3OM9A

T. gondii bradyzoite-specific ldh (ldh1) in complex with nad and oxq
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
329
Chain Sequence
PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate dehydrogenase
publication title T.Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ
rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 111
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3om9A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3om9A02
2B4TO 1SNYA 1XA0A 4BNVA 1RM3A 4MKRA 5TQVA 2C29D 3Q11A 3DBLB 1U2DA 1OMOA 3VHRA 1GUFA 3GFBA 4GSKA 1QYDA 3B6ZA 1H9BA 1DFGA 2HDHA 3OQ1A 4KTVE 1PL7A 3LF2A 2O2SA 4TRMA 5ICSA 1N8KA 3HWRA 3GC6A 2AQHA 3ROMA 4IY1A 2C0CA 1Q1NA 4L75A 3UHAA 1PWXA 1V0JA 2PY6A 1M6WA 4AJKA 2J8ZA 2NVBA 2YV2A 2PKQO 9LDBA 4IPTA 4Z6KA 1P44A 3QWIA 4RVGA 2V6FA 5FWNA 2ZB4A 1I3KA 2Y0CA 5AQ1A 4ALLA 4RVHA 3U0BA 4ZHSA 3ZHXA 3HFSA 3KSZO 4AG3A 3CMCO 1NAIA 4PRLA 4E30A 2PGJA 1DRVA 2VZ8A 4R4JA 5DT9A 3K31A 1K6JA 1C0LA 3I6IA 5BNIA 3WJAA 4GMGA 1U7TA 2EP5A 2X8LA 5GZ6A 5K9ZA 3HUDA 1VL0A 4DIFA 1UXKA 9LDTA 1Q7BA 1EEHA 2VT2A 3HDJA 4R5MA 4CM5A 3ZGYA 4CMAA 3W6UA 1MXFA 1X14A 4OKIA 1E1NA 2G1UA 3VC7A 3D3WB 3S8MA 3C7AA 2Y0DA 2NU8A 4Z3KA 1VE9A 3AOGA 1EVJA 3U4DA 3COSA 3AI2A 4EEXA 2O3RA 4R51A 4CLRB 3DBVO 1IPFA 4M86A 1IL0A 5KVVA 2EKLA 3C1OA 5JY1A 1UDCA 1ADFA 3IP3A 2CY0A 3DAFA 2X6TA 2E48A 2NADA 3RC2A 4YT4A 3WOHA 2FR0A 1UAYA 3TQHA 3JCZA 3MJ4A 5T6BA 4UVDA 2AE2A 3QVSA 1HYGA 2YDYA 1BVRA 1A27A 1QRRA 2B69A 3ITKA 5U1PA 2E49A 5J23A 4A5OA 4JBHA 3DZJA 1R16A 2OP0A 3RAJA 2ZB8A 4W4TA 5L7TA 4M8SA 4GSLA 1ARZA 2P68A 3V1TC 3RKRA 3TFOA 3BAZA 2D5AA 4LW8A 2BD0A 4IBOA 4E2WA 3GUYA 5U9CA 1L7DA 3HHPA 1I3MA 4PGFA 4PLGA 4NHEA 4RVFA 1E6EA 3C24A 1NWHA 2IZ1A 1LRJA 1I2CA 3ENNA 4NQZA 4TROA 3SC4A 3TZQA 4PCVA 1LBEA 1SEPA 1X0XA 3OSUA 3QQPA 2OZPA 5B4TA 3D4NA 2IYOA 1EFLA 1KIFA 1FDTA 2I67A 4P4LA 5IXYA 3FNGA 4Q9NA 5KJ1A 3UFXA 2CVQA 3VOSA 3E5RA 3TJRA 4MVJP 4CM3A 1T26A 1GV0A 3GGOA 1BSVA 3OA0A 4XZ3A 2PKQP 5FEUA 2E37A 5JDIA 4D3FA 3WQQA 3DO5A 1GAEO 4BMNA 1LRLA 2JD1A 4HUJA 3JYPA 3PIIA 3RFVA 2JHGA 4WGGA 3OFSA 5DN9A 1E7MA 4J1SA 1WZIA 4OXYA 5EJ2A 3F5QA 3T4XA 2I9PA 4YACA 4Y8VA 3OEYA 5I9NA 1Y1PA 4BNFA 2HK9A 4BGVA 1YQGA 4GX1A 1ENYA 1WVGA 3BZUA 5G4KB 3B70A 4QEDA 1CERA 2G0TA 3R6DA 4CODB 3GGPA 3OMLA 4DGSA 4IS3A 3WBBA 3VPSA 3N74A 4NBWA 1ISHA 3I23A 2D4AA 2DUUA 1JKFA 1NASA 2P2SA 1I36A 2R00A 3F47A 3GVPA 1UP6A 3WX0A 4DQVA 3FD8A 1DDOA 3LC2O 3GT0A 2BELA 4HFNA 1AE1A 1PQWA 4CJXA 2VUTA 1LU9A 3PYLA 4L8VA 4XR4A 4BNGA 3C7DB 5KWEA 4GVXA 4J0FA 3OEWA 4Y6PA 4UVHA 2X58A 1NP3A 4NU6A 1FDSA 5G0SA 3ZHBA 3L9XA 2JL1A 4W7HA 4BKUA 3ROKA 4NH4A 3WGTA 4QSMA 4NPCA 3L4BC 1ORRA 2CNBA 4JN6B 4BO0A 1Y8RA 3ANNA 3U4HA 2Q3EA 4YDRA 1QYWA 4PLZA 4UVGA 1X15A 4FS3A 5EERA 1ENZA 1AGNA 1J5PA 1GYPA 4UEOA 3WNQA 4DC0A 1VJ1A 1T2EA 4LRSB 5BSEA 4CUZA 3TL3A 1QXSA 4CLXA 1A4UA 1DRWA 2B4RO 3UCFA 5L7YA 3W4IA 2JFFA 4GQAA 3WDSA 2C7VA 3WJ7A 4GI2A 1HDOA 4IDFA 3S2FA 1WAMA 2QYSA 4KZPA 1Z6ZA 3V1UA 3VH2A 5CEEA 3LF1A 4EW6A 1M2WA 3BMNB 2BF7A 1DEHA 1W4ZA 4O5OA 1O8CA 2VOJA 3FPCA 3W8DA 2G76A 2HMUA 4YT2A 3KLMX 3ZU2A 3WYEA 1U8XX 1B3RA 3DQPA 4RPHA 4WJZA 2VTEA 5FF9A 1BDMA 1PS8A 2FWMX 3B1JA 3R3SA 4I9UA 4OSPA 2VZ0A 2DBVO 4IIVA 4XIYA 1A7KA 1S7CA 5CHEA 5ADHA 2D5CA 3GAFA 2EKQA 4ZU3A 3GVIA 3GZ4A 4WEQA 3MEQA 3VTZA 1CDOA 1LDEA 4HP8A 5F3RA 2AA3A 4QECA 3IUPA 1N1GA 3F3SA 1HE2A 1ZJZA 3I9NA 4UUNA 3H3JA 2EV9A 3F1KA 2BH9A 4BNLA 1TT5A 5IDWA 1XEAA 1E7SA 3L9WA 3NT5A 1DIGA 1PJTA 5DP1A 1I8TA 2BGLA 3ITDA 3WMXA 2NM0A 4J3FA 1AXGA 3TL2A 4HV4A 3KXDA 3GF4A 5JNLA 5IN4A 1I32A 1BVUA 4RPKA 4A26A 4R1SA 3INGA 3JQAB 5IFLA 1E7WA 2I99A 1D1SA 3ZV5A 4L74A 4PG7A 4ZGWA 4CMCA 3RC7A 1BWSA 2AG5A 1XSEA 4M1QA 2Z1MA 2ZQZA 3PIDA 4LMPA 4AJLA 1YBAA 3WSVA 2O3TA 5DCYA 1KY5A 1PJSA 1IUKA 1DFHA 3ONEA 3TPCA 1CJCA 1YL7A 4I1IA 4J43A 2EKPA 4MVJG 4WCDA 2H1SA 4YBZA 1GQYA 4IJUA 3DBLA 1T2AA 2Q1UA 1XHLA 1Z75A 1PJBA 3U49A 3DBHB 3HG7A 4II2A 4EGFA 1RYDA 2AW5A 2YV1A 4CLOA 3DDNA 2Q45A 4S1VA 4BNHA 4DPMA 1H94A 4HNGA 3OIFA 4JGBA 1HDYA 1Y9EA 3QVXA 5THQA 4OXNA 1SPXA 4BO2A 4RPGA 1PGPA 1R15A 5JYEA 3NGLA 1OZAA 4B4VA 1EUCA 3JQEA 4AJPA 1XGKA 2OFPA 4J1NA 3RC1A 4YCAA 2HKIA 3TZ6A 2Q46A 5ENVA 1DJQA 2NUAA 3JSAA 4PLYA 3MWEB 5L7WA 1LSJA 4DXHA 1IB6A 1MP0A 1NBOA 3AOEC 2X9VA 4YAJA 5G0UA 4OJNA 2O50A 3JYQA 1K6IA 4JIGA 4RVSA 3KETA 5TGDA 3E9NA 3DZKA 3F4LA 4TWRA 4PIVA 3ZHYA 1ENOA 4RL6A 3U3XA 1Q0QA 5IJZA 5F5NA 1RM4A 2O3QA 4I08A 4YB8A 1SOWA 3JQBC 1HF3A 2Y93A 5FI5A 4XIJA 1ISJA 1NPDA 2PWZA 5CEFA 3QVTA 3CUKA 3ST7A 4BNZA 1DAPA 1Q7CA 5LC1A 4LK3A 3Q1LA 1WMBA 2GCGA 2VYNA 1X13A 2BLLA 1P1HA 4K1LA 4RJTA 4ONEA 5DOVA 4YAEA 3RUHA 4ZQEA 3U62A 2EGHA 3ZNOA 1VSVA 2C82A 3TRIA 1SO8A 1IE3A 4W7IA 3DXFA 4E5KA 1V35A 1I0ZA 4FC7A 4E0BA 2O23A 2GN4A 3GN1A 4BGEA 4XX0A 3U9LA 3BHMA 3V2GA 3WLEA 1A7AA 2ZB7A 2QG4A 2ZTMA 3WQRA 1TXGA 2AE1A 4FCCA 1QYVA 2O2YA 5G2OA 2OOSA 5AXBA 3RUFA 5JXWA 2O7QA 3QW2A 3WNVA 4CMIA 5DCUA 1Y8QB 4XEHA 2BFAA 1LSOA 4IZHA 4ZICA 4YA6A 3UOGA 5A9TA 1T24A 2HK8A 2QHXA 1LEHA 2TMDA 3I5MA 2G17A 2C5EA 2ZJ0A 3KYBA 2VNSA 2PZKA 3FNEA 1L7EA 4GX5A 5G4LA 5CDUA 