3CC8A

Crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
211
structure length
211
Chain Sequence
AVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVSHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative methyltransferase from NDP-N-methyl-L-glucosamine biosynthetic pathway (NP_977653.1) from Bacillus cereus ATCC 10987 at 1.64 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transferase
molecule keywords Putative methyltransferase
total genus 63
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3cc8A00
1R8YA 5EHGA 3G7UA 2H11A 5CCXA 3MB5A 2PWYA 4QPNA 2BR4A 3HP7A 3E05A 4QVGA 3JWIA 4WXHA 1YZHA 3LL7A 5F2NA 2AN3A 1XDUA 4IV8A 4PWYA 4BP1A 2CKDA 3R24A 4KVZA 4A6EA 4RTJA 4PCLA 3R3HA 1NV9A 2PT9A 2ZSUA 4FR0A 1RJEA 4GUAA 3KQOA 4HGYA 5E9QA 2ONYA 3P2KA 4ATNA 4C07A 5GIOE 5HOQA 1WXXA 1BHJA 4FT2A 4KIFA 3CBGA 1G8AA 1RI2A 1M6YA 3HNRA 3MGGA 3S68A 2O0LA 3OZTA 5GM1A 3SSOA 2XVMA 5GP1A 3BWBA 3E8SA 5DTRA 1R74A 1NW5A 4OA5A 3A27A 4X41A 1TW3A 3FUXA 1WG8A 5K03A 3FUTA 3G88A 5EKUA 3TKYA 5FUBA 3UA3A 5LQAA 4R6XA 3PFGA 4M7RA 5E8RA 1EG2A 2K4MA 2UZ4A 10MHA 4DKJA 1VP3A 3K6RA 4IKPA 2LD4A 3A7EA 2PBFA 3KR1A 5EEGA 1RI3A 5EIWA 2PXAA 3TR6A 2IBSA 5K0CA 3SR4A 4PYOA 1JQEA 1KR5A 2AOVA 5EOVA 2NYUA 4DQ0A 2PX4A 1DUSA 4PYLA 5DPMA 5C0OE 3GWZA 3ELWA 2YTZA 5ICCA 3M33A 4HTFA 1XJ5A 3CVOA 1RJDA 3UJ7A 2AVDA 4LECA 3T7RA 3E7PA 1SQGA 5E1MA 2ZVJA 4RTRA 3B3JA 2NNWB 1H1DA 1ORIA 3R9XB 1NW7A 5E2AA 4YUVA 3ERCA 5CM2Z 4HTFB 4R8SA 2VDVE 5DM1A 2ZTHA 3IYLW 2ORED 4GF5A 3ME5A 4BLVA 3HCFA 1EJ0A 3NWEA 4M38A 3AXSA 3B7PA 5CVVA 5FHRA 4OX9Y 5K0JA 3TM5A 3QV2A 1RI4A 2ZIFA 4PONA 4C06A 3PTAA 1YZ3A 3FZGA 2PJDA 2EFJA 3NTVA 2P3LA 3GCZA 2GAFA 3UBTA 5E8JA 2GB4A 2E5WA 2AOWA 2AOUB 2V74B 4DZRA 3DXXA 1JSXA 2GPYA 3KQTA 1T43A 5ICEA 2NP7A 3PVCA 2WK1A 1JQDA 3MCZA 2BM9A 2CWWA 2G8NA 3FPFA 3FPGA 1VL5A 3R0QA 3AY0A 4YV2A 5BW5A 1ZQ9A 1RJGA 4GQBA 3TLJA 3JWJA 3FUWA 3OZSA 2XYQA 3P2IA 3NDJA 3O4FA 3RODA 5DT2A 3G8BA 3KR0A 5EKXA 4E2ZA 4EVIA 1Q0SA 2R6ZA 2P7IA 3DXZA 2I6GA 1KYZA 3C3YA 2XYVA 3L8DA 3GU3A 4ER3A 4PGGA 2ZBPA 2NXJA 2PXCA 1P91A 4A6DA 2GLUA 1F38A 3NMUF 4HSGA 5LQUA 1TW2A 2BR5A 1JR4A 3C6KA 1EQAA 3BKWA 2PGXA 3FRIA 3IV6A 4IV0A 5LSAA 1BKYA 3ER8A 3KPYA 2JHPA 3ID6C 4YMHA 4GOOD 2B78A 3EVGA 5CVDA 3CGGA 4PNEA 5IKMA 1KXZA 3BKXA 4RVGA 4XCXA 3VC2A 3TKAA 1Q0TA 3BXOA 2FRXA 5KVAA 3P9IA 2VS1A 3LX6A 2BR3A 1M6EX 3GRRA 3MAGA 1DL5A 5LQCA 4HRAA 2HV9A 1KYWA 3G2MA 3LDFA 5DX0A 3DTNA 1KHHA 1EJ6A 2HNKA 3PS9A 4QTUB 3TRKA 3BWMA 2FK7A 5FWAA 3UJDA 1IM8A 3REOA 1UIRA 3OE5A 1G8SA 3UJ8A 4QDJA 3UJ9A 3GJYA 3EPPA 4E31A 4DMGA 3KR2A 3GGDA 5D1NA 3HA5A 3BT7A 3NVKI 2BZGA 1QAMA 3FTDA 1KIAA 2B2CA 1YB2A 5K0LA 4AUKA 1UFKA 1VLMA 1SVUA 2HTEA 1N2XA 1I4WA 3LCCA 4RVHA 2O06A 3DXYA 5D1HA 5EZSA 4RTQA 5CCBA 4E2WA 5CVEA 2PX5A 4P7FA 2ZW9A 2FHPA 3QOWA 4R05A 5FTWA 4ER0A 2YXDA 5HIKA 4RTNA 3DP7A 4QQKA 5E1BA 1XDZA 3MTEA 5JUWA 3PFHA 2C7QA 2WA2A 2IFTA 1HMYA 2BM8A 3AJDA 3OU2A 2P3QA 3HVHA 2OKCA 2IP2A 3DLIA 2YQZA 3P2EA 4FT4A 3TM4A 4BLUA 2OY0A 1IY9A 3P9KA 5LQRA 2B25A 5K0FA 3EVDA 5E2BA 2O05A 2ZBQA 2Y1WA 3GNLA 3KPUA 4PCAA 3HCBA 4KRGA 1XCJA 3UJCA 1ZHFA 1RI5A 2PX8A 2YX1A 3AWIA 5DSXA 5DXJA 2PX2A 3F4KA 2QRVB 1R6AA 3CJQA 1P39A 1JG4A 1PRYA 1VIDA 5CVJA 2QY6A 3OU7A 5DTMA 5EPEA 2ZZKA 4BP3A 3EVEA 1D2CA 3LCUA 3ER9A 3WSTA 3HVIA 2VDWA 5K05A 5K09A 1QYRA 2Z6AA 2I9KA 4PIPA 4QVKA 3LCVB 4H0NA 4GOMD 5DX8A 3C0KA 1Y8CA 3LHDA 4U7TB 5FADA 7MHTA 3FTFA 2I7CA 2NP6A 2OB2A 2ZLBA 5G02A 3A7DA 4HH4A 5KQRA 2PVCA 5DWQA 5HEKA 4ER6A 4M36A 2OYRA 1JG3A 1XDSA 1PJZA 2IPXA 5KS2A 5K0BA 2Y1XA 4KDCA 3OPNA 3NDIA 4KW7A 4CTJA 5FQNA 2OO3A 3BZBA 2C7RA 3PT9A 1I1NA 1ZG3A 1N7IA 4IWNA 3Q7EA 2PLWA 4C04A 5EMKA 1SKMA 4PYIA 2ZCJA 4LWOA 2JHCA 4QQNA 3FYCA 2G70A 3P9CA 1YF3A 4QDKA 5DSTA 2PWPA 4RTMA 4YUXA 2N47A 2QE6A 3DH0A 3G5TA 2XVAA 2ERCA 5EHIA 2Z6UA 1QAQA 3SSNA 2KW5A 3TQSA 2AOTB 3FRHA 3LECA 4V0QA 5FHQA 3V97A 3MHTA 2IBTA 2AN5A 5C1IA 5CIYA 2XYRA 1R00A 2R3SA 2O57A 3ELDA 1AF7A 1X19A 3EMDA 1VP9A 2G72A 2OBFA 2EJUA 4E2YA 3LDGA 3NWBA 4PYJA 3M6XA 4AX8A 3KPWA 3FPEA 4R6WA 2UYHA 2IH4A 5K0EA 5F2KA 3TFWA 3I9FA 3MTIA 4KIGA 3M6UA 3EGIA 5EZQA 3A26A 3UWPA 2P3OA 5DX1A 2C7OA 4OQEA 3D2LA 3CJTA 5JR3A 2QM3A 3GRYA 1G38A 5DLYA 5BW4A 4O29A 5LQJA 1NBIA 3RW9A 4Z2YA 2PT6A 4X61A 2FCAA 3JWGA 8MHTA 1JTEA 4YUZA 3A4TA 3M6VA 1QZZA 4RTLA 3OU6A 3CC8A 1ZKDA 4XUCA 5CVUA 3I64A 4P7KA 3O31A 4YUYA 2OPBA 1M0EA 4V0RA 1D2GA 1N7JA 3TMAA 3M6WA 4E33A 1L1EA 4C08A 2Z6QA 3KPJA 2VDUE 2A14A 3KU1A 5HILA 5DM2A 3A25A 2PSSA 4EMSA 5DRYA 1VPTA 1Z3CA 3LGAA 5F2OA 1AV6A 3GRVA 3SGLA 2PXXA 3KQSA 1G55A 3NW9A 2GS9A 3G8AA 3FUVA 3GDHA 5MHTA 1RJFA 2AZTA 3JWHA 4Y30A 5ERGB 4DA4A 1QANA 3EVBA 4GOND 5H02A 3KPVA 3CJRA 3DMGA 4UOEA 2EX4A 3T0IA 1YUBA 4BY9E 1X1CA 3KHKA 4FSDA 3K0BA 2ZFUA 2EG5A 3BGIA 1JSZA 4GC9A 5KQSA 4DCMA 2IH2A 2ZBRA 3ELUA 3EVFA 5EVJA 5LQKA 2YR0A 4QTTB 3SVZA 1TPYA 2P41A 1KPHA 5EGSA 1XXLA 4E70A 3FUUA 1NW6A 1SQFA 4GC5A 2G71A 4C03A 2QYOA 2P1DA 4F84A 5C9ZA 1P1BA 4HGZA 5EMLA 2UYCA 1MHTA 1FP2A 2VZ9A 3OE4A 2CMGA 5FCDA 1AQJA 1VQ1A 1JG1A 2NXEA 2CMHA 2B9EA 3RIEA 1ORHA 1DCTA 2P8JA 2GA9A 3G5LA 1G60A 5LQNA 1BC5A 