3H2YA 4L75A 5AM3A 3C3EA 4V0SA 3CE9A 1SELA 5BMVA 2P2DA 1W93A 1NYRA 3COWA 4EHKA 3FY4A 3JCZA 1ZJYA 4WBNF 4RDXA 2PUDA 2WAMA 4ML3A 4M7RA 1AB6A 2BCGY 1YRBA 1TYCA 1UBCA 2V7EA 3HZHA 3JR7A 4G97A 5HCIA 3NBKA 4GR9A 1MENA 3VR0A 2NSHA 4QRDA 3DTYA 4D8YA 1I9GA 1RJWA 1U1EA 3KLOA 3VKWA 1MCZA 3WMFA 3CLHA 5A4KA 5BV8A 2QNBA 4HNHA 4S1PA 4K6HA 3M9LA 4RH3A 1OOEA 1KWKA 3NONA 1TKRA 1N7HA 4L5BA 4IGKA 4LEIA 1IB0A 3GAAA 2QTCA 5K7SA 1D4FA 1I6LA 1U04A 3K5WA 3C6KA 1U0TA 4PHHA 1WMSA 3G82C 4BB9A 5C8XA 1OUMA 4P4UA 1F17A 1Y6GA 4E31A 1V3QE 2XMRA 4ITUA 2GCOA 5EPUA 5C51B 1KJWA 3DC2A 3MOSA 1Z75A 5EXDA 4K9MA 1GZ3A 1CY7A 5BNFA 3LW8A 3VHLB 2JLSA 5A62A 3ND7A 2QROA 3EASA 4KKVA 4TSFA 4DS3A 1HOTA 3N7TA 5KX5F 3EIQA 1KRXA 4HF7A 5DYWA 2WF7A 1X2EA 4BC0A 5H0IA 2LDXA 3G2MA 1QQ5A 2PK3A 4OU5A 5DXFA 5EJ7A 3HC7A 2OBFA 3LX4A 1PDVA 3LFUA 4A91A 4LYEA 4P82A 1JKJA 1COZA 3SR0A 1Z4OA 2M2IA 3HCAA 1BMDA 3AKZA 1DXQA 2JJ8A 4IXMA 2VUSA 4I5FA 3FDFA 3A3PA 4FKZA 1UQTA 3PICA 4Q4CA 3V48A 4AL4A 5ALVA 5CAEA 3OT1B 3F6YA 3VFDA 3WK6A 3K8YA 3ZD6A 1PX0A 5B6JA 5EL0A 4AO7A 4D43A 1ID1A 1NBMD 3HG7A 3QVXA 5KSPA 3H2JA 3W1EA 5A4FS 1FDUA 1V71A 4TTQA 3KVYA 4UVGA 4WDRA 2Z4SA 4RF3A 1Q0ZA 3TOCA 1P0QA 5IMSA 4QO7A 3RB8A 1Q7CA 4BBJA 3GH3A 4JT8A 4US1R 3WDMA 5FR1A 1DNPA 1CUHA 1NR1A 4RA6A 2QXYA 5EC8A 4B6JA 5HK9A 1HE3A 1FP4A 2Z43A 1B00A 1F06A 3GZNB 3IR7A 2JCXA 4U4AA 5HKKD 2V0NA 3D8RA 3TXAA 3PDUA 4J6FA 3ZNQA 3F9RA 5CDTA 5JNWA 3HVHA 5FLKA 2E1RA 3ETCA 2EJCA 1ZD1A 4Q3CA 4OX9Y 1UJ5A 1YQWA 2EWWA 2OAEA 3FMIA 4X6YA 3VYSB 3ZLJA 2O8FB 4UJ3A 4I3GA 2EBHX 4HWTA 5BRJA 2R1VA 3DWIA 1YA8A 1QFYA 1UXKA 2P2SA 2Z4RA 3ND6A 3W2GA 3DONA 4B3XA 4YRSA 4WZZA 2VDPB 4C4TA 1O96B 2V4ZA 1K66A 3VSCA 1Q0PA 4BVGA 2VJKA 1LSOA 1LNSA 3N59A 4ND1A 4RK1A 5GAJA 2O5CA 1CHDA 1UDWA 1WPGA 4KH1A 2GKGA 4FB4A 3HEAA 2OXIA 1P81A 3TTUA 3ZHXA 3QLVA 4YRFA 1X80B 3FB1A 3P4XA 3L6CA 3KPJA 2FPWA 4FSHA 1KHHA 2D13A 4HFRA 4Y9TA 4UHFA 5HQTA 5IANA 2DWCA 1UQUA 3HY6A 2F59A 3CNLA 3U4GA 3T7KA 4K9PA 1YQUA 2JGIA 4FT4A 1Z2PX 4KN8A 2F1JA 1Q1AA 2ROQA 3ETLA 4PHTA 4TOIA 3KQHA 5M5BA 1M7GA 4UHEA 2B98A 3ET4A 1KGSA 4Q39A 1PJSA 2C84A 2QENA 2AQ8A 4RGVA 2VDWA 3T4XA 3A6PC 2C95A 5IK2A 3FKSA 4DR4B 4L85A 3BKXA 3CEHA 4ZPJA 5AJYA 4US0R 4Y9SA 1TADA 3WNVA 4IIYA 3GUYA 3N9IA 1T43A 4H08A 3VRHA 1W5TA 4PSVA 4R1LA 1HDIA 4M8NE 2XUGA 3T0GA 5ICEA 2BUBA 2PS9A 3OZTA 3IEIA 2ZWAA 3DFIA 5I9TA 2WAAA 1H2BA 1A7JA 4HDCA 5EIOA 4KJZA 3OFSA 4H59A 5DX0A 4ALNA 1Y4ZA 1MAVA 2OENG 2IF0A 4JJFA 2IYRA 3U26A 2FF5A 4B40A 5AXDA 4CMKA 2TSYB 2WJVA 4YONB 1AQNA 3ETJA 1D2GA 4D9FA 1NURA 4RD1A 5LQDA 3F3YA 2C82A 5FXMA 1APBA 2CHGA 1JWBB 4S0XA 3PNBA 1GG5A 2GVZC 2RMKA 