3UG6A

Crystal structure of get3 from methanocaldococcus jannaschii
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
303
Chain Sequence
DGTKYIMFGGKGGVGKTTMSAATGVYLAEKGLKVVIVSTDPAHSLRDIFEQEFGHEPTKVKGYDNLYVVEIDPQKAMEEYKEKLKAQIEENPFLGEMLEDQLEMAALSPGTDESAAFDVFLKYMDSNEFDVVIFDTAPTGHTLRFLGMPEVMDKYMTKLIKLRKQMSGFMKMMKKLLPFDYDKMLEELEKMKERIVRARNILSDPERTAFRLVVIPEEMSILESERAMKALQKYGIPIDAVIVNQLIPEDVQCDFCRARRELQLKRLEMIKEKFGDKVIAYVPLLRTEAKGIETLKQIAKILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenical pump-driving ATPase
publication title Tail-anchor targeting by a Get3 tetramer: the structure of an archaeal homologue.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 111
structure length 303
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ug6A00
1UADA 4JYCA 1N5JA 4B48A 4LJ5A 2Y8EA 4TTPA 2G9NA 1ZINA 2G77B 2A3RA 3LNCA 3W8NA 1RC8A 4TT3D 1CXZA 2I1VB 4C0SA 1GWNA 4TYYA 3EIQA 4NYMR 4ZDWA 4BPBA 1X8KA 5DH9A 2IUSA 4JLNA 5DSZA 5L3QA 1NLZA 2C03A 2VHCA 2IT1A 3EWSA 2GWHA 4PC2A 1XCMA 1P61B 2X19A 3NEJA 2QY9A 1HUQA 4R2IA 3QKRA 4X8MA 4HB4A 4HUQB 3TVTA 3RS5A 2WTUA 4C30A 2FN4A 2YWGA 3Q9LA 3K1JA 4NCNA 3T06B 2WIBA 4M1KA 3WHLA 1MKYA 2IYZA 1SVMA 1DAEA 3MWLA 3FB4A 2ZQ5A 4CYMA 1XTQA 4AIIA 1KKMA 3NKVA 2OO7A 4Q9JA 5EP2A 2P3SA 1IJFA 2J0UB 2R65A 3DZDA 3EX7C 1SVSA 4Z1MA 2IS1A 2ZJ5A 4FCTA 1AS0A 5F98A 1K5DA 4URXR 1UM8A 1SVWA 4ESHA 1XFAA 2H7VA 2DFTA 1XD8A 2OXRA 3CX6A 1QHHB 4QBGB 1FL9A 4GPTA 1PZNA 4MITA 1L8QA 5EXTA 2FFHA 4EQ6B 3GMTA 1NN1A 4KBGA 3BIFA 4OI0A 2ANBA 5KOYA 2WOOA 3GJXC 1A1VA 2UZIR 4HZIA 4K46A 1GKUB 3QKSB 4IFEA 1Z6AA 2FZLA 4KHZA 1VIAA 3O47A 3MWKA 3RC3A 3EIEA 3QVVA 2JLYA 1Z06A 4GZMA 3VHLB 1KO7A 3AGQA 3B2EA 2BKUA 1HA3A 1P2UA 1U8AA 2XTMA 1K5GA 3B5JA 4DT1A 2CL6X 3MUFA 4WOPA 5D3MA 3A58B 4TL7A 4NH0A 3VR5A 421PA 3TQCA 3EA0A 3WNBA 1ZUNB 1NL3A 121PA 5CYOA 5FPKA 1KAGA 2QP9X 5KNBA 3GJ6A 1P9WA 1J8MF 2QPAA 4UNQA 3CR7A 4HSEA 1VCOA 3JZMA 2J41A 2VEDA 3SBEA 4LJYA 1WBDA 2Q21A 3RRMA 2P6RA 3CBQA 1KI6A 2Z4SA 1G6HA 1PJRA 4IJMA 1FMJA 3KX2A 1SKYE 4B3GA 3I62A 2D74A 2JLSA 4BLSA 5DGXA 4EFMA 4EPWA 1G3RA 4Q7JB 1YE8A 1NI3A 3TKLA 2YOFA 1E79D 1D5CA 3BC1A 3U4QB 2QGNA 1VMAA 4HAWA 2NO1A 1TQ6A 3FVQA 3RSOA 3ZS9A 4A8JB 4FMDF 1XPOA 5GJBA 2D2EA 3LFUA 5E4FA 3ZQ6A 3FHTA 2YZ2A 4YXWA 4IHQA 2PL3A 1ZP6A 1E2EA 2FEOA 2PBRA 1QBKC 1QF9A 2VSFA 3EPJA 5EE9A 3C8UA 4M1YA 3UWOA 4KYUA 1E1RA 4NCHA 1OB2A 3ECCA 5E7IA 3F3YA 4FI3C 4MA4A 3TQFA 1HE8B 1XU4A 4B2LA 4MKHA 1XMSA 4YMWA 4D4MA 3O8BA 5LBIA 5EXPA 5KUTA 4QL3A 5AJXA 2X2FA 4B74A 3EAQA 2XITA 2FH5B 1F3OA 3BRWD 4Q4AB 4W7SA 3RANA 3PITA 3M0EA 4IXMA 3SE0A 2CEAA 2P6NA 3VX4A 3EZ2A 2NGRA 4X8LA 3PUYA 3TR0A 3ZVRA 3ADDA 1E2JA 1E0SA 1E4YA 2ZJYA 3SYKA 2WWWA 3VR6A 2W2TA 2I1QA 2YHSA 2ZSEA 1YRAA 2J0UA 2GK7A 1PVOA 2V8OA 1AKYA 4I4LA 2G83A 4Q5IA 2ATVA 3H2YA 3NTUA 5FUVA 3VMFA 1UBGA 4BFVA 4QM7A 3VFDA 1E9CA 2PZEA 2UZ3A 2CLDX 1FNMA 1G8HA 2ZJ8A 3OHMA 2KE5A 3ZD7A 4B43A 3LQRA 4RZ2A 2FE4A 1HEIA 3DMNA 3QIAA 4PO8A 2EWWA 3CH5A 2WJGA 4HB2A 1M7HA 4YLGA 4M1WA 4Q21A 3DOEA 2Q9CA 1KSHA 1FFHA 1RRFA 1Z0DA 3FE2A 3B7GA 5FTNA 4PZLA 3AF1A 1XPRA 2VPPA 1DOAA 2V7QD 3Q3JB 2WOJA 1Q12A 2HDNB 4QGFA 4Z8YA 4IXNA 1SHZA 5A4JA 3CF6R 4MGYR 1EFHA 4KJZA 4Q1AA 1VCIA 2QBYB 1IAQA 4L9WA 2VP0A 3A4MA 4QBFA 4MKIA 1L7VC 2NO6A 3KFVA 1JNYA 2IUTA 3HU2A 2RGGA 1FNNA 3AM1A 4URYR 2WWXA 3PJRA 3L0PA 2H1LA 4TSFD 4IDNA 3LBNA 3QXXA 1E9EA 2W2VA 1G8FA 3EARA 3QY0A 4LOAA 4V0MA 1FQKA 2NO7A 3CRW1 5EE3A 3W9YA 1W7AA 1YQTA 5BYKA 1KJWA 1QVRA 3DDCA 2IYXA 2GHIA 4A82A 1ZD1A 3RS7A 4LV6A 1XMVA 2HYDA 3T35A 1OT3A 1XMJA 2WMNB 3WYGA 1QZXA 4A2PA 4BFSA 1E96A 2D2FA 4B2IA 3O8CA 1KAOA 5HE8A 3BBPA 3GLHB 621PA 4AKGA 1F5NA 1R5OA 2DHRA 2EFDB 2JJ1D 2RGCA 4ARZB 4D82A 1E3MA 2ZI6A 4DZZA 1T5LA 3WBKA 1VECA 1A2BA 4A8JA 2QAGB 2OILA 4EAQA 1KI3A 4OL0A 1II8A 3E2IA 5CJ2A 4HLCA 4JLKA 5FTKA 4JLPA 2F7SA 3B6EA 1X8JA 4UQOA 1FP6A 4M4SA 3CW2A 4GDFA 3HU1A 3MMPA 1E2IA 1KK1A 2FGKA 1DO0A 3JVVA 5SZKB 5JEDA 2QENA 3TSOA 3FOZA 2IF0A 3G82C 3HDTA 4EJSC 5G40A 5JFGA 4RFVA 4XD7D 1LF5A 4LHYA 1ZCBA 4Q9HA 2VP9A 2DR3A 2ZJBA 4PANA 1P4SA 1Q22A 2CMKA 5JZVA 3PQCA 4Q4AA 2H92A 2J1LA 3NBYC 1NBMD 4NYIQ 1DADA 2GVZC 2FF7A 3GEHA 1PV4A 1SGWA 1E6CA 4TLDA 5CITA 4G5OA 4EJSB 1G4UR 3U3MA 2A5JA 4FN5A 1OYWA 4Q18A 2PCLA 1CR0A 2KWIA 5EP3A 2OFOA 2OG2A 2XXAB 1NKTA 4B33A 2JIZD 5DISB 4RY2A 4QG7A 4ILEA 4TMTA 2AKAB 2R6FA 1ZD8A 4NYMQ 1WBBA 2JLUA 3TBKA 3K70B 4G5RA 1EWQA 3VKHA 1A4RA 5CDFA 4HB0A 2KBFA 2YWEA 3U7EB 4I1VA 4WZ6A 1Z83A 5DI9A 4RFSA 2HEIA 1MV5A 4DCTA 5FL3A 4KU4A 4HLDA 4KLZA 3SNHA 2EFHB 1T3LA 4ACBA 1MO5A 2OESA 2W0MA 4XVQA 2B8WA 1W47A 3QF4B 1EXMA 3IO3A 2RHMA 2XNDA 1ZJ6A 1DBSA 3ZIAA 1N5KA 3GEEA 1JI0A 5B30A 1CJVC 4U00A 3R7WB 4D6PA 3GEIA 3LV8A 3CRVA 4XVRA 4QXAA 5CYPA 1CRPA 1R0ZA 4MDFA 2C9YA 2W58A 4LCBA 4ASUD 2JDID 4DSOA 2CJWA 3FFAA 4TLEA 2P2LA 3CUEF 3LA6A 1EG7A 3OEHA 4MRRA 4B2PA 2JLQA 4BFTA 4KVGA 3CNLA 4I81A 3CIOA 1P3JA 3U7HB 2FSFA 1P7CA 3LBIA 1P2TA 3M4YA 2J59A 2QRZA 1CKEA 5CK4A 1GIAA 1QG4A 2J0VA 1JBKA 1W0JA 5IK2A 4AURA 1NN5A 3GLFA 3GLGB 4JSTA 3EPKA 4XWKA 4RD3A 1M6NA 2EFEB 4DLYA 2IS6A 4JLAA 1YZNA 5K8UA 1NLYA 2WAXA 4ARZA 1CR2A 1US8A 4TMWA 2F3TA 