3CC8A

Crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
211
structure length
211
Chain Sequence
AVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVSHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of putative methyltransferase from NDP-N-methyl-L-glucosamine biosynthetic pathway (NP_977653.1) from Bacillus cereus ATCC 10987 at 1.64 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 63
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3cc8A00
3IHTA 2XYRA 4PGGA 5BW5A 5CVJA 2VZ9A 4LWPA 2YXLA 4GOMD 2PJDA 4OQDA 2PBFA 4RTOA 3B3FA 3CJQA 1NBIA 4F85A 1XJ5A 2ZVJA 8MHTA 3MERA 4RVDA 4R05A 3BKWA 3VC2A 4ER6A 1TW3A 3LDFA 4RV9A 5D1HA 1SQGA 2P3QA 2FPOA 3PB3A 3KPVA 2AOUB 4HGZA 2UZ4A 2GLUA 5HIJA 1JG1A 2NXEA 2OO3A 3EVCA 1VPTA 4RTRA 5EC8A 1RI2A 2OB2A 5F2OA 5FA8A 5GIOE 5C0OE 3UJ9A 2O06A 2UYCA 2ZIGA 5HOQA 3F4KA 2E5WA 4CTJA 4GOND 3BWYA 3LGAA 1KR5A 3LX6A 4EKIA 1WY7A 2ERCA 2BM9A 5CM2Z 2C7RA 3M33A 2GH1A 2R3SA 4YMGA 2O07A 2PVCA 4OA5A 4WXHA 3KPWA 3M6XA 3REOA 1G8AA 3SX0A 3PLAE 4P7JA 1P39A 3BZBA 2KW5A 3OPNA 4R6XA 3P8ZA 3LCVB 3A27A 2YR0A 5FULA 5DX1A 3NDJA 1G6Q1 2XYVA 2VDWA 1JQ3A 1EIZA 2YUIA 2ZCJA 4HC4A 5EQJB 3I5UA 5EIFA 2PXAA 4CXMA 4PWYA 4HH4A 5ICCA 2AOTA 4FZVA 4YMHA 4E2WA 1O9HA 1ZKDA 3ER9A 4EK9A 1QANA 3AXTA 3C6MA 5EHIA 3AXSA 4R6WA 4A6DA 2NP6A 2P3LA 1ZGAA 4KVZA 4CKEA 5GINE 2PWPA 1FJXA 4LWOA 1P1BA 2OXTA 2QRVB 2H00A 3DXZA 5HIMA 2IH2A 3PTAA 3P71T 1HMYA 2BZGA 3UJ8A 4C04A 4HSGA 4PYQA 2AN3A 2AN5A 4C06A 4RTMA 4QVKA 1RJDA 3OFKA 2XVAA 3BWBA 3LDGA 2Y1WA 3BGDA 4RVHA 3SR4A 1L3IA 3R6TA 3OZRA 4HG2A 2YXDA 1L9KA 3HM2A 1N7JA 3EVBA 3THRA 4F84A 2C7QA 1T43A 1RJEA 1UFKA 5T67A 3GRYA 3G2PA 3RIEA 3KPUA 2BR5A 3ELYA 3M6UA 4YV2A 3GO4A 3K6RA 3T7RA 4DMGA 1NW3A 5IKMA 2OBFA 3LKDA 3MCTA 2P7HA 3EGVA 1OR8A 2GAFA 3DLIA 3Q7EA 5FHQA 3MQ2A 3VC1A 5LSAA 3P2KA 1D2CA 3K0BA 4QTUB 3I53A 4V0RA 3FYCA 3DTNA 3KR1A 4PYOA 2G8NA 3DLCA 3QV2A 4M38A 1V39A 5BP7A 3O4FA 4BP1A 5HFJA 3SXJA 1RI3A 4AZWA 1NW7A 2PT6A 3M6WA 2Z6QA 3U81A 2FRXA 1YZ3A 4AUKA 4ER5A 4RTQA 1YZHA 3MAGA 1G55A 3LSTA 4U7TB 5HILA 1XCLA 4GOOD 4MTLA 3FUTA 3CJRA 5DWQA 4WVLA 1NW5A 3KQWA 4HGYA 2C7PA 5EZQA 3UJ6A 5DSTA 2ZBPA 3UA4A 4G56A 4KDCA 2BH2A 3B5IA 3FTEA 1IY9A 3KR2A 3NW9A 3HCBA 5DRYA 2OKCA 5EMLA 3FTCA 1VIDA 3RODA 3GU3A 5H02A 1UIRA 2ESRA 2QM3A 5CUQA 2ZLBA 3DOUA 3KR9A 2EFJA 2QYOA 3R3HA 5LQNA 3D2LA 2QE6A 1FBNA 3PX3A 2IH4A 3ELUA 5GIPE 3SM3A 1FP2A 2CKDA 4IV8A 4QTTB 4PYIA 4FP9A 5CVDA 4BLWA 1AV6A 5HEKA 5K0GA 3LPMA 3MCZA 3P9IA 3FPGA 3TOSA 4RTLA 5K05A 3HEMA 1UWVA 5C9ZA 10MHA 4CKCA 1R8YA 5DTMA 2YXEA 3ME5A 2YX1A 2I62A 2CMHA 4KWCA 2PV0A 3BWMA 3GRZA 4CKBA 3HTXA 1DL5A 2R6ZA 3HCAA 5EKXA 1VQ1A 1PJZA 4RTNA 2IIPA 4QQKA 3FTFA 1U2ZA 3LL7A 2ZIFA 3JWHA 3EVAA 1INLA 2IBSA 3PT9A 2ZBQA 3FPJA 1FP1D 4IWNA 2AOUA 3LECA 2HV9A 3HA5A 2G70A 4EQZA 4RTKA 1L3BA 3MB5A 3O7WA 5EVJA 3GDHA 4FGZA 2P8JA 1SUIA 5FADA 3VSEA 5K0FA 2EJTA 2ZULA 5LQKA 2UYHA 5CD1A 2ZW9A 1Z3CA 5U4XA 3LHDA 5K03A 2ORED 2XBMA 2FCAA 3C0KA 2LD4A 3DULA 2AVDA 3GIWA 4PYNA 3R0QA 3BKXA 5FA5A 3TPZA 2FHPA 2JHAA 3A4TA 3PFGA 2IDJA 4P7FA 2B78A 4BLUA 2NXNA 3HCDA 3KPJA 3NVKI 3FPEA 1F38A 2PT9A 3P2IA 2B9EA 2OZVA 3SMQA 1KHHA 1P91A 5GP1A 3KQQA 3G2QA 5EMKA 1RI1A 3G8BA 4M7RA 1VP3A 3G88A 3GRUA 4A6EA 4C07A 4ER3A 3IEIA 4UOEA 3HP7A 5K01A 1L3CA 3LCCA 5F2NA 2P7IA 4FT4A 2JJQA 3G5TA 5EHGA 5CCXA 2ZZMA 3PS9A 5K0LA 4YV0A 2VP3A 4PIPA 5DX0A 1KPIA 4PNEA 4QPPA 2DPMA 3B3JA 3PX2A 4RVFA 4M37A 4CWAA 4E70A 4P7KA 1KPHA 2CL5A 4H0NA 3P97A 5HZMA 2G71A 5DM2A 5B1SA 1TW2A 2GPYA 3E7PA 4GC9A 3SGLA 2HWKA 4GUAA 5ICEA 5DXAA 3C3PA 1Y8CA 2I9KA 2GB4A 2G72A 4PCLA 2AOXA 2C7OA 5EMJA 5K0EA 2NYUA 3FUWA 2UYQA 4OBXA 5DPMA 3ELWA 4JXJA 4X63A 3MGGA 3HVIA 2PXXA 3GJYA 2IFTA 4RTPA 4KIGA 3QOXA 5C1IA 1KPGA 5FQOA 5LR6A 4LG1A 5FWDA 4ER7A 3KQOA 2AR0A 4YUVA 3MTEA 1QAQA 4ER0A 3KU1A 3EMDA 5K8VA 1R6AA 5E8RA 3B89A 2YQZA 4QDJA 3AJDA 3CGGA 5EIWA 1JTEA 3OE4A 4RYLA 2ZIEA 1R00A 1KYWA 1NV9A 3GNLA 5CVUA 2FK7A 2ZSUA 1EJ0A 1JR4A 1O54A 1D2HA 2AOTB 3H2BA 5DTRA 3RW9A 2EG5A 3UWPA 5KYGA 1VLMA 2ZBRA 4HTFA 3UBTA 3DH0A 1ORIA 3TQSA 3OZTA 3UFBA 1KXZA 4QPNA 3KPYA 2O0LA 1BKYA 1ORHA 2HNKA 5DTQA 1HNNA 3ELDA 3KQPA 5ERGB 4C4AA 3HVJA 3NJRA 4YUYA 1G38A 4DF3A 1I9GA 4X61A 2P3OA 4IV0A 2I6GA 3LDUA 1JQEA 2ZTHA 4POOA 3FUVA 5LQAA 4EMSA 5E2AA 3E23A 1IXKA 3G89A 2DULA 3BGIA 5T64A 3NTVA 4PYMA 2P40A 3TM4A 3A25A 1YFJA 3P9NA 3V8VA 3DMHA 2H11A 3GGDA 5G02A 1R18A 4AZVA 3ANXA 3GWZA 4U7PB 3FRIA 3I9FA 2AS0A 4DZRA 3BT7A 2Z6AA 3DXYA 4FSXA 4FR0A 3KQTA 3UJBA 3T7SA 4ATNA 2VDUE 1NV8A 3EVGA 5KS2A 4R8RA 4XCXA 3DMGA 3NMUF 3PFHA 5BW4A 3AY0A 4GOLD 5P8WA 1G60A 1VL5A 3EEOA 1YUBA 1Q0TA 4DKJA 3SVZA 5CCBA 3PVCA 4RVGA 5E9WA 2FYTA 2WK1A 5K09A 2XVMA 2PKWA 1N7IA 4MWZA 3KQMA 4P58A 4PCAA 2Z6UA 4Z2YA 4PIMA 3FZGA 3DP7A 3G2MA 2GS9A 2ZWVA 1FPQA 3GXOA 1IM8A 4GBED 5EPEA 5FTWA 3WSTA 1EG2A 4AZSA 2FK8A 1SQFA 5DXJA 5KQRA 1ZHFA 1YF3A 5DX8A 5JR3A 1EJ6A 2IBTA 5D1NA 3EGIA 5GWXA 1QAMA 5F2KA 2EJUA 5DM1A 5LQCA 4RTJA 5M5BA 4C05A 2PY6A 5MHTA 4Y30A 5E1BA 5EEHA 5EOVA 1XDZA 4PYKA 4V0QA 5DM4A 1N2XA 3IYLW 4OA8A 4ISCA 3LBYA 2Q41A 1QYRA 2IP2A 2PGXA 3S68A 3TR6A 3MTIA 