2XF8A 3NWEA 2R84A 4MITA 1G66A 4P4TA 5AUPB 3GK3A 1SRQA 2J85A 4HNUA 5FBVB 1SUSA 5TX7A 2QSJA 4UBOA 1R6TA 3K0CA 3IMEA 2QVCA 4XVCA 2ETXA 1DC3A 4XDZA 4BKMA 4DLVA 4DQDA 3BXXA 3UAVA 1DIBA 1NMZA 4DC9A 5DCWA 2ZJ2A 3P0HA 3PSHA 4Z0TA 5HFJA 2B4YA 1XMQB 4I9GA 1D6JA 3QTTA 5BMOA 1UC9A 3R0JA 2GVNA 4HDKB 4XLLA 5G3YA 2ID9A 2REOA 3WB9A 1PJAA 3VU1A 3LL7A 3MFQA 1XF1A 3N3BC 1DKLA 3AVVA 1IXZA 4FMDF 5LDDC 1EWQA 2IF2A 1GEGA 4YP7A 2V54A 4FX2A 4QA9A 2C07A 5LQKA 4X45A 2CC2A 4Q47A 2B83A 1YXMA 3BUSA 3CLRC 4MV4A 1GZ5A 3DWFA 2IUUA 1TK9A 2FVXA 1WVGA 5AWFC 3ZHSA 5C52B 4FGLA 1ODIA 2OLJA 1NX9A 4A2QA 1DT5A 1GKIA 4HQOA 3KKNA 4UQOA 4ZV9A 5BYKA 1PT8A 1BEZA 4UTXA 4B3HA 5C8VA 4TWIA 1CIJA 2QSYA 3QU2A 4P36A 4CG2A 3VTZA 3BFPA 5DWVA 1E6EA 3KQLA 2DSTA 3QIVA 1JBQA 5JYBA 5HWSA 3BK2A 2INGX 2W8ZA 3ENZA 3RFFA 1JG3A 4M9QA 1GZSA 4YXFA 5EJ5A 3JR3A 5IT9A 2PKYX 3WFZA 3L7AA 3MCTA 1U0GA 1XLWA 5EFOA 3HB9A 5ERYA 3U7GA 1KVRA 4PQGA 3ADOA 5BR1A 2C92A 1TGYA 3L8EA 3F6CA 1E59A 2RI6A 1FYFA 5E6UB 3PDIA 4NOKA 2FN7A 3G23A 1ZJZA 3B52X 1TA9A 4NCAA 4MYDA 3CEAA 4B84A 1IN1A 3EGDB 1XQVA 1UKEA 2YWRA 4KL8S 5G40A 5FKJA 4TV8F 2Q29A 1X1TA 1F14A 3DNPA 2JKVA 3I04M 4QBGB 5HYVA 5EE9A 4KR6A 4PSAA 4XM1A 4CCWA 5IPFA 1O94D 1GG9A 1U4OA 2FKNA 3AOEA 3EQ9A 5F3DA 3S1LA 2ZUTA 3RDPA 4B3FX 3CNQS 1PQ4A 3KFXA 3DMDA 3UM9A 4DDVA 4KPEC 4C08A 3DXZA 4RPHA 1BVRA 4X41A 2NVBA 5IJ9A 4K3UA 3RABA 2Y1EA 4DLYA 2G5TA 3E1GA 1CY4A 3WLKX 4EGFA 4GFDA 3GA0A 5B64A 1H4SA 3WC4A 2BP7A 3HU1A 1LS1A 1E2IA 3WLRA 1A8UA 1R4NB 2GCNA 3CVOA 3KSZO 4RK0A 5BYBA 4B2PA 5B2EA 3WGTA 5JCZA 1DWOA 2JLCA 2AVNA 2HV9A 2PFGA 5CB4A 5BWMA 5JDIA 4F12A 1DWPA 1TL7C 2PJDA 1P3Y1 4DA0A 3LJKA 1ESZA 3L4JA 1CJBA 1D4OA 2XD4A 2ZUVA 3KZ1E 1WXHA 3NWBA 5JQWA 3LXUX 5JAHA 4ZYLA 3RF7A 3UANA 5ABPA 3NVDA 1YMQA 4YRZA 1GQQA 2PJUA 4KXVA 4ZWNA 5C0OE 1ZL0A 1SCUB 4YCJA 5CVCA 2J48A 4U2DA 3BH7A 2NXEA 3KQSA 4X62B 2OPBA 4DMKA 1GEEA 2KWIA 3QOWA 1L5KA 2CNWD 3PXEA 5AJWA 4H1TA 2R79A 5HIMA 5LLSA 4F4JA 2NUPB 1JFFA 4OGLA 3KOMA 4PIVA 1E0JA 3OFKA 2OILA 1MC4A 1Z0AA 3KP1A 1ZMRA 4XQCA 4WV3A 3SD7A 3MEQA 2AOUA 3LC0A 4CTNA 3I9MA 2V6JA 3TW0A 4EZBA 2XD9A 4ALKA 3T4PA 3L43A 3ZK7A 2IGTA 3RHTA 3ZVKA 2ISQA 3C1OA 4QHSA 1CP3A 2I1VB 3BMCB 2FW1A 2J08A 1YZVA 4LJLA 3ZZ1A 4L0MA 2F62A 3KEFA 4INOA 4WX2B 2FZGA 1NXQA 3JQBC 1JR3D 2FWIA 3FZNA 1TCUA 3LA8A 3X1WA 1TJPB 3HKDB 3FE2A 3LKZA 1AKRA 2NSLA 5AVZA 3CVXA 1ISPA 2FFBA 2H07A 2YC4C 1JDBC 4CV0A 3PTAA 4DJJA 3T99A 1R3DA 2R1TB 2BR4A 4FKBA 3ZDYB 1XLVA 2CXRA 3FRHA 5J9FA 2P6OA 2YCLA 5DCLA 3GRUA 3L0OA 2HBRA 3MK31 3COVA 4W6QA 4DUGD 1JU9A 1EDZA 2Q3BA 2J6BA 1G3QA 2QU7A 3MJVA 4M4SA 5IAEA 3CNBA 4YCMA 3MOGA 3NFYA 