1KSGA 5KPJA 1KGDA 1XEXB 3W6NA 2OEPA 3M1IA 4PPNA 4YC7A 2V6IA 1E1QD 4P4TA 2ZJAA 1O3YA 3O8DA 4M0LA 3MGCA 1P9RA 4B6EA 4H1UA 4ZDIA 4V0KA 2WJYA 1KHTA 2BCJQ 3MRSA 2AWOA 1ZAKA 2ZEJA 3GJ0A 4V0LA 5LD2C 1QRAA 4MYHA 1BMFD 3X1ZA 2WM9B 3P26A 4E03A 1RE0A 1NP6A 3W6OA 2QT0A 4TYWA 3D8BA 3TIFA 5TDHA 3GJ3A 5H8WA 2ZU0C 2JJ1A 4XJXA 1NVUQ 1KO8A 2VP4A 2ZUBA 1ZNXA 1WE2A 2XGJA 1BH2A 2VP2A 3L0SA 5LD2B 4TQUS 1ZCAA 2GXUA 1AGPA 1E2FA 2BM1A 1IN6A 2BEKA 1NIJA 1XEFA 2DPXA 4EJSA 5FTMA 2IX3A 4KITB 4BFXA 5FOTA 4DDWA 5F9FA 5L3VA 2XXAA 3AUYA 3C41J 2IEZA 5FOVA 4GFDA 3DOFA 5JHHB 2D06A 3HYTA 3CNNA 2IYSA 5L3RA 4C0JA 2UKDA 4PAMA 3I3SR 3LVQE 1KK3A 3VR1A 4WVFA 2ZANA 4RD1A 5JMTA 2F6RA 1W2GA 1AZSC 1OKKD 2WIAA 3QKTA 4G5QA 1RW4A 4CGZA 1OV4A 1DEKA 1COWD 2OV2A 4J0QA 4XH9B 1LS6A 5FUYA 3ZLJA 4JIMA 1BOFA 4FMCB 2Z6VA 1AJEA 1HT1E 3U5ZB 4MYUA 2IXFA 2BHRA 2PEZA 3Q5EA 3TSWA 1T0HB 3E5HA 4DUGD 4OKSA 1YU9A 2WWFA 5EZ6B 3REGA 3IPXA 4NDZA 2Q6TA 3EZFA 4C2UA 2P6UA 2JIZA 3DMDA 3EWAA 4OK6A 3BH6A 3AEZA 3FKSD 1D8TA 3A8TA 3RWMB 2ZRGA 4B76A 2FDCA 1NF3A 3VAAA 2WSSD 1ANKA 4A15A 1J99A 1WCV1 2PMDA 1W5TA 3CRMA 1RVDA 3UWKA 3BB3A 2NG1A 4KFRA 4JJZA 1S8FA 4C0QC 3NHBA 4Q1CA 4BGDA 2XAUA 3QI2A 5F2EA 1DS6A 2NTYC 4JBXA 2V55B 3CPJB 2F1JA 4RD6A 5FR1A 2F1IA 5FBVB 2F9MA 3H0KA 3OEED 1SVKA 3L43A 4A0FA 4BECA 5IT5A 3CZQA 1SXJD 4G0NA 1CJTC 3ETLA 4OHYA 4WZAE 3THOA 1IY2A 2RGNC 2OCAA 3GLGA 3DO6A 5CM8B 2GETA 5AJWA 2GA8A 1LNZA 4QM6A 4JLDA 3K9NA 3EPLA 1YZLA 2JATA 1OHHD 1OXXK 2ZM5A 1N6OA 3RABA 1MRNA 2J46A 3WNDA 2VF7A 5BN3A 1TEXA 2H16A 3KTAB 2IHYA 1P2SA 1N3BA 5HZKA 1CRQA 1FPMA 2V1XA 1E9SA 4PTLA 5EZ5A 4LX0A 4Q19A 4NCJA 5D3QA 1U0HC 3UIEA 3GQBA 5C4MA 3OIVA 1E0KA 1WRBA 4HATA 3C15C 1ZBDA 3I73A 4CRWB 2KB0A 1DARA 3TGPA 1SHKA 221PA 3KXKA 4PFSA 1EWRA 1Q1ZA 4PC3A 4P0TA 3AVQA 3K9GA 4M21A 2IYUA 2QMHA 4PPFA 5C46F 4DDTA 3VKGA 2DWPA 3BB4A 1Z0IA 1E69A 3QEJA 3TVDA 4BWYA 2DB3A 1QG2A 1N6LA 1ZM4A 4DLSA 1AZTA 1M1YE 2A5YB 4BASA 3LRPA 5J4HA 3RAPR 2QMUA 4Z1MD 2YJTD 5JLJA 2GXQA 1AS3A 1P75A 3PG5A 2IUUA 3S1AA 4V0NA 1KJZA 4MKGA 4N3NA 1H8HA 2CLSA 1E2PA 1NVXQ 4DRZA 3ZJYA 2V6JA 3ZD6A 3L8ZA 1LW7A 2FG5A 2B21A 1UPTA 3BE4A 1G6OA 1X1RA 3PEYA 1G17A 2YV5A 5HCIA 4B32A 5EE1A 2JJ8A 3NHAA 1IONA 1BIFA 1GNPA 5SZIA 1DAFA 2A78A 1GG2A 2XZOA 2ZITA 1N6RA 521PA 1XJCA 3QE0A 1BYIA 5E95A 1N25A 2ZUCA 5KSYA 4KI0A 1GL9B 2SHKA 4U7DA 1L4YA 1TPZA 3SHFA 1Z6TA 3KJIA 4XIGS 3I72A 3OZXA 3SDZA 3QENA 2R6AA 2H18A 3B78A 2OE2A 3QSYA 5CIWA 1N6IA 4P4UA 5IDVA 4F93B 1FMLA 2P67A 3GCGA 1G3IA 4MGIR 1KI9A 3B9QA 4IRUB 2G6BA 4CDGA 1P5ZB 2BMDA 1V5WA 4M53A 4GOKA 4X8OA 2JLRA 4MRPA 1N2CE 2IHBA 2AXNA 1CR1A 4DUGA 1S9HA 4D25A 2YC4C 1DAHA 2L0XA 4LHWA 2EVWX 2REXB 4MUBA 2BOVA 1E9FA 2F1RA 4F38A 2J9RA 4MRNA 5FFMA 2PJZA 4EPYA 1PLJA 1D9ZA 2BCGY 2IWHA 2QZ4A 1ZUIA 3PUXA 2QMOA 4DIEA 1UJ2A 4OJQA 1J2JA 5IF9A 2A30A 3R20A 4XOIA 3RS2A 3KJEA 4OQLA 3NH6A 4IDQA 4QJ3A 2G0TA 2ZRHA 2MMGA 1JQJC 4URUR 1P6XA 1G3MA 2ZRJA 3SC3A 2F43B 2V3CC 3OIUA 3WXMA 1ZM7A 1E1RD 2BJVA 1Z2CA 3U6KA 2AK2A 1G1MA 3SQXA 2EYUA 4TYQA 1VG9B 4QNMA 5G41A 2WKPA 1FTSA 3EIHA 1G20E 1ZVQA 4JVNA 4KVAA 4CT4B 3FMOB 1XBTA 1OFHA 2ZSFA 2QMEA 4NZYA 4CEJB 4ZIRB 1Z2AA 5AUNB 4C7OB 5HKKA 3KQKA 3SJZA 1P72A 3QBTA 4P4SA 3LX8A 2NPIA 5KTYA 2QEQA 2ZI7A 4MYTA 1OHHA 1CP2A 4PQYA 1G4AE 5A5GA 3BB1A 4W5HA 3PENA 1L4UA 2C96A 1TAGA 5DNYB 1VHTA 1Z0KA 4QGHA 2NZJA 5DN6A 2IS2A 1YZTA 3NG1A 4O25A 4ZI3A 1SVOA 2C99A 2Q9BA 4PHHA 3MWJA 3U60B 3QNUA 4GP7A 4O3MA 4D2IA 3I1FA 3PV0A 4D80A 2ORWA 3NVAA 1OFTA 3GLIE 3R8FA 4WW0A 1JXOA 2D7CA 4BRUA 3WYFA 1R0XA 3AP1A 4GMDA 5UKDA 1IY1A 2ZREA 3UATA 1QHYA 2QUZA 1RJ9B 1W46A 4AWXA 1U2RA 4TLBA 4TWZA 2FFBA 3SN6A 2PLRA 2RMKA 3UG6A 4PXAA 1JR3A 1XTJA 1Z5ZA 3QKUA 1N6KA 4F91B 3DKPA 1XD2B 1P60A 3EXAA 1B0UA 3TUIC 3ZZUA 4JT2A 2QN6A 4OBEA 5L3SB 4UXJA 1J8YF 4CT5A 3KKMA 2EU8A 4ZO4A 4ABYA 1M7BA 1T4GA 4OQFA 5J40A 3CRQA 2BC9A 4Z51A 3U7FB 5FUXA 3A4NA 2YYZA 4OHVA 1FUKA 1XDBA 3TJZA 3U44B 1EGAA 2ZJOA 3DM5A 5K8LA 4Q4JB 4NMMA 3EASA 1II0A 4K81B 4LYFA 2F3RA 3DEFA 1LTQA 5EE5B 4OI4A 4BFUA 1U8YA 4UKDA 5TV2A 1NMZA 3I8XA 1AM4D 3MJHA 2AX4A 3PEUA 3CPHA 1RPZA 2Z4RA 3WY9A 1P62B 2OBMA 4KSCA 4KAXA 1KO1A 1MH1A 1S1MA 1Z8FA 2RGDA 5DI3B 1E9BA 3WMGA 1HV8A 1F2UB 4QOSA 3AKDA 2Q3MA 3AP3A 4LK2A 4DIDA 1KMHB 3SBDA 1HQYE 1E0JA 1Q20A 4HB3A 5G3ZA 5B57C 2YWFA 1CS4C 3TUZC 1MT0A 3KKNA 2QM7A 5DE3A 1D2NA 2UVQA 4XSGA 4A8JC 1JPJA 4LV5B 2OCBA 4LJ6A 1AQYA 2F43A 4POAA 4OJKA 4OK3A 2QPTA 1NMYA 1ZC4A 4KFSA 5TARA 3UANA 2GEDA 2CE2X 5KDLA 1NBME 1S0UA 4TYPA 2CXXA 4DLRA 2ZTSA 4C9BA 2P5SA 1I2DA 5K8IA 2Q9AA 3D6TB 5CB8A 1HE1C 1P2VA 3A36A 2QI9C 3ASYA 2O8EB 1KIMA 4JJKA 3CKLA 3SYNA 2OHFA 4AG6A 2ZR0A 2AHOA 3X1XA 2QT1A 4ON9A 3FHCB 1Z07A 1Z6YA 4V03A 2DBYA 4RD2A 5JWRA 3A1TA 3CWQA 4AYWA 2FA9A 2GCPA 1TEVA 1EK0A 1VHLA 4IVRA 1ZM9A 2ZRCA 3U7GA 2CBZA 3FMIA 3C16C 4IKEA 5LB2A 2IYVA 3CONA 4GT1A 4Y0VA 1XWIA 2IL1A 3UK6A 3WMFA 5AJYA 4LI0A 2C8VA 4HUQA 4URWR 4CEHB 4YDSA 5TB5A 5FL7A 1Z0FA 3ZVNA 5FBRB 1TQ4A 1SKQA 3TNFA 3KQLA 2R6DA 4UJ5A 1X3SA 1IBRA 2G3YA 3K0CC 3KQNA 2OXCA 1BYUA 1IN5A 3LAWA 2JJ2A 1MO6A 3A1UA 4PHFA 3EPHA 5P21A 1YHNA 2VP5A 2XNDD 3CR8A 3BJIC 1G8YA 3ZIAD 3C5HA 3OESA 2FMXA 4LYJA 