1NVTA 2YW9A 3P2YA 1N7GA 4ZQFA 4W9NC 3STHA 4Q3BA 2Z95A 3LDHA 5JDCC 3E82A 1C0IA 4PFJA 4FFRA 1MG0A 4DYVA 2YY7A 3ZCXA 2WJPA 2PZJA 1C1XA 2EW2A 4DA9A 1K89A 2DBQA 2Y1CA 1YB5A 1RPNA 2YQ5A 3E1KA 4BNXA 5I7FA 1EDOA 5BSFA 3DOOA 5JS6A 4DMLA 1KOLA 2B35A 3QWFA 5IN5A 4GBJA 1D3AA 3PGXA 1U5AA 3PZBA 4WKGA 3IAHA 3H2ZA 2UDPA 5JPIA 3TN7A 3ZV4A 5A02A 3PHIA 2EERA 3GNQA 1RYEA 4IXTA 1NVMB 4G65A 1HXHA 3PJGA 4ND2A 3HN7A 4R41A 5H83A 3QV1A 1B8VA 4U6SA 4BNUA 1YWGO 3WB9A 3AM3A 4MVJF 4EJ6A 3TWOA 3ZW8A 1G6KA 4XCVA 5HWSA 2OMEA 3GVHA 4E2ZA 1ZVMA 2XPCA 1YDEA 3CH6A 1O6ZA 4CL8A 1YJQA 1GYQA 2YHIA 3FTNA 3O26A 1PJ2A 1NHWA 1W6UA 4IDCA 1M75A 4OM8A 4YWJA 3LQFA 3D5TA 1Y6JA 3H9JA 4RVUA 2CUKA 3NTQA 2VWHA 5KJEA 3JYOA 4NI5A 1DIHA 1PJCA 3JYNA 4JXKA 3TOZA 1B8UA 5DULA 1QV6A 1PQPA 1XWFA 2O48X 3RUAA 3UKOA 4BB6A 4YQZA 3RROA 3SJUA 3AY3A 1YQDA 6ADHA 2DTXA 5IXSA 4OIMA 3WWYA 1O9BA 2B5VA 1UP7A 1ADGA 1T2CA 4KMSA 1D1TA 1UUFA 3DB2A 2RIRA 1LC3A 1LNQA 3H4VA 1E3LA 3MWDB 2HU2A 3JD1A 4IDAA 1X1TA 5H82A 3DBRB 4B8WA 1Y5RA 2PTGA 4ROSA 3KZVA 2Y99A 2RHCA 3UICA 2Q2WA 3CSDA 1JWBB 1IY8A 3AY7A 2ZB3A 1UXJA 3AUSA 2E6UX 4N5NA 3NTOA 4CL3A 5T8KC 1UZMA 1VSUA 3AI3A 1EUDA 2LDXA 3K96A 4Q3NA 4Y67A 1PS0A 2C20A 3QWAA 3H9EO 3IC5A 3HZZA 3KM0A 3PJDA 2UYYA 4GWGA 1YDWA 3GEMA 3ZV3A 2C2YA 3H5RA 3FNHA 3DHEA 4MIYA 1U2GA 1FXSA 1X7HA 2YJZA 2B4QA 3KYDB 1TT7A 3SEFA 2QZZA 4CMBA 4XQCA 2YYYA 3DMYA 5HA5A 4Q3AA 1F17A 4CMEC 5TNXA 3QP9A 4KUGA 1OAAA 2NSDA 2GNAA 2ZTLA 5DBIA 1QSGA 4DREA 1VKOA 2JD2A 4EI2A 1HRDA 1KVRA 4E2YA 1MA0A 3UCXA 4RF5A 5JAIA 2FHSA 1CF2O 5C7OO 2CDBA 4A2CA 1TI7A 3JD4A 5CAEA 4U0JA 3IL2A 3IKTA 1A4IA 3QLJA 4Z0PA 3P5SA 2C2XA 5MDHA 2CVOA 3ZWVA 1JKIA 4IS2A 4CM7A 1GCOA 3OJOA 4NFHA 4PG5A 4PG8A 1VL8A 1N5DA 3O03A 3DL2A 3CZMA 1E6UA 3JQ9C 3L4SO 3E8XA 4ZVVA 2E82A 4XGNA 4DTIA 4PLVA 4EJMA 1ADCA 4E13A 3PI7A 1NVGA 3A28A 4TKLA 1M6HA 2VRBA 2X22A 2HRBA 3NRCA 1MUUA 3ZWCA 3PQEA 4CLDA 3AK4A 3QA9A 4D42A 3H2SA 2YQ4A 4LVUA 3ZU3A 1KEUA 4K26A 2IZ0A 2AEFA 1YRLA 3UVEA 1VJTA 1WXDA 3PZRA 2VUUA 3WBFA 4UEJA 3INRA 3K8ZA 2W4QA 4HX5A 2NACA 3C85A 5I7SA 4CLOB 5JAMA 1YXMA 5JLAA 1U28A 3DBHA 2EJVA 2GASA 4MIEA 5B37A 1AUPA 1GUYA 1BXZA 3U5TA 2W90A 4Q3CA 4FDAA 1EDZA 2F00A 3VZRA 4RF2A 3OQBA 3RU7A 5DBGA 1ZH8A 3M2TA 3KRTA 2D8AA 4MVJI 3UW3A 2ZCVA 3A06A 5AYVA 1U9JA 4K6CA 2VNAA 3ADPA 4IGFA 2GERA 4D3SA 3RUCA 2G5CA 3K30A 1U5CA 3TFQA 5ENDA 1GTMA 3A14A 3D3EA 4ZJUA 5JO0A 4UUMA 4QO7A 3V5NA 4D0SA 1E3JA 4L73A 4FW8A 3DZBA 1H0KA 1ONNA 3NAQA 4D45A 4CLHA 5L95A 3ZV6A 4OQZA 4QFDA 5EESA 4ESOA 4OOEA 2PR2A 3QRWA 3PHGA 3I9KA 4WNCA 3M1LA 2GD1O 2VWPA 5F1OA 1NYTA 2IODA 5MGBA 1WNTA 2DFDA 5BSHA 1VL6A 3NV9A 3VPFA 4XD2A 3CMMA 2X23A 3K73O 4XQEA 3TNLA 2FY8A 4YJDA 1J49A 3CEAA 2J5RA 2FRDA 3GNSA 4KWIA 1X1EA 1P1RA 3G1TA 3RBZA 1DLIA 4B3IA 4LCEA 5EL0A 3RFTA 3RKUA 2A92A 5G0TA 1H6BA 4XR9A 4AJNA 4ALIA 3KHUA 1BXKA 3HFGA 3NJ8A 4BNWA 1VJ0A 2JAHA 5A04A 4ND5A 4YJGB 1EE9A 2FN7A 2GZ1A 2JKVA 2WTBA 4HY3A 4R5HA 5AVOA 4K6FA 3I6QA 1O89A 4XGKA 2Y1DA 4BNJA 2D3TA 1P3DA 4IIUA 4Z9YA 3W8FA 2NTNA 2YZ7A 1PJQA 1U7HA 2X5OA 3D4PA 3L6OO 4OH1A 4D79A 3P2OA 2VYVA 4TVOA 2GUGA 5TJHA 1JQBA 1TLTA 3EK2A 3H3FA 3FR7A 4MVJH 3GPDG 4RDHA 2PKRA 1E5LA 4FGSA 3G79A 4BKQA 4CMIB 1NNUA 3K9QO 3WGQA 1XCBA 2ZK7A 2O4UX 4G2NA 2ZATA 3EZLA 4U7WA 5CDTA 1Y8QA 5F1PA 3IOYA 4JX8A 5HS4A 5KVCA 3RJ5A 5CPFA 4NNJA 1U8FO 4BNYA 1DHRA 3SXPA 5B4VA 1H93A 3DTYA 4W99A 4R3WA 3BMCB 3WYCA 4BNIA 3GQVA 2ZTVA 1PJLA 1KYQA 1Q0LA 4PLTA 3UAGA 5KNLA 4B7UA 1LX6A 2GDZA 3RC9A 2Q4BA 2HJSA 1FJHA 3ZNPA 5ILOA 3VZSA 2PA3A 5HS6A 1V8BA 2P5YA 2NU7A 1B16A 4GX2A 1V6AA 3GVCA 1C1XB 4WCFB 4IJWA 5C5IA 1F12A 1EK6A 1UDAA 4QT0A 1UXIA 1AHIA 2PV7A 3W8EA 2Y05A 1I24A 2ET6A 4J16A 2OHXA 5AOVA 3H9GA 4URFA 4XRGA 1CQIA 3WFJA 2ZTUA 4CM9A 2BFPA 2V6BA 4MP3A 1RKXA 4A0SA 4QUKA 1JKJA 4AICA 4Q39A 1UH5A 3GPIA 3RUEA 1DIAA 4NZ9A 3QVOA 3LYLA 3MJVA 4IM7A 4NBVA 5JYDA 1E0DA 3IIEA 3HB4X 3S2EA 4BB5A 1EQUA 5CFZA 2CF6A 2QW8A 5AXDA 1P0FA 4BO4A 4B4WA 1LDYA 5K6AA 3O4RA 4EITA 3H8VA 2GYYA 4NK4A 5JAZA 2NWQA 4WE3A 3INTA 4D41A 5JDIC 3E18A 2VQ3A 1RM0A 3GMDA 4FB5A 4YTEA 2YHIB 3B20A 4HADA 4TQGA 4S3MA 4ZQBA 1P1KA 5BSGA 3DHYA 4H15A 2FOIA 5DF1A 3F4BA 2V6MA 5L4SA 5IF3A 2QX7A 3WICA 4ZD6A 1P9LA 5HTOA 2VYND 3DFZA 1T1SA 1UR5A 3VZQA 4P38A 2Q1SA 2HJRA 4IDGA 1J0XO 3SJ7A 4BNMA 2VUSA 3E03A 5TLSA 1GFSA 3C1AA 3BHIA 5BQFA 1P77A 1B26A 4HFMA 2R00C 1U1IA 5EMHA 3ONFA 4TZKA 2FPPA 4E21A 3HQ4O 4CR8A 4F46A 3D5QA 5KVSA 3NDIA 4XDZA 4CLEA 4PVCA 4D7AA 3DBRA 2UUOA 3LVFO 2CMDA 4WOKA 4I8XA 3K92A 4M87A 3WGYA 2X0NA 4O63O 1U3UA 1B15A 3HNPA 1LLCA 1HDXA 3ENKA 3JQDA 1KS9A 3PEFA 1GQ2A 5LDGA 1SEVA 1HWYA 4FPXA 3ZU5A 3Q2IA 3DZFA 3I1JA 1T2DA 1DFIA 2BGMA 3WFIA 1NR7A 4J1QA 4YJHA 5C7LO 1F8FA 4UUPA 3VDQA 1R0SA 5TJ9A 1BDBA 3PHHA 3Q3CA 1C1DB 1JVBA 4Z0TA 1MX3A 4RF4A 2V6GA 1HYHA 3ETEA 5DNAA 3KYDA 2CD9A 1V9LA 2HUNA 1TB4A 4ZRNA 4J1TA 4U8GA 4F3YA 2DQ4A 5AXAA 3U4IA 5EQFA 1O95A 3PWZA 4TVBA 1JDJA 1ZEMA 3OHSX 3DMTA 1GU7A 4J4HA 3OM9A 4OXKA 4Y98A 3ZN2A 2DLDA 4H16A 5IDXA 1E3IA 3OIDA 1M76A 4R01A 2X7HA 3AUTA 4E3ZA 3DAGA 4EJ0A 1YB4A 1KBZA 2RH8A 3I9MA 1SCUA 4AJHA 1FK8A 2DAPA 4FIZA 2Y1OA 5B12A 