2K4MA 3FUXA 3L8DA 3O31A 3JWJA 1RJGA 2A14A 3I64A 5FQNA 5CIYA 1BHJA 3FYDA 4PYLA 3C6KA 2XYQA 4C03A 5ICGA 2YVLA 4X1OA 3TKYA 2JHCA 3EEYA 1H1DA 1RJFA 3E8SA 3HNRA 3OU6A 4K6MA 3EVEA 1JG2A 3GRVA 5K0NA 3KQVA 3C3YA 4KDRA 2IDKA 1SUSA 3FRHA 4KRGA 4E2YA 3KQSA 2JG3A 4LECA 3OCJA 2QY6A 5EMMA 2OPBA 1SVUA 3TLJA 1WXWA 1DCTA 3M70A 2H1RA 2PX4A 1BOOA 3EMBA 5EKUA 1O9GA 4GF5A 1EQAA 3QOWA 4DQ0A 4BY9E 2B3TA 4E2XA 1X19A 2WA2A 2VDVE 5BXYA 2PX2A 2AZTA 3CKKA 3CVOA 4E30A 5GM1A 2V74B 3UJCA 2IH5A 3P9KA 1WG8A 4OBWA 3NDIA 1KYZA 1Q0SA 3DMFA 4P7GA 4MIKA 3HA3A 3UZUA 1NW6A 5ICFA 3DR5A 4AZTA 3EVZA 2F8LA 3OFJA 3ER8A 2ONZA 4RX1A 1NE2A 1AQJA 2O05A 2QRVA 3BXOA 1D2GA 1KP9A 2OB1A 4XUDA 2PX5A 1R8XA 1ZG3A 5GM2A 3V97A 2ZZNA 4BP3A 4RSRA 2HMYB 4E32A 2IPXA 3HCCA 3G2OA 3ID6C 3HCEA 4DCGA 4OX9Y 4RTSA 2AOWA 2IGTA 4QVGA 3P9CA 4RWZA 3FTDA 3R24A 5HIKA 2V7EA 1XDSA 2ZFUA 3B3GA 3CBGA 3CCFA 5HIIA 3UJDA 1YB2A 4B17A 2VS1A 1NT2A 2ONYA 3KQYA 3M6VA 2O57A 1RI5A 5K0CA 1G8SA 4PONA 4X60A 1X1CA 3T7TA 2PXCA 1I4WA 2WA1A 5DM0A 4YUXA 4E2ZA 3NVMB 1JG3A 1PRYA 3KKZA 4C08A 4M36A 1B42A 3BWCA 1I1NA 3FUUA 4QDKA 1JSXA 3DXXA 1XXLA 3GRRA 4L7VA 5DSXA 5DT2A 2NNWB 2P41A 3HCFA 3CC8A 3Q87B 4PINA 3UJAA 4E31A 3UA3A 2G1PA 1NBHA 5K0BA 5FUBA 1JTFA 3JWGA 2ZWAA 3JWIA 3MHTA 3AWIA 2P1DA 4EKGA 2PLWA 4XUCA 4PYJA 1P1CA 3R9XB 2AVNA 3FPHA 5FCDA 1XVAA 3HA7A 2YTZA 1L1EA 9MHTA 3IV6A 4HRAA 2JHPA 5KQSA 3TRKA 5LQUA 4OQEA 2JH9A 2OYRA 4FT2A 1R74A 2BR4A 4YUZA 1KIAA 4PGHA 2P35A 3G8AA 1X1BA 1WXXA 5FWAA 3E05A 3OZSA 1X1AA 1EAMA 4DM3A 1M6YA 5GOZA 5DRTA 3SSMA 3TM5A 2AN4A 1VE3A 3A7EA 3EVDA 4KW7A 2PSSA 3NWEA 5T6BA 3EVFA 3OU2A 3T0IA 2Y1XA 3LKZA 4GC5A 5LQJA 3TKAA 4Y2HA 7MHTA 1WZNA 3EGEA 3M4XA 4HTFB 1MHTA 2NXJA 3BUSA 3NWBA 4F86A 3HVKA 1JG4A 4KIFA 3TMAA 5CVEA 1QZZA 5FHRA 2NXCA 1NKVA 5EG5A 1M6EX 1JSZA 4X41A 3ORHA 4EVIA 2CMGA 2JH8A 1MJFA 1ZGJA 3A7DA 3EPPA 3SSNA 3SSOA 3THSA 2I7CA 3VYWA 5E1MA 5CVVA 3FPFA 3KR0A 5E1OA 3TFWA 5E2BA 5LQRA 2ADMA 3CJTA 3G5LA 5IH3A 4YUWA 4CTKA 3DUWA 2CWWA 3KHKA 1SKMA 2UYOA 2HR1A 1TPYA 1AQIA 5K0JA 4DA4A 4GEKA 1QAOA 1YFLA 1VBFA 2HTEA 2ZZKA 1DUSA 3HVHA 2B25A 1M0EA 3G7UA 3OE5A 5EGSA 1X1DA 2AOVA 1WS6A 2GA9A 3I58A 4IKPA 5EZSA 4E33A 2N47A 2EX4A 5EEGA 5E8JA 3A26A 1XCJA 2BM8A 4YV1A 1SG9A 5DLYA 2PX8A 1AF7A 4ZTBA 5KVAA 2OY0A 1JQDA 3B7PA 3LCUA 3X0DA 2NP7A 4AX8A 1XTPA 5E9JA 1VP9A 3LBFA 4FSDA 4BLVA 1F3LA 4QQNA 2BR3A 2PWYA 3ERCA 1NW8A 3OU7A 4XUEA 1XDUA 3GCZA 3P2EA 4GQBA 1RI4A 4MQ4A 5JUWA 3BGVA 4MHTA 4FS8A 1BC5A 5E1DA 4O29A 3UJ7A 4DCMA 4R8SA 4NECA 1ZQ9A 2B2CA 5E9QA
chains in the Genus database with same CATH superfamily
3GJ0A 3CS3A 1IEVA 1ZK4A 3ZCRA 4Q7EA 3PGKA 4PPNA 5GJWC 2A6PA 1C4XA 4AULA 5JFOA 1MC5A 2G7ZA 5DGIA 1TT5A 2ZYSA 5HA5A 4Q1FA 1G20B 2VL7A 2YDYA 3C3BA 3UAOA 4F85A 3K71B 4QNRA 1YC2A 1XO1A 2PMDA 3H04A 4M49A 2JLSA 2XQFA 1HLDA 1WO8A 2PL1A 4G1CA 4MGZR 1TW3A 3UCFA 4EENA 3IP3A 3MJCA 2P3QA 3S99A 1O97C 3AU9A 4IMRA 1RHUA 3G6WA 4E1AA 1XRSB 2I71A 4X90A 1BSVA 3BICA 1IMJA 2AYZA 5K7SA 1NJ5A 2JCVA 5EC8A 5F2OA 1ZIDA 3KFVA 1OHHD 3CSUA 4R0MA 2CW5A 2P4EA 3FR7A 3Q3IA 1IJKA 4GOND 5C46F 4J7XA 3C87A 4GQAA 3X2EA 4IX1A 5TEVA 1OBFO 5C4GB 4BZPA 4D82A 5CM2Z 3DAOA 3CUYA 3M2PA 2PKQO 5E6SA 4M98A 2EIXA 4JI1B 1L2TA 3FNBA 2VPYA 3QOFA 3TSCA 1NVBA 3TZCA 1RPZA 2VXYA 3AHGA 3IAHA 4KE7A 3I0ZA 3TW6A 2QTGA 3B6EA 1NQAO 2WW8A 2A5YB 1V9CA 2LTAA 2KW5A 4R6XA 4QPCA 3ONFA 3P8ZA 1BX3A 2IV3A 3SYRA 3OT1B 4BV3A 2XDQB 1KEVA 4M0UA 2I7DA 1KK0A 3NT5A 3NV9A 4J76A 4L0MA 3C1TA 2HLNA 3EWNA 3VYVA 3U16A 1U9JA 2GAOA 3OETA 4MPRA 3RC1A 3KTDA 4EEZA 5BPHA 1YH3A 1KC1A 5M34A 1GNSA 1DSSG 3BULA 1QTIA 4BEBA 5MF6A 3TINA 1KJNA 1WCWA 2DBZA 3EZLA 4KVZA 4NJMB 5CCEA 2ZJOA 3IVCA 2VI5A 1Y48E 4FHDA 3OQIB 5FI1B 5KHAA 8ADHA 1OFUA 1S89A 2ZIXA 3P0IA 4XIGS 1GKUB 5J4HA 3LOQA 1AD2A 2O8NA 3VO9A 2QY9A 1Q1EA 4N0PA 1GZHB 4OLHA 1LPBB 4E4TA 3OEYA 4HRXA 2GZ2A 4M2LA 3I34X 1RKBA 1M6NA 3SR4A 2AJLI 1L3IA 1LLFA 3DZJA 3HZHA 3OPYI 4HG2A 4K9SA 1P4HA 2K2QB 3V00A 4EPXA 2X4LA 2O2DA 1T43A 4FE4A 2W58A 5T67A 1R66A 1TU4A 1VJ1A 2OHOA 3GEHA 4PM4A 3H8SA 3H7IA 2EC5A 3M2TA 1BXZA 4CYMA 4ZFNA 3DONA 4KLAA 3GG2A 4LVCA 3TW0A 4ZYXA 1B76A 4G8BA 2B0CA 5ADUS 3THYA 1U0HC 1OB5A 4KXUA 4XZ3A 2PFSA 1G2PA 2ZCVA 1SCBA 3C24A 3SF8A 2VYFA 3AMVA 3L7CA 4RDXA 1PX0A 1ULBA 2XKKA 1XVVA 3MJRA 2PZLA 3VGPA 1JQAA 1R0XA 2IEBA 3MWDB 4MW7A 4AKGA 1Z5OA 3FYCA 3C43A 1RXSA 1ZRNA 2PT7A 4MYRA 1UBLS 2IXFA 1XX6A 2ZIVB 1O08A 4HB4A 4AK9A 3MA0A 2H1HA 2BJWA 5JV5A 3RQIA 2ES4A 1NXTA 1IRIA 2P1ZA 1D5CA 2J8ZA 5F9FA 3RABA 3OPXA 3I23A 1YZ3A 1ZY2A 1DV2A 2GI4A 4NQRA 1XP5A 4TS1A 4U7TB 1FPMA 4GPBA 5EINA 4KE9A 4LNHA 1QHIA 4YDRA 5DWQA 2XCSB 5JJIA 3L8YA 3ZK7A 1YCDA 2B4KA 3FLAA 3MMSA 1NI3A 3JASA 1ONNA 2BJVA 4EHDA 4KXMA 3VSDA 3WGYA 3UWSA 4GU5A 4LXHA 1WABA 3E0XA 4IS3A 4BUZA 3PHBE 3OM1A 4YCJA 3BA1A 4AMGA 3MFYA 5I7WA 2E4UA 4YAUA 3C5WP 1RNLA 2NU8B 5EE5B 3OCZA 1EFAA 3WNCA 4QTTB 3EG9A 3TKLA 5DYNA 5JISA 4P3OA 2W8ZA 2J9XB 4JKOA 4NOMA 3TN7A 1JR2A 1HWYA 4QGBA 1C9MA 3KLBA 2YIMA 4DA8A 3N2GB 4ALIA 2I62A 5DV9A 2GEFA 1YASA 1UJNA 2WQZA 3OQMA 1E6EA 2CGEA 1FFHA 4IP0A 4E3ZA 3ZW9A 4RHCA 2Q7OE 1I6LA 1GHTA 2HU5A 4UXJA 4CM9D 4YAKA 