1KK0A 2JAQA 3HP1A 3EZ9A 3LW8A 2ZRNA 2C77A 5DYGA 3T5DA 1KMQA 3AUXA 1QHNA 2B6HA 4G5SA 4LJ9A 4MH0R 5L3SA 3QBVA 3AH8A 1EFCA 1E2NA 1KY2A 2O52A 2WVJA 2ZI5A 3M6AA 4Q1FA 3RS0A 1QHHA 2X77A 4DEXA 3T1QA 5DO9A 3THYB 1F6BA 4M2LA 3QXSA 2GJSA 3PUVA 3R9IA 4EQ6A 5LDDC 3OEHD 1W44A 2AR7A 2B8TA 5SZHB 4BE7B 3QKSA 2A9KA 1N5IA 2N1BA 3K0EA 1IQPA 4MRVA 2ZUDA 1GRQA 4JKYA 3PUWA 5IK2D 1W0JD 3B60A 3I61A 1N0UA 1Q1EA 2J45A 4PC1A 4E5UA 5KHOC 1NKSA 1G8GA 3OE7A 1Q21A 5DI3A 5FBWB 4O2RA 1E2HA 1F2UA 3AVOA 2ASEA 3AF3A 2WJHA 3NXSA 1SZPA 2C5LA 2IYTA 4JZKA 3L0OA 3PXGA 1TUIA 1KOFA 4EFLA 3NEYA 1NSTA 4JLJA 1GDDA 3H1TA 5JI2E 2VF8A 4GP6A 2QAGC 2ZI4A 3GJ5A 3W5JA 2C95A 2QSYA 5KDDA 3V4RA 3KXLA 4P33A 2FZ4A 5CIQA 4A0RA 2C9OA 3L8YA 1T3SA 5TVKA 3REFA 5E3HA 1GNQA 2G0NA 1KDPA 2ZJ2A 3B13B 4HZUB 3U4QA 1XJ0A 2WJVA 1UBFA 4JS0A 2ZAOA 4OQMA 4QGAA 4PZYA 2O8EA 4TL9A 3WYAA 5JJIA 1I4DD 2J87A 3QF7A 5L8VA 2ZVPX 1DE0A 1Q1QA 3GLIB 1W0KD 4C4PA 4PAQA 4BLQA 3QXHA 2RGXA 5JS8A 3VQTA 5KYKA 4LC1A 4PSVA 2GESA 5FPYA 5KSOA 1DAGA 2MMCA 1OH8A 1ZU5A 5JSZB 3EA5A 3R9WA 4TLAA 2GNOA 2O5VA 2CVFA 2CVHA 2AFIE 2HCBA 3WP1B 2GAAA 4E09A 4D0GA 4BLOA 2OT3B 4M9ZA 4BZXA 4XWOA 5JJKA 2DCUA 5JS7A 3NBXX 3SJAA 2YOHA 2PLFA 1RRGA 4CEHA 4DSNA 3RNLA 1AKEA 1KJYA 2O8BB 5FPHA 5HPYB 5KNCA 4NYJR 1T0JB 1ZD9A 2NQ2C 2ZVQX 3K70C 1GITA 1R0YA 4LBYA 1B23P 1S2MA 3A1SA 4DLZA 5FPSA 3ZH9B 4NCIA 1W4AA 3ZDQA 1E2DA 1E2KA 1XXHE 2W6JA 4OI1A 3ADCA 3CPEA 4URVR 1VYTA 3RWOA 1KNXA 2IYYA 1LS1A 1UKEA 4JBYA 4LUCA 3SOPA 2F1HA 2Q3HA 2BM0A 3AQ4A 3K0CA 4ZKEA 1SXJE 2HLDA 4EIWA 1X1SA 3CRRA 1RRPA 4YMSA 2HYIC 3QVUA 4BLPA 1CIPA 1NVVR 4DCVA 1JAHA 5EP1A 4LV8B 1Z08A 4DWJA 3ZVLA 4MDEA 4DB2A 5TXGA 4JLBA 3V00A 1M74A 3SHWA 4DDVA 1NSFA 2X2EA 3F0TA 4WA7A 1VG0B 1EFUA 5IRCD 3DZ8A 2ZRPA 4KCGA 1E2MA 1HYQA 1ZIPA 2V54A 1XNJA 1G7CA 1XEWX 4MKFA 4W5JA 3W6PA 3W5IA 3U6BA 1UAAA 2QBYA 1VCNA 4HUTA 1IXZA 3VKWA 1SKYB 1JJ7A 3ND9A 4Q4HB 721PA 2QQEA 1G5TA 1HH4A 2ONJA 4C0LA 4LC0A 4I99A 2GJ8A 4IW3B 4N0DA 4Q48A 4RVCA 3U3JA 4D81A 3AVTA 4FMBB 2FPKA 2PJRA 1M2OB 1CJUC 2P65A 3RYTC 3SJBA 1GAJA 2HJVA 1GFIA 2EQBA 2ZYTX 2VO1A 5J4KA 2IYWA 1NJFA 3KB1A 5EJEA 1ZM2A 4UNNA 4TMKA 2CK3D 2YWHA 2DFLA 3ASZA 4QBHA 3A4LA 2FSGA 1ZYUA 3KJHA 4FINA 1W36B 5FBQB 1QVAA 5CLLA 2I3BA 2W00A 3SQWA 1RYFA 4S2EA 4BRWA 2YC2C 4ERNA 3I92A 1E9AA 1MABB 2CDNA 3GLHA 4NP6A 3HWSA 5EUQB 4FWTA 1T8UA 1E94E 3EC2A 3RRYA 3KQUA 4MRSA 1OW3B 1Z6XA 1UEIA 1TTTA 2ZE8A 4HZUA 2ZI9A 5CM9C 4DLXA 2QAGA 2O8CB 5DHAA 5AR1A 2C98A 2ZE6A 4Q9IA 3LVRE 3P1JA 4LJ8A 5CLQA 5GVSA 5KPDA 3SFVA 1OIWA 2XJ4A 4CZ2A 1Q57A 2VP6A 1VDZA 5B2ZA 3U2QA 2EWVA 2ZYVX 2ORVA 3FMFA 3WHKA 4G01B 2YKGA 1H8HD 1RIFA 1U81A 3LXXA 4A6XA 4RD0A 1Z29A 2MSEB 4NL4H 5GADl 2QL6A 3AKCA 2G1KA 3MWYW 2RB4A 3FKQA 1I2MA 4RZ3A 2CHQA 1JEEA 4CVNA 5AUPB 1W4CA 2XOKD 2GJKA 4L8GA 3C7KA 3MAAC 1M7GA 4F7WA 1U98A 2O8BA 1EFTA 2GAOA 3VU9B 4XTCS 4D4KA 4EKDA 2RCNA 4QHTA 4DLUA 1XCPA 1I4TD 2AFHE 5DLQC 2O0KA 4TYNA 1YRBA 3RS4A 1W0KA 1QHGA 4N0EA 3B9PA 3JZAA 1AK2A 4LBVA 3K8YA 3N2IA 2WPDD 2JGNA 2XB4A 3BGWA 3D31A 4QKQA 4RD4A 3V4FA 1EX7A 2B7CA 2GF9A 4HAUA 3HJNA 2J0QA 3HPRA 4PO9A 1YR7A 2ZU6A 4Q01A 2BV3A 3TH5A 1YKSA 2ZI3A 4BZPA 2ZETA 2VHJA 3A6PC 3QPUA 2GBLC 1NN0A 3FFBA 2QTHA 3B1VA 4U5XA 2A2ZA 5LB4A 1XD9A 2FSIA 3QUSA 5HCNA 3KKPA 3ZZ0A 4M8NE 4BFZA 2WMOB 1P73A 5DHFA 4B3DA 4OQXA 4D4LA 4Q1DA 5C4GB 3SS8A 4HAZA 2ZR9A 3QF4A 1NLFA 2QU8A 4DJTA 2VTKA 1YZQA 3MG9A 1DELA 2OSBA 2XSZA 1WMSA 3EZ7A 1EESA 3SEAA 3IIJA 4XSHA 3R7WA 1KI2A 1A5TA 2ATXA 5FUWA 1Z47A 2PT7A 4EUNA 3IILA 2VH5R 3BOSA 3Q7QA 2GF0A 2ZRLA 2FFQA 4HYYA 4IVPA 1VYUA 4DEYA 1BO6A 4JVSB 2J7PD 4FCVA 3BK7A 3OIWA 2W0SA 2QP4A 4DSUA 4XVUA 3IO5A 2ZYUX 4IOJA 1VG1A 3ZS8A 1N6NA 4GZLA 1XZPA 2HXYA 4YMUA 5HKKD 1YJ5A 5FOWA 2W6ID 1MABA 4Q00A 3TLXA 2JLWA 4P3YA 3DPUA 1DAKA 4LYAA 1VTKA 3AP2A 4HAYA 1XEXA 3KFXA 2Q0HA 4Q7MB 5ANRB 2FOLA 5DN6D 2BVNA 2ZRMA 1XRJA 1NNEA 2IXGA 1KI8A 2ZRBA 4BLRA 5J47A 1R0WA 1GVNB 3KXIA 2AD5A 1VG8A 1ZW6A 2CL7X 3W8RA 2D7DA 2CK3A 2NOAA 2Z0MA 1FOEB 4M9SA 3CX8A 3NH9A 3CB4A 4US0R 4B3BA 5C1BA 1X8LA 1LV7A 4IEEA 2GJAA 3Q85A 1Z63A 1G7TA 1XEWY 1IXSB 1Z3IX 4G1UC 5BQ5A 2W2XA 3B1YA 1ELOA 1KK2A 1FW6A 1E9RA 3ICQB 1S1CA 1IJEA 1RYHA 3NIBA 2WJJA 1JR3D 2DWOA 2JASA 1O87A 2BMEA 2IYLD 1KYIA 1SXJB 3AGPA 2CCGA 1CULC 2Z83A 3V9PA 1XX6A 4GBMA 4V0ME 2ZRFA 3O8RA 1UKVY 3G5UA 3KUDA 1TF5A 2H5EA 1K8RA 1U94A 3TRFA 4B34A 3QG5A 3LH5A 5EE0A 3VR3A 4MQBA 3UG7A 1D6JA 3K53A 5FOUA 2WKQA 1EFRA 5EQTA 3C5CA 3FWYA 2PZGA 2XOKA 2XEXA 3EZ6A 4DBLC 821PA 1R4AA 3OF5A 5CK5A 4AYXA 3ZQJA 2O8DB 3IQWA 1TF2A 2IBMA 2LCFA 4OQNA 4DCUA 3BAFA 2KI5A 3QXCA 4AK9A 2IC5A 4QC2A 4LRWA 4R9UC 5KNDA 4MUAA 4AC9A 4DC9A 1UBEA 3PVSA 4JT4A 1E0AA 5A0FA 5FTLA 4US2R 3GFTA 3TE6A 2CNWD 4GNKA 4M9XA 3SFZA 4BZQA 4F92B 2WPDA 2GBLA 3D7MA 4C0BA 4NYJQ 3X1DA 2R62A 3BWDD 1WDTA 3BH0A 4P31A 4NONA 1XTIA 5TY0A 2IYRA 4URZR 3WMEA 1OXUA 3PCRB 3AKYA 1HURA 2QE7D 4QHSA 1Z0AA 2X8AA 3IEUA 3NDBB 5JWHA 2P0EA 2PZFA 3ADKA 2OFXA 2RKOA 1SQ5A 4L5BA 2E87A 2VRWA 4PQFA 5JEEA 1ZNYA 2G1JA 1NN3A 3FGNA 1ZC3A 1ZNWA 3IHWA 2WZQA 1CLUA 4V0OA 5E7MA 2BJWA 3IIMA 3NDPA 2C78A 3QPWA 2ZE7A 4B75A 1E2QA 2QTVB 3B8HA 3AVPA 2JLXA 1SVIA 2ORIA 2MSCB 4ZPXA 