3CKKA 3UJ6A 3OCJA 3MERA 4EQZA 3UFBA 3KQYA 4KWCA 1SUSA 1XVAA 5FQOA 5FWDA 1JTFA 4EK9A 1YFJA 2VP3A 4QPPA 1JQ3A 5CUQA 3P97A 2H00A 2AOUA 4F86A 5IH3A 2F8LA 3KQWA 2HWKA 3C3PA 2DULA 9MHTA 2AR0A 1VE3A 4RX1A 3IHTA 2ZULA 4JXJA 1KPGA 2AS0A 3I53A 5DTQA 2IGTA 3HA7A 4PYKA 4CWAA 4P7GA 3TPZA 3HTXA 4G56A 4E2XA 5HIJA 2OZVA 3FTEA 2AN4A 4PGHA 5DXAA 3VYWA 3GRUA 4FSXA 5DM4A 2AOTA 2HMYB 3DMFA 5E1DA 2JH9A 1WZNA 2AVNA 1WY7A 1FP1D 2I62A 3GXOA 2O07A 3UA4A 1X1AA 3HCAA 5GM2A 3NVMB 4OBWA 5HIIA 1VBFA 1NE2A 3DR5A 5EIFA 2Q41A 3M70A 1EIZA 4AZSA 1O54A 3G89A 1X1DA 3B3FA 4RYLA 2JH8A 3AXTA 3SM3A 3OFKA 3SSMA 4CKCA 2YXLA 3FPHA 3G2PA 4RVDA 1RI1A 3DMHA 1WXWA 3EVZA 5KYGA 2ZZMA 1ZGJA 3G2OA 3B3GA 2GH1A 5DRTA 1O9GA 5B1SA 4AZTA 4RTKA 2QRVA 2ZWVA 5FA5A 4KDRA 2ZWAA 4U7PB 2FPOA 3HM2A 4OQDA 3KQVA 3LPMA 1WS6A 4FP9A 4WVLA 2C7PA 1HNNA 2JHAA 4C4AA 5HZMA 2AOXA 2ESRA 4MHTA 5BP7A 2XBMA 4RVFA 5ICGA 3SXJA 1V39A 3B5IA 3KQPA 3GIWA 3BWYA 4YV1A 4C05A 4P58A 3KKZA 2OB1A 3SMQA 1L9KA 4PYQA 5EMJA 1SG9A 1EAMA 1NBHA 2IDKA 3LKZA 2DPMA 4HG2A 3DUWA 3CCFA 4ER7A 3I5UA 2NXNA 3R6TA 4X1OA 3ANXA 1O9HA 1YFLA 1FPQA 4P7JA 4CKBA 1UWVA 4DM3A 2YXEA 3I58A 5EG5A 5E9JA 4ZTBA 2FYTA 3GRZA 4AZVA 1AQIA 3HA3A 4XUDA 2P40A 1OR8A 4E30A 3KR9A 3EEOA 4PYNA 5T67A 5GINE 3MCTA 2V7EA 4MQ4A 5E9WA 5HIMA 4YMGA 5K8VA 3PX2A 3IEIA 3Q87B 2PV0A 3EVCA 1NW3A 5M5BA 4CKEA 1G6Q1 2NXCA 3OZRA 4E32A 4M37A 5GOZA 4FGZA 2UYOA 4OA8A 1L3BA 3U81A 3V8VA 4OBXA 3EMBA 4CTKA 3PX3A 3KQMA 4R8RA 4RWZA 3LSTA 1BOOA 4X60A 1B42A 3HVJA 3LDUA 3G2QA 2IIPA 2P35A 3DLCA 2B3TA 3QOXA 5K01A 5K0GA 1IXKA 1XTPA 4POOA 4MTLA 1QAOA 4AZWA 1JG2A 4F85A 1P1CA 3P71T 4EKIA 4FZVA 4BLWA 2EJTA 3FYDA 4RTPA 3TOSA 1FJXA 4EKGA 4NECA 5ICFA 5T64A 3FPJA 3THRA 1FBNA 4RTOA 5FA8A 2HR1A 3UZUA 3DULA 3EEYA 5EC8A 1U2ZA 2WA1A 2FK8A 2CL5A 3BGDA 3HCDA 5BXYA 3VSEA 4Y2HA 1F3LA 3EGEA 2P7HA 3ELYA 1ZGAA 1R18A 3OFJA 4LWPA 4MIKA 4MWZA 3DOUA 4FS8A 5DM0A 4GOLD 4ISCA 2IH5A 5HFJA 3O7WA 2OXTA 3FTCA 4PIMA 5EQJB 3ORHA 5EEHA 3VC1A 3T7TA 4RTSA 1R8XA 3HCEA 5E1OA 2G1PA 1L3IA 5FULA 4XUEA 3T7SA 5CD1A 3HEMA 4YUWA 3THSA 1NV8A 2PKWA 3BWCA 3HCCA 1XCLA 2PY6A 2UYQA 3BUSA 1KP9A 4GBED 4L7VA 4ER5A 5LR6A 2ZIEA 1D2HA 1I9GA 3GO4A 3H2BA 4K6MA 4B17A 5T6BA 1SUIA 2YUIA 2JG3A 1MJFA 1NT2A 4PYMA 4CXMA 3LBFA 3SX0A 1X1BA 3PB3A 3B89A 2ZIGA 3LBYA 3UJBA 1KPIA 1NKVA 3BGVA 3HVKA 3KQQA 5P8WA 5EMMA 3C6MA 4PINA 3UJAA 2BH2A 4YV0A 2ONZA 3EGVA 3M4XA 4RV9A 3X0DA 3E23A 1INLA 4X63A 3PLAE 2ZZNA 3EVAA 3NJRA 1NW8A 3P8ZA 2H1RA 5GWXA 4DCGA 5GIPE 3LKDA 2IDJA 1L3CA 2JJQA 2ADMA 3MQ2A 3P9NA 4GEKA 4LG1A 4RSRA 5K0NA 5U4XA 4DF3A 2YVLA 4HC4A
chains in the Genus database with same CATH superfamily
2BKVA 4JVLA 2WJAA 2HJVA 4YGYA 3DZIA 2JH3A 4G4SO 4HB3A 4ZO9A 5D3MA 2A9VA 1JTVA 1R3DA 3V1TC 3W2TA 2P4EA 2SECE 3C5HA 4OJTA 4TV8A 1RE0A 4B09A 3HGTA 3QW4B 5IRCD 2XRZA 1JXAA 4B4VA 2PX6A 2YNMC 1W8DA 1DSSG 3KX2A 4LJ8A 3MTJA 1NW4A 1YJQA 3EPLA 3TNDA 3AO0B 2HK7A 4RLFA 4C07A 5C8DA 1T3ZA 4IDCA 2JGNA 2WKPA 3PCRB 4PZ0A 3S0JA 1UZLA 4KIFA 1QXSA 4L16A 4QYIB 1PS0A 4QU9A 2QUHA 2JVKA 3AKDA 4QUKA 2E2WA 4XWYA 4MJXA 2P9YA 4DVGA 1M3SA 2EWVA 2NIPA 1W8IA 1W85A 4MUIA 4WBNB 3U4QB 4IZOA 3II6X 2OAGA 1UKVY 4UHHA 3FUTA 2FSUA 4P84A 4IJVA 1F8FA 2Q4RA 2QMQA 4R6XA 3RRXA 3NM4A 4Y18A 3UN1A 4NCJA 4HYTA 1QX3A 2REXB 4IFTA 4QA9A 4AZWA 5A4MS 5BSWA 3C70A 5FB3A 3H0CA 2JCVA 4CHTA 1DJPA 2R1VB 3BCSA 3SR4A 1C9MA 4PLPA 1DQYA 3Q88A 1Z25A 1GGJA 4BB5A 4RKQA 1X2BA 3O8DA 4QQFA 1IPEA 3M33A 4MUAA 3WMRA 2DFKB 3DNMA 3D6MA 4L1KA 4NG5A 1WBDA 4GLJA 4M8SA 3DO8A 4OU4A 4G89A 1JQ5A 5TPWB 4G41A 2C7VA 3MRVA 4CYMA 5M29A 3RVQA 2PKYX 4EUKA 1Q7GA 1GDDA 1VFPA 1YIAA 2DSNA 5FBLB 3UUFA 5JHHB 2ZT6A 1I33A 4OQXA 2R00C 4JSTA 1G3QA 3RIYA 2WAAA 3WDKA 5A5GA 2IS1A 3OA0A 5EKDA 3DMTC 3VR2D 3DAGA 1E66A 1IK4A 2R6JA 3E27A 1RHMA 3AVQA 2JAOA 1VHDA 3D1JA 3EIFA 3GT7A 5DM60 1EP2B 4KAAA 1KZ6A 2PJZA 2QY9A 1WHTB 4KXQA 1WQ1R 4ZOBA 4ZALA 1W6RA 2FZ4A 2J8ZA 2NPIA 3B51X 3WYEA 1AKMA 2GAFA 1RPTA 5C34B 1ORRA 1XYYA 4HPWA 4D5EA 5JH7F 3G17A 2QZ4A 5L3QA 2IDZA 1UM8A 3DXXA 3W7AA 1OH8A 3KEOA 2JPDA 1ITZA 1Q92A 4TTPA 3MSXA 1OZGA 4QOGA 3N8HA 2IX3A 4OGFA 1NHWA 5HK8A 4G0WA 1V5FA 4QO7A 4XGQA 2RJOA 4L08A 4MVJD 1Y3AA 4RY9A 4EPWA 2DEUA 4MWSA 4RULA 3N05A 4NARA 3PR3A 1EE1A 2RB5A 4RH0A 5IAJA 2G9ZA 4YK7A 2WRZA 5ALPA 3BXXA 4OQ4A 1ONNA 3DXZA 1NVFA 1YHYA 2I6GA 2EBFX 4Q5IA 1K7FB 4GVXA 3OLWA 1XTSA 1U5BB 2E0IA 3L7NA 3L4BC 2OHHA 1JEJA 5D5PA 1ZGHA 2PXCA 1MQ8B 3AUKA 2ZB7A 3CZ4A 5HG0A 5AW8A 4JR2A 4FR2A 4NC9A 4G8CA 3W6ZA 1HBJA 4II2A 1IYZA 2ZQZA 4FYVA 2XI4A 5K3DA 1I3LA 1T2FA 4TV8F 3ND5A 2Q6TA 1V1RB 3DW1X 5CVDA 3M9LA 4PXAA 1TUBB 1EFAA 1OYVA 4XLTA 4RL4A 3KT3A 4GDMA 4Q9DA 2WIGA 1R88A 5FLYA 3T7IA 2LVBA 4MW9A 4KE7A 3RU2A 1GNQA 1ZVQA 1SURA 1JKIA 1U81A 2HAEA 2E49A 2ZYAA 1P4AA 4FGUA 3FDXA 3E3NA 2AQKA 4PBSA 4RF2A 4MPDA 5ILQA 1P2VA 3HB7A 3F6CA 1EJ6A 3EXFB 3D3WA 1H05A 5FWAA 1SVWA 2BISA 3UJDA 3P7MA 1IM8A 4BNFA 2OXIA 1UXJA 3TOVA 1AS3A 3DZ8A 2D7DA 3WJ2A 3ZN2A 1ULTA 1U0EA 4IDOA 4NNJA 4ADSG 1M0WA 1TQDA 4LZLA 4MQ6A 5DGIA 5CA0B 2ZBVA 3F6EX 1FTWA 2XUOA 5H70A 5HRCA 2W2QA 3Q7PA 4JR0A 4BO9A 1KIAA 1ZK4A 1HK7A 2QP4A 1Q95A 2BEVA 4QSMA 3IDSA 