5KIAA 1ZMTA 1GPDG 4EUHA 1FDUA 2CZCA 3I4FA 3WSWA 1QKIA 1W0CA 3KSDO 4D46A 4RQUA 1CEQA 1MC4A 4IGEA 5BT9A 2EIHA 3DMTC 4KDFA 1IHYA 2AMFA 5BNTA 4HNHA 5DCWA 4NG5A 4KDEA 2A94A 3GY0A 7ADHA 1PZFA 4R69A 4U5QA 4AJ1A 4B4UA 2ZCUA 3S1LA 1NX6A 2FSSA 3JD0A 1U4OA 4FFNA 4CR7A 3PHJA 4G5HA 3SX2A 1DPGA 4BGUA 4NK5A 5JCJA 3K5PA 2J3IA 4ZN6A 2Y66A 3G0OA 4UREA 2PD4A 2V65A 2FPIA 3QHAA 4PLFA 4FC6A 1LDMA 1G1AA 4MP6A 2PH5A 2EHDA 1ZXLA 2HMSA 4BV9A 4WLEA 1FDVA 2PLAA 5CPBA 3VVBA 3VKVA 2ZYAA 2R2GA 3QWBA 4IQ8A 1EZ4A 3PQFA 5LCXA 1CIVA 4I5GA 1GZ6A 4ND1A 5ICMA 1I5RA 4LISA 4CPDA 1ZZEA 5AXCA 3FNFA 3QJ5A 2J6IA 8LDHA 4KUEA 1JN0A 3DFUA 4P22A 4MVJE 3ROPA 1HZZA 2CVZA 2VHYA 4EDFA 1PJ3A 1YQXA 2DBRA 2OO5A 1C0PA 2EXXA 3C3XA 3DR3A 3Q9NA 3RBVA 4ND4A 2QRLA 4CMJA 1RM5A 3FRJA 4IMRA 3P19A 4RVDA 3FPLA 4AJ2A 5I8WA 2HMTA 4XYBA 1PL6A 3GFGA 1DIRA 3ZI0A 1BRMA 1O5IA 2FR1A 4O6VA 5U4QA 3WGHA 5TT0A 4J7XA 4ALMA 4TRJA 1H9AA 4TMFA 5JO9A 4B7XA 3PHLA 4F45A 2FMUA 1HDCA 1QG6A 4UUOA 3ASVA 1DLJA 4IQ0A 4JLWA 1NM5A 2DVMA 2NTJA 4J9UE 3ZWAA 5A3JA 1HDZA 1K2WA 4CUJA 2WSBA 3RFXA 1MLDA 5JBIA 5DOZA 5F5LA 4B3HA 4ND3A 4A03A 3ICCA 2DU8A 3FCOA 4GPD1 1N9GA 2AHRA 3PDUA 1AHHA 2VWGA 3ZWWA 5EIOA 4IDDA 4FFPA 3T7EA 4J7UA 3R3JA 2NVWA 3ZWMA 5L3ZA 5L53A 4IZIA 2WMDA 1QLJA 1T1RA 1T2FA 5JSFA 4FFLA 3RBXA 2NV6A 4DQXA 4WPGA 2W2KA 1C3VA 4GLOA 4KOAA 4CQLA 4XJSA 1KEVA 1ULSA 5KOIA 2JCXA 3DEYX 3PDJA 3PJEA 4YJGA 2X5KO 4WLNA 4RPLA 3K2EA 1V3TA 1YVEI 3R1IA 3VVCA 3I9LA 3NYWA 5IDYA 1M66A 4FGWA 4G81A 3BYZA 3GA0A 4DIBA 2DPGA 3JQAD 1BG6A 3E9MA 1GEEA 4OSOA 3GMSA 4U0KA 4R1NA 3RUIA 4H7PA 4AJEA 5KJ6A 5L40A 2WM3A 1KVUA 4R1TA 3VH4A 5CG2A 1QORA 3RU9A 4XYMA 1GADO 2JFGA 1KC3A 1GZ3A 3GGGA 1CRWG 1GCUA 4HFJA 1P45A 2X0JA 3AUUA 4XWYA 3DTTA 2Q50A 3PLRA 3WIEA 1YBMA 3KV3O 4AFNA 3IMFA 2CSUA 3NT4A 2JD0A 1A9YA 3KSUA 2D0IA 4CM8B 1ML3A 3F5SA 2HLPA 4CQMB 3F6YA 3BMCA 3VAZA 5IZCA 4JROA 3PYMA 4BUCA 3CIFA 2GO1A 4IJVA 4L76A 5TSDA 2UVDA 3HE3A 3FBTA 3HSKA 3JYLA 3BTVA 2QYTA 4PVDA 4HFRA 3EUWA 4YYZA 3UN1A 3NT2A 1ZK0A 3W1VA 5I7VA 3TZCA 4JBIA 3E5MA 4EZBA 4YAIA 4WCFA 1B0AA 1D8AA 1WW8A 3EDMA 4EUFA 1PEDA 1RJWA 1YOVA 2VCYA 1DC4A 1NFQA 5G0VA 2EG9A 2EJWA 4XQGA 3NX4A 3PP8A 2VOEA 4BKOA 3T4EA 4CMGA 2ILTA 3JV7A 1K6XA 1Y81A 1NQOA 4JNKA 3EW7A 5GMOA 1R37A 2PK3A 1ZIDA 3ZHZA 4NBTA 1LRKA 1MG5A 4E6PA 1VLLA 3ZNNA 5C7IO 1LDGA 1HYEA 1YH3A 1PL8A 3HDYA 1O0SA 3OECA 1GY8A 3Q6IA 4MVJA 4PZDA 3H65A 5THKA 2C07A 4YRDA 3EVTA 2G82A 1Q7GA 4PG4A 1J6UA 4J4TA 4BHTA 4B7CA 1B2LA 4WCFC 2I76A 2YFQA 1JW9B 2YDXA 3M1AA 1H5QA 1NPYA 4FJ1A 3WR5A 1EBUA 3FR8A 2GN8A 2GF2A 2GN6A 4JK3A 1LLUA 1LA2A 3FWNA 4LSMA 2GN9A 2I65A 1HT0A 4DBVO 4F6CA 3RCBA 2J3HA 1F8GA 5CDGA 1GZ4A 2RHRA 4Z0HO 4IJKA 2VHXA 3EHEA 1NAHA 3LLVA 3C1TA 3QVWA 4L9RA 1ZJYA 3NDRA 3JQ6A 4BNNA 4WOJA 4IDBA 1XU7A 2RBEA 2PD6A 1KVSA 3GZNB 4BL5A 3PFFA 3OETA 3PXXA 4XYGA 3MTGA 3HB5X 3MJCA 2NLOA 4O0LA 4GX0A 1JAXA 3ZZNA 4N18A 1DHTA 1GL3A 4ID9A 5FYDA 4D43A 2FR8A 1ZMOA 3ZWNA 4XDYA 3PPIA 3WXBA 1I10A 2IXBA 3UH1A 2VYVD 1XKQA 1ISIA 1Y5MA 3IUSA 1IYZA 1PZGA 4YAGA 3LK7A 2QQ5A 2Y1FA 3LT0A 3RASA 3BHJA 2QIOA 1LUAA 3ZWXA 1WDKA 2D2IA 2J3KA 4CMHA 3GHYA 1C0KA 3H9QA 4P4NA 5GY7A 2B37A 4WK6A 1VC2A 2I5PO 2QRJA 4ZQGA 2DC1A 4GLLA 2X5JO 3PQDA 4FBGA 2VZ9A 3SBOA 3MOGA 3FI9A 4YJHB 2C59A 5COQA 1E7RA 2RCYA 5COBA 3GAZA 5CDYA 2I66A 1PSDA 3VH1A 3PFWO 1C1DA 1LSUA 2P4HX 1DBVO 3SLGA 3U09A 4LVCA 1FF9A 4XYEA 3PVZA 1NQTA 4ALJA 2Z1NA 4PLWA 3FN4A 2H5LA 1DSSG 3FWZA 2OXIA 4ZQHA 3CXRA 3ZWYA 3EY4A 2EGGA 2SCUA 4OO3A 1E3WB 3LZ6A 3Q2KA 2HSDA 2ZQYA 4CM9D 3FF4A 4BO7A 2I3AA 2VHZA 1Z82A 1ENPA 4GH5A 4J90A 4OYRA 2Y1GA 4RLSA 5KJCA 5L45A 5KTKA 3JQFA 4AJ4A 4DQUA 1NFRA 1OBFO 2AEJA 1WLYA 4CV0A 5JY6A 3AWDA 2DKNA 3A1NA 3L0DA 4O59O 1QV7A 5A5EA 3V8BA 2X0RA 4NJOA 3G49A 3BMQA 4MOWA 3WGOA 2VHWA 4OOFA 2ZKLA 1NXQA 3BTSA 5COAA 1SAYA 2DUWA 2H63A 3ETDA 5BNFA 3AJRA 2IEBA 5IAAA 5TC4A 4UVIA 3TOXA 1G0NA 3LT1A 4GAEA 1UXHA 4HKTA 3AY6A 3I9JA 3D1LA 3AFNA 4HBGA 3PK0A 3BMOA 3PGJA 5F21A 4JJGA 5LDHA 4PLHA 3H5NA 3ANLA 1J4AA 2EP7A 4OL9A 4BO6A 3OP4A 1IPEA 2X9GA 1LDNA 1ONPA 3DZGA 3U4CA 1GDHA 2R6JA 1ISFA 4R9SA 4GGOA 2GR9A 3OJEA 4CM4A 3SLKA 2X1HA 1E5QA 1A71A 4YR9A 2BKAA 4WLFA 4XRRA 3V2UA 3ADOA 1PTJA 4NFSA 3OJFA 2IXAA 1L1FA 5CG1A 4D44A 4WLOA 4I5DA 1XLTA 1HEUA 2C7GA 4DC1A 2ZYDA 1HLDA 3RJ9A 5JCXA 1ADBA 1ULUA 2JHFA 1HE4A 1PX0A 3I9OA 3NDJA 3VPXA 3W6ZA 2WD8A 4UVEA 3GN2A 1GV1A 2GRAA 3UCEA 5L51A 3BTOA 3GG2A 1NQ5A 4BO1A 2UUPA 4E2XA 4RZHA 1LLQA 3GG9A 4NMHA 4CMKA 3JTMA 4BGIA 3ULKA 2VRCA 1SBYA 1DXYA 3GH3A 3EZYA 1HSOA 1FMCA 4ZA2A 4J2OA 2NQTA 3VPGA 4LGVA 1NHGA 3W4KA 4FSHA 4WASA 4TRRA 1N9GB 3BTUA 4GL4A 4NJMA 1OI7A 3AM5A 4N5MA 2DBZA 4K9DA 4R3NA 3PYXA 1ZFNA 1XQ6A 1YKFA 4MP8A 2WE7A 5TX7A 2XXJA 2IYPA 1X0VA 5FI3A 1HETA 3QSGA 4EUEA 3PJFA 1YB1A 5L9AA 1HL3A 3O38A 3C7CB 2BHLA 3GVXA 3H5AA 4A7PA 2PGDA 4AJOA 2W2KB 2W2LA 5T57A 1ZK1A 1UP4A 1PJ4A 4CQLB 3GHHA 1HZJA 1P1JA 2I6TA 4J91A 3HDHA 2FPGA 3JQGB 1RWBA 4J4BA 5JE8A 4B8ZA 4WEOA 3WMWA 3LU1A 3VKUA 1I2BA 1W8DA 3KUXA 1SMKA 5TIIA 2Q99A 1LXCA 1GPJA 2PNFA 4YEDA 4F6LA 1ZSYA 3ASUA 2H9IA 3F46A 5GZ1A 5EINA 4JQCA 2D59A 2NTVA 3I4CA 4YRBA 