5JBQA 4JMPA 3P4XA 1NVVQ 4ZKDA 3FTQA 2BKEA 1GP2A 4U02A 5H70A 3ZGXA 1CJKC 1UBCA 4PPQA 1XJQA 1W49A 2XJ9A 3A1VA 3K9LA 2ZR7A 2BBOA 1DO2A 2NZ8A 2ZIAA 4R2HA 3UXMA 2PMKA 4AD8A 4A2WA 1N0VC 4ZV4A 3OIYA 4QBIA 1CU1A 4DT1B 5CDFE 4R7ZA 1NVWQ 3KTAA 1JXMA 5C18A 1TQDA 5D3MB 1JAIA 1X86B 2RGAA 3AF0A 5FOXA 2GK6A 2JEOA 1T8TA 1LB1B 2J7PA 4WBSA 3IEVA 2R6CA 1YR8A 4WXRA 1FTNA 4TMVA 4M1TA 2XTZA 4M9QA 3U3RA 4B44A 1S4QA 2XTNA 3MJRA 4Q9KA 4EPTA 4A2QA 1TL7C 3B82A 5FL7D 4NPHA 4GI7A 1U0LA 1NY5A 5H1YA 2GXAA 1W1WA 2W6IA 4A0GA 1GRNA 1WQ1R 2FPLA 2OCYC 2FX3A 5AJZA 1KI6B 5FI0B 2JJ2D 1HTWA 1GM5A 4F4JA 4ACAA 4BUJA 2JLZA 1DG1G 1A82A 2A5DA 3BFKA 1CJMA 1FX0B 1OSNA 3X1YA 2ODEA 3LX5A 4H9GA 4ESVA 2HF8A 1PUJA 1ZUHA 4FW9A 1RFLA 3WBJA 2GDJA 4LJAA 4DVGA 1KDTA 5SZJA 2B7BA 1ESMA 4IDOA 3WP0A 1C4OA 4C2TA 3W3ZB 4Q1BA 1F60A 3UKDA 1K6MA 1MRSA 4N1AA 1Y63A 5AUOB 2GZHA 4PR0A 3DVLA 2W83A 3IGFA 3GLFE 2H57A 4DXAA 1N0WA 3IHLA 4TN1A 1IXRC 4B3CA 4KODA 5BN4A 3TR5A 1TU3A 3ADBA 2O8DA 3GLHE 5HTKA 1GSIA 1ZNZA 2QM8A 3W3AA 3X2SA 4A0HA 4EDHA 1J7KA 1E99A 1H65A 1VPLA 2FV8A 4TQAA 4RSGA 2ANCA 4Q4LA 5EUMA 5EXSA 2PX3A 3CZPA 4C0AC 2V1UA 4JKIA 2GTPA 4BQSA 3I5XA 5GJWC 4UNSA 3TMKA 4KO8A 1G16A 1UKZA 2ZJZA 2VIIA 3OE7D 4TMXA 4EPVA 1DAIA 1NRJB 2OAP1 3J81k 2ONKA 3OFNA 1G19A 3QOFA 3QJYA 2QP3A 3AVYA 2AKYA 2LKCA 3CF2A 1ZMXA 4CF7A 1UDWA 4R71A 3B1WA 3SI7A 1OFUX 4C0HA 3TSZA 3ZYCA 4GL2A 5J4VA 2HF9A 2OBNA 2CCKA 3DM9B 4FCWA 4KV9A 1W48A 3GJ7A 4MYCA 4NKRA 4KBFA 4NBSA 4Q03A 1KKLA 3H84A 2V4ZA 2CNWA 1OIVA 1KNQA 1M34E 1KSJA 2OFWA 4HDOB 1KI7A 5DIFA 3T1TA 4LPSA 5TMPA 1TADA 4CW7A 1SULA 4TMZA 4LHZA 4F4IA 3RSLA 1CR4A 2RH5A 4E22A 1L2TA 2QE7A 1CBUA 3BERA 1T9HA 3FHOA 4AKEA 5E7JA 1W2HA 1R2QA 3HR7A 4JL8A 3RVBA 2OAQ1 3ONWA 4NE2A 2EYQA 1E9DA 4LY6A 1KSFX 3H4MA 3BD9A 4XWAA 3L2OB 3QQ5A 2ZRAA 1ZIOA 2DWQA 1DTSA 5B64A 4BFWA 2J7KA 3IDQA 2ODBA 2GCOB 2Z43A 4LHXA 4BFYA 3F5FA 5F3WB 4CEJA 5J4LA 4ZIRA 5K8TA 4EPRA 4WIAA 1Q3TA 4C7OA 3Q5DA 3A37A 3KJGA 3GJ8A 4YDHB 3ZZTA 3CO5A 1II9A 2IK8A 4AG5A 1FX0A 2CHVA 3RC8A 1OE0A 2W6JD 1IHUA 3KDSE 2AL7A 1IM2A 4IFBA 5CJPA 4RJLA 4Q1EA 2ZRIA 1LF0A 4FMDB 1U99A 4DSTA 1CEEA 5KSZA 1GKIA 2HLDD 3ICEA 1ETUA 1II8B 2YINC 4Y0AA 4FD2A 2IWRA 3LW7A 2WJIA 2WWYA 1R5NA 3T34A 2E9SA 4B71A 2V9PA 3FMPB 4B73A 3GLGE 1TX4B 1OYYA 1DVRA 4GOXA 2BMJA 2QTFA 4KFUA 3T12A 4L16A 1T91A 1RJ9A 2OBLA 4HDCA 2J5XA 5FOSA 2O0JA 3FYHA 2VBCA 4IOMA 4Q66C 2ECKA 1XD2A 1PLLA 3F8TA 4JVLA 4C3ZA 4TL8A 4G3XA 5JCZA 2WSMA 3CF0A 3HPQA 3K0FB 2QG6A 5ELXA 5FI1B 2E1RA 4B47A 1FP7A 2B92A 2FEMA 5EP4A 3BXZA 3KB2A 3LQQA 4PSAA 3QPVA 2YOGA 3WRYC 4JL5A 3AF4A 3QEOA 4TT3A 2VHQA 4HLUC 1OF1A 3U44A 1QDEA 2EFCB 2WKRA 3NWJA 5IHPA 4Q4JA 2ERYA 4TZ0A 2DY1A 1GILA 2R2AA 1CTQA 3GJ4A 2I4IA 2D4HA 3TAUA 2AK3A 1JJVA 4PHGA 3SU8A 3DHWC 3I4LA 1DG3A 3T5GA 3LLMA 3D3QA 4HAXA 4A6PA 2O0HA 3IBYA 1CF4A 1G3QA 1LVGA 4QRHA 4RFSB 2D62A 2JLVA 3R9XA 2QA5A 2BMFA 2ZYWX 4Q9LA 2P5TB 4OHXA 1UFQA 2IXEA 3NBFA 1KMHA 2ZROA 2BWJA 5BYJA 4JLOA 1C1YA 2JA1A 2A5FA 2ZS7A 3WRXC 4A9AA 1TQ2A 5J5CA 4BEBA 1NJGA 4DB4A 1SVLA 4X8HA 2J0SA 2GXSA 2OZEA 5DYIA 4G5GA 4D4JA 1IN7A 4JL6A 4LJ4A 2CL0X 2XZLA 1GKYA 4TLCA 2FJUA 2QQ0A 2GCOA 2CJWB 1ESNA 1S3SA 3SYLA 4RZXA 4HI0E 2N46A 4IVQA 5LPNA 4EPXA 1Z6GA 1E98A 2FWRA 3IBGA 1XCGB 2XNSA 3IKJA 5FTJA 5JRJA 2J3EA 1F48A 1Q3HA 5G53C 5HZHA 2FU5C 2Z5FA 1OB5A 4Q7KA 5HE9A 3VNUA 4LBWA 4TTQA 3GLFB 1XF9A 4OHWA 3AKEA 4A92A 1YZGA 1QHXA 1XTRA 3IPYA 1Q1BA 3LD9A 3LY5A 1BS1A 1JQLB 4B3FX 3EC1A 2WHXA 3T1VA 2FPMA 4GSYA 3R8CA 1XTSA 1US8B 3EG5A 1OLOA 4AKHA 2ODWA 2YNMA 1UKYA 3K70D 1HT2E 3T1OA 3TAHA 1D2EA 4PX9A 1TUEA 3TK1A 4IDHA 1KI1A 3C4JA 4FWIB 4RCYA 5AWFC 3BFVA 3GD7A 1P9NA 3KKOA 4RKFA 2Q3FA 4DKXA 1Z0JA 2ZRKA 1WP9A 5JWOA 2VA8A 5FBLB 4M1MA 3BH7A 4Q02A 3DKVA 3U61B 1WXQA 3JVUA 1LY1A 4ZCMA 2KJQA 2XSZD 4KSBA 1E79A 1JB1A 2BIFA 3THWB 3K0FA 3MLEA 4II7A 3N5CA 1R8SA 3PEWA 1G64A 4OI2A 1AS2A 5C2JB 2WWGA 4OHZA 2ZSDA 2DYKA 2HT1A 4B6FA 1G5PA 4XTRA 3THYA 4IOLA 3LDAA 6Q21A 4GOJA 4QJ4A 1OH6A 3VHXA 3RRZA 4K8OA 1JECA 4QHYA 1NG9A 1GUAA 2R9VA 1D9XA 3BFXA 4S35A 1G9XA 2CLCX 1JALA 2JCSA 4OK5A 1GZSA 2R44A 1W36D 5JECA 3U3OA 5FPTA 2QROA 1M8PA 1A2KC 1OIXA 4HLUA 3FDIA 1KDRA 2AWNA 5HR5A 4PC6A 1MOZA 2XX3A 1N6PA 2VSOA 3CX7A 1W36C 2NPFA 1YR9A 3KQHA 3H86A 2GCNA 3G0HA 4M1SA 4HLQB 1DAMA 3HR8A 1GNRA 3K09C 1MR3F 1EX6A 2AD1A 1T5IA 3KZ1E 3W34A 2HCJB 4QNRA 3TUJC 1R7RA 1HY3A 1S9DA 3Q8XB 3AB3A 1JR3E 4LJ7A 2AN9A 1OXSC 1V43A 2BBWA 1U90A 3QG1A 4I1OA 5JRZA 4ZDKA 1JEDA 2IEYA 4O2LA 1KZ7B 2WWIA 4W9MC 4M22A 1TNDA 1AGRA 4D0LB 1XPUA 4ZCLA 1A7JA 1QHSA 3B85A 4L9SA 4KFTA 1J90A 4TQ9A 1BKDR 2VYFA 2O8FB 3VR2A 3GLIA 2F55A 4PHTA 1VKJA 4UXHA 2V7QA 4YQFA 2XB2A 2C9CA 4Z8XA 2PCJA 5GJVC 5CB6A 2IS4A 2LWIA 1OXVA 2PT5A 1AN0A 1XP8A 2FGJA 3P32A 1U9IC 2HT6A 2QNRA 4NCKA 2CE7A 4ZDJA 1WF3A 3RS3A 4ITRC 5JSZA 4KYIB 2DFNA 2IA5A 3VNVA 1EFRD 1ZRHA 4AI6A 2FFAA 1C9KA 3CLVA 4IEIA 5KDOA 2ZXUA 3PR1A 4TSFA 1ODFA 1YVDA 4FIDA 3B1ZA 1S3GA 4UJ3A 2ZPTX 2ZS9A 2QORA 4PAOA 3MD0A 1GOTA 3E70C 4Z54A 2OCPA 5J4YA 3GP8A 3N2EA 2OLKA 2N42A 3KKQA 2PX0A 3P4YA 1MO4A 4Q7LA 1F2TB 1XMIA 2XZPA 3C14C 4GMXA 3THXB 1KO4A 4DLTA 4I1SA 4QJ5A 2D3WA 2IF2A 4TTRA 1OJLA 3THWA 