5EIEA 3IIMA 4MIOA 1VI6A 4J4TA 3NIBA 3QEAZ 1FP4B 3Q4GA 4GPTA 1TVEA 5FPTA 1F2TA 1LX7A 4D3DA 3EIOA 2CZCA 3K09A 1AO0A 1UBHS 4RPJA 4TQAA 4OM7A 7AT1A 2VSOA 2IEYA 1V3VA 1U0HC 5F2KA 2ZRAA 3LK6A 4PYMA 4TLMB 2II6A 3F8SA 4KRGA 1T1EA 3GLGE 1P29A 2A0XA 3LCCA 3B2QA 3DT6A 1VLZA 2ZQ5A 3GRFA 2ZT6A 2RH4A 3KELA 1A9TA 1T6ZA 1VYHA 4I1SA 1C5KA 1QP8A 1UDCA 4GRIA 5E4JA 4OAPA 3JQRA 3NV9A 2ZR8A 1T8SA 3VSEA 1OB2A 5AKLA 4UHCA 3I3OA 3EWNA 1Y34E 3ESQA 1T8TA 1HQKA 2WM9B 2XB9A 1T2UA 2P9FA 3TDNA 5A02A 2O05A 2F4VB 5LYJA 3CJTA 3GPIA 5KEIA 4LV6A 4PBTA 2O5EA 3KFVA 3IUBA 3KZOA 4UFNA 2FPOA 4OU4A 5IKPA 1ZU5A 2FMHA 3AETB 2Y1XA 4JUIA 4MK4A 4PGGA 4ZOBA 1OA1A 2F3TA 3WMGA 4CKYA 5JXHA 4NCHA 2VWGA 3ZCVA 3ZCSA 1UIRA 2R8YA 3EXG2 1B6RA 3KT8A 4C0HA 1JAYA 2W6ZA 4OKNA 3S44A 1GV1A 1XROA 1VIAA 3R5SA 2OA0A 4C5AA 3CF2A 5DASA 1RBYA 1ZS9A 4DCNA 4I19A 5ISMA 4BU0A 4D44A 1YFJA 1HKUA 2FSSA 3TGWA 4QRHA 1TMKA 3AR4A 1ZZEA 4ZCMA 1P2FA 3MWJA 3MWEB 3SI7A 4P0PB 4DG5A 4IKPA 1M8PA 1Z8DA 4OA5A 3GBSA 4DZZA 3UV7A 3LCVB 3VOBA 2YVKA 3ECAA 4YMGA 4IDAA 1HMPA 2H4FA 1ZRHA 3PFFA 4L8FA 4D6YA 3DJYA 2YV1A 1V7ZA 4M3NA 5DJ5A 1QOPB 1QC5A 3DLBA 2QM8A 4MKXA 2Q0SA 1POXA 4OXRA 5FTWA 2XNKA 4JZYA 2H18A 3OQNA 3FVRA 4CTKA 2WTEA 1U0RA 4P9NA 3U4IA 3WSTA 4BQOA 5AVQA 2FFAA 1M5RA 5KCZA 1JHYA 2GB4A 5CUQA 2BZSA 1EGMB 3EGVA 1J0EA 2XVAA 2ZZKA 1ZKMA 2QN1A 4DHEA 4JWKA 1DEHA 3BRWD 3AUKA 3MTAA 1M2WA 3KKKA 4J0FA 3SHWA 3QFHA 1PG5A 2Z5LA 1R0XA 4QUBA 4RPLA 4YK7A 4BRUA 1VSQA 5FWNA 3UN1A 3VKHA 3DHYA 4GGOA 3KL2A 3EVCA 1O95D 3UVEA 4KVGA 3C74A 4K9QA 5DM60 5E4TA 4WOJA 1PKEA 2YXPX 4G09A 4M76B 3TNJA 1U9JA 3LQFA 2VJBA 1SQ0A 5CCEA 4WNYA 2ST1A 2QPLA 8AT1A 2A0UA 2NZ2A 3GD5A 3JWEA 4QJBA 2YHUA 1KJJA 4IILA 1YS9A 4JVSB 4MW2A 3W6UA 4Q3DA 1GQYA 4B46A 4E5YA 2DOKA 4RVHA 4CIVA 4EBFA 4W6ZA 5AT1A 1QF7A 2V03A 1U3UA 1ISHA 3PR2B 1HDGO 4G01B 4YRDA 1SVSA 4EL0A 3S8EA 2Q3JA 1O94C 1ZSNA 3JPWA 1P2DA 1W36B 4BTLA 1DRKA 3FG9A 1ACMA 3O75A 5K8TA 1YR1A 4V0QA 3KLNA 1VJGA 1P1RA 3N2IA 2HB6A 1DIHA 1RWBA 5IJAA 1UL1X 4WA8A 4X3CA 3ZHVA 4B17A 4DPLA 4CKZA 4PNHA 1ZOLA 3VO9A 3OJCA 4RVNA 3W79A 2X8LA 5HTOA 4IS2A 1U98A 3U3KA 4DXDA 3U9SA 1WV0A 3AF5A 4H77A 3UTDA 4EUKA 5B5SA 1H05A 1EQ2A 4D4LA 1WTCA 5A7GA 4GE3A 5A9SB 2P2NA 3R3HA 2HKIA 3BERA 1UWLA 4YP1A 2AMFA 2C4MA 1CDDA 1JHXA 3WQSB 1H1LB 1KETA 1SJ9A 2C57A 4I8DA 4EA9A 4EAQA 2ENWA 1U8TA 1HK7A 1ZESA 1EK1A 1ZH4A 4UJ5A 4D8VA 3B6IA 4L22A 4R8SA 1F48A 5BOVA 4JNCA 2JHGA 3FUTA 2G17A 4EUEA 4FFVA 1RD4A 4B75A 2B7BA 4L0CA 1HH4A 3NHMA 1NLMA 3CBGA 3USES 2QBYA 2I3GA 2BF7A 2HH9A 2Q1TA 2RH8A 2V6IA 2W2MA 4QNMA 2IDJA 5DYTA 1K75A 5BV0A 1US8B 2QX7A 4R31A 3G49A 1DL5A 3T7TA 1M2NA 