3UG6A

Crystal structure of get3 from methanocaldococcus jannaschii
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
303
Chain Sequence
DGTKYIMFGGKGGVGKTTMSAATGVYLAEKGLKVVIVSTDPAHSLRDIFEQEFGHEPTKVKGYDNLYVVEIDPQKAMEEYKEKLKAQIEENPFLGEMLEDQLEMAALSPGTDESAAFDVFLKYMDSNEFDVVIFDTAPTGHTLRFLGMPEVMDKYMTKLIKLRKQMSGFMKMMKKLLPFDYDKMLEELEKMKERIVRARNILSDPERTAFRLVVIPEEMSILESERAMKALQKYGIPIDAVIVNQLIPEDVQCDFCRARRELQLKRLEMIKEKFGDKVIAYVPLLRTEAKGIETLKQIAKILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords arsenical pump-driving ATPase
publication title Tail-anchor targeting by a Get3 tetramer: the structure of an archaeal homologue.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 111
structure length 303
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ug6A00
2PT7A 3ICQB 3C15C 2J0QA 4GPTA 2GJKA 4LC1A 1BH2A 2F1RA 1JEDA 2ZXUA 3FMPB 1XRJA 1Z47A 1GKYA 2HCJB 4RD0A 1KI1A 1E2PA 3LNCA 1SVWA 1R6BX 2UZ3A 4LHYA 1P2TA 3AVTA 1E6CA 4RD2A 1IN7A 4URXR 3KXLA 1WMSA 1FW6A 4QHSA 4A9AA 4ABYA 1FUUA 1W1WA 2FX3A 4EFMA 4MGKR 2ZVPX 3VHLB 2XJ4A 3THOA 4CF7A 4B75A 3MAAC 2BV3A 4DSNA 4CRWB 3OFND 1JAHA 1K5DA 3TAHA 5IT5A 2R6CA 2BBTA 2O5VA 5L3SB 3GQBA 3W6OA 5J4LA 5KU1A 4EFNA 3CF6R 4GP7A 1E69A 4RCZA 1XP8A 4N0EA 2CJWA 1ZNYA 2G1KA 3MRSA 4IDOA 4TT3D 3VNUA 1E2FA 2BM0A 2O8EB 3C8UA 1XU4A 4LK2A 1YR7A 2CLDX 5IK2A 2D62A 2FH5B 1OYYA 4KSBA 3RS7A 1E79A 4G5GA 2PL3A 1KAGA 1FQKA 1WP9A 2X2FA 3GEHA 3QENA 4A2PA 1P9RA 5DYIA 2OFWA 721PA 1E2MA 4MDEA 3QPUA 1G3MA 2VP2A 2XTZA 5AUPB 1E2KA 1DAFA 4ACBA 3N70A 2PCLA 1DG3A 2PT5A 3QEOA 3JZAA 2CBZA 4LJ8A 5DN6D 1KMHA 2Q3HA 4F38A 4F7WA 1KI3A 3AV0B 1F3OA 1AKYA 4LJAA 4R71A 2IS2A 2D2FA 1LB1B 2H16A 4A92A 3RYTC 5CIQA 4LHXA 3FMIA 1Y63A 3FMFA 3QXSA 1XMSA 2R6GA 4DDVA 2EYUA 2WWWA 2HYDA 1KSHA 2FPMA 2CHVA 2I1QA 3OE7D 4NCJA 1Z3IX 2P2LA 1CR1A 1IHUA 2NQ2C 1E1RA 3KXIA 1N0WA 3MWJA 1UPTA 2WZQA 4ZPXA 4EJSA 3LFUA 1CLUA 1MOZA 2ANCA 3KKQA 4Z8XA 3AKCA 4C2UA 1ZM9A 2QPAA 3PVSA 2XAUA 2XNSA 3RRZA 2NTYC 1DAMA 3VR6A 2ZJOA 4JYBA 4EQ6A 2FFAA 2P5TB 4LYHA 2QY9A 4Q4HA 1JR3E 3DVLA 5KSYA 5EXTA 3GLIE 2GBLC 3HU2A 2OE2A 3CNLA 4DXAA 2O8FA 3MD0A 2OBLA 2H17A 5D3MB 1HY3A 3DMDA 2V8OA 3A6PC 3E70C 2IYLD 3U3JA 4FIDA 4URZR 4F4JA 1VTKA 4WBSA 5DE3A 1L4YA 1ZMXA 2CDNA 4X8HA 1I4TD 2W6ID 4LPKA 2W83A 4PO9A 5SZHB 2FF7A 3ADDA 1EFCA 4PFSA 2JLQA 2WSSA 2BBWA 2RCNA 1KDPA 3EXAA 2F43A 3WMGA 4URVR 4BLSA 3UG7A 2V7QD 1U99A 1NL3A 5EXPA 1QHNA 2RGNA 1DG1G 1N5IA 1XCPA 1D2EA 4FCVA 4GRAA 4PPFA 1SXJE 1TUIA 1E1QA 1YVDA 3HJNA 4LYAA 1CR0A 2JA1A 4QBFA 4C0KA 5FUYA 3EZ9A 1OJLA 4NH0A 2AD5A 4C0BA 1B23P 3B2EA 1KK1A 2XTMA 1P62B 2IA5A 1RKBA 2IYSA 3HU1A 3IO3A 2EFGA 4IOLA 4JYCA 1DARA 2OBNA 3R8FA 5FTKA 5UKDA 2WIBA 2YYZA 2XOKD 4PAQA 1J2JA 2JLRA 5DHFA 2C96A 1IOZA 2TMKA 3P26A 3VR3A 2C03A 4PTLA 2BVNA 1JQJC 2B92A 1M7BA 3O8DA 4A82A 4LJ4A 2FGKA 3A1SA 2GK6A 4P4TA 2NGRA 1KK3A 5H68A 2FSIA 5BQ5A 4B3BA 4NPHA 2IF2A 1P3JA 4L4UA 5LD2B 2RGEA 3LW8A 1KY2A 2C95A 3B8HA 3THWA 4PHTA 1XTRA 2EQBA 3LLMA 3P4YA 3SYLA 3U6BA 4URWR 3EPJA 2ZSEA 2OLKA 4HDQB 4BEJA 2J3EA 5C46F 2G6BA 1VG0B 4LV8B 5TVKA 4EDHA 1G6OA 4C7OA 1QHIA 1J8MF 1L7VC 2ZREA 3TKLA 5FH9A 2CLSA 2WKQA 2ZRHA 4PC7A 2JIZD 1TU3A 2UVQA 4BRWA 4AKIA 2B21A 1W7AA 1K6MA 3AVUA 2MSEB 4DLUA 1Z2CA 1V5WA 3X1DA 1DS6A 3SQWA 4YLGA 1RRCA 3BOSA 4DLYA 3W8RA 1Q3HA 2FV8A 4MUAA 4Q5IA 2FSFA 1CP2A 4XOIA 1E9DA 1KI6A 2V4ZA 4P4SB 1R5OA 1SVSA 2BMEA 1KY3A 1GFIA 3CWZA 3F8TA 1TQ6A 2BCGY 3OZXA 2A5DA 5FBRB 3VMFA 1HH4A 3EA5A 4YXWA 1WE2A 2J7PD 1KOFA 2D06A 3TGPA 5AUQA 4O2RA 1F2UB 1LS6A 1T4GA 4IJMA 3WNBA 3R7WB 4H9GA 4Q03A 4KFSA 3TUJC 1ZIOA 1NF3A 2WWFA 4RSGA 4KITB 1D2MA 1W4CA 3A4NA 2LKDA 2J87A 1UDXA 3HPRA 4QGAA 3S1AA 3KUDA 2ZJAA 1VCIA 2OT3B 4X8LA 2DCUA 2BBSA 3I4LA 2WKRA 4MKHA 2GWHA 3V9PA 1GTVA 4Z8YA 3QKSB 4ZIRA 2PJRA 2BMFA 2JEOA 4YMVA 2ZITA 1IN6A 4ZCIA 4V0MA 4QM6A 4QJ5A 5L3QB 2EFHB 3GLGE 2FSHA 3L43A 3N2IA 4AKEA 4S2EA 2AKAB 4GFDA 1VMAA 4XD7A 3DOFA 2CCGA 1KSGA 2YNMA 1YRAA 4V03A 3AVXA 3E1SA 4JLOA 4PZYA 3CWQA 2FFBA 4A1FA 1DELA 3RANA 3CNNA 2N42A 4OBEA 1FNNA 1AKEA 4JBXA 1EWRA 5B30A 2VEDA 4OI2A 3CH5A 1ETUA 2JJ2A 1FP7A 3QUSA 1FOEB 1MKYA 3UANA 1QDEA 2QM7A 4DT1B 1T3HA 2A3RA 4M4SA 1G3QA 3N2EA 3ZDQA 1I4DD 2PMKA 1KMQA 5P21A 1UEJA 1T91A 1SXJB 3FB4A 