2BBSA 1VCMA 4AYTA 8OHMA 1U0JA 2CHGA 3CH4B 1GL6A 2OM2A 5EXXA 4QGGA 1RKBA 2WICA 3K0AB 4L15A 2ODNA 1KO5A 3S1AB 2REOA 3MCAA 4PSKA 2LKDA 3VX3A 5FH9A 1OPXA 2NO0A 2FNAA 2RAPA 2WBLC 4FMCF 4E07A 2BDTA 3RRNA 3I8SA 1OFIA 3WNCA 3UMRA 1T6NA 1OH7A 1IN8A 2FSHA 1T3HA 4XD7A 1UEJA 1N6HA 3T61A 5JJLA 4D0NA 1ONBA 4RCZA 4C0KA 2VSXA 3MSXA 4DCSA 5BW8A 2DFKB 3SR0A 5KO2A 3AVVA 1Q0UA 2IYQA 1FUUA 4Q4HA 1NBMA 4AY2A 4PPGA 1Y3AA 2QSZA 4QFMA 3UMFA 4LBZA 2KSQA 2RHDA 1N5LA 2RGEA 2WAYA 1UF9A 4DCNA 1E4VA 1VYVA 4LSGA 3IIKA 2A5GA 3HYRA 3LLUA 3SJCA 4CEIB 2ZE5A 1Z22A 3CM0A 2GZAA 1AQUA 2ZSBA 5KU1A 1G7SA 4M1OA 1E2GA 4JLVA 4MGKR 1I4LD 2GJ9A 4KXFB 3SZRA 2OLJA 5GJCA 1FQJA 2WV9A 1YZUA 1KY3A 4FXPA 1GRRA 1FZQA 1G291 3PIRA 3K9HA 3K09A 3FPAA 4NU0A 5BWMA 2GVDC 1H8ED 5KSPA 3TW8B 2O8CA 4H1VA 1TF7A 2A7QA 2QRNA 1G41A 2NO9A 3GPLA 2R6GA 2ZRDA 5JI3E 2O8FA 2WWHA 1G21E 1XTKA 4P32A 5JCPA 3OAAD 2GEUA 2OUKA 1G5RA 5AK0A 4D26A 4BEJA 1R6BX 3U3KA 1W4RA 4JSYA 3X1WA 1UDXA 4LDJA 1X6VA 1SXJC 4JVMA 2EFGA 1E32A 5AJVB 4WZBE 3IQXA 3I5YA 1TU4A 4DLWA 4LPKA 1XXHB 2ZS8A 2KBEA 3L82B 3K0SA 4ASUA 2JDIA 3RHFA 4I1UA 4WAUA 1JPNA 3TW4A 5JHGB 4PZZA 1JR6A 3VU9A 4CIDA 2ZAMA 1OXTA 1U9IA 2YVUA 2VLIA 4BLTA 4US1R 5BN5A 3LBHA 1W5SA 2QAJA 4HDQB 4JYBA 4LGMA 3P27A 3RLFA 3E1SA 2NMVA 3PUZA 3NC1C 1NG1A 4DDUA 1F2TA 2GKSA 3B1XA 4RKEA 4P4SB 4RZUA 4IDPA 3THXA 3OFND 3PEVA 1G18A 1GTVA 4ZCIA 1QHIA 2VHUA 4AKIA 4UNPA 3Q72A 3LWNA 4TZ6A 4LYHA 4MGZR 5M04A 5L3QB 2HXSA 3MFYA 1ZM3A 5B58C 1E1QA 1W4BA 5G3YA 2CCJA 3K0AA 4WXPA 2C2HA 1KZGB 4PC7A 1NIPA 2GILA 2QPOA 1TMKA 3ZVMA 1KDOA 3HU3A 3QKRB 1Z28A 1RRCA 2F9LA 1J70A 3AVUA 1BMFA 1R8QA 1S96A 4B3XA 2TMKA 3IUYA 4YMVA 3N70A 2G88A 4R98A 4KLNA 5H68A 5BXQC 4DLVA 3AV0B 1AA9A 1PLKA 3P20A 2QGZA 2H8KA 3AVWA 4UNRA 2HJGA 5F9HA 3L0IB 4Q47A 1IOZA 3LXRA 3VR4A 2REBA 3QXJA 3GFPA 2VL7A 3LO5A 4V02A 3ND8A 4HEJA 3NC0C 4F4CA 5GVRA 1WA5A 4B35A 2H17A 4A4DA 4DHEA 2K5UA 3NBZC 2X1VA 3GFOA 1G8PA 4GRAA 2MSDB 4CEIA 4A36A 1NY6A 4UXIA 3RDPA 2C04A 2ZSAA 2BEJA 3Q7PA 4OYHA 1ZU4A 4A1FA 1IY0A 3EW9A 3BORA 3KUCA 4LZZA 1OKKA 2NIPA 1Q44A 1KTVA 1KI4A 3CNOA 1COWA 5FR2A 4EFNA 2VQSA 1HQCA 4O0MA 4LWZA 4IOKA 1XZQA 4TL6A 3AF2A 3CWZA 2PH1A 3W90A 3T15A 4PO1A 1GL7A 3BS4A 2GEVA 1AIPA 4YONB 2RGBA 3PFIA 4HAVA 1IN4A 1VIYA 2IW3A 1U8ZA 1G7RA 2AXPA 3DL0A 1DPFA 1YZKA 3FKSA 4PQRA 3A1WA 4YMTA 3VTKA 2PEYA 2HV8A 2BBTA 1YR6A 4YXWD 1PUIA 2WSSA 1MO3A 1RZ3A 2HUPA 2GZDA 1OH5A 5AUQA 2R8RA 1XXHA 1G3UA 3AVXA 4JLMA 1NMXA 1XB2A 3UPUA 1D2MA 1H8EA 3KL4A 2RGNA 4LHVA 2GRJA 4W5WA 3OEEA 1WB9A 4NYIR 4L4UA 1E2LA 3UMSA 3I32A 4NHOA 1SXJA 4ZI2A 1LFDB 2ERXA 1R5BA 2VHTA 4NTZA 4JBWA 3OAAA 2EW1A 1R10A
chains in the Genus database with same CATH superfamily
1K8QA 2GZSA 3ZCTA 1Z4LA 2NU8B 2Y8EA 3IEPA 3PNPA 3G68A 4C29A 5HS4A 3T0IA 5L4NA 5CXUA 2G77B 2QK4A 1NPYA 5G1OA 2EC5A 4TT3D 3LTNC 2YUIA 4R1OA 2OCGA 1GWNA 4C0SA 3EIQA 2VH1A 1U4OA 2O2YA 2P35A 5AVVA 1QFMA 4FNGA 5JBIA 3O2QB 3EXHB 2OZVA 3J7AC 1T3GA 3G79A 3KSMA 1AB5A 4EG5A 3WFZA 4KQCA 1BQ3A 2PSEA 3CUVA 2HR1A 3R24A 1B16A 3WKEA 4JXJA 4OHFA 1K7XB 1I3CA 1Z5PA 4PC2A 1XCMA 1P61B 2X19A 3ACBA 3F4BA 3NEJA 2QY9A 4A27A 4MUMA 4EVIA 1VJRA 4BCCA 5BNFA 3FOEC 6GPBA 2BHTA 2PUEA 3HS3A 1L5HB 2FN4A 3SR3A 2OP0A 2CXRA 3KPWA 4FEGA 3K1JA 4LQDA 2WIBA 2ECFA 2FR0A 5F2NA 2NZXA 3BGDA 3G2IA 3OOSA 4FHDA 1NMEA 2B1JA 4ZQHA 2RHWA 3FB4A 5L3ZA 3ZNOA 3Q9SA 5A3QA 2H1WA 4DJAA 3CFYA 5CA1A 1L4HA 2Q41A 1Q7TA 3TINA 4E2FA 1NU8A 2P3SA 1IJFA 5G0UA 1KYWA 1Y8AA 4QUEA 5LQRA 4Y9DA 1BRMA 1NUAA 1SVSA 2CXOA 4RY9A 3UHJA 1A88A 1GQOA 4FCTA 1P80A 4ZVSA 3VOAA 3KPVA 3DC2A 2E89A 3BICA 3NIFB 1CQJA 1TUGA 3TMYA 4L4YA 4G37A 2MDTA 1HFEL 1GCOA 1UM9B 2NSJA 1QHHB 2OXRA 1U7ZA 2X5NA 2YWXA 3CX6A 3D7NA 2PV0A 3WI7A 5BMVA 3AR7A 3H5AA 3M8KA 5D6OA 2ZCUA 5BPHA 2FFHA 2XVXA 2YMLA 1NN1A 3GMTA 4XIFA 2WOOA 2ZSIA 3KG2A 2I66A 2HTFA 1ZK1A 3KZOA 3OLWA 5LM3A 1A1VA 3RRBA 5E3IA 3H5VA 2PU7A 1JL3A 1ISFA 4ILKA 1MFZA 3O47A 5BW5A 4S2UA 2ISCA 1T5HX 2GPYA 2JLYA 3VHLB 1VHJA 4G97A 2FQYA 3B5JA 3QVJA 1U8AA 3E6AA 3KUXA 1QIJA 2MYUA 3OLXA 4WOPA 3IQIX 1AKWA 3VR3A 4IDEA 5H4GA 4OMCA 4Z4HA 3G85A 4NDNE 2X0KA 3WNBA 3UICA 3OUTA 2A0XA 121PA 2JFUA 2Z8YM 5FPKA 4ER5A 6REQB 2QP9X 1Z7EA 3STXA 2UUPA 1U8CB 4GWKA 5KNBA 4MR9B 4K1XA 3MBKA 4AJLA 5HUJA 1K06A 4H15A 1P45A 3V1NA 2M98A 2P11A 4QE3A 4BNVA 2ZUSA 3Q10A 3GC6A 3K7EA 3SBEA 1UOQA 2ZIUB 1XTBA 3LDGA 1QTRA 1U1FA 1CZKA 1QQ7A 3A11A 4ALJA 4X90A 1KI6A 4KKVA 3RKRA 1I1QB 4MQEB 1PO7A 3TI9A 1N75A 3PB3A 5IZCC 5K2MA 4KW7A 3I62A 2D74A 2OBBA 4KGVA 4JB3A 5CRIA 4AY6A 3HK2A 5BR7A 3LGXA 1ZDMA 2EX1A 3IPCA 1JDUA 4DWOA 1YE8A 1MLDA 1NI3A 2BP7A 2H29A 1J56A 3ND5A 2X4DA 5KQSA 2FK8A 5LMNB 5EJ7A 2M2IA 4DPLA 2H4ZA 3IEXA 3VNRA 2NO1A 4A8JB 2NU8A 1NBHA 2C2MA 3ROTA 3BRCA 3A70A 1MUUA 3D1VA 3PZRA 3LFUA 1AHHA 4FMDF 4H59A 3W4IA 5GIPE 5GJBA 4KV7A 5BOSB 4FSDA 1KFKB 4KIUA 5JADA 1J1IA 2FEOA 4YUVA 1LD3A 2VSFA 3H2SA 4BWGA 3EXHA 3IH5A 4R8SA 1HNZB 1PN3A 1E1RA 3V3KA 3ZK7A 4LE1A 3F3YA 4FI3C 3S99A 3U13A 1UH5A 5AI4A 5IC5A 1U2ZA 3T1NA 4D4MA 1XMSA 1ZW1A 4JR2A 5LBIA 1P1KA 2FWAA 1BW9B 5KUTA 2GJ4A 1NFFA 1JEJA 4MUHA 2DQZA 2ASVA 4QUDA 5AJXA 1F7UA 3JYHA 1T8RA 3DLPX 4X6LA 1F3OA 1R66A 