1DWUA 1XF9A 2L82A 1NW6A 1QVAA 2Q3CA 3G79A 3MIIA 4NE7A 1UBFA 2R6CA 3PUZA 1KJ9A 5EWJB 3RODA 4DMRA 3DDHA 3ZQKA 2GPWA 1DKUA 1PJLA 1M74A 1NYTA 1SK9A 3GMTA 3GG2A 4EQZA 3UATA 4AUNA 4RNDB 1EINA 1IN8A 1NOIA 4LZPA 3WBKA 3CLTC 2WIJA 3DBLA 4RE5A 2ZI7A 2Q4TA 3DTVB 2GI4A 4HNTA 3HXLA 3GFPA 1FB5A 4ZAYA 1BDJA 2XR1A 4MUMA 3VPAA 5JFOA 1H5QA 1ZVVA 2P2GA 1WZCA 2ZTHA 4Q4JA 1L3CA 4OD0A 5AI6A 3H7AA 2XDAA 3OT1A 4N0PA 4BTVA 1BXZA 4UHHA 3VJRA 4QYMA 5KYYB 4IXTA 3TRFA 3BQMB 4CRWB 2VJOA 4N0DA 1P4HA 5DDIP 1XU9A 4BASA 3MT7A 1OI3A 1ECBA 1XB2A 1EH5A 3RKRA 3IMKA 4E51A 3WADA 3ZE1B 3Q98A 2WAOA 3EF3A 2FHSA 1J07A 2RKWA 4XE5A 2YW2A 3TGLA 4G5HA 2V9PA 1E4OA 3Q0TA 2F43B 4L8LA 4LN1A 1B74A 1FXWA 4N18A 4MZXA 2PT7A 2HI0A 1PP4A 1YZQA 4ODIA 3EVTA 1MVOA 3CPSA 4LZLA 4BUZA 1T25A 1F5SA 3G6WA 3I9KA 3RUPA 4DL9A 4WKGA 4HB4A 3TD6A 3RIGA 1TC1A 3G2PA 3GF4A 3SAJA 2G70A 5L3SA 1W0JD 2GPSA 5JAQA 3W34A 2WTBA 3B53X 4RLFA 5LQMA 3U4QA 3CR3C 5JBIA 4CI9A 3FX2A 4M89A 1YNSA 2IYNA 4K46A 1CQWA 2X6QA 2PXAA 3F4BA 4LWPA 5CNMA 2O54A 3GQBB 2IXTA 1YR8A 1OWLA 2I2AA 4MR8B 3KR2A 5IDVA 3QFSA 4AMZA 5BV2P 3BXFA 3BCUA 4R6WA 5FOXA 2HW8A 1HYEA 4X64B 3IQDB 3CRZA 4WACA 2FEPA 3OX4A 2R1UA 4P3OA 4XYBA 4BP3A 1ISIA 1HR0B 3QX3A 5GONB 4EF5A 4W9MC 4RKWA 4LKRA 1TDJA 4OP1A 1UT5A 3PNSA 2V7BA 5MFZA 1CNFA 1NT4A 1FNCA 1WMEA 4Y7DA 3C98A 1U65A 2YS6A 4YREA 1VJRA 4LHSA 5FNZA 1Z0UA 1IOVA 2JIRA 2IV2X 3MZ0A 3B70A 2CEAA 1O9HA 1YRAA 5TE9A 1E32A 3N07A 3EY9A 3GI1A 3UV3A 1NG9A 3B2EA 1AF7A 1Z08A 2X13A 3JD2A 4XIYA 5T6MA 4B6QA 1P1CA 2IEBA 4X1KB 4BB0A 5GJBA 1P61B 2A9OA 3BDIA 3WHLA 5LP1A 1EFUA 2PS3A 4H1HA 3ZY5A 2CV1A 1ONSA 1JR6A 4HDKA 3HA2A 2OXCA 4MUEA 3NDPA 5JYEA 3ER9A 2C04A 4B87A 3T4EA 4Y0VA 4PLFA 3ZLTA 3ISJA 5ADUS 1V25A 5AI0A 1I2CA 4AZ0B 1NFQA 1MVLA 2C1ZA 3B12A 3Q72A 4LXGA 4BDSA 3TN7A 2X5KO 2O2EA 5LQRA 3K0AA 1N1MA 3BMOA 1GQRA 3FPCA 4NMMA 3PFNA 4MQMA 5GTDA 3HDHA 3I45A 4IICA 4Y2YA 5DHFA 5HK8A 5K6RA 5BWBA 3MILA 3MJ4A 3WY9A 4MCJA 2AG1A 4LJ5A 1SZPA 4DQXA 1Z06A 1NGSA 3TL6A 2WHEA 3OCWA 4FOOA 5AYVA 2Q6TA 3EQ7A 2G3YA 1PYOA 3CCBA 3K4QA 4FLFA 3SJUA 1W7AA 1NVTA 3ISVA 2BGWA 1EQUA 3TEMA 5C8DA 5FEMA 3V8PA 2IIPA 4DZRA 1VE7A 1VKZA 1ATZA 1II8A 4YYEA 4JFRA 1UBMS 3OA2A 4YECA 4MDEA 2RGUA 2Z6VA 5JANA 4JI8B 3RFUA 2IPMA 3RS0A 2R0QC 1VIMA 2YFQA 4FYXA 4KO8A 2HK6A 4F1WA 4MMXB 4JYZA 3PPXA 1R5OA 1YGPA 4X54A 4FFBA 3ZTTA 1JSCA 2P1RA 3CKLA 2QEQA 3TBHA 5A0TA 3LT2A 3FI9A 1GPDG 4X7BA 2ECFA 3FCYA 1PGOA 3L3BA 4G1BA 3DH0A 1YA6A 2O07A 1RS0A 4D02A 3GNQA 2GNAA 3GH1A 4RWEA 4E09A 4EX6A 1K8YB 2J32A 2W8BB 5TJ9A 1Q6ZA 4UQLA 3QWBA 4P80A 3ZDFA 2WOJA 3N7UA 1E3DA 10MHA 5JHGB 3D1LA 3NTLA 3W1WA 3CZ5A 