3OM9A

T. gondii bradyzoite-specific ldh (ldh1) in complex with nad and oxq
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
329
Chain Sequence
b'PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQAPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate dehydrogenase
molecule tags Oxidoreductase
source organism Toxoplasma gondii
publication title T.Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ
rcsb
total genus 111
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3om9A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3om9A02
2AG5A 2NTJA 4BNWA 2P4QA 4CMCA 2V6FA 1JN0A 2DBZA 1O5IA 2A94A 1BDMA 2ZCUA 3W8EA 5CDTA 3RUFA 2C82A 1NPYA 1PZGA 1VLLA 1NPTO 1I30A 1O89A 3PZRA 4M54A 4P4LA 4R1NA 3O26A 4J2OA 3HG7A 2WTBA 4FFMA 2VQ3A 1LQUA 1H6DA 2EW8A 3BTSA 3QVOA 4PRLA 1IZ9A 1NM5A 2P68A 2CFCA 2YFHA 3NT4A 1A4IA 1HLPA 2QRKA 3JQCA 1WNTA 1ISHA 2C59A 4OSPA 4YA6A 1KEUA 1BSVA 1FF9A 4U6QA 4BNVA 2EKPA 2CUKA 3MEQA 5IDYA 4XIYA 3I9KA 3ASVA 1HSZA 3UCFA 2VNAA 1ML3A 3LC1O 3DTTA 1YJQA 3FPLA 5GZ1A 1E3IA 3H65A 4R9RA 4H16A 3JQ8A 3U49A 3GDOA 5F5LA 1YWGO 1Y9EA 2VRBA 2IODA 2P2SA 5AXCA 2EIHA 1PJQA 3LSYA 2DQ4A 3ANLA 4NBWA 4XCVA 4F3YA 3G17A 4EJ6A 2XF8A 3WTBA 2WM3A 1LSSA 3QVXA 1E3WA 4DREA 4PG8A 3LLVA 4LSMA 5CDSA 3CZRA 4DPKA 2GO1A 2CZCA 3PGJA 4IDEA 4N18A 1I3NA 4U7WA 1TB4A 1X1EA 3OF2A 4HFMA 3VZPA 2HAEA 3PXXA 4F6LA 2ET6A 4QTZA 1ZK2A 2BFPA 3TRIA 5L9AA 1VSVA 3HADA 1RYDA 1P9LA 3I4FA 5FI3A 3KTDA 4IS2A 4AG3A 4AJ4A 2P5YA 2AQKA 3QJ5A 3P7MA 3WGQA 2GD1O 3Q0EA 1PQWA 1PTJA 3ADPA 4CM9D 3DHYA 4ZD6A 1JLLA 1KBZA 1YH3A 4DPLA 4LCEA 3BTOA 4PG4A 1ZEMA 3GN2A 3SBOA 4GVXA 4R69A 2FZWA 4J7XA 1YQDA 3KV3O 5EQFA 3D3WA 4WEOA 3UF0A 2VT3A 1BGVA 1Y8QA 3INTA 4RO0A 4N5NA 4XX0A 1P1FA 3N58A 4P22A 1DAOA 3MOGA 4WNCA 4EEZA 4RORA 1G1AA 1W8DA 3Q3CA 5AQ1A 3T4EA 5MGBA 5A9RA 2YY7A 5L3ZA 1KEPA 1P1RA 2YZ7A 3EDMA 1GCOA 2Z95A 3IIEA 3WLEA 3DBLA 4ALIA 4IMRA 3ZWXA 5FWNA 1T26A 3GZNA 4RVHA 4CM4B 2LDBA 1XU7A 4PG6A 3A06A 1PGQA 3ROMA 1PGJA 3DR3A 2RH8A 1CIVA 5TQVA 4BMNA 2C20A 4DIBA 4CMJA 4XWYA 1P1IA 2HU2A 1QYXA 4PVCA 2DUWA 1B14A 4KWIA 4EBFA 3BHMA 3CUKA 3IP1A 2DUUA 4DRYA 2B37A 2YDYA 4NI5A 2DU8A 1N92A 5B4VA 1E92A 1BMDA 3H5RA 3PJFA 4J43A 1EEHA 5COQA 4OSOA 4J7CA 3BZUA 4E0BA 2HMVA 3HB4X 4IQ0A 1PEDA 2VHZA 1W0CA 1ZK3A 4Q3AA 4MVJF 2O4UX 5C7OO 3L77A 4FOSA 1J5PA 3VOSA 1ZJZA 4PLCA 5I7EA 4FN4A 1LLQA 5DT9A 3TZQA 1D3AA 3K30A 3M6IA 2VCYA 2A92A 4HBGA 4CLRA 3KSUA 3M1AA 3GVHA 3ONFA 4K9DA 4YT4A 4IGFA 3TL3A 3KUXA 4I08A 4QXMA 1DC3A 4WLFA 1WDMA 5JMPA 4BNJA 1NR7A 5C5IA 4URFA 2X0JA 1K89A 4OL9A 3U4CA 1TT5A 2EF1A 4CMBA 1KVUA 4YEDA 1EK5A 3PPIA 2RIRA 1NAHA 4A73A 4TKMA 4WCFA 2GN4A 3AK4A 3E9MA 4R5HA 1X0VA 2J5QA 1BWSA 2PLAA 4LSWA 1Y8RB 2Y05A 1QR6A 3GDFA 3O8QA 3MOIA 1VRWA 2X0RA 4M89A 4E12A 1P0FA 3QV1A 3AM4A 4O5OA 1ISMA 3GMDA 1ISJA 1YDWA 4PRKA 4D45A 3SVTA 1XYGA 1YE3A 2BD0A 2Y67A 3PFFA 2DPHA 1P33A 1GUFA 4CODB 1SAYA 1V9LA 4I5FA 4PLVA 3S8MA 2NU7A 3G3EA 4I5DA 4IIVA 3M2PA 1T2CA 4IJVA 4XGIA 4IXWA 1XQ1A 3CZMA 3OBBA 1GCUA 4BQPA 5L51A 3FRJA 3WMXA 5JO0A 1DEHA 3QWFA 1GL3A 2IZ1A 3K2BA 2D4AA 3TDKA 3LT1A 4N54A 4R41A 4H15A 2O3UA 2I5PO 1QORA 4YAKA 5COAA 4C7KA 2O48X 3EHEA 2Q45A 2QQ5A 4J1QA 5HRUA 5A05A 4M87A 4OOFA 4O59O 4YT8A 4S3MA 3I9MA 1I36A 1LLUA 1Q2XA 4YAEA 3VVBA 1RM5A 3E9QA 2J3HA 1OOEA 1DLJA 4ZRNA 2IYPA 4CMAA 3UFXA 1A7AA 1J4AA 4BKOA 1GYPA 4JJFA 4GI2A 1GFSA 3JQ9C 3ST7A 2F1KA 3HB5X 4BL5A 5L7WA 4XDZA 5CAEA 4D0RA 1CRWG 4IJUA 2W2LD 3O38A 1FMCA 5ER9A 1MXHA 4E33A 1T2FA 4TVOA 3BA1A 4BKQA 4E13A 1LLCA 4BO0A 1H6BA 1GV0A 4RF4A 3RSHA 3E5MA 5IAAA 5T6BA 3EW7A 4BB5A 3TZHA 3ZI0A 1XA0A 2JCYA 2VWGA 1YBVA 1JDJA 1WDKA 2O3JA 1Y8RA 1FDUA 3K2EA 4GQAA 4MVJI 3DQPA 2FPGA 4PLTA 4RPHA 4LVUA 1VKOA 3NDJA 3WICA 3A1NA 4JGBA 2BRUA 3IMFA 4BO9A 3WGIA 2ZTUA 1RWBA 3ABIA 1ZW1A 4W99A 1H93A 1B3RA 1ZMTA 3Q2IA 4IBOA 3RKRA 4CL3A 3RKUA 4D0SA 4DXHA 1LDBA 1EUCA 4JBGA 2XAAA 3TOXA 4BNXA 3O03A 5BSEA 2GZ2A 4MIOA 3VC7A 3GRKA 1T2EA 4CR6A 3EZLA 3RASA 2AHRA 3T4XA 3OIDA 3GG9A 1WAMA 4B7CA 4UVIA 3EMKA 2E6UX 4IY1A 1UUFA 2PNFA 4YRBA 1U28A 1UXIA 1VSUA 1D1TA 3HN7A 5JAMA 1Z7EA 2EKLA 3I6IA 4NFYA 1U3UA 4ZN6A 2VYVA 3H3JA 2D59A 3L9XA 2I9PA 2Q49A 2B0JA 1ZNQO 1DDOA 2X6TA 3H7AA 2W4QA 2G82A 5JDCC 5HWSA 3DZFA 1GUYA 1C0IA 1GYRA 1BHSA 5T5QA 1UZNA 3TL2A 2NSDA 4FJ0A 4XR9A 1NHWA 3K31A 3LQFA 1DC5A 1E7RA 4FC6A 4OOEA 4CLXA 4L4XA 1YB1A 3BMQA 3KLMX 2BGMA 2OO5A 5EJ2A 1W6UA 1CQJA 3E03A 2P91A 4KZPA 4Q3CA 1ENZA 1PJLA 2NTNA 4IUYA 3DZIA 3LK7A 3FBGA 3GG2A 2DTEA 7ADHA 1DAPA 3RBXA 4IZHA 1SO8A 1XELA 2C29D 1CETA 1YRLA 4Y67A 4CLOA 4D3FA 2WEKA 2IXBA 5EIOA 3ZHZA 4ZQFA 5KNLA 4KQXA 2HK9A 2J3IA 3GFGA 2NNLD 4MOWA 1UDBA 3NJ4A 2XOXA 4PCVA 1XSEA 4KQWA 3H8VA 3FI9A 1SZJG 2I3GA 4DVJA 1I3MA 2FPIA 3FNGA 9LDBA 2YYYA 3VZQA 2JCVA 3OM9A 3D4OA 1JVSA 4RPGA 4UEKA 3DC2A 2W90A 4FIZA 1DRWA 2B5WA 3S1LA 5GZ3A 4OGWA 2C2XA 3S2GA 3DBHB 1LNQA 3GUYA 3FTPA 2E49A 3AFNA 3KSDO 2WD8A 4J90A 2UYYA 4CV1A 5ILOA 1Q1NA 1NVTA 2DAPA 5EESA 3R6DA 3H9GA 5I8ZA 1I3KA 4ZICA 2VOJA 1SOWA 2BHLA 1E1LA 4WUVA 1NWHA 3IJRA 4E5YA 3OJEA 1JKIA 1ZO8A 5IZCA 2R00C 4JIGA 1QV7A 2Y68A 3P2OA 1I2BA 1GTMA 1PJCA 