3OM9A

T. gondii bradyzoite-specific ldh (ldh1) in complex with nad and oxq
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
329
Chain Sequence
PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T.Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ
rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
molecule keywords Lactate dehydrogenase
total genus 111
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3om9A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3om9A02
2X22A 3RUIA 1P3DA 4KQWA 3S2IA 2Q4BA 4XZ3A 4CV0A 4QECA 2O3QA 1YWGO 4FS3A 3TZ6A 4J0EA 4CV3A 4XQCA 2CF5A 4A27A 1WZEA 3JCZA 1X14A 4YVFA 3OSUA 1UXIA 2I99A 3Q0EA 4RLHA 3L9XA 4UUMA 5CP8A 4ZHSA 5TQVA 3C8MA 3P7MA 4BV9A 3QWHA 5JAZA 5EN4A 2NTNA 3DAPA 5KJ6A 1YBVA 3SJ7A 4BNNA 5GZ3A 4NDNE 1N8KA 4PLCA 1LDBA 2VHWA 3IUSA 2FN7A 4MJLA 1CQIA 2C59A 2E4AA 2O7QA 2X5OA 3I5MA 1CIVA 3OBBA 2BD0A 3VZQA 1NAHA 3GRPA 4IIVA 5KJFA 4J1QA 4YRDA 3JQFA 3OICA 4E5KA 4BO9A 4W7HA 4WCDA 5BT9A 3WSWA 4AFNA 5JW6A 5K0ZA 3TRIA 3ZU3A 1EUZA 1PTJA 1E7SA 4YEDA 3UW3A 2RH8A 1DRVA 3BYZA 5C3MA 1H94A 4TRMA 1KVTA 1G0OA 2B5WA 3OJOA 4XQGA 5H81A 1GCOA 3ZHYA 1WMAA 4ZQBA 4PG8A 1MP0A 4IS2A 1DIAA 4NBTA 2Q1TA 3GH3A 2LDBA 5K6AC 4DYDA 5IAAA 3KSUA 3U4HA 3WG9A 2AQ8A 2P91A 5JCJD 3VH2A 4H16A 1H93A 1LUAA 2NV6A 4BO5A 5IZCA 4Q9NA 4OQYA 4XGKA 1NXQA 3WMXA 1XGKA 2VYVD 3D0OA 4E21A 2IZ1A 3U62A 1LLDA 2PA3A 1VL6A 4DVJA 2W98A 3U0BA 3RKRA 5CDSA 2YYYA 2H1SA 3AI1A 5J23A 1M66A 5FYDA 3GPIA 5B4UA 4MO2A 2ZYDA 1E3IA 4BNYA 1KVRA 4WCFA 2HMUA 1UZNA 2FPIA 2IYOA 1XLTA 1LSSA 2AEJA 1GAEO 5FWNA 4BQPA 1NFQA 3N74A 3L6DA 1XA0A 2EGGA 4J2OA 3V5NA 3KSZO 4YPOA 3KO8A 1PL8A 1YJQA 3E48A 2X58A 5DF1A 3L4SO 4R1SA 4MINA 1ZO8A 5ER9A 4JBHA 4RGBA 3HFGA 1P33A 2DBRA 1JN0A 2AE2A 3N58A 2FSVA 2VYNA 4GLLA 4ND4A 3ITKA 2EKLA 3JD0A 1SC6A 3ANNA 2PH5A 1O94A 5AVOA 4E4YA 4QSMA 1Z75A 5A5FA 4GX2A 2VRCD 3L9WA 1GQ2A 3GFBA 2EJVA 3HN7A 1NPYA 1DLJA 3PI7A 4JNKA 3DBHA 3GLQA 3NDIA 1XCBA 5F1OA 2JFHA 3TZKA 4WPGA 4EJ0A 3E18A 2JAPA 4ND3A 1X13A 3GA0A 3SVTA 2W2KA 5LC1A 3RQSA 3BMOA 3FNFA 4DIOA 3KYDA 3IP3A 1BRMA 1FDWA 1EK5A 1P44A 3AU8A 4RF2A 2HRZA 1I3KA 4N7RA 4URFA 3AY3A 2BI8A 3HDQA 1OC2A 1Q7CA 3AFNA 1U2GA 1Y1PA 5AOVA 3W4KA 5JLAA 5B4VA 3RUAA 3CXRA 1ZW1A 5DDIP 9LDTA 3D3EA 2XOXA 1I2ZA 3EZLA 4J9VA 3GNTA 3NYWA 2HK7A 3ASVA 3DONA 3ROPA 3VPXA 5TX7A 3X2FA 3ADOA 4E2ZA 3UGKA 4BNVA 5DULA 2Y93A 5JMPA 2NTJA 3EMKA 4UVDA 3TQHA 3QVTA 4LCEA 4D44A 4OYRA 1ML3A 2CF6A 3BMOB 5ICMA 2J3KA 4H3VA 4D3DA 1JVBA 1E3LA 4XEHA 4O63O 3RC7A 4TKLA 1CRWG 1I8TA 3DZGA 3O8QA 4CR7A 1FF9A 3FR8A 3WXBA 3ZHZA 1WAMA 2AMFA 3KSDO 1L1FA 1QORA 1D7OA 1HDCA 1A7KA 5FF9A 4DLBA 4YAEA 4FPXA 1M2WA 3BXXA 2POQX 1PZEA 4MVJM 3ZN2A 4GX1A 2EJWA 1YL5A 3GGPA 4E5MA 2ZTVA 2P5UA 3GVHA 3JQ6A 1U4OA 1DC3A 4P4LA 1TEHA 4OSOA 3ZV5A 1YL7A 1M6WA 3GF4A 4R68A 5EMHA 5BNTA 3DBLB 4R1UA 4CV2A 4J4BA 3DMTC 3HSKA 5DCYA 3ULKA 4CMBA 4DMLA 4YT8A 4EJMA 1IHXA 2FSSA 4LGVA 1MG5A 1E1MA 1BVUA 2X9NA 3MCVA 4Y6PA 1D4FA 1GEEA 3AJRA 3VPFA 3GAFA 2DPGA 3BTOA 3VPSA 1O8CA 2ZJ1A 4WLOA 1DC5A 1QG6A 3GNQA 2NTVA 5GZ6A 3U49A 3TZHA 3WGTA 3IUPA 4P4GA 1YQGA 1Y8RA 1O5IA 1ZCJA 1O0SA 2WM3A 4RO0A 4KMSA 2IODA 2HUNA 5KKAA 4U6SA 4D43A 3OP4A 3ZWAA 3MZ0A 3WTBA 2LDXA 3ETGA 4NFHA 2YHUA 4R4JA 3D3WB 2I66A 1PZGA 2IRWA 4OO3A 1UXGA 1VM6A 3HG7A 3QWAA 4Y9DA 1V6AA 5L3ZA 4GPD1 4GMFA 4LVCA 3ONDA 4WKGA 1B14A 3H3JA 5JDCA 3B20A 4Z9FA 1K6XA 4L75A 5L95A 2NACA 4MKRA 4N5LA 1GR0A 2I5PO 3HFSA 1PEDA 2JCXA 5C5IA 1HDYA 3KEOA 3AOEC 1DEHA 4ZQGA 1A4UA 4FW8A 1ZSVA 4TRNA 4FQ8A 2W2LD 1NNUA 2QX7A 4JK3A 1D3AA 4TVBA 3NGLA 1AUPA 2UYYA 2F00A 4OMUA 4BL5A 4G65A 2X5KO 3V8BA 5I7EA 2WWRA 2X1HA 3IAHA 1A7AA 4FGSA 1PJLA 4FJ2A 4J4TA 3UF0A 4NJOA 3COSA 2Y66A 2WMDA 2DTDA 2O23A 5AQ1A 1VL8A 5TSDA 1E7WA 3AK4A 3RUCA 3T7EA 2OOSA 3FR7A 4D3FA 1MGOA 1OOEA 1P31A 2DC1A 3GQVA 3E82A 1SBYA 4Y8VA 1LRKA 1O89A 3L6OO 2V6FA 1V0JA 3RKUA 3ROKA 1T2DA 2BGMA 3DFZA 2JD1A 2CFCA 2DT5A 3H5RA 2AXQA 4CMIB 1I10A 1VKOA 3MOGA 1MXFA 1B26A 3GEDA 3AY6A 5JYDA 1ARZA 2PNFA 1A72A 3GMDA 4HP8A 5A03A 4XB1A 3JD4A 2GZ2A 2OBNA 5L7WA 1CERA 2GGSA 2D2IA 2PK3A 3BZUA 3NUGA 1U8XX 4IMPA 3G1TA 5L53A 1C0LA 1RM3A 3NDJA 4N18A 4NJMB 3S1LA 1CEQA 3ZNPA 4ZN6A 4CMHA 3JYNA 1QXSA 1EUCA 1QYXA 2X9GA 5COBA 1X7HA 4JJGA 4NBWA 1KVQA 3K5PA 3F4BA 5L4NA 4LSMA 4PG7A 4BNMA 4BMVA 3C7CB 2VYND 1GEGA 3VVBA 2HMVA 5EJ2A 5DBFA 1PWXA 1PJ2A 1Q0HA 4IDEA 3H9UA 2OGUA 1N9GA 4GI2A 1KVSA 4IDDA 1UAGA 2A9FA 2DBQA 4L4XA 3VH3A 4CM4A 2JJYA 2A94A 4FFNA 1Y9AA 4NK5A 3W6UA 1LDYA 3K2EA 2Y0EA 1UP4A 1Z7EA 2B4TO 3DZBA 2IZZA 3UAGA 4J4HA 4E2YA 1PJBA 3TZCA 1PSDA 3WGGA 1J6UA 5A5EA 3GC6A 1YVEI 4G2NA 2ZYGA 4NK4A 3PZRA 2O3SA 1BXKA 3BHJA 4E12A 1LC3A 3VZRA 1LLCA 1GQYA 2VWGA 3OJFA 1HSZA 4D45A 2TMDA 4WLEA 4AJIA 1Z7BA 5I7FA 4HY3A 3SLGA 1RPNA 1Y7TA 5KWEA 3OQ6A 1VSUA 4J3FA 4B8ZA 3H5AA 5EERA 2BHLA 4B3HA 3BMCB 4Q3CA 4EGFA 1E7QA 4ROSA 4BNLA 2Q1UA 2VUTA 4GWGA 4ZQEA 3PGXA 4IDGA 1DPGA 1XQ6A 3ORFA 3PWKA 4RPGA 3RJ5A 3DMTA 2QRKA 4AG3A 4YRBA 2EKPA 3KEQA 1LSOA 7ADHA 3Q1LA 4J6FA 4WLFA 1F0YA 3LC2O 1E6EA 7MDHA 1BDMA 4AJJA 4BIIA 3VVCA 3PP8A 4XYEA 4RF4A 3ZWVA 3OFSA 1DHTA 1XG5A 