3TDNA 3V34A 2B2CA 3DAPA 4BMXA 1ISFA 1BDJA 3UB2A 1A5ZA 3IAUA 2MWMA 3X44A 1NXTA 2CFIA 4O1HA 3C8HA 4HDQB 4I2NA 3QLJA 2J9FA 2QRPA 2AFRA 2ZRKA 2WU0A 4INPA 2GHRA 2O3RA 1GPJA 4X64B 1M8KA 2XQIA 2ATIA 4IDHA 3K2BA 1QO7A 2EERA 2HCBA 3ZX5A 3FFTA 2HF7A 5IKOA 5DP2A 3L77A 2R84A 3T3GA 4EF4A 3AJDA 2P3QA 5A4AA 2UYYA 2XWJI 4XA8A 3DLIA 2IZ6A 3P4YA 1QYIA 4LTNA 3WIUA 2I78A 2ZIXB 2GJAA 4DLAA 1FSPA 3P9KA 4UREA 1K7SN 1J4AA 1I30A 2FPIB 1MX1A 1QFYA 1YGYA 2ZJ3A 3MUEA 4OJNA 4PCAA 1JEEA 3AHIA 4BN4A 2IZ5A 1HQYE 1NQ5A 2ZBGA 1H2WA 2MCFA 3P96A 5DXJA 1B41A 4BLRA 2ID9A 3OQJA 3ROPA 3FTNA 5JRZA 2HDWA 3F6PA 4P86A 1MV5A 2HKIA 2CLSA 3ZS9A 1U2DC 5E4TA 3P26A 2C5SA 2R7KA 3BSYA 3BWXA 4GYYA 3DKIA 4UMFA 5GIOE 1H2RS 1U7UA 4LGYA 2QLJA 3DWIA 2M6LA 3RTBA 3ZDQA 3BQ9A 4PIPA 4QVKA 3THOA 3WMWA 5LMUB 2PCLA 2QIOA 4DV4B 1EUDA 2J0VA 1Y8CA 2MHCA 2ZJAA 4LNUB 4UM9B 1KGSA 4ZI2A 4MCAA 2H57A 3AESB 3HCNA 4TV9A 5JAHA 7MHTA 3AY7A 3LT0A 3KQNA 2QVYX 1E4OA 1DB3A 2JJ1D 9GPBA 1VFNA 2C03A 1CQPA 4EHNA 3ANLA 1NVAA 2YVKA 4PGAA 4J43A 1DTWA 1AGRA 5DM70 1IQ0A 1QQ7A 2ZXEA 1YBVA 3HDQA 4L9SA 4DJFC 4DUGD 4QXPA 1JDUA 4BRZA 1EWYA 2NO0A 2GZMA 4JDPA 1SKMA 3CNOA 2QMUA 1JH9A 2EW1A 3OIDA 3T9AA 3P9CA 3ENNA 4WN9B 2CJWB 4O2AA 2HRQA 3WLTA 2Y92A 2JGIA 3DTVD 4FVTA 4LAFA 2EGGA 3ROGA 4WL0A 4ZQFA 2QLTA 3QLEA 3PR1A 2XRYA 5CIYA 4AO8A 4HY3A 3L41A 1N78A 1HLPA 5C8YB 4WOCA 1Z9BA 2UV8A 4ID3A 1Q1EA 3OX4A 4BNKA 4NU8X 5JS1A 1YRYE 1MN6A 3FETA 3F6YA 4UHKA 3U3DA 2GAOA 4CLRB 4AX8A 3THXA 2IHUA 5IF9A 1U2PA 1R15A 4HNSA 1QIJA 3KQHA 2XQJA 3K53A 3CJTA 3VA7A 3DDOA 4GIBA 3GLKA 2ZTVA 1GILA 3ZI4A 1MABB 1G5QA 4Y9SA 5ISMA 4X24A 4N6GA 4B81A 3MS7A 3VMFA 1SXQA 3LUCA 1ZIOA 2VHCA 3KTAA 3MWYW 4CI9A 2R8OA 4DJEC 4YUZA 4KR3A 1U90A 1C3VA 2GM4A 3PJFA 4FGSA 4HQLA 5HUJA 4IX1A 2FG7C 1CU1A 2PSFA 4V0RA 5TRTA 2Z43A 5I7HA 2FP4A 4FC7A 1CKEA 2B4RO 3EC2A 2JRLA 4V38A 3EBLA 3HP1A 5HJ7A 3ETNA 5HK9A 1HEYA 2VDUE 2EL9A 1QE5A 3MMNA 1OD6A 3A25A 4GPD1 4A8HA 4OLAA 2A9QA 5JNUA 3V46A 1MX3A 2FDXA 2AFHB 3CX7A 2VBFA 3SZUA 4JP1A 4G25A 3DDUA 3OQ1A 2NUTB 2VJQA 3G5AA 4L0QA 4UVGA 4ES6A 4TKLA 3GOQA 4Y2GA 3LH5A 4F1KA 3AEKB 1GYRA 1Q5PA 3WRYC 4RIEA 5D3QA 5AM2A 3KTDA 1R4NB 2R00A 4IUDS 3I6YA 3DR3A 3MEQA 4UQLA 4FGJA 3ET4A 4GC9A 4DCMA 1L5OA 1C8BA 3EVFA 1U0GA 5EVJA 3I05A 1XD9A 5BNWA 2CVQA 4KO1S 1FS4A 2P4HX 3S29A 3BRSA 2CJXA 3CRQA 3L8YA 5JTUA 1QVWA 3NEPX 2P1DA 1MHTA 4JC0A 1CEXA 1GL7A 5KKNB 4D96A 1FRVA 3QY9A 4QU8A 4QRIA 1SQ0A 3DV2A 4V1CI 4ENSA 3WFZA 1D2AA 2RK6A 4BNYA 3GGSA 4QGHA 4HFRA 4LDQA 1BVRA 4FFDA 4YH1A 3UJ6A 5IKPA 4JUBA 3QWFA 4V02A 1UDWA 2FVYA 4C6RA 2ZUWA 1TJNA 3U4IA 3CZMA 4HAUA 4P38A 3CWCA 1T5DX 2VYVA 4KFSA 3BEDA 4MWCA 2FPUA 4TMVA 2Q4TA 2PBZA 2DULA 5TPZA 4PXYA 3RYCA 2Y1EA 3P9PA 2VWGA 4LSWA 3TI9A 1GKIA 3M0EA 4JLJA 3HA7A 5JYBA 1BXKA 1RXWA 2OZVA 2FXVA 3R3SA 2RCYA 2Z30A 2P9BA 2ACVA 1QHHA 2XA1A 4KO4S 1QCYA 3JQAB 3PNKA 3RCBA 4LYFA 5DGCA 1VPDA 2QRZA 3ZUPA 1YUNA 4MYCA 2O07A 3U2QA 1USUA 3GLVA 3OZEA 5E6SB 1OH7A 5J2UA 1K6EA 2ZSEA 5HIIA 3TSYA 3GJZA 2GILA 2Q45A 3UVEA 4ZZ3A 1U2RA 1O95D 2IYPA 4F5WA 5K4HA 1LTHR 3O1JC 3QE0A 5KHAA 1P1RA 1VYHA 5B1HA 4AXBA 2E4AA 4IGIA 3PNBA 5CT4A 2YZMA 4MRMB 4Q34A 4O4HB 4B6JA 3CF4G 5BN4A 1O9GA 3PU6A 1SXJB 3E9YA 4H27A 2NQTA 4NE2A 4X93A 4QDTA 1ULSA 4U5XA 5FO0A 5JWOA 3DOCA 4B48A 1UJNA 3V6LA 1H2HA 3TRIA 4D0RA 1W4BA 4JLSA 1PVVA 3S7ZA 1SU7A 3MAJA 4DEVA 4C4AA 5HZMA 4DNXA 5IJXA 5BP7A 5H68A 4JKYA 4O59O 2OUIA 1IB0A 1V39A 2QX4A 3BB3A 4OOEA 3U9LA 3DLTA 4C05A 3LUBA 2YKGA 4XFJA 4G5YA 2F67A 3DMTA 1FU7A 2G67A 1KI6A 3MW8A 4HVCA 1NRWA 4F4FA 3EVNA 1N6OA 2NO4A 2NXWA 1G1MA 3HCPA 3IB6A 3PE4A 4DDUA 3OLYA 4Z49A 5AXAA 1QF9A 4MVJG 3HSKA 1QK5A 1ZOOA 1KZ9A 1UF9A 1E96A 3D43A 4G8JA 4PFJA 4O4JF 3GRZA 4OHRA 3WL6A 3GLQA 4DCNA 4C0BA 5FOTA 4MQ4A 1DKRA 3QFSA 5C80A 1ZM2A 4KLNA 5C35A 3HS3A 5DSZA 2VDPB 3LYAA 1QBGA 3ED5A 1R8JA 4HB4A 5G53C 3AFNA 4OEHA 2YWDA 1TT5A 2HCTA 3AWDA 3IAHA 1Z12A 2DBYA 1A9TA 2OYSA 4XM2A 2H0QA 4B3CA 2C9DA 4D44A 2G07A 1CRPA 1ZLXA 4EX7A 1WM1A 1NPDA 1OTXA 2IYTA 1E61A 3W1EA 4HXEB 2BBWA 5IG2A 4LF8B 1IVYA 5KC8A 3QPUA 1ISIA 3U40A 4OL9A 3UK2A 1IQUA 1LVGA 1YJAA 2CEAA 1IUNA 1Q1BA 4FDLA 4POAA 1QP0A 3WHKA 2QW0X 3UCFA 2HWUA 2ZCUA 1ZSVA 3P4XA 4U6QA 2F6RA 3PPVA 5FFFA 1WOMA 2BFDB 1JU9A 2BSXA 2ZSFA 3DULA 3AF4A 2VNKA 1X1EA 3EXEA 5FL3A 3V4VB 2GXAA 2PZMA 3AR4A 3D8TA 2C2BA 2PUBA 5HXAA 3EGEA 1FDUA 3H2ZA 3ELYA 3RAEC 2CYCA 4TYPA 3ITKA 3ZIDA 3VR4D 3ZE9A 5H3HA 3RFTA 2I3BA 3KBOA 1LLDA 2HJGA 2OXTA 2VJBA 1XUOA 4PIMA 4DCUA 1AZSC 2PKXA 1XP8A 3LUDA 3FVQA 4D0LB 1TADA 1KARA 4ZEOA 3T7SA 2R2GA 3JVUA 1MENA 4LNAA 4ENUA 1SK9A 2XOKD 2UZ0A 4I8DA 3QKRB 4W7SA 5CA0A 1NUQA 1JYFA 1Z68A 3MJDA 3VGPA 2FMTA 1ZN9A 3F6BX 4FYJA 5CJ2A 1BGWA 5G2OA 5TMBA 3VOSA 1LBSA 2VH5R 4KOEC 2Q29A 4HLCA 3BF7A 1ES9A 2PRYA 1LQUA 3IPLA 2V9CA 2IRWA 4YLEA 4ZVTA 3PB3A 2VZEA 1AS2A 3U4HA 4BXOA 2H3HA 2MSKA 2XJ4A 1YCGA 4H4DA 4JBNA 3ZKAA 2N46A 4R84A 4QECA 5A04A 5KNCD 4TOIA 4M0KA 3I8XA 3M4NA 3X0DA 5EJEA 1XJCA 3MELA 4ILEA 3UHOA 4NFHA 1DVRA 2H1LA 2RKOA 3BA6A 3FCXA 2H1RA 3WNVA 1G2IA 3AZPA 4DSTA 3T61A 2HBYA 5CJJA 2OO5A 2MSDB 5J2UB 1MAAA 2V0NA 4PLCA 1DEXA 5CCXA 1HETA 1ZSNA 2IZZA 3WA7A 