3OM9A

T. gondii bradyzoite-specific ldh (ldh1) in complex with nad and oxq
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
329
Chain Sequence
PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lactate dehydrogenase
publication title T.Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ
rcsb
source organism Toxoplasma gondii
total genus 111
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3om9A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3om9A02
1MP0A 1A72A 1DEHA 3RWBA 2G0TA 4CM4A 4CMAA 3MEQA 4K28A 4LSMA 4XQGA 2W2KB 3ANNA 2IE0A 3WYEA 4CM8B 1LDEA 1LLDA 3ZDFA 2G1UA 2DBRA 3E1KA 3PRJA 4XYLA 3GAFA 3MJTA 4JQCA 2FP4A 3WMXA 4CQMA 4D3SA 2FR8A 3LT1A 2O4CA 1DHTA 5L9AA 2HRZA 2JFGA 1JQBA 1MC5A 1FDTA 3GNTA 3BMNB 4YB8A 3ZWXA 2AXQA 4MVJI 5CDSA 3NEPX 4J0EA 4NK5A 3GNQA 1U3VA 4E5MA 1PGQA 3P19A 2DFDA 3DB2A 5HWSA 3PFFA 1EVJA 4CMHA 4HUJA 3DTTA 2RAFA 1Y7TA 4OQYA 3D5TA 3LLSA 4J1NA 3BIOA 3B20A 3KUXA 4IQ0A 3H9EO 4B79A 4CQMD 1A71A 4TROA 4BL5A 2YQ5A 2H9IA 2V6MA 3VVCA 3UVEA 4IDDA 4GQAA 4XYEA 4NBVA 3GA0A 2TMGA 5CEJA 2X9GA 3DOCA 3O9ZA 3GHYA 2C29D 2JAHA 1UH5A 4WK6A 1GQQA 2I5PO 2WSBA 4WJZA 3U5TA 1GTMA 4ZRMA 3EDMA 1Y6JA 3Q0EA 2NVBA 2E6UX 1UXGA 2PTGA 2D3TA 1FMCA 1H9AA 3JSAA 2Y93A 5T57A 1HWYA 2AE2A 3I9OA 5CP8A 3QWHA 4UEOA 2WJPA 2FSVA 3OA2A 3U4CA 5JAIA 1PL8A 4ONEA 3GVCA 3W4JA 1YB1A 2ZYAA 1VKOA 3IJPA 1ENZA 4O63O 4DUPA 4WUVA 2R00A 1PJBA 3ZWPA 3S2IA 3JQ7B 1B0AA 2Z1MA 5IDQA 3PVZA 5JDIC 4RQTA 2PY6A 1G1AA 4ZU3A 3BHIA 3HZZA 1LLQA 3SLKA 3WIDA 4GGOA 1GY8A 3PJDA 2G5CA 3DONA 5TX7A 1CDOA 3RC2A 4QO7A 3A14A 2NU9A 3D0OA 2H5LA 4AG3A 3I6IA 3WICA 4BQRA 4CMIB 3WNVA 4Z6KA 4YRBA 2ZTLA 3OIDA 1PL6A 4LSWA 4YAKA 1Z45A 1SEPA 1VJ1A 2PZJA 1GUYA 2TMDA 1WLYA 2IZZA 1RJWA 2VUTA 5KJ1A 4PLZA 1NQTA 1R0LA 3MOIA 5H83A 4O0LA 4CM1A 3I4FA 4YA6A 4URFA 5T6BA 1QMGA 3JQ8A 4YJGB 4QX6A 3ZWNA 3L07A 3UICA 2P4HX 1NWCA 3GEMA 4XRRA 2I67A 2IODA 4Y9DA 3TRIA 2JKVA 4J2OA 2VNSA 3FBGA 1QG6A 2WD7A 5KJFA 3B1FA 4NU6A 1LTHR 1T26A 1KETA 1ORRA 2G76A 3T4EA 4IINA 1E7SA 1IPFA 1VRWA 3H3FA 3CXRA 3VZPA 3VPHA 1P45A 3OHSX 2YFQA 1OOEA 2IZ0A 4LGVA 2XXJA 3TZHA 3L9WA 1Z6ZA 5JFOA 3JCZA 1ADBA 4R3WA 5I8WA 2PZMA 1YONA 3AUUA 1SOVA 3I9NA 5F1PA 5IDYA 4MVJM 1JU9A 5IFLA 1NTOA 1DXYA 1EE2A 4PG4A 3PYLA 3DBRA 1ZZEA 1ENPA 3MWEB 4U7WA 3JQCA 2J8ZA 3RBXA 3ZZNA 2VRBA 3N74A 4ZQGA 1Q0LA 1CQIA 2O4UX 2FWMX 3K73O 2OHXA 4Q3BA 2I76A 1HETA 2DAPA 2Q2WA 4Q39A 1IZ0A 4NNJA 1XLTA 3B1JA 3O38A 3GN1A 5FF9A 3UCXA 2HRBA 4R1NA 4OOEA 3Q2KA 2VZ0A 3SJ7A 2AE1A 4DREA 1NR7A 4C7JA 2RIRA 3PK0A 4OAQA 4YT5A 1A9YA 4RQUA 5CAEA 1LRLA 3CPSA 3OEYA 2FPGA 4DBZA 5ICMA 1Q0QA 3ZHBA 1E7RA 2X1HA 2Y1DA 1NFRA 4EBFA 3VKVA 1FDVA 1VSVA 4BNJA 3I9JA 5F1KA 5FFFA 4EJ0A 3DZFA 5HBRA 5I9MA 1U2DA 2YDYA 3LQFA 4XB1A 1IL0A 1O6ZA 2NACA 3ZU4A 3ON5A 4E33A 1EQ2A 3AU9A 3TZQA 5MGBA 2NTJA 3DHYA 5EN4A 3NYWA 2FZEA 2EF1A 1ZO8A 4G2NA 2VHWA 4C4OA 3ZCXA 3RKUA 3ROPA 1DFIA 1GZ4A 4ITUA 2X5OA 3FNEA 4JBGA 4JIGA 1TLTA 1WZEA 1KVUA 1BTOA 1HLDA 4A27A 4WNCA 2POQX 1NBOA 3H9GA 5JW6A 3W8DA 3H5NA 2A9FA 2ZYDA 4E3ZA 2E82A 1VPDA 4Y8VA 3PFWO 4BIIA 3F4LA 4RO0A 2EJVA 1VL0A 5THQA 4CM5A 2I66A 1I33A 1RKXA 2NM0A 1IZ9A 1HXHA 5A9RA 2RCYA 1I36A 2PR2A 4E2YA 4BO6A 1RM4A 3I1JA 3ENNA 3B1KA 3PHIA 4E5YA 3OECA 4BO4A 1HEUA 2CVZA 1Y81A 3TZ6A 2P5YA 1LNQA 2P9EA 4F3YA 3HSKA 4Y6SA 3BA1A 4CLHA 3H5AA 4WECA 4F45A 1LQTA 3BMCB 1XQ1A 2JD1A 4KDEA 4C7KA 1LUAA 3CZRA 1RWBA 1HYGA 4GH5A 2BGMA 4BNKA 3UHAA 5JMWA 3PWKA 3LSYA 3Q3CA 3AU8A 3FSRA 3QA9A 5DBGA 5F21A 1PX0A 2H63A 4KP7A 4NBRA 4U0JA 4E30A 4GSLA 1AHHA 2CNBA 1ENOA 4DXHA 4GBJA 2B0JA 1H94A 1NM5A 3PJEA 3OJLA 4DPLA 1TEHA 5IDWA 2OMEA 5ES3A 3IC5A 2Q45A 8ADHA 5ITVA 3C7AA 4EEZA 3FI9A 1PSDA 4ND1A 2HDHA 4O6VA 2V6FA 4EW6A 4NR0A 3LC1O 3QV1A 4UULA 3HJAA 4NBWA 4ND2A 1YOVA 5JMPA 3BTSA 4LRSB 4R51A 3IKVA 4CM7A 2HMUA 2NWQA 4JLWA 1NWHA 3ZHXA 5CPBA 4D44A 4GKVA 4CL3A 3QVXA 2RHRA 1PR9A 3ULKA 1L7EA 4MO2A 1QKIA 2H1SA 1BWSA 3DZIA 1EDZA 4D3DA 3GZ4A 1BW9B 2AQIA 3KYBA 1GUZA 2YZ7A 3AWDA 1EBFA 4OHUA 2DKNA 1WP4A 3VVBA 5L7YA 4NU5A 3NKLA 1GD1O 4YJFB 1AE1A 1R4MB 3G3EA 4I5FA 3ZWCA 4EDFA 3NRCA 1I3MA 4FOOA 2OOSA 3ZWAA 4E6PA 1EE9A 3JYLA 3ETEA 5A9TA 5KJ6A 5DOVA 3WX0A 3U4DA 3VPFA 3V5NA 3U09A 1Y9AA 2YV1A 2BHLA 1NQAO 2FR0A 2DTDA 2NUAA 1P31A 1ZH8A 4FPXA 1UXJA 2WM3A 1QYDA 3DZBA 2V6GA 3GNSA 5A5EA 4CLOB 2V65A 2I99A 3F5QA 2EGGA 4WLOA 2JCXA 2OGUA 2VWHA 1GQ2A 5DP1A 4DRYA 1FXSA 4MKRA 2VOJA 4TWRA 4UVEA 1DIRA 2X8LA 4FD3A 4TZTA 3TJRA 3HADA 4A26A 1BDBA 1U7TA 1DRVA 3FNHA 2Y0EA 1HF3A 1DRUA 3DBLA 2FZWA 1Q7GA 1WDKA 4TRRA 2YY7A 3PDJA 2QZZA 1R4NB 3A4VA 3ONDA 4GVLA 2C82A 9LDTA 4DIBA 1LDNA 2HK7A 5CEEA 4BO9A 1M2WA 1LJ8A 3NTOA 1V8BA 2EP5A 2IXAA 2EW8A 3I83A 5K6AA 1Z7BA 3QSGA 3JYNA 1SB9A 3CMMA 4M54A 1K5HA 3ZN2A 3I9MA 4HFNA 1JWBB 4TVBA 2HLPA 4R41A 2AQHA 2NVUB 2Y66A 1CEQA 1GPDG 4EI2A 1QORA 4J4HA 4PZEA 4QO8A 1C0LA 3KEQA 3OIFA 3H8VA 4P4NA 3DZKA 1Y8QB 1ZK3A 3KHUA 3L77A 3N58A 4UVDA 1MA0A 5A3JA 4NFSA 4OOFA 2W90A 4KTVE 5L4SA 1NHWA 4WLVA 1RM3A 1MV8A 1NXQA 4MIEA 2X23A 2I3AA 3H5RA 1I3LA 5AVOA 4B3HA 1PZEA 1Y8RA 1JA9A 3DO5A 2FY8A 4FIZA 2R6JA 4WEOA 1QRRA 2VTEA 4IDCA 