1GYQA 1MFPA 3JYPA 3GK3A 4WK6A 3GHYA 5JMWA 3OH8A 5EINA 1ZUD1 4AFNA 2YDXA 4HP8A 3Q2KA 1LLDA 4KOAA 4RV9A 4MO2A 5KCZA 3BTVA 3IP3A 1SBYA 5IZCC 3UH1A 1HKUA 5TC4A 3W8DA 3WBBA 1NVMB 4YPOA 2X23A 3SC4A 3FHLA 4D44A 1IE3A 4FGWA 3LZ6A 4AICA 1V6AA 3S2FA 6LDHA 3ADOA 3S2IA 1R12A 1QG6A 3C7AA 4I5EA 4M1QA 3HHPA 2NVUA 2C5AA 3L9WA 5L40A 4ZHSA 2BI8A 3DBLB 3Q1LA 1TA4A 1U3VA 3UAGA 4AJLA 3KXDA 2X22A 1NBOA 4UUNA 4OAQA 4CM3A 1MXFA 4EUFA 1EBUA 3E82A 2DBRA 4CLHA 4YBZA 3GNQA 3CH6A 1ZH8A 3QY9A 5TJ9A 4NJOA 2Q99A 5I9MA 1R66A 2PD3A 1F14A 3KRTA 1EVYA 2OOSA 4JX8A 3WOHA 5JBIA 1XG5A 1IB6A 4I1IA 4OO3A 4YB8A 5EN4A 5A9TA 4A03A 3AY7A 2FMUA 1VC2A 1H9AA 2NLOA 3WLFA 2UV8A 4L4SA 2FZEA 2AQIA 1GD1O 3PWKA 3U0BA 3WSVA 4CM1A 4UULA 3I1JA 1YBAA 3LT2A 1VL0A 3C1TA 3L6EA 4PLZA 5A9SB 4JP2A 4O0LA 2VYVD 3FF4A 1E6WA 4QSMA 4QO8A 2HMWA 3V2UA 2VRCA 3H2SA 4GMFA 4Q39A 1KY4A 1TI7A 4LISA 4XDYA 3E6AA 1T4BA 3MTGA 4YJFB 4FFNA 3EK2A 4E5MA 2LDXA 4DBVO 3CEAA 1NR1A 2ZTVA 1PWZA 3KYCB 2Z1MA 5IDXA 2IDZA 1EUDA 5T57A 4I5GA 3GPDG 1RM3A 3SC6A 4UVEA 2ZK7A 1Y81A 2YHIB 3U62A 5DN9A 3TZKA 3ZV4A 4OKIA 1VJ1A 1SNYA 1HDCA 3CKYA 2HCTA 2ZB8A 3D1LA 3GZ4A 4NBVA 4K28A 2PKRA 1NQ5A 1YVEI 2I76A 4EYEA 1EVJA 2PV7A 2JD2A 1H5QA 3DZGA 5A3VA 2EP7A 1Z45A 1V0JA 3DAGA 1N9GB 1M2WA 3KYDB 4KUGA 4NFSA 4CJXA 1ZCJA 3JQAD 4YJGA 1V3UA 4BMSA 3DBHA 4BKRA 3LC7O 4NJMA 3FPCA 5GMOA 1GPJA 3WYCA 4IDGA 3ZWAA 4B4OA 1Y1PA 3H9JA 2B69A 2JL1A 4LW8A 2NU9A 3C7DB 4L4RA 3GC6A 4NFHA 2VWQA 4Z0TA 3WDSA 4E6PA 1BXZA 3HSKA 4G65A 4FB5A 1P77A 2EERA 2OXIA 1JTVA 3GNTA 4YAJA 2Q4BA 5DBGA 3OJLA 4ILKA 5TRTA 4PZEA 2BI7A 3QW2A 1E5QA 3V8BA 2JAHA 2IXAA 3TZ6A 4LRSB 1LEHA 4BNGA 1VPDA 5JLAA 3W6ZA 4C7JA 2VUTA 1UP4A 3WGHA 5IXSA 1GADO 2R00A 4M86A 3GZNB 4II2A 4XRRA 5H82A 1C1DB 3JYLA 1E3WB 3L6DA 4MKRA 1UP7A 1B26A 2O7SA 4ZGWA 4Z3DA 3IKVA 1Q0LA 2FR0A 4MVJP 4YYZA 3ENKA 1KEWA 1B15A 1B8PA 1C0PA 1M76A 1XWFA 4OJNA 4XD2A 5F1OA 3KSZO 4KMSA 1WZIA 2Q1SA 3F9IA 4JBHA 1ZIDA 3K8ZA 4ND5A 4D41A 1HE3A 2GR9A 3GVXA 2BFOA 4CQLB 1M6WA 5IN4A 1PWXA 1PGPA 2GASA 1W4ZA 1EMDA 3ZU4A 3LVFO 4JK3A 1DSSG 2W2LA 3I52A 4NH4A 1BVUA 4CM5A 1HLDA 4PG5A 4JLWA 1EVIA 1FXSA 3ETDA 1KVQA 2F00A 2WYUA 4EDFA 4EUHA 2I3AA 2G1UA 2AQHA 1ZEJA 1UJMA 4DLAA 1U8FO 2ZQZA 1DIAA 1B16A 3D64A 3GVPA 4K6CA 2CDAA 1KC3A 3VKUA 2O50A 5BR7A 1G6KA 1ZXBA 4GGOA 4CMHA 5TT1A 4AJOA 3QSGA 2JKVA 4JJGA 1WVGA 5JS6A 1V8BA 4RF2A 4BIIA 2EW2A 3GOHA 3S2EA 4NHEA 3JQDA 3TN7A 1B0AA 1U1IA 1MV8A 2BFMA 3AI1A 5BNIA 2Q1TA 5AOVA 3GFBA 2DKNA 5CHEA 3VPFA 4WNIA 5H83A 4XYLA 4NBTA 1D1SA 2P9CA 5CG2A 3GN1A 3K5PA 2AXQA 1YOVA 1E3LA 4P4GA 1M75A 2PZLA 4MINA 4OH1A 2WDZA 3OQ6A 4QEDA 3ITKA 1I10A 5ADHA 3ZWOA 3WBFA 1I2ZA 4GH5A 1C1XA 3JQ9A 1PR9A 2VNSA 3U5TA 3KETA 1R4MB 3AOEA 5G4KA 2Q1WA 3NKLA 1H2HA 3CMCO 1GQQA 4CV2A 1NQTA 1Q7GA 1HF3A 1O6ZA 4MP6A 3ZWNA 2CF5A 1ONPA 1GUZA 3QWIA 4Y98A 3NAQA 4GVLA 4D42A 1SC6A 2E48A 1DIGA 2I6TA 3ZV3A 2ZTMA 3UUWA 1YQGA 5F3RA 1H6CA 1VL8A 1JA9A 1MC4A 2UVDA 4W9NA 4DC0A 4R1TA 4PVDA 5JDIA 3ZWBA 1DHTA 2GGSA 4E5KA 1DC4A 3IDSA 3WB9A 4RQUA 2YV1A 5DOVA 1N1GA 2AE1A 1BXGB 1R15A 3RQSA 4R16A 2ZIZA 3INGA 3VZSA 3B1FA 1V35A 2Y99A 4DA9A 2ILTA 3DL2A 1F8FA 3PQEA 1ULUA 2VHYA 3RBZA 4PZDA 3GGPA 3VVCA 3D3EA 4L73A 4ZQBA 1H2BA 4PLFA 4LK3A 5K9ZA 3QP9A 4Z0HO 3K96A 4P4NA 5CG1A 2X9NA 2UUOA 1P44A 4YJFA 3HE3A 1U9JA 5IFLA 4BNUA 3Q6IA 3I3OA 3D5QA 4MIEA 5KTKA 4YRDA 3H5AA 1NX6A 2FRDA 4F45A 4U8GA 3MJSA 3W6UA 2JFHA 4EEXA 5K6AC 1N7HA 2NACA 4E5NA 1IHYA 1T4DA 4LVCA 1MA0A 4A27A 2B4RO 2J6IA 3C1AA 2Q3EA 1LDNA 1NFFA 4ND1A 1PZHA 5L53A 4YR9A 4UAGA 1VM6A 2YHIA 1NNUA 1LJ8A 4IDCA 4EW6A 1LA2A 5HS4A 4FOOA 1WLYA 3VAZA 3IJPA 4MPDA 2EXXA 3IOYA 1HZZA 2EV9A 1ZK4A 4XYMA 1S7CA 1UXKA 2W98A 4TRJA 4EUEA 3W1VA 4B79A 4R01A 4A26A 5HA5A 1SOVA 4GX0A 5A5EA 2HUNA 3RD5A 3M2TA 4TRMA 2PD4A 5C7LO 3RWBA 3K9QO 1DFGA 4O63O 4WGGA 1F17A 4RLSA 3VDQA 3C85A 4D3DA 2GPTA 1V3VA 3GT0A 1U4SA 5DBIA 4OMUA 3AJRA 1IY8A 2GN8A 1GQ2A 3TQHA 2QZZA 1LRJA 3UHAA 4BO1A 2Y1DA 3AW9A 4FFRA 4AJJA 4J49A 1ORRA 4GX1A 2IRWA 1HSOA 1NPDA 5DCWA 4A10A 3DZKA 1CEQA 4INAA 4WOJA 3ENNA 4Z0PA 3W4KA 2O3QA 4XQCA 1GY8A 1X0XA 2FY8A 3KHUA 1R6DA 4TMFA 4UVHA 1X13A 1DBVO 3H4VA 4J9UE 4TROA 1R37A 4U0JA 1HDXA 1YDEA 4J91A 4MVJH 5FFFA 3U4HA 1M66A 3FD8A 5A02A 1MUUA 4LRTB 2JHGA 4TSKA 3VPSA 1XR3A 1UDAA 2A4KA 4P38A 1ULSA 1ISFA 1I33A 3NT2A 3ZV6A 4ND4A 3QHAA 1MLDA 4CLDA 2ZATA 2VWHA 3INRA 1FJHA 1OI7A 4DTIA 8LDHA 1LXCA 4B7XA 3U09A 4FFOA 3UOGA 1E5LA 3WSWA 2YHUA 1SB9A 3OIFA 2DC1A 5JAZA 4RLHA 4G81A 1FDWA 3GGOA 3PQDA 2E37A 5G0VA 1WXDA 3OICA 1Y5RA 4MP8A 3NGXA 2R6JA 5JFOA 3HDYA 3WGTA 5KVSA 1X15A 4CMEA 2O4CA 2JFGA 3RFXA 1HDGO 1HZJA 5TGDA 2H1SA 1AXEA 1OZAA 5HS6A 5A5FA 5CEJA 4J3FA 3R3JA 4FJ2A 1ZFNA 1O8CA 2VWPA 4N7RA 1E1KA 4S1VA 3D4PA 3B1KA 4FC7A 2CVOA 1YOVB 2NV6A 3JD4A 4W9NC 3JYNA 2GUGA 3L4SO 2OORA 4R4JA 4BS9A 2AQ8A 3HN2A 3PHLA 3Q9NA 5AXAA 5DDIP 1A9YA 5KVCA 4RVUA 5KJFA 3DFUA 1J6UA 2Y1FA 1QV6A 4LN1A 3PHGA 4I9NA 2P4HX 4PLYA 3RJ5A 1C14A 1UZMA 1SEPA 3NTQA 3IUSA 4FGSA 5BSFA 4KDEA 2BMAA 2VOEA 3EYWA 2Z1NA 1R4NB 4KUHA 1EE9A 1S6YA 3BMNB 1DB3A 4GSLA 3HJAA 4NK5A 3O8QB 2RH4A 4NZ9A 1R4MA 3R1IA 4A2CA 1PR3A 3LF1A 3AM5A 