1UPCA 1WHTB 2ZBQA 1XCGB 2Q3LA 3LECA 1KTVA 1JVSA 1WUKS 1MJ5A 4CM6A 2LV8A 2PSDA 3AEKA 3FMVA 1XTKA 1JEQA 3EXHB 3LO5A 1QIFA 1RLOA 2EJTA 1YIDA 3OZEA 4HNTA 3BC1A 5AXDA 3SQWA 1ZOSA 4MQBA 2VF4X 3UO8B 1LBIA 1TE2A 2NYAA 5AVQA 2ACKA 5I8WA 3DULA 4YQYA 3TPZA 1P2DA 4CLXA 1USWA 3BKXA 2AC7A 4J07A 1H4SA 2FMIA 2XMCA 3KT0A 5IJ0A 3PVZA 1VKRA 5CT5A 4PNZA 3FFBA 5J47A 2PAAA 1A98A 2ZU0C 3WK5A 4ZXPA 4ZAGA 2MINB 5K3CA 1F2VA 2O2ZA 2HHCA 3ENVA 3I9NA 2G8LA 4IH4A 1RD4A 5MDHA 3KBOA 2XGSA 2JFBA 3ZWCA 3A9UA 3PQDA 1QKJA 3FFAA 3ZCQA 4BX2A 4EYSA 5BRAA 1ULSA 1YS4A 3G5TA 4KO8A 1XK6A 2G09A 2RHBA 2ACEA 1IN8A 4MWBA 3RS0A 3TD2A 1DXYA 2CNKA 5IDWA 2FFBA 3G49A 1RJWA 1S2GA 4G9EA 4F8YA 5DNWA 3IUJA 4ZV4A 4BQFA 4ZEMA 2HF7A 3EEFA 4NYJQ 2OHGA 4L5AA 1HE2A 1TZMA 3ENWA 1P7WA 3V7UA 1QHXA 2Q45A 5HZMA 2QROA 4MK4A 3FCCA 1EEXB 4QU0A 4UREA 3TBHA 4CLRB 2WU4A 1R3UA 2DFDA 3IODA 2AUNA 3GDFA 3N86A 5DBOA 2FUKA 2G7MC 2WSIA 2X9LA 1EM8A 4AJ2A 3PUHA 2ZYRA 1GRQA 1T91A 1ZD5A 3IT0A 2BTOA 2C2HA 2OFWA 2PKRA 4KH0A 5KSZA 1V96A 2D5AA 4JU8A 5FPSA 3SDBA 1Z17A 3FFXA 2FEOA 2GZDA 4RD4A 5HFNA 3V2UA 2FZEA 4EX7A 4X20A 1IWPB 1TUGA 2ZOSA 3IR6A 4J4BA 3WTBA 3GJ7A 4HLQB 1GUAA 1FDWA 1JP7A 1Z0KA 4GNRA 1L5HA 4UZEA 4AT1A 3H87A 3GFFA 2V58A 2YWBA 1NQTA 1V4VA 4ETNA 2J30A 1J39A 3HPQA 4US0R 5EWMA 5L95A 5A6VA 4II2A 1JR4A 1O54A 3LW7A 4PPFA 1XXHE 1XTTA 1VLMA 4IUYA 1SU6A 2BEVA 3TQSA 2AX4A 3UFXB 2PYZA 3K53A 2YFYA 2ZIAA 4IQ4A 3FY4A 3KKLA 4B35A 3FF4A 1BVYF 1FDVA 1PD0A 1G38A 1Y3IA 2HEGA 1R5BA 4G85A 4X7MA 1W5TA 3RT9A 5JS2A 2QRPA 3GD7A 1N6PA 4DLUA 5L7YA 4D41A 3BH7A 4MHOA 3ITDA 4FCTA 2AYYA 3DDSA 1B1AA 4LSZA 2ZE5A 3T95A 3FWPA 3FDJA 1Q20A 1QG6A 4P4SA 4Q4LA 5T64A 1M1YA 5EPOA 1UKVY 3P9QA 1Z29A 4ZD6A 1VMEA 3NDRA 3KFLA 1BD4A 3O03A 4RQAA 3GBPA 1VTKA 2A92A 2X9QA 3GGDA 5G02A 1VI5A 1O94C 1W1UA 2HUNA 3DKVA 1GL6A 1C9DB 3DB1A 4V3CA 1Q7EA 4Y2RA 1XTBA 2CMFA 3L7NA 5A3JA 1ISRA 4WN9A 4OHPA 3TX2A 1BA2A 1KEPA 3EVGA 4M9XA 4XWAA 4R8RA 1XCBA 2BJHA 4BMYA 4HXGA 1QRUA 4GX1A 4DCJA 4B47A 3LP8A 5BQFA 3S0JA 4IILA 4Z4CA 4PZZA 2WKQA 5D3MA 1G7TA 2O3RA 2XUGA 1Y6GA 1E7WA 3CLKA 3PNPA 4QLAA 4OHYA 4WUTA 2O2SA 3KAJA 3TD6A 2X8JA 3NAMA 1JHQA 4NEGA 4A6DA 4DPKA 1ISSA 4KQMA 1P8AA 4UAVA 1CG6A 1H9AA 2P90A 4E46A 1AV7A 2PFKA 3ZHRA 3MJHA 2Y71A 3ZK8A 2QD2A 3PXEA 3DEYX 4KCGA 3R7SA 4AN0A 3MZ0A 5HKKA 1FDRA 3AKCA 4INPA 1ZI6A 2WWYA 2DGDA 3L5OA 3RHZA 4ENUA 1N32B 1QH9A 5D8DA 2PNFA 1DBVO 3USES 5KEIA 2VNSA 3W7BA 3UTDA 1N34B 3ECCA 4BPBA 3LBYA 3MWLA 1KI7A 1CV2A 2VSOA 2OQVA 5DISB 1UM9B 2AFVA 3MJ4A 4Z9AA 3W5CA 4B6SA 4PR3A 4HAWA 2GTHA 3ABIA 5FQNA 2E55A 3DPUA 4PQGA 1LX7A 1HORA 4EHAA 4Z5XA 3VDRA 1GQFA 3EDYA 4MDEA 3BF8A 3N0VA 1VCNA 1G6KA 1FUKA 3HNRA 1H2WA 1P61B 4IJUA 3RF6A 4GLBA 3HE3A 4DLNA 2XKJE 3CIFA 1UMCB 1RVV1 3Q88A 3ADBA 2CXSA 1KKLA 3DV0A 3EH2A 4YP7A 2XTZA 4J4TA 1NSFA 4B85A 3MWEB 3FHCB 1VGRA 4X1KB 2JS7A 1QCZA 4BQNA 1SM4A 2Z4RA 3GJRA 3JD4A 3N1UA 5T6MA 3QU2A 3UYLA 3KIPA 1Q1ZA 2AXNA 1MR3F 3KTFA 4MLDA 4MVCA 4RZUA 2VDVE 4NFHA 3S2EA 4EDFA 1NULA 1UXIA 2V7WA 3EVTA 5FXMA 5JQGA 4G0WA 2P9BA 2NU7B 3GD5A 4J0CA 4XFKA 2I6SA 2WE7A 3IO5A 1CUFA 2D1YA 1P1RA 4L22A 4WLNA 3SYTA 5JNVA 3OZFA 1DRVA 3NHWA 4WKCA 3COZA 4ARZA 1O5TA 4ECEA 3LPCA 4KJZA 4BMVA 1EFVB 4XUDA 3AR9A 3AY3A 3I83A 1FFWA 2I78A 4O5AA 4BP3A 3K0HA 2UZIR 1NJ6A 3RJTA 2IPXA 3DTVB 5COBA 1GUBA 4BBPA 2UZAA 1MO6A 1N2CA 1GGNA 3KVYA 4HNRA 1IIBA 3LUFA 4J3JA 4J9UE 3E22A 1MA3A 4HQOA 4KK4A 4Q24A 3Q1LA 3VJLA 2IW1A 2ZSIA 1E0JA 3FTDA 4ZRNA 2NVOA 4GM1A 1GTL1 1JT9A 4XASA 3A6GA 1K6XA 1UBCA 3JVUA 3KQYA 4BNFA 4MUIA 1D6SA 2UZ3A 2OAQ1 3EGXA 5JD4A 3HZOA 1QIGA 1I4WA 3BXXA 5SY9A 2R48A 2RGNA 4YRJA 2G9RA 3PDIA 3K8OE 4IPTA 5IJXA 3X1YA 4BNTA 5KNDH 3QVGB 2WINI 4CUZA 1X8LA 4ZOLA 5IUJC 4FXPA 4O4LF 3W6OA 4LXGA 4FB5A 2XMBA 3HCFA 4PX2A 1LW6E 2J67A 2O5RA 4E6EA 4EHBA 2GJSA 3K0FA 3F1KA 3HY4A 2Q5JA 3BCSA 4WNAA 1OXXK 2JGNA 3MS2A 4WZBA 1WXDA 4NCHA 1O94A 2UU9B 3W7AA 1OLXB 4EHKA 5DYTA 1NJ2A 4XLZA 4ADSG 4FD3A 4BKQA 2FGJA 2YTZA 3E84A 1T9DA 3HN2A 3S29A 1R4MB 3SKYA 1H2RS 4XGKA 4YAWA 2EQBA 5LYJF 2WRZA 2PBLA 3JRNA 1L4BA 1YCHA 1OGJA 4FFBB 3SY8A 3QFSA 4JSTA 1QONA 2G82A 5IHXA 3WADA 4HWGA 3O8RA 1J0CA 2PLRA 1AE1A 2FN8A 4QOEA 1Q2XA 4DN6A 3WNBA 2WD7A 3IDZA 4ZEWA 3SSMA 5ALMA 3DFIA 3OX2A 2VK8A 4NV3A 4OHVA 1QPGA 1CR1A 1Y3BE 3KZNA 4FMCF 3USZA 4IHKA 3ZDZB 1K6JA 2JF0A 5DE3A 1J90A 3AHDA 4UHEA 1J9ZA 3E53A 1ISMA 4QATA 3CTPA 5KJ1A 1A9YA 1B26A 3K0KA 1OFVA 4JEIA 4LQCA 4X1IA 2WB4A 4EM6A 5E6UB 1RXUA 3C7DB 1ONSA 1OF1A 1ZMRA 3ORHA 4JL8A 2BGLA 1ZGJA 4ZDKA 2ZSJA 4JR1A 2NO5A 2I7CA 4O2BA 3WMFA 2YDXA 1FLNA 3C5HA 4PXAA 1GFZA 3O7MA 3F7OA 3RSGA 5SYAA 2CWWA 4ZC1A 2RC6A 4WJLA 2JFQA 2CCGA 1TPYA 1AQIA 2R6DA 3CF6R 3SZRA 3ETDA 1T4MA 2W37A 2YY7A 4JUAA 1H2BA 5HYVA 2VBGA 3TPCA 3ENQA 3ZHVA 3PRYA 1P45A 3BJMA 3I58A 4J1SA 4TMTA 1D3AA 2BI8A 2XXJA 1TUEA 3R7FA 3GUCA 3EXEB 1WSDA 1Y6QA 4COOA 1SG9A 4G5RA 3O26A 4KLCA 2NTNA 5KVAA 3TLZA 1VECA 5ISMA 1L4GA 4HQRA 1QE0A 5K3SA 2P2GA 1JQLB 4LHVA 3RS5A 4BN5A 4BUCA 1P2BA 1QYDA 3E0QA 4YXWA 3W8DA 4HZUA 4CQLA 2O8EA 5E4FA 1GCAA 1KGSA 4I4TA 2QLNA 3EBLA 3I3SR 4O29A 4REQB 1E1YA 3OIGA 3QEJA 4DCMA 4HGOA 5FOUA 1DAFA 3IXMA 