3VKUA 1D7OA 1EVYA 1M75A 3LDHA 5L7WA 4ZQBA 3DFZA 4M8SA 3DWFA 4CL8A 1H6AA 3JQFC 3V2HA 5BSEA 1Y9EA 3RKRA 1IOLA 1Y1PA 3OMLA 2YHUA 3H9JA 2W8ZA 1L1FA 1T2FA 4BKUA 4CM9A 4BNMA 1D4FA 4RVGA 2RHCA 3ZV5A 3QE3A 1GCUA 4XRGA 2VHYA 1J0XO 1U4SA 4JJGA 3K96A 2O2YA 3IL2A 3KSUA 3HNPA 4YQYA 4E2ZA 2HMWA 1F06A 1NNUA 4DQXA 1HTBA 1NP3A 2X5JO 1O8CA 4RF3A 5B4UA 2ZTUA 1HKUA 1GYPA 4CUJA 3FN4A 4LMPA 4Z0TA 4AJHA 4YRDA 4E13A 5JC1A 4X54A 3H9QA 4PFJA 3GT0A 4ALKA 2AA3A 1V0JA 4L8VA 4D46A 3S1LA 1YVEI 1B3RA 3PLNA 2GCGA 1JWAB 1NVGA 3QVWA 5JCJA 3FNGA 2GZ2A 1EDOA 4CM9D 4Z3DA 1WZIA 3DMTA 4KZPA 4LVCA 3GUCA 3UN1A 3M6IA 4FDAA 2WD8A 4XJTA 5KKAA 3IUPA 4TKMA 2IXBA 2PWZA 4R54A 1DFHA 1HLPA 1C14A 1YJQA 3ZWVA 2WEKA 3WS7A 4J91A 1QYXA 2B69A 2X0JA 2BF7A 1HDOA 4MKXA 1XU7A 1QR6A 3RFXA 4Z9XA 5A05A 1B26A 2BFOA 5DDIP 5ILOA 5HM8A 1I3NA 4MVJP 5ER9A 4UVGA 2Y1FA 3H65A 4IGEA 1YB5A 3B6ZA 3LVFO 3AI3A 1ARZA 2IZ1A 3AY6A 5IXSA 1KEVA 3Q11A 4D45A 5T8KA 1HE5A 2NNLD 1Z75A 2O3RA 4H16A 5TGDA 4B4VA 3O26A 2GLXA 2QZ9A 4ZRNA 1VSUA 4NI5A 4ALMA 1T1RA 3OBBA 1U4OA 2BH9A 3DAFA 3WJAA 3SBOA 5I7VA 4G5HA 4XYBA 1HSOA 4FSHA 2HMSA 3WLEA 1HL3A 1SEVA 3V2GA 4CMKA 4YT4A 1R66A 4II2A 3ROQA 5L7TA 3KOUA 1NVTA 4TVOA 4RF4A 2NU8A 1MXHA 3FRJA 1PS9A 4ROSA 4FJ2A 3EHEA 1T2DA 3E5MA 2XAAA 2JAPA 4TRMA 3WGHA 5LCXA 3C7DB 2WYUA 3KYDB 4JP3A 1P1JA 1N9GA 4CPDA 4D42A 4YT8A 1J4AA 1E7WA 2VWPA 3ETGA 2DBQA 3PZBA 3RVDA 4OM8A 1VM6A 2ILTA 5BNFA 4DPMA 2EG9A 5CG1A 2RH4A 4J2HA 4RVUA 1PGJA 4NBUA 4P4GA 3G0OA 3ZV4A 3ZWYA 5JO0A 4R3NA 5C5IA 3RQSA 3KETA 3FNFA 5GZ3A 4IUYA 1N92A 2GN9A 3OJ0A 1JDJA 1NFFA 1D1TA 3GH3A 5F5NA 2UYYA 2Y0CA 4NZ9A 1TI7A 4XZ3A 3UAGA 5GMOA 1I30A 3K2BA 1PJTA 5JAMA 1Q2XA 5ILGA 4BO0A 5B1YA 4CLRB 4LISA 1UAGA 1W8DA 4HP8A 2X9VA 5HA5A 1ZJYA 4I08A 4J4BA 3TQHA 3WTCA 2O3JA 2HKIA 3KSDO 4IMRA 3BMQA 5DT9A 1WPQA 3RC1A 3K6JA 3KO8A 3P7MA 4E5KA 4HV4A 4N5MA 3VZRA 1W4ZA 5AXDA 1N7HA 1LRKA 4NBTA 4YAIA 4YEDA 1XA0A 3O8QB 4NJOA 2QG4A 4UVHA 2GERA 3WSWA 1H0KA 5CEFA 1DDOA 4GX1A 3UOGA 3U0BA 3A06A 5BSHA 4BNHA 1E92A 2EKQA 3ADPA 3E9QA 3GVIA 3JQAA 4FOSA 3TZCA 1LDBA 3TF5A 3ASUA 1E6UA 2Y1OA 2GF2A 3TZKA 5B4TA 3B70A 3IAHA 4NG5A 4XX0A 3E5RA 1KVSA 2VT2A 5BNIA 4EITA 2HJRA 4B4WA 1KEWA 3EK2A 4K1LA 3WLFA 3C24A 3NJ4A 3OSUA 5TJHA 1I24A 4MIOA 2VHVA 4FQ8A 3P2OA 3VZQA 1K3TA 1DIBA 2ZQZA 4J7UA 3W8EA 4IDGA 1N7GA 3FR8A 2PLAA 2JD0A 2YJZA 4B7CA 5KVCA 5COAA 4CODB 2Y1GA 1IB6A 4LK3A 5G4KA 5KVSA 1EK6A 3JQAD 2IYOA 3ZV3A 1GYQA 1ZK0A 3NTQA 2FMUA 4DYVA 4KQXA 1UXIA 3D3WA 3L4BA 1ZW1A 1EZ4A 3LLVA 5G2OA 3EAGA 1XHLA 3IJRA 2BFMA 1GZ6A 2R2GA 3BZUA 3DXFA 1EUDA 3RROA 4CQLB 3UGKA 4WCFA 1Y5MA 1GYRA 5CDUA 4BB6A 3QLJA 2D59A 5KVQA 4R68A 5DCUA 2P4QA 4RDIA 3AW9A 4CLDA 3HN2A 1C1XB 4F46A 2VCYA 1T4BA 1BXGB 2C2YA 2YHIA 2CFCA 4BNVA 4IXWA 4E0BA 5C7LO 4RF2A 1ZK2A 4S1VA 3GFBA 3RU7A 4BOYA 2F00A 3P5SA 3EW7A 1CJCA 3UXYA 1X13A 5T67A 3CE6A 3GZNA 3LYLA 1DIAA 4L0QA 2AEMA 2OL4A 1FF9A 3GN2A 2Q50A 2O7QA 2QIOA 4W6ZA 3ZGYA 1ZSVA 3TWOA 1BXZA 4QECA 1AUPA 5IZCA 3HG7A 1TB4A 4HY3A 4KWHA 3MCVA 1KIFA 4QFDA 4DYDA 4PCVA 1E1LA 1I2BA 3QQPA 3OQBA 4DQUA 3WGYA 2ZB7A 1MGOA 1T1SA 9LDBA 4I5DA 1QLHA 5A03A 4GSKA 1A4IA 4W9NA 2HAEA 1I32A 5F5LA 2JHFA 1K2WA 5JDCA 4AICA 1UP7A 2B83A 3WGQA 4AJLA 4CMGA 1OC2A 4BS9A 3UUWA 4N5LA 1ADCA 1O0SA 5B37A 2P2SA 4BNYA 3E82A 5COQA 4BUCA 3OETA 4BQPA 3ZNQA 2B4RO 1JKFA 3GLQA 4KUHA 4BGIA 4B4OA 1CIVA 2DT5A 2Y1CA 1U5CA 4XKJA 3WR5A 3U3XA 5L4NA 1NAHA 4BO7A 4AJ1A 4NPCA 1A7AA 1HT0A 4WOKA 3AOGA 5KKCA 2FSSA 3GUYA 4TRNA 1YDEA 1GCOA 3DZHA 2Q1TA 3EY4A 1EVZA 1E3WA 3A9WA 3K92A 3O4RA 1DLIA 1LA2A 4GX5A 1E7QA 4MKZA 4PZCA 2AEJA 1B2LA 3WMWA 2PK3A 5EERA 3RJ9A 1E6EA 1N8KA 3RASA 5A9SB 4D3FA 3F6YA 4FFLA 3WSVA 3DC2A 2A35A 3PZRA 4XYMA 2DM6A 2R00C 5L40A 1GEGA 1VJTA 4ESOA 4FN4A 4WLFA 4UUOA 3WBBA 1KVRA 2CY0A 3STHA 2UDPA 3G17A 3S55A 1PJ4A 1J5PA 3CIFA 1Y5RA 2AG8A 1P74A 1H5QA 1LC3A 4DLAA 4BO8A 1G6KA 1KBZA 1P0FA 2XPCA 3NTRA 1HDZA 4FBGA 2RBEA 5BSGA 4DTIA 3O03A 4YBZA 3JQ9A 4TQGA 4AFNA 1YJ8A 2UV8A 3VH3A 2VHXA 1JKJA 4WLUA 2ZB4A 3I9LA 1E3LA 2Y67A 1BRMA 1YL6A 3NDIA 3M2TA 4J49A 2GD1O 3ANMA 4YACA 3DBVO 4OGWA 1XKQA 1TT5B 2BGLA 2CMDA 2GR9A 1OZAA 5JPIA 3QVTA 1D3AA 1Q7BA 3PHHA 4P38A 3TOXA 3ZWOA 4P4LA 2ZYGA 4EUFA 5G4LA 1C0KA 3AY7A 5A5FA 3FPLA 2ZB3A 4JCOA 1UJMA 2PA3A 4YPOA 3GK3A 2Q4EA 3FF4A 1MC4A 1JN0A 4IDEA 3D7LA 3PHGA 5COBA 4PLTA 3ORFA 1T4DA 2P68A 3KXDA 4WCDA 1PQPA 3I5MA 1BXKA 3QWBA 1T24A 4AJIA 1YGYA 1SC6A 1DHRA 3ASVA 3VZSA 4Q3DA 4CJXA 2X6TA 2BD0A 3QIVA 4MVJH 3PWZA 1XCBA 2PGJA 1QLJA 2GNAA 3GOHA 4FCCA 2HMVA 1DC6A 3QWIA 3DBHA 4YJHA 2UUPA 2EGHA 1LBEA 5EL0A 3ANLA 4K26A 5G0VA 4DLLA 7MDHA 4FFOA 4ZN6A 4DC0A 1GFSA 2NADA 4CUKA 3LF2A 1I8TA 1MG0A 1YKFA 4R9SA 2W98A 4XIJA 2IYPA 3RI3A 1LEHA 2W4QA 3TPCA 5JY1A 1ZXLA 2I65A 1WAMA 1PL7A 1XQ6A 5I8ZA 4BNFA 1ID1A 2BGKA 4DQVA 2LDBA 5KVVA 3WGIA 3WB9A 3KTDA 4A73A 2DU8A 1YXMA 4PLYA 4RPLA 1MFPA 2Q46A 4IGFA 3ZH2A 3HFSA 4B4UA 2BKAA 1GU7A 1GR0A 4W7HA 3NJ8A 3Q9NA 4XDZA 3FR7A 4A5OA 1ZEJA 1HSZA 2OP0A 4FFPA 4I9NA 2B36A 2X86A 2CZCA 3INGA 4CM4B 3KBOA 3V1TC 2EERA 3I3OA 4QEDA 4QSMA 1MUUA 3JQEA 3IP1A 4GGPA 1LLCA 1YQDA 3BHMA 4OSPA 4L4SA 4B7XA 3DAPA 