3T7CA 2J3IA 3JQ9A 4J90A 3G79A 3DZJA 3E5RA 3G3EA 3HADA 3NEPX 4D42A 2D5AA 2FR0A 4PVDA 2QIOA 3C1AA 1I36A 1V3UA 2GN9A 2XF8A 1HRDA 2CUKA 1PQPA 4I5EA 1Q2XA 3STHA 4EJ6A 3VPGA 3ON5A 1GCUA 3E9QA 4EEZA 3ONEA 1JWAB 1GTMA 4W99A 2I3GA 2CDBA 3C7AA 3LQFA 3LZ6A 5U4QA 1B8PA 3WQQA 1BXGB 3BMNB 3DBRA 3GVCA 3R3JA 4ZICA 1DHRA 3FBTA 3FWZA 2FMUA 3KLPX 5EQDA 3PIIA 3JQAB 4W82A 4LVUA 4XWYA 1QLHA 1N7GA 4DLAA 2EP7A 1KEUA 3PYLA 5TJ9A 2BGLA 1PGOA 1DBVO 4BNTA 1H6CA 2X4GA 1NAIA 1Q1NA 3AM4A 3TNLA 1GY8A 2X0RA 3HUDA 3WLFA 3CZRA 5EPOA 2PZLA 2QHXA 4NBVA 3JQGA 1LBEA 4IGEA 1QKIA 1NR7A 1WP4A 2Y68A 3PK0A 4FDAA 4E30A 5KNLA 4XR9A 2D3TA 2YHIA 3C1OA 2X23A 3WJ7A 1YO6A 4CMIA 3NGXA 4UVHA 5T8KA 3HQ4O 3L0DA 3MOIA 3V2UA 2BFAA 3IC5A 1BMDA 1XSEA 3ZWYA 5C7OO 2EV9A 4CLRA 1DFGA 2DTEA 2P4HX 1F14A 4B3JA 5JDIC 1NP3A 5ILGA 1E6WA 5IG2A 4WCFB 2EERA 2O7SA 4J49A 4A2CA 1H6BA 3CSDA 4P38A 5ER6A 1EZ4A 1PZFA 1R37A 2P9GA 3O38A 4P4NA 3JQBA 5JO0A 2PGJA 4IMRA 1JVSA 4XDYA 5JY6A 2Q45A 5JSFA 1LU9A 3VTFA 5T5QA 1JAXA 2P9EA 1E3JA 4WOKA 3PHLA 4WLUA 3K2BA 1I24A 5HTOA 1R0LA 2VNAA 4GGPA 4FCCA 1LDNA 3FHLA 3K9QO 3BTVA 3WTCA 3RUEA 4CMGA 4BO4A 2E49A 1PJ4A 3CINA 2ZQYA 2V65A 4Q3DA 2UVDA 2NU6A 1M76A 3NV9A 5IF3A 2F1KA 1HDOA 4H15A 5IZCC 1GYQA 3KRTA 1GYRA 1V3TA 1HE5A 4NIMA 3S55A 3AOEA 3KUXA 3WBBA 4R5MA 4KWHA 4PG6A 1U3UA 1WWKA 4BB6A 3LLSA 4RCVA 3ZU2A 1ZFNA 3SLKA 4N54A 1N7HA 2IEDA 2ZTMA 4BKPA 1HDZA 1A9YA 3CMMA 1SOVA 4G5HA 4I5DA 1U5CA 2YDXA 3HZZA 2OP1A 1DB3A 5LCXA 2GF2A 1T26A 3DZHA 4J1SA 4DREA 4YA6A 3I9KA 3SX2A 2CZCA 1R16A 4OAQA 5ENDA 1K5HA 3JYQA 2E82A 4DQUA 3C3XA 3UUWA 5JXWA 1GPDG 5JCXA 1C1XB 3ANLA 3AWDA 4NZ9A 3RAJA 5JAMA 2FZWA 1HLDA 3PJFA 5F1PA 3OEWA 1HF3A 3ADPA 4CL8A 5KOIA 2VT2A 2FHSA 1EK6A 3FCOA 4ZGWA 3O9ZA 2PD3A 1ADBA 3H4VA 3TF5A 1DJQA 1YS4A 4J7XA 4Q3NA 3AW9A 2ZB3A 3FF4A 3SXPA 4YXFA 4AJ1A 3LT4A 4J9UE 1LDGA 3I9MA 3PQFA 3D4OA 4U6QA 1AXEA 2AHRA 2IDZA 4WK6A 4B8WA 4JXKA 4Y67A 1H9AA 3GEGA 4EEXA 4MVJG 2WYWA 4A10A 1QSGA 2A4KA 3ST7A 2VNSA 4R5HA 1GADO 5GMOA 5T6BA 4WLNA 2BH9A 1DDOA 1KS9A 3PQEA 3AUTA 3H9QA 1NFFA 3QA9A 3PJDA 1I5RA 3ASUA 3KXDA 4BNKA 5F21A 3KB6A 3KM0A 3OIGA 3JQCA 2GDZA 3NJ8A 2XPCA 3OMLA 3F46A 5A3VA 2IXAA 3B1FA 3W8DA 1PQWA 4WGGA 4WUVA 3VC7A 3ZWNA 2H63A 1ZK1A 2P9CA 4ND1A 5DCUA 5ITVA 5DOVA 5IXSA 1PZHA 4CM8B 1HL3A 3I9NA 4Z9YA 1VJ0A 4RVUA 3SEFA 3QVOA 1TVEA 1B8VA 3QWFA 4HBGA 1U28A 4JLWA 5B12A 4P8RA 2WDZA 1YBMA 2EHDA 3RBVA 1F17A 1HEUA 3VZPA 2HSDA 4RPJA 3UCXA 1DAOA 4XRRA 4JBGA 1TXGA 2GZ1A 2YQ5A 4UEJA 1ZEJA 3PWSA 4DLLA 4QUKA 1DLIA 1FMCA 1MFPA 2NQTA 3ZI0A 1OFGA 1LSJA 4CM6A 3GVXA 2I9PA 4IGFA 4BNGA 3OJLA 4FN4A 1HE2A 3BMQA 2V6MA 3JQGB 2AG8A 1UXJA 5KCZA 1IYZA 3KTDA 3UCEA 4N5MA 4OSPA 1EUDA 3NAQA 4E6PA 1UZLA 1YGYA 1GPJA 4IDAA 1KY5A 1A5ZA 1O9BA 1CQJA 1B2LA 2W2LA 1N1EA 3GDGA 3GK3A 3V1UA 4ND5A 1TB4A 2GRAA 2PZMA 3ZW8A 4Y6SA 4ZRNA 5I9LA 2OMEA 4GL4A 4NQZA 4LW8A 2FRDA 3FD8A 1JDJA 2GUGA 4KDEA 3IIEA 2ZK7A 2C0CA 2WD7B 1QR6A 2J5RA 5TC4A 3NRCA 4YTEA 2GO1A 3DBVO 2ZCUA 4CR8A 2VZ0A 4L74A 4OIMA 1UZMA 3DHYA 3AUAA 3UVEA 1ISGA 1GUFA 3JD3A 1AXGA 4M87A 1RM4A 2AE1A 2G82A 4YT4A 5I7SA 2EW8A 5JYEA 3EDMA 3ICPA 2DU8A 3K30A 3VAZA 3PVZA 4ALIA 3GOHA 2UDPA 3C1TA 2Q3EA 1NVMB 2G1UA 1Y5MA 2C54A 1EBFA 4E31A 1ENYA 4R16A 3TJRA 2D8AA 4R69A 1P1RA 3IP1A 4PZCA 2CNBA 1T4BA 2DKNA 2Z95A 5CFZA 3W4JA 4WEOA 1R6DA 3PXXA 4YDRA 4M54A 2JHFA 2A35A 3RC9A 3ITDA 3I9JA 5EL0A 2X9VA 4FOSA 1JTVA 1E0DA 1FDTA 3DMYA 3K31A 1P9LA 5G0VA 3OQ1A 3PPIA 1MC4A 3FI9A 5T64A 1T1SA 5AXAA 1K6JA 1YDWA 5H82A 4IPTA 5BNFA 3VOSA 4NFYA 2DBZA 3JQ9C 3JYPA 3A9WA 2FWMX 3OHSX 3TDKA 5AXDA 1ULSA 4EI2A 1JKFA 4CUZA 2DAPA 3MWDB 4J1NA 1KOLA 1E3SA 3LLVA 3ANMA 1NPTO 2HKIA 3WQRA 1T2AA 1LQTA 1XELA 4RVDA 3BIOA 4U8GA 4OXKA 3WGZA 5MDHA 1UP7A 4GGOA 1PGJA 1HXHA 1MC5A 3QHAA 4YCAA 5A3JA 4TZKA 2E6UX 5LDHA 2Q1WA 3U4DA 4RV9A 4FR5A 1O95A 3BAZA 4NPCA 1P1JA 3QE3A 3PHHA 3FNHA 4P22A 3DXFA 4GQAA 1WLYA 3ZHBA 1H2BA 2NVWA 1LEHA 1JQBA 2VTDA 3RBZA 2D1YA 4O0LA 3INGA 1MV8A 4CODB 1DOHA 2JFFA 4CPDA 1C0PA 4BB5A 2BF7A 2QRJA 1M67A 3RJ9A 4I08A 1U1IA 1U9JA 3TSCA 4FFOA 4HNGA 1PU2A 1VKNA 3DHEA 2EXXA 1LTHR 3L4BC 4R3WA 1PJ3A 4E5NA 3NKLA 3UXYA 4BUCA 3M1AA 3H6KA 4BKRA 1NQOA 1JW9B 4ALKA 4MVJI 4YJGA 4PCVA 1U5AA 4IXWA 5FEUA 4W7IA 4XKJA 3QWBA 2NU8A 1I33A 1P74A 1UJMA 4QXMA 1SEPA 4BO1A 4DPMA 3FNEA 5BSGA 1E5QA 2Q1SA 3WICA 3QSGA 4EYEA 3NJ4A 4DQXA 2PV7A 1X7DA 3GGOA 4OM8A 4ZQHA 3RFTA 4YWJA 1QYDA 1NBOA 4IZHA 1BVRA 1D1SA 3LT0A 3TOXA 3PFFA 1Y6JA 2AA3A 3G49A 3E5MA 3ONFA 4M89A 4XIYA 2Q50A 2XXBA 3RI3A 4YJHA 3W8EA 4HX5A 1XIVA 2GR9A 3Q11A 1S6YA 4YJGB 1P1KA 5AYVA 3HHPA 4ZRMA 3UCFA 3GN1A 3AFMA 1N5DA 2DTXA 2VOJA 2P68A 5DT9A 3SJUA 1BXGA 3DBRB 3H9JA 1P1HA 1YRLA 1QYCA 1EMDA 5T67A 1Y8QB 5L7YA 5C7LO 3BTUA 3GHYA 4IINA 5I8WA 4PLZA 3ZWCA 2E48A 2ZATA 2Y1FA 2V6GA 1JKJA 1Z45A 1LLQA 1CWUA 4NU6A 2Y1OA 3DB2A 1EEHA 3QVSA 1SB8A 3RUDA 4BO0A 5G2OA 4K1LA 1U8FO 4J7CA 3RVDA 1J49A 4GSKA 3GNSA 1AHIA 1BG6A 4U0JA 3NT5A 3TN7A 1PQUA 3FNGA 3HDJA 3Q2IA 1ZSYA 4YT2A 4L0QA 4B7CA 3L77A 4L8VA 2G17A 2ZB4A 4OH1A 5F3RA 2Z1MA 4Q3EA 5A9TA 2X0NA 4HADA 1DFHA 3TOZA 5CEEA 4E5YA 3GDOA 1A27A 2EIHA 3PTZA 3H2SA 3G0OA 