2J9YB 4JBLA 1XQWA 4RIFA 3GNQA 2D5BA 5ICMA 3I61A 2CNLA 2FI1A 4CI0B 2PBFA 2PNJA 4DQDA 1QG0A 2AWNA 5TARA 1SBQA 5F33A 2EZTA 2WIFA 1MB4A 4MS4B 1LQ2A 4LDNA 1ML4A 1VHWA 4IY1A 3V4PB 4CHGA 4YWJA 4G67A 3ESDA 4F56A 5AESA 5IH7A 5K99A 3KX2A 3ZHUA 4CI9A 1II8B 5GZ3A 1FC0A 3D1JA 4HH1A 4MRMB 2HW8A 4PRKA 1JG1A 1XA3A 4ZHQF 4RGQA 2QJFA 1RI2A 1W47A 2D7CA 3HFRA 3PE3A 3PZRA 4OU5A 3T5PA 2QVZX 1T3HA 2XGMA 3BL5A 1W6UA 5CLIA 2Q2OA 2Z95A 4FEEA 1KR5A 2XVYA 5CFNA 3CPHA 3H9BA 4FFWA 3PIRA 2HCRA 1H2XA 1T6YA 4JXKA 4LYDA 1F7UA 3SQNA 4N8EA 1P9OA 2YWJA 2WSSD 1UK9A 2GBPA 1DIAA 1U4SA 3BZBA 421PA 1X9GA 3AL2A 2C97A 3K1TA 1G6Q1 1BU5A 1COWA 3AYXB 3RSOA 3INRA 2ZKLA 1IB0A 2M9MA 5CGZA 2KS6A 5A3RA 2J0SA 4V0ME 2XR1A 3PLRA 4HDKB 4KUEA 1RBMA 5HKBA 1B23P 3E9DA 1GV0A 2OWDA 5ESWA 4L08A 1U3VA 3V1LA 2CEAA 3P0HA 1QQBA 1K8QA 5LXTB 3FPLA 4IV5A 4WH0A 1MPTA 3WGTA 1FXUA 4QSMA 4RZSA 4BQPA 4KACA 4CKEA 3FI9A 3I09A 2QQ0A 1P1BA 3GARA 2OXTA 1E20A 5TVKA 1PR2A 2EEPA 4H16A 1DTEA 4ZVLA 4HDRB 2H52A 2XWPA 4Y0VA 3RHTA 4C04A 5DIZA 4MVJE 3A1CA 3MUEA 2HIGA 1JDBC 1OJ7A 4INJA 1DFHA 4S1WA 1S02A 3O8OA 4IR7A 3K35A 4CM4A 1X70A 2AQ8A 3NFYA 3DKRA 2FJ0A 3H1AA 5FPKA 4GP7A 2FR8C 4JYCA 5KMGB 1OI4A 1JILA 3GLHB 3RUDA 2EFHB 3R5HA 4M3NA 1KH1A 5TPWB 3KDAA 5IJAA 3O0TA 1MEJA 2CLEB 4BO6A 2C57A 4L8WB 3GQBA 1KMHA 2BR5A 3GEPA 1YT5A 4BFUA 4DV4B 1RZ3A 3ROPA 1UJ2A 5DIFA 1KETA 4QT0A 2CYAA 1X7DA 5KCMA 3LT5A 4Q9LA 1OGYA 1ELOA 1GQOA 1H1TA 2HK6A 2J9GA 3AF1A 1TL7C 2G5PA 1X0XA 3GLKA 4FZJA 5FUMA 5K2OA 1HFJA 3B53X 3OQBA 1F8GA 4RELA 3INYA 1HTBA 3Q0IA 4QREA 3SXUA 1P75A 4K28A 3N3AC 3IULA 2PZGA 3ZC3A 3HMQA 3FA2A 2H0AA 4XJXA 4UTOA 3VNAA 3H9CA 4IQ8A 2L18A 2HRZA 2I34A 2P68A 3RIYA 1J2JA 3GLIA 4WNYA 4FR5A 1HKUA 3PQ4A 3W6UA 2IZ7A 3GW8A 5LOVB 4BN0A 5K2MA 1JDUA 3NGXA 4ZVRA 4DG9A 2QNIA 5FOQA 4E08A 1W35A 1YZHA 1E94E 3LSTA 2XSZA 3CX4A 3AV0B 4GOOD 1MW9X 2N1MA 5G1NA 4KPUA 4GWLA 3ZTWA 4FNMA 1ZEJA 3MLBA 4BNJA 2B35A 5AO9A 1D6JA 3PUKA 1ZFNA 2Y1CA 3M6AA 3NAQA 3PRKE 4L74A 4D7AA 4AUEA 4ONEA 4JBXA 3QVUA 5JARA 4QXOA 2BFPA 1A5TA 1ORRA 1CQWA 3ROKA 3F2VA 1HFWA 3KZOA 3L6EA 3OO0A 2DHQA 4FDMA 3EXFA 5C9ZA 2XKBA 3FWKA 2NVUB 3SYLA 1I7DA 2WJGA 2G4LA 4J4HA 3RUFA 4BLRA 1JDVA 1VHQA 3OCWA 3QLUC 3V46A 1U9ZA 5EKXA 1TJ3A 5TMDA 3NBFA 4HWRA 1U04A 2ISSD 2AKYA 4QQKA 4X8LA 1CPYA 1H1LB 1SHTX 1NOJA 4J6FA 4BFXA 1DEAA 5AXAA 5YASA 1DLIA 2QPLA 2OESA 2XNDA 1QIIA 3OT5A 1OZHA 4QKQA 2ZUSA 4IWNA 1ZQ1A 5F64A 2AOUA 1VSUA 2CLCX 3T0GA 3W90A 1D03A 4GKAA 4R01A 3UUFA 1P44A 4KGXA 3I8SA 3NFRA 4B09A 4YMVA 3ADKA 2R85A 5M7EA 2HLDA 2YOHA 2OL4A 5TXGA 5U4XA 4L27A 4CU5A 5K03A 1OGIA 2XBMA 1CVRA 4GMHA 4WFQA 1H8HA 5I7EA 2Z04A 3QBEA 4FYHA 3A4TA 1PEKE 2RI6A 3ABSB 5BV0A 1TQ6A 3KPJA 2RGAA 2RH5A 3JAKA 3VR3D 4V0OA 4MO2A 2GMWA 2UZ1B 5ALHA 5BR7A 4G41A 5JY1A 3HSKA 3B60A 4IIJF 4RK6A 1OY1A 5EJ7A 3LC2O 2RJNA 1XC7A 1P73A 4OSPA 3HV2A 4MV7A 4BVBA 4TUYF 4XM2A 4BHTA 5FV4A 4YJFB 1ZXBA 3IT3A 3PI6A 5FJIA 4OU4A 5B7QA 3L6UA 3WKCA 5L7TA 5BR8B 1OCEA 3V7NA 3KJXA 4YV7A 1H94A 2F9LA 1C30A 2IGBA 4M37A 3GYGA 5ESXA 2TMKA 2PD6A 4R1TA 2ZYAA 4IZHA 2FR8A 1HETA 1D0SA 2IQIA 2X4IA 3D81A 3D8TA 3KOUA 4GUAA 5BN3B 1K66A 1UT5A 2R1TB 3VR2D 4H17A 2GEVA 4GDFA 5ARDA 3IIKA 5LQSA 3PDJA 4CT5A 4X8HA 4CCSA 1EP9A 1FS4A 1ZINA 2VRBA 2XE6A 3HG7A 1BXRA 5IJWA 2HB6A 1ONPA 2Z5FA 4KAXA 3K5PA 2VH5R 2PJZA 1HUQA 3Q3GE 4CLEA 2CHUA 4HNUA 2Z9CA 1TZ2A 3UMBA 1TECE 2BOVA 4N3BA 1OX4A 1ORWA 4D4LA 3RFFA 4Q0MA 3WGIA 1V11B 1ZUWA 3VMMA 5IASA 1U8FO 2Q2NA 5F1KA 5LNK6 4J0DA 4Y9TA 3PCTA 1K4MA 4YMWA 3TEFA 2ZIEA 3LUPA 1NV9A 2IZ0A 2HBZA 3L06A 2ALJA 4R2WA 1BMDA 5IT0A 1N77A 4PU0A 2FLKA 2BM1A 2GARA 3RW9A 3MQ4A 1URPA 3DMTC 2EG5A 5IVHA 3L6BA 3D7LA 2PV7A 4NRDA 4P32A 4Z7JA 3REFA 3E82A 4QJ5A 1EK6A 2UVPB 5DHRA 3G9TA 3R7AA 1I2BA 5EKTA 3AP3A 1M66A 3DBIA 2ODQA 1NVXQ 1NRXA 1NLYA 2X0NA 3QVJA 1WQ4A 1FVFA 3EULA 4BCDA 2ZYIA 1DKUA 2JBAB 4HP8A 5K8JB 2PBZA 4X61A 2FEMA 1YRYE 2ZCUA 1NTRA 3LQRA 4E22A 2QV7A 3RFXA 4TTSA 2EP8A 4BGIA 4DRXB 1VE1A 1GCUA 2ODPA 4X0EA 4YDQA 3GPBA 1RXIA 5G1PA 3L7IA 4PC7A 4ESHA 2HMSA 5C31A 3R7NA 3NAGA 3TR5A 3ZQJA 1A9PA 1C9YA 4HFMA 1XKQA 4QXPA 2PUBA 3FDXA 3O9ZA 5AHRA 1GP2A 2HCFA 3H9QA 4AU1A 1KI2A 3QLUA 4MVJF 1MOSA 3VZBA 3DXYA 3R7WB 1VL0A 4C6TA 1Z7YA 2RHTA 3FDFA 4HFNA 3A36A 2YWDA 3FSJX 4IINA 1UJCA 4LAFA 4QG7A 5KVCA 4GYKA 4H7FA 1V1JA 2O1SA 5DT9A 3WL6A 1EU1A 1YOVB 1NHGA 1QVZA 1DIOB 2Q9BA 2O2YA 4FEGA 1A7AA 4G9GA 2GSWA 4NESA 3U3XA 2X6QA 2NU6A 4C5BA 5JWRA 5LIPA 3NOOA 4M1WA 3UAXA 3GP5A 3PA8A 3GR6A 3BE6A 4WE3A 4CIBA 4OI4A 4GRAA 2G5GX 3IE0A 3P9SA 4ERXA 2R8YA 1USKA 2LKDA 2ZT6A 2Z2IA 5IAKA 2OK7A 2AFHE 3A0UA 2WZDA 2WICA 4AX4A 5TMEA 3CPSA 5AW8A 1YMVA 4GPEA 4MV1A 3ZU4A 3EBPA 4YRNA 2MJLA 2D0OB 5I9IA 1FTWA 3T9FA 2OYSA 1U7WA 4TTQA 4OQYA 2FZCA 3I3OA 2W2VA 3LVFO 2P11A 3RADC 3NKLA 2EJUA 3OLCX 3IJEB 3KLMX 1Z0IA 5JSYA 4MYCA 4G0UA 5IC6A 3H5WA 2VUIB 1O0BA 4W6ZA 1PIWA 1Z74A 4L9SA 3TX6A 4F7WA 1JEYA 4KWIA 3L0CA 2J6IA 2OFOA 4ROTA 1C7FA 1QYRA 3PBKA 1CIPA 4DQ0A 2F48A 1LTKA 2IU4A 3OJFA 2F67A 3NHUA 3OD1A 3L0PA 3U1TA 1RMQA 4EIWA 1G21A 5BMVA 2Q27A 2BZ0A 4ZK2A 3EEYA 4DIBA 2OC9A 1ORDA 1RWOA 3VSBA 3WMRA 3KQVA 4W8GA 1ODIA 1V48A 