3K5PA 4CQMB 5L45A 1LSJA 1BVRA 4AJJA 3UCFA 2OFPA 1R37A 3CMCO 3PQDA 1RM5A 3TSCA 3LT0A 4OJNA 1GV0A 3ZNPA 2UUOA 4BHTA 5H81A 1LSSA 2G82A 1AGNA 4JBHA 1YL7A 5HS4A 1LSUA 3EZYA 1U3WA 4ZJUA 2YDXA 5CPFA 5EESA 4B8ZA 3RUCA 3UFXA 3DEYX 2J3HA 1TXGA 3GVPA 3CH6A 3RAJA 4ALNA 5FI5A 4GKBA 4XGIA 1HDGO 4HFJA 4IDAA 5TRTA 3I9KA 1GQYA 5TSDA 1SCUA 2VRCA 3V1YA 4MPDA 4CMBA 4GX2A 2CVOA 1LDGA 1OMOA 3ZWBA 1M67A 1EUZA 3GR6A 3INRA 4J4TA 3RUFA 1PWXA 3VPSA 1T2EA 4W82A 3GGOA 4BO3A 4E5NA 5AQ1A 4PG6A 2NVWA 1M66A 4UVIA 1ZJZA 1EMDA 1A27A 4Y67A 1GUFA 1YE3A 1I10A 3KVOA 4PIVA 1PJ2A 4PRLA 2VRCD 4PG8A 4FJ1A 4F6CA 1GAEO 4HFMA 4L4XA 1SNYA 4OH1A 3MZ0A 4W99A 4KMSA 5C7IO 2HCTA 2J3JA 4XEHA 5GZ1A 4PVDA 1KVTA 1WXDA 1LC0A 1C3VA 3PGJA 3PEFA 4ZQHA 3WDSA 3I52A 4Q3EA 1HYEA 2ZCUA 4W7IA 3RUEA 1NFQA 5BSFA 2WTBA 2VYVD 3UCEA 3E9MA 4MP8A 1KC3A 4J0FA 1ZK1A 4BVAA 3MJEA 5L4LA 2LDXA 1EBUA 2E4AA 3CUKA 2PD6A 1PWZA 1QV6A 1X1EA 2YYYA 3ZU2A 2Q1UA 4IIVA 3K30A 2FRDA 2CDAA 1LSOA 1B8PA 1DC3A 4AJ4A 2Y05A 4A7PA 1P9LA 1V9LA 2WYVA 3DOJA 4MVJG 3A1NA 3C3XA 5JSFA 3MTGA 3D4NA 3JQ8B 1B15A 4IM7A 3IQDB 4WE3A 4JGBA 5LDHA 3LC7O 3JD4A 4L76A 2V6BA 1UP4A 1V35A 1TT7A 4LMRA 4OYRA 4EGFA 2IEDA 2SCUA 2HK8A 5THKA 5LC1A 1F17A 3KYCA 2WD7B 4XGKA 4TRJA 4BO1A 2Q2VA 4JK3A 2VZ9A 4NFYA 3GVXA 1I5RA 2J3KA 1HDCA 3W8FA 1JLLA 2C59A 4PLCA 2GO1A 2WWRA 1UDAA 4A10A 1ISIA 3R0IA 5TJ9A 3VDRA 4BGUA 3O8QA 4MVJE 1VKNA 1CYDA 2B37A 1CERA 2VQ3A 3OF2A 4XR9A 4Z0PA 2DPHA 1OFGA 4PG5A 3MWDB 4OKIA 3HN7A 3ROMA 1TA4A 1QP8A 5CDTA 4R1TA 1ULUA 3DBRB 3U4IA 4WLEA 1R15A 3PWSA 3SJUA 5A3VA 2Q2QA 5DNAA 3AJRA 1OC4A 1ZNQO 2WYWA 3NT4A 3PYMA 3IUSA 4Q3NA 3BMOA 4D79A 2NLOA 2NQTA 3AM4A 4M49A 2Q3EA 1YS4A 2DUWA 1H2BA 4FFNA 4I8XA 4PLGA 4QT0A 1DJQA 6ADHA 3RUIA 1U3UA 3GVHA 4XQEA 1LDMA 5DP2A 1B7GO 3GHHA 3JQGB 3JD3A 5KNLA 1B16A 2IEBA 2W2KA 2AEFA 4CM8A 2CF6A 5ICSA 4XB2A 5K6AC 1SOWA 5C37A 4ZD6A 1SAYA 3QVOA 4GMFA 4E31A 3M2PA 3PPIA 2PD3A 1UUFA 4ND4A 4RGBA 5A1TA 5IN4A 3HE3A 2GN4A 3E8XA 1ZCJA 2PKQP 5G0UA 1P1HA 3BMNA 3RC7A 1P3DA 1PJSA 4D43A 5TLSA 2JHGA 2EWMA 4Q9NA 1DO8A 3LU1A 3GPDG 4CV2A 4J6FA 4M89A 4BV9A 4PLWA 4WPGA 3BXXA 3GDFA 4BKOA 2ZB8A 2PGLA 2VUSA 1PQUA 1E3SA 3I23A 4UEKA 4ZQEA 5TT0A 4L4RA 3K2EA 1MX3A 4A03A 3AOEA 4YYZA 3QW2A 4P8RA 2ZTMA 4TSKA 2O7SA 4IXTA 4CV3A 1H6CA 5EJ2A 2IRWA 2DFVA 1S6YA 5ITWA 2Q4BA 4MJLA 3L4SO 3PHLA 1A5ZA 3LT4A 4I9HA 4IJVA 1NQOA 3JQBA 3RBZA 1RM0A 3INTA 2B4TO 1H6BA 4MIYA 2DVMA 3BTVA 4U0KA 4XDYA 2Y68A 3DL2A 3ITDA 1OI7A 1PR3A 4IBOA 2O2SA 3N7UA 3ZU3A 4CMEA 1HYHA 3V8BA 1DB3A 4R5MA 1R12A 4ALJA 4UUNA 2NU7A 4M86A 3ADOA 3G49A 4KDFA 4RPJA 2YV2A 1I2ZA 4AJOA 3ETDA 4RORA 5CDYA 1F8FA 1N1GA 1P1KA 1UP6A 2ZIZA 3C7CB 5DCYA 4EEXA 2D5CA 3AOEC 5ADHA 2O3SA 1DOHA 3GPIA 3C1TA 3KEOA 3DDNA 3JQ7A 4WEQA 3VDQA 2EKLA 3E48A 3U9LA 4MP3A 3WBFA 1DAPA 2BLLA 1JTVA 1E5QA 2JFHA 3GAZA 1ONPA 3F3SA 4Y6RA 3WFIA 1NQ5A 3JQBC 3DMTC 1EK5A 4N18A 1E1KA 1W73A 4IZIA 3IOYA 2GZ3A 2VYNA 3SLGA 1P1FA 1W6UA 1NAIA 1SPXA 1WW8A 2BFPA 4CMIA 2NU6A 5U9CA 1BSVA 1CF2O 3BAZA 2BFAA 3WJ7A 5G0WA 4Z9FA 1PTJA 4BNWA 3PTZA 2C07A 2X0RA 4FGSA 3W1VA 4RF5A 1ONOA 2B4QA 3AFMA 4J9UE 1E77A 3GG9A 4TZKA 1YOVB 3DZJA 5DBIA 2A4KA 4IJWA 3W6ZA 3VPXA 2I3GA 3WGGA 5KTKA 2X0IA 7ADHA 3GGPA 2ZK7A 4YVFA 4U8GA 4JJIA 4YJGA 5JLAA 1YWGO 4LW8A 2PZLA 2VYND 5AXAA 3RUHA 3FCOA 4R69A 3PLRA 1K0UA 3FPCA 2GRAA 2C20A 5T8KC 4LVUA 4NMHA 1C0IA 3IS3A 1M6WA 1IPEA 3CKYA 3WYBA 1DLJA 1YO6A 3ZV6A 1UDBA 4HWKA 3C1OA 1KVQA 4GAEA 1Q7CA 4BNNA 2EP7A 2C7GA 2PKRA 2GZ1A 3E6AA 2PGDA 3Q6IA 1ZK4A 4KWIA 4RVHA 4CR6A 3F4BA 4PGFA 1UZNA 1OAAA 5GZ6A 3AUAA 2Q1WA 2YV3A 4XA8A 3PGXA 5DZSA 4MVJF 3OQ1A 1ENYA 1TT5A 4YAEA 4M87A 1ISGA 4KUGA 2J5KA 3KSZO 2ZJ0A 1X14A 4GPD1 4L9RA 2OXIA 4E4YA 1EQUA 4GI2A 3VH4A 5EQDA 1PGPA 3K8ZA 3EVTA 4DLBA 4RVFA 3HHPA 2AHRA 2QQ5A 3ST7A 3SX2A 3HUDA 2JJYA 5EPOA 2FN7A 4JN6B 1A4UA 2GN8A 1WMAA 5JO9A 3WIEA 2UAGA 4MP6A 3WGZA 5FEUA 1F8GA 3TFOA 4DMLA 3Q1LA 4RJTA 3WNQA 3WFJA 5EQFA 2EKPA 4ZVVA 4ILKA 4YR9A 3NGLA 4I1IA 1YQXA 4EUEA 2C7VA 3DBLB 3DMYA 3JYOA 4O1MA 5GY7A 1PEDA 1U5AA 1CETA 3VOSA 5A02A 2P5UA 5EMHA 4AVYA 4OXNA 3JD0A 3PJFA 1XWFA 3NGXA 1B8VA 1JKIA 3D64A 4B8WA 3OIGA 4J90A 5K9ZA 3RCBA 4CMJA 4CV1A 2WDZA 3OQ6A 3F5SA 4IJKA 4NJMB 3RC9A 1MXFA 5JC8A 3M1LA 1HE2A 3PQFA 4LN1A 2O48X 3D4OA 1IHYA 2EEZA 3FBTA 4GVXA 3S2FA 4D0RA 3GY0A 1UR5A 4IMPA 1ZXBA 3UF0A 4Q3AA 1ADGA 1NASA 4YCAA 1E3EA 5JYDA 1XEAA 4IIUA 4PN3A 4EUHA 4JXKA 4DBVO 5J23A 4OIMA 2FHSA 2CVQA 3G1TA 2I9PA 5MDHA 2O50A 4PZDA 1R6DA 1K6IA 1KEUA 4J9VA 3ZHZA 1T25A 1FDWA 3EGOA 2NTVA 1VC2A 4RZIA 1Y8RB 3ZI0A 4BNIA 3S2EA 3ONFA 2OUIA 3IIEA 4EJ6A 4E32A 4RPKA 4YRAA 4XGNA 2D8AA 4N7RA 5CHEA 3WXBA 4OKNA 1R16A 3PYXA 2QW8A 3GGGA 1GDHA 4XJSA 1U7HA 1KY5A 2O3UA 1P1RA 2GN6A 4K6FA 3JYQA 1ZMOA 3H6KA 2Q99A 3RSHA 2BI8A 1DBVO 4K9DA 2O3TA 5I7FA 3RFVA 1J49A 3BMCA 4IJUA 1IUKA 2X9NA 3GMSA 2DC1A 2PH3A 5U1PA 4FW8A 2E37A 4AJKA 3HQ4O 1XG5A 1AXGA 4N54A 3L4BC 3GRKA 2B5VA 4F6LA 3IDSA 3WTBA 2UVDA 5FI3A 2QRJA 3DHNA 3DQPA 2DTXA 3KLPX 2D0IA 3U49A 3E9NA 5KJEA 1ADFA 2JFFA 2J6IA 4WCFC 4UEJA 4NH4A 1UZLA 5TIIA 1KERA 1P77A 2HO5A 1Z7EA 4J7XA 3I4CA 1AHIA 2C0CA 5G0SA 1LI4A 