1U5AA 4XB1A 1H9BA 1P1JA 1HL3A 2EWMA 1HYEA 4UUPA 3ORFA 3BTUA 2H9IA 4LMPA 4KWHA 3DOOA 3F1LA 3WGGA 3ZCXA 4AJKA 3KEOA 3RU9A 3O9ZA 4XA8A 3PIDA 4BGUA 5T64A 1HEUA 4XGNA 2J5KA 4CM8B 1LDYA 3E18A 1JAXA 4BO7A 3TOZA 3BYZA 3CE6A 5JCJD 1PJSA 4BGVA 2NQTA 4BKUA 4NDNE 4QT0A 5A4DA 3GHHA 2OHXA 5JY1A 1Y8QB 4FR5A 5EMHA 3MZ0A 2HRBA 2O2SA 3FNFA 3HWRA 5CDYA 1DJNA 2WD7B 3UVEA 5I9NA 4FD3A 1K6XA 2V7PA 3HDQA 4RPKA 5L95A 4XB2A 3ROQA 4XQ9A 3SLKA 1U8XX 2GF2A 1F12A 3VH2A 1OFGA 4R1SA 4IQ8A 4ZQEA 3OEYA 5T8KC 2PR2A 1NQOA 4ZRMA 5ICSA 4RVDA 4WCDA 1BXKA 1H0KA 4TKLA 1LI4A 1X7GA 4RF3A 2GRAA 4GMGA 3WWZA 1H6AA 4MVJA 4E32A 1WWKA 4AJ1A 3VDRA 4ALNA 3VZRA 1YJ8A 1QYCA 3WNQA 1PJ3A 3LLSA 2AEJA 3L4BC 2EHDA 2HRZA 2J8ZA 4BVAA 4BNHA 4XIJA 1XU9A 3JCZA 4H3VA 1BW9A 1SMKA 1A4UA 1DLIA 3WMWA 1JWBB 4XR4A 5K0ZA 3FSRA 4FFPA 3H5NA 1DFHA 5TX7A 2QX7A 1B8VA 3OHSX 4HFNA 2GERA 1A5ZA 3N74A 4R5MA 4YJDA 2Y0EA 1EQUA 1ZXLA 1LDEA 5H81A 2D2IA 9LDTA 2FSSA 4BNZA 3AY3A 5DP2A 4IDAA 2CY0A 3BHJA 3DHNA 1VE9A 2D5CA 2FR8A 2GDZA 4GWKA 3ZGYA 2GSDA 2G76A 5JC1A 1JAYA 5TSDA 2OP0A 3DXFA 4ID9A 1PGNA 5G0WA 3ICCA 3JQ7A 5BSHA 3WQSB 3OJOA 5DNAA 5B4UA 1DOHA 4TWRA 3PTZA 3PJGA 3DBRA 3JQGB 1Y6JA 5L45A 4HWKA 3E1KA 1QKIA 1ADBA 3KYDA 5BNFA 4E30A 2D0IA 4NR0A 4FQ8A 5B12A 2Y1OA 1GDHA 3FWZA 1XCBA 2X4GA 4MIYA 1I01A 3UW3A 1QLJA 1E1NA 3I6QA 1IPEA 1DC6A 3H9QA 4E3ZA 4ZU3A 1KETA 5AXBA 4ALJA 5G4LA 2X5OA 3V2GA 4TZTA 4XRGA 1VJTA 3WGOA 2ZYAA 4I9UA 5THKA 3M1LA 1UAYA 1PQUA 3F3SA 4DYVA 3MWEB 1QRRA 2YJZA 4J6FA 1UXHA 4CQMB 4KP7A 5K6AA 5A3JA 1UR5A 3CIFA 4L0QA 5JYDA 5JYEA 3DTYA 2UUPA 4DPMA 3KEQA 4XZ3A 2D1YA 5L4SA 4NU6A 3WYEA 4W6ZA 2QG4A 3FTNA 1RPNA 1PGOA 4DQXA 3AY6A 2D8AA 5DCYA 1NWCA 4HFJA 3E48A 4YAGA 4B4UA 1I8TA 5L7TA 1E3SA 4H7PA 2W8ZA 4Q3DA 3EAGA 1PL6A 3G1TA 4CM6A 3U4DA 4OXYA 4RL6A 4AL4A 5IXYA 4BGIA 4BO5A 1A9ZA 1TXGA 4OKNA 1AHHA 1NASA 4XKJA 3JQFA 4KDFA 3UICA 2HK8A 3ZDFA 3GEMA 3ZU3A 1GAEO 4BMVA 1PSDA 1LX6A 3R3SA 4HFRA 1P1KA 4MP3A 1BDBA 1KS9A 1JWAB 2YQ4A 3RC2A 5ICMA 2WE7A 2ZJ0A 2WYVA 1ZMOA 1MG0A 4L74A 1K6JA 2H6EA 4E2ZA 1F06A 1O95A 4DIOA 1P45A 4XGKA 4XEHA 3BMCA 3OA0A 1N1EA 5T8KA 1FDSA 2Q46A 4O1MA 3SXPA 3L07A 5DF1A 4Y6SA 1PJTA 1KERA 4CLEA 1UXJA 1B7GO 2X0IA 1LBEA 2B5VA 1ARZA 1PS9A 1ONNA 2GN9A 2OUIA 5CPBA 1SEVA 3I4CA 4L75A 2BFAA 4TRRA 1J0XO 4U5QA 3OQ1A 3PHHA 2B83A 5FYDA 3G79A 2PGJA 1HDYA 2PGDA 2X86A 3G1UA 4YAIA 2Y66A 2ZYDA 5F5NA 2DPGA 1GZ4A 1RM4A 2VTDA 5ENVA 3DAFA 4EI2A 3JD3A 4W7IA 5BQFA 3BMQB 1NVGA 3N7UA 3GDGA 1LTHR 1UXGA 3MTJA 3VTZA 3HZZA 4J1TA 1IPFA 2IEBA 2ZJ1A 3IUPA 1NYTA 2C2YA 2PZJA 1A72A 3KB6A 5IF3A 1IOLA 4IJWA 3CPSA 1Z75A 3I9OA 1ZK0A 1QP8A 1OMOA 1O0SA 4QECA 1Y9AA 5JY6A 3SEFA 4PLGA 3ON5A 3TZCA 3SJUA 3RUEA 3WXBA 3TFOA 2Q50A 3DZBA 1GZ6A 5C3MA 4N5LA 5HM8A 4OM8A 4IDFA 4A7PA 3FBTA 4DYDA 4IINA 5G0TA 5IN5A 1HYHA 2AMFA 4D7AA 4BNKA 4CMEC 2PD6A 4A0SA 2POQX 3U4IA 5DBFA 2I65A 1K3TA 2UDPA 4CM9A 4PN3A 1NXQA 5GZ6A 3NUGA 2PKQP 5TLSA 3B1JA 1SCUA 4ONEA 1E7QA 4FJ1A 3AUTA 1E6EA 1LQTA 3PGXA 4UREA 3VHRA 2ZKLA 4DL9A 3ZW8A 1EZ4A 1Z6ZA 1QXSA 1YL7A 2IZZA 1LU9A 3AI2A 1V3TA 3JQEA 4WLNA 1MGOA 3MCVA 1JKJA 3OECA 3MJCA 1HYGA 3ZHYA 1HE4A 2HMUA 2HJRA 1M67A 2FOIA 3DWFA 1X1TA 4E2WA 3UKOA 1A71A 4Q3BA 4MVJD 4CR8A 1WDLA 1TT7A 3W4JA 5B4TA 3ZHBA 2AEFA 2GN6A 3H9UA 3CMMA 4JQCA 3ZNOA 2YV2A 3NYWA 1M6HA 5G0UA 2SCUA 3AM3A 4OYRA 1E0DA 2OBYA 2QRLA 2QYSA 4XYGA 4A5OA 1PU2A 1L7EA 3VKVA 2WD7A 4RVFA 4WCFC 4YTEA 3UCEA 3JYQA 1WW8A 4PLWA 2RHRA 3X2FA 1CERA 4BNFA 3PLNA 4DQUA 1U2DA 3AFMA 4TZKA 3C8MA 4XYEA 4ND2A 4OXNA 4DBZA 4O6VA 1PL7A 1FK8A 1PS0A 5LDHA 1DJQA 1VI2A 3RUAA 1FDVA 1WP4A 2QIOA 1YGYA 5JCJA 4D43A 2W2KA 1IUKA 1JU9A 3DBRB 4GX2A 4R1UA 4Y6RA 1PS8A 3RFTA 1ENPA 4JXKA 1X7DA 1ZSVA 4B4VA 1N5DA 2Q2QA 3C1OA 5KJCA 1IZ0A 2OBNA 3D4NA 4II3A 1BG6A 2GNAA 3STHA 2NM0A 1LC0A 2P9GA 4YCAA 1JKFA 1U3TA 4YJHA 4NPCA 3ZNPA 3NTOA 4B8ZA 2VRCD 4RZIA 4ALLA 3OSUA 1ZBQA 3JQFC 2EEZA 2UAGA 1VL6A 1Y7TA 4YT5A 3TJRA 2TMDA 3FN4A 2PGLA 1K2WA 3HDHA 4IDBA 2DFDA 1E3JA 1T24A 2O7QA 3DBVO 2CDBA 1ONOA 1BW9B 4RQTA 1HDOA 4IGEA 2JFFA 2C07A 1ISIA 2HK7A 2C54A 1I3LA 3PWSA 1AGNA 5KKAA 2O3TA 3WJ7A 1I2CA 4BQRA 3OETA 2DLDA 1K6IA 4PIVA 1T1SA 3RBVA 4GWGA 1BVRA 3F6YA 4Q9NA 2C5EA 1HWYA 4FSHA 4HY3A 3W4IA 4ESOA 3PI7A 4QUKA 4DWVA 4M8SA 4IDDA 1RJWA 4JN6B 3TWOA 4WOKA 4YRAA 2O23A 5F1KA 4YT2A 4HXYA 1DIRA 1IYZA 2NTVA 2I67A 3Q11A 3QWBA 1HETA 4IQGA 3FWNA 1RM0A 4JROA 3FR7A 1OAAA 1WMBA 2B36A 4WLEA 1B2LA 1D4FA 1MB4A 1LSOA 1XEAA 3EVTA 3GR6A 1G0OA 1C3VA 4QFDA 4U6SA 1LDGA 4HX5A 4E2XA 5JSFA 4IPTA 3JD1A 2X7HA 2NQ8A 3X2EA 2VTEA 4W7HA 2HMTA 3ZNNA 3QVTA 2Y1GA 3TFQA 4NQZA 5CEEA 4MKXA 3NGLA 4L8VA 2EGHA 3ZN2A 4JBIA 2X58A 3NT5A 2HJSA 3AUSA 1KYQA 3KLPX 4FCCA 2CSUA 2E4AA 5C7IO 4R68A 2HMSA 2FWMX 3KVOA 3OFSA 1R0SA 4XJSA 4YWJA 5JNLA 3JQBC 4DQVA 2BELA 1EK6A 3AU8A 1JVBA 4UVGA 3KYCA 3NDIA 4BV8A 4YVFA 1P31A 3DMTA 2EJWA 4WECA 1P0CA 1YB5A 3HUDA 3GEGA 3GAFA 3ZH2A 4CUZA 3ZV5A 1ADFA 4WKGA 3JQGA 4OQYA 1I0ZA 3MJVA 1YXMA 5JE8A 1MFZA 4GLOA 3PLRA 3G0OA 4XQEA 1DPGA 4J1NA 4K1LA 3ONEA 3VPGA 2PH3A 2VYND 5ENDA 3Q9UA 2CVZA 2NU6A 2DFVA 2NADA 1PJ4A 3I5MA 2IEDA 3T7CA 3FNEA 1P74A 1C1XB 5HBRA 4BNTA 5DZSA 4RCVA 