3UB2A 4EYSA 5JAOA 5KWEA 1IK4A 3DMGA 2JJMA 3LX4A 3V2GA 3TFQA 2OZKA 4W7SA 3RANA 2N75A 4CMIB 4IXMA 5JYDA 3LQ1A 3WB0A 3VX4A 1SWWA 5DTEA 2JD1A 1NVGA 1Z5GA 2JK1A 3PUYA 3TR0A 4QWWA 3ADDA 1E2JA 2Z2ZA 4FT2A 2ZJYA 2N3ZA 7REQB 4YCSA 2YHSA 2GK7A 4HVAA 1Z38A 2PZMA 2V8OA 4NFSA 1ZEJA 1NF9A 5A4MS 4BMYA 3PNLA 4Q5IA 1DX9A 3H2YA 5IH3A 1IQUA 2BI8A 3TKAA 3VMFA 1UBGA 3VFDA 2AZTA 1E9CA 4GX1A 2VQEB 3ZHYA 5ADHA 3C8MA 3OHMA 5DK4A 3HJBA 3ZD7A 3O90A 3JYLA 3QTBA 3B3GA 2J6HA 3ORFA 5AYVA 4YUYA 2PXAA 2ZB7A 3F2VA 3HYLA 4RZ2A 5IAGA 1W6UA 2BLLA 1XRSB 2B25A 4YGXB 3QIAA 3F71A 2EWWA 4PO8A 1E5QA 4ZO8A 5I7AA 3CH5A 2RH8A 3NAZA 4PLPA 4HFMA 2CDAA 3EH1A 5HKBA 2Q9CA 4E7OA 3F96A 4POOA 1FFHA 3CN9A 4DCPA 4IV0A 4W5TA 4IRMA 1KR5A 2AVDA 3B7GA 4N3GA 3VR2D 3I9MA 2H5LA 4NZZA 2HGZA 4EUSA 1VGQA 4ISBA 2V7QD 4PS1A 4ZD6A 1BZYA 4MI9A 3L6DA 4IXNA 2C4TA 4MDYA 4EEKA 4DNPA 4F9TA 3KR2A 1VCIA 1XQWA 4ZJPA 1IAQA 2X5OA 4KNVA 4RMJA 3RR2A 1I94B 4NC9A 2Y1DA 1SFRA 3KFVA 3NGMA 1RWMA 4BVEA 3HU2A 2RGGA 3R8FA 4XM0A 1ODSA 3UPTA 1SCQA 9ABPA 4IDNA 4MR9A 2VJCA 3AYXB 3DL4A 2HK6A 5FF9A 3NRJA 1E9EA 3QXXA 4G26A 5EE3A 4BDTA 4V1CI 5DFAA 1OA1A 2BGTA 4P3OA 2GOYA 1K98A 1W7AA 1UKAA 1XHLA 2XCIA 3AZQA 4J0GA 3WA7A 3GZTB 3K94A 3COWA 4PSUA 1IWBB 1CUXA 3RS7A 1RQRA 4LV6A 2JC3A 1XMJA 4TS9A 2FP3A 4BQNA 3WYGA 4BS9A 1QZXA 1CC1S 1ODJA 1WKBA 4NATA 2E5FA 5ALRA 3SQLA 3WO0A 1E96A 2D2FA 4B2IA 5EKSA 2NP6A 2H52A 2HMYB 4MI6A 3FJYA 3N28A 621PA 5TPZD 1DFHA 2DHRA 4D82A 1KXJA 3HE3A 3RAJA 4ARZB 2POQX 3UTDA 1V5GA 3BK2A 3A4TA 4A8JA 2QAGB 2BM8A 1KI3A 4OL0A 3SJUA 2GM4A 3E2IA 1V16A 2ONCA 1SCKA 3QEKA 4JLKA 1PGPA 4KACA 1X8JA 1P5JA 1PR4A 3O3MB 1NDHA 5CX4A 4AMYA 1ZZEA 4FPXA 1KK1A 4FZVA 2FGKA 1DO0A 3JVVA 3FTFA 3LKVA 2B2XA 4FBLA 3TSOA 5AOCA 3FOZA 1TMOA 4GLBA 3G82C 2K2QB 2HH9A 4N6OA 4A9AA 3DZFA 5HWSA 4WGGA 4AF8A 1J5XA 3M89A 4RFVA 2ZSKA 4FR5A 3LC1O 2QVCA 1LUAA 2PT9A 4J16A 3V7WA 1E18A 1UC4B 1XU7A 3GROA 4D9BA 2WM2A 4JA2A 1U5BB 3OQPA 1XNRB 4TX1A 2GUWA 1XZDA 2J1LA 4Y18A 1NBMD 2CXQA 2FOIA 4NYIQ 4TVOA 2FF7A 2JH9A 4OAQA 1SGWA 1PV4A 1O8BA 2D54A 1M2EA 1L4EA 3I9OA 3IC5A 2JKYA 1JTFA 2A5JA 4BO9A 1E2BA 3GT0A 4YQZA 5EP3A 3E2PA 3ZCQA 5DCWA 4E11A 4K1LA 3QX9A 3PQ7A 3DHNA 3HBMA 2JIZD 4ZOEA 2WIKA 4DV6B 1WM1A 1IOLA 1V11B 2IXAA 2EG5A 3I9FA 1RRMA 3INGA 1VBMA 2R6FA 3O75A 3RLIA 5A9RA 2NSYA 3G5LA 2JLUA 3TBKA 4PZCA 4DREA 1OU0A 3A2LA 2QIOA 1DKQA 3BVPA 3FSJX 3VKHA 1A4RA 3KWLA 2YWEA 4EJFA 2CWWA 3STVA 3F6CA 3NHJA 3ZE8A 2ZQYA 1RCFA 3ZUGA 2OHJA 3OFSA 2O05A 4D8VA 4YRIA 4WWHA 1BXRA 4BAZA 1Q14A 5FL3A 3PE4A 5LQKA 3SNHA 1FF9A 1XZEA 3F6BX 1IULA 1T3LA 2NT4A 4BATA 3PJEA 4WNCA 1YFKA 1XZGA 2OESA 1VRVA 1W47A 4EG1A 1EXMA 3TB4A 3IO3A 3IQEA 1VPWA 1ZJ6A 3UT5A 3ZIAA 1JVSA 4REMA 1JI0A 3KYIB 5F12A 5B30A 1HDYA 5CT4A 2DEUA 2I6UA 4EOGA 1C8KA 3R7WB 5HHTA 4X7PA 1PTJC 4QXAA 2A86A 1Z6QA 4OAPA 4WUTA 2P9HA 4J94A 4CKWA 4MDFA 1A8PA 2W58A 4LCBA 1D0VA 2I4NA 3UAXA 4BVFA 3FFAA 1SUIA 2JHAA 2P2LA 3OFJA 1MFPA 3LA6A 4TLEA 5AW5A 3VVMA 3OEHA 2XW6A 3ZHUA 3CLSC 4FKBA 1VLJA 2HRQA 4KVGA 4QJIA 1Z25A 3CNLA 1P3JA 3U7RA 1EAMA 1WW2A 3U7HB 1ZAYA 1P7CA 3LFTA 4G85A 4NOMA 1TT5A 2RB5A 2J59A 4V3BA 1CKEA 5CK4A 2J0VA 3ZU4A 2UXCB 2AUNA 5HS6A 4OFBA 4QX6A 3GLGB 4JSTA 3EPKA 2DPYA 4RD3A 3MWFA 5IXYA 2EFEB 3ELWA 3KJQA 1MG0A 1JWLA 3KSUA 5BOVA 2D00A 3D9QX 3CU5A 1IUKA 1CHNA 1MEEA 1WXHA 2JCXA 2WAXA 3DOHA 4ARZA 1CB0A 4CM6A 2IXTA 2IU4A 5J9FA 5CAEB 1KSGA 1VHQA 5KPJA 1XEXB 4GR9A 3W6NA 2VSNA 3IE0A 2C3OA 4N7BA 5HIMA 3VTAA 4D4HA 5I47A 2ZM6B 3COPA 2V6IA 1STOA 4LDPA 3R3SA 4QUHA 1K7YA 1MJGM 1O3YA 4ITVA 4RBNA 2D59A 2ZIZA 1A77A 1C9MA 1XA3A 1M2KA 3BX1A 4V0KA 5DEIA 2WJYA 3RJTA 3VZDA 4AT1A 2PSDA 2I7TA 1HFKA 4QXMA 5HQ3B 3TTVA 2W71A 1GPJA 1Y34E 1ZAKA 3GJ0A 4LA4A 3GW8A 2YMQA 5LD2C 1RRVA 2V65A 4AY5A 1BDBA 2OWEA 2Q3CA 2B0JA 2FMTA 2WM9B 3L7YA 3WAKA 2VUHB 1Z37A 1V8PA 1NP6A 3KYCA 2QT0A 2I91A 4TYWA 3PP8A 3D8BA 4V38A 2IV2X 4JBIA 2ZU0C 3I5UA 1LSOA 2UXDB 4RHYA 4XJXA 1KO8A 2VP4A 4IPTA 3RJMA 2ZUBA 2FW0A 2VK2A 1U5BA 1ZNXA 3ZLTA 2XUOA 1PK9A 1Z74A 3H2KA 4BTLA 1U7TA 1RABA 1IN6A 3GVXA 2OORA 3UUFA 4G09A 5IAOA 2WI8A 3YASA 5FTMA 4YJ3B 1IQRA 2DHCA 2OGZA 1WS6A 2V97A 3ROZA 4BFXA 4KITB 4BXOB 2Q3EA 3VO8A 4ENPA 1XCOA 2BH9A 3ZX4A 1TUBB 2GDZA 2DBVO 3C41J 3GRVA 4R7GA 3NFYA 5TSDA 3IUNA 3EEOA 3LUPA 4H7KA 5KYXB 2GM3A 3DV2A 3OU7A 1CFZA 3DOFA 1MEJA 1V11A 3L4SO 4XW2A 5DASA 3TRDA 2V4UA 1A9PA 3CNNA 2IYSA 3PX2A 4DSZA 3FBGA 1ZH0A 4PAMA 4FGZA 5BVHB 3VR1A 1WPQA 4PYLA 2F6RA 2FX5A 2PGOA 1OKKD 1T2DA 2R7LA 2WIAA 4G5QA 4IHJA 4ZEVA 3BGIA 4CGZA 4CIWA 1DEKA 1COWD 4Y2PA 2VQ3A 3DMTC 4FS8A 4PFKA 2IKSA 1AJEA 1HT1E 3PNVA 2I4LA 2EIXA 4WN3A 3O4JA 5BPFA 3RH0A 3OO0A 2IHUA 3Q5EA 1G6KA 1QJ4A 1U2EA 3D0KA 5TQ0B 1DCMA 2WWFA 1ZNQO 4XDHA 2H2GA 4IAOA 4MPJA 1YS9A 1NONA 5GGXA 1YT5A 4D0RA 3IE1A 5K5EA 1TA9A 1NT2A 3FKSD 1KJNA 4GMHA 4QVGA 3RWMB 2ZRGA 1JYSA 1PFUA 5KX5F 4FUTA 5CXSA 5LU9A 3EGVA 4M1QA 5FD8A 4OQEA 1PUXA 3TLJA 3WMRA 3FG9A 2DLDA 2J3MA 1W5TA 2PMDA 3BHIA 3OPMA 4DC0A 1U2GC 2NG1A 2FUG6 2ZZKA 3DBLB 1S8FA 3EF3A 2ISSD 4I4TA 4EHKA 4DN6A 5KNLA 2NTYC 5FBVB 2V55B 2FP4A 2F1JA 3CPJB 3ROGA 5H80A 2QRPA 2PS1A 1X7ZA 3F46A 3H0KA 3SZGA 4D99A 1SVKA 1NI4A 1NF2A 2E1PA 3L43A 2FN8A 