2HUNA 3C1AA 3GDOA 1YDWA 3G1UA 4AJPA 4YDRA 1GL3A 3BYZA 2CDCA 5JDIA 2HK9A 3QHAA 4YAGA 4DPKA 2C2XA 5TC4A 3Q2IA 3IP3A 2AG5A 4ND5A 1X7DA 4BB5A 4L74A 1BHSA 1BGVA 1I0ZA 1A9ZA 1B3BA 4MINA 3GQVA 3ZWMA 4NDNE 3KRTA 1EUCA 1D1SA 1PGNA 2YUTA 1U9JA 3F9IA 1HE3A 2NTNA 4B7UA 5IZCC 5I9LA 2Y99A 2HU2A 2FPPA 1E5LA 1SO8A 4ND3A 3OA0A 3R6DA 1LRJA 2GSDA 3L6DA 1PGOA 1KOLA 4W9NC 3BTOA 5BQFA 5FYDA 2AQKA 1DIHA 2BI7A 2VNAA 2FOIA 5JAQA 5JDCC 3VPGA 4EJMA 1BW9A 2GPTA 1FDUA 1P44A 2P91A 1G0NA 1F12A 3DAGA 2IDZA 1EFKA 4NK4A 2PH5A 1YBVA 1IY8A 1ISMA 4YJFA 1R4MA 5L53A 1F0YA 4RDHA 4Z0HO 4E2XA 2GDZA 2GUGA 2X0NA 5BT9A 4LCEA 3H9UA 3WQSB 3D1LA 5B12A 3HDJA 1UDCA 4YJDA 1NX6A 3UW3A 3C85A 3X2FA 1E3JA 3PI7A 1C0PA 1UXHA 4OXYA 4PRKA 1CRWG 3VH1A 3JD2A 1ISFA 4JP2A 1C1DB 3RUDA 4FB5A 2O23A 1N9GB 4NIMA 1V3UA 4P22A 5L51A 4CLOA 4U5QA 4BKPA 4CMCA 4J7CA 4E2WA 1PU2A 4D0SA 4DIOA 1WDMA 1V3TA 4OO3A 5IJZA 4NHEA 4CLXA 2PNFA 5EINA 1N5DA 1EEHA 1HZJA 1M76A 3OJEA 5AXBA 5BNTA 1JAXA 1R4NA 4FJ0A 4J3FA 3OICA 4UUPA 1ZSNA 2Y1EA 1ZKMA 3LC2O 3CINA 1R0SA 3S8MA 4ZGWA 1OBFO 3OH8A 3JQ9C 2D5AA 3HWRA 3TOZA 5K0ZA 3OEWA 3LF1A 3OJOA 3NV9A 1WWKA 5HS6A 3MOGA 4NQZA 2NVUA 3EUWA 1ZMTA 3VH2A 3BMQB 4IDFA 3HB5X 3WG9A 2ZKLA 1H2HA 3PQEA 5KCZA 2X22A 3WQRA 2AMFA 3MJ4A 3MJSA 3CSDA 1Y8QA 2EIHA 3W6UA 4IQ8A 4BMVA 1F14A 4XYGA 2VWGA 2ZQYA 1Z74A 1ZSYA 2JD2A 5KJCA 5IF3A 4RV9A 1FJHA 1VJ0A 2YFHA 1X7GA 3NT5A 5U4QA 3BTUA 5AOVA 3HDHA 3JQAB 3JQGA 4INAA 2G17A 1JVBA 2O3QA 3QWFA 4HKTA 4UAGA 4ZHSA 3C8MA 2X4GA 3CTMA 1X0VA 2OP1A 5IXYA 2GASA 3A28A 1XU9A 4I5EA 1WMBA 2P9GA 2ZCVA 2J5QA 1NPDA 4ID9A 3LT2A 2Q1SA 3BHJA 3GDGA 4R1UA 1LDYA 3TNLA 4JJFA 1LQUA 2NSDA 3PDUA 2CDBA 4XR4A 1T2AA 5G4KB 5IN5A 1W0CA 2Z1NA 5TS3A 1E6WA 1QYWA 2A94A 2DQ4A 3T7EA 4MVJA 3E03A 4BGEA 4HX5A 3D3WB 3MTJA 4YWJA 4QTZA 3D3EA 1QXSA 3JTMA 1ZEMA 2VUUA 3H7AA 5IAAA 4R01A 1IHXA 2AQ8A 4AL4A 4RPHA 4HADA 4WCFB 4U6SA 4BV8A 4PVCA 1GADO 5DBFA 3ZNNA 1ZIDA 4A2CA 1BMDA 4J1TA 1YRLA 2HMTA 5I7EA 2CD9A 2YHIB 4MVJD 2YQ4A 3EZLA 1EFLA 3GG2A 3JYPA 4FFMA 1NR1A 5L3ZA 3PIDA 3TDKA 4FC6A 3IKTA 4XCVA 3AUSA 4IY1A 1H93A 1PJLA 1CQJA 4JROA 4RL6A 4TKLA 1PIWA 1R0KA 1E3IA 1ONNA 1VI2A 4R16A 5ENDA 2GYYA 3ZW9A 3V2UA 1LXCA 4PLVA 3GZNB 1ML3A 3OJFA 2Z5LA 4IQGA 5ER6A 3PXXA 4J1SA 5JAZA 1HZZA 1BVUA 1QYCA 2Z95A 4I9UA 4WLNA 2OZPA 1WVGA 2HSDA 1U2GA 4RVSA 2VYVA 3OM9A 5H82A 3EVNA 3KV3O 1XSEA 4RZHA 4DMMA 4H7PA 4KOAA 4QFCA 1RPNA 1SZJG 3SEFA 4H15A 3KM0A 4YT2A 3GEGA 3T7CA 4IS2A 1BDMA 5C7OO 4GX0A 2BMAA 3EYWA 3G79A 3F46A 5KWEA 1VE9A 4CUZA 4FFRA 4DIFA 3JQ6A 1X1TA 1X7HA 3H2SA 1N2SA 4PLHA 1GV1A 1LLUA 3K31A 2PKQO 5JBIA 1U8XX 1U3TA 3RBVA 3P2YA 4DA9A 2D2IA 4W4TA 1VL6A 4WOJA 2X7HA 2RH8A 3KYDA 1QV7A 4YXFA 1MB4A 2CF5A 1RYEA 1E3WB 3FD8A 4HNGA 4HXYA 8LDHA 2ZTVA 3K9QO 2PZKA 1HDRA 4OQZA 4XQCA 5JXWA 3H3JA 4E5PA 4FR5A 3E18A 3GMDA 1K89A 3ZHYA 3VTFA 4EYEA 1LX6A 1NPTO 4XIYA 3HFGA 2OBYA 3W4IA 3FTPA 3FWZA 3L9XA 4PLFA 3L0DA 1EVIA 1NPYA 1ULSA 1SMKA 3L6OO 4BMNA 3F1KA 4BNXA 4CLRA 3MJCA 3RU9A 4XQ9A 2XF8A 1UAYA 5ENVA 4UUMA 4XWYA 3LZ6A 3RJ5A 3Q9UA 3TFQA 4BNZA 1Z73A 4ZA2A 3ZNOA 4J1QA 3ZW8A 2DLDA 4JNKA 4IS3A 5IG2A 4KUEA 3ENKA 1HRDA 1X15A 1AN9A 1P1IA 1UXKA 1HE4A 2F1KA 3UKOA 5A04A 1DAOA 5A06A 1DIGA 3FTNA 4BKRA 1I2CA 1PJQA 1WDLA 3CEAA 5JE8A 5TT1A 3SC6A 1SB8A 2J5RA 3AY3A 4BNLA 1D8AA 3D4PA 2BRUA 3DOOA 4FS3A 1G0OA 1NVMB 4CM3A 1NYTA 4Y98A 1AXEA 2C5AA 1ZVMA 5KIAA 4WGGA 3OP4A 1QSGA 4G65A 2VZ8A 5AYVA 3JD1A 4A0SA 3IMFA 4R5HA 2D1YA 4NJMA 5EIOA 3GF4A 4II3A 4R4JA 3NT2A 3M1AA 4HFRA 3JQFA 1KS9A 1E7MA 3DBHB 4TMFA 4YJHB 5DN9A 4Q3CA 1X0XA 4R1SA 3WWZA 3RIHA 1DPGA 4GWGA 4BNUA 2FPIA 4E21A 1N1EA 2E49A 1CWUA 2VTDA 1SBYA 1Q1NA 1YH3A 3EMKA 1IULA 2V7PA 4CR7A 1IE3A 2C5EA 2DBVO 1PJCA 4FC7A 2QX7A 3ONEA 4I5GA 4K6CA 1U8FO 4CQLA 4QQRA 1KY4A 3QVSA 4EZBA 4NFHA 2CSUA 2VHZA 4M55A 1XELA 1C1XA 5HTOA 3D5QA 3NX4A 4FGWA 3HB4X 1BXGA 2WE7A 5I9NA 1PJ3A 1DRWA 3RUAA 3AFNA 2QRLA 3NDRA 2VN8A 5HRUA 1K6XA 1O5IA 3CZMA 4M1QA 3W4KA 4AJ2A 1H9BA 3I6QA 3X2EA 3FHLA 5JNLA 3HDYA 2Q49A 3DTYA 2JCVA 3WGTA 4S3MA 4Z3KA 4B3JA 2EW2A 1ISHA 5F1OA 3NAQA 3ZWWA 2DTEA 1RYDA 3KLMX 3MJVA 4G81A 4RLHA 2HJSA 3JV7A 3PP8A 4D7AA 4DWVA 3VHRA 3ICPA 1Q0HA 4GL4A 1E0DA 1DFGA 1L7DA 4KTTE 4OXKA 5JYEA 4LRTB 2VOEA 3JQDA 1IYZA 3KZVA 4H3VA 2EV9A 4BNGA 3FWNA 4MOWA 4GMGA 4ALLA 5CFZA 1YBAA 1M6HA 4CV0A 4CR8A 3VTZA 1J6UA 1FK8A 3U62A 4GLLA 2PFGA 2D4AA 4U6QA 3S2GA 6LDHA 3KB6A 1DJNA 4AJEA 4LCJA 4DVJA 2CUKA 3QY9A 2Y0DA 3DHEA 4ZICA 5A4DA 3GEDA 4GLOA 3WGOA 4CM6A 2VT3A 3QP9A 1PS8A 5TF4A 1PZGA 2AW5A 1E7YA 2ZATA 4YQZA 4AJNA 1GZ3A 3LK7A 2E48A 2X5KO 3ZU5A 3AK4A 4O5OA 1O94A 1YL5A 2ZJ1A 4KQWA 3WQQA 1YBMA 2EHDA 3L6EA 4CMEC 5JCJD 3F1LA 2XOXA 1JVSA 5F3RA 2VWQA 3WYCA 3AM3A 2HQ1A 1XDWA 1Z82A 3DZGA 3ITKA 1U28A 5A9SA 3ROKA 2OORA 4RCVA 4ALIA 3QRWA 4RPGA 4BKQA 3NDJA 1B8UA 1V3VA 2QYTA 1WNTA 1I3KA 1O89A 1V6AA 2OBNA 2J3IA 4QUKA 5G0TA 2DBZA 4DGSA 4WNIA 4QXMA 1KEPA 5DOZA 4MDHA 3GC6A 3F47A 3VAZA 3AI2A 5BR7A 2WE8A 2W2LA 5DCWA 1KYQA 2GGSA 1XYGA 3HDQA 5T5QA 2QYSA 3DR3A 5T64A 1ZBQA 3COSA 4J16A 4JBIA 3WOHA 1A7KA 1GEEA 1LU9A 2DPGA 2QHXA 5TQVA 2NQ8A 3QJ5A 1DC4A 4BGVA 1P0CA 5L95A 1B14A 