1E4VA 621PA 4IRUB 2OSBA 5FPKA 3U4QA 3HWSA 3BBPA 3O47A 2NO6A 5KDLA 5TB5A 5JCZA 3ZVNA 1OKKA 3C7KA 5JJKA 1JEEA 2GXQA 5EXXA 3SFZA 1E2QA 5CLQA 1JALA 2CK3A 1CR2A 1G3UA 2VPPA 4ITRC 4JT4A 4WZAE 3KDSE 5EP2A 3EPLA 3CNOA 2NO1A 1Z06A 1P4SA 1P2VA 4LPSA 1W0JA 1G291 4RY2A 4PANA 2FMXA 3ZVLA 4RZ3A 1C4OA 1Q1EA 1OV4A 1LNZA 1TX4B 4LHWA 4U00A 1ZW6A 1ZM3A 2QAGC 2ZI6A 3FMOB 1ZM2A 4MRSA 1U9IC 4CEHA 4KBFA 1XEXB 2WWIA 3CPJB 2WHXA 4Q21A 5J4KA 2YC4C 4DHEA 3I3SR 1MO6A 2YWGA 3NVAA 4HEJA 1J7KA 2BJVA 3WNDA 4AI6A 4XSHA 5K8UA 2XSZD 2WWGA 3B1WA 1UKZA 4ASUA 4YONB 2QMOA 4CYMA 4FCWA 2ERYA 3B82A 5J47A 2XXAB 1PUJA 3THYB 3DZDA 3H0KA 5HE9A 2ZI5A 4IOJA 2AL7A 3CRMA 1GVNB 1G7TA 1FZQA 2F3TA 4TL7A 3PXGA 2KBEA 3A37A 2FPLA 5DLQC 4LZZA 3JVVA 3EZ7A 3AKYA 2IYUA 2R8RA 1E2IA 2R62A 2EU8A 4Q7KA 3SDZA 2EYQA 3IO5A 4M9QA 1SGWA 2LCFA 3OIYA 4PR0A 4A15A 3A1TA 2JASA 5DNYB 2C9OA 4C0SA 5FBWB 3EC2A 1RRFA 3UKDA 1HA3A 3W8NA 5J4HA 4XWKA 2J1LA 2B8TA 2ZJ2A 1VIYA 1U98A 1EG7A 4LOAA 1KO1A 2KI5A 3CR8A 2R44A 5H8WA 4LRWA 4ZI3A 1PZNA 1W0KD 4C0HA 4G5SA 4B3XA 1QRAA 3U3RA 1RYFA 1X8JA 2IYQA 4PC3A 4Q4JA 4QGHA 1G7CA 4QFMA 1FMJA 1KK2A 1NSFA 4QBGB 2ZRAA 5G3ZA 4DLSA 4M8NE 5TARA 4G5RA 1Z8FA 1OHHA 2H57A 5KNBA 5CIWA 2ZRMA 2QMHA 1AQYA 3P4XA 3RRMA 3AKDA 4NHOA 5EE5B 2AXPA 2NZ8A 2ZTSA 2PLRA 4DCUA 2MMCA 2EFEB 2KBFA 2ONJA 1YHNA 3ZH9B 3A1WA 1QZXA 3DM5A 1RE0A 3ADBA 2W2XA 4Q1FA 2XZLA 4AIIA 1I4LD 2G0TA 4I81A 2D74A 1EX7A 2DB3A 3SE0A 3SYNA 3U2QA 2VP6A 4KBGA 1HT2E 4FMCB 1T3SA 3H84A 1KI9A 3REGA 2OESA 2CJWB 2IT1A 4MGIR 4WW0A 2AXNA 1E0KA 2CXXA 3DKPA 3BFKA 3SJAA 2SHKA 3T61A 4QBHA 2XGJA 4Q48A 1Z0FA 1H8HA 3UXMA 3TK1A 1MABA 3L0IB 2ZSAA 3DEFA 2XJ9A 2VP5A 2YC2C 2ZRCA 4M53A 1R10A 4PX9A 1KDRA 2CE7A 2WBLC 4OI1A 1KI7A 3X1XA 1VCOA 1Z0IA 4Q7MB 4HB0A 3TW4A 2QP9X 1KNQA 4XWOA 1OF1A 4CVNA 1E2JA 4WAUA 2QQ0A 5CJ2A 4W9MC 3Q5DA 2BHRA 2GBLA 4GSYA 5LB2A 4PHGA 6Q21A 1N0VC 1TF5A 2IEYA 4HZIA 2D2EA 2F7SA 1G5TA 1KMHB 4UNNA 2OFXA 2WJHA 2AFIE 2F3RA 2W2VA 5ELXA 3B9PA 3BERA 4MRNA 2PEYA 3B1YA 5JEEA 4FXPA 3TUIC 2QG6A 1NN1A 4KSCA 2YWFA 3RLFA 3LW7A 1TQ4A 1XDBA 4B33A 4WIAA 5KYKA 1A82A 1A2BA 1XTJA 3NHBA 2D3WA 2A5JA 1VG8A 3DO6A 4L15A 5JI2E 1VPLA 3RC3A 1M6NA 3IIKA 4DLVA 1NKTA 3B85A 3OAAA 1GUAA 4IDHA 1RIFA 2GAAA 4EJSB 1PVOA 2VL7A 4GP6A 1SVOA 5GJWC 1U8YA 3NDBB 1N5LA 1HURA 2E87A 4CIDA 4EQ6B 4MRRA 4NKRA 1Z6GA 1NN3A 3OIVA 4F4IA 1N6KA 1Z5ZA 3W3ZB 3ZD7A 3GLHB 4B3CA 5JBQA 4B44A 1DAGA 2ZSDA 3KKOA 2ECKA 3PITA 3K70D 1E9FA 1KSJA 1UBCA 3PUYA 4KAXA 5F9HA 4TWZA 3BD9A 4JT2A 2V1UA 1MH1A 1P2UA 3CZPA 3EIQA 4XWAA 1S1MA 1Q44A 4NBSA 1EGAA 4V02A 2ZJ5A 2RGDA 4JSTA 1G6HA 1P61B 2DBYA 2F1JA 3GJ3A 4V0NA 4QG7A 4B3DA 1IN8A 1W36B 2RB4A 1CJKC 4A0GA 4IDNA 5FI1B 1MR3F 4B73A 2QPOA 2P3SA 2QENA 4LJ7A 3TUZC 2B7CA 3C5HA 1N6IA 3EZ6A 1UF9A 1A7JA 4FW9A 1TU4A 4RFVA 3B5JA 1FUKA 1PLLA 1QBKC 3KFVA 1IM2A 2PJZA 3TMKA 3K9LA 4E5UA 4UXJA 4P32A 1VKJA 4TQ9A 4WXPA 4D0NA 2W6JA 2PX0A 3K09C 2ZSFA 1JR3A 1E32A 4MYCA 3LX5A 3AP1A 2QBYA 4XSGA 1EFUA 3GLFB 2RGCA 4XJXA 4C2TA 3IHLA 1Q1BA 3CUEF 3QE0A 1AS3A 1F60A 3AP2A 2PH1A 1BKDR 1XEWX 5CB8A 2C8VA 3SOPA 4TL6A 4BZPA 4D82A 2PX3A 3L82B 1IONA 3AM1A 4WA7A 2IS6A 4QBIA 1XEFA 1SKYB 2WJVA 4HB3A 2DHRA 1UBGA 3THWB 1OIVA 1TMKA 2ZRKA 3IKJA 2GVZC 2J0UA 3RWMB 4Z1MD 3SR0A 3IILA 4ON9A 1A2KC 1NMYA 4YMUA 3ZYCA 5HR5A 1IBRA 4MRVA 4C7OB 1ZRHA 4KO8A 3AVVA 2NPIA 3TBKA 5EP1A 4CDGA 1WRBA 4BLOA 1G4AE 2QEQA 2WWHA 3UIEA 3QQ5A 4AWXA 3JVUA 5J4YA 4IW3B 3QPWA 2JJ1A 4DDWA 4TMXA 1A5TA 4UQOA 1GNRA 3R8CA 2AR7A 3TVTA 2J41A 2HLDA 1CTQA 5CJPA 4B3GA 1KI6B 3Q9LA 2I3BA 4OHXA 1OH5A 1P9WA 1Q12A 1U2RA 4TMZA 4Q01A 4URYR 2AX4A 1OXUA 3H4MA 1FPMA 2Z0MA 4JLDA 4RKEA 4NU0A 1NJGA 3B78A 1D5CA 3QKRA 3U60B 1D9ZA 4DUGA 2JLYA 2I1VB 3RSLA 2ZS8A 1CJMA 1N2CE 3LQRA 3S1AB 1LFDB 1JQLB 2DR3A 2FNAA 4G01B 4US1R 4M1TA 1J99A 1NLYA 3OF5A 2IX3A 4ZIRB 1H8ED 3OESA 2R2AA 5IHPA 2A2ZA 1XCMA 1VIAA 5HCNA 1W47A 4JBWA 2YOHA 1CJVC 3SFVA 4RJLA 2ZAOA 3OEED 4B2PA 4FMDB 2O8BA 4DBLC 3BC1A 3HYRA 5K8IA 4GI7A 1VYUA 2A7QA 2O0KA 4TQUS 2P67A 3WMEA 3I5YA 1IY2A 5AJWA 5L3VA 2QAGA 4LBVA 1GKUB 1U9IA 2IXGA 2F1IA 3RDPA 5KSZA 1RJ9A 1VHLA 1NJFA 3GCGA 5AJYA 4A8JC 2BM1A 1KZ7B 2VBCA 3H2YA 1MRSA 4HDOB 4TT3A 2OILA 2MMGA 1KI2A 3MWLA 4JKIA 3Q3JB 1P7CA 4NYMR 4G5OA 2WWYA 4PPNA 4YMTA 3B9QA 1KZGB 