4URYR 1RZRD 3G3EA 4XD7D 9ABPA 4IF4A 3ZJVA 4RV5A 2WYVA 3UATA 3NHSA 4KQFA 2ZRCA 1XEXB 1OH7A 4MR8B 4GF5A 5H59A 1RQ7A 4JC0A 5SZHB 1DIBA 1QZTA 2DWCA 2P0EA 5F51A 3WLKX 2OVFA 3LT4A 4EBFA 1VG0B 3OAAD 1RABA 1BDMA 4Q01A 2CXTA 1Z12A 3G0HA 3V6LA 1WG8A 1XBTA 2NO0A 4L78A 3RBAA 4D9JA 3DKPA 1SFRA 1G4AE 4K3UA 4X93A 3UZUA 4BQEA 3F9RA 1HSZA 3A3PA 2F8LA 1ZVKA 1L4NA 5IC4A 4G0PA 2I2FA 4BO0A 3V97A 5JATA 4NQZA 2GZHA 3LO8A 4TT3D 1U90A 1KERA 2D0PB 3K0AA 1KTIA 3PXAA 4NDZA 2NQTA 4B4OA 4OP2A 3DMTA 4U9HS 4EARA 4RWZA 1PJ2A 3U49A 4J0KA 5LM3A 2ZFUA 3CCFA 4RZ3A 5ER6A 1ZJ6A 4BQIA 4YJ3F 2W9XA 4B17A 4ZZIA 1TAGA 1V9LA 2CV1A 1DAIA 3SKXA 2HK8A 2O57A 3PJFA 1BHQ1 2ATEA 3Q0EA 3C85A 1Q7RA 3T7TA 4QQFA 1J0BA 3K5WA 1G5QA 2XTMA 5F4ZA 3IT2A 1T2EA 4GPZA 4Z1OA 5DN6D 2EFDB 3MIIA 2C58A 1QSGA 2BMVA 2IYZA 4P2GA 1JIJA 3UJAA 1HYEA 2YJ4A 5J2UB 5IEBA 3K9FC 3QVOA 4S0XA 5A4KA 1P31A 4NBUA 1N1DA 4NL4H 4RVUA 1FYDA 1Y1RA 1H8EA 3V32A 1DKLA 2C2BA 4ITRC 3RC9A 1PJAA 4KR6A 3WGUA 4HQ0A 4HAIA 3AI2A 1ODKA 1RJ9A 1UPUA 5AVJA 4CKZA 3NI2A 3GJ3A 2H7YA 4KI0A 3ZU3A 2TRSB 3HBAA 1W46A 3D6JA 1Z68A 5IBCA 2JHPA 2HMTA 2JC3A 5SZJA 1XG5A 3OLWA 3OEHD 4FDAA 3Q7SA 2W2KA 4ZJPA 1DDIA 5KYWA 2FKNA 3IAM1 3OF3A 1W2GA 1XZLA 3OVMA 4R7GA 2WOJA 3WFIA 3KKEA 3OZSA 2NTJA 5AJTA 3WOVA 2F3QA 4RE6A 1NLZA 1P0MA 3B1XA 4LOAA 2WKRA 1M2OA 1UUFA 1P60A 4YGYA 1HV8A 4BWFB 3KAPA 1G59A 4P5EA 3IOBA 1A71A 4HN9A 3BXHA 3KXDA 4P31A 4RPCA 1ETUA 1T1EA 1XZGA 2PYDA 2Q8QA 4HZGA 4Z4EA 1N2IA 1VMDA 1QORA 1ZNYA 3H0CA 4K6HA 4BLOA 5LDHA 1Y7IA 3L1HA 4WINA 3PEWA 3VPHA 1S1MA 2EGGA 2G0TA 1OVGA 4CCAA 4B2PA 4DMMA 1M2HA 1TKRA 1LF0A 4RA9A 2FMUA 2ZJ1A 4GZ3A 1ZL0A 4IDAA 3GA0A 3U1BA 2VJMB 1VDZA 3CJTA 5IH3A 2C7VA 3IXLA 2C3MA 4BQRA 3UF0A 3PDUA 5BXQC 4N82A 4NH4A 4JLDA 5LZ7A 1NJGA 5MFPA 2H6EA 1QOPB 1RRPA 2WYUA 1SNYA 4P08A 2VC2B 2C4MA 2V6IA 5ABPA 3TFQA 1ECGA 2JI8A 5A4DA 4W1SA 4I1VA 2CL7X 2Y0PA 3IAS6 3G7UA 3B1WA 2QZ4A 1SEVA 4TM8A 4B4VA 3UMFA 3IHWA 4D4MA 5ITVA 1HDCA 2GBCA 1GA6A 3PC8C 1PTKA 4F06A 4BVEA 2GZAA 2CFOA 2NP7A 5CPFA 3X0DA 1KBOA 1KI6A 4AX8A 3MUNA 221PA 5E2IA 2HA7A 2QN3A 2ZSHA 4A2WA 1QO7A 4EDHA 5I7SA 2PWYA 1B0ZA 5CK5A 4EYKA 1THMA 2KX7A 3AUUA 4P81A 3E3MA 1RI4A 4BGVA 4F9EA 1W8DA 5IYZA 2CZGA 3ZXUB 1U6IA 5SY6A 4XM0A 4DIUA 3BOSA 3P9NA 5E9QA 1XZEA 4UEKA 1CYDA 2J08A 1UMDB 5JNWA 2O19A 1OFHA 4GX2A 1BA3A 4GOMD 3SEFA 1Z6TA 3Q8KA 4IG4A 4KR2A 3GMIA 4XLTA 4CKBB 3PFWO 2HIMA 1NBIA 1TM4E 4FEYA 1W34A 1W0JD 1GPKA 4FIZA 2FFJA 1PI3A 2M98A 4RLHA 1EX7A 4MV6A 1GD1O 1W87A 2IA5A 2PZEA 3EPRA 2VHJA 3IVAA 4GOXA 4MV3A 4A6PA 4RHXA 4D98A 1YUMA 5KTNA 2NQ2C 5I5GA 4UNQA 3RVSA 3VOBA 1PDOA 3HY3A 3IMCA 5FR1A 1GSHA 1JPNA 2BE7A 3PXXA 2V3WA 1DAGA 2GJAA 5GIOE 3UW1A 3WKDA 4RQUA 1KRHA 4ZU3A 5DP2A 5JJCA 4DLLA 3MEQA 1YDFA 3IBSA 5TEWA 4NABA 3EZYA 4UUOA 4DADA 4EFMA 3S8YA 4IDPA 3DCNA 4EAAA 4YLGA 1P19A 3LT2A 4BO5A 5CX4A 2QBYB 1I80A 4XI9A 2A0FA 1GT6A 2JFYA 3TI9A 5HKOA 2OCXA 3A27A 3H5TA 1U7PA 3GNSA 4KDFA 3NDJA 5IM4A 1GAXA 4R8MA 5B6PA 3IX7A 5BN1A 3CQ9A 3PSHA 3M34A 1AM4D 4DLZA 4TZ0A 5HXAA 5I4KA 3AR6A 3CNHA 1QGZA 1Q7CA 4IQFA 4JVOA 3ACDA 4KBFA 4M22A 2V7UA 4XKJA 1QKKA 3T4EA 3T9BA 1C0IA 3ZZUA 5HUJA 3N0WA 2RB5A 3FWYA 2DTXA 4YJHA 1CLEA 1ZGZA 2GPAA 3KNZA 5BNZA 5G40A 3RS3A 4YPVA 3AESA 1T6XA 1ZGAA 2HYIC 1DTWA 4I3GA 1L1QA 1SQSA 4EMBA 1E4EA 2GYWA 4D99A 4PN3A 4LJRA 1HMYA 1JALA 5JTUA 2BN4A 1CF2O 1HY3A 3OZDA 1MUUA 1OWOA 2VJAA 1E7SA 2ZR9A 5FNVA 3GLGB 2ZUBA 5AW5A 2VYND 2O6HA 2XVAA 4CDGA 1YHYA 2Q2VA 2R66A 3ZVLA 3OJOA 1KZ1A 2HGZA 4EHJA 2Y1WA 1FRZA 5B3LA 4C0LA 2CL6X 2PS0A 3RJ9A 4FWTA 4A23A 1EE2A 3N87A 1TXGA 1Z0AA 1XMIA 1YBAA 2CDRA 5F76A 1E64A 1YR2A 3GLRA 4OQMA 4HVAA 3WWCA 5LA6B 2PO7A 2BGTA 5CAEA 2QN8A 3CTMA 2DF8A 3KO8A 3V8BA 5BW8A 3LKDA 4LHXA 1PT8A 3ZDFA 5IWCA 4W5RA 3FHOA 1SKYE 1NG1A 3AG5A 1D2CA 2FTKE 2HA2A 3VVBA 1O89A 2O0HA 4D4JA 3PXUA 3KR1A 4LSGA 1C2YA 5ES4B 3HKEB 1R6UA 4B3BA 1MBZA 1L9XA 1HQDA 1WPXA 1WX1A 3DBLA 3V3TA 5JHHB 2XBLA 3FYSA 5ALEA 5I45A 1X42A 1K7EB 1G3QA 2C0PA 5J40A 1E9AA 1H2HA 5JY6A 3PC8A 4A73A 1ZCZA 1YMUA 3ABRB 5AVXA 1DKQA 1R8JA 5EIOA 5KREA 1Y5IA 1ZGCA 3RYHB 1CY4A 4EEKA 4J2HA 3G1TA 3JALB 5JXJA 4DSOA 2X22A 1UDRA 2PKCA 3MGKA 3EXAA 4LHSA 4EABA 4G56A 3W7VA 5IAJA 3R9KA 2ET6A 1KIFA 1P2VA 5DRYA 2W6PA 3GUZA 4IXNA 3PJDA 4BKUA 1WDTA 1YR6A 3IILA 2Q4EA 2OGSA 2CLDX 2WAMA 2WZCA 1O58A 2CLHB 3DDOA 4JBHA 1KO8A 4JEHA 3T5TA 5AVVA 4GZ5A 1ISJA 4H15A 1QOQB 1JKFA 4Q6BA 3ZK9A 1AK1A 2Z2KA 4PLHA 1QHEA 2ZS8A 1GKKA 4CT4B 1T2CA 3TL6A 1ZK1A 5LJLA 4HJRA 4KSBA 3SMVA 1C7IA 1HZJA 3ZHCA 1PVDA 4LC9A 2J5RA 2OLKA 4KL8S 3IDQA 5B2EA 4MP6A 5KTKA 2ZPAA 1G5PA 1PE0A 4BASA 2VKQA 1FQKA 1YRWA 1R5OA 4BMOB 3D8SA 1VL1A 2JGIA 5BOSA 2ODAA 2EZ9A 4WBXC 4Y9DA 1GAWA 2L42A 3DVAA 4DDTA 5JCJA 2EDCA 2WHQA 2EERA 1CY1A 1JSRA 4R5MA 2XOKA 4DZZA 1C1XB 1MVOA 1OBVA 2FHSA 3C3XA 4JIMA 4YH1A 4MRRA 2W93A 3JQAB 1Z2DA 3GA5A 3A6PC 1N78A 5CDFE 5K0FA 1VLJA 2VN8A 3ZGVA 3A6DA 3F5SA 1E3TA 3A37A 2EEZA 3FZQA 1IOZA 5AI5A 4CMJA 1PJ4A 1SIUA 2KB0A 2VK1A 3F46A 2FCAA 3GIWA 3GP3A 4IDGA 4ND1A 5H5JA 4AY4A 2R6FA 3MWGA 3NHKA 1YVRA 4MPDA 4JUBA 1JQBA 1SUPA 4KQJA 3AQIA 4R1OA 1BHO1 1WU8A 2PEZA 3KQQA 2VSNA 3G8BA 4PPGA 