1O95A 1T2CA 3H2ZA 1HDXA 3TL3A 5I7SA 4ZQFA 1C1DA 1PQWA 3PJGA 1GPJA 1S7CA 3DFUA 3NUGA 3TN7A 3WWYA 4DL9A 3SXPA 1DSSG 1MLDA 1XIVA 1K6JA 1VL8A 3GRPA 4OMUA 3T4XA 4PLPA 5CG2A 2BELA 2JL1A 2W2LD 4HNHA 3H4VA 4D41A 4R9RA 2C54A 4RLSA 2EJWA 4WASA 3OFSA 4BO2A 4Z9YA 1XGKA 5B4VA 2PV7A 5AXCA 5FWNA 3R3JA 5IZ4A 1E1MA 1TVEA 2DUUA 5IDXA 4IZHA 1I01A 1DC5A 3PHJA 5KOIA 4RVDA 4BMSA 3PIIA 1O9BA 4XD2A 5LDGA 1ZUD1 1FDSA 5C3MA 3V1UA 1YQGA 3R3SA 3KYCB 4O59O 4BO5A 2NV6A 5DF1A 2JCYA 4YTEA 1YB4A 1NHGA 1QYVA 1KC1A 3ABIA 4J43A 4UREA 1H6DA 4CLEA 4IDBA 2P9CA 3TL2A 1UZMA 4OL9A 3UH1A 5JCXA 3GFGA 5CDGA 1PZFA 3ICCA 3U4HA 3VC7A 1MFZA 2PD4A 4GWKA 3AM5A 4HBGA 4L73A 5DULA 4YAJA 1ISJA 1BG6A 1MG5A 2WMDA 1PS0A 2OO5A 3AUTA 3QWAA 2ET6A 4L75A 3RFTA 4DC1A 3SC4A 3SVTA 1ZFNA 4JX8A 2I6TA 5TNXA 4Y6PA 2EXXA 4OSOA 4BNTA 1VLLA 1E1NA 2A92A 2XXBA 4N5NA 1XR3A 1JW9B 2B35A 1HDYA 2B5WA 4PG7A 3RD5A 2H6EA 4E12A 5JS6A 1U1IA 1P33A 2QRKA 2X58A 1JAYA 4B3IA 2YW9A 4IPTA 3BMOB 5JY6A 3R1IA 3AI1A 1PZHA 2FR1A 4WKGA 3EC7A
chains in the Genus database with same CATH superfamily
1O6GA 1G21B 1MP0A 2WVGA 4ZANA 2AKAB 3RD5A 4G0VA 2H4ZA 3MUEA 3RWBA 3VC1A 1R3DA 2ZPTX 4HB4A 3HCBA 3T1QA 4G4IA 4CM4A 1RXIA 1Q7TA 3MGGA 4EK9A 4F9FA 2V98A 2RC5A 3O8BA 1T91A 3NYRA 2IE0A 3HR7A 3I6BA 4GOND 2PHZA 3OU2A 1LDEA 3EW9A 5AI5A 3KP1A 3H8SA 1CRPA 2QG6A 2R8BA 3ZDFA 2WWHA 3HB0A 3HP4A 4AIIA 5C1BA 4OJQA 3E1GA 1IG3A 2V7GA 3LT1A 1NXTA 4RPIA 1RYFA 2JFGA 4KQ9A 1NOKA 4DJEC 1WBDA 1GGHA 2H7XA 4TQ9A 1UPBA 2GNPA 2K87A 2HLHA 1KQ3A 3KNZA 5LDDC 2ZJ4A 4P4UA 1NMZA 2OILA 2PDAA 4MVJI 2X8JA 3NEPX 3OE1A 3OC6A 3CONA 2OBLA 4J0EA 4UBKA 1QHFA 3SKXA 3WXMA 4C1NA 4E5MA 3DB2A 3N2ZB 5HWSA 3UKDA 3COWA 1OAOA 3PFFA 4OJMX 3EQ8A 2Q6OA 4HUJA 5ICGA 2RAFA 1Y7TA 4I2VA 4P2BA 5BW6B 3EGEA 1S1CA 2A9VA 2EEPA 4D0GA 1LBHA 4KXQA 3B20A 1YZGA 4IQ0A 3WNCA 4B79A 1WOYA 1A71A 4BE4A 1XCOA 5LMNB 4KQ1A 2ZVJA 4ZMRA 2H9IA 3FVWA 3VVCA 1ZR2A 3I28A 3UVEA 4IDDA 3MJDA 4GQAA 4TTTS 1GAJA 3EDCA 5EWLB 2W93A 3HI4A 5CEJA 4EF4A 3P9QA 1WZUA 3U26A 3AZQA 3U4QA 1RJ9B 1WMSA 2M9MA 4QBHA 4LRUA 1L8OA 2IDMA 4UNNA 1U3GA 3BQMB 5FFNA 2AJBA 3SYMA 1QWSA 2IC5A 4QU8A 1GQQA 4NE7A 4WJZA 1XRJA 3EIFA 3EDMA 4R2LA 4BMXA 4RDCA 2C4VA 1RRKA 2R6HA 4KO1S 1DNPA 2PJDA 3JSAA 3KAKA 3I9OA 5DYTA 4PR3A 4BX3A 4ZEMA 3ZDCA 1DS6A 2VPIA 4TTSA 1PVOA 5BMVA 2BM0A 2FHPA 5CH3A 2BE9A 2C00A 3CNQS 3FWKA 3T3EA 1A8PA 1EINA 1Y48E 2HNKA 2NU7B 4RCZA 2I6XA 3BRQA 2KJQA 1A2KC 1T9CA 2XYVA 1ATIA 1XMVA 1MO4A 4KO4S 2C4KA 3S3TA 1YJ5A 1WX1A 2W8BA 3A4MA 2R00A 4DUPA 5BUSA 1H85A 1PJBA 2OCDA 2MINA 3S2IA 4HAUA 1B0AA 1VJGA 5LYJA 1JPVA 3PVZA 2W7TA 3ZXSA 2XYQA 2DUJA 1L5YA 1PHRA 1YS1X 3PHCA 5HF5A 4R83A 3FPFA 4GGOA 1JDNA 1WMFA 2CJFA 2G5CA 3DOUA 5J2UB 4PYJA 4YMTA 5E4TA 4LQCA 3UJ9A 5EZ6B 4O2LA 4WIAA 1I9CA 1XHFA 3QKRB 5F2OA 3WWOA 4B8YA 4CMIB 3JAMA 1IY2A 1W88A 3ECCA 4NZPA 4HUTA 2F8SA 2ZTLA 4LSWA 4EY3A 4JJ8A 1VJ1A 2WV7A 3RYTC 3OFND 1ZUHA 3EG9A 1QGYA 2BFEB 1IAVA 2WF6A 4PAOA 4HDSB 1R0LA 1DC8A 1RW4A 2FPRA 2NUPB 2WJ3A 3HJRA 3IRVA 3MOIA 1AKNA 4ZU6X 3RIXA 3VBCA 5H83A 3PC8C 3RADC 1Z0SA 2R84A 4CM1A 1UC8A 5HBGA 1W1UA 4PTLA 3T7DA 4U3JA 4FEYA 4YA6A 5T6BA 4FCVA 1SZPA 3D0RA 3JQQA 3QPVA 2B1RA 1PVVA 1O03A 4MUIA 4QX6A 3HA2A 1MGPA 1KZGB 4NZMA 1KA9H 4OQ4A 3HMQA 4G25A 2WUVA 3EWSA 1NWCA 4PSAA 3UICA 5M7EA 4P98A 4K8RB 4BQIA 2I67A 2A5DA 2P2DA 1RRMA 2UZ0A 2X14A 4MK4A 3T3IA 3D6UA 3KJQA 1D0SA 4O5AA 4A5SA 4J2OA 1NURA 3QEAZ 3FBGA 3IEIA 4S24A 1QG6A 1YACA 3UXMA 5C5DA 2IH4A 3BSFA 1X80B 3QVLA 4NU6A 1LTHR 1Z0DA 3M4JA 1T26A 4YQEA 3TUJC 1KSJA 1IJKA 1AZSC 2D5IA 3I6YA 3P0IA 4GI5A 1V45E 1R0ZA 2XTJA 3I34X 2ZVDA 3H3FA 1YRQA 1QGUB 3LX8A 4MI9A 1OSNA 1P45A 5ALPA 3JRXA 4LGMA 2IZ0A 4GXRA 4LGVA 2ODQA 3GLIB 3JCZA 4R3WA 4V39A 1JHZA 1K8YB 1V7QA 2O8NA 1FYDA 1MZVA 1YONA 2VPXA 3LY7A 3OX3A 5ESXA 4X6LA 3U44B 2W4MA 5KQLA 1JU9A 4YLGA 1CUJA 1EE2A 1GGMA 3HUUA 4PG4A 3ZCQA 2QDXA 4KIGA 2R6CA 2ZI5A 4ZT7A 5AW7A 3UMVA 2GEVA 4KN5A 3RBXA 2J8ZA 3D1VA 5DN6D 1EA5A 1JG6A 3DP7A 3D7KA 4U2FA 2VRBA 2VK8A 5HE8A 3AB8A 1U8UA 3VI4B 4UMFA 4EL5A 1CQIA 4Q3BA 2AIRA 2IZ7A 3VSBA 4C06A 4V2UA 3OEHD 1X1SA 5FF9A 1SXJB 2UZAA 2ZFUA 1UBRS 3O38A 3W5JA 4NBLA 5TPZD 2V7VA 2AE1A 1NR7A 4O4HA 2QVZX 4RQUA 4EO7A 3IBCA 1SPBS 2FPGA 1RBMA 5EKSA 1E7RA 2Y1DA 4EBFA 3NNDA 5AVRA 4UXHA 2ZU6A 1E64A 1XEFA 3OE7D 4BECA 3TZBA 3I9JA 4C3OB 2DHRA 2WHPB 4JLAA 4EJ0A 4PZZA 4QBFA 2BFFB 5JH7B 3C2QA 4LOIA 3HFJA 2D00A 1O6ZA 5CTJA 1L7AA 2W6JD 1QONA 1GZ7A 2X2PA 1NW7A 4KFSA 3VFDA 3ZU4A 4D6PA 4E33A 2A33A 3CVVA 3AU9A 3I1FA 3TZQA 4QUHA 2G70A 1NW3A 1CZNA 2NTJA 5M3BA 5CB4B 3U56A 1ZO8A 1RHRA 3SOZA 4G2NA 4C4OA 2ZBPA 3ZCXA 3VDMA 3F8TA 2YWXA 3AHCA 2BOVA 2GTPA 1X6VA 3VSEA 1UMKA 3ZZTA 4CTNA 3NMUF 1U2PA 4HH1A 4JBGA 2GBPA 3PFNA 3FJOA 5ETJA 3SS9X 4TV9B 1WZEA 2YVAA 4MUGA 3UQYS 1YOBA 2B1QA 1H0HA 3JRWA 3FUVA 1LBSA 2PUFA 2WTUA 4ZO7A 2IP2A 2FEXA 4A27A 1NBOA 4ZDKA 2QWXA 3KWJA 3W8DA 2AI2A 4M1YA 2C9ZA 5M2QA 5GOTA 1KMNA 4UHDA 4HXFB 3FKJA 4E70A 1RVV1 2ZSIA 1K4MA 2ZYDA 4BQSA 4UM7A 2OGSA 4ZI3A 3F4LA 1XPOA 3MJHA 1PCXA 2I3BA 2QD5A 3OOYA 4N6GA 3VGJA 1RBYA 4HDMB 5BN4A 3KQYA 3NHFA 4OQEA 4DXAA 1IZ9A 5GPBA 3FAZA 2WIGA 