3CPSA 1IHXA 1PZHA 3ONDA 3AI1A 4OGWA 2IDZA 1LQTA 4PG6A 4M54A 4L4RA 1ONOA 1ZBQA 2O3JA 2PD3A 3L77A 4IUYA 4E33A 2EF1A 2OORA 3VPHA 3RWBA 3RSHA 4EYEA 1U3WA 2GZ3A 5JCJD 4YJFA 2NU6A 1H2HA 2UAGA 1EK5A 3RIHA 4DYDA 5KVQA 3LSYA 4CM8A 4CQMA 1PQUA 4OMUA 2IRWA 1BGVA 3FTPA 2QRKA 3WWZA 3MJSA 4RF3A 2PZMA 3KEOA 3ABIA 2J5QA 3EAGA 3BXXA 4DUPA 2IE0A 4PZCA 1B3BA 4D0RA 4E32A 4PLCA 4WUVA 3Q0EA 1MFZA 2IEDA 1YOVB 4XB2A 2PZLA 4Y6SA 2DPHA 1OOEA 5G0WA 5TF4A 1B14A 2VT3A 2CF5A 2W8ZA 4FJ0A 4NIMA 4BNTA 1PR9A 1KVQA 3GDOA 1H6CA 3GOHA 3DAPA 4A73A 2WYUA 3KEQA 1DRUA 3E48A 2AXQA 4PLPA 4DVJA 4J9VA 1CQJA 4IMPA 3O8QA 1YBVA 2Y67A 4KWHA 1X7DA 2JJYA 5A05A 4MKZA 5FFFA 1E7YA 1JVSA 4QTZA 1GUZA 4N5LA 3GDGA 4Y6RA 3PRJA 3VDRA 3GEGA 1P1IA 2GGSA 2VWQA 5I9MA 3GRPA 3OF2A 1CETA 5DZSA 4WLUA 1EE2A 4I5FA 3KTDA 1YL6A 4Z3DA 3IJRA 3CTMA 4O1MA 3WQSB 3IKVA 1GEGA 4JP2A 3QWHA 1GD1O 4FOOA 4JBGA 3WTCA 4N54A 3HADA 1UZNA 4J6FA 1YL5A 3DZHA 3WTBA 3E9QA 1TA4A 3CKYA 3S2GA 4CR6A 1BTOA 1W73A 1ZNQO 3EC7A 1N92A 3CE6A 4DWVA 4YRAA 5HRUA 2I3GA 3L4BA 4XA8A 4JJFA 2VTDA 1BXGB 1K5HA 2NVUA 5K6AC 3OH8A 4BQPA 4LRTB 3L6DA 1AXEA 3GZNA 2C5AA 2B83A 4DPLA 1LSSA 4B3JA 1ZSNA 3BA1A 5B4UA 4J0EA 4BQRA 2E4AA 1MXHA 3G1UA 3WGGA 4GWKA 1PWZA 1ZXBA 4GMFA 1E3SA 3DWFA 4OAQA 4XJTA 2BI7A 4Z9FA 3H6KA 5ER9A 1JAYA 3DHNA 4CV3A 2Y68A 1EFKA 3NUGA 3LT4A 5JAQA 5KKCA 1A72A 1EBFA 2DT5A 1EVIA 4II3A 2HMWA 3NTRA 1I33A 1R12A 2H6EA 1AN9A 2UV8A 1NQAO 4R9RA 3WGIA 1MV8A 1I3NA 4M55A 3GNTA 4RV9A 2J3JA 2WYVA 4FQ8A 3OJLA 4BMVA 1GQQA 3OBBA 8ADHA 2FZEA 1QMGA 3VH3A 3JQ8B 2Y1EA 1U4SA 1Y9AA 3QE3A 2GZ2A 2NU9A 4FOSA 4DLLA 2YFHA 2A4KA 2JCYA 2HO5A 4WNIA 1E6WA 1KEWA 3GR6A 5I7EA 5TS3A 4BOYA 4E5NA 2RH4A 1F06A 1EQ2A 3AFMA 1G0OA 4NBUA 4GKBA 4TKMA 5KCZA 3KYCB 3PLNA 4DIOA 4RLHA 1E3EA 1WDLA 1XYGA 4DLBA 4KQWA 3MJTA 2GPTA 4MVJM 3DONA 1BW9A 5ER6A 4Z9XA 3WLFA 5A03A 5K0ZA 3IP1A 4BKRA 3UGKA 5TT1A 4FJ2A 3I83A 3D0OA 1V3UA 2XAAA 3WS7A 4GGPA 5F1KA 3OQ6A 1E3WA 4I5EA 5HM8A 5BR7A 2BGKA 1VPDA 4E5YA 1CYDA 2Q1TA 1Z7BA 1R4NA 1DC5A 4DL9A 2Q2QA 1ZUD1 4FN4A 1VRWA 5A3VA 4YT8A 1E92A 3BMQB 4MVJD 4BO8A 1R4MB 2D1YA 3LT2A 2FSVA 1I30A 1H6AA 1F14A 2O4CA 3JQCA 5DDIP 3WGZA 4AVYA 5C3MA 2JFHA 1DIBA 4PN3A 1DAOA 4UULA 3RQSA 3JQ7A 2HAEA 1MB4A 5IDQA 4BIIA 4CV1A 1NWCA 4XQ9A 1KVTA 2CDAA 1VI2A 2JCVA 2P4QA 3IDSA 2RAFA 3MTJA 3BMOB 5A9SB 2ZYGA 5ITWA 5I8ZA 7MDHA 1QP8A 1TVEA 5T5QA 2PGLA 2OUIA 1P0CA 3OA2A 2DTDA 2XXBA 4XKJA 4RPJA 2HRZA 1OFGA 1YONA 3ZWBA 1HE5A 2WD7A 4CM4B 1LI4A 5L4NA 4JP3A 4CUKA 3ON5A 3RI3A 3PTZA 5ES3A 1HDGO 5CDSA 2ZJ1A 1WDMA 4LCJA 2EWMA 1KETA 1PGNA 1EUZA 2A9FA 3DOJA 3LC7O 5A1TA 4PRKA 1JTVA 1PR3A 1IOLA 2J5KA 1Y7TA 2YUTA 1GR0A 3EGOA 3RUDA 3W4JA 4AJIA 5JW6A 2GLXA 4GVLA 2Y0EA 2HQ1A 3D64A 2P5UA 5ITVA 1YO6A 4LN1A 3AM4A 3AOEA 4RQTA 4NDNE 5TRTA 4LMRA 3D4OA 5CEJA 1ZK2A 1YS4A 1OC4A 4JCOA 5KKAA 3QIVA 2EEZA 3L07A 5EPOA 1UZLA 2FZWA 3ZH2A 4B79A 4XB1A 3ZNQA 4EEZA 2X4GA 2P9EA 4A27A 3V2HA 2EW8A 4E12A 3QY9A 1KEPA 3NEPX 4OKNA 4HWKA 4ITUA 3JQBA 4I9HA 1JU9A 1XR3A 1M67A 4NJMB 1EVYA 1N2SA 1B7GO 2B5WA 2DTEA 4MPDA 1GYRA 4OHUA 1SOVA 3ETGA 3K2BA 2GSDA 5CP8A 2CDCA 4DPKA 1IZ0A 4KTTE 4AJJA 4L4XA 1FDWA 1SZJG 3DC2A 4XYLA 3N58A 5DBFA 5EQDA 2WYWA 4DMMA 5GZ3A 2Q2VA 1LC0A 1ZK3A 2X9NA 4KUHA 5T64A 2AQKA 4E31A 1T4DA 2X0IA 3P7MA 2WEKA 5JFOA 1LJ8A 4R68A 4MKXA 2Q49A 4BVAA 3L6EA 1N1EA 3KB6A 3ICPA 1YE3A 3TSCA 3I52A 4DRYA 2WWRA 1XELA 3JQGA 2V7PA 3ANMA 3D3WA 3VTFA 4C7JA 4J49A 3BIOA 3EYWA 1A5ZA 2B36A 1XG5A 3H7AA 4PZEA 2BRUA 3F1LA 4H3VA 4OQYA 4J7CA 2BI8A 4J2HA 3GLQA 1Q0HA 1TEHA 4CLRA 3G17A 4BS9A 4NR0A 4RCVA 3IQDB 1SB9A 3MCVA 1Q2XA 3CINA 3N7UA 3UF0A 1JA9A 3GRKA 1WPQA 4QX6A 3HJAA 1ZO8A 4Q3EA 4UAGA 5L4LA 3ZWPA 4CV2A 4BNKA 3AU8A 4CM6A 2BMAA 4M89A 3UXYA 1DO8A 3ZU4A 1O94A 4FR5A 4D3DA 3M6IA 1P33A 4IINA 4BMSA 4E5MA 1Z74A 4WECA 4YJFB 4FFMA 2AEMA 1ZKMA 3PWSA 3HN2A 1XDWA 4ILKA 5JMWA 3GUCA 4BV8A 4W9NA 3LC1O 3AUAA 1WZEA 3TF5A 5H81A 5JDCA 4EBFA 1PIWA 1R0LA 1E77A 4FD3A 4YT5A 2O3UA 1YGYA 1N7HA 3EMKA 1QYXA 1WMAA 1YJ8A 3X2EA 3ORFA 1D7OA 1ZK4A 1OC2A 4K28A 2BFMA 4INAA 1HKUA 1HE3A 1R0KA 3ZWOA 1HDRA 3D7LA 1MGOA 2YV3A 1E1KA 1NTOA 4LSWA 1PS9A 3S2IA 4XGIA 1DC6A 5IZ4A 1I01A 5ILGA 4FFOA 4RORA 3SC6A 3NGXA 2HK7A 3M2PA 4R54A 1E7QA 3KLPX 5IZCC 2OP1A 2XOXA 3I3OA 4ALKA 3O8QB 2P9GA 3A9WA 1QYCA 3O9ZA 3SVTA 1H2BA 4I9NA 4TSKA 4RO0A 2HMVA 2VRCD 4MJLA 4YVFA 3ZW9A 3K6JA 3NKLA 1I2ZA 3TZHA 2POQX 5A9RA 1LQUA 2HCTA 4RDIA 3ROQA 1S6YA 4GKVA 5B1YA 3JD3A 4B4OA 1I3LA 1KY4A 1P74A 3MJEA 5IG2A 1K3TA 5JC1A 2OBNA 4JJIA 2C54A 2VN8A 1PZEA 5T67A 1CWUA 1WWKA 4DBZA 2BFOA 4U6QA 4P4GA 1ZSVA 3OJ0A 1MFPA 1LTHR 3TZKA 1XU9A 1EVZA 3GDFA 4R16A 4C7KA 1F0YA 3B1KA 1Z73A 4IQGA 3MZ0A 1T25A 4QFCA 4YXFA 2W2LD 3FBGA 4L0QA 5G4KA 5JMPA 2NVUB 1Z45A 2JAPA 2QZ9A 1MC5A 3IJPA 1KERA 1NPTO 1BXGA 3FHLA 5JC8A 4TRNA 4DLAA 1R6DA 3AU9A 3OIGA 3LLSA 4MIOA 3E6AA 1H6DA 3KOUA 1ISMA 1SC6A 2Z5LA 1PGQA 1LLDA 3R0IA 1WP4A 4ALNA 1EMDA 2A35A 2AG8A 3ZDFA 4BO5A 3EVNA 2DM6A 4NU5A 4E4YA 3DZIA 4YAKA 5T8KA 2B0JA 2OL4A 1Y8RB 4MO2A 6LDHA 1ZW1A 3PWKA 1KC1A 2WE8A 4QO8A 4CM1A 1JWAB 2AQ8A 4P8RA 4YPOA 1HTBA 1P1FA 2F1KA 3JQ8A 4M49A 3F9IA 2W98A 3KO8A 