1GU7A 2IE0A 4UEJA 3UGKA 3HFSA 3I83A 2EKQA 4EITA 1N8KA 1R0LA 1BTOA 3QRWA 1TT5B 2JHFA 1UZLA 3MJEA 4MVJG 5AYVA 2NVBA 2W2KB 2X1HA 1GZ3A 5KVQA 2WMDA 2ZB4A 3VH3A 2CDCA 2FHSA 5B37A 1E1MA 2RCYA 2XPCA 3EZYA 2V6MA 4J0EA 1GEEA 1TVEA 3HDJA 4HKTA 3PWZA 4MDHA 3OJFA 2JCXA 3LF2A 3RC7A 3ZU5A 3RU7A 5U9CA 1QYDA 3QWHA 4GAEA 3WQRA 4GLLA 3GEDA 4RVSA 5TJHA 4D46A 4JCOA 1ISGA 5DP1A 1NAIA 4RZHA 2JJYA 1KY5A 4IM7A 5AXDA 2BKAA 3L4BA 4OIMA 3A9WA 2G5CA 4MVJE 3ICPA 2GZ3A 5CDGA 4UEOA 3RFVA 2A9FA 3VPHA 3I23A 1B8UA 3IS3A 1GR0A 1KVSA 3WYBA 3W8FA 1XGKA 4W82A 1GV1A 1QSGA 1HXHA 1N2SA 4BNYA 4NNJA 4CL8A 4KTTE 2FP4A 2C0CA 1JQBA 2PTGA 4L76A 4NJMB 3AI3A 4OQZA 2TMGA 1IHXA 3PDJA 4NU5A 4P8RA 4CLOB 4CQMA 3K73O 4F6CA 4GX5A 4FFLA 1I24A 1YQXA 3BAZA 2YQ5A 2VN8A 5EL0A 3ONDA 4F46A 4PFJA 4WE3A 1EBFA 1E6UA 3HQ4O 3RUDA 3PDUA 4XJTA 3TF5A 2GCGA 4OHUA 3DZHA 3H3FA 5IDQA 1PZFA 1PQPA 2J3JA 3WIEA 4B8WA 4FDAA 2CNBA 1QYWA 2H63A 1KOLA 1D8AA 1CYDA 2HDHA 2B4TO 1E7YA 3GA0A 1DHRA 1SB8A 3D7LA 1OBFO 3OQBA 3WIDA 1G0NA 1QMGA 2D5AA 2PZKA 3PEFA 5I9LA 2J5RA 1U3WA 3VPXA 2RHCA 4R3NA 4LCJA 3HFGA 2YFQA 3WQQA 3E5RA 3BMCB 3BMNA 4RPLA 1AUPA 2Z5LA 3QE3A 4GGPA 4XQGA 3V1TC 4AJIA 1ADCA 4YXFA 2RBEA 4HV4A 2VHWA 4RJTA 4KUEA 2NVWA 5CPFA 3OJ0A 1TLTA 4R51A 2DTDA 3LDHA 3L6OO 1YO6A 3MWDB 1E7SA 3GVIA 4TRNA 1U2GA 1CF2O 4G5HA 2Y1EA 3GQVA 2O3SA 3I9JA 4LMRA 3GMSA 4CUKA 3S55A 2ZB3A 2BGKA 4PG7A 4FS3A 1A27A 2JD0A 3DO5A 2ZCVA 3R0IA 1W73A 1Q7BA 4XYBA 5A9SA 4CV0A 4E4YA 3DMTC 3PVZA 1EVZA 2Y0DA 3DHEA 4CUJA 1Z74A 4ZVVA 1Z82A 1ZVMA 1HDRA 1Q7CA 3F4LA 2PZMA 5J23A 3C24A 5JAQA 3GF4A 2C7GA 1JW9B 2WYWA 3KBOA 4Y9DA 4FPXA 5A04A 1VKNA 1HT0A 2VHVA 1T2DA 2PFGA 4ITUA 3WWYA 5HTOA 3P5SA 4R3WA 4J4BA 5CP8A 4Y6PA 4YQZA 4BNMA 4EJ0A 2AA3A 1ZJYA 3RVDA 1ZSYA 2EGGA 1IULA 3NV9A 2B35A 4ND3A 4E21A 3B20A 1QLHA 4UVDA 1ENOA 4RGBA 4E31A 2BLLA 5BSGA 1TEHA 4EZBA 5I7FA 5IG2A 3BHIA 3KYBA 4Z9XA 5G0SA 4GBJA 1YONA 3WJAA 1EDOA 5I8WA 1F8GA 2PY6A 1XQ6A 1YKFA 2OZPA 3DMYA 1YB4A 3F5QA 3PJEA 3ZNQA 1PJ2A 3ZU2A 4DC1A 2X5KO 5KKCA 1EQ2A 3IL2A 4J2HA 2ZYGA 3H6KA 4QO7A 5FI5A 3RROA 1EUZA 1WMAA 4ZQGA 3JSAA 3QWAA 3ZWYA 2PH5A 2OL4A 3EVNA 5G4KB 5KOIA 2VZ8A 4AJHA 1YL6A 4AJNA 1A7KA 1T25A 3GVCA 1H94A 3AWDA 3RIHA 4ALKA 5U4QA 3H9EO 3E8XA 1ENYA 5L4NA 5GY7A 1C0LA 2X9GA 3SJ7A 4BNNA 4ALMA 4GPD1 8ADHA 4BO2A 1GQYA 3FR8A 4UUOA 3T7EA 4YACA 4BV9A 1O9BA 3IQDB 1E7MA 4E2YA 5U1PA 1UP6A 4NG5A 4WASA 4Z6KA 2O2YA 4HNHA 4GL4A 5TT0A 1UH5A 3O4RA 3ZHXA 4D79A 5LCXA 3ASUA 3JQ7B 4NMHA 5CFZA 3LC2O 1D7OA 3B70A 3ROPA 6ADHA 4IXTA 2BF7A 3FNHA 4CMKA 2AW5A 4R54A 2B4QA 1YS4A 2G0TA 3D3WB 1PZEA 3QVWA 1O94A 3D5TA 3RC1A 5CEFA 4BNLA 4Q3NA 5JO9A 4BO4A 2XXBA 4WCFB 4CMIB 1LSUA 3A14A 5L7YA 1NFRA 2CD9A 1MP0A 4J16A 3K6JA 1YBMA 2Y93A 3AU9A 3PRJA 1T1RA 1I5RA 4WLVA 3KM0A 3V1UA 4YJHB 3FCOA 3JQAA 5CDUA 2NUAA 3PP8A 3DOCA 3CXRA 3GLQA 1Z73A 3ZWMA 5KVVA 3OA2A 5JXWA 2OFPA 4CV3A 3U3XA 2VUSA 2YW9A 3LT0A 1VJ0A 4I9HA 3LT4A 3RC9A 3PQFA 1EFLA 3PFWO 3EUWA 3OMLA 3IAHA 4GKBA 2I66A 4X54A 5JW6A 3ETGA 3RJ9A 5EQDA 2WE8A 3UCXA 3KOUA 3HNPA 2EP5A 5DOZA 3I9NA 3OP4A 4AVYA 3VTFA 1Y5MA 1EFKA 1L1FA 4OXKA 2CF6A 3WTCA 3L0DA 1BRMA 1E7WA 2YUTA 3ETEA 2H5LA 3I9LA 1MX3A 3RAJA 3ZWWA 2QRJA 4I8XA 1LUAA 4BKPA 4E5PA 5THQA 1U4OA 1BXGA 3ZWCA 1P1HA 3DEYX 3IKTA 2J3KA 1KEVA 3B6ZA 3MJTA 1AE1A 3JD0A 4RF5A 3UN1A 3GH3A 1KC1A 4RDIA 2QYTA 4CM7A 2VYNA 3AOGA 2VHXA 4U0KA 2PWZA 1GEGA 1N9GA 1ID1A 2HO5A 2C7VA 3KO8A 3ANNA 1KVTA 3NEPX 4MKZA 3EGOA 4WLUA 3V5NA 1DO8A 5JC8A 4DLBA 2AG8A 4DLLA 1HE2A 5ITVA 1FDTA 3DB2A 1EE2A 2RAFA 3LU1A 4N5MA 2FSVA 5T67A 3V2HA 1DRVA 4C4OA 4FBGA 3WG9A 2CMDA 4Q3EA 2X0NA 3ULKA 4J9VA 3WFJA 4ZJUA 1QYVA 3F46A 1RKXA 5DCUA 3QA9A 5KJEA 4EGFA 2GZ1A 3OIGA 3PJDA 3GGGA 3NTRA 2OGUA 4BOYA 1WPQA 5A1TA 4GKVA 1ZZEA 3EY4A 3WX0A 1LRLA 1NP3A 5DULA 4BNIA 4DUPA 2Q1UA 5ILGA 3LYLA 1XDWA 3F4BA 1XIVA 1LDMA 3AOEC 3JQAB 5L4LA 4HNGA 3BMOB 4PLHA 1ADGA 3DFZA 2JD1A 2YV3A 3GAZA 4QQRA 5AVOA 4G2NA 5TNXA 5JDIC 1NHGA 1PIWA 1R4NA 1Z7BA 2VT2A 3CINA 5ITWA 5FF9A 3JD2A 4QFCA 5EPOA 4MJLA 2R2GA 4CPDA 3ZZNA 4NK4A 5B1YA 4NBUA 5IJZA 3DZJA 4MVJM 4WPGA 1HDZA 1KIFA 1KVRA 5G2OA 4CR7A 1DRUA 2DM6A 1K0UA 1U7HA 3TNLA 4CLRB 3G49A 1DIHA 1N7GA 3RUIA 4JJIA 1T2AA 3D0OA 3C7CB 1NFQA 2I99A 4B3IA 4BO6A 1CDOA 4BGEA 1CJCA 3E9NA 5F1PA 4WJZA 2CVQA 1K5HA 1XKQA 2ZB7A 4Z9FA 2V6BA 4D3SA 3K92A 3OEWA 3F5SA 3F47A 1LSJA 2DBVO 2WSBA 3SLGA 3DONA 3WFIA 1DXYA 4CQMD 1B3BA 3RUHA 4Y8VA 3JYOA 5ER6A 4R9SA 3UXYA 3H2ZA 2IYOA 1X14A 5JCXA 3IC5A 2Q2VA 1LRKA 2BGLA 4IMPA 3QVSA 2P9EA 4NIMA 3ZWVA 3JQBA 1X7HA 4DMLA 5C37A 3EC7A 4JNKA 4TQGA 4WEQA 5IDWA 2PKQO 4J4HA 1UAGA 3WR5A 2AE2A 5BNTA 1Q0HA 2Q2WA 3PHIA 2GLXA 1CQIA 2AEMA 4ZQHA 4AJ2A 5KWEA 2GYYA 3WNVA 2PA3A 3ZW9A 3QIVA 3WGYA 1L7DA 2PK3A 3GPIA 2WJPA 3JTMA 3QLJA 1NQAO 4W4TA 5I7VA 3BXXA 4IIUA 2BH9A 1ZSNA 4Z9YA 2NWQA 4LGVA 1AXGA 4L9RA 3ROKA 7MDHA 3GY0A 5EERA 3U9LA 2EJVA 3KZVA 1CWUA 4CMGA 3WGZA 2QZ9A 5BT9A 5A03A 1PJBA 1I32A 2Y1CA 3DAPA 4IZIA 2IZ0A 2NU8A 4RVGA 1Q0QA 1R0KA 2X5JO 3DDNA 1XLTA 2OMEA 1C0KA 5JDCA 1PL8A 1OC4A 4CM8A 5KJ1A 4J1SA 5A06A 3BMOA 4Z3KA 2DVMA 3PYLA 2QW8A 5JPIA 3BIOA 1IL0A 1RYEA 4J7UA 5IZ4A 4J4TA 4J0FA 