5C8VA 2Z9DA 5ALGA 2QN1A 1KK3A 3RT1A 4E2YA 1G6OA 3I1JA 1ZU5A 1ZMXA 3B1KA 3PHIA 1T4GA 1L3CA 1WD5A 1BJTA 3C8DA 1VHQA 1KU0A 3A6EA 3CHYA 1E2DA 4QYMA 3TZ6A 4Z4QA 1LNQA 4F3YA 4DZRA 4Y6SA 4CLHA 4WECA 4BE7B 4E1VA 3SC3A 2V8BA 3BMCB 5IHXA 4Z53A 4KDEA 4TYYA 1Z3CA 2PGOA 3EDYA 3CZRA 1LK0A 2G40A 2NSYA 1TU3A 1KJIA 3UHAA 5FA5A 4AU1A 5TR9A 1JNYA 1A9TA 1EGAA 4FZJA 4C08A 2B8JA 1UK9A 1II8B 1RKVA 3QA9A 5F21A 2VP6A 5MFPA 4WESA 3TVTA 1PX0A 1EDEA 3V7WA 3CR3C 1D0IA 2H63A 1A5SB 2GVZC 3H5OA 4KP7A 4U0JA 1DARA 3PEVA 4BTEA 3KCNA 4GSLA 1RNLA 2QE6A 2K2QB 2HK6A 1T4CB 4DEVA 3BULA 4UU1A 4C03A 4GBJA 2BI4A 1US8A 5FPKA 1H94A 4R40A 3VJKA 3TAHA 4YAOA 4BFZA 4NBKA 3PJEA 5B1SA 3QKWA 1UOQA 2FU5C 4ML3A 3TLJA 1NVKA 2A86A 2OMEA 5HX7A 2XB4A 3IC5A 3OZ7A 3KQUA 2W6IA 4U7JA 4Q3OA 2Q45A 2ZOSA 5CCXA 2QQ0A 4B7AA 3CO5A 3GLHA 3U6BA 3QV2A 4IW3B 2F8TA 4V02A 4Z4EA 4O6VA 2WZQA 3PL5A 4EGCB 4EW6A 1UPXA 1Y33E 3LC1O 3HJAA 1KJZA 4RFSB 5K0EA 1V71A 3GFFA 4Y1RB 2GBLC 1YOVA 5JMPA 5CA0A 3V1LA 4OHCA 1NVWQ 3LL7A 1E1QD 1PWYE 1ZL0A 4CDGA 4F96A 4R51A 3U2QA 1TRKA 4C07A 4KJXA 2FPPB 2M32A 1NWHA 1C7FA 4RULA 3ZHXA 1V37A 5CX1B 4EYQA 3ITNA 3HVIA 3Q3JB 4S12A 3JZFA 5ADUS 4MW0A 1U9IA 1OA1A 2J85A 3AEZA 1N6OA 4WT7A 2CD7A 1RYYA 3WFZA 3DZIA 3I04M 1IY1A 1EDZA 3L7MA 1FLAA 3ND6A 1V16A 3GZ4A 4LHZA 3NHRA 1GUZA 2YZ7A 3AWDA 1EXDA 4KLCA 3SF0A 1DELA 3EX7C 3VVBA 1WP4A 2IEAA 2Q6VA 3VRHA 2B8NA 1GD1O 1ZMRA 3NKLA 3TEFA 3WLPA 3MHTA 4HUQB 4MR7B 3O4JA 4I5FA 1P9NA 2G0AA 3WLNA 2VSNA 5EJIA 3H5WA 1ZUNA 2PCLA 4EDFA 3NRCA 1I3MA 1NMYA 5F35A 1EBBA 3I8SA 4TMYA 4UTNA 2OOSA 3U31A 4I1YA 4E6PA 1RSZA 2W11A 3FJ1A 1MEEA 3JYLA 3M6WA 4D9BA 3U16A 3GRRA 3A1CA 5DW0A 5DOVA 4QZVA 3VNVA 4FKBA 2VDNB 1N8SA 3NVMB 1OLUB 3U09A 1P7CA 1XZGA 1Y9AA 3EA4A 1L7MA 5J43A 3B5JA 2FR0A 4MYUA 1IWOA 5K09A 2DTDA 3AHFA 3N8HA 1P31A 3U7GA 3HJFA 3LKDA 1EX7A 1ZH8A 3RT7A 1T9DA 2ICAA 4WZBE 3A1UA 5FR2A 4CLOB 5CFMA 3QX9A 4XVQA 2I99A 3F5QA 3QE2A 4PAWA 3SYRA 3UT5A 4LXTA 4KK3A 1YDHA 2VWHA 2UUBB 5FEMA 2ZIEA 2WFAA 3FX2A 4DDKA 5GIOE 5CIYA 1WB9A 2WZBA 2X8LA 3BL5A 4EY5A 4L1KA 1HTTA 5FTMA 1NXSA 4DL9A 4F3RA 1P5HA 1U7OA 1DKOA 4L28A 4Y6LA 3I37X 4QXRA 2RJ3A 3NVDA 2RGNA 1IJFA 3OIWA 2XB8A 3LDGA 4GVLA 421PA 4HQKA 4DIBA 2XCUA 2A9QA 3AV0B 4UXIA 1M2WA 1QAOA 4FBMA 3BE6A 1J23A 5AD1A 3I83A 5IABA 1OH6A 1QQBA 1Z7BA 3ESQA 1NKSA 2KW5A 1MDBA 4K5QA 5KDDA 1SB9A 4M54A 1OBVA 1EHIA 1MT0A 3MCZA 3TLXA 3ZN2A 1JWBB 4FKZA 4TVBA 1PV4A 1J8MF 3A4IA 4F38A 1LTQA 2DR3A 4ZP1A 3ZDAA 5HFNA 4QO8A 2F4VB 4IOKA 1JR2A 5J4KA 4BX8A 4B83A 4W5OA 2C4WA 3L8EA 4AQ7A 3N58A 2REOA 4UHFA 1MA0A 3C3EA 4NFSA 4V1CI 4XWGA 2OWDA 1HT1E 3RHSA 3WZ2A 4B76A 4EPTA 2QORA 1NHWA 1MVOA 4MHTA 3OCCA 3W2IA 1MV8A 4PNZA 2X23A 5EHZA 5JS7A 1I3LA 3C4QA 4JYZA 3ND7A 4YCDA 3G6WA 1UJ4A 1QRRA 2FXVA 3KQMA 2KI5A 1AQLA 1D7OA 1QHXA 1O57A 3MT9A 2RHJA 3L46A 5L7WA 4RA9A 5FTNA 2X3FA 1V5GA 3DFZA 1C9KA 4B3XA 1AGRA 1H6AA 3K4HA 3QXHA 3V2HA 5BSEA 5KOYA 1Y9EA 3GH1A 4UHCA 1B41A 3MILA 3T0GA 3IQEA 4X1YA 1Y1PA 5HPYB 4PHGA 4P7BA 4ZOLB 2OSVA 1GKIA 1D0VA 4Y3UA 1JR6A 1L1FA 4IHJB 4ARUA 3HRKA 2ZRCA 1W2WB 1G6Q1 1N6KA 2GN0A 2X2FA 5DMXA 3R7AA 2AL7A 5JVDA 3K96A 5EHIA 2XNSA 3EXHC 3TBKA 2O2YA 2CHVA 2H4HA 5DMHA 1LTKA 2O20A 2HMWA 3H0EA 1NNUA 1YHNA 3Q7IA 1NP3A 1Z07A 1M1YE 2WLTA 1RCUA 3AKYA 3P9SA 2PKCA 2ZTUA 3HUEA 3ILYA 2FKAA 3MTQA 3R7DA 4WXYB 4BJ3A 4CUJA 4LMPA 4URZR 1U7PA 1G7RA 3QLEA 4YRDA 4Z0TA 3SIRA 3ZXIA 4AJHA 1PFVA 1QFSA 2GPAA 4BZQA 5KHOC 5JC1A 4M8KA 3EZ6A 2AA3A 1V0JA 4L8VA 1B3RA 2G04A 2O5RA 4LXXA 3QVWA 4DVGA 2WPDA 2PGAA 3PPXA 2O9JA 1EDOA 3RWOA 4CM9D 1NONA 3CSSA 3D7MA 1XK7A 3BKXA 2XADA 1VFNA 3DMTA 3KUCA 3RM3A 5T7BA 4KZPA 2QNRA 4LVCA 3T4UA 1RXYA 4U7TB 2FEWB 2IYEA 1LZKA 2R48A 3QKSB 4FDAA 2WD8A 2QI9F 2G9NA 1FTGA 2BM1A 4F84A 2HIAA 1NNLA 4XJTA 5KKAA 3IUPA 2IKSA 1QP4A 2IXBA 1VG0B 2GCPA 3V80A 3HXQA 1YJQA 4L9SA 3DMNA 3WS7A 3BN3A 3IO3A 3AF1A 1QYXA 2B69A 4MKXA 2FDXA 1XU7A 3H9CA 3RFXA 3UWKA 4BUJA 2R0QC 3F7MA 3TNFA 2OBFA 2W6CX 2BW0A 5A05A 4ACBA 5DDIP 5ILOA 2QD3A 3ZLBA 2MYPA 3MA0A 3C48A 1R9NA 1NXXA 4MVJP 2I62A 3DDSA 2YKGA 2Y1FA 3H65A 4IGEA 3B6ZA 3AUXA 4JD5A 5C8YA 1Q1GA 4R0MA 2Y71A 1NBME 1D8TA 3PS9A 3SX0A 3K9FC 2I6GA 2I6FA 3Q11A 1HURA 1CZKA 2A1UB 1HE5A 4NNPA 1L1EA 5AHRA 1GP2A 4FMDF 3ELWA 4WGFA 5KSYA 4NEHB 4WD3A 4H16A 2IDKA 4IIFA 4JP5A 4C20A 1VSUA 1N2BA 3LUJA 2GBFA 1JFTA 1T1RA 3LDAA 4UEQA 2UYHA 4OQNA 1AS2A 2BH9A 4AROA 3PITA 2O8FB 3WADA 3CYFA 2J31A 1ZC3A 1N2GA 2GAIA 3KOZA 5JSQA 1V4VA 1ZGGA 5IPFA 1OLSA 4II2A 1A9PA 3KOUA 1EYZA 5J1SB 3UATA 3EPLA 3T52A 4F91B 5JPCA 5EYPB 5BMOA 1LBQA 3MK31 4PYMA 4FJ2A 3FTDA 1L5FA 3QFFA 1V8FA 2WINI 3R5XA 3NRJA 1BQ4A 3OQJA 3WGHA 2AXPA 2J30A 2RFLA 3D31A 1DJOA 2DZDA 3IR5A 4JP3A 1N9GA 4DW8A 4YT8A 1SN7A 4CU2A 2VWPA 3V1KA 2VBIA 2H2FA 3EA5A 4NZZA 4KXMA 3PE4A 4ZDIA 4DPMA 1NXPA 1NUAA 1JJVA 2Q5CA 4II7A 3DLPX 1DCFA 3VR6A 4EATA 1Q0PA 1F2UA 1N5JA 4J2HA 4NBUA 3ZWYA 1OWLA 5DI9A 1VYVA 1CVIA 4P7JA 4PS0A 5JO0A 4G5XA 4D4GA 1G20E 1HMPA 1WY5A 2VEOA 5C5IA 4ZZ2A 1KYTA 4AUEA 3EUEA 5J3JA 2XTZA 1T4MA 3GJXC 4HZUB 3RR2A 1N92A 1N36B 2VQEB 3OJ0A 1JDJA 1K0FA 1BYUA 2I1WA 3RO7A 2O8BB 3OQIA 4ZCMA 1L5HA 3GH3A 5DLQC 