3WYBA 1P45A 3ETEA 3RU9A 4J2HA 2R00A 1YB5A 1IHYA 2PKRA 4O1MA 4OGWA 4QFDA 4AJLA 1N9GB 1WZIA 3OF2A 2VRCA 4BGEA 1B15A 1SEVA 3NTOA 5G0TA 2ZYAA 4J16A 4FFRA 2YY7A 2C29D 4IDCA 1B3BA 3PHJA 1I3LA 4KUHA 4DYVA 4RVGA 3RSHA 3PYXA 4BO8A 1BDBA 4NI5A 2JCYA 4XX0A 1H0KA 1T4DA 2ZCVA 1ZJZA 1IZ9A 2BFPA 3EVNA 1PJTA 4D46A 2PZKA 4J91A 1R15A 5CG1A 3ZNNA 1NTOA 2AW5A 2O3RA 4CLOA 3DAFA 4DL9A 1KEVA 4PLVA 1E3WB 1B0AA 1F8GA 4UEKA 4TRJA 1UDCA 2C07A 3F47A 4LCJA 4BNFA 5ENVA 3S8MA 2UUPA 2NQ8A 2GERA 2CSUA 1RWBA 3OQBA 3WB9A 3S2FA 4QO7A 2WJPA 4GVLA 2B4RO 2UV8A 3E8XA 4AICA 1U4SA 3ZU5A 3K8ZA 2GPTA 5HA5A 3ZDFA 3HN2A 3QVXA 3EY4A 3EZYA 5JBIA 3RCBA 1U7TA 4UAGA 1MUUA 3W6ZA 3Q9UA 1LRJA 2AG5A 2I65A 4RF5A 4D7AA 3O03A 5JC8A 2YV1A 3OJEA 4NH4A 4PLGA 5JPIA 2B36A 3I1JA 2AEFA 1YOVB 3H5NA 4GAEA 4UVIA 3JQDA 2H9IA 2J8ZA 3P2YA 4CQLA 3JQ7B 1PR9A 3L4BA 3WWYA 2PLAA 1HWYA 2HMSA 4NMHA 3ROMA 4GWKA 4M55A 1VC2A 5JO9A 2VCYA 3CZMA 3VPHA 3NDRA 1P77A 1DSSG 1B8UA 4S1VA 5A4DA 4IDFA 3O8QB 1Q0QA 2BELA 1QMGA 2YW9A 1SZJG 1YJ8A 4ILKA 3IJPA 2WYUA 5GY7A 8ADHA 3DZKA 5IDWA 4OKIA 5JDCC 2VWPA 4TSKA 4FSHA 1E1NA 2X86A 3FPCA 3IKTA 4DTIA 4XQEA 1I2CA 2Q49A 1LA2A 4MKXA 4MVJA 1JA9A 4MPDA 1E5LA 2O4CA 1NHGA 2JHGA 3PFWO 3NT2A 5DNAA 4DIFA 2D5CA 3HWRA 2ZB7A 1ZNQO 4NFSA 1YONA 1U3VA 5GZ1A 2AQIA 2ZKLA 3WNVA 4UVGA 1NYTA 3D5QA 3GEMA 3PIDA 1BHSA 3V1TC 3QLJA 4QFCA 1TI7A 4X54A 2B37A 1XKQA 3K92A 3B1KA 2EF1A 3WIEA 3CUKA 2ZTLA 3FBGA 4BNZA 2O48X 1A4IA 1TT5B 4RVHA 4CMEA 1NHWA 5TLSA 3CH6A 1SOWA 4CM7A 1NFRA 1VRWA 3LC7O 3VDRA 2QG4A 3SBOA 3ZV6A 4LISA 2VZ9A 1FDVA 5H83A 3ETDA 2OP0A 4F45A 5AXCA 4BGUA 4YAJA 4UULA 1D1TA 5I8ZA 2PGDA 1EE2A 2AEMA 1RJWA 1MA0A 1C0IA 3RU7A 3WLEA 4CJXA 3OJ0A 5A04A 4L73A 2DM6A 4M86A 1BW9B 5MGBA 1HDRA 1ADFA 1NQAO 3N7UA 4QO8A 3S2EA 2DPHA 4YJFB 3AM3A 4YJFA 4KTVE 1I0ZA 3E9NA 5JCJA 2VWHA 3A28A 3QIVA 4ZU3A 1A9ZA 1ZH8A 3MEQA 5CPBA 2ZIZA 2GN6A 4N5NA 1CJCA 2Q99A 3I9LA 3I4FA 2VHVA 3KYBA 4ITUA 4QTZA 3ROQA 3RFXA 1DFIA 2C5EA 1XR3A 5TNXA 4CLRB 2YQ4A 3DEYX 2O3UA 2VUUA 3LU1A 1I3NA 2DFDA 1ISMA 1ID1A 2UUOA 4QEDA 4ALNA 1NWCA 1ZMOA 5FFFA 1HZZA 6ADHA 3IL2A 3RD5A 4ALLA 4CLEA 3A06A 5TIIA 4R1TA 1LQUA 2CDAA 1GDHA 2D0IA 1HDXA 2J3JA 3A4VA 4MKZA 3B70A 1F8FA 3ZHXA 1FXSA 4AL4A 1X15A 1TT7A 1W0CA 4AJKA 4KDFA 3VH1A 3LDHA 1HT0A 5CDGA 4RL6A 4ONEA 3WWZA 1ISHA 3WSVA 2OUIA 1IY8A 4PG4A 2YFHA 4WASA 3GDFA 4EITA 1TLTA 2IXBA 3MWEB 4LSWA 1E3WA 2Y1DA 2Y0CA 3QWIA 1S7CA 3GZNA 2WSBA 1OC4A 4LK3A 5BSFA 4I5FA 2BRUA 2C2YA 4KP7A 1T1RA 4ZD6A 4FB5A 3H2ZA 1OBFO 2HMTA 4A03A 4DBVO 5ILOA 5CDYA 1DO8A 2NWQA 4E0BA 5THQA 1M75A 4I9NA 1OMOA 3KYDB 2V7PA 1V8BA 1LLUA 5IN5A 4CUJA 5B4TA 1G6KA 3D4NA 4J7UA 5G4LA 2WE8A 3ZWPA 4E13A 4KOAA 2G76A 1VPDA 2VRBA 3IOYA 4UREA 1E6UA 1EBUA 3CEAA 3D7LA 3JQ8B 4RQUA 5G0WA 4CM3A 1OZAA 1U7HA 4XCVA 2GSDA 4RZIA 4DMMA 2NVBA 3E03A 1NQ5A 1ZK3A 3ZWWA 1T2EA 1SNYA 4IBOA 4XGNA 2YFQA 5U9CA 1H6AA 4IXTA 4W9NA 3PHIA 3I6QA 1T24A 1P0CA 2HDHA 4U5QA 4D41A 4F6LA 2O50A 1A71A 3IQDB 4CQLB 5IJZA 3ENKA 1VJ1A 2B35A 3EYWA 3QJ5A 3QY9A 1ZSNA 1WW8A 1UUFA 3FWNA 1K2WA 1X0VA 4CMKA 4OL9A 1U2DA 2C5AA 1GUYA 4HUJA 5CEFA 1Z82A 1KY4A 1ZXBA 4CQMB 2O2SA 2QRLA 5L45A 3L07A 4MP8A 4BNXA 4CMCA 1C3VA 3PEFA 4II2A 3KLMX 4B3IA 4BO3A 3NT4A 2DBVO 1WDKA 5HWSA 5KKCA 5BNIA 1MG0A 1P1FA 3KV3O 4O5OA 1DJNA 5IDXA 4EW6A 3BA1A 2PKQO 1HYEA 2ILTA 2BFMA 2GNAA 3LYLA 2JD2A 2Y67A 2XXJA 1XQ1A 4Q3BA 4RPHA 2I76A 1ONOA 4MIEA 3FTPA 3KETA 5DBIA 3ENNA 3CPSA 4EUEA 4CMEC 1GU7A 1CETA 1N1GA 3E9MA 4HNHA 1N92A 3M2TA 4XDZA 1XU9A 2JFGA 1G1AA 4FFLA 3I52A 2GZ3A 4CQMA 2WYVA 2PKQP 4ALJA 3VH4A 1PL7A 2B5VA 3JQFC 3FN4A 1WMBA 2B4QA 3ZU4A 3OM9A 4LN1A 2Q4EA 3PLNA 4TKMA 1PS0A 3H3FA 1G0NA 1Y5RA 4Z6KA 1BSVA 2VYVA 3CTMA 5JNLA 3VZSA 2BI7A 4BMNA 4K9DA 3DOCA 2EEZA 4MIYA 3IS3A 3TWOA 1EDZA 1CF2O 2FP4A 4ZA2A 2Y1CA 3H9EO 5A05A 2JD0A 3JQAA 2RCYA 2PR2A 4D0SA 3ZGYA 3GY0A 3R6DA 1J0XO 1YQDA 3PWZA 4IQ0A 4PLFA 4KQXA 3HJAA 3JV7A 3LVFO 2ZQZA 4FBGA 1XWFA 3I9OA 3PHGA 4DRYA 1GL3A 4BMSA 1YDEA 4B4OA 4XYBA 1H5QA 4YJHB 2VN8A 2HJRA 5JC1A 3RUHA 4FGWA 4F3YA 4ID9A 4DBZA 2DUWA 4KZPA 5A06A 4I5GA 3BTSA 3CKYA 4F46A 3R0IA 1LI4A 2GD1O 4TROA 3C24A 1HDGO 3LF2A 3OIFA 3PJGA 1AHHA 3WGYA 2ET6A 1SCUA 1B16A 1PJSA 4XYMA 3HB5X 1NVGA 2VT3A 3KZVA 5TT1A 4NU5A 5LDGA 4DIBA 2Y05A 1ZUD1 4G81A 4R3NA 3MJEA 2W90A 3PDUA 4UUNA 1ISIA 2C20A 4PIVA 4PLTA 4TWRA 4WE3A 2Y99A 4BV8A 4FFPA 4YBZA 2VOEA 1PGQA 1Y9EA 2HAEA 4NG5A 3X2EA 5THKA 2Q2VA 3E6AA 1JWBB 4LRSB 1IPFA 1JLLA 2PGLA 4BS9A 1UDAA 3D4PA 3Q6IA 4W4TA 3QQPA 2GCGA 3GGGA 3HDHA 5G0SA 5A9SB 1EVJA 1KC3A 1PX0A 3P5SA 4AJ2A 1X7GA 1EVYA 3P2OA 3TZQA 1J4AA 3JD1A 4Q3AA 1IB6A 2D4AA 2X0IA 4PGFA 1IE3A 5CEJA 2ZB8A 1LRLA 1R4MB 4RORA 2EG9A 3OA2A 3NTQA 3TPCA 1WNTA 1GZ6A 1Z73A 4XJTA 2HK9A 4YQYA 3NTRA 3ABIA 2HLPA 1ZJYA 1FDUA 1F12A 3G17A 4PG5A 4K26A 4I9UA 2W2KB 1MLDA 1RYEA 2CD9A 3LT1A 3K73O 3ZWXA 4ESOA 1C14A 1P1IA 3GAZA 3VKUA 4BKOA 4YYZA 3B1JA 4KUEA 2OBYA 1ZBQA 3R3SA 2GASA 3AUUA 4GBJA 4YAGA 3U5TA 4DA9A 3GG9A 1UDBA 4B7UA 3JQBC 1VLLA 4XB2A 4DXHA 3U09A 4ZVVA 4IJUA 1XHLA 3RWBA 4H7PA 1L7EA 3JD2A 2HJSA 4FFMA 3EHEA 4K6CA 4L76A 3WDSA 4W9NC 1LC0A 3H7AA 2OL4A 4IY1A 2PD4A 3GVIA 