1AZLA 1UPBA 5E6RB 1GUAA 1KZHA 3UY4A 1H65A 2I4TA 5AW6A 5J4HA 4LCEA 3SS9X 5LA6A 3KKPA 4GPBA 1IDN1 1U2GC 3MYRA 2BEVB 3NWJA 4PTZA 3UA4A 4NZNA 3WIUA 4WE3A 2EIXA 5C8YA 3E7DA 4BNDA 3WO0A 4I66A 2KSQA 2CVFA 4WZBA 1FSGA 1O0BA 1NMXA 3LQYA 4DYVA 1G9XA 3ZWDA 2PX3A 2JC3A 3LVFO 3QKUA 3UKJA 1EFCA 3FBWA 2Z2XA 1QAQA 2RHJA 1SKUA 4BMVA 5L7WA 1T8WA 4FEEA 4UU0A 5I7AA 4LFAB 3R6LA 3TVYA 4FNAA 1QRAA 1RWKA 2JAUA 1PN3A 5E9JA 4CPDA 3EXIB 1G7RA 4RA6B 2GN9A 1TPZA 1KJQA 2NZYA 2PKEA 3HB1A 4JHLA 2TMDA 2YNMC 1G6Q1 4FJ0A 4HQLA 3TKLA 3L4KA 1KDZA 1G42A 1QZ3A 3DW3X 2J3IA 2NSYA 1V5GA 3HJNA 2H3HA 5ALHA 3U3MA 3B1KA 3JATA 3WGKA 1CR4A 3RNLA 4EW6A 1BS9A 4JDUA 3LNCA 4WK4B 2WM8A 3FSRA 4B79A 1C0IA 2R00A 3DAFA 3HMKA 1NULA 2PGXA 3O73A 2YDXA 1KI6B 2CL0X 2PXXA 2FWBA 4HN9A 3V9AA 2GHIA 4BGEA 5A5GA 3IJEB 2JI4A 1NRIA 1PEKE 1CUGA 1GPAA 2JLAA 5B53A 1W85B 3ZWXA 4OI0A 3EVGA 4ZHQF 1MN6A 1WW2A 5A4AA 3TNDA 4MEBA 1A9OA 4BMDA 1RYHA 3RUFA 2OFOA 3IKJA 4HO1X 1E5VA 5JNSA 1ENYA 1X14A 3E4DA 3W5AA 4PBSA 3DPSA 1Z8NA 3T7JA 1TM2A 2A0WA 2H59A 4E08A 1T2FA 3CKYA 3F5MA 3RVQA 3WRXC 1ZSVA 1F20A 2F9LA 1RQ7A 3E05A 1HDZA 4IIJB 3FLEA 2HO4A 3GRZA 2H1LA 3M81A 4QEKA 4FVTA 1Z6XA 2UDPA 2GJ8A 3FPBA 1E6CA 2E5WA 1CQJA 2X7JA 2Y76A 3LD9A 2H00A 3OCUA 2P2ZA 2GN6A 2QGFA 3QFTA 4IRXA 4LRWA 5E9AA 4ZU1X 3HPQA 3DC7A 5LDGA 3VZBA 3FPLA 3SBOA 5FEUA 1CUVA 2RGEA 3H8SA 1P2GA 5KSZA 1W49A 1LA2A 2IYEA 3PDCA 4QLOA 1QHYA 3B1WA 1IIRA 3SICE 3UJ7A 2QU8A 2JLZA 4INJA 3PWTA 2OCIA 3U1VA 4CUKA 4HRVA 1YRQA 2SBTA 3IDAA 5EJ8A 5EUMA 3QVOA 4AX8A 2YZKA 4C20A 3H1GA 4DTCA 3OTOB 2EW1A 2JIZD 4FWIB 4IIJA 3UAOA 2Q4BA 2GFHA 1JVNA 1EA5A 2YS7A 1HETA 1XGKA 2FUNB 4D82A 4AZ3A 3CRNA 4Y1FA 4LNUA 1FQOA 5DNCA 2PJZA 1R15A 1YB7A 2HJWA 4HZUB 3KLPX 1P1HA 3ZGOA 3BIFA 1TJNA 1FRFS 4CKBB 4RZQA 4ITVA 1MFPA 1W4RA 4WVLA 2IP1A 3EPPA 3SJCA 2CXPA 4JT4A 4QKQA 1VMDA 4FGJA 2A94A 3LCJA 4QXAA 3E27A 4PSKA 1JG7A 1ZH2A 2HJRA 4N8EA 3ZWBA 3K16A 1KI6A 4P31A 3NM4A 4H9GA 5SZHB 3IRVA 1KJ8A 1MR3F 2GXUA 1V11B 4ZXFA 4B5KA 3GCWA 4AW9A 5IS2A 1HRDA 4DVGA 1Y7LA 5JAZA 2J9XB 3EZ6A 1GCGA 3HU2A 3O03A 4TMYA 5IUJC 1JQEA 3QI2A 3KZCA 3LBFA 4WCFC 1ESDA 2FGJA 4RV4A 5F3RA 2PMCA 4FDMA 3VR2A 3TCKA 3H5LA 4FP9A 4J0QA 1FE8A 2F1IA 4DEVA 1RZRD 4AJPA 4S1NA 2CFTA 3DZHA 1N2BA 3FOZA 3I37X 2GN4A 1K9SA 5HJ2A 3LVQE 4V3CA 4RPGA 3SC2B 1ORIA 4YUZA 4HSGA 2WIDA 1DJOA 1U1GA 3WI7A 4TRMA 5IAAA 1TEZA 3U4CA 4I8IA 3KPWA 2V65A 5JZMA 2YN4A 1HE4A 4LVCA 1L1RA 2GZMA 4TTTS 3SF8A 1QS0A 2GERA 4WNCA 2FPLA 4XYLA 1KEEB 3BTVA 2FK8A 3ESYA 3G8CA 3IT0A 4QDTA 5BSUA 1RXEA 3ZKWB 5BOSB 3MSXA 1FTWA 5E6RA 4JT9A 4I50F 4O0LA 2OTCA 3FUXA 4P7KA 1ZIDA 6PFKA 5IFLA 3GC6A 3ORHA 