3H4TA 3QX7A 2Y0CA 4NZ9A 3WOVA 1PF7E 4K6MA 4AMBA 1J0CA 1T34A 4XM2A 2XCRB 1KO8A 2ID8A 1ZJ6A 1F8UA 1W94A 3RVRA 3DD5A 4K6OA 4MA4A 1O95C 4LEIA 3DXXA 3B1WA 4AN0A 3SYTA 5AI6A 4B3BA 1W8DA 1IBCA 5CURA 2VH1A 3TQHA 1MTZA 2HA0A 1I3CA 3TIIA 3OZWA 5TQJA 3CW2A 3OBIA 4ZI7A 1SG0A 3RVKA 4UM9D 1RT9A 2PTHA 2BDEA 3RC1A 3K6JA 3WJ1A 1SXGA 4HV4A 5ECYA 3FPEA 4QXPA 2ZWPA 5JCPA 3ZOZA 3U7QA 4IVQA 1V6SA 4J76A 2PZBA 4OI1A 3LYUA 4XI9A 4MR8B 2B21A 3DEHA 5KSPA 5C34B 1E79A 1VG9B 2R8EA 1KAQA 1JPUA 1UKYA 2GERA 2OKCA 2PYIA 5D7BA 1YHYA 2CEAA 1BHO1 2ZJ2A 3IDQA 1AKEA 3UOGA 4DCPA 5BN3A 5CEFA 5DX8A 5H70A 5BSHA 5KNCD 3E9QA 3ANSA 4FOSA 1FJXA 3TF5A 1JIXA 1E6UA 1EGHA 2Y1OA 1P29A 5B4TA 4MCJA 4HWGA 2PWAA 3WBJA 2DYKA 1TU4A 1YR2A 1T36A 2XSZD 2JFBA 5JALA 1XZMA 5LBUA 3EVGA 5E2IA 4F5EA 4HCJA 3SZRA 2HJRA 4W63A 1KEWA 4EITA 4HXEB 4OP3A 4H7HA 1RYNA 4WINA 3GRYA 3GBVA 2H3EA 2ORED 3NR2A 3W5AA 1L4GA 1PHPA 2POCA 3P2OA 1K3TA 4UDOA 4LC0A 4A0HA 4GZ5A 1JFFA 3ZIUA 4AT1A 5KNBD 4B7CA 4XIGS 1F6WA 4M7RA 3WRXA 4CODB 2DWUA 1IB6A 4IJMA 4Q9JA 5KVSA 2JZCA 4OLHA 1EK6A 1WXXA 3G1WA 3JQAD 1AO0A 1Q7RA 1ZK0A 2QRVB 3I6MA 3NTQA 3INNA 1E0SA 1KS2A 1EAMA 4C0LA 2QJWA 4DYVA 2OO5C 4AKHA 5EZYF 1GT91 2JFQA 1IU9A 3COVA 5C4MA 1ZW1A 1CW2B 1JE0A 3TW4A 3E9DA 4C87A 3NNSA 1QJ4A 4PO3X 1XHLA 2R2GA 1AK1A 1GZ6A 2B0CA 2CE7A 3B1ZA 3IV9A 1VA5A 3EXHB 5AR1A 4BKMA 2PGIA 2VYCA 3KT3A 1Y5MA 3RYIA 3SICE 1XQYA 5H7XA 2PUJA 4Q4DA 2OR3A 1SKAA 2J5XA 1JE1A 3OT4A 2AZTA 1R64A 3QLJA 2D59A 2YJ5A 4Y6GB 1FW6A 3C7TA 4LDJA 4M53A 3CZQA 1MJHA 4O3MA 3HN2A 2CUNA 2AFHB 4AKEA 3SYKA 4LZNA 1FUKA 3OM0A 1BXGB 2C2YA 4LE2A 5TB5A 5LNK1 3FWPA 2CFTA 4EFDA 4KLAA 1ZK2A 2R4QA 1PEAA 1RAGA 4IVRA 4QGAA 3MRXA 3VR3A 4DV6B 1GA6A 5EEGA 3KKKA 1PR0A 5KYWA 3EVFA 4YP6A 2GM9A 3OIYA 2WP8J 2F00A 2B30A 1NE2A 3E7PA 1SA0B 2VT6A 3UXYA 3SY8A 3ZHVA 2FLKA 2VQ6A 1VLHA 2WUWE 3S6JA 3RK0A 3GZNA 1O58A 4L8WB 3BRWA 2BM8A 2P9FA 4L0QA 1RLIA 2FLVA 4GOJA 1QGOA 1ZOLA 1LV8A 1P2DA 3SHOA 4OLJA 2XMZA 5IF9A 1ZSVA 4Q1DA 3LUPA 3SEQA 1TMYA 4QECA 4R1MA 1WXEA 3IOCA 3HG7A 5IZCA 4HY3A 3MCVA 1KIFA 4E51A 3VNUA 4BQEA 3VM6A 3ZGNA 2VJDA 1NJ5A 1J2TA 2YMMA 1T1SA 4MQ5A 2YY6A 4EB3A 4LYHA 4I5DA 2P9QA 1DTWA 5KC8A 5A03A 1A4IA 4ZZ3A 1I32A 2XXAB 2FSUA 1THGA 3OO1A 3LUCA 4IDQA 3N2NA 2ISSD 5KX5F 3ZQJA 4JI7B 2ZB2A 1OC2A 1DL5A 2FFBA 3UUWA 2ZJYA 1ADCA 5B37A 1GWNA 1QE0A 4KLNA 4P2GA 4QYXA 2B2NA 3D7NA 4FMBB 4I3GA 4UBOA 3LUBA 2ZJAA 1S2GA 1XDSA 2RBKA 4HB3A 5CDFA 3UB2A 2JAQA 1MJNA 4BUCA 4IG4A 4Q1VA 2Q62A 2DPMA 4BQPA 3SFZA 4BGIA 2PRSA 2QR3A 4R84A 1CIVA 2PX6A 1QZZA 1QFMA 1U5CA 5GOZA 1AKVA 3T6KA 2P1RA 3U3XA 2R9VA 5L4NA 3CX3A 1NAHA 2A5LA 5LQSA 4AJ1A 4NPCA 2F48A 5DLEA 1HT0A 4WOKA 4BO7A 3AVYA 3AOGA 5LP6C 1OJLA 1P6XA 4CKYA 1OGJA 5KKCA 1URPA 4B43A 3G2OA 4Q9LA 1ULBA 1SC1A 4Z1MA 3GGJA 5F4ZA 2FQQA 1T10A 3DG9A 1IRXA 4QPCA 1IXZA 1YRYE 2PMDA 2Q5FA 4CIAA 1L4FA 3HZHA 4DT1A 1KE2A 4MKZA 2OQIA 2AEJA 4PZCA 3WMWA 4FT4A 5EERA 3RJ9A 5JSUA 5KNDA 1N8KA 2WC1A 3RASA 3M4ZA 2ODPA 4MHSA 4IDPA 4BVFA 3RU3A 3V8EA 5E3JA 4YUAA 3PZRA 4XYMA 1C30A 1SXJE 3OTOB 1OCEA 5L40A 1JFSA 2V3CC 5BWLA 2YVKA 2GEBA 1GEGA 2QNIA 2O8DB 3LCVB 1IN1A 2O1XA 3DV0A 1ECGA 2I87A 2JFPA 3CNEA 1ECJA 2CY0A 3L84A 4G97A 5JMOA 1RABA 4LSZA 5LBTA 4A3SA 3HACA 4KRFA 1W96A 4HDNA 4O1IA 1P74A 1GDDA 1P8JA 3NKFA 4GRIA 4DLAA 4BO8A 2B82A 5KTYA 3NTRA 1FNNA 1YUBA 1H1LB 2RBEA 1OB5A 4PR0A 4IMJB 4YBZA 4C04A 2DR2A 3MCTA 4JC8A 2NAPA 5C4GB 4IQ4A 3HV0A 5FOWA 2H4XA 3NAZA 2RGDA 4GG1A 5JAHA 2JKZA 1BCRB 1RQ7A 1HKHA 1JKJA 2ZTSA 4MXDA 3SWWA 2ZRDA 3TCKA 4AKTA 2R62A 3LFHA 4LXGA 3ADDA 1YL6A 3AF5A 3NDIA 3M2TA 5K05A 4BFXA 1XKQA 1TT5B 5BN4B 4UUAA 1T6XA 1QQ6A 1FXWF 1Q7BA 3L41A 3PHHA 5SZHB 3ZWOA 1L7QA 4P4LA 2ZYGA 4MS1B 4TUYA 5G4LA 1C0KA 1MPTA 1W35A 4ZRDA 3VNRA 3VV3A 4F9GA 5A5FA 1J2UA 1KFBB 2VO1A 3CO0S 4DSAA 1Z28A 3FAKA 4YPOA 3IUBA 1DQYA 2X76A 2XT9A 2Q4EA 5BSMA 3FF4A 1ZA1A 2O2HA 3EGIA 1PVDA 4M98A 3SSNA 3VO2A 3PHGA 1VYHA 2OLKA 2Q2NA 3IPYA 4A6DA 3LCCA 4CKWA 2JFZA 4DUZB 1GGFA 1G3QA 3HLKA 1PQPA 4JXJA 1BXKA 4KH0A 5EIBD 3TTSA 5GJBA 3U1BA 1MRNA 1Q7EA 2PLWA 4L6CA 5EE3A 1ECFA 4YX9A 5AVSA 3FW1A 4YLEA 1RJFA 4MVJH 3HYCA 3LCJA 5KQGA 2GNAA 4FCCA 4YRQA 3CLTD 3LBIA 3FPHA 1KO7A 1QH8B 2ZXEA 1IN8A 2EGHA 3DE2X 4MYCA 3VSDA 3VYSB 3WZMA 1GTRA 3ANLA 3QEBZ 4DA7A 2ZI4A 7MDHA 4FFOA 1W5EA 1GRVA 4CUKA 3LF2A 4PFQA 3D6NB 3MERA 2YNMD 4NEQA 4OVKA 3FUXA 2IYPA 5K03A 5ALWA 4V1CB 2DF8A 3TPCA 4KKXB 2JRLA 3P5BA 1ZXLA 3FZNA 4ZYUA 1VMIA 4ISBA 2XOEA 4XLLA 1PL7A 1XQ6A 2C58A 5I8ZA 3UPUA 2BGKA 1GZDA 3WGIA 1PJRA 1XLTC 2ZBFA 2RGGA 1UPUA 2YMQA 3FB4A 3IKMB 4FMPA 1EPUA 3AUYA 3KTDA 4LDRA 2DU8A 2WSSD 4KPYA 5B7GA 3IT3A 3ZDBA 4F21A 1JSXA 5A9SA 1G3UA 3HFSA 3ZQ4A 4ED9A 3B9RA 4E07A 4AMYA 1GIAA 1C41A 3IUYA 1DQNA 3L4EA 1GR0A 3EBPA 2PKWA 4QODA 4REQB 1D2NA 4Z7JA 4CW7A 4BU1A 1FP7A 3NJ8A 5AM0A 4A5OA 5I01A 5LLTA 1T2UA 2RAVA 1Z7YA 4RA6B 5JISA 2X86A 1N3BA 3HR8A 4YNBA 5FNZA 1M72A 3KBOA 3SM3A 2PLRA 1DEXA 2H7CA 3O2QB 3PUZA 3ZJ5A 3RNLA 2WWWA 2YWHA 4YRCA 5C8XA 1DWOA 2WAMA 4QEDA 3GJ7A 1OFHA 3JQEA 3AR8A 1KHTA 3LPLA 3IAXA 3BDIA 1IONA 3PD0A 1X3SA 1XJQA 1BJKA 4CQMB 5L45A 1RWMA 4B0OA 1LSJA 1BVRA 1W85A 1MAUA 