4F6CA 1XEAA 1X1EA 3OETA 5IDQA 2OFPA 2PTGA 3MTJA 3EUWA 2DQ4A 2P4QA 4A5OA 3F1KA 3C85A 1WDMA 4E2WA 5C7IO 3I3OA 1GUZA 3KYCB 1ORRA 4RVSA 2J5KA 2JAHA 3AM5A 3K6JA 2BLLA 1LXCA 3DZIA 5G4KB 4DC1A 1SPXA 1IPEA 3M6IA 4LMRA 5G4KA 2C82A 2FPGA 3JQAD 3GUYA 2I3AA 1FK8A 4BGVA 5IFLA 1HZJA 1T2CA 1E77A 3IKVA 1YXMA 3DHNA 4O6VA 3G1UA 4R54A 3ZNOA 1WXDA 5EINA 2VUSA 5L4LA 4RDIA 2O4UX 6LDHA 3Q9NA 3WS7A 1TA4A 4PN3A 2PD6A 3CIFA 4FJ0A 4A0SA 1KETA 3GPDG 1V3VA 3F1LA 3GHHA 4RF3A 1Y8RB 5EIOA 3DWFA 3QW2A 3RC2A 4JX8A 1KEWA 1GQQA 4NR0A 3R1IA 1I3MA 5I9MA 1PWZA 2J3HA 1HYHA 2Y1EA 4DWVA 4QQRA 1PJCA 4DPLA 3D3WA 4XGIA 5JMWA 5JE8A 1MB4A 5TJHA 1SMKA 5JS6A 2JKVA 3HNPA 1K89A 1J5PA 3UKOA 1W4ZA 4XJSA 5JFOA 5TF4A 3LC1O 1JU9A 4CQMD 1E7RA 4OJNA 3SC4A 4BNUA 1ZMTA 3TFQA 3TL3A 5F1KA 1EQUA 4JROA 5BSHA 4PRLA 4Z0HO 4CM8A 1DIHA 4TRRA 1YQXA 4BNHA 1TT5A 2W8ZA 2GYYA 4CLDA 1BTOA 4K6FA 3SC6A 4MVJH 3KOUA 4YB8A 4BGIA 4RZHA 1E1LA 2RBEA 2TMGA 5L9AA 4OOEA 1I2BA 1NPDA 4D0RA 3W1VA 5A1TA 1GZ3A 5JY1A 1VJTA 1ADCA 2NNLD 2VTEA 2R6JA 3UICA 1YL6A 9LDBA 3GFGA 3HB4X 1MXHA 2CVQA 1DAPA 4E33A 1T2FA 2HO5A 1NM5A 1DC4A 3FTNA 5BQFA 4NJMA 1P0FA 3ZV3A 3DOOA 2G5CA 1BW9A 4RJTA 1W6UA 1R66A 4FC6A 3MJ4A 3I4CA 3IJRA 3EK2A 5CPFA 1GV1A 2Q46A 3QV1A 2B83A 3EGOA 4HFJA 1E1KA 4R9SA 4RPLA 3ZWMA 1LNQA 4TQGA 4HKTA 1FJHA 2HU2A 4IDBA 1KERA 4XA8A 4CLOB 2CVOA 4DUPA 2DVMA 4JN6B 4Z3KA 4WLVA 4CM9A 5B1YA 1ZEMA 1V35A 1C1XA 4E5PA 1EDOA 4BQRA 4CM4B 5FI3A 1QV7A 4LRTB 1BGVA 4XRGA 1EVZA 5DCWA 3DQPA 1NWHA 3F5SA 4MVJD 2RH4A 1X0XA 4O59O 1YB1A 4KUGA 4FD3A 4MP6A 5DP2A 4QX6A 1CYDA 4R51A 1QV6A 3MJSA 4TVOA 2IE0A 1PJQA 1UR5A 8LDHA 1LDEA 2DLDA 3DC2A 3PRJA 3S2GA 2RHCA 2UAGA 5COQA 4JBIA 5L40A 2NM0A 3AU9A 1Q7BA 3OECA 1ISJA 4TMFA 3WFIA 5COAA 4UUOA 2VZ8A 1XYGA 3TFOA 1C0KA 1R12A 2VHYA 4HWKA 4CM9D 5KTKA 2IEBA 5DBGA 3OH8A 1LJ8A 2YJZA 1XU7A 4MVJF 4YACA 1H2HA 4R1NA 2CY0A 4L9RA 4IUYA 1C1DB 1K3TA 4RLSA 1Q7GA 3O26A 1SO8A 4J43A 1HSOA 3D5TA 2AQKA 1AN9A 5BR7A 2WE7A 5JAQA 1AGNA 4Z0TA 2FZEA 2X8LA 3W8FA 5KJCA 1KEPA 2EKQA 4LMPA 4I9HA 4OOFA 1U3WA 2J6IA 4OHUA 3DAGA 3RIHA 4DQVA 4JJIA 1H9BA 3I83A 4IJVA 4OXNA 4CM5A 4RPKA 1PGPA 3AY7A 1ISFA 4YRAA 3RASA 1JKIA 1Y81A 4MOWA 4AJOA 1ZK0A 2O2YA 2FR1A 2Q2QA 4JJFA 2HMWA 4E3ZA 4W6ZA 4NHEA 1L7DA 1YH3A 3DBLA 3WGHA 3LK7A 4WEQA 4XR4A 1QYVA 2ZTUA 1HETA 2BGKA 2FR8A 2OO5A 4C4OA 1MX3A 4R9RA 4I8XA 1Q0LA 1MFZA 3PJEA 3BMQB 3H65A 4GVXA 2EW2A 4TZTA 1B7GO 5C37A 1RM0A 4DPKA 4MDHA 3F4LA 3ZH2A 3FRJA 2QYTA 3MJVA 1UXKA 4JP2A 5F5NA 4PLWA 2J5QA 5DP1A 4XD2A 1EVIA 2CMDA 3PLRA 3M2PA 5ES3A 2FPPA 4FOOA 2I67A 5KJ1A 5IDYA 4AVYA 4CL3A 2IZ0A 4EZBA 3A1NA 2GN4A 2EWMA 4Z9XA 3RROA 4U7WA 5CHEA 3UOGA 5JAIA 1UXHA 4FJ1A 2PWZA 1IZ0A 2JL1A 1QLJA 3E1KA 4UUPA 1ONNA 1I01A 4GX0A 4OQZA 3GG2A 3PQDA 1YE3A 2Z5LA 5HM8A 3F9IA 2OORA 1T25A 5A02A 3ZNQA 4D3SA 4D79A 4OXYA 4BOYA 4PZEA 4RDHA 4JQCA 3WYCA 4BO7A 4KTTE 3LSYA 3WFJA 4I1IA 3VKVA 3DL2A 4BNJA 2WD8A 1D8AA 2DUUA 4Z0PA 5HRUA 1R4NA 5KJEA 3BHMA 4IZIA 4XQ9A 3BMNA 1EE9A 5CDUA 2CVZA 1Y8QA 4B7XA 4WECA 2FOIA 1UP6A 3ZWOA 1ZVMA 1GYPA 4GH5A 5IN4A 3GN2A 4UVEA 5EESA 4A73A 2SCUA 5L7TA 4WNIA 2NU9A 4QT0A 1AE1A 2B69A 3T4EA 2C7VA 1FDSA 5KVSA 3JYOA 4GX5A 5BSEA 1QYWA 4MVJP 4CLHA 2QQ5A 3ZV4A 2NUAA 3NX4A 4B4WA 1DIRA 3ZWBA 4IJKA 1WDLA 3JQEA 1ZIDA 1Z74A 4HXYA 3OEYA 2AQHA 1QRRA 4HFNA 2X5JO 2BFOA 1DIGA 3WGIA 1IULA 2OZPA 3DTYA 3EC7A 4PZDA 2GLXA 4ND2A 2VHXA 3F6YA 4IQ8A 2HRBA 2VQ3A 4PLHA 3MTGA 1E92A 4WJZA 3WBFA 4EDFA 3WOHA 4GSLA 1QP8A 3WMWA 5HS4A 4EUFA 2NSDA 4YAKA 3VTZA 3PGJA 4R41A 4CM1A 3RUFA 3WQSB 2I6TA 3PZBA 5T57A 3DFUA 3ICCA 2HK8A 5DZSA 4JP3A 1X1TA 3MJCA 1LSUA 4MP3A 3UFXA 3OA0A 3RC1A 2OXIA 2VHZA 1HLPA 3P19A 4FC7A 5CDTA 3KBOA 1NQTA 1BXZA 4WNCA 4MVJE 2Q2WA 5I9NA 1SAYA 3GUCA 3TL2A 3WYEA 1VE9A 2EP5A 1U3TA 4B79A 1KVUA 5I7VA 4R01A 1ZKMA 5ADHA 3ZZNA 4Q39A 3GZNB 3GR6A 3WR5A 4JIGA 4PLPA 1C1DA 3T4XA 1DC6A 4IQGA 1KC1A 2PH3A 1KBZA 3A14A 3I23A 2RIRA 4WOJA 2C2XA 1PGNA 3H8VA 4MIOA 4PFJA 4RVFA 1B3RA 1ZK4A 3L6EA 5T8KC 4NBUA 2DFVA 4KWIA 1XDWA 4BO2A 4C7KA 1EFLA 5KVCA 5EQFA 3I6IA 4YAIA 1GV0A 4ALMA 3GZ4A 3V1YA 5FI5A 3DOJA 1DXYA 3U3XA 1RM5A 1GD1O 4M1QA 2JCVA 3JSAA 2WEKA 5L51A 4XYGA 1PS8A 2IYPA 1EQ2A 3RBXA 3CMCO 3HE3A 1I30A 2EGHA 2BMAA 3KHUA 1ZZEA 5F5LA 1W8DA 1DRWA 4CUKA 1CDOA 2V6BA 2PY6A 1SB9A 2W4QA 3CE6A 2YV3A 1KYQA 3GRKA 3AI3A 1HTBA 2P5YA 1YOVA 3JYLA 4HFRA 4GMGA 4B4VA 1R0SA 4PLYA 4CMAA 1ENOA 4M49A 3JQ7A 4YJDA 4ZJUA 4EBFA 4CMJA 2QZ9A 1E7YA 3LT2A 4RQTA 5DOZA 3WJAA 3QVWA 2R00C 5DN9A 1VI2A 3EAGA 4AJPA 1VSVA 4J1TA 1NASA 4GKBA 4DC0A 1PR3A 4XIJA 2B0JA 5A9RA 4CR6A 1KIFA 1PS9A 4C7JA 1ENZA 4BKUA 1R4NB 4M8SA 1BWSA 1EFKA 1NR1A 5HS6A 1IL0A 5U1PA 2O3TA 3KYCA 5K6AA 3U9LA 4IM7A 4L4SA 5G0UA 2G0TA 3DTTA 1GFSA 1PL6A 1YBAA 4AJ4A 2WTBA 1UH5A 2HQ1A 2X6TA 1E3EA 2X7HA 2XAAA 3RFVA 1N2SA 2Z1NA 3U4IA 3FPLA 4NNJA 2OHXA 4PRKA 4BNWA 3V2GA 3AI2A 4ZQFA 4B4UA 1ULUA 2WD7A 1F06A 4HV4A 1R0KA 5TT0A 4A26A 1HE3A 3O4RA 3LF1A 1K6IA 1WVGA 4S3MA 5CG2A 3D1LA 5JDIA 3WGQA 2O3JA 1V9LA 3QRWA 4WCFC 1ADGA 1NX6A 3VDQA 2YHIB 2FY8A 1NVTA 2QYSA 3AUSA 3GMSA 3MJTA 4INAA 4AJHA 4EUHA 4AJNA 1K0UA 2NU7A 4II3A 2GN8A 1ENPA 4IIUA 4E2XA 