4YQYA 5JAIA 1OC2A 4B3JA 2OP1A 3CTMA 3DOJA 2EG9A 4K26A 5ES3A 1AHIA 1UDCA 4RDHA 4BO8A 3PK0A 2HLPA 2NVUB 4B7UA 3F1KA 1XHLA 4BO3A 2ZTLA 2VZ9A 4RPJA 3AUAA 1HRDA 3WS7A 3ANMA 4ROSA 1E77A 1F0YA 1HE5A 2DTXA 2DT5A 3NJ8A 5I7SA 4JP3A 2V65A 5FEUA 1C1DA 2E82A 2VZ0A 3PHJA 1ZKMA 4GSKA 3RCBA 2HSDA 4DIFA 1LC3A 2Y0CA 5COBA 4PZCA 4HUJA 4TVBA 5LDGA 1HTBA 1MG5A 3TPCA 2ZQYA 3GNSA 5TIIA 3RUCA 1R16A 3AUUA 5KIAA 2V6GA 3NX4A 5F21A 2DBQA 3NDRA 3ITDA 2HQ1A 4UUMA 1NTOA 3C3XA 1E3EA 3COSA 1U7TA 5TF4A 1PX0A 1MC5A 3MJ4A 4M55A 2HKIA 3TSCA 4PGFA 2VUUA 2O3RA 4BB6A 1J49A 1U5CA 3PYMA 4AJEA 4BHTA 3JV7A 3A4VA 2G17A 4CM4A 1ZK1A 3P19A 1SPXA 5MDHA 3P2YA 4CQLA 1DFIA 4B3HA 1WZEA 2XXJA 3JQ6A 2FPPA 4M49A 4HADA 4QX6A 2Q4EA 4WLOA 4YDRA 3RI3A 3SX2A 1YL5A 3ZWPA 4YJGB 5KJ6A 4KTVE 3QQPA 4PLPA 4EJMA 1AN9A 1GPDG 3A28A 2WWRA 2X9VA 4DGSA 1EDZA 4AJPA 2P5UA 3NRCA 2FN7A 4K6FA 2FR1A 2JAPA 5TS3A 4BUCA 4CMIA 3PZBA 4ZA2A 5LC1A 3V1YA 4B4WA 2A35A 4IS3A 3VH1A 3CSDA 1P3DA 4NBRA 4IJKA 2X8LA 3PYXA 1DIBA 2QHXA 3GRPA 3JQ8B 4DMMA 3VH4A 2D3TA 4FW8A 3PIIA 3GUCA
chains in the Genus database with same CATH superfamily
3QFHA 2NTJA 4BNWA 1I1OA 2PX4A 3I53A 1NONA 2D8MA 2P4QA 2V6FA 3EIHA 2A94A 2ZCUA 3V1KA 3OM8A 3R6WA 5CDTA 5BVHA 3TBHA 2O9JA 2PPVA 1OLUA 1I30A 3PZRA 2CXOA 2QL7A 1FNSA 3GQBB 5H02A 2WJGA 4R1NA 4J2OA 3HG7A 3QBDA 2DCMA 4FFMA 1S2IA 2VQ3A 3WHKA 4MH0R 4EA6A 1K3UB 4B2YA 3PUKA 2EW8A 3BTSA 4ZYZA 4PRLA 1NM5A 4HH4A 1KAHA 2CFCA 1DKPA 2QQEA 2YFHA 1M7HA 1U8CB 3NT4A 1HLPA 5FKJA 3JQCA 4C6RA 3FTEA 1PE0A 1W5SA 3MGBA 1QKKA 1QQ7A 1BSVA 3U9SA 4BNVA 4KDCA 5BMOA 1KJYA 4HH0A 4XIYA 4LQCA 2GJKA 1X19A 3UCFA 4HWPA 2VNAA 3FHOA 4D98A 3FPLA 5GZ1A 1E4EB 1SBHA 1FDOA 1BWQA 1ZY2A 4H1WA 5HZKA 2FRXA 4R9RA 3IDQA 1JFTA 1GPWB 2HNAA 3GDOA 3R3WA 2WJHA 2WU4A 2AXNA 1YWGO 4YXWA 3VU0A 1CZUA 3N8NA 3MTIA 1MEEA 4UEWA 3LSYA 1CY8A 4EPTA 2DQ4A 4NBWA 1QQTA 2YWXA 2ODEA 3DAYA 3UCXA 4KC0A 4Q21A 2WAAA 4DILA 3QJGA 5C18A 2WM3A 3A1SA 1KU0A 1SKYB 4JLJA 4DA7A 3QVXA 1E3WA 2Z8YA 4KE6A 1AKEA 4MYSA 2YWRA 4BFLA 3QUQA 5F33A 4PG8A 3B82A 2VZLA 4LSMA 4KGVA 3GLVA 4J75A 4RTOA 4TYWA 2PMWB 4N7BA 2AR7A 2A67A 4A8JC 2XUJA 1I3NA 1NBME 1NJGA 1TB4A 4HFMA 4K7JA 3B2EA 2R84A 2ET6A 3R09A 3WLTA 1OA0A 1T34A 1X9IA 2G80A 3AEQA 1MOSA 3BVPA 3GP3A 4GYJA 4KQEA 4EUKA 1M2JA 1UIRA 3HADA 1R6TA 3M3DA 3V55A 2ZDGA 4ZXPA 4E51A 2ZSKA 1VMDA 1YZQA 1W88A 4AG3A 2P5YA 4QRIA 4ESHA 3IQHX 5F73A 3WGQA 4D4JA 2ZYSA 2FK7A 3EA0A 1NI3A 4PICA 4D3YA 3DHYA 3RSFA 4CG0A 2OENG 4RZ2A 4U9UA 3T5CA 4JASB 1WBDA 2PZAA 2QN8A 2XAUA 3GOQA 5EJGA 1GRQA 5GAJA 1MZPA 2GX6A 3CF4G 3R20A 4R69A 4J7XA 1YQDA 3KV3O 1Q21A 4ND8A 1W30A 3PBKA 2DPLA 3D0KA 3D3WA 4YMVA 4TYMA 5I3ZA 3JU3A 3OPVA 2H4ZA 4GW3A 1I3OA 5FOTA 1BGVA 4PBTA 3RYFA 9MHTA 1P1FA 2VEOA 3H97A 2Q4DA 4EEZA 1GGEA 5DLPA 3PGVA 5IVIA 4EB8A 1HTWA 1Q1QA 1PWEA 1A9XA 4PZ9A 1KI1A 1P1RA 2YZ7A 3EDMA 1J99A 1KKMA 2Z95A 3PENA 4ZMRA 4UNQA 3GROA 5KHOC 3ZWXA 2ONYA 1T26A 3GZNA 3PC7A 4RVHA 3WL3A 3I6BA 4GI5A 1JJIA 1SVKA 2D74A 5B5SA 2QPLA 2WWYA 3DZ8A 4V24A 1ZUNA 4HUQA 1JALA 4TM7A 3AR4A 3DR3A 4TM8A 5KYXA 2RH8A 3AKCA 3CRQA 2UYOA 3ANXA 2CCKA 2C20A 2VDMB 1RRKA 2W22A 1VJGA 1BOOA 3DVSX 2XMGA 4G6ZA 4TLAA 4XWYA 4DLSA 3UHFA 5B3LA 3ZIAA 4KO2S 1M34A 3K1YA 4KWIA 3TINA 1SH7A 3RV3A 2GAJA 3HLKA 1U63A 4ARZA 2GJ4A 1D09A 4OYLA 3DFMA 1E92A 2BGUA 2F8SA 1RYBA 4PZLA 4RHFA 2FN8A 2GZAA 1LH0A 3LRPA 4KAJA 5B36A 3L6UA 1G2QA 1USUA 3U44A 1EEHA 5COQA 5GP1A 2O2JA 4N0PA 4OSOA 1GZ7A 3FYUA 5IUJC 3TAHA 5LZ7A 4E0BA 2HJWA 1WXXA 1J1ZA 4UHHA 3C98A 3GGSA 1PEDA 3KJZA 3CZPA 1S1MA 5DHTA 4B85A 1L7MA 4HAUA 4J0CA 1W0CA 1FXWF 1ZK3A 2OLJA 2QJOA 1EYZA 3DDSA 5LQMA 4F3CA 3P97A 2N3ZA 1OLUB 1NW6A 4FOSA 1SELA 2B25A 3DWGA 3VYRB 3WNZA 5I7EA 3SS8A 5ENZA 5IF9A 4DDTA 4G86A 1ZZGA 2Y8EA 1UBJS 1D3AA 1NVVR 2E1RA 3M6IA 4NX2A 3FNBA 4K9MA 4OBXA 4X3CA 3ZV7A 4B4DA 1N25A 2XCUA 3ONFA 1LW6E 2VHEA 4FTWA 1XC7A 4I08A 4QXMA 4KQHA 3FH0A 4BNJA 3A7EA 5IKXA 5ALEA 2QJFA 1Z2EA 3I04M 4KN5A 5C5IA 3L7NA 1JB1A 2XCQA 1NN1A 3HRHA 2AN9A 3QVJA 3E3LA 4PFSA 2A7QA 4URFA 1K89A 1E1RD 4P31A 5HK8A 5EE3A 2EF1A 3OE5A 1MB3A 4NS4A 1KVUA 3G88A 2ZIGA 4YEDA 3PPIA 2RIRA 3DHWC 3ZKWA 4Q3LA 3O94A 4KVZA 3FDIA 2GN4A 3AK4A 3K4HA 4QE3A 3RFUA 3TKYA 4DT1A 3E9MA 1MABB 1T0BA 1T5OA 3G2LA 5FUVA 1BWSA 4BX2A 4UQOA 4LSWA 1GAXA 2GVNA 1KK1A 3GDFA 2XJ4A 1YE8A 3O8QA 4EHKA 4DG8A 1VRWA 1Z6TA 2AR0A 2X0RA 1P0FA 3ZCUA 3QV1A 4C05A 2E4XA 3AM4A 2GTIA 4MWTA 1ISMA 4CTMA 4HDMB 1C0EA 4MUBA 5AKEA 1J1UA 2G8LA 4F7WA 3RC3A 4DCVA 3BL5A 3CF6R 2BZGA 4Q02A 2DP4E 1SCIA 2Q2NA 1Y3BE 4OL0A 3B85A 1RI4A 4QOGA 5HF5A 1AV7A 2PA0A 3EIWA 4WL0A 3AF3A 3S8MA 2W43A 1BYIA 1NVAA 4RSHA 2PVSA 3G3EA 4DA4A 3H11A 1SHUX 3O82A 4B44A 4GD3Q 3CZMA 2IPMA 2OFWA 4H9GA 2DFTA 3I2GA 4REOA 4BQPA 3COYA 3ICEA 3P2EA 3EB9A 2C7QA 5HQ3B 2IYWA 4DMRA 3II6X 5K3FA 2ZUVA 4PW0A 1O5OA 1RPJA 1L4LA 3LT1A 4MKFA 3SZLA 2W93A 5LBTA 2I5PO 1QORA 3C6ZA 4RK7A 5COAA 5SY9A 3MJDA 3VR1A 3IV6A 1XHFA 2ZRIA 2H7XA 4N6NA 4RACA 5A05A 1FP7A 2YIJA 5FFMA 4X24A 3OAAD 1MEJA 5AKIA 2V6JA 2V7WA 3I9MA 3VPBA 2J3QA 1YS9A 2RONA 4NV1A 1LLUA 5HRAA 4YP9A 1XQXA 1V48A 4DDMA 4RQAA 3E9QA 3RSLA 1N57A 5T4BA 5GJCA 4EKDA 2JARA 