2OFPA 3CMCO 5FPHA 1USWA 2MYNA 2JI7A 2HQOA 3OKCA 3E0XA 4ETMA 3WK9A 2UUOA 1JEQB 1UPFA 2G82A 3KOWA 1O54A 4YFYA 4V0KA 3OX1A 3BXOA 4JB0A 3AILA 1P9WA 3EEIA 1LVGA 1BQEA 1DKUA 2CLHB 2C0PA 1L8AA 4FE4A 5EESA 1UANA 3H2GA 3UFXA 1QV9A 2IT1A 3QXGA 4CIVA 2XB6A 4ZC8A 1VLZA 4W5RA 4E14A 1BDJA 2R1TA 3I9KA 3O47A 5A4AA 3HVKA 5C1OA 3AF2A 4G5YA 2VRCA 3V1YA 3TI9A 1QH1B 3QOXA 2ZJZA 4OFBA 4GX2A 3DLAA 3CLKA 5EMLA 2CBGA 1EUZA 1JSLA 2GZRA 1YMVA 3AT1A 1E1DA 4J4TA 2DWPA 4K87A 4NJEA 5EG5A 3V00A 4JJEA 1JYFA 4DQ0A 3RVOA 5AQ1A 4OGFA 3BORA 2C5GA 1VA4A 1ZJZA 4HZGA 4UVIA 3N3AC 4JEMA 1QLWA 2V58A 1JEEA 1F8YA 4Y67A 3SR3A 3U40A 3RS8A 1KDPA 4IJQA 3I30X 3BM5A 3U7IA 1QE3A 1I10A 3ZHQA 1P72A 5KYYA 4G5SA 1PJ2A 4PIVA 4N1AA 3KAQA 3QFHA 4FJ1A 1NJSA 2QXTA 2CKDA 3U3OA 2GXAA 3LA6A 1VSQA 2SICE 4OJTA 2VKQA 1H69A 2DUMA 2EL9A 3C0KA 5AM5A 4RXTA 3SMQA 1UBJS 2ZYRA 1SY7A 3N59A 3MFYA 1FPMA 4CDNA 3IH5A 2PUVA 2TECE 2HCTA 2J3JA 3UJ7A 5JAUA 4B3FX 1GN8A 4IF4A 4LDPA 4MKIA 2ONYA 4QREA 5K4GA 4E22A 4FQ7A 1L5GB 1LC0A 1QZUA 2F43B 2PH1A 2XNKA 5DI3B 3CRZA 2MHCA 1AQJA 4ZQHA 1PNOA 4YCJA 1RQXA 4KC0A 5CH5A 3G2QA 4ZPXA 2ONCA 2ZCUA 3T94A 3QYFA 2HTFA 3HY3A 4AN4A 4HXGA 1NFQA 5BSFA 2WSYB 3NKVA 2A4MA 2P2LA 2LPMA 2WTBA 4UD2A 3G13A 4MP8A 4J0FA 2FZKA 1NG1A 2XBLA 4BNDB 4BVAA 1NNEA 4OIFA 4YJ2F 2WJWA 3CF4A 5IJXA 3C6MA 2PD6A 4ZHQB 3SHFA 3CVUA 1QV6A 1FFCA 2WFLA 2Q1UA 1CR4A 4JNCA 1E2EA 3K30A 1GTVA 1UJ2A 4BEWA 3O0DA 3VYWA 4N0PA 4TLCA 4UOQA 5F7XA 4AJ4A 4TPKA 1SUIA 3KD3A 1P9LA 3P2JA 1V9LA 3DOJA 4O4LA 4L78A 3U3ZA 3W5VA 3ZE7A 2C4TA 3DTVD 3FBWA 4RE5A 5AHWA 2YC4C 3I0ZA 5JSFA 4G1BA 5EXTA 3KIPA 1RXUA 4WE3A 4EVIA 1GGVA 1LVHA 4ZYLA 4L5IA 3AR3A 4HB0A 4CEJA 4L76A 2V6BA 4UW9A 1PYGA 3QU7A 3HYSA 3NBKA 4LMRA 1Z7GA 2NXEA 4ZO8A 1K2VN 3LHFA 2I33A 3PIRA 1A5AB 4BQQA 5THKA 2VFAA 5LC1A 4LHEA 1AGXA 1YQWA 1TJYA 1U0TA 4XGKA 3DL4A 4YUZA 4CETA 4BFTA 4X6UA 4V0MA 4KPFC 3W8FA 1JLLA 1P80A 1Q16A 3ETLA 4B3MB 2AG6A 2D06A 4D8UA 1E4EB 4OD0A 5A0VA 1RD4A 2D62A 4G0YA 1XUOA 3UAYA 5G1NA 1JA0A 1ISIA 3PFHA 4P7GA 3U1TA 3VDRA 2OBBA 3ND9A 4YP1A 1NBMD 5AFSA 4O33A 1L7NA 2CYCA 3CJQA 2XVZA 2EQBA 4MVJE 3L3BA 1CYDA 4KE9A 1J9GA 2VQ3A 3K0BA 4D5GA 1PNRA 2G6BA 4Z86A 4F4JA 2ASVA 1Y98A 4PG5A 2HBRA 2J9FA 2I3DA 2C3PA 2NO9A 3EXAA 3HN7A 5CDTA 5IFKA 1CT9A 3DBRB 1E2LA 3E7DA 3HO8A 3KKMA 3KU4A 1RYMA 1XWWA 3FSGD 4QG3A 3I04A 3E05A 1RI2A 2P0YA 3CA8A 1UZUA 4Y9UA 3GI1A 1G4UR 4O2BA 5I9TA 2QJFA 1I7PA 3B9QA 4TTQA 3PYMA 5BUCA 1N7IA 4UM5A 3JATA 5C80A 4Q3NA 1EJBA 2FX3A 4RD1A 1DADA 2NQTA 2HD4A 3RODA 4F04A 1ISPA 3B6MA 2ODEA 4E3ZA 2HLDA 3E35A 1EDBA 5CAEB 4I4NA 6ADHA 4MPTA 2PG3A 2QM3A 3GVHA 1QKKA 4XQEA 2O2IA 3MD0A 1P60A 2IXTA 3GJ6A 3NWBA 3KALA 2QLLA 4JUAA 3TECE 2FTKE 4NYIR 5KNLA 1JDVA 2W2KA 4KR9A 1T9AA 5EJ4A 1DZIA 3H84A 4ZD6A 5C46F 5DB4A 1FW8A 1SAYA 3KBBA 1KMIY 2A59A 3KZCA 1AZWA 4QE3A 3ACDA 3SC2B 2YS6A 1FNMA 1ZOIA 3OLWA 1SUCA 5A1TA 5CVTA 4GUDA 5IN4A 1WQ1R 5G1OA 1ZCJA 1SQ5A 1XNQB 5DBEX 1JR3D 2IHBA 2QKYA 2XCIA 3BMNA 3EJ6A 1IATA 2B5OA 3RC7A 1P3DA 1PJSA 4D43A 5TLSA 4XGRA 5SYNA 2HY7A 4XFKA 3LU1A 4CV2A 5HDQA 4DZTA 4J6FA 2ZSAA 2ZBUA 3G9QA 4WPGA 3IR6A 5LOVA 2PGLA 4D9JA 3CRW1 3KJIA 4B47A 1E3SA 1SQ0A 1KWKA 1K4YA 4X8MA 5E6RB 4RHFA 3UA3A 3TQIA 3WGUA 2C9BA 3UC5A 4Y2VA 1ESDA 3D8HA 2NZ8A 3SJBA 1H6CA 4URWR 5EP1A 5GGYA 3ZVKA 2DFVA 2F2TA 3QXJA 2Q4BA 2GFQA 3PGA1 3CKLA 4JI0B 1Y1KE 2D1TA 1J99A 1NQOA 3FG9A 1RM0A 2EZ8A 3OSZA 5DPMA 3BTVA 4KH1A 2QL7A 2CHQA 2O8DA 5ARCA 2Y68A 4P58A 1BA2A 3DL2A 4MGYR 5H9VA 5FAKA 4IBOA 1P75A 1CHNA 1OFTA 3F6EX 4TL8A 4U7PB 4ETWA 3AVOA 5B7QA 1KARA 2JLSA 2WU3A 2RH9B 3NO4A 3OVMA 2V54A 1R12A 3K35A 4UUNA 4M86A 3G49A 4XUGB 3ZD6A 5CDYA 3H4MA 5ADHA 4RADA 3EVCA 3G02A 4QNRA 4AXBA 1DOHA 8OHMA 5FOSA 3FSEA 4EENA 3GROA 4JC0A 3DDNA 3JQ7A 3M1IA 3MBIA 4BTLA 3HL0A 3Q3EA 3K09A 3E48A 4RZ3A 4HWRA 2BLLA 4LY6A 1E9SA 1UJ5A 5LWHA 2H07A 4JMPA 3SDSA 4J03A 3B48A 4K6GA 3F96A 3F3SA 3QLVA 4S1TA 3GP3A 4WXEA 2H59A 4KGZA 5HE9A 3WY9A 4CQLB 1FIUA 5B2EA 4Y2HA 1E1KA 3OAAA 4R1LA 2GZ3A 2VYNA 4KO2S 5I51A 1NAIA 2FN3A 2JJ1A 1ORWA 2Q28A 2R5NA 3IBGA 4O4JB 3S2UA 1K63A 3TM4A 3FF1A 2WJYA 4HF7A 4KXFB 3I5XA 4MQFA 4Z9FA 4D99A 4JLUA 5CDHA 2X0RA 4FGSA 4D4LA 1GQFA 2XUOA 1CUFA 4A8JA 2B4QA 1K7CA 5KYUA 4G0UA 1WKBA 1K08A 2HQSA 3GG9A 4QDTA 1O6FA 2BMVA 5DIFA 1K8QA 4FFSA 4IJWA 3W6ZA 3VPXA 2EARA 2QN7A 2DEUA 1KP3A 4KIFA 4DNOA 1IIBA 4BMZA 5KTKA 2FMXA 1CRQA 4Q66C 4JJIA 1XDZA 4U8GA 1ORDA 4UFNA 3KEGA 1I4DD 2IPLA 2HDOA 4YJGA 1YWGO 4MRNA 5C8DA 3UUFA 1BXRB 2L17A 2L42A 3FCOA 2IXFA 1K0UA 2G4LA 1X7YA 1Y1LA 3NHJA 5T8KC 4WZAB 1NF8A 4WBNA 4NCHA 3S99A 1IWPB 3A3OA 1B23P 2RGWA 5AI9A 1UM9A 1IPEA 2H2HA 3G2JA 4J94A 4GR4A 1DLJA 2MOKA 1ZLXA 4IYRA 4EF5A 1XD9A 3KJGA 4YRJA 2QPTA 1KVQA 3ZU6A 4BNNA 2EP7A 2GAOA 3U7JA 2GZHA 3AZOA 3EIHA 1VMDA 4ZODA 4EG5A 4ZYXA 1HQDA 3AUAA 4YXWA 3N0RA 2Q1WA 2YZKA 3D6FA 2QL9A 2JFWA 2C2KA 4QOJA 3AZPA 1V8DA 3G2LA 2C7PA 1TADA 5ALFA 1KPIA 4M87A 2KBFA 1VSBA 2ORIA 3IQXA 4GPD1 4L9RA 1Y9ZA 3IAS1 4DIUA 1M2GA 1WXGA 4P0PB 5EQDA 3QBVA 3JZIA 1G8FA 3GGSA 3K8ZA 1JSZA 2WI8A 1OXUA 3D6VA 3WAKA 5HW0A 3MWEA 2FWNA 3WAGA 5I3ZA 3HHPA 2XECA 1B1AA 2ZSKA 2QQ5A 1DAEA 4YP