4J3NA 1KFCB 3RU9A 4DY4A 3H2JA 4ZT3A 1CERA 5KHLB 4Z4EA 2HBQA 2YJNA 1PV2A 2B4RO 3ETLA 4OHYA 3LMKA 4WZAE 3SDBA 5D01A 5TPWA 3THOA 2RGNC 4CM4B 4Z4CA 3GLGA 4Q82A 1B76A 1VLQA 2XQFA 2PUWA 2NTNA 1X42A 4YRDA 4BJ6A 4R16A 5FHQA 2GA8A 4BE4A 4L8WB 5KEIA 1ICEA 3UMVA 1WMFA 3IBFA 2Q3LA 2AF4C 3N6RA 1N6OA 3INNA 3FCAA 3RABA 3TTYA 5AKLA 3F1KA 3HRHA 3PQEA 1JHVA 2XYRA 1P2SA 5BW4A 3DCNA 1N3BA 2GGSA 2OYCA 2C5BA 1CRQA 4I1PA 2YRWA 1FPMA 1CWUA 1E9SA 2R00A 4LX0A 4Q05A 3E15A 1NOKA 3R5FA 3WV4A 4LF4B 1U0HC 3C6YA 3UY4A 3WSTA 4ER7A 4QYXA 1Z2NX 5C4MA 2XF2A 3ETGA 3OIVA 3PPWA 1WRBA 2FWJA 4HATA 4J0KA 5SY9A 4WX2B 4F5ZA 5I3CA 3QEBZ 3T99A 2Y1EA 4A7PA 2BLNA 1SHKA 5IMBA 4KOAA 3WIBA 3KXKA 4PFSA 4DWWA 1DC8A 3R5KA 2WU8A 2HQBA 4PC3A 4QUKA 1NXOA 1XLUA 3JTMA 1ULZA 1VE6A 1KP2A 1Z0IA 3MF4A 3MYYA 3QEJA 2NWQA 5HKLA 3TVDA 2QX8A 2EQ5A 4EG4A 1AQ6A 4EKEA 4IFIA 1J5EB 1ZM4A 1GUZA 1M1YE 3RVOA 4WFJA 1I3NA 1RWQA 1Y4AE 2R5FA 3O7MA 4ND7A 3RAPR 4JLWA 4YYEA 1D6NA 2GXQA 1AS3A 2NXNA 3PG5A 3CY6A 4YJ3A 3I58A 2IUUA 3ROXA 4BXOA 4R01A 5JISA 1C7EA 3PYXA 1OI3A 3SJ7A 4W5RA 3MOGA 4HPWA 2I6XA 1TUBA 1KPHA 1E2PA 2RBGA 1X92A 4DRZA 1DOZA 1FLNA 3C5EA 5GM1A 5KYXA 2FY8A 5AMXA 3NGLA 3SZMA 4ZAVA 1UPTA 3PC7A 1QCZA 1G6OA 1X1RA 4MUNA 3PWKA 3PEYA 2F4VB 1EVYA 1HKUA 4NK4A 3WZLA 3IE2A 4B32A 2NXCA 2E4ZA 3E61A 1CF9A 3NHAA 4CQJA 2RHOA 4BU1A 3H17A 3U1BA 1GFZA 4LX8A 3L0ZA 5ALTA 3OCVA 1HTBA 3DAFA 3DOIA 1KYQA 5CA1F 4LF8B 3P9IA 1UUFA 1P8AA 5I7UA 1HQDA 1K0UA 1XJCA 5H9VA 1A7AA 1TO2E 3IOYA 4YMHA 1JE0A 1U7WA 1V1RB 2GBPA 4KI0A 1L4LA 2SHKA 1IJBA 1L4YA 1YQWA 3PC8C 4ZZIA 1VSQA 2JFFA 5EIFA 2BKAA 1XJWA 1L7DA 3EFOB 1V0JA 2M6RA 3QENA 5FTWA 2CXUA 2AXQA 2R6AA 1DEHA 4HKTA 2H1CA 3BJMA 4NBTA 4QO7A 1OWLA 2P2YA 2VWQA 3BCHA 2FZ5A 5BMVF 1SCUB 4F93B 1WZIA 4QT0A 4AF6A 3GCGA 1G3IA 1RIIA 2O8VA 3JPWA 2Q2NA 4IICA 3DBLA 4M53A 5TLSA 1N33B 3COYA 1LFAA 4PZAA 1N2CE 4N65A 5ALZA 3OM8A 1CR1A 3SXPA 5ALHA 4N8DA 2JFGA 3OBBA 4FXOA 3ZGVA 1K7CA 1N2GA 2RC5A 4LSZA 4X63A 2L0XA 3LPAA 4HWKA 1L5ZA 2YMMA 3F7TA 4F84A 3QY9A 3WLFA 2BOVA 1E9FA 1GNSA 1CX9B 3N7AA 2PJZA 3L7CA 1WDWB 3TPCA 2BCGY 4WOKA 4R5HA 4DV2B 4DIEA 2GS9A 1RYNA 1Q0LA 2X9VA 2P5YA 4BVHA 1UJ2A 3SHTA 1MORA 3R20A 4XOIA 3AIIA 1CCWA 3C3BA 3KJEA 1TEHA 1TYBE 2B4KA 3NH6A 4IMRA 2PNJA 2E6UX 2ZRHA 5JC8A 4GMGA 5JSQA 1KMCA 4URUR 4S1VA 2IPXA 1V3QE 1FMFA 1MIOA 1UDAA 1TK2A 4D46A 2Z98A 3U6KA 1C7FA 3SQXA 1G1MA 1QANA 1XKQA 3RCBA 5JNVA 4QNMA 2WKPA 2ZIEA 3D3NA 2A0YA 1Z3CA 2VAVA 4FC6A 4M8IA 2ZTLA 4CT4B 4EGCB 4W1PA 1RPNA 1UT5A 2HEGA 1CVLA 5DIZA 3LIPA 1ESZA 1TJ5A 2EFYA 1K66A 1NJ5A 1Z2AA 2NAPA 3VJKA 3ZI0A 3OE5A 1QH8A 2EWMA 2XVMA 3A26A 2ZSJA 1P72A 2XZDA 3QBTA 3T54A 3NEAA 2XWQA 5KTYA 2QEQA 2ZI7A 4MYTA 2H4JA 2RGYA 1JH9A 1OHHA 4PQYA 4K03A 2CMDA 2COUA 2ZYIA 3AY3A 4J1TC 3PENA 2R4QA 3L8GA 4DCOA 3I30X 3PDIB 1W25A 5DNYB 4RMIA 2NZJA 3BQNB 4EELA 2B8NA 1YZTA 2F48A 1BVRA 1OZFA 3DQQA 3NG1A 2QN1A 3EDYA 3IMGA 4HBGA 2YXDA 2QU7A 3G0CA 4GP7A 4D2IA 2BRUA 3FVRA 1FSZA 1MC5A 2TMDA 2DC1A 2RHCA 3NVAA 4YJFA 5A7HA 4QG3A 1OGJA 1UPXA 2CLKB 1C80A 5AKYA 1DBIA 4KQHA 4PLYA 4YV7A 3GLIE 3E9YA 1I3KA 1JXOA 2D7CA 2XUJA 4R6XA 1Z2EA 2QVZX 4WLVA 1PT8A 3IPRA 4H7FA 4OG2A 5DHRA 1JW9B 1L7XA 2ZREA 4DR1B 3UT6A 2FZWA 3UATA 3ZLUA 1F2DA 3HJUA 4MVJD 1W46A 3H1GA 3NUZA 4KGDA 1YI8A 3DEYX 3GN2A 4AWXA 1E58A 1SKAA 1U2RA 3OA0A 2RMKA 2X6RA 1QIEA 4LZPA 3GH1A 4LY3A 4QUJA 1GZ5A 1YRWA 3FNBA 3I4CA 2DXIA 1SQSA 1XD2B 4MB2A 1RXVA 1E1KA 2FG6C 1JIVA 3GL9A 1O6CA 4QU5A 4Y6PA 4NF2A 5DF1A 4BV2A 5AIBA 5LQNA 3BN3A 4MUJA 1KF0A 1J8YF 4CT5A 1AGYA 2GD2A 5T64A 1QGOA 4EUFA 4RTSA 2PZKA 3KQPA 4RF4A 3RTGA 1ZJ5A 3OPNA 2ZUFA 4ZO4A 5BQPA 3W8FA 4I5EA 1NRWA 2MJLA 1VKZA 3BCSA 4ZQIA 1NW6A 2BC9A 3CRQA 3IESA 4FX5A 4PLZA 5FUXA 3R7LA 2DQKA 1G21B 3RI3A 3IL2A 4JJFA 3TJZA 1F6DA 1T2FA 1DRVA 3FUTA 4DCCA 1UFRA 3IR6A 4Q4JB 4DA7A 4JXXA 1H9AA 1Q77A 1RACA 1N7GA 2O07A 5TXGA 4KXNA 1WKVA 4OI4A 1U0TA 5CLFA 2JS7A 3AWIA 2WJ6A 1FNCA 1TIKA 2PHZA 4UDOA 4D9IA 2IZ7A 1RPZA 3NWOA 1F4VA 4L0QA 3WY9A 4WJLA 3TZCA 4PCLA 4KAXA 4OYRA 1MH1A 1Z8FA 2DMRA 3ENQA 4GVLA 1Z35A 3BZUA 4G4GA 4HD8A 1F2UB 1QE0A 3IXQA 4MIEA 3S5UA 2C61A 3O3OB 5K3DA 3LLSA 3SBDA 1JX6A 1HQYE 4KUEA 4RK0A 1MOQA 4G0OA 2Z04A 2Y9MB 2ILTA 2RHGB 5B57C 4CKXA 2X40A 1MT0A 4H18A 3W6ZA 2F62A 4H35A 4PGHA 5IAEA 4XIYA 1R0CA 4G5XA 1QU3A 1QIIA 1G8KA 1SRQA 5H59A 1PD1A 3UQYS 4ZICA 3DUFB 5K51A 2OCBA 1HRKA 2C9DA 1D2GA 1AQYA 1WUIS 2OV6A 5DGIA 1XTPA 1ISPA 3R6TA 4KFSA 1P1IA 5F77A 5TARA 4MCAA 1NBME 2EBFX 2JW5A 3BIOA 1TZKA 3LDFA 5TS3A 1N9GB 4F9FA 3EEFA 3KSBC 1SPXA 5ADVA 3C4QA 4M87A 2MWMA 1M1YB 4C3UA 4ZT7A 3ZKWA 2VPQA 2XMQA 2Q9AA 3L8CA 3R1IA 3UUWA 3FWKA 1P2VA 5DYYA 1UBNA 1D2HA 3P2YA 2YYSA 4MV3A 3ZCSA 2ZFUA 1SUCA 3K73O 4RVSA 4U8HA 4U8GA 2QT1A 5CEFA 2I29A 1ORVA 3FHCB 3AJ8A 1Z07A 2ECQA 3K1AA 3BD8A 1FUEA 2V0CA 3ME5A 5FLYA 4DA6A 4DEVA 3UMJA 3UAGA 1M5TA 2BI7A 1LSUA 4RW0A 2FA9A 3W2HA 1TEVA 4PBTA 4F3YA 1M8GA 2ZRCA 2GARA 1SURA 2R5NA 2VF4X 4N5DA 2IITA 5B1IA 4HWGA 1EGHA 1Z12A 3CRZA 3LC2O 1LNSA 3C16C 4M7PA 1QUFA 1U8EA 3CONA 1JG3A 2A9RA 4GT1A 2IHVA 1EPUA 4RV9A 4B3MB 1JEYB 2YDXA 4HUQA 5GV8A 4PY2A 2X4LA 4N3CA 5FL7A 3ZVNA 1W9MA 1FSSA 5J1TB 1TIBA 1WPRA 4W9NA 4UU0A 