3URKA 3NV7A 3UFXA 5LLTA 1NDQA 3UHPA 2COEA 1GYPA 1Y3IA 2A0KA 3WGKA 1XB2A 4KGZA 2IWHA 2ZSUA 5CFPA 4XARA 1SM4A 2F1KA 4BQOA 1NYLA 1JIXA 2VJBA 4XDZA 4X20B 2DB3A 3DCJA 5CAEA 4IJUA 4UEQA 4MDEA 2W2LD 2M6KA 1M8PA 3O38A 5J1SB 1HDEA 3DVRX 1EUYA 1Q0UA 1WZCA 4DDVA 1O96B 3LWNA 6REQA 5KUTA 1T2FA 2C4VA 4Q4JB 1FXUA 4YWHA 2VXCA 2WG1A 4XI9A 1LJUA 3AG5A 4NAUA 2EL9A 3ZCQA 2C96A 5DXFA 5CVJA 1NVWQ 1P6UA 2JAUA 2FQ1A 3E5MA 5IAAA 4XVQA 3TS1A 3U7HB 1FXWA 1A7UA 1I6WA 1W34A 2EFGA 2WD9A 4JMLA 1MT3A 3ZI0A 3DCIA 3HGMA 1S7GA 3KSMA 5EP3A 3ZIDA 5LQCA 1JDJA 1WDKA 3NZEA 5IVHA 2GXSA 4GQAA 3EZ9A 2R5WA 4FYWA 2Q7OE 3HABA 5H9WA 1O6FA 2ASVA 3KAJA 2FPGA 4PLTA 1JF8A 1NVVQ 3BCUA 4LVUA 4W5HA 2QI9C 3WICA 3WGIA 1W2GA 4OBWA 5EPEA 2OTCA 4ZYXA 4M7WA 1BH2A 1P72A 1YZGA 2E55A 3HYTA 4FZRA 2GQ0A 3Q2IA 5IVKA 2ZAGA 4D0SA 4GP6A 3Q3IA 4UBIA 2IPAB 2B7LA 2HEIA 2JVJA 3HY3A 3K72B 4JBGA 3UWDA 2G4CA 2D62A 4GYKA 4BNXA 2N1BA 1CJKC 5DWVA 2GEKA 4MIOA 1RLMA 2NT3A 2PLRA 4G9BA 2PUWA 2PUHA 4HHEA 3F3YA 3H16A 1C2TA 3UJPA 2ZETA 4GBGA 4LZJA 5FADA 5PGMA 4D6XA 1NUAA 5JMTA 3CVXA 4DQ0A 5CFMA 3K70C 4FMDF 3GG9A 4B7CA 3UJ3X 3ABRB 3AR2A 3PS9A 3LC0A 2PNFA 3H5VA 1G3QA 2NYAA 2BFDB 4OYHA 3RJTA 1UWCA 4YRBA 2VJMA 3LUKA 5CT4A 5FAKA 2EKLA 1ZM3A 3I39X 4ER6A 3ZE7A 5JAMA 4WOCA 3VJRA 4HYQA 2C3MA 1F6DA 3H3JA 1TTHA 1DJMA 2B0JA 3I8SA 2W4QA 1RWWA 5JDCC 4P1ZA 4B6QA 3R3HA 4IWNA 4WZBB 1C0IA 1UJCA 2YBDA 1JL3A 1DP4A 1YDGA 2CBXA 1W85A 3TXXA 2AYXA 1IXRC 5T5QA 1P4SA 1UZNA 2FPIB 2JBHA 2Q41A 4FLEA 3UKDA 2R7LA 5JHGB 2KB0A 3EYAA 2DECA 3RVPA 3VUEA 4G3XA 1E7RA 3GV0A 3L7BA 3BMQA 1JB9A 3IDAA 3VQTA 1QNFA 2Q5QA 4PR0A 4S24A 3D81A 1L5VA 4R0VA 3J80A 1L7AA 3D6MA 3NP9A 2BTQA 2XDYA 2YXEA 4Q3CA 1M1YE 3DZIA 3AKEA 3O3MB 3TK1A 1SU7A 2DTEA 1SC9A 1TEVA 2HIAA 3EF1A 3TCNA 1FNDA 1ESDA 4IZHA 3CPHA 2BP7A 3A2LA 3LLCA 5L3SB 4Z0NA 3GCWA 3AQIA 4BBZA 2HC9A 4ZYTA 2F6RA 5DYNA 2WEKA 2IXBA 2PM8A 5EIOA 4ZQFA 2O8EB 1I9CA 3PUWA 4KQXA 5LXTF 1CUYA 1GGFA 2JIQA 4J1TC 3H87A 2ECOA 3NJ4A 4KXFB 1G6HA 1OJLA 3KKNA 1OBHA 1JDVA 3R8XA 3PF8A 4NU0A 4NYJR 4IIYA 4TSRA 2QLLA 3VZBA 3RW9A 1WXQA 3FNGA 3OZVA 3T34A 2YYYA 3NWEA 3R74A 3UTDA 3VZQA 1ORWA 3ZGLA 3D4OA 3M5WA 3O0DA 1WXHA 1XWIA 1VCNA 4FIZA 4UEKA 4EL0A 1P3Y1 1DRWA 5DK4A 4ZVOA 5GZ3A 4Q3OA 2FPKA 2C2XA 4OGWA 4RXTA 4D4GA 5HX7A 1PR2A 2E49A 4A8TA 3OZUA 2HLHA 2PT7A 3PKJA 5LJLA 2ZRGA 1N6KA 3LI2A 2UYYA 2HL6A 3CJQA 1Q1NA 1UKAA 3NBQA 2R751 4MI1A 1VMKA 1Y0BA 4D2IA 1LLFA 3WLRA 4H6WA 1I3KA 2VOJA 3DM5A 1QTIA 1VL5A 4EG7A 2DOKA 2VPPA 3CCCA 3ED1A 1JKIA 3CT4A 4MR8A 2R00C 4US2R 1E3QA 1S2DA 4TLCA 3MUOA 5KYYB 3FOZA 4KK3A 1TCAA 1D0SA 3LBNA 4JIGA 5K3DA 3SJCA 2DE0X 2WSYB 1HH4A 2YWFA 2IDKA 3MLAA 3P2OA 4NATA 4RGVA 1RQRA 1COZA 5TB5A 4MYRA 2J30A 3AMVA 3AR6A 4NENB 4Q48A 4Q7MB 3GHYA 4WK6A 3T9EA 3WL8A 5B58C 3MQ2A 4AFNA 2Q0QA 2YDXA 4HP8A 4MPJA 4HVCA 2R6CA 1M6YA 1W4LA 3FCXA 1G5IA 3IP3A 2WG2A 3WRXC 5C4IA 2H4XA 2O2DA 1SBYA 3WSVA 1HKUA 5KMGB 1NY5A 3CZAA 4G23A 4O4LF 3EGDA 4P93A 5AR1A 4MTCA 3VC3A 1JMVA 4QWMA 1SZPA 5LMCA 1L5HB 1U90A 2PGIA 3RWMB 5KPDA 3VHXB 3AFOA 3ADOA 3V3TA 3VGPA 1QK3A 1ND6A 1SWVA 4IV5A 1AZWA 1R12A 1JG7A 3BUSA 3EC1A 4I5EA 4F9EA 2C88A 4JYBA 1NGSA 2V7QD 4FUQA 1KI2A 1L4UA 1U6KA 4WN9B 2NVUA 1U9ZA 2C5AA 1XROA 4GDMA 1ZIPA 3SC2A 3W6NA 2DUMA 1FDRA 3WLQA 2VUIB 3Q1LA 3HCNA 2ZIFA 1TA4A 2R6AA 1QANA 3BXEA 1QLWA 5AP9A 3KXDA 5IABA 1NBOA 1UM9B 4OAQA 1KDTA 2KQUA 3L8DA 4CM3A 2VT6A 4LHSA 5AOBA 3IBTA 4FFBB 3E82A 3PQ6A 4B8YA 4RV4A 3LCMA 3LHDA 1F2TB 3T52A 4DIKA 5DTEA 1PV4A 2HBYA 2QM0A 4OK3A 3CH6A 1Z37A 1VGRA 2V6IA 3HYCA 3HYRA 3B9BA 3QY9A 3FYSA 4P7KA 2HCRA 5ALOA 2Q99A 3EXHB 5I9MA 4JB3A 4LTDA 2VVTA 4D4MA 4ZGBA 4JVMA 4O8ZA 4JX8A 3W2FA 5BWNA 2OOSA 1FPQA 5KDOA 4OO3A 1AZSC 2ICAA 4B9AA 5FRDA 3BGWA 5EN4A 3LX6A 4FS8A 4FYJA 1EWQA 1Z5PA 1ZS9A 3K3PA 1TQ2A 2FZEA 1GD1O 4HZIA 1DOZA 3U0BA 5LYJF 2PGNA 4A8JB 4IO0A 4RS3A 5K8LA 3MTEA 3GRAA 2HRCA 3RSCA 3TQQA 2KI5A 4M0FA 2REQA 3LT2A 4XVUA 2PQ2A 4PQFA 4XPZA 3SE7A 2QMUA 5KYVA 1ACLA 2EBHX 3FF4A 1KMHB 2J67A 4KRGA 5F9HA 4FFBA 1L5GB 2HMWA 3V2UA 1V8PA 2R11A 4NPHA 3BXHA 1ZPDA 2X4IA 5H4HA 1KO5A 5CB0A 1VPLA 3PDWA 3UXEA 2G71A 2I4RA 2J41A 5E4YA 1VCHA 3RK4A 1R0WA 2G88A 2OD2A 3R5SA 3PUVA 3RRMA 1T4BA 2QVYX 3MTGA 3RRFA 4EMSA 1JQ3A 1OIXA 4FFNA 4UTPA 1KFJB 1V16B 2BFWA 4DBVO 3PNKA 4L9AA 1S9DA 1PWZA 1QRTA 1P2TA 2O0LA 5FDFA 2WFAA 4G63A 5DW0A 2ZJ4A 3ZD9A 4FHGA 4IFBA 1EUDA 2IYUA 3SZUA 1L5HA 4A6EA 4BUJA 4P84A 3H5WA 1LF5A 4MZXA 1Z17A 4UOEA 2WAYA 2PKCA 3QF4B 1W581 3FXAA 1K4KA 1Q5PA 3O4GA 3CKYA 3E9ZA 2HCTA 5ALZA 1Q20A 2PMEA 4Z7QB 1TTTA 2P6OA 5AKYA 2UZAA 4JBLA 2O0JA 2CLLB 2I76A 4PX2A 4EYEA 4HDKA 5LJIA 1GFWA 3LUJA 1EVJA 1H5QA 4Y2TA 5A3VA 1UMKA 3PC3A 1B43A 4LWPA 1ULTA 3D8HA 1MKYA 3AKYA 2NU6B 1ETHA 1N9GB 1BH6A 1U2EA 1M2WA 2B82A 3KYDB 1UBMS 3DAHA 1ZJ4A 4NFSA 4RK0A 4CTOA 4IX9A 1ZCJA 1WB9A 3JQAD 3GJSA 5FWXA 3RSOA 3S4YA 4BMSA 5AI0A 1WS6A 1JMKC 3DBHA 2C3PA 2ZIUB 4PCAA 3RABA 4PC3A 4ZO9A 4HYEA 5GMOA 2F8MA 3SYLA 5I9BA 1IAQA 1Y1PA 3H9JA 5KI6A 1N5JA 5IX8A 2XE8A 1RLTA 2ZZNA 2HSZA 4NFHA 1RU3A 1FSSA 2ZUTA 4ER7A 1BXZA 3QEMA 2BISA 1P77A 5CXXA 1PG2A 4W8HA 3ZQUA 4C3VA 3N3BC 2PSSA 2QUZA 4F6RA 5CH8A 1V6SA 