2CLCX 4ZI2A 4ERNA 4X8OA 3CM0A 1ZIPA 3BIFA 2JDID 2V55B 1RRPA 2WM9B 1P6XA 3FHOA 1N6NA 3OEHA 4TLCA 3PFIA 1DTSA 5DIFA 4CW7A 4BFXA 4JS0A 3U4QB 5IF9A 3GLGA 2FOLA 1XXHA 1G9XA 2GHIA 4PHHA 1G64A 2RGXA 1D6JA 2WPDD 2WJJA 5DSZA 2ZRGA 4YDSA 5FPHA 4YMWA 1XMJA 2GILA 1BMFD 1Z28A 1ZNXA 5DN6A 4A4DA 3IIMA 5DO9A 3WBJA 3PEWA 2D7CA 1FFHA 2P5SA 3U3KA 1HT1E 1W48A 3T35A 2VTKA 1BOFA 3DKVA 3LV8A 5K8LA 3REFA 4RD3A 2F6RA 4RZXA 2JJ8A 3EWAA 4OQFA 4QL3A 5E3HA 2EFCB 2HF8A 4PC1A 1YQTA 1XPOA 2NO9A 4QGGA 3NBYC 3I62A 4WZBE 1VYTA 3OE7A 3ONWA 4B34A 2GXSA 2DFKB 2FFHA 4Q1EA 4EPWA 5F98A 2BC9A 1EXMA 1RW4A 4KI0A 1X8LA 4QNMA 2X2EA 5A5GA 3RS5A 3TJZA 2IW3A 1N25A 2OAQ1 4TQAA 2B6HA 1PLJA 4Q1BA 3V00A 4DZZA 5B57C 2L0XA 4FWIB 3QSYA 2ZEJA 4OJKA 3RAPR 5HZKA 1Q21A 2ZUBA 1SKQA 2GZHA 2IL1A 4D80A 5KSOA 1Z83A 4MYUA 2GJSA 4TZ0A 3C4JA 1DO0A 4C0JA 4A8JB 2IS4A 2QGZA 5CB6A 3CPHA 1HEIA 3KUCA 1FMLA 3HP1A 1RZ3A 1ZU4A 1NLZA 2IYWA 1XTSA 3EZ2A 3KJGA 3QXJA 2Q9BA 2V7QA 2ZS9A 4M1MA 2C9CA 2LWIA 1NNEA 5JRJA 3K0CA 5BW8A 3TLXA 1NP6A 2V9PA 1SHZA 5FPSA 1AZSC 3TE6A 3NC1C 1N6LA 2GTPA 1YJ5A 2V54A 3TSWA 4GDFA 2ORIA 1E3MA 4B2LA 3P20A 4IVPA 2XOKA 1GNQA 1ONBA 3PQCA 4CEJA 2NG1A 2H8KA 5JWRA 2WAYA 4HZUA 4L16A 3RC8A 1BIFA 3Q5EA 2ZIAA 3K70C 5AUNB 3PV0A 4G1UC 3DZ8A 4JVSB 3KQKA 3THXB 1R0XA 4ARZA 4IOKA 1QHSA 1F48A 2QT1A 5TV2A 3PG5A 5BYJA 5CM9C 4R98A 2OCYC 3G0HA 1E1RD 2CNWD 4EUNA 1XJ0A 2UKDA 4Q4AA 2A5GA 2C77A 2FWRA 1DOAA 3DL0A 2W58A 5FL7D 2C5LA 4AC9A 4EPRA 1ZUNB 3LD9A 3PJRA 3GD7A 3Q7QA 2HYIC 2QT0A 4IHQA 3VR5A 5DISB 1OH8A 2F9MA 2O8CB 1KJZA 1OT3A 4BLRA 1M74A 1E2EA 1GITA 2Z6VA 3F0TA 4OHVA 5TY0A 5FOSA 4B48A 1L2TA 1T5IA 4QNRA 4PC2A 3QVUA 3WYFA 3U5ZB 4L8GA 5EUMA 2IUSA 3SHWA 3A8TA 3DM9B 1KDTA 3IEVA 5G3YA 1EFHA 5AJZA 5DI3A 2RGAA 3CX6A 4IDQA 2DWQA 2A30A 3K9HA 4UKDA 2QP4A 2AKYA 1G3RA 1OLOA 2EWWA 3AB3A 3E5HA 2J7PA 1W36D 2GRJA 5FR2A 4HI0E 4PQFA 4IEEA 3I92A 2K5UA 2MSCB 4QC2A 3HR7A 3NG1A 2YINC 3WY9A 1ZAKA 4HAZA 4ZDWA 4PAMA 4ZV4A 1NRJB 3K09A 1XJCA 3K8YA 2XITA 3BS4A 3MWYW 1WF3A 2HUPA 4TYYA 2CCJA 2GJ8A 4AYTA 5EP3A 2Y8EA 4I1SA 5TMPA 4TLEA 4E22A 2Q3MA 2WWXA 2VSFA 3FE2A 4PO1A 2FPKA 3TR0A 5L8VA 3BRWD 4XTRA 1G16A 2ZUCA 5CM8B 4Q4LA 4TL9A 1LS1A 2ZI9A 3FWYA 1PLKA 3UMSA 3QKUA 3Q8XB 2VP4A 4Q7JB 3IIJA 1XD9A 4P0TA 2WTUA 1JECA 4K8OA 4X8MA 4MUBA 3GFPA 1Z6XA 4LC0A 5DYGA 4LGMA 5BN4A 4DLZA 1AN0A 2CE2X 4K46A 5JJLA 2IF0A 5KTYA 4TLAA 3PEUA 3TW8B 1ZVQA 2WJIA 1W4BA 3ZLJA 4S35A 2FEMA 3QI2A 2ZRFA 1JJ7A 1V43A 1Z0AA 4D81A 1XXHE 2Z4RA 3LQQA 1CF4A 4FN5A 2OZEA 2ZRDA 1YZTA 1P9NA 4DLXA 3G5UA 1E2NA 2NOAA 3OHMA 3GLIB 1X1SA 2VHCA 2WMNB 3T34A 1BS1A 3HU3A 3L2OB 1NSTA 2QBYB 2VP9A 2JCSA 4PSVA 4HUTA 5KPJA 5F3WB 3KQHA 2BJWA 1UKVY 2AFHE 4JBYA 1G5PA 4LI0A 3K0SA 1G8YA 4JVNA 1G5RA 4ZO4A 1Z6YA 4D25A 4Q1DA 1QHYA 5KSPA 5D3QA 3FKSA 4PQRA 3FYHA 5LPNA 2P6NA 3QNUA 4YXWD 1SVMA 4C0AC 5B64A 1ZC3A 1Q57A 1E0JA 2OM2A 4A6PA 5LB4A 5CYPA 3AF4A 3KL4A 4D4LA 3SBEA 1KO8A 1UKEA 2QORA 3BE4A 1WDTA 1Q0UA 3MWKA 2ZYUX 2J0UB 3RRNA 5JMTA 3X1WA 1SVLA 2ODNA 4DJTA 1G1MA 4YMSA 4QHYA 5FTMA 3TQCA 2DWOA 1YE8A 2XSZA 2H7VA 2YOGA 3R9IA 2ZQ5A 3HDTA 2XZOA 3QOFA 3UMRA 3RSOA 4CEIA 1NMZA 2ZYVX 3BB1A 5IRCD 3VFDA 1W5TA 4RVCA 1EFRD 1T8TA 2Z5FA 4G5QA 1P73A 2HXYA 2I4IA 1Z6TA 4XH9B 1XD2B 4WXRA 4B6EA 2BEJA 4HLUC 3HPQA 1D8TA 1JNYA 1GKIA 2REXB 3AVPA 2D7DA 3TQFA 2P65A 3BB3A 1A1VA 4OI0A 3EZFA 1YZNA 1E0SA 4DCTA 4BFVA 2AWNA 3QXXA 2DFTA 2IUUA 2CVFA 2ZE6A 2HJGA 5H70A 4HAYA 1B0UA 3QKRB 5HTKA 5KNDA 2A5FA 2OHFA 3CZQA 5GJCA 1SULA 1YKSA 3M0EA 2GZAA 4A8JA 4QRHA 4F91B 5L3SA 3CH4B 2PZGA 3H86A 4LHZA 4R2HA 3NBZC 4EFLA 4DB2A 1JJVA 2ONKA 3T5GA 5KOYA 1W0KA 3SHFA 1OXXK 2O0HA 2KE5A 2ZSBA 1RYHA 3Q85A 1EX6A 5HE8A 221PA 1NN5A 2H1LA 4GZMA 2QI9C 1CS4C 5B2ZA 3TAUA 3C41J 2QN6A 4BFYA 1DAKA 1NIPA 2CHGA 2PLFA 1E9BA 2HXSA 1FTNA 1GP2A 3EIHA 3VX3A 3CRRA 4D2IA 1M2OB 3X2SA 1NY6A 3MG9A 1IXZA 1GL7A 3ECCA 1S4QA 4JLKA 4GT1A 3ZIAA 4C4PA 5C18A 2IXFA 1ZM7A 4PPQA 4E09A 2CK3D 4YQFA 5KHOC 2GEUA 3BORA 1T5LA 3KB1A 4DCSA 1KI4A 3B1VA 4IOMA 1F2TB 1F5NA 3D8BA 1IJEA 4Y0AA 3ASYA 2QAGB 1T0HB 1SQ5A 3PUVA 4OL0A 1VYVA 2IC5A 4JVLA 4NCKA 1AK2A 1XF9A 5TDHA 3SC3A 1QG2A 3I8SA 3U7EB 2XB4A 2FDCA 5K8TA 1TF7A 2NO0A 2GDJA 2YWHA 1C9KA 1JB1A 1WB9A 3W6NA 2G77B 2VHJA 2VF8A 2GCPA 2ZRBA 2W0SA 4JL5A 