1VP3A 2YWHA 4PEVA 4RDCA 2JAWA 1IRXA 4K6CA 5L3QB 5EQTA 3T5MA 1H3NA 5CDGA 4FE7A 3PT5A 4PSKA 4N5NA 4X3PA 5K6AC 1OLUB 2VTBB 4G0VA 4FFOA 1E62A 3O2QB 3K3PA 5E6RA 1R6VA 2I1LA 4JLSA 4DBLE 1XPJA 3KJFA 2ZYGA 2VDNB 2UZ0A 3H9JA 5HWSA 1R4AA 2OAGA 4BX9A 5CB0A 4RVFA 5MGNA 4ZI7B 2Z2ZA 2FV8A 4XTCS 4HGQA 1YZFA 2XDWA 2HWKA 2QDXA 2WPNA 4NDNE 5IBPA 1U1CA 4HPWA 4GX0A 4DRZA 2XUAA 4WOBA 1KBQA 2I9KA 2V7QA 2ZDHA 1LLDA 3BFJA 2FPGB 1JLLA 4GT1A 3EXG1 4DA6A 5FUVA 1X7XA 1Y4ZA 3HR7A 3S55A 1DGQA 1OOEA 4BAUA 4QA9A 2Z5VA 2QRUA 5KJCA 4WZAB 4B31A 1F5NA 1RHKA 2WD9A 2VOJA 4TN5A 2P6UA 5CJPA 5ALRA 4XXHA 2H3EA 5LR6A 1PR6A 4LG1A 5LWQA 3GVHA 1DG1G 3ILHA 1Y8AA 3ZE7A 1BFKA 4KVGA 2EYUA 3AUJB 4FMBB 4ZAZA 2VWHA 3JQGA 4QDTA 3KV1A 4HAUA 1LPSA 1ESDA 2OBYA 3B89A 1P2FA 3F9CA 2YQZA 3VZQA 3CGGA 2Y1FA 5EIWA 5B1EA 3A4NA 3DP9A 4JEMA 4DTCA 4E94A 5HUHA 3K9WA 5EFZA 4YIKA 2F1IA 2JFOA 3JATB 2O48X 2I6UA 3K2QA 4H7PA 1D9ZA 2AF3C 4Q9IA 1GUDA 1D2HA 3F6PA 4MP8A 1CX9B 4RJJA 4UNSA 5AOVA 3VJKA 5UKDA 4LI0A 3PHJA 2RGCA 1ZNQO 5A9RA 4R5HA 4F9TA 2B94A 2C07A 4WDRA 3V8MA 5C35A 5CDUA 1Z36A 2O8DB 1JFFB 4JOBA 5B7PA 1Z7WA 4B81A 4MQ6A 4P5DA 2PZFA 2W6JD 3NOQA 2JIOA 2P3OA 2I6GA 1VZ3A 2LE0A 1XWIA 3D5QA 3L1KA 1M2GA 3PGLA 4J90A 4N0DA 3KEGA 3N2ZB 1ZIPA 2QUBA 3LVBA 3SQLA 3EA4A 3BMNA 2MYPA 5F23A 1JHOA 3K0CC 5KNCD 2B8EA 1R6XA 3G89A 1J8MF 2HJHA 1ZISA 3HYNA 1B8VA 1UXGA 1FSZA 2G1AA 2JANA 2ZJYA 3MK31 4LTNA 4MUFA 4UTXA 3UT5B 4BNHA 1R0BA 3R8FA 4IIGA 1FQJA 2F8MA 3QVTA 1GSIA 3I2KA 1MB3A 5GOTA 1T9KA 4PX3A 1E6KA 2Y99A 4RAQA 2WHXA 5BQ5A 5CEEA 1HDZA 1ZMBA 4U7PB 1KQFA 2AS0A 2ZTSA 2JCBA 4TL7A 4U0KA 1CY6A 3LWZA 5CA0A 3I12A 4WVFA 1LJUA 4KGVA 3J80A 3V4LA 521PA 3L8GA 2GXUA 1LV8A 2OOKA 2GTPA 2I2DA 3ADOA 1GXSB 1V47A 1GDHA 3WYGA 2V97A 4UCQA 1L8LA 1RIIA 2OKGA 1YUBA 1AO3A 4JFAA 3MN1A 1S2NA 4FYVA 5ED0A 1L7OA 4MGHA 2DWUA 2X6TA 1J7KA 5KX5F 2W2NA 3L8HA 1A5BB 1ZUHA 2BEJA 1JECA 2XOEA 2ZU6A 4CKWA 1RYEA 1K5DA 4EL0A 2WLSA 1W75A 3W2FA 4UTZA 3GAFA 3BMCB 1CDOA 1K7YA 4MV4A 4UEWA 3RDPA 5KSWB 2SKCA 2ZWVA 1EA7A 3TO5A 5C8YB 3FJOA 3U3KA 2OHXA 1YCFA 4POAA 4WLOA 2H1FA 2QTMA 5DX8A 3M1IA 2V96A 1HA3A 4WOCA 4E09A 4DW8A 4K3VA 2OCDA 4XEUA 4YAIA 4DWWA 4RGVA 5A04A 1B6RA 4ML3A 1F1JA 4JLOA 3VYTB 2B5OA 3FNHA 1MC8A 3BS4A 3GEGA 3RC3A 1DZIA 4EJSB 2ZSBA 1X7HA 3W9UA 1N2XA 4QOSA 3A3OA 5CB4F 2I76A 1UT8A 3QNMA 2DUNA 5K6AA 3QA3E 1R15A 1SUWA 1DBPA 4AMUA 2QN6A 4HD8A 4JQZA 3N8HA 4F91B 4C2TA 1WSWA 3L8DA 1QIKA 1I33A 4B3IA 4JDUA 4A2PA 4EHLA 4CGZA 2XZLA 4KX3A 1SVSA 2ZB2A 4AYWA 5ICGA 1CP3A 2R1ZA 3P0FA 1UBMS 1X74A 4ID9A 4WKGA 4AJLA 3DE6X 1M75A 1NG9A 5KI6A 2IDKA 2HJRA 5DK6A 4CU2A 3ITNA 1BEEA 1UC5B 2IX3A 4NXMB 1SVUA 1T3SA 3D7RA 3EFBA 3H18A 1XMVA 3ZHBA 5L6LB 2DFPA 3LYUA 4A8PA 1W93A 2WZQA 4EOGA 1XF9A 1KZ7B 3AVVA 2RHJA 4XQ9A 5I7AA 5BV7A 5JDIC 4MMXB 4W99A 3CMCO 2BT4A 4TLLB 3MF4A 2RKBA 2OLEA 2XT6A 1QX4A 1YL5A 1Z8FA 4ARAA 3NDIA 2QS9A 4IUBS 1UK8A 4HDCA 4YI5A 1JJVA 2BMDA 3S28A 3UEOA 4AZTA 3GCXA 5JAOA 1BE6A 3KWFA 4M86A 3EGDA 3ER8A 3AERB 2ONZA 3A6JA 5EJAA 1B8NA 2HWYA 4G1UC 1WBBA 4L8YA 4URHA 3QKUA 3AHFA 3EEQA 3I9OA 4RK5A 5DTJA 3FOZA 4FGWA 4X24A 5IM5A 1A2KC 1DBSA 1X7GA 3PEEA 3CZ9A 5KNDA 4BVJA 1YQTA 2XCLA 4W8OA 2INGX 1A72A 1XDSA 2KJQA 4JBYA 1X80A 4TMXA 3B9RA 5B1DA 4M0EA 3THXA 2BFBA 3L7LA 2QTVB 4HZIA 1PHPA 4QO7A 3DHYA 1IZ0A 9GPBA 1PJ8A 2PH3A 3KXPA 4BMCA 3MSXA 3CZCA 3P5SA 1D1PA 5KWIA 1E2FA 4UUBA 4M9QA 1U2EA 1O4VA 1NX6A 3MOSA 2GFQA 1FA9A 2VZ8A 4HNSA 2DEUA 1I1NA 3K0CA 4B9AA 5KWEA 3IUNA 4J7CA 3D6AA 3R9WA 3GGJA 1XNHA 1PR5A 2BH9A 4P54A 5AP9A 2NU9B 4NG5A 4MYSA 4MEAA 2QOEA 4MKGA 3RS4A 3DZ8A 2PBRA 2F1RA 1FNNA 4DG8A 2D3TA 2H4XA 4MGEA 5FCDA 4DSNA 4R8KA 5L3SB 1IMOA 2Z3ZA 5CD9A 4WLVA 4ZCTA 4CEJB 1DJMA 1I9CA 5D86A 1V8OA 1SD1A 5JAHA 3DZIA 4OQEA 1Q0UA 4MR9B 3BJZA 3EQ2A 4FT2A 4D6PA 4UJ5A 2V8OA 4JGBA 4JLKA 4H4CA 3RVQA 5HZKA 5EGNA 5TQ2B 1T9BA 1UKYA 1Y9DA 3P0RA 4YCNA 1RQPA 1C7EA 3F6SA 3WLEA 2AN4A 3JYLA 1JSCA 1CT9A 1VG8A 1TC2A 2TMDA 3G9ZA 3S27A 3SLGA 4Q4CA 2UV8A 4Y2XA 3QE9Y 2FU5C 1U0JA 4GC5A 4L73A 3ZDQA 4R8VA 4DVGA 9LDTA 4Q21A 4WJZA 5JASA 2H07A 4KJXA 4XPIA 4MVWA 3NWBA 5KWJA 3A4MA 2IIBA 1HZZC 4FOLA 2DPLA 1P0CA 2L82A 1JSZA 2X19A 3UC9A 5EXPA 1PG0A 3W9BA 2JZOA 5JCZA 2SKDA 1P74A 4EF4A 1E9EA 3HS3A 3QJYA 3UAVA 3VPGA 3VYWA 4DDWA 3IVGA 3E7WA 2BFEA 3LOPA 2QTAA 3U80A 5AFSA 3IIJA 1G5IA 1USVA 2VWGA 2WD8A 4CIYA 4NU0A 4ZGBA 3TTTA 2X1LA 4D3ZA 4BEWA 2P2SA 3NBYC 3MT7A 4PZPA 1NNI1 4EBBA 3N2NA 3X1DA 4IGIA 2A0UA 4M55A 1WETA 4IO0A 4XPZA 3ZX5A 5FI3A 4N7BA 4FS3A 4GYYA 1RM5A 1EQUA 3GAAA 3F6RA 1Z33A 5EEGA 1HG0A 3L5KA 3C3JA 1L5ZA 4KKVA 2ZB7A 3VU9B 1FU7A 2VHYA 4C7JA 4ZTBA 3P45A 2O8BA 1KAMA 2NGRA 2X1VA 3C14C 4GKVA 5K8UA 3HJCA 2GCIA 2W22A 4RDIA 1K08A 1VPVA 2HFKA 2P2YA 3L0ZA 5AKKA 3VDMA 4D25A 3E6AA 3Q12A 3S3TA 2V55B 5JUWA 1UBNA 5JZVA 5ECGC 1TCUA 1I1HA 4KIWA 4BDSA 2R6JA 3O83A 2EP7A 3H97A 2VPXA 3KSRA 3UBMA 2B2CA 2J9ZB 1BCRA 1QC5B 3A4VA 4WLUA 4HQFA 5CVJA 3ULKA 2HIHA 5CDYA 4RD1A 1JR3A 3B3FA 1RBQA 1ZGHA 2C84A 1UPXA 3ITKA 4LZNA 4R9SA 4YBZA 5F35A 3K6SB 1J8VA 3GFTA 1BWPA 3OH8A 2C4WA 4KQKA 4R05A 4Q3KA 1CU1A 1KY2A 4S1OA 1TYBE 5D1HA 1XT6A 4BVFA 3Q5GA 4BO7A 1Y8QB 