5KVVA 5B37A 2H6EA 2NVUB 4BNIA 5HBRA 2Y1GA 4HFMA 1Z6ZA 3H9GA 4JCOA 4E32A 1IUKA 3BHIA 5KVQA 3VHRA 3EW7A 3F3SA 1HKUA 3WIDA 4DGSA 3INRA 2NLOA 1IOLA 4OKNA 1ONPA 1PIWA 3ZCXA 4Y98A 4AJEA 2ZJ0A 4CV1A 4NBRA 2RAFA 1JAYA 2Y0DA 2VWQA 2PZJA 2X0JA 2E37A 3PYMA 4JGBA 2PFGA 3DO5A 1LX6A 3IDSA 4L4RA 3F5QA 5K9ZA 1R4MA 5KIAA 3DDNA 3IMFA 4YT5A 3ZW9A 4YQZA 1HE4A 4PVCA 1LDMA 4J0FA 1RKXA 2NVUA 3GT0A 4Y6RA 1ZK2A 2YZ7A 1YKFA 2D59A 3Q2KA 3OIDA 5TGDA 3JTMA 1I32A 1M6HA 1OI7A 4CLXA 2R2GA 4UEOA 3QP9A 3K96A 2BKAA 1O6ZA 2C7GA 3WGOA 2H5LA 2YUTA 4A7PA 3PDJA 3AOGA 1WPQA 5CAEA 5TRTA 3JQ8A 5A9SA 1W73A 4XYLA 3DR3A 3M1LA 3UH1A 5ICSA 4U0KA 4K28A 2P2SA 1OAAA 5IXYA 1ZXLA 2QW8A 4FIZA 1E7MA 4YR9A 2HCTA 5AXBA 4BKQA 4Z3DA 4GKVA 3HDYA 3D64A 5TS3A 3FSRA 3WNQA 2QZZA 4IS3A 1UAYA 2CDCA 3DBHB 4IJWA 1YB4A 3V2HA 2A92A 2NADA 3BMCA 4GLOA 3GVPA 4BHTA 3W4IA 5ITWA 3DZFA 4BVAA 3WX0A 2YDYA 1DIBA 4BO6A 3B6ZA 1VL0A 3INTA 1DRUA 3UN1A 1H6DA 3EVTA 3U4CA 3Q3CA 3C7DB 2RHRA 1HYGA 2YV2A 1GZ4A 3KVOA 3UHAA 5IZ4A 5L4SA 1RYDA
chains in the Genus database with same CATH superfamily
1II0A 5E8JA 4CIAA 1B76A 4JBXA 3MGGA 3NTXA 4MUXA 5K2OA 5EWMA 2GJ4A 4QECA 3M4YA 3F71A 2W2TA 3HY6A 1T2UA 1JQ3A 4J0EA 4QOJA 2FA9A 3TEMA 2FKNA 2JCBA 3O8DA 4LJRA 2XOKA 4FHDA 4YVFA 5CMLA 1UXIA 3Q0EA 5CNJA 5CP8A 4BLVA 4NL4H 2GQ0A 5TQVA 3X1WA 3ZOZA 3K5WA 4LKRA 4QJ5A 1F5NA 4Q1CA 4TN1A 5JAZA 5JXGA 3ML1A 5EN4A 2NTNA 3DAPA 4HWPA 3WO1A 5KJ6A 1SHUX 3FZGA 3RHFA 4QXQA 1HOXA 4NDNE 4RGQA 1AURA 3AKDA 3FKSA 4PR0A 2ADMA 1K2VN 2VHWA 5KTPA 1RPZA 1J1UA 1BRTA 4MJLA 1CQIA 2O7QA 2E4AA 4MUBA 4ZO6A 3S4YA 5KOJB 4P92A 2PGIA 1CIVA 3OBBA 2XT0A 3QBDA 3UK1A 3T7TA 1KJZA 2ZJ4A 4EUSA 3EXIB 3LCUA 4M0LA 3JQFA 3FYUB 1DG1G 2P6PA 2NTEA 5JSKA 2ZYSA 3WIUA 3W2IA 3TRIA 3ZU3A 3AF4A 1JFVA 2RGCA 2RH8A 3A1TA 1DRVA 3A3PA 3PC8C 1ORVA 1ZQ9A 2I87A 3TLGB 3HA7A 2GBLA 1T1GA 1KVTA 2E4WA 5HKKA 4NCIA 1JIIA 5J9FA 1HM5A 4J6EA 3ANYB 1W25A 5ETJA 4NBTA 4BCBA 2QZJA 3VKFA 3GH3A 3RVNA 3AHIA 1Y34E 1H2AS 5K6AC 5KU7A 2O0LA 3HP7A 3UW1A 1AIPA 3LO5A 4FYMA 1ZXXA 5A3SA 2VTVA 1ADJA 4DBLC 3WLKX 4E11A 3CVVA 4P4TA 1LUAA 4AMBA 2NV6A 5D7NA 2VYQA 3EXG2 4BO5A 4DDUA 1FJGB 3HBLA 4Q9NA 3ETHA 3ZS8A 1CCWA 3WMXA 3D0OA 1TM4E 1VA4A 4G5FA 2IZ1A 4YP6A 1AGPA 4YONB 3ZUPA 3J80A 3SQXA 2FWBA 2M6RA 5CDSA 4FOLA 3IUNA 2XITA 2XY4A 1KJWA 2H1SA 3EXFB 4B2IA 1M66A 3KS9A 5FYDA 1XVVA 5B4UA 2ZYDA 1E3IA 1RWPA 1BJKA 1PJAA 4NPHA 4XW2A 2HMUA 1SVUA 2I4TA 2I7VA 4HB2A 5AJHA 4UCQA 2X4DA 2AEJA 4G4SO 2PZFA 4JMPA 4HQNA 4BQPA 1R8JA 3N74A 1V45E 3A37A 3SXJA 3OQMA 2P6NA 1JQKA 2EGGA 4J2OA 1XMOB 4FW9A 3TLMA 2GM4A 2KBFA 4RTQA 2X58A 1HDIA 3LUPA 3PUZA 5DF1A 3SEQA 3A3YA 1JRLA 1E4VA 2IELA 3ND9A 1O0CA 1UK7A 5BMVF 5F52A 2O1SA 3HFGA 1EZZA 2WJZB 2H1LA 2Q3LA 4AO6A 1JN0A 1L3CA 3KXKA 4BRWA 1E3DA 2OV8A 4GLLA 3RRMA 2B2NA 3ITKA 4YLYA 4CF4A 1V5FA 1KOGA 4LJ9A 2EKBA 2GN1A 4EM6A 4DB2A 2OLKA 2PH5A 1O94A 5AVOA 1XYYA 3IRUA 1Z75A 3L8HA 4Q0MA 4Y6LA 5HKLA 5TGZA 3GFBA 2EJVA 3HFRA 4AM8A 4KFSA 1SBCA 3PI7A 1TCCA 2GA9A 2QU7A 1Y3HA 4Q18A 2NUPA 3NAMA 2JFHA 3TZKA 5I45A 2OV2A 2C57A 4WPGA 4EJ0A 3SVTA 2W2KA 2JLBA 3PNSA 1TK2A 3BMOA 1SULA 4ODIA 3KYDA 4BRUA 3IP3A 4DMHA 1FDWA 3A3OA 3N3BC 4BEJA 4RF2A 4AYXA 1NUTA 2BI8A 4PYOA 2CFOA 3AFNA 4Q4JA 1XTRA 4B7AA 1C9NA 1Y1PA 4HAOA 4NRDA 4L78A 3VYTB 3JWJA 4AS2A 1MOPA 1X74A 1KPHA 3B2NA 1JHVA 2BCGY 3M81A 2FK8A 2ZAMA 3D3EA 4UQLA 3QXHA 2OFOA 1T91A 2FX2A 1XDBA 4GM1A 5HUJA 3SF0A 4Q3KA 4M0FA 5TEWA 3KLNA 3VVMA 3U4QA 2VYCA 5LB4A 1QFZA 2Y0PA 4ED9A 4TS1A 1MN6A 5LQKA 1L1EA 2M1ZA 3UGKA 1HX7A 4BNVA 5DULA 4W1SA 2Y93A 3FZQA 5KTTA 2ZWPA 1PV2A 2ECFA 3LJKA 2X6QA 3EMKA 2HF7A 4KXFB 5FD8A 4LDNA 3UB3A 2PKEA 3TQHA 4DHWA 3QVTA 4RIGA 3GP8A 2Y2VA 3TEFA 4D44A 4O4JF 4C89A 3E5HA 4D3DA 1Z47A 3PFHA 4PYLA 4DDHA 5B64A 5AK6A 4O63O 3SJBA 3OQPA 2WKWA 1CRWG 2XKBA 4L0DA 2HFJA 4TKLA 3A4IA 3COVA 2PX8A 2GESA 1CK4A 1DBIA 3I64A 3KOYA 1RE1A 3C6QA 4YAEA 4FPXA 4E4RA 4MVJM 1PZEA 2BUAA 2VZLA 1OT5A 1I4LD 1E1QD 4GX1A 2QUHA 2JA2A 4HO1X 4Q34A 4A0FA 4C08A 1VHQA 3HYLA 4HGOA 1DKUA 2P5UA 4UMVA 5AVVA 1M1NA 1NIJA 3UWOA 1TEHA 4FMDF 4OSOA 3ZV5A 1YL7A 1M6WA 2CLSA 2PQ2A 4R68A 3BIXA 5JARA 2BEVA 4RY2A 2F3SA 1WULS 2FP3A 4R1UA 3DMTC 3ULKA 4CV2A 4DMLA 3JAMA 1VLMA 3VX3A 4DA8A 3KB2A 1U6IA 2FSSA 2UKDA 4DWWA 1E1MA 3BN3A 4LC0A 1UFQA 1K88A 5LVAA 3URMA 1VYHA 1A5TA 3P9RA 4LXQA 2O0KA 2G83A 1Y6GA 1QG6A 3GNQA 1KTIA 3PDCA 4R83A 3U49A 2ZUDA 2CEAA 5KOYA 1YQGA 2WOOA 4IOMA 1Y8RA 1OE0A 3T5AA 3KVYA 4ENWA 4YRRA 1FMFA 1F51E 4KQ6A 2OHGA 4KMSA 3D81A 5EKXA 4A9AA 3OP4A 2ZETA 1JU3A 3MZ0A 1TTPB 5EMNA 4BLUA 4HL6A 1PZGA 2I4LA 4OO3A 2I9KA 3FI0A 3G5MA 3OX1A 3A9CA 4V0OA 5BUSA 3L18A 2GYUA 4G1MB 5L3ZA 3TXAA 3RIMA 1RAGA 2EFCB 3X1XA 1M5RA 1QH8B 2PRKA 2ZVPX 2R6FA 4GMFA 3ONDA 2GARA 4WKGA 3DFIA 1B14A 3KT0A 2HHCA 4MICA 2I71A 3H3JA 2A59A 3GAAA 2AZTA 4I50F 1I9CA 1K6XA 4D4JA 3WRXC 2GPJA 2NACA 3VR1A 4AMUA 1GR0A 4W1RA 2GOYA 2R8RA 3KC2A 5AOAA 2JGFA 1HDYA 6ABPA 3KEOA 4QJIA 1CUHA 3Q8WA 3TQTA 3WIBA 1DEHA 1Y5NA 3DKRA 4RKWA 1A4UA 4ZQGA 4URXR 1GN8A 4E03A 2HLDD 3OURA 3U48A 3LCRA 1XQVA 3AP1A 1P7PA 2UYYA 4RPCA 3SFZA 3E3MA 4UBIA 1KQGA 1W1IA 4BL5A 3I73A 3AR9A 1KIAA 