1WDMA 5I7EA 2WICA 2GK7A 5FORA 3S2FA 2YVLA 4KH0A 4KWEA 2LZ0A 1M1YE 3ZKAA 4Z7JA 1VJ5A 4GM4A 4A03A 3I01A 2RGWA 4AG6A 1ZJJA 1WXWA 1NY6A 1JQ3A 3GMSA 3WOHA 2PUCA 1FZTA 1DCTA 3P5SA 1ZCAA 4B73A 1BC5A 2IYWA 1ODCA 3AHGA 4JWTA 2BE7A 3R5XA 2FN8A 3EIWA 4DHWA 3H0EA 3NIGB 5TF4A 4P0TA 1WBBA 4IEFB 5G1NA 4TKUA 4LV8B 3F6BX 3PHHA 5B36A 1ISFA 4JGGA 5K3DA 1QB7A 5LM3A 1ISGA 1MHPA 2IZZA 4MSUA 1A72A 6YASA 2B8WA 1XMOB 1E2LA 1D2CA 1PE0A 2JJYA 2Y1KA 4MW5A 4R9RA 4WFJA 4EKEA 1HDEA 3B51X 5D5QA 4AY2A 5CFNA 4EHBA 3AP2A 1KY2A 1C41A 2O8BB 1KK2A 1XEFA 4JEIA 2EGHA 4S24A 3QXXA 8ADHA 5A2GA 4GW3A 2IJGX 4B3BA 1RPZA 2VN8A 3PFGA 2JIPA 2SICE 3HR8A 4J1TC 5CBPA 4C4ZA 3TAUA 2V3VA 1OZ0A 1ESNA 4KAAA 1B0ZA 4DPKA 3JZDA 2ODBA 1WB4A 3V1NA 1LI7A 1WUYA 2EERA 4E14A 4EMTA 4Q05A 2XUHA 1Q2UA 3BGVA 1DDOA 1PR3A 2G0AA 4PBRA 1P9NA 1NBWB 2PANA 1SG6A 3CJQA 3EVEA 1YIOA 2VJMA 5IAJA 3ZWOA 4G24A 2HYDA 2IHYA 4V0RA 2V3CC 2CWWA 3DKRA 4LHZA 2V1UA 2H6EA 4PQEA 2BCJQ 4N41A 2A84A 3QGMA 2ZBQA 4KIFA 1GGFA 2QJTA 2DKFA 4BBPA 3AP1A 4KZPA 1M9NA 2JEOA 5F5XA 3AR8A 2V8BA 1PGNA 4PLGA 5HTKA 5JNLA 2GCPA 4N5HX 4ZVPA 3KOWA 3SNHA 1ZVKA 4R2JA 4GKJB 2MR5A 3HN7A 1A8QA 4HXFB 1C0LA 1M5UA 4NBVA 2H65A 3ABSB 1R6VA 5JE8A 2D0DA 4YMLA 1YL7A 5AMXA 1JIIA 1GKUB 2NVUA 3E9NA 5F12A 4NCNA 4B2LA 3RIMA 5DBEX 3MM4A 5DO9A 4CWAA 1DIGA 5C5IA 4B7ZA 2GN1A 4IGEA 4LRYA 4LHEA 4JV5B 1VHLA 1Y5LA 3DR5A 4R54A 4EW2A 4EVIA 1AXGA 5IKEA 1AZSC 5B57C 1B8OA 2BM8A 3A0UA 4KO2S 5JJBA 3INNA 4BP9A 1O6FA 4TN1A 2CWDA 4LNHA 1AN9A 4NLLA 5CFZA 3L7BA 4G56A 1G3MA 2NPFA 3CXUA 4YAIA 2O8DB 2HNBA 2A2ZA 5TMEA 3ITKA 4JD5A 1C14A 2J0UA 2ZIGA 1DBRA 4YGXB 2PX6A 4YI5A 4BE9A 3LWBA 3PCTA 4QSHA 1VJCA 4YYZA 2WNHA 1M76A 4HNAA 2A14A 3UAWA 2ZYHA 4EFKA 2GBFA 3MTIA 3R09A 2F55A 2DPLA 1MB3A 3LLSA 5HRAA 1RIFA 4OVKA 1KRHA 1WVIA 2IPAB 2Z2IA 4UE6A 4I36A 5LBTA 1FYEA 3MD9A 3E1KA 3W5JA 4N5LA 1PR0A 1WMFA 5HKOA 2E0IA 1D0IA 4HMQA 1R8XA 4I6GA 1Z37A 5J5CA 1DBWA 1Q1GA 1RVDA 1U9CA 1XNGA 2P6PA 2HPHA 5F1KA 5KJCA 2MDTA 1OX6A 4YAEA 2R5NA 4HLQB 2MMGA 2VAPA 4BO1A 3Q7EA 2V96A 4DR1B 4K9NA 1F8FA 1G20B 1RI5A 1UZNA 2XCQA 3CLSD 4P58A 3FMVA 5DHTA 4CQMD 5G4LA 3ICOA 3PJFA 5CFQA 3WMWA 1LQUA 2QGZA 3K1JA 2Z08A 2GKSA 2YN2A 4QAJA 2FSPA 2QMZA 4FDVA 7GPBA 3ECCA 5CCBA 1V1MB 5KC9A 3BD9A 2AOVA 3OICA 1DAEA 3U61B 3EB9A 1ZH6A 4GQIA 4B3TB 4TSRA 2CVHA 1VJTA 1FJ2A 3W3ZB 5LQNA 1JPVA 1I8TA 5CFLA 2DSNA 4Y2JA 4U7FA 2FP3A 1CJVC 2IY7A 4ATNA 4B3MB 1XR3A 2VDRB 3S8YA 3RYIB 5AJUA 4YJHB 1GNPA 2V0CA 3FCEA 3GFGA 1MJ5A 2RHWA 2V7VA 4MRAA 3SR3A 1ECCA 2B92A 5F76A 1N5OX 1L8LA 1OX4A 1DBQA 1VL8A 1MOSA 2C5SA 4QUDA 2WZDA 4E5SA 3GQVA 3FVTA 3G0BA 3R3SA 2G88A 3NAMA 2CB9A 