3TRKA 3URMA 3WLTA 3OX4A 3CV3A 1PU2A 3TE7A 2VPXA 3KZKA 2OFFA 1X3SA 3AG6A 2PO7A 3K0CC 2WZDA 3KT0A 4DE5A 1BYUA 3UJ6A 4X71A 4E1AA 2JI9A 2YY7A 4I3HA 2JJ2A 4WKPA 1MO6A 2EDAA 2Q46A 4PHFA 5K6TA 1EVJA 3QLVA 1XZNA 1O6GA 3P0FA 4E5VA 4EGQA 3UK0A 1Q1NA 4XDYA 5DNDA 2FMXA 5CG2A 4YRMA 5CCBA 4E2YA 2ZRNA 1PJTA 3T5DA 2EZ8A 1BQEA 1KMQA 2Y1FA 2B6HA 3F9RA 3MK31 4LJ9A 5HDBB 5K3EA 1HNXB 2EP5A 2R6ZA 4DNFA 3G7SA 3SQMA 2O52A 3BL5A 3D0QA 3F90A 4H3HB 4LSMA 1Y7HA 4DVJA 2PT6A 2HSEA 4O4JB 4KIGA 5DO9A 5LCXA 4CCWA 3THYB 3SXUB 1AK9A 3PQ8A 2GJSA 3MTEA 3PUVA 3QXSA 3R9IA 3TOCA 1G21A 4J8PA 3VJRA 4N8EA 2LXNA 3BDVA 2JJQA 4DPMA 2PIDA 1N5IA 2N1BA 5D1HA 5B6IA 1G8JA 4MRVA 2EKBA 2ZUDA 2F4NA 1UJ5A 2XEDA 1Z8HA 4BO4A 1QHEA 1EVZA 1W0JD 1XL0A 2O2EA 1FYVA 1RS0A 3D8TA 1N0UA 3DMHA 2J45A 1PJSA 5ITZA 3HLKA 4JUFA 5JCOA 3ZY6A 1XXLA 3RK1A 1G8GA 2Q29A 1Q21A 3DFKA 1FLAA 2LW7A 4RPCA 1E2HA 1F2UA 4GZ5A 4O29A 4A73A 4AJNA 4LYYA 2IU3A 4L5IA 2VJDA 2EJTA 2WJHA 3GF4A 3QFTA 4IHKA 1X2EA 1O77A 5F2OA 3ANNA 3NXSA 3BIWA 3NCTA 4OMDA 3T3HA 1SZPA 1KZ4A 3KOYA 4MVJH 1TUIA 4NEGA 3TQRA 3UB4A 4K9DA 1NSTA 4OJNA 3H1TA 1J8QA 2EKLA 3FJ1A 4KN5A 1JRLA 1SUAA 4EUEA 4WKCA 3EEQA 3GJ5A 4ZCRA 1DV1A 1QLHA 4L5JA 1HE2A 3JSAA 5JOQA 1WUHS 4MI1A 2NYUA 4LHSA 1LX7A 1TMYA 3PDUA 4P33A 2GAFA 3SKYA 4A0RA 1U0GA 4TKVB 1ZIXA 4EG0A 3L8YA 3SC2A 2I6QA 2ZJ2A 1ZI8A 5LLTA 2PX6A 3FZYA 1F4PA 4MLPA 5GZ1A 4JS0A 4NMHA 2ZAOA 1ZMBA 4KOEC 4ECAA 5BSKA 2V4MA 4N39A 2HWKA 2G07A 2AJBA 2XUKA 3EXFB 3IHKA 4WJKB 2W6OA 3GLIB 3JXEA 3TECE 3ZOKA 3N5KA 4PAQA 4BLQA 1GG9A 2RGXA 1GQYA 5G02A 5JS8A 2FQ1A 3VQTA 3ZD8A 5FPYA 1CUGA 2B1QA 3SYMA 3CSDA 5JSZB 5JFOA 1JEOA 4URFA 4RZQA 2D0PB 1NC3A 1WNTA 2AFIE 3BTUA 2HCBA 3EZNA 1ISIA 1R4NB 3GPBA 2QRQA 3PI6A 4LXYA 4YQEA 3VBEA 4BLOA 5HZGA 1ZR4A 4BZXA 1PW5A 2DCUA 1YBHA 3DYVA 4UUAA 4PN7A 2W2MA 1TZBA 4J0IA 1RRGA 5LZ4A 3BWYA 5L45A 1AKEA 2PZLA 3EIFA 2O8BB 5KNCA 1NVMB 4NK5A 4NYJR 1TZCA 1GUDA 1C81A 1ZD9A 4IQFA 4U7PB 2EP8A 1HRDA 4ABTA 3ODGA 2XVZA 3K70C 1GITA 1R0YA 2EJCA 3OQBA 4V39A 4AG3A 1T9DA 4KH1A 1S2MA 3A1SA 4O2AB 1KS9A 4PXSA 2ICAA 4P5EA 3T94A 3QNWA 1W4AA 3ZDQA 3HKDB 4P36A 4YRBA 3DEKA 3LYHA 1CUBA 4MYRA 4E5KA 2W6CX 2ZBFA 1JHAA 3ZE6A 3B1JA 3RWOA 2H1RA 1Y42X 1EAYA 2J07A 4JBYA 3PUJA 3T3PB 2IVFA 2JFQA 2BM0A 1L5MA 5TT0A 2XCQA 5HYVA 4EIWA 4W8HA 3IUQA 1C3OA 1UAGA 1Y1KE 4JHXA 4EKNB 3KWFA 4PYOA 4BB9A 5IANA 3BSSA 5CDHA 4DABA 3QVUA 4ZC8A 5BT9A 2JAHA 3AWDA 5FT9A 4BN0A 1Z0ZA 5TIIA 1X70A 2G82A 4LOKA 5EP1A 5G4LA 1TKBA 4MV5A 4ZHSA 3EGOA 4MDEA 5LNK1 5BN1A 2RKWA 1UBSB 1KC1A 3WYCA 4IO0A 1SZJG 2NSLA 3O3CA 1JDBC 5AIAA 2NUBA 2X2EA 1B7GO 2FZKA 2ZK7A 2BISA 3F0TA 4WA7A 2VJYA 4FK8A 4D96A 3N6VA 2ZRPA 2QL9A 3AOEC 1E2MA 4IZ6A 4YT2A 3O1LA 1ZIPA 2V54A 2D2XA 5JH7B 3W6PA 5B1EA 4ML3A 3VRHA 2UZ4A 4J2TA 5JFTA 4HUTA 2WTBA 3CLSD 4D9FA 3K6JA 4HZGA 1SKYB 2WC1A 2QQEA 3B6KA 4ZEWA 1OILA 3PFWO 4N0DA 3IUEA 1P8JA 1OOEA 1NVFA 2CUTA 4I4TF 3U3JA 5FLXA 4N7MA 3BGSA 2P65A 3SJBA 2NZVG 1XMQB 2HJVA 3P7MA 2WZCA 3PDCA 2VO1A 2VK8A 3BSWA 2WPNA 4TS3A 4YHHB 5HCUA 1ZRMA 3WDSA 5ERGB 5JVDB 4DR4B 1W36B 3JR3A 3TQOA 4D9JA 3ZHZA 1JT9A 1OA0A 1RYFA 1TB4A 3SQWA 5AVSA 1FB5A 4Z0NA 3HYNA 1KWGA 1E9AA 1MABB 3HWSA 4NOKA 3D4NA 5EUQB 2YHIA 3WL4A 4KVFA 3EC2A 3BEOA 3HEBA 3L0DA 1OW3B 1Z6XA 2PZ8A 1TTTA 2GK4A 2R85A 2Y6UA 3KQMA 3QELA 5FLKA 3Q7IA 2ZI9A 2JHCA 2GZ2A 4XKJA 4DLXA 2O8CB 4HT3B 4MS3A 2J9FA 2C98A 4Q9IA 3IRVA 3LVRE 3P1JA 2XCLA 5CLQA 5GVSA 3EXFA 5KPDA 4LRTB 3SFVA 3IKMB 2XJ4A 4OFWA 4ARCA 4ZVOA 4MKZA 4DLBA 1VDZA 2C7BA 2WD7A 3L1VA 3U2QA 2AV6A 1SK8A 3QX7A 2H31A 1XAJA 4GX2A 1CEXA 1W85B 3LYLA 2PX8A 4YI3A 5GM2A 5A2QA 2ZUUA 3LXXA 3G8BA 3E22B 1R6TA 2QW8A 3RYCB 3O2SB 5F5XA 1M75A 1WHSB 2RB4A 3MD9A 5H4HA 1P1CA 1HNNA 4HNVA 1FSGA 5AUPB 2FUNB 2XOKD 1X7WA 3OTQA 5FKJA 3T7CA 5DM0A 3I5MA 1XQVA 2O8BA 2GAOA 4FGUA 4EKDA 4QOEA 4ESOA 1TMGE 4CL3A 5KNDD 4RTJA 4LVNA 4WTOA 4QHTA 2C92A 2IEIA 3F3MA 2W70A 3AI3A 1M73E 2O0KA 3FB1A 3DAOA 3SSMA 2Q50A 3VPXA 1IG3A 1VP9A 3B9PA 2I7VA 4O2AA 4LBVA 2C9ZA 3OHSX 4QKQA 4YJ3F 5BSGA 1E6MA 3V4FA 2GF9A 4HAUA 1RBYA 3MINB 3V4SA 2B20A 2ZJ4A 3C43A 4W5NA 1NMSA 2C7VA 4TZTA 1EFVB 2Q5CA 3IVXA 4MW6A 3GFSA 1FK8A 2WMYA 1NP3A 4I8XA 4RKYA 4KL8S 2X41A 1W96A 1R18A 3B1VA 2A2ZA 3GP3A 5DHUA 5DRYA 3OJCA 3ZV3A 3H19A 4M8NE 4ZZ1A 4BFZA 3PQ4A 3DAYA 3LY7A 4RUKA 2AFVA 1K27A 4WI1A 5DHFA 5FHRA 5CXQA 4DLNA 1Q0SA 3QU2A 2PDAA 2QRUA 5DSXA 5TS2A 4AMVA 4X1YA 3WDLA 5C4GB 4R0NA 2FN9A 3H99A 4PV7A 4L7QA 1A4XA 1J49A 2CLFB 1R0LA 4ND8B 3NTLA 2HF7A 3K1YA 2OSBA 4I14A 4RU1A 5DM60 2XSZA 2PNFA 1ULBA 3EZ7A 3FNQA 5JH7A 4JU8A 4D4GA 4RF2A 4Z9XA 1UXHA 1KI2A 1Z13A 4RK5A 4H16A 3DAHA 3ZWNA 3IILA 2VH5R 3BXFA 3D4OA 4CPDA 1BH6A 2IH2A 2D3TA 3Q3CA 1I10A 5KTPA 4RANA 1FDVA 1H4VB 2ZRLA 3H9GA 3HBFA 4P92A 3R7DA 1X1BA 3LKDA 4D42A 4GOOD 3FNRA 1L5RA 3O4GA 2GHTA 1W94A 4ZA2A 1V7PC 1SXQA 3C8HA 4ZGWA 3GGPA 2EFJA 1O6FA 2TYSB 2QP4A 3MRTA 5AKZA 3IVCA 3W04A 1EWTA 1UZMA 3ZBPA 5JVDA 3WB1A 2HIAA 1O5TA 5EHQA 5JCJA 3ZS8A 4MCIA 1K9SA 4QVKA 2HXYA 1FFAA 3FTNA 3M7IA 1AUQA 3PUHA 1RU3A 4ZOLB 2H7YA 5AVYA 1MABA 4Q00A 3SX4A 1T1GA 5EQJB 2BGNA 4W5OA 1FVHA 2H00A 2OCXA 1DAKA 4LYAA 4OHKA 1N9KA 3AP2A 2WU0A 4XB1A 3UZUA 2AFIB 2Q0HA