4MQEA 1DJQA 1EVJA 2OCIA 2O06A 2C95A 5HOQA 1PVOA 4JLMA 1I2ZA 1EBBA 3F4KA 3S2YA 2DSNA 3WWEA 4CTJA 1XROA 4TLEA 4UQOA 3PNOA 4I6EA 1LFDB 2B3DA 1LBHA 1G4UR 2Z5LA 3HKDB 3KOMA 3NIFB 4U00A 1NRWA 3SFTA 4BB9A 5B7NA 5BYJA 2PWAA 1SN7A 1T4GA 1IAVA 2EKDA 2RGGA 3GFPA 1P39A 4LNUB 2GLTA 3NUQA 2PD4A 4M76B 3ZIDA 4RBNA 3ST7A 1FMFA 3PU6A 4IUCS 1AC5A 3OLXA 4TVOA 5KBYA 1KY4A 1EVKA 2C5SA 2EL7A 2FUNB 3YASA 2FFQA 2IXTA 2YZ2A 2OHJA 1UBJS 2X5XA 1PGOA 4TN1A 1ZA1A 2VHVA 2D1TA 2Q5IA 1KA9H 4OHZA 1P5ZB 4HH4A 2AOTA 2BFFB 1RWKA 4C2UA 2FE4A 1WMSA 4QGFA 1Y33E 1KVQA 3CRZA 3KT8A 2E5LB 2C04A 4J1TC 1A3CA 2ENUA 4YQFA 1KNQA 1P72A 1QIEA 3Q3VA 2BLLA 2BTQB 5SZKB 1TMKA 4MEBA 3WGVA 5KYYB 2IH2A 4FNOA 3J7TA 3H42B 5JIBA 3HJNA 4JYMA 4FYYA 5J5AA 1Q1AA 4RQTA 1J2UA 3ZGOA 4EFDA 4RY8A 1I2CA 1O77A 4YJ2B 3RU9A 2XCTB 4IAOA 2H65A 2IW3A 1PVVA 4AYTA 1SWWA 4TSRA 5KYUB 1HZZA 4DR5B 3THRA 1N7JA 5CT6A 3ZJ5A 1UFKA 4FYJA 4JP2A 2O14A 1PGPA 4DJTA 2PGDA 3G2PA 5CYFA 4EX6A 1KIMA 1ABBA 2BE9A 2I91A 1LK7A 2OPHA 3A70A 3I5MA 5DNAA 5CW2A 5FL7D 1PWHA 2Q3FA 4GLOA 4J43A 1ZCBA 3GWGA 2FNAA 3KAQA 3OWHA 1HL7A 3WISA 1ZCAA 4AC9A 2G07A 2FEAA 4PLZA 3SYKA 1Z8NA 1JLHA 2VUTA 4I5GA 4RQBA 3PJRA 4O4HF 3AY7A 4JHXA 4UBJA 2C8KA 3TDKA 1FRVA 3UJPA 3D64A 4WCFC 4BNYA 4V0MA 1IL0A 1LLQA 3WP0A 1CUXA 4WNCA 1EFPB 1DARA 2ORWA 3GPLA 1IN4A 3M6WA 2B82A 1USGA 3B7WA 3TXYA 4CN9A 1K1EA 4RTQA 4MB0A 5TSDA 1E2PA 3N3BC 1M10A 4LA4A 3CJRA 2W6ID 5EJMA 2PSEA 1CR0A 1REQB 2C54A 4N6OA 4RORA 1H69A 3MD9A 4ABYA 1GTZA 4EA9A 1WCIB 4IGFA 4XDYA 1VZ2A 3H2IA 2CK3D 2DPHA 3D3WA 3RU7A 5HJ5A 3NW9A 4S2EA 5GZ1A 2XV1A 5A5VA 2RE8A 2YWCA 3K7EA 2VT7A 1BD3A 2DHRA 5CNIA 2GBGA 3D2LA 4KXWA 1W88A 1AF4A 2XUKA 4GBMA 3ELUA 1FYWA 3HDJA 5GIPE 3VPXA 4DZTA 1BGVA 4HXFB 4QGHA 2BL4A 1SBYA 3L7OA 2HA0A 3MCZA 3TF5A 3AIOA 2HO4A 1PZFA 5ALIA 4D9GA 4HBGA 4BAGA 3TEJA 3BBLA 3LS2A 3LLVA 4L28A 3COVA 4TQUS 1OYOA 3H3FA 3OUTA 4B8YA 2YV4A 2YXEA 4HUJA 4CMIB 3LUHA 1XVUA 4KOAA 2OQIA 4OREX 1UXJA 3ND8A 3KVNA 1P3JA 2XBUA 4NATA 3RG2A 1DLJA 3HCAA 3IA7A 4H3VA 3OFND 2FPMA 3K2EA 1M9NA 3O4RA 3KBBA 3PT9A 2B4TO 3DHVA 4RHEA 1FTQA 1NSTA 2W2LD 1G8JA 1XRLA 2OO7A 3PPXA 1GGMA 3LHIA 3TMKA 3ET5A 1P0QA 1R4NB 2X5KO 2DKOA 1GLGA 4REMA 1CK4A 5JJKA 1OIVA 4IHJA 1E9CA 3UAWA 3R20A 4DV3B 4QM6A 1Z3CA 1PAUA 2F3PA 2NAFA 3W6PA 3DDNA 2P6PA 4EO7A 3C0KA 2LD4A 4HJXA 1KFKB 3ZHTA 2VG8A 2SKEA 1UMKA 4NAUA 2B20A 3ONDA 1MEEA 5MN4A 1JU3A 2X2EA 4YRIA 1PYDA 2D1SA 2R6HA 3JYPA 4MUEA 3RASA 3X1MA 1GNQA 2GN0A 2IZ6A 1SA0B 1Z5NA 2QX8A 3BXZA 1YZTA 3E15A 4J1TA 3C98A 1PGQA 4LSWA 3ZWWA 2A86A 2GAJA 3R6WA 5CVTA 2TMGA 4ND5A 4QDZA 1YZLA 1M5RA 3KSDO 2QX4A 3C8ZA 1R0LA 4BO4A 3HR4A 3LQFA 3HPRA 1UQUA 4OQXA 4PLTA 1BW9A 5J9FA 7YASA 1OI2A 4P6VF 1ULHA 2GRAA 2VSYA 4RA6B 5AVSA 2YS7A 3AB7A 3GAZA 3ICVA 3HKBA 3T5DA 2BCGY 2JLAA 4E70A 2C2MA 1P62B 2OCKA 3CLVA 1Q83A 5BSWA 1OIXA 3PRJA 3WIVA 3LCMA 1DINA 1C7JA 1GOTA 1KSJA 1NMSA 3ILVA 4I0WB 2DKFA 1AQNA 2I3GA 2J4CA 2AOXA 5CCDA 5H68A 4K9LA 1ZOPA 2E49A 2Z56A 4X63A 1GAJA 4LF7B 2O1XA 2ID9A 2JNWA 2RGRA 5C1IA 3OF2A 2JJ2D 4QHSA 4U5QA 1MZVA 2JRLA 3ZXXA 2Z2JA 4CF4A 1ZW6A 8ATCA 5JAMA 2BONA 1X86B 3TW4A 1Y6FA 1SH7A 4HNHA 5FKJA 3ROZA 1ADCA 2QX9A 3QTTA 4JWKA 5DCUA 2B5WA 2GCOB 4M89A 4WCFA 4V1CA 3KOZA 2IF2A 3OZBA 2E4YA 4MOWA 4NZZA 4GKKB 2XTJA 4A0QA 1WHSA 2XMGA 3L7DA 3UWPA 1FTNA 1HMPA 2ZBRA 1PO7A 3U26A 1G20E 3PHLA 3DAYA 4GOKA 4C4PA 5K45A 2JLRA 1E2JA 5KQMA 1GPWB 5DTQA 1CJKC 4IIXA 4OCZA 1HNNA 3KQPA 1D5WA 4QJIA 3UMCA 3QJGA 3P0EA 3V55A 2JARA 4UM9B 3SR0A 1ZD1A 4IH9A 4Z0PA 1RTKA 1LSJA 1Z82A 4GGOA 5LQAA 1N6KA 3HQ4O 5B37A 3H1GA 2VQFB 2H2HA 5DM60 1Q44A 2PMBA 4EYOA 1JI3A 3BGIA 4O8ZA 3FZEA 3T8YA 4L5YA 3ZTTA 2POCA 3FIUA 2BKUA 2H5JA 3PXGA 4BZZA 5CDHA 3EZGA 3IAXA 4KUGA 4J16C 1M34B 2P30A 3BJEA 2H5IA 1QS0B 4E5KA 1GGHA 1BWQA 1KEWA 3COPA 2A33A 2OV4A 2ISQA 4PIVA 4QULA 4N0QA 5DBGA 3NANA 4DIKA 1I7LA 3NV7A 3NKVA 5IZ4A 3PFHA 4QBGB 4ALNA 5C3MA 3AY0A 2P4UA 1UF9A 1G9TA 2IPAB 3H19A 3HHEA 4GPIB 5DEIA 3OQ1A 5BSVA 4A10A 3BL6A 4WXMA 3PC4A 4D57A 2YNMC 3D7MA 5IPFA 1DKNA 5LYJB 1SUDA 4DVJA 3E18A 1FVXA 1MQSA 1WF3A 4C4YA 3RYCA 1C50A 2W6ZA 3ANLA 5FTNA 1D1SA 2WWVD 4ND3A 2C98A 3VOTA 3OSUA 5E4YA 5JJLA 1JTVA 1UL1X 2R86A 1EVLA 4NHEA 1V6CA 2FK8A 1IUKA 2IHTA 2FQXA 3HDYA 3NTRA 4X85A 1HLGA 3KHSA 5JNUA 4FMCB 3A28A 3JYOA 2DOKA 5CVCA 5JR3A 2A9OA 5HBGA 5LQCA 1DXOA 2EBFX 1DAEA 4J3FA 1N3BA 1OFTA 2QSYA 3MJEA 3CURA 4XA8A 1DFGA 4BLPA 1PJCA 1YRLA 2FPIB 1EXNA 3CLSC 2QI9F 4UAJA 2PYIA 5E1BA 1GTVA 4KHPB 3GZJA 3DOFA 4RKYA 4B7CA 4BKPA 3GMTA 5IXJA 1U7HA 2OHIA 1BCSA 1UDCA 4DEVA 4LMAA 4Q3OA 4D2IA 1VFPA 4P36A 1VKJA 1QYIA 1MB0A 1BHJA 4KXXA 1A0OA 2F43B 4O8CA 3O8QA 4PYLA 4U4AA 5EWLB 3UH1A 3NRCA 1QR2A 4C4AA 2CNDA 2M1XA 3OU6A 4G0MA 5KYXB 2ZRNA 1JFRA 3PKIA 4LIPD 4OKIA 4E2YA 5ELLA 4A8JB 1VDMA 1XXHB 4HPJB 2QTHA 4EZIA 2I4TA 2YV1A 3RBXA 5EKUA 4KI7A 3H6HA 5DCWA 1TA4A 2B2XA 3BH0A 1AB6A 3IQFA 4EI8A 1WZEA 1MN6A 3VPDA 2IP1A 1DE0A 2NUPA 3RCBA 3TVYA 3ZVRA 4BGUA 4E30A 1HYGA 3CVOA 3FKJA 2AFIA 2EG9A 3LYLA 4F1KA 3QE2A 5CB8A 3MBIA 1KZ4A 4KWHA 3W5DA 7GPBA 1RPAA 3IV9A 4FUQA 3CU5A 3I01M 4O02B 4II3A 3WL3A 3ZYCA 3LGSA 4G07A 2X7JA 4JUDX 4LE1A 