2YVUA 2OFOA 3ZZUA 5JHGB 1OYWA 3SNHA 4M9XA 2ZANA 5EE0A 4TLBA 3GLGB 1U94A 4KFRA 4TYWA 4GL2A 1M7GA 2QE7D 3X1ZA 1OXSC 3HYTA 2EFDB 2KSQA 3CLVA 4DSUA 2NZJA 4R9UC 3ZVRA 4F93B 1XBTA 2CHQA 3K0FA 4JLJA 3IGFA 3K0AA 1TADA 5DHAA 4I99A 2ZYWX 3GJXC 1XWIA 4HAXA 1G4UR 3AH8A 1VCNA 3NTUA 1U81A 2C78A 3ICEA 2VLIA 3WXMA 1S1CA 3U61B 3Q7PA 4JL6A 3T5DA 4BPBA 3CPEA 2VQSA 2G3YA 3ETLA 4CT5A 2O8DA 5AJVB 4GOJA 4BZQA 4Q18A 1L8QA 1XTQA 3BWDD 4ZDIA 4F4CA 3MFYA 4JL8A 2QRZA 3K0CC 2YHSA 1LTQA 4A2WA 1GIAA 1S3GA 1AA9A 3SN6A 1E94E 3CRW1 4WZ6A 3NIBA 2BKUA 2GJ9A 4FCTA 3PUXA 1D9XA 4M1WA 2ZPTX 3BAFA 5HKKA 1ZNZA 4KLNA 1SZPA 4QOSA 2J0VA 3VR1A 2HDNB 4W5JA 4WOPA 3OIUA 3A36A 2XZPA 1QF9A 1KKLA 4IKEA 1GSIA 2DY1A 1I2MA 3EG5A 1Z07A 1Z0KA 2V6JA 1GG2A 1U0HC 3B1XA 2Z83A 3BH7A 3NKVA 4MKFA 1YRBA 1JPNA 3I8XA 3VAAA 4DSTA 1Q1ZA 2GESA 3ZZTA 2ZJBA 3KTAA 4KXFB 3ZS9A 1W46A 2P6UA 5FBQB 2QTFA 3GEEA 421PA 4M1KA 5E7JA 4HUQA 2J5XA 1UADA 4JLAA 2ERXA 3NBXX 2J45A 5FOUA 4Q4HB 1ZUIA 1VHTA 1NKSA 1TPZA 1IXSB 1JI0A 1BYUA 2O8FB 3NEJA 5AJXA 4ACAA 3L8YA 2ZRNA 5E95A 1ZYUA 1W44A 3TR5A 1HQYE 3IQXA 2ZR7A 2JLSA 1NLFA 1NMXA 1XJQA 4XIGS 5JEDA 3B7GA 1COWA 1PUIA 2IHYA 2P6RA 4M0LA 2BOVA 1YZLA 4BUJA 3BB4A 3GJ5A 3B13B 4HZUB 4KODA 3CO5A 2F43B 4BASA 2IK8A 1NBMD 2FE4A 4DSOA 4EKDA 4TZ6A 2VSOA 1PJRA 5HCIA 4XVUA 5IDVA 4NYJQ 4TTRA 4MQBA 1RPZA 4TSFD 1QVRA 3LO5A 3BFVA 3SYKA 2P0EA 4BFZA 2NIPA 5GVSA 1UM8A 2ORWA 4M1OA 1F2UA 2GEVA 2ZUDA 3PEYA 121PA 3U3OA 3R20A 4GZLA 1NY5A 1N6HA 1YZKA 3LX8A 4Q4AB 3R7WA 3O8CA 3GP8A 4BWYA 3C16C 1SVIA 2Q3FA 3FGNA 1MO3A 5FBLB 4D4JA 1WQ1R 3MLEA 2EVWX 3GJ0A 4NZYA 3VNVA 4NYIQ 1U0JA 1J70A 4IEIA 2NPFA 1QHHA 4AKGA 2XB2A 2GKSA 4A0RA 1AS2A 3IQWA 4LJ6A 5G41A 2BKEA 1OFTA 3LRPA 4POAA 5CDFE 1XNJA 5L3QA 4G0NA 1UAAA 4W5HA 1NVVQ 4GBMA 3DMNA 4PQYA 2QROA 2CVHA 3EIEA 4D0LB 1ZNWA 4HAUA 4BLQA 1Q22A 1AQUA 5G40A 2F55A 4LBZA 2PZFA 2QUZA 1IY1A 1YR8A 3NEYA 1G17A 4TL8A 4DIDA 2A9KA 2UZIR 4HYYA 2QSZA 2N1BA 2QU8A 4M2LA 3IUYA 1RVDA 1P60A 3CX8A 1TQDA 2GEDA 4GMXA 4NTZA 5B58C 3CX7A 1NN0A 4Q02A 1SVKA 2R6FA 3VR4A 1XB2A 1R5BA 3I32A 2VF7A 2RHMA 4AG6A 3TNFA 1WA5A 3SI7A 2YWEA 3MSXA 4JLMA 5FPYA 1KIMA 3AVWA 4H1UA 4ZDJA 4NMMA 1H8EA 4R2IA 3QXCA 1VDZA 5FUXA 5GADl 1GRNA 1Z0JA 3LBHA 1NI3A 1II8A 3D3QA 3LWNA 4OQNA 4RD1A 4BECA 1U90A 3OEEA 3GLFE 5FTLA 1CRQA 5JRZA 2VYFA 2ODWA 4JMPA 3WYGA 3CW2A 5A4JA 4OYHA 4D0GA 1GDDA 1E4YA 2G88A 3ADCA 1DAHA 1OPXA 4IDPA 3QVVA 3A1UA 2FFQA 4UNPA 1GZSA 2RGGA 3CKLA 4P4UA 5KO2A 3K9NA 1XX6A 5JSZA 1XEXA 3IBGA 5FI0B 1U8ZA 1GL6A 1TNDA 1SXJD 2JATA 3KQLA 1WCV1 4NCIA 5AWFC 1GRQA 2GVDC 4O2LA 3WHKA 4LYFA 1KO7A 2GCOA 3GJ4A 4B71A 1CEEA 1TQ2A 3NBFA 1L4UA 1JPJA 4MGYR 4YC7A 4BGDA 3UWKA 1GWNA 2HJVA 4D4KA 1W5SA 4C30A 2JDIA 4HLUA 2JJ1D 3QBVA 3SJZA 3LVRE 4DVGA 4B6FA 1IN5A 2X8AA 1X8KA 4OQLA 4A36A 1CU1A 3OFNA 5FOVA 2CL7X 4JSYA 1WBBA 4EPXA 2QRNA 1T0JB 3MJHA 2WPDA 4JLBA 3L0OA 5EZ5A 5G53C 3W3AA 2VRWA 3MGCA 1ZCAA 3QF4A 2R6DA 4V0KA 1BMFA 1QHGA 4NP6A 1KGDA 2ODEA 2RMKA 3LXXA 1OFHA 3L0SA 2VHUA 2ZROA 2E1RA 2ZJYA 4LV6A 2FGJA 2QA5A 4JKYA 4CZ2A 2ASEA 4AK9A 1G19A 4F92B 4FWTA 2HT1A 4PZLA 3X1YA 4KVAA 3GFOA 4LDJA 4PSAA 3WP1B 1M34E 4M9SA 2AHOA 4D6PA 1KSFX 4FI3C 5FUWA 2PCJA 2QPTA 4EPTA 4N0DA 1OXTA 1VCMA 2WIAA 4CEIB 3KKNA 2OCPA 3I73A 1XZQA 4AG5A 1ZD9A 1E2GA 2QL6A 4EIWA 1XTKA 4AKHA 4PSKA 3NH9A 4DDTA 3F3YA 2ZRIA 3M1IA 1II9A 1X86B 4RFSA 2XNDD 3A58B 3FHCB 4TTPA 5FOTA 1ZM4A 2FZLA 4O25A 2G0NA 2YKGA 3E2IA 3AKEA 1A4RA 1U0LA 4BFWA 4GOKA 4IVRA 4CEHB 1N6PA 1GOTA 1KNXA 1Q20A 3A1VA 1T8UA 1OB2A 3RS3A 2X19A 3W6PA 1Z6AA 3KJEA 4L5BA 2IYVA 1TF2A 2ZI7A 3BH6A 4TTQA 2BBOA 1CXZA 1AM4D 1HE1C 1HE8B 1H65A 1NBME 1FQJA 1US8A 1XFAA 3AEZA 3KZ1E 4RD6A 3B1ZA 2VHTA 2NO7A 1W4AA 2QM8A 2FU5C 1QG4A 1CR4A 1TTTA 1P75A 5C1BA 4AYWA 4ESVA 2QZ4A 1OIXA 4OQMA 3LA6A 4Q47A 3NC0C 5DH9A 3UPUA 1J8YF 3GJ6A 1IJFA 3O8RA 1YU9A 1EWQA 2R65A 3OEHD 3EX7C 1E9RA 2ZS7A 2FA9A 4JLNA 2IUTA 3U3MA 1TAGA 2OUKA 3W5JA 1FX0A 1KAOA 3IHWA 2FG5A 2IWRA 3LVQE 1NG1A 2ZR9A 2V6IA 1LVGA 3CONA 1O87A 1G18A 1KO4A 3T12A 1P5ZB 2R9VA 2W6IA 2JLWA 2B8WA 2GCNA 3ADKA 4FMCF 4Q4JB 5IK2D 1ZUHA 3WRYC 2IEZA 4OHWA 1FTSA 1E79D 3EASA 4KYIB 1AJEA 4P31A 1F6BA 2IYTA 3ZD6A 1OH7A 2F1HA 1OIWA 3IDQA 4LV5B 3QXHA 3UMFA 4M9ZA 1HQCA 1G7RA 4CGZA 3BJIC 2ZJ8A 1S96A 