4KP7A 3S55A 5KJFA 2O7SA 3RD5A 2LDBA 4CMEA 2CFCA 1T4BA 2O3SA 4X54A 5A06A 3VZPA 5A5FA 4CQMD 1UXGA 1E1LA 1UDBA 1QR6A 1DJNA 1VKNA 4WLVA 4YQYA 4QQRA 3KYCA 2Q4EA 1NFFA 4RGBA 1K0UA 1B8PA 4RZIA 1BW9B 2P91A 4R1UA 1LDBA 3IS3A 3CZRA 3WYBA 2PH3A 1QLHA 1ZCJA 1PU2A 1ID1A 1IZ9A 2OGUA 2TMGA 2VHVA 3BMNA 5I9LA 1IULA 4MINA 2NQ8A 1UAGA 1Z7EA 2DFVA 2YHUA 1DB3A 1E1MA 1XIVA 2X86A 3WIDA 1VM6A 3OICA 2FP4A 4BKPA 4IXWA 2ZIZA 3T7CA 3JQ9A 1R4NB 1C14A 4N7RA 3AW9A 1X7GA 4QXMA 4L4SA 4HXYA 3A4VA 3V1YA 4Y9DA 4A10A 1JLLA 3KBOA 2WDZA 2Q1WA 1UJMA 2P9CA 1R4MA 1XQ1A 2OBYA 3FSRA 4BO9A 1SB8A 1TT5B 3RVDA 1BHSA 3C8MA 3JQ7B 4KQXA 1R66A 1ZEJA 3KVOA 4Q3DA 2NNLD 3G3EA 1NR1A 3GK3A 4W6ZA 3WG9A 3Q9UA 1PGOA 2XF8A 4NFYA 1U3VA 1HSZA 1A9ZA 4ZRMA 2IZZA 4UEKA 3B1FA 3UUWA 5EN4A 1ISGA 2AQIA 5A9SA 1DC3A 5DP2A 1V3VA 3MOIA 3JQAA 3JQFC 4NBRA 4E5PA 5HBRA 3NJ4A 4TZTA 3H9UA 2PFGA 4W82A 3X2FA 3HDQA 2WD7B 4MDHA 3JD2A 1PGJA 4AL4A 1U3TA 4C4OA 5A4DA 4BO3A 3DOCA 3TDKA 5C37A 4IDEA 1BMDA 3GEDA 1DOHA 1P31A 1HLPA 1D4FA
chains in the Genus database with same CATH superfamily
2R8OA 3SZOA 2QAGC 1OLXB 1V47A 3QUAA 1SNYA 3HPRA 1HYBA 4PYNA 5AI0A 3IUBA 4BNVA 5TMDA 5ALWA 5TQVA 4B0PA 3G6KA 4LXGA 1BE0A 2ZI9A 3DBLB 2HWUA 5CLGA 2O7NA 4AKGA 1SCDA 3KUCA 2PX2A 1QGED 2BUCA 3HUUA 1G98A 1IATA 1NW7A 1H9BA 1DFGA 1BCRA 2OQIA 2ZJAA 4ZU1X 4CIXA 1H0HA 3PX3A 1CVLA 1DT5A 4JLMA 4KW7A 5BV0A 3LF2A 3HYRA 4TMWA 3OO0A 1N8KA 4EKEA 1WRBA 1NY6A 5P8WA 3ROMA 3VR0A 4BV3A 1DEOA 2WC1A 3ENQA 2C0CA 4B4KA 2GWHA 4L75A 3A3YA 3UHAA 3QEJA 1V0JA 3G23A 5BT8A 4RXTA 4AJKA 2NVBA 9LDBA 4G4IA 3BE6A 1AA6A 2BGWA 1KAMA 3M49A 5AVSA 3DEAA 3BJEA 4RVGA 2AOXA 1PTJC 2A1TR 2V6FA 2NSYA 4O3FA 4NH0A 1CR2A 5GJCA 1GILA 2WHYA 1EDDA 3N2LA 2BDTA 5AQ1A 3R5HA 2NZJA 3TLMA 2H52A 3B12A 4ARSA 4P7GA 1CV2A 3U19A 5CD9A 3ZX5A 3QU4A 2VP2A 4ZKDA 1ZD3A 2VZ8A 3A1FA 4J94A 1KOFA 3I8XA 3TBFA 4RD2A 1XMPA 1H4TA 1GTL1 2RGWA 5EUQB 2FQWA 4WZBE 3Q0TA 2VHUA 2EP5A 2X8LA 3D5EA 1IHPA 4Q4DA 1S3SA 5MN4A 3RK4A 2ALJA 1VL0A 5DM1A 5LQMA 4J0HA 9LDTA 2DUJA 4L3VA 1WTAA 3MMPA 1EEHA 3C2QA 2CXSA 1UJNA 1DAIA 3IKMB 2IPXA 4M1SA 3T61A 1C80A 5BYBA 3TDNA 1NNLA 2VT2A 1RSZA 2Q1XA 4JLUA 3U39A 3ZGYA 1BKDR 2RGAA 3MN1A 4IXNA 3RABA 3W6UA 5JANA 4EFNA 2DEUA 2WJ6A 1COZA 1JR3E 1IIRA 3S8MA 4XIIA 5JIBA 3R6WA 4NECA 1YZ3A 3FNQA 5AI5A 4MV8A 3VR3D 1KO4A 4KLRA 2NU8A 4DDHA 1VE9A 2AS0A 4PM4A 2FWIA 3SM3A 1C3OA 5FQNA 4MRPA 1PAUA 2CLFB 4CLRB 2GTHA 1NZJA 1IL0A 4ZREA 1O1YA 4OY3A 5BV1A 3C1OA 5CFMA 1MAHA 1UDCA 4J0DA 1ADFA 2QUKA 3DKPA 3IP3A 1N3LA 2CY0A 3DAFA 2X6TA 4OMFG 4PPYA 1IEQA 1RPJA 1W36B 2E48A 4D25A 2NADA 4IYRA 3OJCA 5AI9A 3RPEA 3DLTA 4DR7B 1UAYA 5T6BA 1P2TA 1ZMRA 3GCXA 3T52A 4E08A 5H3CA 4YQFA 1KJQA 3HYTA 1EX6A 2Z2ZA 3KTAA 2HADA 2YDYA 1N77A 1QRRA 2B69A 2O0HA 1SQSA 1GPYA 2BLNA 4QXPA 1GTSA 3MTEA 1RZUA 3I2JA 4D3ZA 2AN4A 2QD4A 3AUYA 3TLCA 4M1OA 4W4TA 3UPDA 3DMFA 5HJ5A 2A78A 3QPWA 4GNRA 4EMBA 3EEQA 2JA1A 3KR1A 1VE3A 3IEKA 1BCSB 1G2QA 3RKRA 3TFOA 3BAZA 1ABBA 3CIOA 4KBYA 4B8YA 2YFKA 2BD0A 2VAPA 3E7DA 4B73A 5HMMA 5AKYA 2J0EA 4K5QA 5ALUA 3Q8KA 3G9XA 2E4ZA 3V4ZA 3HHPA 5K2MA 1TQ2A 2EBFX 5ALHA 2HRDA 4RVFA 1NWHA 3E1GA 4NMWA 3SEQA 3UA4A 1JFFB 1LRJA 1EVQA 2OO7A 3RJZA 1RIIA 1YRYE 3SWWA 4ADSG 3L7YA 2PX0A 3TZQA 1T5IA 2OD9A 1M2VB 2MR6A 3FRHA 1EA5A 2FPSA 2OZPA 5B4TA 1IDOA 5HFNA 5FDFA 5AVTA 1L4HA 2IYOA 3C87A 2F9MA 5IYZF 3LQ1A 2I67A 3B51X 2HGZA 4P4LA 1F7UA 3UT0A 3GPCA 5B7NA 3IOCA 4Y2UA 5FLKA 1DUIA 3FZGA 3O4IA 1VJ5A 2ZS8A 3WMRA 2CVQA 5KJ1A 3TECE 4I0WB 1T26A 1N1MA 3TIIA 3V7FA 3TRJA 1Y3FE 4CG0A 1DRKA 2CZQA 4C0HA 3W5HA 4XZ3A 1C4WA 3HR8A 3OA0A 2PKQP 3OKPA 4TWAA 4GZMA 1BS9A 4JXZA 2X15A 4P2GA 3X1YA 3KQVA 1O6FA 2AOVA 3I5UA 1L7PA 1TEVA 3WQQA 4W1QA 4BMNA 1J8DA 2JD1A 1Z4QA 3ZCVA 1OV6A 2JHGA 1BA2A 2JK0A 4J1SA 3AR4A 2BZ1A 4K87A 2RHLA 5IT9A 3CUTA 3WI7A 4QODA 1GDTA 5FTJA 5CK5A 3CCCA 3RHZA 2H2FA 3ZOZA 2FRVA 1N7IA 2PQ6A 4OD0A 3USES 2ZIAA 2A7QA 1DT3A 2AFHA 3FYSA 3LWDA 1YQGA 3LS2A 4ARVA 5I47A 5KYYB 3PNVA 5D5QA 5TS2A 1WVGA 1AV7A 1AY0A 3GJXC 3KSMA 1ULBA 4QOEA 3GLRA 2HHCA 4OVKA 2FSIA 2ZRKA 4IS3A 5FXMA 3STVA 1EGMB 4DGSA 1E60A 3TSWA 1KI4A 3I23A 4C1BA 2A3NA 2D4AA 1JKFA 2P2SA 4R8LA 3VNVA 2R00A 3GVPA 1R18A 3JRXA 4X1YB 5A4JA 3DFIA 3F9CA 2GEUA 2G4LA 3KR2A 3ZJ4A 3PYLA 3GFPA 4MI1A 1GU1A 5KWEA 4YJDA 5KYWA 3SM9A 4J0FA 3V6MA 1QWSA 2OCBA 4Y6PA 3FJOA 3Q7PA 1Y3HA 2X58A 4UVHA 3J80A 1FDSA 2W2PA 5JSYA 3ZHBA 5J5VA 3ZXYA 2GA8A 1BN7A 1ZM2A 2JL1A 1GNLA 3ODPA 3Q8XB 4NYIR 4BKUA 4BXOA 1YZVA 4QSMA 4BP8A 1ORTA 1W5EA 4NPCA 3LCUA 4ZZ2A 5BN4A 1VHDA 1B76A 2J32A 1V9SA 3S27A 5J1SB 5B6IA 2JJ8A 3VO1A 1E98A 1TEZA 1OX4A 1HFKA 1HO3A 1CY8A 1FVHA 1ILEA 1GNSA 1XBTA 1JKXA 4ZOLF 5EERA 1QFJA 4XUCA 1DZIA 2V4UA 3WNQA 4K3UA 1YMQA 3N2GB 4CUZA 3ND6A 1THGA 4GW3A 2Q0SA 2UVQA 4HXEB 4LDJA 2IC5A 5JWHA 1EXDA 4EJ2A 4CT0A 4K9LA 1IUPA 2PLNA 5AICA 1NVVQ 2CLDX 2K2WA 2CJPA 3CY6A 3GFFA 3UJ3X 3W4IA 3HCDA 4F04A 2C7VA 3P9SA 5EJEA 1WAMA 3VH2A 1Z6ZA 3FW1A 2VJAA 3GGDA 3I0MA 2IFTA 1M2WA 3LF1A 5CEEA 1JHQA 3CM0A 3CRVA 1PZNA 3QTTA 4O5OA 3NRJA 4M1EA 5FOVA 1O8CA 2VOJA 3FPCA 1XTJA 4ZZ0A 1JNXX 3VNBA 5CM8B 1WX1A 2G76A 4TV9F 1RQ7A 1V8OA 3DKIA 4R8MA 