1PUXA 2R4QA 2XNCA 3HKDA 3ME5A 3NIWA 4ILKA 4PGAA 4RPIA 3H9BA 3QW2A 3BXPA 4MNTA 5FWAA 2ZPTX 4G1VA 5HZGA 4I4TB 3TZ6A 4HN9A 1XMOB 4AF6A 5AVZA 1A95A 3ZQ6A 4MB6A 4P3OA 5ALJA 5LD2C 2CW5A 1VPDA 4BJ6A 1U1EA 5IC4A 4DIMA 3W77A 1UP4A 2DYKA 2HA4A 3ZDCA 1BCRB 1KZ9A 2OZLA 5LMNB 4EY5A 2X77A 3GZNB 4QHYA 2J46A 1SBZA 5TPWA 1C1DB 5ERGB 2WAXA 4ZVKA 4ARVA 1I4TD 2WJVA 2BZ1A 1FW8A 2XBMA 1UP7A 3NBXX 2DETA 4C1NA 4HN4B 3IKVA 1ECBA 1Q0LA 1TOAA 2Q6KA 2QVCA 3OHPA 4F86A 2ANBA 4C7OA 1KEWA 2QV7A 3ZTYA 5KWIA 2I8CA 3L1VA 2W6MA 4EJSA 3KSZO 2B6NA 3ILVA 5JVDF 4B17A 5EHZA 2ZJ7A 3OT1A 1PFGA 3FLAA 1KKLA 4IP0A 2R8EA 1HE3A 3IOEA 4TOIA 1U0TA 2BFOA 2V7GA 2YW2A 1VMIA 2FLKA 1PGPA 1MB9A 3L46A 2VSNA 3ZU4A 1XDSA 5G1OA 4BMDA 4K81B 5EMMA 5IHXA 3CEHA 3C3YA 3I52A 4NH4A 4OD0A 3U3KA 3QVGB 4CM5A 3LQKA 1T9GR 4GI1A 3TGWA 4EDFA 2P4UA 5BQXA 3EEOA 3GX1A 2G1UA 1ECCA 2AG6A 2AQHA 1IJEA 2E6KA 2JGJA 1ZEJA 3EZ6A 1UPUA 1GRRA 3D64A 3GVPA 2NZ8A 3K2QA 5DCLA 4ZT5A 4C22A 4RMIA 5P8WA 3U60B 4IV0A 1ZXBA 3PITA 2YWGA 4AZ0B 4RTQA 4Z53A 2OQ2A 3EIFA 2V58A 3IULA 5TT1A 5EHGA 5E7QA 2YNMC 4KJXA 3JZIA 4KZKA 4PYOA 2JKVA 2V96A 1TM3E 1XFAA 3NIGB 4HWGA 1P7WA 2NZ2A 5C7YA 5JS6A 5ALWA 1L5RA 4IZOA 3L82B 3MWGA 1U0OC 4R9VA 1RLIA 1LJLA 3IAEA 4LV6A 3CA8A 4LHWA 4ZVLA 4AO6A 1U1IA 2BFMA 3DJFA 3LDFA 2Q1TA 2JJQA 3T7DA 4CM1A 1X1BA 4TXHA 5TEWA 4IX1A 4CIDA 4XYLA 3OQIB 2A0WA 3IBCA 3MBOA 4NBTA 1D1SA 3IPLA 4DNXA 2J7PA 5FFNA 4P3KA 3B8HA 4JUBA 1C3EA 3UO8B 2XRYA 5CG2A 3BRWA 5D00A 1A4XA 2HA3A 5KX5B 3GCDA 1NG9A 3W2HA 5LP6C 2PX0A 3G68A 4FX2A 4WXMA 4XWGA 1Z88A 4O2RA 3ZHQA 2PZLA 3BOSA 2WDZA 4G4IA 1OW3B 1I10A 4EAAA 4MW4A 1SIOA 2NIPA 4LHEA 2WJ6A 1ZNXA 5A5GA 2JJ1D 5GONA 1EJ0A 3N05A 3DE6X 3NC1C 1C1XA 3LDUA 1Z68A 4FFWA 4LV5B 5F12A 4U8HA 1GFIA 3D7RA 3H2BA 3NOQA 2Q1WA 1RZRD 2HGSA 2JEYA 4LJ7A 1H2HA 4EO4A 1COWA 3NBKA 4D02A 5L3QA 2QBYB 4HCJA 3OZ7A 1Q7GA 3ZGNA 4MP6A 3KE9A 2RHLA 2BM9A 2VK4A 3Q7RA 4YJKA 4L8LA 2QSYA 1YB2A 3TSOA 4I14A 3DHVA 4Y98A 3O2NA 4Q9LA 4ZOLB 2IS6A 4YFYA 3ECSA 3MRVA 4TTSA 5TEVA 2ZM6B 2I6TA 3QITA 1P5FA 4D4IA 1HBJA 3ZV3A 3C1UA 2KBFA 2XNHA 3FSGA 3GELA 1R8QA 4I55A 3RS2A 1GG2A 3LPLA 1SURA 2WTAA 3KWLA 1FUEA 2GTHA 1MC4A 1ZUHA 3PQ8A 3Q1KA 4H1UA 2NZYA 4MYDA 3T7IA 1M8FA 3TLCA 4PVDA 5JDIA 1M8KA 1VZ2A 1XKLA 5JSZA 1DHTA 2WNIA 2GGSA 4E5KA 3B3AA 1BJKA 3AR7A 2AE1A 2EW1A 4LXXA 4YRMA 3KR0A 3RQSA 4F6RB 1KI4A 2IEAA 4R16A 4CGYA 3INGA 3VZSA 1TTPB 4C01A 3ROTA 3DKKA 1DQRA 2Y99A 3IQWA 3R7AA 4DA9A 2GUWA 3IO5A 3G0GA 4N01A 2YUIA 1V11A 2Q8QA 1YZNA 3RBZA 3OPMA 1PFYA 1ZHFA 4YI3A 5EFZA 2B34A 3AHHA 2WJYA 1Z36A 3SYTA 1XTUA 3UGTA 1LCIA 3X2SA 1TJ5A 3FKSD 3KD2A 4UHEA 4P4NA 2CNDA 4Z0HO 3SHQA 3VX4A 3TG2A 3OAAA 4JAVC 4Q1DA 4YJFA 4B81A 3HE3A 2RHMA 3CG0A 5ALQA 2FF7A 2MR6A 2ID8A 4B32A 2CCGA 5KTKA 3GUHA 3DF7A 4FZJA 2QTLA 3UWMA 5K0NA 4YRSA 1NX6A 3KZKA 2FRDA 1BA3A 4UM8B 4K6MA 2PIAA 2L17A 4PRZA 5K6AC 1XA3A 1VJ5A 4UNNA 4E5NA 4I1YA 2LV8A 1MA0A 4A27A 1UDRA 3PQ4A 1X70A 1PZHA 3IUBA 2JIPA 5L53A 5JJLA 1PNQA 3DDHA 2YHIA 3QXHA 4L50A 4KSCA 4KMMA 3BF8A 4J03A 1DAKA 1G6Q1 1LI7A 1ZRNA 1JAZA 2RGYA 4GEGA 3RFFA 4EW6A 1YJAA 3F5MA 2R1TB 1KP3A 1RNLA 2IIVA 4DJAA 3NM6B 4BQSA 4RD0A 3ILSA 2EXXA 2JKZA 4H1HA 1WCYA 2H1IA 1S7CA 4E2FA 1XDGA 4BYMA 4TRJA 2ZRMA 2RG1A 2MYTA 5FL3A 2CNWA 4YJ3F 1V26A 4UZFA 4A26A 1SOVA 4LF8B 1IY9A 1IM8A 4S1PA 3VDQA 4E5DA 1F17A 1AKNA 3HBNA 4QUEA 3HFJA 3HL0A 3IVGA 4O4JB 4Y9RA 5DBIA 3SHOA 1SBQA 3KL2A 4LYFA 3W5VA 2ZIXA 2ZANA 1U2DC 2FUCA 1KJNA 2QZZA 2Y1DA 1OAOC 3PU6A 4AJJA 1IZ8A 2GZMA 1KDYA 3HO1A 2B2CA 1UOPA 1M1NA 3RS8A 4KXUA 4LRWA 3FDXA 4INAA 3UTCA 3FYUB 5BNWA 1DI0A 1P5JA 2O3QA 4XQCA 3ZCRA 8ATCA 3FWYA 4CT0A 1X0XA 1R6DA 4N39A 4UVHA 4EPXA 1DBVO 2XB8A 3H4VA 3LOUA 1R37A 4TROA 4EB3A 5A3QA 2A7XA 1JG4A 2CK3D 4J91A 4MVJH 4R7GA 3FD8A 4G5QA 5ILQA 4X9XA 2IZ6A 4K86A 5H16A 3SFZA 4C0LA 4TSKA 3L0YA 3G8AA 3KQUA 3NBAA 4WTOA 4UOZA 3FPFA 3I1IA 2YOGA 3H2GA 2KYRA 1JXQA 3L8FA 4EA8A 2EZTA 4QPJC 4IVRA 1VJCA 3M4XA 1JJVA 3MN1A 2JVIA 3O74A 1V3QE 4HX9A 4KL8S 5KNCA 1CY1A 4Z3OA 3QHAA 1CF4A 1VRVA 2YXDA 4CLDA 2VWHA 1J70A 3SVZA 1XQWA 1MO4A 1MO2A 5K4HA 1LXCA 4B7XA 3RAPR 4LYEA 2IF0A 3UK0A 3JASB 5FUXA 3U09A 2NU9B 1DX9A 4KRXA 2GF9A 1MAUA 1V5WA 5JS2A 2CYAA 2XVMA 4GUDA 5E6UA 1KZ7B 4BFYA 2EX4A 1KOJA 3GGOA 1PG5A 5M3BA 5SY4A 3PQDA 4JP1A 1LWOA 1ZCZA 4Q7EA 2E37A 4BJ5A 4ZI5A 2ZYWX 1L8OA 2Z6VA 2ZWOA 1QVVA 1WXDA 4JJEA 3RK0A 4IEIA 4DW8A 3ZWPA 4MP8A 1XRQA 2GZSA 1W36D 2CKDA 2ZVQX 2R6JA 1ECPA 6PFKA 1EKXA 2BZSA 3LP8A 1MABA 4MJ7A 4ZVPA 3VYUB 5BV0A 1WVIA 4R8SA 2V55B 3HDYA 1G7SA 1W35A 1U7XA 5KVSA 1XD9A 3EPKA 5JWOA 4IHJF 3A6PC 3NHZA 1RYYA 4B09A 3OE7A 1TVKB 5EWJA 1Y37A 2O4CA 2OHHA 3L18A 3RFXA 4EW2A 5TGDA 1AXEA 1OZAA 2XY4A 2QJRA 1RWMA 3CXUA 5CEJA 1NVKA 1ODFA 2Q5FA 3AEKB 5CM9C 3WMEA 4TV9B 2PGAA 5HQTA 3AVTA 3VAAA 2Z4RA 1CUGA 4RTNA 4G07A 2A5DA 1L8XA 2QLJA 1O5TA 3R23A 4LOLA 4N7RA 4S1VA 4X71A 5KTMA 3U7EB 2JFYA 1GSAA 1QFZA 3B1KA 1W36B 1G59A 3QF7A 5ESXA 4N65A 1YOVB 4NJEA 5LIPA 4M0EA 4W9NC 2GUGA 3KJFA 1SXJE 3ENZA 3LPDA 4R4JA 4IW3B 4R8KA 3H04A 2QW0X 3K09C 2H92A 3HN2A 5AXAA 2WWVD 3SZMA 5DDIP 4AC9A 3NHRA 5KYYA 2DXIA 1Y5LA 1J6UA 1VFNA 3CUUA 4QXPA 1U5BA 