2OBMA 2CNWA 4HAVA 4B32A 4P33A 3PIRA 2JLUA 5FL7A 2W00A 1BYIA 3ZQJA 3EW9A 4U02A 4C0QC 4MRPA 4Q1CA 3J81k 3LLUA 3I1FA 3SQXA 1N6RA 1S8FA 5ANRB 4I1UA 3GLHA 2WMOB 3K0FB 2Q21A 4FMBB 5F9FA 3VKGA 3K0AB 4BLPA 3CBQA 4Q9KA 1II0A 1MABB 1DO2A 2OXCA 3QJYA 4DKXA 5C4GB 4AY2A 5GJBA 2DFLA 5C4MA 5LD2C 1N0UA 1R8SA 3FPAA 3U44A 2O8DB 2FZ4A 3Q72A 3KQUA 4AD8A 5BYKA 3EPHA 4AYXA 4U5XA 3UK6A 2BWJA 4IVQA 1R4AA 4MKGA 1AZTA 4KCGA 3ASZA 4JJZA 2A5YB 1Q1QA 3DDCA 1G7SA 1TUEA 1S3SA 3PENA 3TVDA 4ZCLA 4XVRA 2JIZA 4MYTA 1G21E 3FDIA 4Q66C 2ATXA 3W34A 4TLDA 1M7HA 2VH5R 1G8GA 1KDOA 4FD2A 1KK0A 3A4LA 2QMEA 5E7MA 1E9SA 4NE2A 1CBUA 1FNMA 4ZDKA 3P27A 4W5WA 1UEIA 4UNQA 3QPVA 1R0ZA 2QNRA 5JJIA 1K8RA 1P2SA 4LJYA 3SJBA 4BQSA 3GLFA 3I61A 4EPYA 2WSSD 3K70B 2ORVA 2QTHA 2QTVB 1HTWA 4KLZA 2YOFA 3RS4A 3AUYA 4U7DA 3NDPA 4UJ3A 1CKEA 5BWMA 1UKYA 3KTAB 1IN4A 5EUQB 4ILEA 4ESHA 2J7KA 2BMDA 1E1QD 2GA8A 4LYJA 3V4FA 3VX4A 3NXSA 2VA8A 1MRNA 3CF0A 2AWOA 4HUQB 2Q6TA 3T15A 2GF9A 4E07A 4P3YA 3IBYA 4KVGA 2IYZA 4M22A 5EJEA 4Q7LA 1RFLA 4LX0A 4QJ4A 1OE0A 4BZXA 1DAIA 1AS0A 1Q3TA 3QBTA 4GNKA 2J0SA 3D31A 4Q9IA 1R0YA 2D4HA 4UXIA 2CL6X 4BE7B 4EPVA 3FHTA 2GNOA 3C5CA 1ODFA 1GILA 3KX2A 1R2QA 4DC9A 4US0R 5CYOA 3DPUA 5EQTA 3VR2A 8OHMA 2VSXA 4QKQA 2ZU0C 4URUR 2X1VA 3SZRA 3T06B 3ZS8A 3IEUA 3VU9A 4MGZR 3MUFA 2BMJA 5TXGA 3AGQA 4EAQA 3AP3A 2QGNA 5LBIA 3WBKA 4HLQB 3IPXA 4TN1A 4HAWA 1CJUC 1ELOA 1DE0A 3UG6A 4R7ZA 3VKWA 1KI8A 2VIIA 1X6VA 3T1OA 1W4RA 3M6AA 3UATA 4QJ3A 5JI3E 5KDDA 4L9SA 3ZQ6A 1TEXA 1X1RA 3CRVA 1Z63A 2DYKA 2CEAA 821PA 2QAJA 4WVFA 1SXJC 1U8AA 2JLZA 5EE3A 1DEKA 3AF2A 1VG9B 1QHHB 2DFNA 1NG9A 2PEZA 1EFRA 3U7FB 4PXAA 3VTKA 3LBIA 1ZU5A 4KFTA 1TEVA 3GMTA 1GM5A 2LKCA 1HUQA 2RH5A 1G8HA 1RC8A 2ANBA 2VHQA 4DB4A 4IXMA 2XTNA 3QF7A 1OH6A 3B60A 2CCKA 1E9CA 3V4RA 2OCAA 4TMWA 2R6AA 1DVRA 4DWJA 2KWIA 4JVMA 2GK7A 1MO5A 3CRQA 3UWOA 3AQ4A 3WMFA 4V0LA 2YJTD 3QKTA 1SHKA 1YR9A 4HLDA 1PV4A 1IXRC 3BXZA 5FOWA 2Q9AA 3H1TA 2GETA 1KTVA 4B43A 3LBNA 1Z0DA 3CR7A 1X3SA 1MO4A 2WICA 2JAQA 1S0UA 2G83A 4XD7D 3KJIA 4HLCA 1OB5A 3FKQA 3RHFA 4Q19A 3EARA 4FMDF 5GVRA 5JS8A 1JXOA 5CDFA 1II8B 3AF0A 1LF0A 3FFBA 2GXAA 2ZRLA 4YDHB 4V0OA 2O52A 5E7IA 1MT0A 3I72A 2REOA 4TMTA 3WYAA 3QIAA 1W2GA 521PA 2H92A 2EWVA 2JJ2D 2O0JA 3FKSD 3K0EA 5FL3A 2WAXA 2QQEA 2Z4SA 3EC1A 4LBWA 1UJ2A 2OCBA 4LBYA 4UNRA 5JWOA 2Q0HA 1T3LA 3G82C 2O8EA 4JZKA 2J9RA 2OLJA 5JSZB 5M04A 4MH0R 2HEIA 3MJRA 4IFEA 2WV9A 2HV8A 5FTJA 4HATA 1OSNA 2GCOB 1G3IA 4A6XA 3RS0A 3W90A 4B35A 3SEAA 2FN4A 1OKKD 2ZETA 3FTQA 2J46A 4MITA 2O8BB 3JZMA 4DDUA 4K81B 4A0HA 3ZZ0A 3GLHE 5FBVB 1YZQA 1E2LA 3AVOA 4BLTA 3FOZA 1W0JD 2W0MA 3QG1A 4LJ5A 3SJCA 3R9WA 3AVYA 4QHTA 2OAP1 3L0PA 2AD1A 1WXQA 2QE7A 2AK2A 5KPDA 1ZP6A 5FOXA 1RJ9B 4PAOA 4H1VA 1XTIA 5SZJA 4KHZA 4DCVA 5AR1A 1BO6A 3WRXC 5J5CA 5DGXA 3LAWA 3QF4B 3NHAA 4HDCA 3KJHA 1RRGA 4DEYA 1G8PA 4AURA 1AIPA 4LHVA 3U6KA 4ASUD 1XCGB 5JHHB 1YZUA 1QHXA 1T6NA 3KKPA 3ND9A 5FTNA 3VHXA 3D7MA 3P1JA 2NMVA 2VO1A 4JIMA 2OXRA 3NH6A 4BRUA 3KB2A 2GZDA 4HB2A 3F5FA 1ZD1A 1OFIA 2OO7A 2G9NA 3EWSA 3NWJA 1XMIA 4MKIA 4LSGA 2IHBA 1LF5A 1XXHB 2ODBA 1NVXQ 3LH5A 3N5CA 5KDOA 2XX3A 2HT6A 1Z29A 3T1QA 2ZE5A 2C04A 4KJZA 4DRZA 4Z51A 4NDZA 1W49A 2RKOA 5E4FA 2IWHA 4RFSB 4CT4B 1YZGA 2ZJZA 2V3CC 4TYQA 1E98A 4XTCS 1AGPA 1DBSA 1E2DA 5D3MA 2GXUA 5DI9A 3AF3A 5F2EA 4PC6A 2BCJQ 3ZIAD 1IQPA 2OEPA 1KJYA 2V1XA 5EZ6B 3IPYA 3EA0A 2C98A 4DIEA 1N6OA 5JZVA 2ZR0A 3K53A 1G41A 1JR6A 4OHYA 4LY6A 1LV7A 3WNCA 4LJ9A 4C9BA 1ESMA 3CB4A 4KYUA 3SBDA 1US8B 1NVUQ 1EK0A 1SKYE 4DEXA 2HF9A 4Q00A 2REBA 1OXVA 3EAQA 5FUVA 2CL0X 3HR8A 4LUCA 3RRYA 5EE9A 4DCNA 2C99A 2YV5A 1ZBDA 3THXA 1G20E 1NVWQ 1OHHD 3U7GA 2B7BA 4C0LA 4EJSC 1LY1A 2IYYA 1T9HA 1KHTA 3I5XA 4TYNA 3RVBA 1FP6A 4N1AA 4A2QA 5BXQC 1XPUA 2HCBA 3AF1A 5AUOB 3TIFA 4BFSA 1FX0B 1WBDA 2JGNA 2WOOA 1GAJA 4O0MA 1NIJA 2WJGA 1IAQA 3GJ8A 4UNSA 4QM7A 1Z2AA 2O8CA 3TSOA 1CULC 4D26A 2DWPA 4TMVA 3KXKA 4O3MA 5JFGA 1LW7A 3QY0A 3TH5A 2ZM5A 3SS8A 4PZZA 4OK5A 4RKFA 1DPFA 3WHLA 2RAPA 2GF0A 4DLWA 1KJWA 3GFTA 2BIFA 1EFTA 4I1OA 1H8HD 3ZGXA 3W9YA 4ZCMA 4PPGA 4FINA 1CRPA 4PO8A 4RZ2A 2WKPA 1NBMA 5H1YA 1W36C 2ATVA 3KQNA 1GRRA 4IXNA 4JLPA 4TSFA 3M4YA 2ZRPA 2RGNC 5J4VA 5JS7A 1TL7C 2ZI3A 4TYPA 1CJTC 1N3BA 4I4LA 4PHFA 3RNLA 