4JDPA 3TSZA 5HCUA 3G88A 3OFND 5ILOA 1XRMA 2VAVA 1PNOA 2ZZMA 4RD2A 2LCIA 1GNVA 3EEYA 3CF4G 3ZIAA 1JL3A 3T06B 1A5SB 4B1FA 4DRXA 4OCZA 3IPYA 3WZMA 1ANKA 3OM9A 4GXTA 4KZKA 5I7SA 1UK8A 4GRDA 4D0NA 2GAIA 3RREA 2Y0BA 4K9RA 4KQ1A 1C3OA 3WGGA 5ADHA 5ELXA 1F5NA 2OG1A 4BMCA 2IEGA 3IOEA 1OLSB 3KSMA 4S0ZA 5KHAA 3HFGA 3ODGA 4L2IA 3VJMA 2OC9A 4LBZA 2FSHA 4QFDA 3SHQA 5AW3A 2BUCA 1ZICA 2KBEA 5J23A 4PX2A 3K35A 2OV6A 3FMPB 2VAXA 3B6EA 4D74A 4DGQA 4PF1A 2PMEA 1TVKA 1J8MF 1PJ2A 4ES6A 3RJZA 2BC9A 3QK7A 3TLKA 2ZUWA 4HDNA 2XKJE 2VDUE 5J1SB 3ZJVA 1TYEB 2R5WA 1Z13A 4EUSA 4NSNA 3VH1A 3IBSA 2PRIA 2OZPA 3UMMA 3U0VA 4IYRA 3HKCB 3PC8A 2D00A 3T3DA 2OWEA 4BFCA 1OI4A 1JIJA 2Y8EA 2IYFA 1TU0A 5FWXA 2NMVA 1PJ8A 2OD9A 4D0GA 1BX3A 2QN2A 1DZIA 1FMJA 5L9AA 2PX4A 3ZWAA 4UEWA 1RXVA 5FNVA 1FJHA 3EXG1 3L4SO 3L79A 1DAGA 1WIWA 4IFTA 4Q6BA 1SUPA 1E7YA 1OTXA 3SSNA 3PT5A 1LPSA 5DOZA 4YUXA 3GX1A 3ZWKA 2RKBA 1OFIA 2UYYA 1DTSA 1W94A 2VPTA 2XBMA 1LDYA 2Z9DA 3BPSA 4IXDA 4MGZR 3A06A 1M2GA 4PAQA 4XASA 4ZYWA 2JCSA 1XDWA 2PKXA 5GZ1A 5IU6A 3H6HA 5F21A 1ADFA 2FRDA 2JAQA 2RHDA 1JBKA 2ARKA 4UC0A 4YAUA 4C2UA 2ZRQA 2ERYA 5C1DA 2F2TA 4QM6A 4FYIA 3X1JA 3IP3A 1FFGA 5HEKA 1YRWA 4FGKA 4X61A 5LC1A 2EVWX 1YDFA 4FQ7A 3DLHA 1Z39A 4LTMA 2PGLA 4NV3A 4C21A 4AY6A 2JPDA 2QDXA 2F7SA 2PWZA 1WCWA 2BGKA 2QRPA 5L3ZA 4RTKA 3JQ8A 1JI3A 4YT4A 4ZVUA 1RYMA 5T3UA 1H4QA 1KO1A 1EFRD 4JIGA 4H6WA 4KU4A 4K9SA 4LK2A 5KAMA 4F96A 2XMQA 5KOYA 4ZYVA 1VL1A 1M2VB 2DQZA 2H85A 2Y6VA 3A11A 1N8TA 2X5JO 3OPYI 1RZ3A 2W2QA 2AG8A 3SZMA 3MYYA 1II9A 4NAVA 3HLTA 2P65A 1XRPA 1XRJA 3HO6A 1ML3A 4PO3X 1Y8CA 5DYYA 5IT0A 1CS0B 5DP1A 4DCVA 4Z0PA 2JFGA 1HX7A 1V7PC 1AGYA 1G55A 1ZNZA 3MAGA 2YWXA 3DBHB 3H19A 3ZIDA 1XZKA 4X00A 1PV2A 3TG8A 5CD9A 3OLYA 2XXAA 4G5SA 2W48A 3RFTA 1GGMA 1ZD2P 2Q2WA 3Q2KA 4KV7A 4HT3B 1FFAA 3IYLW 4MARA 3ILSA 5F9MA 1ZGJA 2OECA 3JQDA 5HSGA 5KWVA 4PC2A 5AW4A 1B76A 1KAQA 2CB0A 2A3RA 3L04A 2W90A 4DCJA 4DCTA 2G1KA 3DOIA 1P2VA 1QHNA 3COYA 2VRCA 3JYQA 4KO4S 1X7WB 5DZSA 2QRLA 2JGEA 2Y1DA 5KQPA 4AKSA 3FWPA 2IU0A 3H99A 4FGSA 2RAVA 3NTQA 4HPWA 3CUYA 4OHCA 4F5DA 1V2HE 5CYOA 1F6DA 4ENVA 4KRFA 3DDOA 1XDDA 4UU7A 3FDZB 5LWQA 2AOWA 2GHTA 4FT2A 2VA9A 1Y1PA 3QE2A 1V3TA 1CZHA 1PV4A 1EUYA 2KLBA 2V74B 1BWPA 4IW3B 5DBHX 1FDWA 5CBKA 1Z29A 3HXPA 1P2SA 4JEHA 1EXMA 1UXGA 1UAYA 2E7ZA 3TSYA 3CZMA 1E79D 3G1WA 2C5GA 1P9RA 2JGLA 1IY9A 2UYCA 2C0QA 3MJHA 4M8LA 4MYTA 2P2CA 3ADPA 4FGWA 4IOJA 3UB3A 1XP8A 4ZT2A 4L51A 1AVTA 3AUYA 3H5NA 3PFHA 4NV1A 1IXSB 4P3XA 2BZ1A 4NARA 3A1SA 1DHRA 1D9ZA 4LDPA 3ZU4A 4EAAA 4KI7A 1R0CA 3K6KA 4R01A 1E0AA 3W4KA 1Y3HA 4CLOB 4G86A 3VU8A 1E94E 1PHPA 