1NRIA 2X5KO 3R5SA 1YFZA 3QK7A 3QNWA 2FUCA 2Z6UA 1UDRA 4K81B 2WYHA 4KJXA 2VT6A 2Q3FA 4MW5A 1FUUA 5JSUA 3CISA 2YHBA 3PNYA 4NC9A 1GAXA 3QMWA 1U6KA 3UF0A 5IH3A 4OLBA 1SUEA 1UOEA 3SDBA 4MO9A 2YIJA 3OFND 1E7WA 2JFQA 4UE6A 2ZZMA 3R5FA 1OOEA 2C4KA 3IESA 2YNMC 2Z3ZA 3R0QA 1E2KA 3CX7A 1O89A 3EVBA 4MYTA 4GOLD 1XRLA 2YHAA 1ODIA 1UIRA 3RKUA 3ROKA 4AUNA 4CDGA 3DMHA 3CRRA 1BGXT 2BGMA 1QIJA 5JQGF 2JD1A 2I22A 1ECGA 1X7WB 3ISTA 1DT5A 3H5RA 3UWPA 1I10A 4EYQA 1DV1A 3MOGA 5IBCA 1GDDA 4FVTA 1XZGA 2YNMD 3REQB 4ZI7F 5JYDA 1FFGA 1ARZA 2PNFA 1A72A 1TOAA 2ZUBA 3GMDA 3H11B 1GGKA 3KJGA 3L46A 1WV1A 3HP1A 2IUTA 4HP8A 4TV9A 3TLAA 3DKIA 3JD4A 1CUDA 4CI9A 2B4KA 3E1SA 3NB0A 2Z1DA 1ZOSA 1S2OA 2OESA 1MJ5A 5E4YA 2IBMA 4MUJA 3U3KA 3FMOB 3HDVA 2DX7A 3HO6A 1CVRA 2D2IA 3NUGA 3BZUA 3F7NA 3P27A 4MYCA 4GRAA 4I81A 3NDJA 4QUGA 1PR5A 3GUUA 4MTCA 5LD2C 4NJMB 3WL7A 2FFRA 3AHGA 4YALA 4CMHA 3LQQA 3JYNA 5CB6A 1AUOA 3QNMA 1IWBB 3UT5B 2HQSA 2Z2XA 2X3FA 3EPHA 1JFRA 1A77A 4L50A 3WP0A 5IW8A 3PVCA 4RQAA 3K5PA 3FOWA 4BMVA 3L7BA 3ZCTA 5BWLA 4WKNA 1W29A 5CBPA 3HM9A 1KI7A 1X3SA 5EJ2A 4H1WA 1Y1QA 1PWXA 3H5TA 1FRNA 5DBFA 3UYLA 2QJWA 4M6WB 2E18A 1T3TA 2FE4A 3H9UA 1ZWKA 4IDDA 4INOA 5FTNA 3COJA 2HV8A 2DBQA 3GLFE 4P3PA 4XSGA 1SQ0A 5KX5B 4BWYA 5BWNA 1BCRA 3WBKA 4KR3A 2Q0SA 4ESVA 5AUOB 1R8XA 5KQSA 1G42A 3W6UA 2JBHA 4R9UC 4U00A 4E1VA 1M2NA 3LX4A 1V95A 2JLQA 2PLNA 2VJPA 3BREA 2O7RA 4Q47A 4YI5A 4OHPA 3TPFA 2W71A 4J4HA 4D1YA 1PJBA 3RV3A 4E2YA 3HXMA 1ESMA 4DLTA 4JCCA 4C0LA 2IGTA 1YVEI 4O4HB 2ZYGA 3FE2A 1Y48E 4ECAA 5GJVC 3B82A 3QE0A 3BL8A 1K4YA 3ZWQA 1UK6A 4HWTA 4U63A 2YVLA 2ZRNA 2O3SA 3P0HA 3QTTA 4E12A 3ORYA 3L82B 5LMZA 3NWOA 5FX2A 2CNWD 1ZA2A 4KXNA 3VBEA 2VWGA 1GKYA 4XJXA 3L4JA 4X6UA 2A58A 3S6JA 3Q6MA 4AJIA 5TPWB 1Z7BA 5I7FA 4JC4A 1RPNA 3OQ6A 1VSUA 1BEEA 1XOIA 4M8IA 3OUTA 4B8ZA 4BCDA 2EJCA 3BWDD 4R98A 1M1UA 1G9TA 4MHOA 1RACA 1X19A 2WIGA 2QUZA 5DI9A 3IDQA 1P3Y1 1D5CA 5AK5A 3L0IB 3C98A 1G18A 5JECA 4IEFB 3WL8A 3PX2A 3MHPA 4WGFA 4ZQEA 2GKGA 1XQ6A 2INGX 3H5WA 1E0KA 1TJ4A 3ORFA 4MUFA 4QG3A 4NABA 1DWQA 1Z15A 4AG3A 3PFKA 1FVOA 4EHJA 2ZBFA 1GGMA 2YWEA 1QHXA 1TO2E 4J6FA 2FUG1 4K9QA 3OG9A 4WLFA 3V32A 1F0YA 4CFYA 1X3LA 2LD4A 4M9UA 4BLRA 5BV1A 3R7LA 1T1EA 3VVCA 5LSAA 4XYEA 4Y1FA 2W83A 1DHTA 3OJCA 3M6WA 3PCTA 1M8GA 5EE3A 2J67A 1ATZA 1DJOA 3C74A 2P6OA 1OPXA 5J2UF 1B6SA 2K7FA 5A0TA 3G68A 1IXRC 4LRXA 4UQOA 2O8VA 3G3EA 2YC4C 3NEPX 5E3IA 4D42A 1JUDA 1SQFA 2PTHA 3WKBA 1AS2A 1E69A 3BZBA 3C1AA 1V3UA 4QHYA 2GN9A 2XF8A 3EWSA 5M04A 2UVPA 4RTRA 1PQPA 4GPTA 1S89A 4I5EA 4RDCA 4B80A 3V55A 1EHCA 4GP7A 3VPGA 4X1KA 4EEZA 2NZ8A 5JQWA 4DS3A 4NVRA 3I1YA 3IVGA 2I3GA 2AFHB 2AXPA 2CDBA 3C7AA 3O82A 5J63A 4WINA 4C5AA 2EFHB 3D6TB 3S5JA 3L05A 4EY4A 4BQIA 3P9YA 4DR1B 1BXGB 3GVCA 3HPQA 4HUTA 3WMGA 5F64A 3TUZC 3PXGA 3CUWA 4F0JA 1I1OA 1NXPA 1AGYA 2V3VA 4FNOA 1JE0A 5EQDA 2PXCA 4W82A 3DE2X 2HNBA 4N03A 3RS7A 2EDCA 2XMDA 3TBFA 1Z0AA 4WZBB 4IOLA 4EPYA 5JYCA 1N7GA 3HV0A 3KTFA 4R8MA 3PYLA 4WY5A 2NU9B 4DLAA 5DYIA 3C5HA 5MFZA 1M6NA 4IVPA 1WHTB 3PHBE 4DLYA 2QTNA 2YWHA 4MUYA 1NP7A 4EYOA 4XVCA 3PFNA 4FB4A 2BFDA 2X0RA 3CZRA 5BVHA 2DRIA 4ZAWA 2XZTA 4IGEA 3ZGOA 1L0BA 1NR7A 3NATA 1IZ7A 4BBZA 3P52A 5HJ5A 2CMGA 1CP2A 1N6NA 2Z08A 4KR7A 1RC0A 1L7XA 4LJLA 4QEKA 4O3MA 2P62A 1CZHA 3FPHA 4CMIA 4AX4A 4ZGGA 3CUUA 4MR9B 3DEIA 1QTNA 4UVHA 5KTNA 5T8KA 3E5NA 4DRZA 2H5EA 1OJ7A 1SCNE 4CTJA 2QZPA 1XRMA 4OJMX 5EE1A 1XSEA 4UHCA 3VYSB 3GRYA 5A7FA 3L1JA 1DFGA 3F90A 3D8TA 1H0SA 2ADFA 3IQIX 1NP3A 2MDTA 4RK0A 1E6WA 1QBGA 3JALB 3JY6A 5JROA 2HD4A 3D8HA 3G0HA 1A9PA 3O3CA 421PA 3BWEA 3BK1A 3NASA 1H6BA 5ER6A 4KR9A 1E5VA 2DB3A 2XSZD 1WB5A 1JS1X 1R37A 3ASYA 3O38A 3J7AC 1GZSA 4Q9KA 4MIKA 3KSRA 2PGJA 2V96A 5FTMA 1W581 5C0OE 3ZG6A 1G60A 3SR0A 4CEIB 1OILA 1UBJS 3B6JA 1LU9A 3VTFA 3PEYA 4RTKA 1WY5A 2X0EA 1PFQA 1GTSA 3RARA 4KVZA 3K2BA 2BPOA 5J2UA 1N9ZA 3TSAA 1MH9A 2VNAA 5CA1F 4DR2B 3FPAA 1B0UA 3G2PA 4UE2A 3UZUA 3RFFA 1V5IA 2ZXFA 5KI6A 2CEKA 3RUEA 3UAOA 3U7IA 2E49A 3FCEA 1C0EA 1E0AA 1QKJA 1G7TA 3CINA 3LKDA 4OVKA 1BA3A 2UVDA 2NU6A 1M76A 2AR7A 4ZIRB 5IF3A 1OLXB 2F1KA 3CCFA 3M4JA 2IDJA 2Q7XA 1TJ5A 4TX1A 5LLSA 4BLPA 1A7UA 4C5BA 1HE5A 2QM0A 3F7OA 2HRCA 3N8HA 4JJ8A 5HZMA 2VJBA 1A9OA 4QGSA 4KHZA 3CEHA 2CXRA 3TNYA 2HT1A 2BFCB 4EHLA 3LLSA 4JB3A 3HUUA 4L16A 2VBCA 2JIBA 2XNKA 4NZOA 3CNQS 4YJKA 1I51A 2ZTMA 4A6PA 3ZCSA 3G8DA 5JD3A 3CMMA 3HO8A 3LECA 1RABA 1Z4LA 2YDXA 5KCMA 1IAQA 3MUOA 3GRFA 2GF2A 2PU7A 1P80A 2LNDA 1M0EA 4MLPA 4OMDA 5CVVA 1XNRB 3OCVA 1UIMA 1OGYA 4YA6A 1IM2A 4HLDA 2D5IA 2OLEA 2CZCA 4HAUA 1R16A 3K9WA 3OU6A 1K5HA 2EYUA 3JYQA 4GT1A 3C3XA 3AVOA 2HA3A 3DWIA 4JJ7A 1YS9A 3GX1A 4Y2RA 1GPDG 2JBAA 2LUOA 2KJQA 3W9UA 4B2YA 4QOSA 3A9SA 1KMHA 6GPBA 1HLDA 3L8FA 2XH8A 5INTA 1RS0A 4CGZA 4CL8A 4QYWA 3UJAA 5KOIA 3H1GA 1H4TA 5KYTA 1EK6A 4CNQA 1DQPA 3EX7C 3CCCA 3OU7A 4N7JA 4MTLA 3H4VA 1C7FA 5K20A 3N39C 4X84A 3RANA 1YS4A 1IVYA 2ZB3A 1LTKA 2CNNA 1EG7A 1F3LA 2EF0A 3MCZA 1BE1A 1LPNA 1XRRA 2AOTB 2AJLI 3PQFA 5I7AA 5BQOA 4AX8A 5AUNB 1AXEA 4I3GA 3QEBZ 5E0KB 1K7CA 1H8ED 2QRHA 1AK1A 3B9QA 1TKAA 4JXKA 1A8HA 2PMDA 3KXPA 