2X77A 3VKHA 3FFAA 3FVQA 3P32A 5JWHA 1XPRA 3LXRA 3CF2A 2F9LA 4V0ME 5EXSA 3MCAA 2PBRA 2AK3A 4CEJB 5HKKD 1W2HA 5CLLA 2JLXA 2CMKA 2IBMA 2QSYA 5JECA 2BEKA 2W2TA 4NONA 1MV5A 4B2IA 3T1TA 4KU4A 2PMDA 2JLVA 4M1SA 4LCBA 4P4SA 3KFXA 3C14C 1E9AA 5BN5A 3A4MA 5BN3A 2ZU6A 3O8BA 1R8QA 5A0FA 4ARZB 4MDFA 1OW3B 2A78A 1UBFA 2ZAMA 3BFXA 1KO5A 1OFUX 1M8PA 4MYHA 4RCYA 4Q9JA 4L9WA 3OAAD 4ZKEA 4NCNA 1IY0A 2WJYA 2IYRA 3U44B 4Z1MA 5GJVC 4OKSA 2C9YA 4OHZA 2XEXA 1DADA 2G1JA 4RZUA 1ZCBA 1M1YE 4M21A 4LWZA 3OIWA 5KNCA 3PUWA 1Z22A 2WVJA 3QEJA 4TMKA 4XVQA 5SZIA 1P72A 1E2HA 3AVQA 3TRFA 4KV9A 5J40A 3TSZA 3EPKA 3QKSA 2GAOA 4B76A 2E9SA 3CIOA 3DHWC 1E99A 2FEOA 5L3RA 2BDTA 2VP0A 3ZJYA 4OJQA 3B6EA 1R0WA 3U7HB 1CIPA 1JXMA 1ESNA 5DI3B 5EE1A 4OQXA 1JAIA 1N5JA 3L8ZA 4RD4A 4Q9HA 1COWD 3GLIA 4W7SA 5EP4A 2OG2A 4M1YA 3RABA 1VECA 5CK5A 1J90A 4B74A 1I2DA 1HYQA 2MSDB 1K5GA 4I1VA 1S2MA 1XEWY 1GL9B 3RWOA 1FL9A 4DLRA 5FR1A 1UDWA 2IS1A 1UFQA 1R5NA 1XZPA 3SU8A 3K1JA 3GJ7A 4UXHA 2C2HA 2RHDA 3AGPA 2ZYTX 4NYJR 3DOEA 3MMPA 4BEBA 1HV8A 4J0QA 1D2NA 1E96A 2AN9A 4DT1A 4IFBA 4OK6A 2GJAA 4A0FA 4Q1AA 2ZE7A 1EESA 2W6JD 4OI4A 1O3YA 3ZVMA 1JR3D 2RGBA 2YZ2A 4D4MA 1UBEA 4Y0VA 1SXJA 1DAEA 1C1YA 1Y3AA 2Z43A 4UJ5A 3QG5A 4Z54A 1KYIA 1E0AA 1AGRA 2ZE8A 5SZKB 3T1VA 3PEVA 1R7RA 3PR1A 3GEIA 3RS2A 2QP3A 2WSMA 3AUXA 4NYIR 5LDDC 2ZRJA 2N46A 3PCRB 1N5KA 2EW1A 3LY5A 1XD2A 2DPXA 3ND8A 3VQTA 1Z08A 4II7A 4GOXA 1XMVA 4B47A 4OK3A 2KJQA 4QXAA 3VU9B 2ZVQX 5FPTA 5JCPA 2ZI4A 1ZC4A 2H18A 5JLJA 4C3ZA 3BGWA 1NVVR 4B3FX 4NYMQ 1S9HA 4HSEA 3W5IA 4E03A 4NCHA 4BFTA 5HPYB 2J59A 4KFUA 3D6TB 2IXEA 2PZEA 4HB4A 4JJKA 4MA4A 2XXAA 1XD8A 4BFUA 3THYA 5C2JB 4US2R 1YR6A 4ZKDA 3BK7A 1S9DA 2H5EA 4QGFA 2Q9CA 1JBKA 4JLVA 1GNPA 3WP0A 5CK4A 4DLTA 1ZINA 5KUTA 2HLDD 4G3XA 5HZHA 4N3NA 3LDAA 1ZD8A 3GPLA 2QMUA 2OV2A 4GMDA 2XNDA 5FFMA 5CITA 4NL4H 1ZJ6A 3BH0A 1KKMA 2FJUA 3PUZA 1G8FA 1VG1A 1E9EA 4DUGD 3R9XA 2KB0A 3KKMA 1F2TA 4Q9LA 5AK0A 2IYXA 2FSGA 2WOJA 3K9GA 1ANKA 1QVAA
chains in the Genus database with same CATH superfamily
3IP3A 4KEAA 5DOZA 1JE0A 1PSWA 5B3KA 3NJRA 3PUIA 4ZJUA 4TV9A 3QEAZ 2R8OA 4OX9B 3OPMA 1CQIB 5JPIA 3IQHX 1A7KA 3K30A 1FRFS 3DPSA 4PZCA 1JEDA 2CZCA 3KAJA 1EGQA 3R77A 4IHJB 4RX1A 1E5VA 1XN1A 3ZLBA 5FYQA 1NXPA 1R6AA 2HCJB 3ECSA 4DYVA 4B3SB 4IEFB 2WYVA 1SVWA 2UZ3A 3C3DA 5EMLA 5A0TA 3UHJA 3VVLA 1MVOA 1P2TA 1UXGA 5LDHA 1E6CA 3QHAA 4FYIA 4RD2A 4IYJA 3H17A 1TM4E 4WFQA 4FGUA 1WW8A 4FFSA 3BE6A 3GLUA 2MSLA 1X38A 3DT9A 4GLFA 4B4DA 3MAAC 3AKZA 1UK9A 4BX2A 1C0EA 2GTIA 3AZQA 4CRWB 1IMOA 2QYTA 3WK9A 1L5QA 2R6CA 3ZV7A 3AY3A 2ZT6A 4UCFA 2G6TA 3OC0A 3GRVA 1P0QA 3GHYA 1MH9A 4TV9F 4EFNA 3ZE1B 4GP7A 2P78A 2CJWA 4L57A 3SEZA 1I6WA 2WNIA 4K88A 1T1EA 1CUYA 4IS2A 2VLBA 3DEJA 3WGKA 2MYPA 1WF6A 1ENPA 1HEUA 2CLDX 3CHYA 1SUWA 2FH5B 2FPPB 3QU9A 4KSBA 3RS7A 2GEKA 3MTJA 2YZKA 1EVYA 3MJDA 4Z9BA 1YKGA 3OZGA 1F0PA 4V3CA 2H2FA 2P6OA 4WDRA 5DYIA 4KXXA 1VKZA 1OC2A 1E2MA 2NUTB 2OFWA 3CKMA 3MBOA 3OZVA 1Y1QA 4OTZA 3GGOA 2IFTA 1MPXA 4RQTA 5IJ0B 1T29A 2XVYA 1JSXA 2NYRA 3EMVA 1N4AA 4ZGWA 3HV0A 1RT9A 4HO1X 4CBVA 4MR7B 4KIGA 3N70A 3F6RA 4QDKA 5F78A 5EMJA 3QEOA 1DG3A 4B82A 2GZ3A 5C52B 1RLUA 3JZAA 2BFBB 2B9VA 2RHWA 5DN6D 3ZY2A 4YPFA 1YKFA 3EA4A 3GAZA 3RUEA 2G4VA 3LLCA 4LJAA 3EVBA 4NV1A 3S28A 4WADA 1BHSA 4IG4A 3OBBA 2O6LA 1V6SA 4JOSA 2RARA 4RL4A 4YJGB 2XRYA 1PWEA 1PX2A 3L4SO 1GTL1 3INTA 5F21A 3RYTC 3JRXA 5CIQA 3KQOA 4LHXA 3ZHXA 4C3OB 1DAPA 1XMSA 2YUIA 1RP7A 3QBEA 1YRHA 5HHTA 1E7MA 1KSHA 1TK3A 2FPMA 5JS2A 2QL7A 3O74A 4NCJA 2P2LA 3DGEC 4HH3C 3SVLA 3KLBA 3IAXA 3KXIA 5HFAA 4H59A 1Y8RB 1ZOSA 2QUHA 2XF8A 4GC5A 1PD1A 4EJSA 3LFUA 3CVYA 2IKSA 4N9QA 1MOZA 1VE1A 1YMQA 1NFRA 2ANCA 2FZ5A 3AKCA 1GLVA 3PVSA 2XAUA 2XNSA 2SKDA 1NV9A 4IDEA 3RRZA 2ZJOA 3N6XA 1ABEA 4JYBA 2QY9A 2FEAA 5B3JA 3RASA 4JEUA 5EXTA 3KXPA 4EW3A 2CUKA 4UFNA 3CNLA 2O8FA 4B3HA 2CJYA 4B7XA 1EP2B 4HWPA 3PGA1 1ZJ5A 1RTKA 4FFOA 2V8OA 2X40A 3FYSA 4LDRA 4N3CA 1GPMA 3WICA 1MQSA 1V7PC 2QN3A 3G17A 2BFDA 2GQ0A 4TXMA 1SQGA 4WBSA 4GPBA 3LF1A 1U2ZA 1DC3A 3IMCA 1ZMXA 2CDNA 2I6XA 4JBGA 2Y0BA 4TXHA 3UH1A 3H5WA 1I4TD 2W6ID 4O2AB 2CL5A 2X3UA 1E62A 4QUGA 2FF7A 3FYDA 5IT4A 3C39A 2JLQA 4JFRA 4IQ4A 3KC2A 4R1MA 1X1BA 4AUMA 1KDPA 1NNUA 5FWXB 2F43A 4HQLA 