1B3RA 3D43A 3FMVA 3M7IA 3P9PA 4RPHA 4WJZA 2GZAA 1PS8A 3R3SA 5IDVA 3HGQA 1ZH6A 2VZ0A 2DBVO 4IIVA 4X20A 3E84A 2EARA 1O6CA 1A7KA 2XD4A 3T9BA 3TLXA 2D5CA 3GAFA 2W58A 4Z1MD 3GZ4A 5AHOA 2UZ3A 5AVWA 1CUSA 4KE6A 2I8LA 3HEBA 3VTZA 3EVFA 2WWWA 3R9XA 3DXYA 1AN0A 5EXXA 2OVBA 4QPNA 3IUPA 1N1GA 4RVNA 5E9AA 1HE2A 4IEEA 1ZJZA 4CDNA 3I9NA 5J3JA 3H3JA 5JARA 2EV9A 4BNLA 1TT5A 2M6KA 1LFAA 4FGJA 4NCIA 5EE5B 3BFJA 5IDWA 1Q17A 4OP1A 3CVXA 2AZDA 4P34A 1CX9B 2G08A 3ITDA 4J3FA 3WMXA 5C81A 1G4HA 3KXDA 5JNLA 5IN4A 3ELWA 2X8JA 3L18A 3QZUA 2HDWA 5JOQA 1GIAA 3IHLA 4DRXB 5IFLA 4IIJF 1FSSA 4L8YA 1FNBA 4G0WA 1A3CA 3QVGB 2I99A 4IJ5A 2BGGA 1B0UA 1YDGA 4CF6A 3QKRA 5IAEA 4CMCA 3VR5H 2X40A 3LYUA 2FJPA 1C4KA 4ZMSA 2V8OA 3UMBA 4M1QA 5B1IA 2Z1MA 5TEVA 1T2NA 4LMPA 4U9IS 5DCYA 2NYAA 1PJSA 1OLXA 4LRUA 3C74A 1NNEA 4PZ9A 3THSA 1CJCA 1YL7A 4QXQA 2EKPA 1OGYA 3OQIB 2XUOA 1TVKB 2H1SA 2GPAA 4YBZA 2FPRA 1M1YB 3A0UA 3O92A 3DBLA 3V9PA 3LXRA 5EIHA 1XHLA 1PJBA 3OZUA 2X5NA 3DBHB 3Q7RA 1TM3E 4Y2RA 3U49A 5JMTA 5LL6P 2PQ0A 3ZU6A 1Z6YA 3DDNA 1QIGA 2ZRJA 3SJBA 2XUAA 3B82A 1Y37A 3KZMA 4DN6A 1MQ8B 4QNMA 3DLBA 1IU9A 1W6RA 4JC8A 4G1VA 1LPOA 4RPGA 1CZLA 2BBOA 5DTMA 5JYEA 2L18A 3KWJA 2W2QA 4AJPA 4X6XA 3KQPA 4Q93A 4X00A 2J3QA 4Z3OA 2HKIA 1L7OA 1NV8A 2P27A 3E5HA 1Q2UA 1Z68A 3RS3A 1CEYA 4IHAA 1NJ8A 1R1DA 1DQSA 1Y98A 4NHOA 1C7FA 1GVHA 1C3JA 1NURA 2HEGA 3DV2A 3C6KA 1EGAA 4QDJA 3NGMA 3DVLA 1ZJ5A 2J9GA 4NYMQ 5FLXA 3Q1KA 3AR3A 1DPFA 4ETWA 1CUIA 3WGMA 5K45A 4D97A 2O50A 1NBMD 3D1JA 1JWLA 3FXAA 4JIGA 4RVSA 5SZIA 2NSJA 1LWNA 1NDUA 2F17A 4ZVOA 4E11A 1PLKA 4KVGA 3L92A 1YKGA 4DEYA 4N9WA 5IVIA 3K0BA 4I55F 4OP3A 4IWYA 3G85A 1ODLA 3LAWA 4RL6A 2FWNA 3U3XA 3UJNA 3WNBA 2ODQA 3HM2A 1Q0QA 2V7VA 3KDSE 4RKQA 4C6TB 5IJZA 4FEEA 5JSZB 5U4XA 2O05A 4KHZA 1SOWA 3B8HA 4YB8A 5FLYA 4G67A 1HURA 1QF9A 1SC3A 1HF3A 1CRLA 2XHEA 4HQNA 5FI5A 1DO0A 3KPYA 2Q7DA 1ISJA 1Q6ZA 4G37A 2JAWA 1RZVA 3LFTA 4WD3A 3I8SA 4QUIA 1TZMA 4PSKA 4BNZA 4QELA 2KE5A 4P32A 1DWPA 2Z2YA 4K40A 3Q1LA 1WMBA 1BQ4A 2MSCB 4MUNA 1X13A 5ALYA 5EKTA 4WTOA 3ZIAD 2C78A 2ICAA 2WHPB 4H0NA 1S8FA 1JI3A 1U3DA 3OT5A 3U62A 1SVWA 3E81A 3IE1A 4RY8A 5DISB 1UFOA 1JFSA 1QPBA 2V9ZA 3T9CA 5BRAA 3TAXA 3FYUC 4F11A 6REQB 4AWXA 1OBCA 3QBTA 1SO8A 1P0IA 2GVDC 2X3YA 5LSAA 1QF6A 3OOSA 1A95A 3NXSA 4OGLA 3GXBA 3AZQA 4MQUA 4XXHA 3GLKA 1WMDA 1DG3A 5B55A 2XQJA 5AM4A 2C8JA 2XWBF 3RK1A 4LIPD 3KTFA 3GN1A 1Z0KA 1C41A 4XX0A 3ZHVA 3WLEA 5KZMB 2ZB7A 4L5AA 3WQRA 1TXGA 1Q22A 2AE1A 1BCSA 2Z2JA 1TKAA 4N0QA 2OOSA 2H06A 4JX9A 1ZGCA 2VNHA 5DEIA 2G5GX 1VIMA 4QBKA 1E18A 2WUEA 2Q9CA 4UHJA 2VYQA 3C98A 3LYAA 2ZWVA 3NBKA 3VJRA 1KMHB 4WBNB 1XTVA 2RHMA 4RD3A 2VP9A 5AOCA 1JFFA 3IHTA 2HK8A 4DVGA 1L7RA 2R8EA 2O8BB 5FCDA 3HI4A 4WACA 1BJKA 3HBAA 3OCJA 1JHYA 1ZRHA 2C5EA 3D02A 3EVZA 2ZJ0A 3KYBA 1M2VA 4D9EA 2VNSA 2J5XA 3MUFA 4JFAA 3FNEA 1L7EA 2FW9A 2NO0A 3K09A 1NVTA 1XXHB 3P2YA 4PWYA 1I9CA 4GYJA 2WR8A 4KXMA 1J8FA 1U4NA 1U1DA 4Q3BA 5CFLA 3BCUA 3MWJA 4YO7A 2OFXA 1CVRA 1EFUA 4FFRA 4X1KB 4U7JA 2R5NA 1MG0A 1SKUA 2CMHA 2WJPA 4OHKA 4QC2A 2IKSA 4EY6A 1C1XA 4PZ0A 3LK6A 3PBKA 2HYDA 2DBQA 2I2DA 3JAKB 3P20A 3ND8A 3AGPA 3E1KA 5CNJA 1Y1QA 1KRXA 3DOOA 1KQNA 1KOLA 2C58A 3DFKA 5KX5F 2XTNA 4EW2A 2YIDA 5IN5A 4GBJA 1EWYA 4IVNA 4MR7A 4R8RA 4R84A 1D3AA 1HQCA 4H9GA 3M6LA 1U5AA 1D7AA 4WKGA 4GUAA 3IAHA 1OBOA 2A5JA 4LNAA 3IVMA 3CSUA 5TQJA 4KX5A 3PHIA 4EUKA 3DE2X 2ORED 1RYEA 3GMTA 4M6WB 3HN7A 3VMFA 4R41A 5KYYA 2YMQA 3MC1A 3QV1A 4JGGA 2CXOA 4D8XA 4BNUA 3FOEC 3AM3A 4MVJF 4FLMA 1NV9A 1NYQA 2OMEA 3T3IA 3ADBA 4DA7A 2H2HA 1A50B 1ZVMA 1FUUA 3FMIA 3KC2A 2Q27A 3SYNA 1UBNA 3O26A 2M98A 2NT4A 2GA9A 3H5OA 4X1YA 5MN5A 1WZNA 1M75A 2OHGA 1GG2A 4IDCA 2GKOA 2AJBA 3JR7A 3CONA 5GTDA 2VNKA 1L8OA 1Y6JA 2OV8A 2ZWAA 3DCYA 3P0JA 4KV7A 5KJEA 1FFSA 1G4UR 1DIHA 1N2HA 2ASEA 4NI5A 1XMSA 1X38A 5JSHA 2GEFA 3I64A 3IBFA 1JS1X 3SG0A 3NS7A 2C9YA 3PXBA 1T3SA 3PDIB 5DULA 4F3TA 1KJJA 3NKVA 5BY2A 3T3OA 1AC5A 2AN3A 3SJUA 4TN5A 2X2FA 2CUNA 3UANA 4KXUA 1VCMA 1IY9A 2YJGA 1KHHA 1O9BA 2CN1A 3ECSA 1ADGA 4YRCA 4A23A 1D1TA 1DCFA 1UUFA 3DB2A 3NH9A 1TL7C 3K1AB 3NC0C 5JJ5A 1XMOB 3MWDB 1SHUX 4DT1B 2XUJA 2R2AA 2H92A 1KNXA 4JB8A 4KYTA 3T5GA 4G1FA 3V8EA 5K4GA 1ESMA 2FKAA 3BFPA 1TCAA 1N0VC 1MF7A 3KPVA 4L51A 2R4QA 1DZ3A 1GGNA 3ABSB 3KOWA 4FHGA 1ZG3A 1ZHOA 2P9TA 5A6VA 2ZB3A 1L4UA 1UXJA 4LPKA 4FGZA 3AUSA 3BILA 2QVBA 2VTKA 3NTOA 5AKGA 4CL3A 3B9PA 4HVCA 1UZMA 2LDXA 4G5QA 4Y67A 5AJWA 1G8YA 1PS0A 2C20A 3SOZA 4KMOA 4MB6A 2AOTB 3WIBA 3KM0A 2RG7A 4HEHA 3NAGA 4GWGA 1NVVR 4HNRA 3EZ6A 3ZHQA 4OB7A 3M5CA 4BDSA 3G0HA 1DKRA 4J3JA 4RD4A 5FUYA 4DJFC 5BW4A 5KQRA 4MIYA 3UJAA 5FWDA 3UJ6A 2YR0A 1Z2NX 4BC0A 1TT7A 2ZS9A 1IEWA 4CMBA 3DMYA 4CMEC 4Q3AA 3G9ZA 5TNXA 5AK6A 2BAGA 3KQYA 5E1DA 4RL4A 4IGKA 4AZ3B 2NSDA 3N6RA 2A88A 5DBIA 1TU3A 4DREA 1INLA 2ZR7A 1KVRA 3IT1A 3MW8A 4MUFA 4RVUA 2Y3IA 1Z0FA 5BN3A 1KPGA 1OD6A 2YJ3A 3AIOA 4HDNB 4WXMA 5CVVA 3FVVA 3RUPA 4LJ5A 4KVFA 3RRBA 2P41A 4A2CA 3SXJA 2QN9A 3NPAA 5HKOA 1AS0A 4FEYA 3TQRA 3IL2A 4FSDA 4K8RB 3HACA 1A4IA 4ID3A 2FETA 3RWMB 3WRVA 4EAAA 5MDHA 3B1YA 2GZMA 1XD9A 2RKWA 3ZWVA 3EXG1 