4LS3A 2XBUA 4MVJG 4Y67A 4K8OA 3U1VA 1ZICA 1QSGA 2A4KA 1FFCA 2VNSA 3EUAA 1CUCA 2BH9A 3AF1A 1KS9A 4LMAA 4WLNA 3PQEA 1OT3A 3QUQA 5AUQA 3DPIA 1YHNA 3KXDA 3LCMA 1SU8A 2CLKB 2HQBA 3ISJA 3LLCA 4FI3F 4PPNA 2FZGA 5D5PA 3KB6A 3BFKA 5FUWA 2FW7A 1YDFA 3KM0A 5HE9A 2D2VA 1J9EA 4RDXA 4X64B 1LS6A 2GDZA 2WWYA 3IALA 5KDLA 1BMFD 4O4IF 1P1BA 3B1FA 1H9CA 1RFGE 2QZ4A 2CLCX 4LQCA 1PQWA 3IVAA 4WUVA 3ZWNA 5A2GA 5IMSA 2P9CA 3PUWA 3IKMB 2A1TR 3AF2A 3GFSA 4R81A 2X6RA 4CM8B 1HL3A 4IIYA 4M38A 4Z9YA 1VJ0A 4UZFA 3SEFA 1N5JA 4LJYA 2RHMA 3KDPA 3QWFA 4HBGA 1C3OB 1U28A 4GYYA 4KCGA 5B12A 4Q7EA 2H65A 4FYYA 2EHDA 3CU5A 4WN9A 3RBVA 1KSGA 4RTPA 1F17A 4KIGA 2A5FA 4WN9B 1PWYE 2RAPA 2HSDA 4G86A 1QGUA 4JBGA 2YQ5A 2I34A 4WJKB 4WXPA 4US2R 3W5DA 2L17A 2IYVA 2GHTA 1KP3A 3PWSA 1DLIA 1FMCA 4QUKA 4AUEA 1C1HA 1T9AA 2OCKA 2PRJA 3I9V1 3ZI0A 2UZ4A 1RAFA 4MQMA 1HG0A 1YZLA 3RG8A 4OX9B 1O97D 3OWXA 5F51A 2PVCA 4J0JA 5HSGA 2ZVQX 3JZMA 3FDJA 2CE2X 8MHTA 2YXBA 3CVUA 3ZJ5A 3T5MA 3A4YA 4KKVA 2AG8A 3BX1A 3T5CA 4Q9IA 1IYZA 3K1AA 3P9NA 4HEJA 3TSZA 4C03A 2GEJA 2PZAA 4INJA 4O33A 4OSPA 4V2IA 2I3BA 3GLFB 1GPJA 3U31A 5C1PA 1GQOA 3RVLA 1A5ZA 1L7MA 2A78A 2QMYA 1MO3A 3ME5A 3S2ZA 1B2LA 4RVOA 4JITA 2W2LA 1EZ1A 1N1EA 4YRKA 4HQ6A 3AVTA 2NYRA 3GRCA 3EH1A 3LYUA 3EIEA 1SUDA 2BW0A 2JCGA 5BUZA 1B73A 3GGCA 4RMHA 4U8HA 1E2BA 3E70C 1NE7A 2ZTHA 1TB4A 4ZCTA 4V3CA 1U1DA 1HT1E 2R7KA 3FPKA 4ND6A 3CR8A 3HZOA 2DFPA 4NAVA 2PCLA 3ZDBA 3NIGB 4NQZA 1M7HA 4JQZA 5I3CA 2JI9A 2CT8A 2XUIA 1D1PA 1P6UA 2B61A 2ZS9A 5F2NA 3DOFA 4RHEA 2VAMA 3IIEA 1KNQA 4QLAA 3DH0A 4YIKA 3VSDA 1NDUA 3ZVKA 2HIAA 3O3OB 3ANXA 1QR6A 4DSOA 2J5RA 1NN0A 1ZGGA 2WA2A 3IR7A 1GXSB 4E08A 1QCDA 4MHTA 5E1BA 1JIKA 4CR8A 1KMCA 4NLLA 4P84A 1E96A 1QRDA 2Q5CA 1UZMA 3UVEA 2AOVA 2XJ4A 1GUFA 3JD3A 4M9RA 1CC1S 2XNDA 4DARA 1RM4A 1GILA 3HKCB 3HB1A 4RA6B 2FZ5A 2P40A 2EW8A 4F2GA 4A91A 4JI2B 2RK6A 1UC9A 2BONA 2I1WA 3EDMA 3ICPA 1WLSA 2IYFA 4J0IA 5AKLA 1DZIA 5HUHA 4O29A 1BGWA 1WPXA 4EB8A 3VAZA 3PVZA 4X8OA 3BE5A 3GOHA 5IAKA 1RWKA 4TYNA 4DJEC 3SSAA 3HWSA 4DXDA 1NVMB 3Q3VA 4B75A 1EBFA 2A0UA 4DCGA 1P4AA 1T5TA 2UUCB 1V3QE 2DHDA 3A32A 5JNWA 4XWAA 1N2EA 3IP1A 4U2DA 5D7BA 4TOIA 4WEOA 4YDRA 3PXXA 2ZTSA 5AP9A 3RC9A 2A35A 3R40A 2D54A 3I9JA 1O4VA 3FYUC 3L02A 1JTVA 4RBNA 4Q48A 2D2XA 1E0DA 5F7ZA 2JLWA 3AEQA 2PSHA 3MF4A 3DMYA 3DVRX 3K31A 1IN6A 1P9LA 2AOTA 3PPIA 1MC4A 3FI9A 3NI2A 4PQGA 4WKBA 5T64A 1T1SA 2QY9A 3D6UA 4PO8A 4K2AA 1YDWA 5AXAA 2PWBA 5H82A 4CIBA 4MPTA 3I62A 3JQ9C 2C1EA 1FEZA 2G8LA 4S1OA 2B4AA 1C50A 3OHSX 3ZDZB 3Q3JB 3GUZA 1ULSA 3CW9A 3NWBA 2FQQA 2QTLA 5F5XA 3SCZA 4EATA 4CUZA 1K97A 3EOBI 1O6FA 2ISQA 3MWDB 3PR2B 3WKEA 4BLWA 3LLVA 4DIMA 2V98A 2HKIA 1AKTA 3ZHCA 1ZVJA 4OUDA 1KI6A 1T0JB 5FOWA 2LV8A 4X1OA 2ZI3A 5IJ9A 2YASA 3JATA 2DR2A 1U1GA 4RVDA 3T12A 3UGTA 4EHFA 1LNSA 1U1FA 3L7LA 2DOKA 3WGZA 4LZOA 5MDHA 3PL1A 1HXHA 3QHAA 1OZ0A 4K03A 4F3KA 1P5FA 2LXNA 2YYSA 5LDHA 4L8WB 1EB8A 1YMQA 1CG6A 3L7NA 3NPAA 2HU5A 3AVVA 3BAZA 2OGWA 1OFTA 1QYRA 3PHHA 2CMHA 3HBJA 3A7EA 5AKHA 1GG8A 4RH3A 1BNCA 1KJYA 2UZ1A 4AZ0B 2JGAA 4GQAA 3VR5H 1AKWA 3ZHBA 2QRZA 2A3RA 3V4RA 3FDZB 3ETCA 4RV4A 5J4LA 1RYHA 2VXOA 5KZMB 2D1YA 4J3NA 4CKXA 2OR3A 4F60A 4URVR 3FLAA 3INGA 4P31A 3MPOA 4R6XA 4MWTA 4OATA 2I7TA 3P96A 1ISSA 4MJ7A 2VP9A 2BF7A 4LGCA 5ALHA 1DOZA 2QRJA 1XI2A 4GOMD 3FHTA 3RJ9A 3TSCA 4ZVKA 1U9JA 4WBNB 4FFOA 4CCYA 5EQJB 2GAJA 3R74A 1X87A 3TJZA 1U5BA 1PU2A 1VKNA 3DDSA 5FXMA 8AT1A 1LTHR 4R3WA 5ECWA 4KMRA 3TR0A 2WU1A 4F1WA 4BUCA 1ZMRA 3M1AA 3FKQA 1NQOA 1JW9B 2FPPB 3SNKA 4YJGA 4C7XA 4YAWA 4IV5A 1U5AA 2XNSA 2ZT8A 3CM0A 4IXWA 2JAOA 1OH6A 1LV8A 2H48A 3QWBA 2A7XA 1I33A 3AHEA 3KKMA 2NU8A 3EXIA 4BN0A 4GR5A 3EQ6A 4IRXA 5EIBC 2HJVA 4BPBA 5K0FA 1YQWA 4P98A 5LQAA 3BAFA 4RACA 3KQVA 3QSGA 5BWOA 4B8YA 1Q19A 1NURA 3CUEF 2DWCA 5ALNA 4OM8A 2N9UA 1YCFA 4YWJA 3CR3C 5TMEA 3SQLA 4IZHA 5KSZA 1BVRA 2HF8A 3C7TA 3NONA 5IHXA 1JA0A 5KKNB 3LT0A 2VDUE 3THWA 3TNJA 3PFFA 5JBNA 1R74A 1Y6JA 2ZJ3A 2UVPB 1E2IA 5P8WA 1NJ6A 2HLNA 1U8AA 3UFBA 3H0CA 1N7IA 2FW1A 3RPEA 3I0ZA 3IP6A 4TV8B 4M9QA 1S6YA 3H8SA 1J8MF 1P1KA 4QULA 1KDZA 4TKUB 5FT9A 3FPSA 4CKBB 3WHIA 1NQVA 4TLEA 2DTXA 4CKEA 5A4JA 3DBRB 4F56A 3S1AA 1YU9A 3HTXA 1QYCA 1EMDA 3EOZA 3ZK8A 1Y8QB 4JA2A 4A23A 4EGQA 5I8PA 5L7YA 1B8OA 5HFAA 3U9TA 1XF1A 1Z4JA 2LPMA 3ADBA 5EMLA 4IGAA 5I8WA 1YDHA 1QHHA 2X2PA 1PJ8A 1P62B 1WDWB 4Z5XA 1J97A 1MO5A 2ZYVX 3X1MA 4RCYA 5FOVA 5HG0A 4ZEVA 4EGAA 3THOA 1RWVA 3HYSA 3PKIA 4NU6A 4D9MA 3OM8A 1V6CA 4HOYA 1EEHA 3C7KA 4JOQA 1J21A 3QVSA 5AKZA 2IYUA 5J4VA 1T4MA 5CT8A 3RUDA 3WL3A 4C2UA 3MMNA 4K1LA 5DBHX 2FEMA 2O8FB 3GNSA 1J1ZA 1ZI6A 4YCJA 5AKJA 3TN7A 3NT5A 2B8TA 1PQUA 3FNGA 3M82A 3Q2IA 4OGKA 3HVIA 1NMEA 1ZSYA 1F2DA 3OPYI 3RWOA 4RD6A 2WSMA 4YT2A 3E3NA 1YIAA 4UBLA 3SNHA 4B7CA 5A3QA 3L77A 1WXQA 5F3RA 2X0NA 3PQ5A 4D82A 2O1EA 3GDHA 3GZJA 1U90A 3BH7A 4KODA 3LC0A 3GDOA 1A27A 4QG7A 3G0OA 2QJFA 3FOAA 5AD1A 1V1JA 1IY1A 4Z4EA 2Z04A 1NU8A 1YB5A 1IHYA 5DX1A 4R8VA 4AECA 2PYIA 2O7NA 2VRWA 4YCDA 1AOXA 3MB8A 4EG6A 4HTFA 4FUTA 1MZPA 1WZIA 2BTOA 3K9FC 1GLGA 2YMPA 4FDUA 3WLJA 1RQPA 4ZMBA 2HK6A 1XJ0A 2D62A 