4X97A 5D6OA 3COPA 1S4MA 3QFRA 2V7QD 1PFGA 4PZDA 1NL3A 2RGNA 2KX7A 3DBVO 3SQDA 3WK6A 1XCPA 4GRAA 4FCVA 1KVSA 2VTVA 3EGDB 3G9XA 1F0YA 2POQX 2V7WA 3COWA 1DMSA 2YHUA 2OHHA 4GLJA 2QD1A 2QZPA 2QLLA 4LYAA 2ZIGA 1TE2A 3KU4A 4KQ1A 4QBFA 2W93A 2GPBA 4G86A 4C0BA 4NH0A 2Y99A 3L49A 1J9EA 3NTVA 3DE5X 1P62B 3KR0A 4P92A 4IOLA 2G9QA 4MRMA 3IAEA 3W1EA 1HE3A 2V97A 5JYEA 2OBNA 3OPNA 3DPIA 3LBAA 3D3WA 4RF2A 4DTCA 1UM9B 2B1GA 2F4VB 2JLRA 2WJ3A 2M2IA 2XMGA 4KWEA 3P26A 4P84A 2WM3A 2BVNA 4KH1A 2B92A 2YV3A 1M7BA 4A82A 5IFLA 4GR4A 4ZQGA 2QWXA 1UOOA 3IDFA 1FS4A 3OZDA 4XGRA 4ZEWA 2NGRA 5IJZA 4L9AA 5BQ5A 2VDUE 4JX8A 4LXHA 1P3JA 1C1XA 2P5UA 5LD2B 4RIGA 1ZIXA 5CURA 2C95A 1T2AA 4UVDA 3G2HA 2VBGA 5A3VA 2EQBA 1YD7A 3ZWYA 2HHCA 4U7JA 2O5CA 3B52X 3UJ8A 4R2KA 3TPZA 4BMSA 3P8ZA 3WIEA 2G6BA 2ZQYA 3GT7A 4LV8B 3I9FA 4BCDA 4IQFA 1MCZA 4WN9A 1TGYA 3CLKA 4JP1A 2JH8A 1EVZA 3JRWA 3TKLA 3WS7A 2CLSA 1O0SA 3L46A 1HTBA 3KVYA 1NFQA 2JIZD 4PC7A 4WNYA 4WY2A 3SM9A 1DQYA 2B21A 1K6MA 4HR7A 1WG8A 3VNSA 4BRWA 5AVZA 1W7AA 4PG5A 4FGWA 1DS6A 1TW2A 4E5DA 4Q3OA 4OAOA 4ZI5A 4DLYA 1DQNA 2VCYA 3W8RA 1Z4MA 2FV8A 2D1FA 2J3QA 2W8BA 1SCBA 2O48X 1SB9A 3GRFA 3I45A 3Q3GE 4I2VA 2HIMA 5CTAA 1EKXA 5DLPA 4PZUA 5FUMA 2YW2A 2BMEA 4BNFA 4WTOA 1KY3A 1GFIA 1Z6QA 1UQTA 1PJCA 1U0GA 1S02A 4LY0A 4O8CA 1WE2A 3KJXA 1QH1B 4YJ3B 1CIJA 3ESXA 3EFHA 3H5LA 5AUQA 3TGPA 1E3DA 2ZVDA 1LS6A 1E3QA 3C5WP 4EVQA 1T4GA 5CU7A 3LMKA 4UW9A 1B74A 3WFIA 2JEYA 4NCXA 2C0QA 3JQFA 4HHEA 4RSGA 5DHUA 4KITB 1TT5A 3H5TA 4XPIA 4DR1B 3S1AA 4OXIA 2J5QA 1UBSB 2QR5A 3KUDA 3E18A 4KVFA 4WLNA 2Q5QA 1ZSNA 4MKHA 4QFBA 2XUKA 1O97C 4XVHA 2FUCA 1MG0A 4FK8A 1ONNA 4LZOA 4XVCA 4PZPA 5AVJA 4GI5A 1V25A 2P69A 4QM6A 2QRMA 2FSHA 1V4BA 3B6MA 3EMBA 3KVOA 3WWZA 8AT1A 3A1EA 4S1TA 4S2EA 2AKAB 1JDUA 1HRDA 1KSGA 2GBFA 1D5WA 1HE5A 1YRAA 4V03A 4K8RB 3O73A 1ULSA 4D8WA 2FQ1A 3F67A 1X7XB 2FFBA 1LU9A 5FI5A 3RANA 4KK3A 1QK5A 1GNVA 5BWLA 1VSBA 3FCOA 1AKEA 1CYEA 5B30A 3M81A 4Q93A 2E4UA 2QM3A 2BE7A 1JP7A 1ZD2P 5CT5A 1OWPA 4ND3A 5AICA 1FP7A 3QUSA 5DGIA 1C7IA 4B7CA 1UQUA 3IE2A 3OZIA 3UANA 2QM7A 4M1ZA 1T3HA 4L6IA 1M1YA 4MWEA 5CX1A 4ME6A 1I4DD 5LOVB 5JLAA 3PK0A 1PT5A 2E4XA 3L6DA 3HUFA 5BWBA 4YRCA 3RARA 5P21A 1T91A 4CF6A 3OZFA 4L72A 3FB4A 1E4VA 3GNSA 1G21B 1YB4A 1LBHA 3MMZA 4IRUB 3TFWA 3HFRA 4JP2A 4LF5B 4MPJA 1GD1O 5KDLA 4AMVA 5HIAA 3C7KA 1NW4A 1CDOA 1JEEA 4CM4B 5JJKA 1L4MA 1TAUA 4A8PA 1CR2A 1AUPA 1GPLA 1FYXA 1XZIA 4JODA 3WHPA 3CNOA 1DDOA 2CC2A 3ZI7A 1KYTA 2VI5A 1P4SA 4M36A 1CEYA 4E5YA 2V7TA 4PANA 1DXOA 2PMFA 1QK3A 1EFPA 2EX4A 3H9BA 4RZ3A 3ZVLA 1HORA 3AHCA 4Q7QA 5KJCA 2D54A 2QAGC 2ZI6A 3GO4A 3VSDA 1JDTA 1CERA 1I1HA 2AG6A 2FYTA 4A8TA 4CEHA 4QSMA 4MEJA 3K1ZA 3Q2OA 4XB2A 5J4KA 2YC4C 3NPMA 4M0PA 4ZQCB 2ZTHA 1MO6A 1N2IA 1DKRA 3ER9A 1C8BA 2BJVA 5E6SA 1A8PA 3LSYA 3W2HA 2ZTLA 2XSZD 2P9JA 2PUWA 1UKZA 2WWGA 4YONB 2QMOA 2P30A 3OT1B 1ZWKA 4CYMA 3BN3A 1NWHA 4EP1A 3FOAA 2GCIA 3HVHA 3S1LA 5D5HA 4ZCTA 3C8MA 3HXLA 4NDAA 5CM2Z 1XDDA 3GMIA 5HE9A 2ZI5A 2QTRA 1FCJA 1ZA2A 4H1WA 3OTOB 3ZJTA 4I46A 3CRMA 1ZGCA 1G7TA 4HWOA 1SA0B 2KBEA 3RVLA 3SXUB 1OILA 3NBAA 2FPLA 3QH4A 5DLQC 1S8NA 4R41A 5IM5A 1GAEO 2RI6A 3T4EA 2XMZA 5GM2A 3P19A 5HMLA 2EKZA 2IYUA 2I03A 2PGIA 3AUJB 3C0KA 3EXFA 4MJLA 3IO5A 1PGJA 4IHKA 5DP2A 2GFQA 2LCFA 3OIYA 4X3PA 2YXBA 4AUKA 2Q5CA 4EJFA 4MVJG 1QRUA 1E6EA 2JASA 1L5ZA 3H5VA 4C0SA 1NR7A 1H6DA 1RRFA 4G1FA 3BWYA 1NDHA 4XCXA 1XLWA 5CIYA 4BJ5A 1QOPB 3W8NA 2AMYA 2CSUA 3I8OA 4RVNA 4AJJA 1SJ9A 4QJBA 9GPBA 1AXRA 3LHDA 2ZJ2A 1VIYA 4HNRA 7REQA 1RRVA 1Q14A 1U11A 2FLWA 2Y9PB 4LG1A 4ALJA 4Q3CA 2YWDA 3REGA 4CIXA 5KYWA 3WZMA 3OSUA 1YOVA 1QDUA 2Z3VA 1H2ZA 1QO9A 4IBOA 4Q4JA 4QFMA 1GDTA 1FMJA 3K92A 4FPXA 3RT7A 1CUIA 1J1UA 3FETA 4KN9S 2XT0A 3ITNA 1U7WA 4QBGB 4MUJA 5EKSA 2ZRAA 1XQYA 4BIMA 2HQOA 1OJ7A 2D1TA 3MHTA 4PF1A 5TARA 2JI4A 3PNKA 2QAIA 1Z8FA 2BEVA 4RH1A 2F17A 1Z36A 3AYZB 1CY6A 4GH5A 4PCVA 4DRXA 5IG2A 4X63A 5CBKA 1FSPA 2Q8NA 2CFTA 4NE9A 2Y1WA 5CIWA 1EX1A 2QMHA 2R66A 1KFEB 4X1IA 3RRMA 4UUMA 1PIWA 4NU5A 1UOQA 2KQUA 2NZ8A 2DPYA 2PLRA 2MMCA 4ZHQA 5FEUA 2EFEB 3I05A 2WHEA 1U1CA 1T35A 2VDRB 3A1WA 1M5UA 1UFVA 3IAFA 3WWCA 1GYPA 3BE8A 3DB1A 1NQWA 5TVGA 5A2GA 1PF7E 3P96A 1CY4A 1NV8A 3FZYA 3H11A 4J6FA 4CLOA 4DARA 4LFCB 