4IS2A 1GCOA 5FOWA 5J2UA 4MUKA 4JLSA 4PG8A 1Y4AE 2BGIA 2HPAA 2ORWA 2Q3FA 3KVVA 3NNSA 4XPIB 2PX3A 1N8NA 3WK5A 2ZAGA 3KCNA 2C4NA 3L4SO 3E8XA 3FTQA 5D51S 4ZVVA 2ZRDA 3QOFA 4C0SA 1TMGE 4PLVA 1W49A 4L8WB 4LHEA 3FSEA 1Y7PA 2ACWA 1MRZA 2JIMA 1M6HA 2VRBA 1R9MA 4BUZA 4NJEB 3ZWCA 1R8QA 4CLDA 4IKOA 3E9RA 4LVUA 3ZU3A 2SECE 5CR9A 2JVJA 3E3LA 5EWMA 5ALTA 3X44A 3ETJA 3GELA 1CDEA 3DF9A 5TR9A 1RLUA 3H1PA 4C4SA 3IP9A 4UEJA 3INRA 1I13A 5A7FA 1DUSA 2R60A 2W4QA 3OQIA 4REMA 1MEJA 5EJIA 4QDOA 1TVKA 3MMSA 1M1YA 3E4CA 4DMCA 1J1IA 3BMXA 4G36A 5I7SA 2D3WA 3GL9A 1C29B 1IAVA 3DBHA 5TE9A 2EJVA 2A67A 1QIJA 3EVDA 1M54A 1GUYA 2OCKA 1SURA 5EMKA 3MHTA 5IJ0B 1BS1A 1BXZA 1R6VA 3U5TA 4JOCA 2DULA 2X42A 3AR2A 2W90A 1U9YA 4GPBA 4WOPA 1EDZA 2Z1DA 3G0IA 2GARA 4REOA 3RS8A 4HCJA 4RZ2A 3OQBA 4R1LA 1K6EA 3TW6A 4RY2A 1EUCB 3JPYA 1YC2A 4OQPA 2BR3A 5KYTA 1QH8A 2BKUA 3KT0A 2D8AA 2Q5QA 4WUTA 2ZCVA 3UW3A 2EIXA 2GJ4A 1PDOA 2C5BA 2ZJ8A 2WT9A 3CH4B 5ECYA 4DHWA 5KU1A 3OAAA 8GPBA 4AWBA 4EJSC 4G56A 2BH2A 1KMNA 3A14A 3LDGA 4OUKX 2QA5A 4US1R 1NIPA 5KBYA 4KEAA 3Q9LA 2HA7A 3AR8A 2R6FA 1RRFA 4FW8A 1TVMA 1H0KA 1ONNA 1PV1A 1WXHA 4M9QA 1EP9A 2QTRA 3P9XA 1MB2A 3L1IA 4LJ9A 4OK6A 2QOEA 3DQQA 1G19A 3KKNA 4OQZA 5J63A 4QFDA 5AHKA 3SFVA 5CLLA 1E5TA 3N59A 5AK5A 5EESA 4MIKA 4JLBA 2G9UA 4MWZA 4OOEA 2PR2A 4B6RA 4ESOA 4BV2A 1YJ5A 3TQOA 2XGGA 4K6GA 2VWPA 3D1VA 4KFRA 1DKQA 1P2GA 5BSMA 4FR0A 3T94A 4NYMR 3TW0A 2AG6A 2WVHA 4YV2A 2GXQA 2XHZA 2H1FA 3NV9A 2AN1A 1KGDA 3K9LA 1G6Q1 1KJ8A 2P2ZA 3E4DA 4BFZA 4BLTA 5KEIA 1TQ8A 1BOOA 3ENWA 3E3AA 3CS3A 3OC6A 1SC4A 1Y4SA 2XKBA 3L8ZA 1PNVA 3MBKA 4LECA 1TQHA 4LSGA 1VMDA 3ABZA 3KXIA 4KWIA 2QT0A 4GBGA 1IPHA 3C6MA 4JODA 4ERXA 5FL7A 3A0RB 4OXRA 4CT5A 5E7IA 4E1VA 3RKUA 1G2OA 3PUIA 1U9IC 3HJHA 1M2OB 4N47A 4AKTA 4RTLA 4NCNA 1S1MA 4LKRA 4KDCA 4QQNA 1R5OA 5B53A 1AKTA 3DOFA 3LM8A 4F0JA 2WA1A 1H6BA 4N40A 1PSWA 4AMGA 3KHUA 3NJ8A 3GLTA 3KB8A 4R6WA 1Z18A 2BFFB 3QF7A 5FPYA 2QTHA 1WP9A 5H68A 4R5HA 3GARA 3I6QA 4UW9A 4WA7A 4PCUA 1URPA 6REQA 1VL1A 1P3DA 4IIUA 1OWMA 3CU5A 2ZE6A 4GOXA 4KKVA 2R66A 3A4NA 3ZD6A 4RV5A 4DUYB 2OCDA 1TE2A 1DG9A 1V9CA 2V1XA 4PRYA 5F51A 3P2OA 4C4ZA 1YZTA 2VYVA 4W1RA 5F12A 4BU1A 1PHPA 2ERYA 3H3FA 3FR7A 2Q3LA 1T5LA 3OZDA 2PKRA 4HPXB 3ZV7A 1A5BB 4FGSA 4BKQA 1T5OA 4CMIB 1NNUA 3BA6A 3K9QO 1FTWA 3TSAA 3U31A 1MV5A 4BWYA 1E63A 4JUFA 1N6OA 1ZN8A 2BFCB 2IIPA 1G66A 2JJ2A 4CKXA 5F9FA 1II8B 1CUUA 1W2WB 4HLUC 2Z09A 3RJ5A 1LTQA 5GJWC 2VQEB 3HVRA 1KMHA 1J1UA 1GPBA 1N6PA 1U8FO 4BNYA 4NAVA 5K09A 2IEYA 1PJAA 3DTYA 3VSAA 5HK9A 3EZNA 2O8BA 2XY4A 3ACCA 4BNIA 1KK2A 2ZTVA 4PLTA 4ZV9A 5T4HA 1LX6A 1K9SA 1XD8A 2AUNA 2GDZA 3EVCA 5AKXA 2EFGA 1NLYA 3H83A 4BZPA 1BO6A 2I4IA 3VA7A 1FJHA 1XXHA 4XVHA 3GLFB 3NORA 4HRVA 1TLFA 3AHGA 1EHIA 3DL7A 3O9VA 5CM2Z 5FYQA 5DNYB 2C7RA 2FH5B 1D4ZA 1B16A 2A4MA 1XRNA 4HOYA 5JTTA 1DXHA 3FOAA 3VOTA 5I4CA 2WK1A 1EK6A 1QGOA 4Z2AA 2NUTB 5K4AA 3QPDA 3CZPA 4B7ZA 2YJ4A 3KLBA 3QW4B 1AQLA 5DNVA 4J16A 2OHXA 3EXHB 3HH8A 4XIFA 5M7EA 3SQLA 4BQQA 3W1EA 3DQZA 1KWGA 3BEDA 2QT9A 3JAKA 5F76A 1JZQA 3WFJA 5DBHX 4FWTA 3ENZA 2GM5A 5DIZA 2BFPA 3IIJA 4MP3A 4A0SA 3DWEX 4C06A 2QGZA 3DWGA 1D0SA 3K05A 5J1TB 1KJZA 1E2FA 1EI9A 1EGQA 2CMKA 4Q37A 2R44A 4U39A 5FUBA 1DXQA 1TVCA 4HWOA 3RUEA 2PU7A 4V0LA 3OFND 5JYDA 1EQUA 2CF6A 1UFVA 1SC1A 2C4KA 1XDSA 3LLMA 3SYLA 4Z4GA 2JAOA 4BO4A 1T0JB 3H11A 3OSZA 1WY5A 4UM5A 3H8SA 1LDYA 1SBTA 4M6WA 4CG1A 5K6AA 3PGVA 2XZDA 3OWOA 3G2NA 3H8VA 2GYYA 3OE5A 1RRMA 1VXRA 2QRHA 2NWQA 3S0JA 1NKTA 5BN5B 5ALKA 4RS3A 3KDPA 2IWHA 1F7VA 3MUNA 3KOZA 2VQ3A 3GMDA 3JAWA 2FPLA 4Y2QA 5TMEA 1Z7GA 4ZQBA 5JSKA 4G0YA 5FB3A 3CNOA 3KQWA 5BSGA 3EXIA 4O4HF 4UU7A 3W5UA 2P5TB 3B1VA 1LPPA 2Q07A 3FFAA 1NUHA 2DY1A 2FSGA 4GOND 2V6MA 3T7JA 5L4SA 1ISSA 2QX7A 3MD0A 5TEWA 3AGQA 4ZD6A 4C1NA 2IX9A 4MUEA 4MGKR 3FJ1A 1DOZA 3QNUA 4BZXA 1YQEA 1T1SA 3VZQA 4MWSA 4C4PA 5HTOA 4P38A 2AWNA 1D2HA 2GETA 1YCHA 1YS9A 1I7QB 3R2JA 4E5DA 3SJ7A 5E2IA 1THZA 5AO9A 1EQAA 1QDLB 1SBIA 3PDIA 2BGNA 3UWMA 2LIVA 3TIFA 2VUSA 5AHXA 3G2KA 1W36D 1M83A 1WABA 2BCEA 2EBWA 4UHBA 2HFKA 4GS5A 1GFSA 1RJGA 4ZODA 2LR0A 1GXSB 1BROA 3O7WA 4E5SA 3TW8B 3U6BA 4PAGA 2GJKA 1IB0A 2KJQA 1BMFA 2OV4A 4G5OA 2D7CA 4FNAA 4A6EA 3K1AA 5IJXA 4E21A 2P6UA 4MWBA 2WJYA 3HQ4O 4DT1A 1EK2A 4HQRA 5CBKA 3PX2A 1PZXA 3NDIA 4CLEA 1CQWA 2ZBEA 4QBFA 4D7AA 5A2GA 5K8TA 2HYIC 1JHDA 3JWPA 4AQYB 1L5NA 4WOKA 2BMDA 3C45A 3K92A 1ECGA 1U3UA 1ZOSA 2IZ6A 1RYFA 2W0MA 4IJMA 2O8FA 1LLCA 3CUYA 1G6OA 1HDXA 2CMGA 3AVPA 2X9QA 3G82C 4LV6A 3JQDA 1GAWA 5EE9A 3TLEA 2YHSA 4HRXA 3UWDA 5C51B 1N5KA 1HWYA 3LFHA 4JYPA 3ZU5A 4GMDA 2A86A 3FYHA 1J2YA 4WK0B 3UJ9A 3WXMA 3K0CC 2QB5A 4R71A 1DFIA 4TMXA 4XGRA 1NR7A 1OYWA 3TMKA 3T9AA 2QLJA 4R2MA 2ZIUB 3Q3CA 3UO8B 5JU6A 2YY6A 2WAXA 4L27A 1HYHA 4HLCA 5DNAA 4YP9A 4EKYA 5MHTA 1U02A 1M0SA 2B82A 3HXQA 2P78A 1JDZA 1ZIYA 3L1JA 2DQ4A 3GZJA 3OOWA 2QRZA 4L9AA 4KQ2A 5AXAA 3EOZA 2JGNA 3DTVA 2HJVA 3ZE7A 4R7GA 3ZQUA 2DETA 3CLSD 4Y2SA 1XDBA 2JLRA 2ZOSA 4JL6A 3RSOA 4BFSA 3PD1A 1KP9A 5REQA 1KH1A 5CLQA 4XWKA 3G8YA 4HDNA 4MWDA 3M34A 4GP7A 3MAJA 2XYVA 4CKCB 2X7HA 3VU1A 1ZH4A 3HABA 