2BE7A 1B15A 3NVMB 3WSTA 3WL4A 1LPAB 4BDTA 2CZGA 1JPJA 2LKCA 2UZ0A 4J16A 4FFRA 3SYTA 2YY7A 1J5EB 1RYZA 2C29D 1ESEA 3ZGXA 1USUA 4WBXC 4JFAA 3OCUA 5FV4A 3UWDA 2XCQA 1GPMA 3C3JA 3R2JA 1UT6A 4RVGA 4X20A 3PYXA 1IJKA 1BDBA 2JCYA 3B5IA 4LE0A 3ND6A 1T4DA 2EARA 2F8LA 2YIMA 1QIHA 3KZXA 3SR4A 1IZ9A 4LHXA 3TIFA 1CRLA 1OX6A 3EVNA 5ALSA 3WWPA 5CBPB 4MVWA 1R15A 2JH8A 3ZNNA 4AY5A 4F04A 2ROQA 1F8UA 3EWNA 4RK1A 1NVBA 1W34A 2A5GA 4QIHA 1YRWA 3S99A 4UOZA 5H3CA 4K9PA 4QELA 2ONJA 2Q21A 1T9GS 3NKVA 4LMBA 1EK1A 2C07A 1H66A 3F47A 4LCJA 4H35A 4MCJA 5JVDF 1V1MB 2GERA 2WFZA 3OFVA 3G2NA 5E3HA 3BULA 4RSHA 1NXXA 2VVTA 5AVSA 4QO7A 4GVLA 4HH3C 4UTZA 1J8YF 1U4SA 3WAJA 1K06A 2QS9A 2AC4A 4L4UA 3VR4A 1DXOA 1OWNA 4G63A 1BCSA 1P8JA 3HEBA 3BGOS 1IG3A 2TS1A 4H7JA 4XOUA 3ZDFA 1FYXA 1Z5PA 4FYIA 4MZXA 2BV3A 2YBEA 3CYFA 2IEGA 4XM1A 1UQTA 3EFOA 3O1JC 4P1ZA 3RCBA 3TZEA 1CUYA 5JBIA 1U7TA 3W6ZA 5KO2A 2R1TA 1YBHA 4RVNA 4IHAA 5K0GA 1GL7A 1HE8B 4RF5A 5CT9A 5FA6A 4A82A 4DJ5X 5FUQA 1VXOA 2JBAB 1ZUHA 3OJEA 2FRVA 2IF2A 3BQMB 3VKWA 1JBQA 3I1JA 3OKCA 2QVCA 3CUVA 1YK0A 1EK2A 5HKKD 3JQ7B 4EY8A 1FMLA 3FBWA 2G5PA 2F62A 4I2VA 1V8FA 4M0DA 4RH1A 5PNTA 1W0KA 1MT0A 2HMSA 4NMHA 4JY7A 3JSXA 2OPHA 1E2PA 2IOFA 2C5LA 2JJQA 2B7BA 3LPCA 3CZMA 2H9YA 4EFDA 4WW0A 1QQ6A 3F6PA 3F8SA 1DSSG 5A2QA 1RXUA 1W96A 4IDFA 3O8QB 1L5LA 4EEKA 5FO0A 1G21B 4F9GA 5CDFA 2BELA 1LB1B 1WG8A 2JI7A 3RVKA 1SZJG 1OBVA 1Q83A 1YJ8A 3K70B 3HEMA 4FHFA 1W5BA 2FUNB 3QPAA 1QTIA 3CG4A 5E7MA 1Q20A 3LBYA 2VPWA 3MTAA 4KQ9A 3T0FA 4ASUA 5BV2P 1QRTA 2W7TA 3KJNA 4Q9HA 5IDWA 2F48A 5JDCC 1HA3A 4PC7A 1PQ4A 1XMXA 2V8OA 1VE7A 1E1NA 1IMOA 1E9FA 2QORA 3EB9A 4AROA 2Q49A 2SKCA 1RYMA 1LA2A 4LNUA 1JA9A 1E5LA 2O4CA 4BZPA 1NHGA 2JHGA 3KTOA 3PFWO 3BGSA 4G4GA 2D5CA 4QICA 4Q82A 5HX7A 3RVQA 3MWGA 3KLBA 4DYHA 2FW0A 2OZLA 5HKAA 1YONA 1W5EA 2A0KA 3DMNA 4GMDA 4FYWA 3T5BA 2XB4A 3UMSA 4UVGA 3PIDA 1Q0SA 1N57A 4I6GA 1B8NA 3V1TC 3O95A 2DGDA 1TI7A 3K92A 1H2EA 2XYVA 3CUKA 4BPRA 5LWHA 2EU8A 1LKZA 4AMGA 3C6KA 2DZDA 2O48X 1RWMA 2VDLB 4MPJA 3TCNA 4AN1A 4M0CA 2OORC 4CDMA 1VLHA 2YWXA 3GO4A 1JT9A 3K9GA 5IT5A 1U9YA 1SOWA 1US8B 3GU3A 1BKYA 1NFRA 4CM7A 3DT9A 2QG4A 3H4TA 2Z30A 4PNPA 3WGMA 3V8RA 4Y7CA 3QSYA 4TSFA 5H83A 3VV2A 2OP0A 2J9GA 4F45A 1TM1E 5AXCA 3BGVA 2O8EA 1OFIA 2I6FA 1C7ZA 5BN4A 2WNIA 1JDBC 3LDFA 1JIVA 2PGDA 2XB9A 4NBKA 4CJXA 4B46A 1SUBA 4G0VA 1SK8A 4GR9A 2ZS8A 5AKKA 2GWHA 5HCUA 4C7BA 1WQ4A 1B43A 1Q6ZA 1RT9A 3LTEA 4YXWA 1U9ZA 5MGBA 4X62B 1ADFA 1ITZA 3N7UA 4BBAA 2RJOA 1RRFA 2DPHA 3VU8A 4CEJA 1HOTA 4YJFA 1ILEA 4KTVE 3E9NA 5JCJA 1AQNA 3QIVA 2WHYA 2X3YA 2QRPA 3IKLA 5LYJB 2X0FA 2JZOA 3LRTA 4EVRA 4LRWA 2Q99A 1O87A 4ITUA 4FTWA 3JASA 1CZOA 2O07A 4J0DA 3RFXA 1Q0PA 2D5BA 3M6UA 3T8YA 4EAQA 5TNXA 1CQXA 3ZHVA 2A5YB 2M98A 3NTLA 4MAMA 3DEYX 1Z62A 3LTNC 3ETNA 2DFDA 5H80A 4MWBA 1WABA 2QVLA 1RP7A 1NWCA 4W5OA 4NX2A 4ZO7A 1HZZA 1WHSA 1PVVA 2MU1A 4CLEA 3IL2A 3KKZA 2ZRCA 4MLDA 5LP6B 1OROA 3E9ZA 1SVMA 2J3JA 4DUGA 1Y33E 3B70A 4TTRA 1FXSA 2EZUA 2OWEA 3QI7A 3EMBA 4U7DA 1IK4A 3L04A 3TLKA 1KRHA 3GEPA 1UWKA 5E6RB 3TQOA 2GCPA 3LDHA 3BFJA 3OEEA 4A5SA 2HDWA 4G01B 3DUWA 4DZTA 1IHUA 2X15A 3LP6A 2IYNA 1WDTA 4UXJA 3MAGA 2OUIA 5D3MB 3KJQA 1B0PA 2CLDX 3UAWA 3EVGA 4ZOCA 1TLTA 3MWEB 4HDMB 2BKEA 3LY7A 2XYHA 3PD0A 4B3RB 2ZRPA 2QXYA 3PCXA 2G7MC 1OC4A 1SBZA 1N2JA 4MYDA 3EZ9A 2C2YA 5H4HA 4MLZA 3ZVMA 3OOYA 1QGDA 3LBAA 4HSEA 5TQ0B 2HMTA 5CLGA 4NBNA 4A03A 4DBVO 1NN3A 4L22A 3HCAA 4UOQA 5THQA 1M75A 1JG3A 1A98A 3KYDB 4IQFA 4LXYA 4CUJA 5KYUB 1LLUA 3FLEA 2J0EA 2OXFA 3D2BA 3H16A 3D4NA 2JLYA 5SYMA 2XF2A 5SICE 4QTXA 3IOYA 4UREA 2F3QA 1D9ZA 1N2CE 1CUAA 1WD5A 1OZAA 1U7HA 4XCVA 4RZIA 2ZUVA 2NVBA 2BRUC 2FQYA 4HWGA 4MUGA 3ZWWA 4B84A 1SNYA 3K32A 3WLOA 5KSYA 4FEYA 4XGNA 4RNDB 4W9NA 2QVXX 1GKUB 1XTKA 1E9VA 1RYNA 1T24A 2V7QD 1P0CA 1TZMA 1LJLA 3KZ1E 4F6LA 1CF9A 2YVKA 4O4HF 1VJ1A 1QTRA 5DM70 1YZKA 1H2RS 4F4UA 1DI0A 1DCTA 5FAXA 2BUCA 2IHUA 1UUFA 1XJQA 4H4CA 4I7EA 5DO9A 1L7AA 5BSRA 1QUFA 1VDZA 3UMJA 4EMBA 4OL9A 2W6ID 1Z82A 3CT4A 1QH8A 5JJKA 2WD9A 2QRLA 1GO2A 5EAIA 2VBFA 4H7IA 4P5DA 1LI5A 1BD3A 1EESA 2I2XB 4BNXA 4CMCA 1JLKA 5BURA 4TKVB 5TF0A 2O2JA 3K0CC 2FMHA 3AR5A 3ESZA 4JVLA 3EQ9A 3NT4A 2DBVO 1TLLA 2FW6A 3RYFA 1XJ5A 4BC1A 4WESB 3I6ZA 5BNIA 3NM4A 4IGIA 1MG0A 3K53A 4O5OA 5BQ3A 3O8LA 5DI3B 2PKQO 1HYEA 2I91A 2F9FA 1MZVA 2JFOA 3LYLA 3VNQA 1G20B 2XXJA 1SIBE 5BMVA 1XQ1A 4Q3BA 1Z63A 3UAGA 1SVLA 1MJHA 1ONOA 1RLJA 2BBTA 4MIEA 4RPHA 1MV5A 5M3BA 4YCSA 4EUEA 3NG1A 1VPEA 2WUEA 3NNNA 4X65B 4LF8B 2QTHA 1GU7A 3UB2A 3K05A 3ZXIA 4KAXA 3EUFA 4LRQA 4BVJA 4DIDA 3QKSA 4GLBA 4HNHA 4MW7A 3M2TA 4XDZA 1O96B 5KNCD 1XU9A 1QIGA 2XVZA 4ZYZA 4LF7B 4C0BA 1ZQ1A 1TJYA 1QIKA 4JJ6A 4LOKA 4EY3A 4KQ2A 2H18A 1Y3FE 2B5VA 1S1CA 2O5CA 3EQ7A 2WJYA 2BEWB 3FN4A 2YWDA 2B4QA 3ZU4A 1YS7A 3OM9A 3HBNA 1FUKA 3PLNA 4TKMA 1T2VA 3H3FA 1X9IA 4UM5A 1G0NA 3LUFA 5FJJA 4LV5B 5ARBA 4M88A 3CTMA 4B9EA 5JTTA 4X7BA 2AUMA 3MAAC 3R8XA 3AVYA 4Z49A 4H6VA 3DOCA 5YASA 3FCYA 3EZFA 2EEZA 3TM4A 5LMUB 1EDZA 1NYLA 4MB2A 1CF2O 2FP4A 3TTVA 4YH1A 1FOEB 3H9EO 2JD0A 3JQAA 5DPMA 4FFVA 5A05A 3SSMA 5CDFE 3ANTA