2QT0A 4HGRA 3U3MA 3W5UA 4HVLA 1U0FA 2JHAA 4IG4A 2FEMA 1SVNA 2DMRA 2V4MA 4OJYA 1Q7TA 1OASA 2OBBA 2P4HX 1GVHA 2B92A 1SEPA 1WCIB 3M82A 5JAHA 1E1CB 1SC4A 5DO9A 4ZARA 4A0GA 2VOEA 3AR9A 1LQ2A 4KUHA 3SQXA 2AKAB 5CA1A 3EZXA 5AW3A 3O8QB 4NZ9A 5K99A 1XZCA 3R1IA 4IIFA 2CV2A 1Z0UA 4HAWA 4AQ7A 2ORVA 1KAGA 3CHYA 3UPTA 4EIWA 1O97D 4YN3A 2RHDA 1G2PA 3WLNA 1P1JA 2BE9A 1HL3A 2EWMA 1HYEA 3G2MA 4UUPA 2GEFA 1T9HA 2DG2A 3VR2D 4BX0A 4X97A 5LB2A 2H11A 4EK9A 4V03A 1JFFA 1F5SA 1QIHA 3OE1A 2FZLA 2YMLA 3RU9A 3UKJA 4X8HA 4RTKA 3DT9A 1KI7A 2W2XA 4TYPA 5E0KB 5ED0A 4GZ5A 4QOJA 2V97A 5T64A 3TZEA 4N0MA 7ABPA 3B1WA 4CM8B 3CVVA 2WHPA 3GEIA 3NHMA 5BR4A 1X1SA 1XRRA 3W9SA 4JJ4A 4K88A 1XPJA 4ZOEA 1UBRS 4V3BA 3GH1A 1Z38A 4I3HA 3TRFA 4DCOA 3TPFA 1TADA 4NDNE 5AT1A 1MJGM 1VDMA 1YFKA 3GLKA 3IAFA 3KXIA 3RHZA 1NT2A 1DCMA 3GHHA 4L95C 2B1RA 3JVUA 4NF2A 2XUAA 4LHXA 2R44A 2VPYA 2ZRKA 3CEMA 2JLVA 1KQNA 5KKNB 1DJNA 5LPNA 4R1MA 2WICA 5I9NA 2R97A 4FD3A 5BMVF 4CF6A 2WLSA 5L95A 4TLDA 3TUJC 3ROQA 1XO1A 4JZKA 3SLKA 1JT9A 1QWOA 1U8XX 3RVMA 3I42A 4PYMA 3VH2A 4JI8B 2IEYA 3VNAA 5K8CA 3MERA 2TMYA 2ZR8A 1L0BA 2QU7A 5DXAA 4POOA 2BSQA 1N32B 3OLQA 2CYBA 3DZCA 4M1KA 4TV9A 2PR2A 1ZOPA 2WHPB 3T7JA 3M1IA 1A2BA 2ZI7A 4Y2UA 3DD1A 4RVDA 5K8TA 2BN4A 1RRPA 1H0KA 3DCYA 3EZ2A 3KYJB 4YNBA 4WNAB 4BB0A 5EZ5A 3M9XA 4RF3A 4UBNA 1RJ9B 1Z22A 3PC2A 3RYCA 4MVJA 3SYMA 4E32A 2HXGA 4TV8A 1JEQB 1L7VC 3VZRA 4ALNA 4TKVB 3THOA 1PK8A 3D2BA 1N5IA 4JJKA 3A6DA 4RTPA 3D2LA 1LVUA 3MK31 8GPBA 1R6XA 2IP4A 4X8OA 4YRIA 5AM0A 2VYCA 4BNHA 2Z2YA 3FX2A 4G36A 4HNQA 1RI1A 1IM2A 1CFZA 5H8WA 3TM4A 1ZD1A 2NUPA 2G9NA 4L85A 3JCZA 4H3VA 4L9SA 1BW9A 1S8FA 4FE3A 3STXA 1E1CA 1R6AA 1BO6A 1A4UA 1WCWA 2WNSA 1H4VB 1JWBB 3A6FA 3HY4A 1CV2A 1JJFA 4HX2A 5CLJA 1ZGCA 1YRYE 2LCQA 5KYGA 3H5NA 1BJTA 1SUEA 3KAPA 1B8VA 1XYYA 4FOTA 5CT5A 2GAFA 3W5AA 4KR6A 3KUCA 5AFSA 5KTPA 1CU1A 1Z0JA 2B8JA 4URXR 5M5BA 2Y0EA 5I7OA 2K2WA 3NBUA 1FX1A 3UUFA 3AY3A 4DLNA 4ECEA 2A30A 1OLXB 2IOFK 5DP2A 1EP1B 1CUDA 1X39A 4OGGA 4PGHA 2HM7A 3WP0A 1SXPA 3K9NA 4Q4AA 1M9NA 2FPGB 5DNEA 4LF5B 2B30A 5FQNA 2O8DB 1MRSA 2WJ4A 4M0UA 3FMPB 1EVQA 1Y1TA 4CF5A 5TSDA 4L5BA 2BFCB 2PJUA 2WT4A 2VDRB 1U3CA 3DXFA 1WPRA 3CNQS 4NCHA 3GU3A 5FIUA 1UQUA 2O2CA 5F98A 2VPXA 1V37A 1RZRA 1XOIA 3WQSB 2AG0A 1CC1S 4TQ9A 4YDQA 1DOHA 1PR1A 2J9FA 1CR6A 1TM7E 1AC5A 2X76A 4FONA 4XFKA 3JQGB 1E3MA 3UMVA 5L45A 3MC1A 3EMVA 1ADBA 1KOFA 2AMLA 4FWBA 3V33A 4E30A 4ZCTA 4CEJB 3M6VA 5B12A 4F38A 3EQ7A 5ICEA 1YBHA 3FWZA 1FFHA 2OSVA 2ARKA 4RDCA 2VI5A 4M6WB 4ACAA 3UW3A 1HFJA 1NNI1 3AERB 4DB2A 1QLJA 4BLPA 1IPEA 2HBRA 1KETA 3NKVA 3QUTA 3CPEA 1E32A 3CLSD 4TZTA 3SKYA 3WGOA 1GNLA 2JFUA 4KO8A 3VI4B 1UAYA 5ESRA 4Z1OA 4AIRA 3QEOA 3WYNA 4DWOA 3V8EA 4DYVA 3IYLW 1Z6XA 1UXHA 3MRXA 4KP7A 4OHCA 4QASA 5DTIA 3KBBA 4MCAA 2HI0A 4PX5A 2PUCA 5G53C 2CLSA 1GU1A 3LXXA 1F5NA 4HLNA 2LD4A 3V1LA 1JEQA 3K8OE 1E94E 3DR5A 1AQIA 1EZZA 4ZXFA 1K0FA 1VB5A 3FTNA 1EG7A 2N0SA 3ISVA 5AKLA 4CF4A 2GJ8A 3AO0B 4I50B 4TXMA 3EARA 3O3OB 3RADC 5C80A 4LFBB 3RTGA 4JNCA 4DYHA 1G18A 4XUDA 3E48A 4M9UA 5IBPA 2Q3HA 1CUCA 5LB4A 4QVKA 3EH1A 3HVKA 4B4UA 3NHSA 4F56A 1BU5A 4H7PA 4MCJA 2A0UA 2W8ZA 3HU1A 3OOJA 1LS6A 3CSUA 2JJ8A 3IE0A 4ZODA 4EVRA 4G8JA 1Z8FA 4B6EA 3WC4A 1P2FA 2OA0A 2I3BA 3SVLA 5JTUA 4PRYA 2HK8A 4BMVA 3GEMA 1XF9A 5CK4A 3ZU3A 4DF3A 4B0OA 3HUEA 3S81A 2PLWA 3OWOA 4MW2A 1EESA 2YVKA 2FCRA 5DTQA 4BTLA 2MYUA 3DQZA 3QNWA 4MK4A 3EVFA 4X93A 2CWWA 1JH9A 3RJZA 4L74A 4RSMA 2IYAA 1U9IC 1NVBA 3BRWD 4RD6A 2ZULA 3ICWA 3BJEA 4DIOA 3PCRB 3ANYB 3JVIA 1EGMB 3R4CA 1Y1SA 2OXEA 2I8AA 3IURA 4L8YA 2G9RA 2MSKA 2HV9A 3DGFC 1PJTA 4ZI2A 3JZFA 1HR0B 3LP5A 3M5DA 1E6LA 2ECQA 1VA5A 3AJAA 3PE6A 3TTVA 3KU1A 3LDGA 4C7MA 3QX7A 1ARZA 4ENSA 5IK2A 3VKFA 2ZU6A 2I71A 2Q5LA 1SG9A 4PXYA 4XSVA 5CPBA 2AUTA 3G5UA 3JZDA 3GFSA 4YRRA 1ADYA 1J0XO 1FSZA 4R2XA 3SEZA 2B83A 1TM5E 1UMCB 1U7WA 3BE6A 3OPXA 1BXRB 3G1UA 4YAIA 2Y66A 4BE4A 3PDIA 4ZIRA 4I50F 4A2WA 5F5NA 4BCCA 1DTSA 4V02A 4HI0E 2OZEA 4ZAYA 4EI2A 2O2GA 1NUPA 1FFBA 1KWGA 2PQ6A 1FTSA 1XTSA 4BEJA 421PA 1NVGA 3MTJA 1K6EA 1UXGA 4FE4A 2P9FA 3HZZA 1X7WB 2IEBA 1OT3A 1YI1A 2ZJ1A 4IQFA 4QBIA 5DT2A 5JZSA 3QVUA 4EG6A 4FOLA 3U9TA 1I0LA 1AKRA 3KB6A 3LW7A 3CLRD 5JWHA 2FWAA 4KV9A 3CPSA 4YP6A 4EO9A 1Q83A 1Z75A 1NXPA 3KUKA 1QP8A 1RQNA 2B1JA 5IANA 2XDWA 5G40A 4QECA 1Y9AA 1F0KA 2OYSA 2Z8YM 1V5IA 4XVHA 3C6XA 3CONA 5L6LB 1F7VA 2PX6A 2Q50A 1GZ6A 2QWXA 3KIPA 3LCCA 2OBFA 3GJRA 4LY9A 4OM8A 1X86B 4DMCA 2PVCA 4DYDA 1L5SA 1N0WA 1L4GA 1QB7A 1N5KA 2PO7A 3HVHA 4G1EB 5H0IA 4D7AA 1X38A 3OEEA 4WN9A 1ZVQA 2X3UA 1G98A 1WZ2A 1E9BA 1RJGA 3C3CA 5CB4F 2P2LA 3C74A 5AVRA 3U6KA 4WESA 1GN8A 2I65A 5CT9A 2ZYUX 3TW4A 3AHDA 2CVHA 2X2PA 5GZ6A 3VNSA 4G8BA 4BRSA 1ZR4A 2W6PA 3I3SR 4OJQA 4C87A 1Y6RA 2OGSA 1W48A 5CFLA 3JQQA 3P8ZA 5K2MA 2X0DA 2X0FA 4UREA 2PWPA 4B45A 3B6KA 3STYA 4DJ5X 2GEUA 2LR0A 2ORIA 1YL7A 1RXUA 1RHRA 2RC5A 3DDZX 3A11A 4QDJA 4WLNA 3TQCA 4JXZA 1SUIA 2GETA 1A76A 1JKJA 1TJYA 4PIPA 2XF2A 2CL6X 2XD4A 2HWXA 2XZDA 2V5VA 3IIMA 3MJCA 3N6VA 1HYGA 2X6QA 3RYFB 3NNSA 3SX0A 4AD8A 3LBHA 3EPPA 1CRQA 1BE6A 1C9JA 2BC9A 3BFJA 1O6BA 2BEU