5LNK6 1MPXA 1YZHA 1Q2UA 4DQXA 2HDHA 3B1ZA 4OXXA 1KP2A 4GE0A 4KVZA 4YJ2B 5KINB 3WQRA 2HSEA 4OFWA 2JIBA 3BXZA 3R3HA 5JCOA 3B1KA 1DZ3A 1UBOS 3RFCA 1NV9A 5AICA 2ZSUA 3EDMA 2A7XA 4PSCA 1NG1A 1Q7EA 3NNSA 1Z74A 5CCDA 2HF8A 4ZI7B 4BLOA 3RI3A 5HOQA 4C5CA 1AMOA 1RAEA 2Z4SA 4MSUA 3CBGA 4WEOA 4XB2A 1RFLA 1YU9A 1YXMA 1PHRA 2Y05A 4U3JA 2O0LA 3P1JA 3S68A 5BOSB 2I67A 2HIHA 1Z4OA 2C4MA 2DQYA 1T36B 3L6CA 2VAWA 5C8VA 3B1JA 4FPXA 4J0KA 2IYXA 1JALA 4RHUA 5J9FA 1JHYA 1Z6QA 5FOUA 1TRHA 4ZCSA 5I7EA 3VKHA 3QVTA 2VDKB 4URUR 2Z0MA 3VSEA 4DMKA 2QNBA 3GDFA 4V3CA 5K0CA 2V9PA 1DDOA 3KKEA 4JLDA 7ADHA 1QK4A 1QO0D 3FLEA 3GEPA 4WZAA 5JD5A 1C41A 2PZLA 3VV2A 2BF7A 1I80A 1XRRA 3QNWA 5ITZB 5F1OA 3COPA 2OV8A 5ALOA 2RHBA 4UOQA 2GCEA 3NHUA 4CLHA 1EVIA 1V25A 4GP6A 3I0ZA 4Y6LA 4ZQHA 1Z16A 2YXPX 4YUVA 1C9YA 1C29B 2W4IA 3AIOA 4AT1A 3STXA 4L8YA 2WT8A 2QNIA 1OTHA 5GMOA 5IJZA 1TQ8A 4D9FA 3A3YA 1K0UA 4UHCA 1Y6QA 4Q7EA 3WOVA 1ENPA 4L5CA 4EGJA 3N5CA 3SP1A 2YRXA 5LIRA 3OX2A 1ZZEA 1Z62A 4XVUA 2QI9F 2IU6A 4PTYA 4FNOA 2WUDA 4MV6A 3AVPA 3EIOA 1B7GO 1PQUA 1YJBA 1P7ZA 3C6YA 3S3TA 3RNLA 1CZLA 2JGRA 1WZUA 5AH0A 4AY5A 4EKEA 4XD7D 3I4FA 4JMPA 4L50A 1EP9A 1QGYA 1OJLA 3EOAI 4Y2QA 3EWNA 4QTZA 2I8LA 2AOWA 3PD7A 2MT9A 4IINA 4U6SA 3T9CA 4F46A 2CNOA 3KS9A 5HRAA 3KQTA 1HE5A 2QV7A 3ND9A 5DTJA 5FUYA 1V6CA 4B7AA 3DE4X 2HHHB 1W4RA 1G6KA 2HIGA 4EGCB 5FX2A 3PEFA 3GHHA 3FPGA 3VH4A 3R0QA 4QLBA 1F12A 3CZAA 1JB9A 5CX1B 2HA4A 1OGYA 1Z0JA 3G23A 3UATA 2IXBA 3A6FA 4RNDB 1RSZA 1P6UA 3UUGA 3B5JA 3RODA 1E9SA 1YIDA 4HSEA 4EYQA 1ZI9A 2PUGA 3RC1A 4A03A 4DPLA 2XUIA 3U7GA 1I7PA 1XU4A 4B6SA 3BJZA 3SZOA 2J09A 2GAAA 3LUAA 1E1CB 5EZ5A 1QWOA 3HUTA 1MLDA 4M4SA 4N5MA 4WASA 1F38A 2GTPA 3NHRA 3FWZA 4FMDB 4NONA 2ZM5A 1EGMB 4E07A 1DEHA 4E6EA 4F06A 3VKGA 1BKYA 4J8PA 5J40A 2OCKA 2WHPA 2B78A 3FJYA 4NBNA 3L8GA 1M10A 1X8XA 4DN6A 1E6WA 2NYRA 4D3ZA 3EPJA 4K9LA 2C4WA 2C84A 1DWOA 1E5VA 2H29A 1MV8A 5F35A 1QUEA 2C31A 3B78A 3MTBA 3SLRA 2YRWA 2Q46A 3P9IA 3HYRA 5KVAA 1OWNA 1KI7A 1OKKA 2AJLI 3CLSD 5GOTA 4YR7A 4Q4JA 4Z6KA 4KOAA 4IXWA 1FJGB 3EXAA 2FWPA 4O2LA 2C1EA 1AT1A 4LSZA 5JJBA 5J5VA 1G6HA 2J5KA 2PZEA 3PQ8A 3QKSB 1YB4A 3O21A 3ZE2B 1MR3F 1YNOA 1A4RA 2P27A 1WSAA 4MO9A 2IYSA 4C3OB 621PA 3UJ9A 4Y7DA 4RY8A 1VMEA 3IBYA 5J43A 1WMBA 1VXRA 1KJZA 2CJYA 4UEJA 3U4CA 2H1HA 1BU5A 1BVUA 2A2ZA 2V3VA 5GZ3A 4CM8A 4Z7JA 2EFDB 3A6ZA 4QFMA 1U8CB 4RPJA 3TLMA 4CL2A 2QLLA 4UNPA 2O2DA 3O03A 2O6HA 1U4SA 2ZW9A 4P7FA 5LDHA 4AY2A 1I0LA 3RK0A 2B5OA 1AUQA 4COOA 2DAPA 3OOJA 3THWA 1VIVA 5FAXA 3TE7A 1ECPA 3DBVO 4WUVA 4L9AA 1ZP6A 3VPGA 3K73O 1RXSA 4O2BF 2AK3A 4UNSA 1WUTA 3CT4A 3TDKA 4QU5A 4L6AA 2HA0A 5DCWA 3IHWA 3CUTA 1SWVA 3QX3A 1P18A 3ZWBA 4BLUA 1TLLA 1L4EA 2WJ3A 4S35A 4BNUA 4EA8A 5A6SA 1JKJB 2WU3A 1IY9A 2X2FA 3MJHA 4G4GA 5JMTA 3GPBA 5IXYA 1I0IA 3JTMA 5ADVA 5DLPA 3AR8A 4MVCA 1RI5A 1P3Y1 3ICEA 4XFKA 4IKEA 1E3WB 3X1WA 3C1AA 3PDIA 4AG5A 1ZVVA 2GUGA 1UL1X 4RA9A 4YYZA 1S4QA 2E85A 1Q0LA 1ECCA 1F4LA 2VDWA 3LPLA 4NZOA 1X0VA 4FBLA 4FDUA 2IQ5A 1QPZA 2IYOA 2IA5A 5I51A 4AMYA 2DWPA 1V1JA 1AO3A 3WGYA 3ZHRA 1QV7A 1KYQA 2YASA 3I72A 1G64A 1F7UA 4BV2A 4NG4A 2C8VA 1U6KA 2RI0A 2ZLBA 4L6CA 1Q0HA 4HH4A 1PI3A 1DTWB 2RHGB 2PVCA 4OD0A 5PNTA 6ADHA 4ZTZB 1Q2XA 4QGGA 1NQXA 2HJ9A 3RVLA 4DOMA 1MGPA 2WFAA 1ZCAA 2HMAA 3WZMA 4ZAFA 4LQLA 1CUCA 5B6PA 5IW8A 1REQB 2XDWA 1HUQA 1KORA 5FBRB 1FNNA 5FUWA 4ZVPA 2RGXA 5JXIA 1TL7C 4MO2A 4P0PB 2IXGA 4XJSA 2LCQA 3P0EA 3PI7A 1DEAA 3RVBA 3IMEA 1FRNA 3HBFA 4MZXA 1PS9A 2QTCA 1FDIA 5FYDA 2WDZA 1QMPA 4WZZA 4XGRA 3ZDCA 3VGJA 1E6UA 5JU6A 5HM6A 2Y93A 5ALXA 3LXMA 4GWLA 3GVIA 2C77A 2O5CA 2VXYA 1O87A 2BGWA 3LFHA 4LY6A 5K8CA 2QX9A 3LECA 4YONB 5FHQA 4D6YA 3U44B 3L0ZA 4MV0A 3GLGB 2CV0A 2FMIA 5T41A 5ALEA 3DBHB 5I7VA 1C0KA 1UZUA 1H9CA 4KO3S 2A9KA 4FFVA 3ZK9A 1IC6A 3VISA 1SQ6A 2J3MA 1WHTA 2HZ7A 1KKMA 4S1PA 3QELB 4Q1EA 2H65A 3UIEA 3I9FA 3AKEA 3QLVA 3M6UA 4DYDA 3IAEA 3OTOB 2Q1XA 1L5SA 3E9MA 1YQTA 3NHFA 3ZE7A 1Q6YA 1G38A 5HJ2A 4Z86A 1VG8A 2QTZA 2R96A 4NQZA 2JLWA 1T9AA 1R5OA 1D4AA 4W9NA 5BN3A 5LQJA 1S89A 1HE2A 1XDWA 1YQWA 2P67A 4I1UA 4Z1MD 2C58A 1R0LA 2Q6LA 5CXXA 1OAKA 1Z28A 2BGNA 2O2EA 1GVNB 1G9XA 1BE0A 1JG7A 1FQWA 1LW6E 2ZK7A 1SUDA 3VZCA 3GNSA 3EQ2A 4LRXA 3C4VA 1IUPA 1XDGA 4EJ6A 1CZNA 3HB5X 2QL6A 4J4BA 3TMAA 2VTDA 3DB1A 3IKVA 5HKOA 3GJ6A 2WFLA 4AMVA 1ZM9A 1PTJC 13PKA 2PL3A 1LS6A 2NZ2A 1AK2A 3I01M 2BJWA 2CXHA 3IDZA 2VJMB 4MNTA 4OYLA 3OP4A 3V2HA 3W9YA 5LMNB 3HU5A 1R9NA 2IWRA 3LGAA 2ZYVX 4ZVKA 1NP3A 1TTQB 4BB0A 3O9VA 2A0WA 3DEKA 3QVKA 4CT4B 1WPXA 2GNOA 4BMCA 1SULA 3K32A 3QPAA 3JVEA 4BQOA 2Y0CA 3LOUA 5DGDA 4BGDA 1FVFA 2E55A 1LI5A 3DLAA 1DJQA 3ESCA 2HZBA 5WRFA 2WINI 4BY9E 1DKMA 3K09C 3H9UA 1MB2A 2ZIAA 3JZDA 3VUEA 2PAFA 1HYBA 1SXJA 1Y89A 4D0SA 4PR0A 2YR0A 1OGIA 1U3CA 2Y0PA 3KXKA 2JJ8A 1ZL0A 3KYDA 5L40A 3KQKA 5IVHA 2AMLA 1NW6A 2RH8A 3JQ7B 5KX5F 4GC5A 3QPBA 3UHAA 1GGFA 2QM7A 1FFXA 5D3MB 2JKZA 1QOQB 2VG8A 2BBSA 5HCIA 4IIJB 5AVUA 2P9JA 2H2GA 3LQ2A 4TLCA 4YO7A 3V1UA 5IJ9A 4XQ0A 3GJXC 3RTAA 1FU8A 1ORHA 2BGJA 1CUUA 5LQNA 1E1QD 5EJ8A 5IM4A 4CBVA 5EFZA 4UUPA 1SKUA 4HQRA 2FNAA 4JLBA 5F4ZA 5B7GA 4KWCA 3T4PA 