1Z5WA 4QGFA 5BVHB 2PMKA 2ZB3A 1UOOA 4KREA 2FZEA 4RMJA 2WWIA 3FCXA 2AMJA 4IMIB 2FA9A 1LVUA 1KEKA 3PRHA 2EGGA 5FV4A 5K0ZA 4D7AA 2VTKA 4NZYA 4PX3A 4X7MA 3DBVO 3DS8A 3LT5A 2FY8A 4H7JA 2ZM6B 2WRZA 1GUDA 1HFEL 1XVIA 2FJ0A 1N6PA 4A8PA 1L4GA 5JVDF 1UH5A 1E5LA 1LD3A 4I9FA 3MTEA 5D00A 1C0EA 1NVGA 1GPWB 1H3EA 2R6AA 2EU8A 4IS3A 5E7IA 1KH1A 1QKIA 2KX7A 1MG0A 3L93A 4UVHA 1DRJA 1DINA 2W37A 1H2ZA 3SSAA 4RDIA 1XPOA 3NIDB 2Q1WA 1E7SA 3UBTA 2PCJA 2HU8A 3G1TA 3L8FA 4CN8A 3OWXA 4HWSA 2I1LA 3WLEA 4C07A 3P4UA 3M70A 2FF7A 4RSGA 1X0XA 2V8OA 3FOAA 4YP0A 4BMYA 1U8CB 3R6DA 3AF6A 2QAGB 1T1GA 3JVEA 1AHIA 3KR9A 3IV9A 3RT1A 4E70A 1ENPA 2FP4B 3CRW1 4MVJA 3STHA 5DNYB 1MNAA 2EFHB 3GFRA 1SULA 1X3LA 1WKBA 2WIKA 1UXJA 4C7VA 4BMPB 5C7IO 1DQNA 1W2GA 1HLGA 3IVAA 4CG3A 4P8RA 1SHKA 3R7WB 2ZWIA 5F51A 4CF5A 1J39A 3DMPA 2BF4A 4N39A 4DBVO 2AN4A 3EVFA 1N6HA 2DBQA 2QI9C 5FFMA 1MJNA 1MRZA 1P7CA 1L8OA 3IDZA 4PGAA 4RJLA 5CK5A 5CPFA 4RTPA 4BAZA 4NYJQ 3RYIA 5ALPA 3U4MA 4XR4A 1T3SA 3PPYA 3DD5A 1EHYA 3HKEB 4P5PA 1HYGA 1PZGA 1W4BA 2HRQA 5M3BA 2P2LA 4KE9A 3U60B 2Z1NA 4FPXA 2ZRNA 1YH3A 3RSZA 1OLXB 1J8DA 3S5UA 5HG0A 1KEUA 2HY7A 3ROTA 1H8HD 3W9BA 1S7CA 3K9FC 1I7PA 3GLQA 4Q1VA 4ZCTA 1G291 3JZMA 3KQOA 4FS8A 3TH5A 3WGZA 2Q6OA 4PQYA 4YUYA 5KQSA 4XLTA 1V7CA 2X77A 1NQWA 3ONWA 4DQLA 3BE5A 2QE6A 6NULA 1YTUA 3LY9A 2NZJA 3O82A 4YRLA 1VKRA 3ICCA 3Q3EA 1SVLA 4HJXA 2RHMA 4HDQB 2OB1A 1CUJA 1RQNA 5ED0A 2HRZA 4LXXA 2J3QA 1WUIS 1DFHA 3FLMA 4FUTA 1RHQA 4JX9A 3WHIA 2IYLD 1Z25A 3A6KA 3G17A 2FLWA 2Q9AA 3QXHA 4N3NA 4R81A 4LZZA 4ARZB 3RUAA 3HNOA 4HI0E 2IIQA 3C7DB 2J6HA 3CXRA 1JR2A 1ZOIA 2A0KA 3FOBA 4MIKA 3E58A 3NHWA 5M2QA 3NYWA 2XJ9A 3THWA 4KIWA 4LBVA 1CQPA 1IWPB 1QLWA 1OYOA 2RCNA 4FHFA 5FOWA 1EK0A 1QH8A 5JXWA 4J3FA 1L5ZA 1FYDA 1PEYA 1KO5A 4G37A 4WL0A 4JI6B 3ELUA 4CI0B 1QHHA 3EOBI 4RIHA 5ALJA 4LY6A 4C2BA 4EKDA 2IHVA 1I1OA 4MOWA 1I4WA 3W5HA 3MGAA 4DDKA 2BI7A 1Q7BA 1XU4A 2YZNA 4G0UA 4ARZA 3I2JA 2DHDA 3I39X 1ZK4A 4MZDA 1PSWA 3P9NA 4II3A 2B1GA 4U6SA 3ZLBA 4EBBA 1NPTO 2BFEA 3NKVA 3IAS1 5I9IA 3JZAA 4EOGA 1IMOA 3II6X 2BZGA 4MV1A 4PVCA 2NYAA 1W5AA 4UHDA 1ACLA 1Y4UA 1AUXA 1TTPB 2WWFA 4EGQA 5A4JA 1ADBA 3EIEA 3L7CA 4R98A 4NZ9A 5T57A 2A59A 1UMDB 1DTWA 1RM5A 1SQFA 2BELA 2AV6A 4RHCA 3UENA 1N8KA 4FTWA 4Q1CA 5IVDA 2E82A 1M6YA 1MAHA 1PK7A 1LFAA 4OAQA 2DWOA 4GL2A 2PGDA 2UYOA 3LUJA 3PTZA 3X2EA 2I66A 4OB6A 1OREA 1ELOA 4BLVA 1OZHA 1W75A 2Q5JA 4GO1A 3SEAA 2CHUA 1GVNB 3KAKA 2IYZA 1OLXA 4S12A 1RQ2A 3K94A 4XKJA 3RK4A 4Q1EA 1QTQA 2O48X 2RGNA 1CYEA 4RH0A 3MMZA 2IXBA 1W36D 1JHUA 2A4KA 3RAJA 2C2MA 5F1PA 4LY9A 1H9CA 3CV3A 3K73O 1T34A 4GLOA 3QMVA 5J4YA