4TLLB 2DB3A 2CUTA 4C7OB 4B6JA 2KBEA 3HNOA 1C4XA 2L17A 4P6VF 1JT9A 3JVIA 3CISA 2H51A 3ROFA 5GVSA 1IBSA 4C0JA 3RF6A 2GBCA 3ACDA 5AFSA 5BVHB 4RNDB 1VKZA 4IDQA 4XPIA 3SQOA 1GPDG 1L8QA 4M7OA 3KPJA 1H0RA 1U7WA 2JGIA 2O5VA 4K03A 4ASUA 1L2TA 1BE8A 4DSTA 1E96A 1W0CA 3KSDO 4FXPA 1UT5A 4ME6A 2RHBA 4Y3UA 1DV2A 2ZULA 1IN5A 4KE9A 1JDBB 4F4JA 3LGSA 3JZIA 1IHYA 3RARA 3O8NA 4LOKA 3ROEA 1SZPA 3DUWA 4NJEA 2WTUA 2UZAA 3GY0A 2IZOA 4ZCQA 4R31A 3UB3A 5BSTA 3GAMA 4AJ1A 4B34A 1T9BA 4J0KA 1YS2X 3S1LA 2FSSA 2QNBA 3EBLA 1U4OA 1FNNA 3JYHA 2Q5CA 1TIKA 3K1TA 3U44B 3U7HB 3EEIA 2FN4A 4KC0A 2EFEB 2R48A 3TUIC 4DA8A 3EEBA 1N2BA 4P3KA 3G0OA 5JQGB 2DHCA 1H66A 2V65A 1RWMA 2PGOA 3IBYA 3PI6A 4LXQA 4FC6A 1LDMA 4XDGA 1IWBB 1DCTA 3NJRA 2HBYA 2CE7A 4O2BB 4I4TB 2IU0A 2PLAA 1ZHFA 4BV9A 5IS2A 5IJ0A 2P30A 2ZYAA 2R2GA 3CPJB 2A5DA 1EZ4A 2A3RA 1F5SA 2WHRA 4QTUB 4X44A 4WERA 3AZOA 4G01B 3G9TA 3Q5EA 1H5UA 3A3NA 3BXHA 3HFJA 4HNSA 4CPDA 3DL0A 4KRXA 1KK0A 1RXEA 3LBYA 4FHCA 4KUEA 4YP5A 5CFRA 4TKZA 3ROPA 3GLHA 2AD1A 4UNRA 2UZ4A 4ND4A 4OQNA 2QRLA 3FRJA 2O06A 3T5AA 3G7NA 1ODSA 1QKKA 2JFPA 4V39A 3AV0B 2NVOA 2OA0A 4DDUA 6GPBA 5IX8A 2JBWA 4AJ2A 5I8WA 3FVWA 2GAIA 2BM0A 2RH5A 2YFYA 4NX2A 4XYBA 4DQLA 2OE2A 3PUKA 3OZEA 1DARA 4LS3A 1EA7A 3KQHA 4OLJA 3IP7A 1U7DA 1H9AA 3KEFA 4F45A 2FMUA 3L0CA 4KN8A 1DTEA 3GV0A 1E3QA 2E4WA 1NM5A 3ZWAA 2V4ZA 1HDZA 3M6XA 4CUJA 2WSBA 4W8GA 4B3XA 1OYOA 4B3HA 4ND3A 4GIBA 3ICCA 4I66A 2DU8A 1N2GA 5AVYA 5JRDS 1XZBA 3B5IA 2AHRA 3EZGA 2D5IA 4KODA 1KZYC 3PC8C 3PDUA 2BBTA 3OPYB 1Z47A 3PA6A 3CSSA 5AIAA 2H5IA 5JZ9A 2FVXA 2P2GA 1BQ3A 4FFPA 4HTFB 4IDDA 1G8PA 2RCNA 3IURA 3FHOA 2LIPA 1O0CA 3S3TA 1W35A 3UM9A 3ZWKA 2M32A 5L3ZA 1ICEA 2VYFA 5DNWA 3TMAA 2BF4A 1EM8A 2H11A 3GFVA 1QLJA 1M2OA 1YCDA 4E6EA 4U2BA 1V25A 3D8UA 1CIPA 2GPSA 1XF9A 1C3VA 1EXMA 1E64A 3L3BA 2WIKA 2YYSA 4GR5A 5TPZA 3G7UA 1TQ4A 3VZCA 3DEYX 5KCMA 2FWPA 4JBLA 1VYUA 2OBLA 1KSGA 3SQXA 4NP6A 3HU1A 1TLLA 1V3TA 2SKEA 2ZUSA 1CLUA 5ELLA 3VVCA 3T1YB 3STYA 5EFZA 3UAZA 4WESB 4P08A 4PTYA 1PJZA 1M66A 4FGWA 4MAAA 4Q02A 3COPA 3FRIA 2VEOA 3PGKA 5EJMA 4D8VA 4DV4B 1THMA 4XASA 3WWPA 4FUQA 3GMSA 3O8OA 4PGGA 2BDEA 1X8KA 2JBHA 4C5AA 1XHEA 1YCGA 1E2JA 1G20B 3ETLA 4H7PA 4FGKA 4TOIA 3T41A 4KZKA 4R1TA 1K6MA 1XRMA 3W2TA 4S0XA 5IBPA 1GADO 3RSCA 1XK6A 4EFKA 5EJ5A 3BT7A 1LW7A 1H22A 3GGGA 3HZHA 3L01A 4MQFA 1GCUA 3VSCA 4OB6A 4MS4B 5BMOA 1GLNA 3DTTA 1II8A 3AL2A 5G40A 3WIEA 2DR0A 4LV8B 3GCZA 4A2QA 4TXNA 4ZHQB 3NT4A 1CPYA 5HE8A 4JI3B 2Y1WA 4CM8B 1ML3A 5EJGA 1HL7A 4JITA 5DSXA 3RIMA 4IEIA 3PYMA 4L76A 2CXTA 3BXOA 621PA 4G5FA 1E4EA 3FBTA 1ZGGA 3W2EA 4LV5B 3H13A 4M1WA 1MVNA 1KEKA 1V45E 1ZK0A 3W1VA 1RAGA 3ZHCA 3BXZA 4LKOA 1QNFA 1SBZA 1FQWA 2E1RA 2VJQA 1B0AA 1D8AA 3EDMA 3LQ4A 1HOXA 4EUFA 5JAOA 1PEDA 4OAOA 1JFRA 3QH4A 1HGXA 1J2TA 1DC4A 3QVLA 5HGXA 1ITZA 1DDGA 4Y2VA 4Z7NB 1F5NA 2YWXA 2D5BA 3OAAD 4INZA 4PSVA 2G36A 5D6OA 1RI3A 3AFHA 3QF4B 4UTNA 5IM4A 5GMOA 4NYJQ 1R37A 5LBTA 2PK3A 3DKRA 3KJIA 3DGFC 2DKFA 3VOAA 4C87A 1YZQA 1LRKA 1PX2A 1LDGA 1WTCA 3JASB 1HYEA 1YH3A 1PDWA 3HDYA 3KAJA 1X1CA 3INNA 2OR3A 1NW8A 1XXLA 1A2QA 1XO1A 2OO3A 3EVTA 3IDQA 3IO5A 4YRDA 3AVTA 1Q7GA 3GJ4A 5DPMA 4IFBA 3SS8A 1YZKA 3EF3A 4PG4A 2H4JA 2XNDA 4R7ZA 4J76A 1J7JA 4R6XA 5AJXA 3R76A 1VP9A 2Q4OA 4K1XA 4H4CA 2VG8A 3V1NA 1XK7A 1M1NB 2O8NA 3G13A 4MJ3A 2I76A 3PSAA 1JW9B 2YDXA 5FP0A 1H5QA 2IV2X 1CUXA 4N76A 3FROA 4FJ1A 1GARA 2EVWX 3F7TA 3FR8A 1DEKA 3R4VA 2JEZA 5BN5A 2PANA 3EXHC 3RS2A 1CP3A 4BTVA 5JALA 3HPQA 1BX0A 3FWNA 4TXMA 3O93A 5LQCA 6ABPA 2OEPA 1G5IA 3VXKA 4F6CA 1KI3A 4P3NA 3RCBA 2Q8QA 1G8SA 1QTIA 2PH7A 4JU8A 4CI9A 1W1UA 2WF7A 4MHOA 2IH5A 2FOLA 5FL7D 4R05A 5IK2A 1WOYA 4L85A 4H1WA 1N6HA 4YRRA 1GSHA 4YCBA 1JF8A 3QI7A 2Q5HA 5DTEA 3TKAA 4HQ6A 5IH3A 2KSQA 4H4DA 4TVKA 1FFHA 3JQ6A 4PYIA 4BNNA 2EATA 3REOA 3VUEA 1YIDA 1W4BA 3CO5A 4IDBA 2B6HA 2PD6A 2Z8XA 4JMLA 4UNNA 1Q84A 3GZNB 4BL5A 1G291 4RA9A 2CXNA 1FDOA 2A33A 4ITVA 3BF7A 4MK4A 4JUAA 3VKGA 4N18A 2ZAOA 2JVKA 3IOBA 2GAOA 3ILXA 5TVGA 3TW8A 2FR8A 1E2EA 5IUJC 3MSXA 1Q50A 4RKWA 4XDYA 3PPIA 1HKHA 5EXTA 3ZWNA 1J9EA 2Q9AA 2VYVD 4YMGA 1XKQA 8AT1A 3R09A 1IYZA 1PZGA 1RWWA 4AIIA 4GKKB 2WIGA 4P31A 1AUVA 2RBKA 2YWDA 4XX1A 1SC9A 4P4NA 2B9VA 2E21A 1VC2A 3H1FA 5LQNA 3A11A 2ERCA 2JJ2D 3RYCA 2DC1A 1LV7A 1JQDA 3RTDA 4QLBA 2UVPB 1XNRB 3PQDA 4FBGA 5H9WA 1OXTA 1Q77A 3LW7A 3MOGA 4IOKA 1NOKA 4PYOA 4YJHB 3U4QB 4P84A 1U8UA 3ZGLA 2C5LA 5T7BA 2R6ZA 1M9NA 1GZVA 5COBA 2XNJA 3ZCQA 2H5JA 2R62A 3JWEA 1QB7A 3OZ7A 2RHOA 3MXOA 4JWTA 5EEHA 1XRRA 4BQEA 1QHXA 2Y9MB 4CXMA 3PLAE 2IUFA 3SLGA 4JS0A 4FEGA 4KACA 3U09A 4MPPA 3O3OB 5LU9A 1FF9A 4XYEA 4LZAA 3UOAB 5CJPA 5AMXA 2Z1NA 1DKNA 3TZCA 4C0XA 1UBEA 3WDLA 5K20A 1E59A 1W5TA 4B47A 5DGCA 3H8JA 4ZQHA 1DC7A 5IKMA 3K70B 2ECOA 1U1GA 2JLAA 2LRHA 3BD8A 3ZWYA 2QGNA 4OO3A 1FZTA 1E3WB 3GJ8A 5ERYA 3A6DA 2WWYA 2ZVPX 1T10A 4IO1A 2VHZA 2FG5A 4GH5A 2AL7A 3QBJA 4BO7A 3AL0C 4C7OA 5KTKA 5CU7A 1NFRA 3UOWA 1PT5A 3GX1A 3IALA 4IICA 4AXXA 1WETA 3EIFA 2Z5VA 3DE7X 2AV6A 3IELA 2DKNA 4V0ME 4JELA 3A1NA 3L7OA 4BP1A 1ULZA 5JY6A 1QRSA 3SZUA 2C84A 5BVHA 4NJOA 3LPDA 2QDXA 4YLGA<