1PQWA 2IGBA 5ULLA 1BCRB 4NJEA 3E9DA 1NZDA 5E0OA 3EIXA 3R6LA 1HYGA 2JJ2A 1KK0A 2UUBB 2G09A 3IB3A 2AFIA 5KTKA 2EKQA 4G09A 1J20A 1PJ8A 1QH8A 3MB8A 4Q7KA 1TMKA 2IIBA 4P7GA 4QXRA 2W83A 4H59A 1Z2EA 4P8RA 3WYAA 1W88A 3RU7A 1D6MA 5CX4A 5EJMA 4RJLA 4MQFA 3VR1A 1XDDA 3UMJA 1X38A 1WY7A 3AHFA 3UH1A 2ZRNA 1XD8A 3EWSA 2FX2A 3UMYA 3ZOZA 6ABPA 5HF8A 3UAZA 1VC2A 3NDPA 1G4AE 1RKBA 1P4JA 2CHQA 3BOSA 3MZ0A 5DYIA 2KBEA 4BP8A 1H5UA 1H3NA 1X3LA 5JBNA 2YIVX 3HR4A 3QKUA 3R41A 2QNRA 4QULA 3GJ5A 3ZEIA 5T4EA 2ENWA 1X1DA 2Q21A 3G89A 4J75A 4AZSA 3V48A 4B9AA 1A2OA 2D2IA 4EB6A 1X7YA 1BQ4A 1NC1A 5EJIA 4L4XA 5KYGA 4IGEA 221PA 3ROZA 1PYDA 3ZCPA 1XD2A 1P1JA 3SFVA 1MABA 1F9AA 3H4IA 1OXTA 1G3UA 3DEYX 3H87A 4M1KA 4N3AA 4FI3F 2B4YA 2ZWMA 3FD8A 3KTAB 2YZKA 2A33A 2JGAA 3GVHA 4ZC8A 2PS1A 2PMWB 4HX9A 2XUZA 2YXBA 1A2KC 1FTGA 2EC5A 4C89A 1XD2B 3CNHA 5A4JA 1RPNA 3N8NA 4DR5B 4NZMA 2ODNA 2RHRA 1PJTA 3NKFA 4LKOA 2VSNA 3H1PA 2PM8A 3HA2A 3N8IA 4PAQA 1XO1A 1NFRA 2J85A 1QLJA 2WAMA 5EA2A 2P75A 4DUYB 3UWOA 1VZ2A 2X6QA 2A5YB 4ZT3A 4TSFD 1ATIA 3WE7A 4CKBA 3GLHB 4LOJA 1XG5A 1M2HA 4WOJA 4Z1OA 1G7CA 1WMEA 1EK0A 1LLUA 1MC1A 1QZTA 2VUSA 3JZIA 1WU8A 3MCTA 3R3WA 4I4IA 4LXHA 4ZAZA 5GINE 1QGUA 2GD1O 4NS4A 2E18A 4H3HB 3OJXA 3QFTA 4IDQA 4BWYA 5LA6B 4O2AB 1JQLB 1RWOA 1OMOA 3L1KA 1PUIA 4JEMA 3OCUA 4IKOA 1UC8A 3DFMA 3BICA 5FTNA 1X92A 3CVUA 2I65A 2PU7A 2FEAA 3CPSA 3GR6A 1IXRC 3I01A 4D81A 1XHEA 4M0CA 1Z6YA 3OF3A 4K9SA 3MWFA 4X7RA 2H7YA 3BDVA 4O4HF 1Z0ZA 3FW1A 4ARBA 4QOEA 1SCNE 4LVNA 1UQRA 1X13A 5B3LA 1J1ZA 5K0GA 2YIDA 3ZK7A 2VO1A 3Q9UA 5C4GB 2Q5OA 4H1TA 4YCCA 2HPHA 2IPMA 2O8EB 1TECE 4GRIA 4EW2A 4AJOA 1FBNA 3JQBA 3IE0A 3PHIA 2ES4A 2QAGC 3WK5A 2PMEA 1HXHA 1I7NA 1J6UA 1QE0A 1MUUA 1XA0A 4CPDA 1ZCFA 1TD9A 2Q0QA 2QR2A 4IHJF 5I9NA 4A36A 4P4TA 4L3VA 4MR9B 1GRVA 3SBXA 4B7UA 4FLEA 1U6IA 3W6OA 1T36A 3W9UA 1C30A 4XPIB 4GPZA 2G1PA 5E1OA 1L3IA 3OUZA 4R9UC 2JNWA 4GP9A 4YAGA 1D0IA 3QBEA 1EK6A 5BQXA 2PKWA 1Q84A 4MVJE 4YCLA 3ZIUA 1GL3A 2F1JA 1Z5GA 3PC3A 3F5FA 4MITA 1FQKA 5AOAA 3BH6A 3NH9A 4WX2B 3F78A 4C4XA 5FWXB 1CDDA 4TKMA 5HP4A 3DMRA 1N2GA 3JAKB 4I9GA 3MJTA 2OD7A 4BKRA 4CGYA 4C7XA 3PPIA 3QI2A 4C0AC 3KJQA 1F06A 5KTMA 2VT7A 2QN1A 5I7RA 4MVJP 3ED1A 3RQSA 4LDPA 3OZBA 3B89A 2I3AA 3ILHA 1QJCA 3BGVA 1PQ4A 4BFSA 4TXLA 1NPTO 2NT3A 3NKLA 4PZPA 4ENQA 2B2NA 1W88B 3OMXA 3PHGA 3PQ7A 2WTXA 4X1YA 4B44A 4TRNA 4PO3X 1I4OA 3ZNQA 3EVAA 3P8ZA 4EHLA 5GIPE 4GPTA 1OHHD 2QZSA 5AHOA 2HI0A 1GUZA 2VPYA 5AVSA 2OOSA 1DJNA 2FPIA 2GI4A 2O14A 3QLTA 4HWPA 1K0FA 1Z4JA 3JALB 4GZ5A 1JPJA 3I6ZA 1XQXA 3ZWMA 2JJ1A 4G5OA 3BIJA 3FPBA 1QCDA 2M6KA 4IX9A 4PCLA 1LFAA 1QH1B 3PUJA 4PNZA 3FIJA 4B6PA 1RR6A 4DWVA 1I14A 3M89A 4Q9JA 5F4BA 4YHBA 4FT2A 4L2IB 3RTCA 4TRJA 1BEZA 5DI3A 4P1ZA 3MGGA 5JPDA 3W5CA 1DAFA 3SX4A 2WUFA 2QZJA 1KZHA 3NHZA 2GHTA 1E0JA 3UJNA 1G2QA 3HRKA 5CVTA 4TWIA 2BFFB 2YV4A 3GEGA 4F7WA 4YAWA 3AIMA 1OFIA 1K8RA 3GP8A 2CLFB 4NMWA 2VXBA 1WW8A 4M1QA 3WP1B 1SAYA 1VXOA 2XUGA 5AK0A 4KVFA 3TTSA 1RRCA 1AKWA 1WXEA 4J2HA 4JN6B 1XU9A 2GAJA 3A7EA 4R5MA 1GO2A 1NVMB 2P91A 3BB1A 2VHXA 5E7IA 2KQUA 4PYLA 5C0OE 4IYRA 1Q0UA 5JECA 4BFTA 1Q11A 3CB4A 4FFBA 4HVAA 4LQ4A 2XZOA 1JX6A 4U1RA 1U7HA 3AUTA 1J1UA 1DNPA 3B3JA 1T9CA 1ZWLA 2Z83A 1ZR4A 4QBFA 2X5JO 4R8SA 4UPDA 2ZM6B 1N77A 2O19A 1UKEA 4GF5A 2CNWD 4PHGA 3TNLA 2FE1A 3UXEA 4ZZ0A 4FK8A 2VQFB 1TXGA 2WWRA 4HUJA 2QD1A 2HHAA 1ZJZA 3CYFA 1OWOA 4ZVVA 1SOAA 4DWJA 3SN6A 5C31A 2JK0A 2ZIFA 3NM5A 4CDMA 1FF9A 2SBTA 1EESA 4QXQA 1QFSA 3O95A 1S02A 4V03A 3TLBA 1Q1QA 1MOZA 3OMLA 3JVIA 4UM9D 1YQQA 5J4LA 5H4HA 4C0WA 4ZU6X 5T8KA 3RU9A 2FRDA 1XV5A 3ENQA 1I7DA 1QKKA 1SCUB 4PZEA 4GR4A 1Z7GA 2PL1A 3RIGA 4YAIA 4YWJA 3RWBA 1ZVJA 4PSUA 1PT5A 4DW8A 2ZRLA 4RSGA 5AI5A 5A06A 4MOWA 2G7MC 2QAGB 2I1VB 3FUWA 2OC9A 1FFWA 2QL5A 5JMWA 1KEEA 1EUYA 1V1MA 4XYEA 1PNOA 16PKA 3E9RA 5CPFA 3G8BA 3V2UA 2QG6A 3D1LA 2ZREA 4EM6A 5CH8A 4HFNA 2OCAA 4W63A 1UBGA 1KYZA 2VCYA 2C2YA 1KU0A 4EO4A 4IEIA 4ZHSA 5DHPA 3WDMA 4Z0PA 5JNWA 2QZ9A 2AGVA 4I6EA 5AO9A 1SBYA 1E7WA 1U9IC 2WWTA 4XARA 1Y4AE 3PTZA 3QIAA 3NMUF 2F8MA 3HKEB 4B31A 4R1SA 4OHZA 2NYAA 1G7TA 3TCXB 3QBTA 5EFOA 2QG4A 3CY6A 5LKAA 3UHFA 2A1UB 2VNAA 1GA6A 1UPAA 1KR2A 1MAUA 3L79A 1ESNA 2X6RA 3H1BA 4TSFA 4D8XA 5C46F 4J1TA 1NQAO 1VRWA 2R4TA 3CIOA 2PH3A 1Z88A 1B14A 2L69A 3IUPA 1XVVA 5JCXA 4XYBA 4ZOAA 1APBA 4FFNA 1HNZB 4A23A 3KRTA 5D6OA 5IT4A 1O5TA 3HHPA 4MI3A 5CDHA 3LDFA 2GM3A 4NAVA 4ZV7A 4PGMA 1ESEA 3I9JA 3OOEA 3Q7SA 5AESA 5IZCA 4K28A 3BILA 3V4PB 3RANA 3DTTA 3R4CA 4YRIA 1YT5A 2AC2A 1BWRA 1UIRA 3FMIA 3OFVA 4FZ5A 4KFRA 4EUNA 5KJ6A 4G4JA 1F2VA 1HOXA 2JIZA 4QGFA 3DAFA 2D4HA 4ZYXA 1T2EA 2W2VA 1SVMA 4GL2A 4Q3KA 4Y9DA 3ES9A 4BO3A 3UCXA 3ESZA 3BF8A 1N6NA 4FZJA 3COWA 3LWDA 4X20A 4Y2JA 3NPMA 1L5FA 5K0LA 1BNCA 1C80A 1FW6A 4A2QA 3JQFC 4NZZA 4X8MA 1UFKA 2LTAA 1YONA 4Q4AB 4RTQA 1R4AA 3AVVA 5H7XA 3GVXA 1DDGA 1IZ7A 3OICA 1IM5A 2CVPA 1BE6A 4K9KA 5I8PA 3KWLA 2LIVA 4D9HA 2Q62A 5JQGB 5JUWA 3BIXA 2A9OA 2A4KA 2X0KA 5HCNA 2I2BA 4EQ6B 2PDAA 2OBYA 3OH8A 1NWCA 1KNXA 2BM8A 3O47A 3AUFA 3CCBA 2C99A 1UBMS 2XMSA 1LPPA 2IP2A 3GQBB 3KG2A 2N9UA 5TGZA 5JCJD 2VHJA 3HB1A 4HN4B 