4PC1A 3WLRA 1JDZA 4YCCA 4I5EA 3VDQA 4I1YA 5EHQA 2AFHA 1N5RA 3PNSA 1IY2A 4HGRA 2JGLA 3ND6A 2ZRBA 4GNKA 4XYMA 4HRVA 1D2GA 1KP9A 1P1IA 4JLJA 4QNNA 3OQPA 2VYVA 5BWNA 3QQ5A 4GZMA 1BFUA 4QYXA 4ZI5A 4I81A 1XMQB 1XZBA 1GPDG 4O2LA 3H5NA 3N2LA 4RK0A 4OX9Y 1FF9A 1KZ9A 1RYDA 4QVGA 1YRAA 2REXB 4IJ5A 5ADVA 3HO1A 3VR4A 3UMVA 3ZVMA 2ZI7A 2DLCX 5FD8A 2NXWA 3D6TB 4HLDA 5K4GA 4LJSA 1XDGA 5HGXA 4Y6SA 2WU3A 1UC9A 1SXQA 3FKQA 2QRLA 1GGJA 3TOVA 5IFLA 4D8VA 2V3CC 4ZHQB 2AI1A 2ZJ2A 3TR0A 1GZ5A 1PRYA 3PWSA 2QG9A 1QJ4A 3QLEA 1VOTA 1MA0A 3WO0A 4MUNA 5C1DA 5CEJA 1JB1A 1M2EA 1YK0A 2B6NA 2ZYTX 1HRDA 4P0TA 1K6EA 3OT4A 4I3FA 5CB6A 2G1PA 5CG1A 1KR2A 4UD6A 1E3QA 1LZKA 4UDYX 3V7FA 2EBUA 4AVYA 1FVHA 2C83A 2JDIA 3GNTA 4J16A 1KKUA 2PLWA 2Y3IA 5K0ZA 3KZKA 2UUPA 1EA5A 3T9DA 4B6JA 1SXGA 2D0IA 1MDFA 1E32A 3HYSA 4J1NA 3WB2A 1BZYA 1PL0A 2CXUA 2FSPA 3WRXC 1E92A 3IBTA 5AKEA 3SFZA 3LV8A 1EGAA 4BE4A 4F92B 4GXTA 1L4YA 2ON6A 3TIXB 4M1OA 2P35A 4DAEA 1J1IA 4RK4A 2ZANA 1NT4A 5GOZA 3VR6D 3LPAA 2G6TA 2YNMA 2FRDC 1KDYA 4YFYA 2XAUA 2ANBA 4XLLA 4LX8A 3MJTA 5E9AA 2X3UA 1I3MA 3JAWA 2Y1XA 4ZJYA 5F3DA 1DI0A 1XVTA 2ATIA 1KSFX 2WU8A 1WZNA 3EZNA 3INNA 4H27A 4HB0A 1Z18A 5ESDA 4EUFA 3FBWA 1M67A 3C6XA 3IDSA 3B1VA 4GMGA 5AJVB 2IPNA 2WG0A 2FSIA 4JHLA 4KXNA 5B1HA 4CDRA 5CA1A 4RH0A 4HWKA 5LDGA 4G26A 4FB4A 1E60A 4LTMA 1CUWA 1DKMA 3G5LA 3S70A 3OO1A 1SOAA 2DJIA 2H9IA 1DP4A 3ASYA 4HO1X 3DGEC 1BX1A 3GUUA 3K32A 4LOIA 4D3SA 3UT6A 4Z54A 5B3KA 5M29A 3LU1A 1V5EA 3CMMA 3WBFA 4E1VA 1JMVA 1JKIA 1K06A 5CXUA 1DUSA 2G9UA 4D74A 1WAMA 4BO8A 4BC1A 3TGPA 3KSMA 2WM8A 3QITA 1W9HA 4AO6A 2ZJAA 4LJ7A 1VBNA 4LDZA 3VHLB 4Z7NB 2BM8A 4URWR 3P19A 1TLFA 2Y27A 1RKQA 1W6RA 2PX8A 2QXUA 3QXJA 5JPCA 4YR7A 3IKMB 5JD5A 3H2YA 4QDUA 2QRQA 3ZBQA 2WIKA 2BDTA 1A5ZA 3RWBA 3L2OB 1AKWA 3AHIA 4QQNA 5AUPB 4MS3A 1ZLYA 3HY6A 3EG9B 3F97A 4P3PA 3N2KA 2O8FB 3JZMA 2JW5A 2ORVA 3PEVA 5A3QA 3QSGA 3MMXA 4DV2B 4XX0A 3G9XA 5GAJA 3HI6A 3EF1A 5C5DA 1AB5A 1TGVA 4G1VA 4Q1DA 1WDKA 4ZCRA 2VZ9A 3EGWA 3S6JA 3RYFA 2BI7A 3T0FA 3CJQA 2P4QA 1FW6A 1HX7A 1O95D 4YO8A 2D13A 3CLUD 3K70B 3MMNA 2RC5A 3BKWA 3D6HA 3FNGA 3O47A 2D2XA 1UQTA 3I6YA 5BNWA 4OGGA 1V5GA 4K46A 3FRJA 4W5OA 3ZXIA 1SIOA 1NGSA 2GR9A 2OZEA 16PKA 2H16A 3NHRA 2IIVA 2OB2A 1OX5A 5FA8A 1EP1B 1PX2A 2QTNA 1RMYA 1MX1A 1C14A 2J5QA 4PTYA 2QQGA 5JW6A 3F6BX 8GPBA 2JIZA 2BM9A 2YJNA 3UV6A 3VV2A 5KTOA 4N65A 2YZ7A 4OL0A 2WSLA 2XXAA 2HKIA 5IJ0B 2CFTA 1U2SA 2X86A 2AMLA 2C9DA 3UUEA 1QO0A 2JA2A 3K4HA 4DLPA 1PJTA 1VE6A 5FNZA 1D6MA 3ZE0B 4CCWA 5A5FA 3U7HB 5FULA 4EY5A 2QP4A 2FZLA 3IQXA 4E5VA 2EP5A 2JEZA 3EHDA 2XUOA 2F64A 4R4JA 1F9AA 4GI2A 5C52B 5A9TA 4MRSA 3C5CA 1NRJB 4JVSB 1H9CA 3NNDA 4PQYA 5DBEX 3DEJA 3WRXA 4WCVA 4RZQA 4EJMA 2B7CA 1Z45A 1BRMA 3PXCX 5TGTA 3SHVA 1GGFA 2QUIA 4HMOA 1JPUA 3BK7A 3CNEA 5C3UA 6ABPA 1JA0A 2BZGA 4KR7A 1XJQA 2E4XA 3HKCB 1P1HA 1QH8A 2FRDA 3IB3A 2Z58A 4IIJB 2QRNA 4PYQA 4Q3BA 4JJ4A 1RJDA 1Z7BA 1RHRA 2IYSA 3O1JC 3VNQA 4F7DA 3DE5X 1SC3A 1IOVA 3A06A 3I52A 4PSAA 3ROEA 4IDBA 4M4SA 4B6OA 2CWDA 3OESA 2C5BA 1KF0A 2VHZA 3K9GA 4BNDA 5BQ3A 1ENPA 3EVBA 1N5OX 3ED1A 3KB8A 4ZALA 2B8JA 4UCFA 4X20B 5ELXA 3T1TA 3H13A 2N42A 2OFFA 1XKLA 2VHQA 5AT1A 1BKSB 3QMMA 1O97D 1Y4SA 1WLYA 2E4VA 4PLCA 2J3HA 1ESMA 2IPOA 3K1ZA 4OJMX 1GR0A 3CVWA 3DO6A 2LNDA 3VH3A 3ND7A 3S7TA 1QLWA 4BZXA 2AC2A 2PX0A 4L07A 4RD3A 4YAEA 2VP4A 5IG2A 2BEVB 5JYBA 4B75A 4Z6KA 3FLBA 3PL5A 2XXBA 5JRZA 1I01A 1M7HA 3AW8A 1GPYA 1FDIA 3VR2A 1U0OC 3R0XA 1JAZA 1RKXA 1NW5A 1SQ5A 2COEA 1VCMA 1ZUNA 3KQWA 4JX8A 2OQ2A 2VATA 3CUKA 1YTLA 2ZPUA 2AC4A 3OIDA 4H4EA 3G2LA 3QNUA 4DBLC 3QE4A 3KR2A 2ODEA 3ET4A 2BEWA 3RRYA 5GADl 3IKTA 2R25B 4HQLA 1RRMA 1OB2A 1Z47A 5LQNA 2PIAA 4TYMA 1HE8B 2IYEA 2D5CA 3ZV7A 1YA4A 1C2TA 2JAQA 4PAQA 2AKEA 4FP9A 3BE4A 1W36C 1LX6A 1YAHA 2ILVA 4IHAA 1OWMA 4EPVA 1UWVA 1USUA 4OY3A 3N76A 4MYHA 1LPMA 1E1QA 4TKVB 1L7NA 3TPFA 1X7ZB 2YX1A 4F6CA 4RMJA 1Z34A 4KN8A 1QB8A 2R6ZA 4XGQA 3AETA 2QTBA 1VQ1A 1NOIA 3C3CA 2FOIA 1FLVA 2XCQA 3C8HA 1U2ZA 1N5KA 1BXKA 4IOMA 5ALWA 3ESCA 3SR3A 4JASB 3UBTA 4ETMA 2UXDB 2PCJA 1KI9A 3ZXSA 5KKCA 3CZQA 2FH5B 2JFZA 1Q16A 5D6OA 2HV9A 3UXMA 2G70A 3TVDA 1U3UA 2RKWA 1R5NA 1Z88A 4IZOA 4M0LA 3SFVA 3RK1A 3PFCA 5EVJA 4IYJA 1X8KA 2WVHA 2XE8A 2JLVA 4JP1A 1PW5A 4UUQA 5DLEA 1U02A 1A4IA 1LJ8A 3W6ZA 3ZD8A 1NUHA 2MWMA 1S9HA 1XLVA 4EEXA 2JFNA 2FDCA 1TADA 2I8CA 4DMHA 4R3UC 1OZ0A 2VT2A 3O3CA 4J6EA 4YP9A 4DDUA 2PT9A 2RCYA 2X0JA 2QL7A 3K1AB 1ULUA 3VHXA 2IYNA 2XZPA 3LJKA 1UBFA 2QSUA 4K9KA 4BECA 1TF7A 1TQ8A 3BG5A 4UOEA 1XV5A 2HLHA 3WBJA 3EAQA 4QU9A 3QPCA 4JKIA 5ITSA 1Z4JA 5CCXA 1NBMD 3HYRA 3WYAA 1JI0A 1ZU5A 3PL1A 4KXYA 4N47A 5BNTA 5AIBA 1GILA 1YUNA 2KMLA 5J59A 1I14A 4TYWA 5IF9A 2DZDA 4BEJA 3MS7A 3OHMA 3H2GA 3N5KA 5L4SA 1RM4A 3K1YA 3RKRA 4LE2A 4BYGA 3V42A 4YYEA 2XB8A 2B9VA 2IODA 3RT1A 2VBIA 3CW9A 2ZTLA 2G71A 2VIIA 5DM2A 2HMAA 3E7PA 3U3OA 3RGGA 1Z4NA 2G1KA 4Q02A 1MX3A 1ZM9A 1QIMA 4HHEA 1DAHA 3C3PA 4K8OA 2REQA 3HH8A 2WT8A 4M1SA 4V0NA 5IMBA 3UK2A 2VAVA 3QEBZ 1ZUD1 1GZSA 1VRWA 1G6OA 4IZ6A 5CX1A 4JXJA 3SNHA 4OHWA 5GY7A 3GEBA 4G1BA 1OU4A 2NTVA 2QPOA 4PNHA 3UWMA 1JPVA 4DR7B