4LK2A 4KBYA 5AKKA 3RUDA 3TEFA 5LQRA 5IMSA 4JDUA 4OMCA 3VPBA 1CRZA 3MAAC 1XVLA 2ZS7A 4KX5A 3PXUA 4U8HA 4CU2A 4P9NA 4H3SA 2QBYA 2PX2A 2HBRA 3EH1A 3P0JA 5AVRA 1CUWA 1UJ2A 3QE9Y 1T91A 3VVLA 3UPDA 4G5XA 3T3DA 2YRFA 2ZZKA 1NJGA 4YAKA 2E4UA 3L4BA 1U0SY 2P79A 4AF8A 1TJ4A 1MOSA 2Y9PB 3CLKA 4HAIA 4CM9A 4XIIA 2QBYB 2QN9A 2SICE 2OG1A 1ZK3A 2Z6AA 3LCVB 2Q3LA 1JSLA 4G84A 2XTZA 5DX8A 3QRWA 4EB3A 4Q12A 1P9RA 3SBDA 4HEQA 1KMHA 4RA6A 1II8B 3TQHA 2NSDA 2EZ9A 2YUTA 1UBEA 3RSZA 1RABA 3INYA 1LV7A 2DP4E 4ER6A 4N4AA 1FNCA 3R09A 3R7WA 2WAXA 4D9EA 2PL5A 3JATB 1V26A 2XUFA 4MS1A 4BECA 2ZBUA 3QV1A 3ZEAA 3I8OA 5EIXA 3OIWA 3PTLA 4LBVA 3TPFA 2B7BA 3H1FA 3LHIA 3BD7A 1XMOB 4MDFA 3K0CA 1EAYA 3PUKA 2VN8A 3Q0IA 5AR1A 3RHTA 3Q7EA 2ZSKA 3TTWA 3DMYA 1R8SA 3LNTA 1E9VA 1U6JA 2YH2A 3ZE8A 1E69A 2I33A 3H8VA 2TMGA 5IXJA 3ZXUB 2XVAA 2QR5A 2ZI5A 3PHJA 2GLTA 1II9A 1DRKA 2WY2D 1O77A 3QE3A 3ZKWB 2WF9A 1YKSA 3L06A 1W36D 4MX8A 5E3IA 2W8BA 2CE2X 2ECPA 1CE8A 2XUKA 3EZGA 4RY0A 1KAQA 3EYAA 4QJ4A 4P92A 5FTMA 1LX6A 4H18A 2O1WA 1WVIA 2ENUA 2VP2A 5LOVB 2B8TA 3A26A 3R5SA 5E7QA 4H7DA 2GVDC 4YRSA 1MDFA 5TQ0B 5IAAA 3PKZA 3NHSA 3ZXIA 1SCQA 1L6IA 4LE1A 2HIAA 1A95A 2BJHA 3I0NA 3KJZA 3QVGA 4UC0A 4N7JA 5C18A 3EZNA 1K6MA 5LMCA 1OXBB 3T3PB 2E82A 2IZ7A 3CC8A 3N0TA 3FZEA 3ZHBA 5LP6B 4C7BA 1R6VA 5AKXA 2Q9BA 4DMFA 2XQFA 3FNGA 4ML3A 3JQ9C 1UZMA 1PVOA 1JHZA 3A4NA 5FPSA 5J1TB 1KEEB 2EEPA 2QVCA 2A14A 3OZUA 2WHXA 3AJAA 2IEBA 4BE7B 2I5PO 4XB1A 3DQQA 4RIGA 3LUHA 3CLUD 3UAXA 1UAAA 1ST2A 2XIQA 1R4ZA 3ESDA 5JW6A 2WAOA 3W7VA 2AZMA 5B1IA 4AYTA 1M8PA 5DBFA 1C2TA 1ZD3A 2HBQA 3HO6A 4DT1A 3QFHA 3T1YB 4M0PA 2OQVA 1FUYB 4PSVA 5BQPA 1DX6A 1JSZA 1TCVA 3WIEA 4BFLA 4FOOA 3ELUA 4MKGA 1PT6A 3W6NA 1W48A 3VJLA 1VL2A 3B6EA 3KVVA 2R2AA 4C30A 1KI2A 3IVGA 3QMMA 1OYOA 1XXLA 3L8ZA 3FUUA 2GX6A 5CIWA 5F64A 1GOTA 1ZEMA 3SF8B 1DO0A 1H0RA 1E3TA 3GEEA 1WV0A 3M2TA 2PXHA 3CE9A 4LTDA 5HF9A 3TMYA 2GZDA 5IHXA 4EW1A 3U4GA 4DJTA 5EPUA 4NP6A 3ZJTA 1JG1A 4KLCA 3WYFA 2HLHA 1TUIA 2Q6KA 4MLPA 3Q72A 3T54A 1K8QA 3FCOA 1EJ2A 2WWWA 1FYEA 3G5LA 3NIBA 4HNAA 1GA4A 1LGYA 3CKKA 4RXMA 4S0ZA 1HE3A 1XAHA 1CY8A 5IVDA 2W2XA 1IBRA 3E8MA 5FQOA 3B9PA 5ALRA 5CFMA 1MJ5A 3OTGA 1JQ3A 4RZSA 5A3VA 3QHPA 5JASA 2CL6X 4MB0A 3E9NA 3BL5A 4HNAB 3C3PA 1C9NA 3GLRA 1E4YA 2FG6C 3GFOA 2W6ZA 3IHTA 3D5TA 3KUUA 4ZT2A 5CYGA 1KPGA 3I53A 4JYAB 1CETA 1SOMA 4K3VA 3OECA 3H2HA 3TPZA 3ZX4A 2JA2A 3GV0A 1JIXA 1CV2A 2JGLA 4K03A 2IPNA 4K5QA 3R8CA 2C59A 2O8FB 1RCFA 1NOIA 5ED4A 2OGUA 3ZXYA 2GZRA 1N1EA 4IH9A 3VQTA 4BJHB 3AFMA 3C5VA 1Y7PA 3EIQA 4U0KA 3RBXA 2XZDA 5KQLA 2O5EA 1M2OA 5EKTA 2VH2A 2ABWA 4QOIA 4UUBA 1NM5C 2WQ6A 3LW8A 2PUWA 3BD6A 2YFKA 4ZT4A 4CMEC 4XPIA 4EF5A 1I2ZA 3PX7A 3LQKA 2H4FA 7REQB 3O92A 4AMBA 4J3NA 3SM3A 2G6TA 1PIWA 4RGVA 5CYFA 2QDKA 5IDYA 1BTOA 5KAMA 2GCOA 4AY6A 2XOEA 1Q7TA 5B53A 5TXGA 3T06B 1ENYA 1U8TA 2V97A 4DILA 3IC5A 1NJ2A 4HHEA 1X8JA 4XM0A 2XXAA 2CXSA 3EAFA 3SLGA 2QEQA 2Q2NA 3ND8A 4QOJA 4W99A 4B2PA 1SXPA 4UU8A 1SCAA 2FP3A 4LXXA 2YHIA 3N86A 4LCEA 4MWDA 4Q18A 5CTAA 5IFLA 4PNHA 3SMQA 1X1SA 3THYA 5AK4A 2ZYGA 4YAJA 1QP7A 1KFKB 3C6XA 3TNFA 1SBQA 4CN9A 5HIAA 2IHJA 3G9QA 4OHUA 1HX7A 3BQMB 4MVJM 3W3ZB 1ZJJA 2H1CA 3MIIA 5I9BA 4KQJA 5K0ZA 3H9JA 4CFZA 4DBLC 4F71A 1YFLA 3AR9A 1YZQA 3BXPA 3JAKA 2WNSA 5EG5A 5CW1A 1T2UA 4UAJA 3MSCA 3L3BA 3SFZA 4LHSA 1JLLA 3MRSA 5FNVB 5L45A 4XSGA 2I7DA 3RC9A 2WTEA 4Y6RA 5B37A 2B5VA 5CFPA 2JL1A 2PHZA 3Q10A 3TDMA 3WGVA 1CVLA 1L7BA 2QTFA 3DBLA 2QJWA 5F9HA 1GGVA 2YYSA 4OA8A 4OATA 2WU4A 1NL3A 1QRUA 4OBXA 4AYWA 1J5XA 3EMBA 1GDTA 1YZVA 4ZRDA 2J46A 2NZYA 4FINA 1QCCA 1T9GS 5FNZA 2D7JA 3HVJA 1GTG1 3LDUA 1ZIXA 2IIPA 3WYCA 5KOHA 1P0PA 2BDTA 2D1RA 1IXKA 4Q1VA 4C7VA 1B0AA 2GBLC 1FUUA 3WLRA 1IEVA 1YL7A 1QFZA 2ZBFA 3OQPA 3RSLA 4OP3A 4KR6A 3GELA 2WU1A 1XNJA 2C7BA 4XDZA 5FPKA 1NAIA 2P4UA 1QRDA 3AF1A 3EG9B 5KNBH 3EEYA 5AM5A 1U2ZA 1O4WA 3ZY3A 1SUEA 1ZM3A 1WTCA 2HT1A 1F3LA 2YVQA 4S1OA 5ALHA 4FNGA 3ONNA 2NSHA 4FS8A 2RGNA 5IT0A 2K7FA 3T3EA 2OBNA 1C0EA 2HSGA 2PGOA 2XMBA 3HY4A 3FTCA 4I4NA 4TUYA 5ECWA 3SC3A 2ZKLA 4C88A 1RPJA 3RGGA 2VJDA 2VR1A 2WU8A 1T8TA 2BFCB 2WYWA 3O2SB 1U0BB 1ZY2A 3DONA 5IX8A 2DTEA 1PD0A 1GGNA 2XR1A 4JUCA 1FUIA 4RSHA 3TLEA 1WQ4A 3HCCA 1MO5A 4KBFA 3VNUA 4IHKA 1H6CA 1X74A 5DIFA 3ZGVA 5LR6A 5IAKA 1F0KA 2ZIEA 3I9V1 2P0AA 1GPKA 1A5BB 4AXXA 2H0AA 2UUPA 4I2VA 5KBYA 2P1RA 2R6HA 4MAFA 4Q82A 3VVCA 2AFHA 1SUIA 2IHZA 2JANA 3PRJA 4GMHA 4UBJA 2OQ2A 2Q3DA 3CLVA 1IXSB 2FXIA 3P20A 5EJ5A 3TW8A 3BMQB 3SS8A 1ADYA 1N5MA 1VL8A 3A6EA 3ZYZA 4CM5A 1ZOIA 2WJWA 4LJ7A 2HPZA 4RV9A 1EKXA 2WMYA 3PGJA 2CKMA 5EIHA 2XWQA 2F90A 1UJMA 1U3WA 1Y4DE 1ZDMA 2AFIE 4RK7A 1UOEA 3REQB 4HC4A 1IG3A 4G5HA 4HO1X 2C78A 4WNAA 2R60A 3C7TA 4BRSA 4C2BA 1XPUA 4YPFA 3HP7A 3WWYA 2HTFA 3K0SA 4E5NA 2AX3A 3QGMA 3OE7A 2XMZA 3VR6A 2R44A 3ZZ1A 3SZRA 3IRVA 4YXWD 2IZOA 5B7PA 2P9GA 2PX3A 3T5CA 1YB1A 3PDCA 1JDZA 4MPTA 5ESDA 4FILA 3MWDB 1E9DA 4XDYA 1XVIA 2II6A 3E5HA 1F5SA 3IH5A 1RI2A 3ENWA 4K1LA 4MVYA 4YAFA 4MS4A 3KYCB 3SSOA 2INGX 3MYRA 4P3YA 2C82A 4H3VA 4MI6A 5F33A 3BFVA 1M1ZA 3E8SA 4Y67A 4FHGA 3R3ZA 5DK6A 2FW9A 2GK4A 4NJMA 1X39A 3ZH9B 5B12A 2B30A 3QX7A 5TEVA 5G4KB 1FRQA 2RHDA 4L5YA 5FUBA 3PNLA 3L0YA 4JC5A 5M3BA 4M7RA 3ZCUA 1EG2A 1MBZA 1U3TA 2K4MA 1HT1E 2XLCA 4HDNB 5KTYA 4YB8A 3GJ8A 1UJBA 3WIBA 4ETMA 2LD4A 3VBCA 1FX0A 5KYWA 1QH0A 3KOUA 4XR4A 1R16A 4U9UA 4IBOA 2EZ8A 1RKQA 1FYDA 3N2NA 3USZA 5AXCA 5K8JB 4CIXA 2XEXA 3KP1A 4NAUA 1LNQA 1VG1A 1UBTS 1SR8A 2A1UA 4LPKA 3T41A 4C6TB 1BYUA 4DJDC 1Y1KE 4QXAA 3JARA 2I8AA 2CEKA 2IKSA 1UKZA 1Y3DE 4WN3A 2X77A 1PZGA 1Z7EA 3A3OA 1Z75A 2VDVE 5CP8A 5EZ6B 2GBIA 1ISSA 2R85A 3W9BA 2R5FA 3DCYA 3LSYA 4ZOLA 3ZCSA 1J39A 1E9BA 1S9DA 3LMKA 4PLTA 4OGKA 3HR7A 3VOBA 2Y4OA 4OX9Y 2FSSA 1GRCA 4OGGA 2OM6A 1NXVA 3QV2A 3QTLA 3CT6A 1O6CA 1HSOA 1AK1A 2JFNA 4KPUA 3SYNA 2E5LB 4FE3A 1S01A 2PJDA 4REOA 4YJ3F 5IVKA 1CLUA 3GCZA 1DAKA 4YT4A 3SDBA 2KLBA 3EZ6A 3GCWA 4KPYA 4KQHA 4PAGA 5HM8A 1SVSA 3A1TA 2O2GA 1T43A 4JR1A 2WK1A 3FVTA 1RRGA 2K2QB 4B32A 3NTRA 3AY0A 4DA7A 5BN1A 4A0GA 2Q3FA 3BK2A 1T3HA 2E5FA 3C5EA 3ONFA 4HP8A 5KSOA 1FFGA 4P31A 3R4VA 1RDFA 3O4FA 3MJ4A 4TV9B 2VEOA 3AERA 1B73A 2HYDA 3ET5A 3GLUA 3HWRA 1YDFA 3G0CA 5E9AA 2VJNA 2ZG6A 4AY4A 4OOFA 2DHQA 1NN3A 3HKEA 3ONDA 1QFXA 1YV9A 2R86A 3UXYA 3C3YA 3FMOB 4UOZA 5B4UA 1QO9A 5AP9A 1CR4A 4TMWA 1ZD9A 1DC6A 2ZBPA 5F77A 3UT5A 4GSYA 2KYRA 4XE5A 5EWLB 4DMRA 3OIGA 1TW2A 1BZYA 1JL3A 3GP3A 1C8LA 5LZ9A 4CMGA 4P3NA 1BO6A 1FSGA 5UKDA 4KEAA 2UXDB 4NQRA 3M6LA 1XNRB 4Z8YA 1VJGA 4RY2A 4N5LA 1M34E 2BWJA 4A0HA 2J3IA 1PG5A 5DH9A 1BHSA 5AW2A 3HEAA 3KYIB 2BGMA 1Z2OX 3EQ6A 5JSFA 1S5PA 5KC9A 2BI7A 5B1YA 4YJHB 1GZSA 2ZE5A 3IBTA 4MUFA 3U37A 4EG0A 3DBHA 5AVOA 3G2MA 4J0FA 3VR6D 3OQ6A 4B3SB 1W0KA 4U7JA 1RJ9A 5REQB 5J2UF 2AXEA 1LQ2A 5GVRA 4E14A 5CG2A 2XKKA 2OSBA 3T9EA 5F73A 4WPGA 3W90A 1N0HA 1T4CB 3NYRA 4QDJA 3GJYA 3IVXA 1NVDA 2XODA 1JHXA 4HL6A 3Q3IA 1D1TA 5EERA 5ER9A 2IXDA 3CUKA 3PT5A 2BDEA 3AEQA 2Q99A 3FDFA 5REQA 4I55F 2G5PA 3UC9A 3W5DA 5BN3B 1U5CA 1GGHA 2C2OA 1IDN1 4BKUA 5AMXA 3OLVA 3T3OA 1YB2A 1WPRA 3A9SA 3LF2A 3M5WA 2I6XA 5EESA 2HTEA 3WBFA 1ZJ4A 2SKEA 3Q6MA 1GPLA 1NJSA 1YFKA 1L5MA 2Q7XA 2W2NA 4JJKA 2PGLA 3WAGA 1L6RA 4UZSA 3VI4B 1CRWG 2ONKA 3HJFA 1NMEA 5F98A 4RTNA 5ESRA 1GN9A 3TFQA 5E1BA 2P3SA 1E2IA 3UYLA 4E88A 5HWSA 3EC1A 2SKCA 5BMVB 2VXCA 1YS9A 2AC4A 4OMUA 1J2RA 1E7RA 3OFSA 4EVRA 4YRNA 5EHNA 5EE0A 1ARZA 2ZIUB 4ALJA 1CUSA 1R0WA 2NWQA 2OK7A 2R48A 3D3NA 1HQDA 1WEKA 4ARZB 5TPZD 5K0FA 3GNLA 4UTRA 3O73A 1Z8DA 4ITVA 1E4EA 2G83A 2R1TA 3TZCA 5K3OA 1YRQA 1I01A 2I4OA 3F4KA 4PG5A 5BPFA 1E2PA 1VIDA 1JG4A 1PRYA 3A1FA 3W2HA 4C7KA 1N0WA 3AUUA 4Y2YA 1DWQA 3A1SA 1BWPA 5BQOA 1JDBB 2FPXA 3KFXA 1XPRA 4I5DA 2C42A 3EVEA 4CG0A 2X8WA 5M2QA 5DHSA 3HVIA 1EBUA 3SHQA 4KNYA 1Q17A 3CNEA 2P6PA 1SMKA 4YIHA 3HXMA 2H52A 4HMPA 4DGSA 3QVWA 2GD0A 3TG2A 3E53A 4XM1A 3PJEA 2W2TA 3HH8A 4WESA 1WCYA 2OFPA 2DFPA 5FADA 3ICOA 2FPGA 4QL3A 4YRDA 1U9IA 2QVBA 4NPAA 5K1ZA 3A7DA 3UWDA 1JUDA 2APJA 2Q4OA 2E3JA 4IIYA 4QYIA 1IZ0A 1CUJA 4L3WA 4RORA 4A2CA 4B4WA 1P3DA 1UANA 2A58A 1XQ1A 3K1AA 4EHBA 1G5RA 1UODA 1D0VA 3EWAA 2HGZA 1JEQA 1XXHA 4B80A 4EFNA 3NUGA 4MQMA 3EJWA 2JFZA 4S24A 1W9MA 1EMDA 4DMGA 4NCBA 1MP0A 1Q50A 4Q7QA 3RVNA 3ZQJA 4CL8A 2PTHA 1J0XO 5T3UA 4QHYA 1OCEA 1TYBE 4GX5A 2PUVA 2D4AA 5FTKA 2VJPA 5I8WA 2D6FA 3UMGA 1AS0A 1SC3A 1V5WA 1SN7A 2LCFA 4IH4A 4ZU3A 1CIJA 3ROKA 4XDGA 3GBPA 1QPGA 3TQSA 2YJ4A 4Z7OB 1XTQA 4ZVQA 1O96B 4CLEA 2ONCA 3GZTB 2JDID 1R00A 3L0PA 3TGWA 4EARA 2HA6A 1DC4A 4DAEA 4R1QA 3LNCA 5AXBA 1KO4A 1NQVA 2B6NA 3GDOA 1U1FA 4FMDF 2EJUA 1YBMA 3COYA 1GKLA 3EVTA 1PV1A 1H4SA 2IYQA 3HU2A 3O4IA 4F3KA 2UYHA 2C29D 4Q01A 5AW6A 3E5MA 2EFCB 4KIGA 3TFWA 1JLKA 4IICA 2JJ2D 2MR6A 1PX0A 3V32A 2PD3A 5B58C 1TKRA 3G2HA 1SFRA 1UMCA 1X1QA 1T6BY 2ZXFA 1AD2A 3CURA 3U9TA 2C7OA 5ED0A 2QM3A 1VSUA 1OGJA 1Y34E 3DOJA 1Z6XA 3NYIA 4C6HA 4DDVA 1GY8A 4CEHB 5EJ7A 5LNK1 2OV4A 1TMGE 3PPYA 3L01A 3A4TA 2GBLA 2PEYA 3P9YA 5JSUA 4QTYA 4FE4A 4QELA 4W5OA 2HSDA 2YDYA 4XUCA 1XEFA 1GTVA 1F2TA 1GL6A 5THQA 1WDWB 3A9CA 1XROA 4LDJA 3WZ2A 5EHXA 4WFJA 1T1SA 1XZDA 1MTOA 4URFA 2ZT5A 1L1EA 4V39A 1M2VB 4R1UA 1Z22A 2QX6A 2O54A 3S4YA 2Z6QA 4GLOA 2GXQA 1QYWA 2AHRA 2X86A 4NDAA 3AEKA 3HUDA 5T5QA 1TYCA 3BGSA 3ZZTA 5DFAA 1VKOA 1K5PA 4QHTA 4QSHA 4G97A 3ZU3A 4DT1B 4IDEA 4X65B 5BSRA 2YL2A 2VSFA 4OHYA 3IBSA 2NTEA 3L6DA 1LW7A 1NVKA 2Q5FA 2GS9A 3SHWA 1HDCA 2JIPA 1B16A 3HYTA 4FYMA 4JVMA 3OQVA 4NZPA 4KNVA 4CHGA 1CVIA 2ICAA 4XYLA 5A5EA 4JAVC 3NTQA 3BXGA 5H02A 5A9RA 1T8WA 5BRNA 5LLDA 1EXWA 5D51S 4PRKA 5GPBA 4RFSA 4FSDA 5IXSA 2EG5A 2BUCA 3H8SA 5L3VA 1O97C 1V8DA 5BN4B 1P2UA 3CEJA 3UWKA 5F23A 4HQ0A 3BJEA 1PFYA 3ODGA 4NLLA 4NV3A 4OO3A 4QODA 5C8YA 3HCOA 3ROEA 1YRAA 3JQGB 3GLFA 1KMQA 2CXPA 4NE9A 2QYOA 1EHCA 3G13A 2W2LD 5KIAA 3QXSA 2Z8XA 1TMOA 3QA9A 1C0PA 4YP7A 2ANCA 4NBSA 5LC1A 2RCNA 1B2RA 1LPSA 2Z4RA 3I5AA 3TSAA 4ZJZA 4MMYB 5CX1A 2CVFA 1LC3A 5CJPA 1VKNA 2GA9A 2XNDD 4ZZ1A 1M7HA 4HAWA 4LV6A 2D5BA 4W9RA 3TXYA 3QXJA 5CLHA 2PIAA 3P52A 1OLXB 4G1BA 1SUSA 2PS3A 3A6KA 3OC0A 5EIOA 1KERA 1SXGA 3JRXA 4I4LA 4RJIA 4YQYA 3UEOA 2XCQA 3TJRA 1K2WA 2EWWA 4IILA 3DFUA 2B1QA 4TT8A 2VJYA 3L8EA 1VE3A 1FTYA 1PEAA 4QNMA 4TUYF 1TAGA 5JAOA 3L9WA 4JROA 4S1TA 3D5EA 2DHCA 1QFMA 5AOCA 1RRFA 2HSZA 3JW8A 4GYKA 3DWEX 4MARA 4CKEB 4YXFA 1SCDA 1M6VA 1TM1E 4IW3B 3W8DA 4PGHA 1E2UA 1H6AA 3QJGA 4UNNA 3GRUA 5DXAA 1F17A 1E6LA 4AAYA 1COWA 2K7ZA 3N8GA 1IN8A 5E1DA 1MORA 1FP1D 3IODA 4ZI5A 4IO1A 4BVJA 3F7OA 1AIPA 4I8IA 4ZQEA 5G0SA 3EEIA 1S8NA 2OE2A 4LHWA 1VBFA 1PKEA 1PZXA 4P08A 3RVDA 4L02A 4RIIA 3AIKA 3M70A 3ORYA 2IBMA 1V5IA 1MX5A 2JCSA 5IDQA 2ZIXA 3EFHA 3BXFA 1NLUA 2I1LA 3FYSA 4ROTA 2Q5JA 1HG0A 3WAJA 2NZVG 2R1ZA 3BZUA 4RH3A 1KK3A 2JK1A 1MKYA 3GPDG 1U2GA 3PF8A 4PLGA 1L5GB 2Y0BA 3DDCA 1MB3A 4MB2A 1X1TA 3S2SA 1JFVA 3GRKA 1TVKA 1Q0TA 3HM2A 4J0DA 3WB2A 2A88A 3A3PA 4WOPA 2C7PA 3VR5A 2ESRA 3DWGA 3INRA 5TPWA 4CTMA 3NZEA 3D6TB 3BWYA 1M76A 3TLGB 3TVYA 2NO5A 3EIUA 4GOJA 1WCWA 3K1YA 1GPDG 5EMJA 3O93A 2ZE7A 2Q5HA 1F51E 1FA9A 4XX0A 5I8ZA 3VTZA 2VATA 3PDHA 4B76A 4H7JA 2C1XA 6AT1A 2O8CA 1O8BA 2Q1WA 2WIDA 3F7MA 3MCAA 3OVMA 4CT0A 5EUQB 8ABPA 3ZGNA 4A3SA 3EZFA 4X1OA 2N1MA 3STTA 1M2NA 3FZNA 1K4YA 4W1PA 2DHRA 1N33B 2ZP1A 4ZIRB 4N54A 3SMVA 3DCJA 3HA3A 3RRZA 4E30A 1F2UB 1ULHA 4PYNA 4F04A 2JKVA 4IJUA 5M5BA 2G28A 3TAUA 5ALWA 1HWYA 2RIRA 1P8AA 4TMZA 3TZLA 3KLNA 4KKVA 3V1LA 3VDNB 4C22A 4AJ9A 1Q1NA 1NI5A 3R3VA 4AKGA 3QMPA 1Q1AA 1T0BA 1X7WA 1JN0A 3U3RA 3HQ4O 4G0XA 1MIHA 1OLUA 1AO0A 1NXWA 1PV2A 2VAMA 1VRCA 3HN7A 2JAPA 2ON6A 2PWAA 1MHPA 5DP1A 3L6OO 1CUIA 4CM3A 3GLFE 4BNGA 1WLSA 2LCIA 5THXA 3A4IA 5K0SA 4HMOA 2KBFA 1V3UA 2MMGA 3AT1A 5LXTF 5IDXA 1Y6FA 5FT9A 2PBRA 3AU9A 2J9GA 1P7YA 3EXEB 4RGYA 5SV2A 5AW3A 5AVYA 4DIMA 5JZ9A 3A9RA 4BLWA 1G9TA 2Y67A 2ZRJA 3FYDA 4HLUA 3TTYA 2PAAA 1ENOA 2Z98A 1P2BA 2X3FA 4RZXA 2HJSA 4NEQA 1RRVA 5DNVA 1KDTA 3DE7X 1UDCA 3IA7A 1A8IA 1E0AA 3S1AB 3V1MA 3AILA 4KI0A 1JA1A 2VHZA 1MEOA 2X9GA 4B79A 4CCYA 1XYVA 2ZWPA 1RKUA 1CR0A 2A9JA 4MWZA 1SCBA 2G76A 1Q6ZA 1PWZA 1NLYA 3FDZB 3D3KA 5JYEA 4TVKA 1E1DA 1PWEA 2OCYC 3DT8A 4FYIA 4QYWA 1NJ8A 3UV3A 2V8OA 4V2UA 2CVOA 3NIFB 4Q7JB 4YT2A 3KD3A 2CMDA 2FOLA 2V7PA 3K9WA 3NYWA 3PYXA 4H3KB 5EEHA 3I52A 3V6MA 5FULA 3Q2KA 4BNZA 2BEWB 5CD1A 1XX6A 3BMOB 1ISPA 4OI2A 1EDZA 3QFRA 1TNDA 4EJ0A 3RM3A 3MMSA 1NU8A 4MH0R 1E1YA 1KP9A 1I1HA 3C43A 3EXHC 1LLQA 4QLOA 5DCLA 1EVJA 4B17A 1QE3A 1X7ZA 2CFTA 4Y9TA 3LY8A 4B73A 1JPUA 4BV9A 1CJTC 5IC6A 4KXMA 1CF9A 1QNLA 4YI3A 3DVAB 2FEOA 4GR9A 4XAQA 4ICIA 3O7MA 3SX0A 2O2HA 1PJ3A 3RTGA 3KEGA 1QHGA 2ZZMA 3I45A 3WGGA 3ENVA 3EGVA 2C0PA 1RC1A 3W1WA 3SPXA 1LSOA 3JQAA 4AL4A 4B4OA 3SEFA 5EZYF 3IQDB 2XECA 4A26A 3WJ7A 1AGYA 1JJIA 4GKJB 4ZPJA 3LKDA 4UFNA 1ZMTA 2VZ8A 3MQ2A 5ALNA 3WLQA 1XWWA 2GCIA 4TWRA 3U39A 4MV3A 4PPYA 5AKEA 3WYGA 4W5WA 4F2DA 4IAOA 2DBZA 5GONB 3ESXA 4M76B 3NJ4A 2JFFA 4DV0B 4QPNA 1JEDA 2BR4A 2AIRA 2ZJ7A 3PC2A 3R5FA 2PU5A 4HLNA 4M2LA 4IV8A 9LDTA 3EPKA 1AQUA 3R24A 2Z8YM 7REQA 5ER6A 4GVLA 4LJLA 2GCGA 4EHAA 1Q22A 2NUBA 4WADA 3G6WA 1L5HB 3OWXA 1YI0A 4J6FA 2R9VA 4K6GA 5E9QA 2ZJOA 3KQOA 5ARBA 3K70C 3P2KA 121PA 4WINA 2P2NA 4RHCA 3RG2A 1MXHA 1L8LA 4H31A 3DAHA 5FI5A 2WWVD 3KZCA 5TGTA 1B23P 1M6YA 3ZD7A 1IXYA 3T1HB 4L8VA 4LJAA 2WPNA 4CEJB 1SUCA 4FYKA 2Q6VA 3KUCA 3H42B 3LYHA 2RFLA 1JHVA 2VK2A 5LLTA 1QH9A 1VA5A 3JQPA 5IYZB 1OLXA 1DV1A 1L4MA 2I3GA 3RJ5A 1EGQA 1T6YA 1ID1A 3GJ4A 4F97A 1V8BA 4JQZA 2JFPA 1UAYA 5HYVA 1RW4A 1WNFA 3VTAA 3SDZA 3ZGXA 3CXRA 2PXAA 1NATA 3DFIA 1GFWA 1QTRA 1CQIA 2Q8PA 1RADA 4PYOA 3DZCA 4LX8A 2YN2A 1XC7A 3BWDD 1JAYA 3AF0A 2PNJA 3WADA 3ELWA 1W2HA 3L1VA 2R6FA 2Z5GA 4AJ1A 4AN4A 4DZZA 5ICCA 2VUIB 4B8WA 3IE1A 3TIFA 4PLVA 4Q4HA 3I1IA 3ICWA 3VYVA 1SQGA 4Q9KA 4EUHA 4MJ7A 4F72A 4RTRA 3J81A 4F5EA 3W1VA 3CEMA 2I1QA 4CTNA 1HOTA 5CM2Z 2PMFA 2OCXA 4JB0A 1ADGA 4MR8B 3PRHA 2QW8A 4KN9S 1RYDA 1JBQA 4NZNA 5DM1A 3P0IA 4UHDA 1ZJ6A 5TJ9A 3R9IA 4KN5A 5ES3A 3BN3A 2X0EA 2B99A 4D41A 1XWFA 3ILXA 2C8LA 3MUOA 4N0PA 3ZWYA 4Z2AA 3GH1A 1JT2A 2PRJA 3MPOA 2NM0A 1RJ9B 1SU6A 4H1UA 4YA6A 5I48A 5JFTA 4ERXA 3OZXA 1N6LA 1AZLA 1TTPB 3A11A 2VCHA 1NI4A 3PDIB 3QOYA 2A5GA 1LX7A 2ZR8A 4K2HA 4Q6WA 5FO1A 4WH0A 4HNUA 1AG9A 2AOUB 1OZ0A 3PEUA 4RK6A 1DAHA 1Z4KA 3LBAA 1W0KD 4KE9A 4RPKA 1PGQA 1AKUA 3IPXA 4K9OA 4RJJA 4RZ2A 3SZMA 5EHQA 3DYBA 4M7WA 4WMLA 4OI0A 3KDAA 1J00A 5BUZA 2W11A 1DLJA 1P45A 3EAGA 4DLLA 4ZP1A 2HT6A 5K3BA 1IK6A 1G0NA 1T5IA 1D0SA 2IY9A 3GLHA 4PR3A 3QMWA 4E51A 1FFCA 5EJAA 4CMEA 4GDFA 1EEXB 1F2DA 4GNKA 4CV1A 4GOXA 1J8QA 1Y5NA 2JEYA 1DBPA 1FQOA 3ZPXA 1N6RA 3V2IA 4PNPA 4BO6A 2C3OA 4E2ZA 1W5SA 4Y6GB 1JW9B 4HAYA 3HDTA 2FZKA 4JI3B 5FOQA 3JATA 3KUDA 1RM4A 2WSBA 4MS1B 4EA6A 1SXJE 1HDYA 2QENA 3O3MB 4XFDA 3WC4A 4IIJF 4QPZA 1WIWA 5C5CA 1EP3B 2DR3A 2G88A 4FCVA 4NYMR 3RABA 4EWLA 4J7UA 1EQAA 5LSAA 4BNDA 1MH9A 2DE0X 4IV0A 4XJXA 3ER8A 4IFBA 3NGMA 2FSFA 2WF5A 1QGOA 2HCJB 3K30A 4WLFA 2V7QA 2WD7B 4G0YA 3GARA 3CGGA 1V8ZA 4KU4A 4F5YA 5BWLA 4I1PA 2WEKA 3MS4A 4OMDA 2C5FA 3UWMA 4QX6A 4QUBA 3S2IA 1N34B 4YRTA 3EXHB 4YC7A 2X9LA 3N76A 2XCRB 3TLKA 4IZ6A 2EAUA 1Y7HA 1ZGGA 2FWAA 1NHGA 4EL0A 1IFXA 3GGCA 1WWKA 3HSSA 3MAGA 3M3HA 4JBWA 5JDCA 5KTSA 3TEJA 4JQYA 1YKGA 3D8HA 3H2SA 4KODA 1Z26A 1DQZA 1VHTA 1KHHA 4F11A 3N2IA 4LNUA 1GPBA 1LSSA 3TW0A 4JU8A 2BEUB 3SHTA 3LLSA 4GSKA 2AUMA 3C3WA 3BC1A 1EUCA 2VRCD 4YRGA 4CM8B 5LKRA 4W9NC 3Q9LA 4ENTA 3OZWA 3BT7A 3QJYA