3U2QA 4KBGA 4LI3X 1JI3A 1KI9A 2ATIA 4X6XA 1PKXA 4MQ4A 4MV0A 4ROSA 3NHSA 1YVUA 5EJ6A 4LFBB 1KEZA 4KACA 1H4SA 2XCTB 3BFKA 2NYVA 2ZW9A 1NNSA 2SHKA 1RMTA 3N8HA 1JIKA 4NV0A 1I80A 1CDZA 2AG5A 2YJNA 2ZBEA 3TK1A 3UPTA 3ZHVA 4ZYTA 2ZSAA 1RM0A 4ZYZA 1JIXA 2VP5A 2XJ9A 3GUZA 1GARA 4GWKA 4MI6A 1GGEA 5EKTA 1R10A 2H1IA 3KKEA 4IX1A 1Z88A 3DBIA 2CE7A 4NC9A 4QPJC 3PQ3A 4DABA 1YH3A 3E3MA 2GS9A 4PG8A 4XQ9A 4RGVA 3TW4A 4XWOA 3LT4A 1OF1A 1E2JA 4I5IA 4JI0B 2A9QA 5CJ2A 4W9MC 4ENTA 2GBLA 3NANA 3PNOA 4DG9A 3G89A 1N0VC 1ZJ4A 2MU1A 3M1AA 4ZT3A 2PN1A 4X60A 3HLTA 2D2EA 3VGJA 1KMHB 3JAKB 3PUJA 2WJHA 3CS3A 2H4JA 2Q4TA 2F3RA 3EK2A 2HXGA 3HCEA 1F9EA 3ZIDA 1V9CA 3A11A 5C37A 1L4NA 2XODA 1RP1A 5JEEA 3HKDB 5LQNA 3PA6A 1P7YA 2QTTA 4R84A 2YWFA 1R0CA 1NRIA 3L4KA 4UM7A 4HYEA 1RE1A 3AUSA 3OJLA 1LDYA 3ONNA 3HU5A 3VO8A 4Z2AA 3PX2A 1B15A 3L79A 1A2BA 1XTJA 1E6MA 5JI2E 3RC3A 3EFEA 1M6NA 1ORDA 1PJTA 3QMWA 1ZGJA 2CLHB 3JQRA 4HXFB 4ROTA 1F0NA 3TO5A 4N41A 2A59A 4WRRA 4G0XA 1HDGO 3HB4X 5KINB 4GP6A 1L6IA 2NO5A 1SVOA 1CRZA 4J7AA 4XDYA 5ECWA 3WKDA 4E3ZA 1GYRA 2FWBA 2X41A 1OI3A 2W71A 4GSKA 1PR3A 2IEDA 3OIVA 4HLNA 2PKWA 4RJIA 1X7HA 1P1CA 3K6JA 2IS6A 4FDUA 3W2IA 1P9OA 3DQZA 5JBQA 1HGXA 3F7OA 1A98A 1XZMA 2Q6LA 5I7OA 4DW8A 4TZKA 2NU9A 2PTGA 3PITA 3PRYA 1SZDA 3K70D 1GZ6A 4AY6A 3TDKA 4TWZA 2WC1A 2WT9A 1XVVA 1P2UA 3WO0A 4D9GA 3TDMA 2RGRA 4XWAA 2WHPB 1S1MA 1Z2NX 4OHOA 1K0UA 3Q12A 3IUNA 2ZJ5A 5IYZA 1WS6A 3DBHB 2DBYA 1U3TA 4LOHA 4YP5A 4C04A 3GARA 4TRRA 2R79A 1IN8A 3K5IA 2DUNA 1P44A 2PXHA 1KYVA 2VHEA 4KUGA 1LC0A 3PC4A 5EJ8A 3V8VA 2C07A 2MR5A 5FI1B 5GOTA 4U2BA 3HR4A 2QENA 4NZPA 4QFDA 2AC2A 5T8KC 1FRVA 1WV0A 3RTGA 3EH1A 4DXHA 1UF9A 2ORYA 3DL2A 1A7JA 4R2WA 1TU4A 5BORA 2QW1A 3IDOA 3ZVKA 1R15A 3UJBA 2GN2A 3TNDA 1GPKA 4J7UA 2XYGA 3LHKA 4WXPA 1JQ3A 4MQ5A 4LXUA 1Y4AE 2PX0A 3F9IA 2VNAA 1E32A 3Q3VA 5I9MA 2J9FA 2NZXA 3R24A 4CV2A 2QZZA 4ZOCA 1RAIA 2QBYA 4NAUA 4QU8A 2M6LA 1R9JA 2PX2A 2CD9A 4DBLE 3DF9A 3COZA 2RGCA 4XJXA 2V9CA 4Y9RA 3PP8A 2OK8A 4RANA 4MPPA 2WRZA 4TVOA 3R09A 3W5AA 5H3CA 4UC0A 3KG2A 1F60A 1UBMS 2IUYA 2Q8QA 1FMTA 1JQBA 2Q8PA 2RK3A 2VAXA 3UENA 2P11A 1RRMA 1XEWX 3GT4A 1AMNA 2C8VA 4ANFA 2HU8A 2VT2A 4PY2A 5FPPA 5B37A 5K3FA 3TW6A 3PRJA 3V2GA 1SC4A 4BZPA 1N1DA 4D82A 3AM1A 3L04A 2W4QA 4G0MA 5FO0A 5FJJA 3WA7A 4RV4A 1NQOA 3HBMA 2B4KA 4QBIA 3ZWMA 1QOZA 3D59A 2DHRA 4B0OA 1UBGA 2RKBA 3FJOA 3SK0A 4UOZA 3THWB 4YJ3F 2V45A 1O5IA 1TMKA 1A7AA 4DLNA 1D4AA 1T9GR 2GVZC 5AI4A 1B8OA 4KIJA 2N75A 4ON9A 1A2KC 1B7GO 1G20B 1CUFA 4GW3A 2C42A 2W6CX 4FNOA 4KAAA 1RABA 2DH5A 1YL7A 4C7OB 1P4RA 4Y0NA 1OD6A 3RI3A 2GCGA 3KNZA 3TBKA 1J8VA 1R88A 3DE4X 3O75A 5G0VA 2QYHA 1F4PA 1W8IA 2QEQA 1JA0A 4AWXA 1X1QA 2IHKA 3K1TA 3QQ5A 2R5NA 4W5OA 1RWMA 1TMGE 2W9XA 5TQ0B 4OCZA 3R2JA 1KXJA 4TMXA 4DLAA 4GPZA 1P1FA 3TTWA 1L5RA 2RB5A 4RETA 1JDBB 5CJPA 1H22A 5CNKA 1KI6B 2I3BA 4Y2JA 2Z57A 5TJ9A 3BD7A 4PLFA 4QT4A 1U2RA 2GO7A 2EIXA 2AA3A 3I2GA 3KLMX 4BJ3A 1PQPA 4FZ5A 1FX1A 3B78A 4NMXB 1OTXA 2ZBRA 3ENNA 2OKCA 3BXGA 3COYA 2IZ6A 3UJCA 2JLYA 4MTLA 1GUYA 1L5MA 2IZ1A 1CJMA 4MW0A 2CFSA 3HP4A 3LQRA 3OTIA 2OBYA 3IT0A 3ME5A 4U9HS 4ZZ3A 3QVOA 2PRZA 2EZ8A 4US1R 1NLYA 3OF5A 1DT5A 4QFCA 2IX3A 1T0UA 3TLGB 4CLEA 4G0ZA 4INJA 1JA9A 2N3ZA 1RI2A 4Z4EA 1YBHA 4R05A 2A2ZA 5BT9A 3SD7A 3LHIA 4C1NA 2G72A 2MSKA 4PYRA 1M2OA 2IU3A 3EG9A 4U6QA 4EHKA 1YS6A 4J1QA 2ZAOA 3DBRB 4FMDB 1PV2A 4L4ZA 1TVCA 1E77A 2FMTA 4D4IA 3HYRA 2GTHA 2HSJA 1EB8A 3R3JA 3ULKA 3MILA 1VYUA 3ANYB 4D9MA 1DJMA 3G2PA 3H83A 4BO4A 1ECBA 4ZXFA 1V48A 4U39A 5L3VA 1SXIA 4UASA 5CB4A 4RIFA 4ZQHA 1GKUB 5TMDA 1T26A 4Q24A 1RJ9A 2WIJA 3L4JA 3TQIA 1Y7PA 5KYUB 4DCJA 1KZ7B 3B6JA 5ARDA 4Q9AA 4NOLA 3K20A 3BMCB 1JEQB 5ITSA 2QG4A 1KJ8A 2FW9A 1P7CA 3BD8A 3I76A 1JDSA 1QFJA 3GBVA 2R5FA 3B9QA 2CLCX 4D3YA 4JITA 4ERNA 4X8OA 2BPOA 1ZIPA 1L4GA 2UAGA 1MN6A 1VJCA 1N6NA 2HRDA 4MWDA 1NW3A 4C5BA 2OQIA 3CU5A 1EK6A 3M6VA 5DIFA 2QZJA 3QVGA 4JS0A 1AUVA 2H51A 1TFUA 4HFJA 4ZI7B 5DXAA 4YMLA 5IF9A 2AJCA 3L0DA 2XPCA 4PHHA 1P2DA 1G64A 3LVFO 3WIVA 4D41A 2ENWA 1D6JA 3ASVA 4PX2A 3RUCA 13PKA 1H5QA 8ABPA 4QLBA 1UMDB 1VPVA 4G4JA 3ELDA 4FE3A 5FPHA 1YVRA 1KVUA 1YJXA 1EESA 1VKNA 4HYTA 5DN6A 1TJNA 4BMOB 3WLOA 3IIMA 5DO9A 3NQ41 4PX3A 5KNLA 3U4IA 2DU8A 3CZ4A 3QTLA 5L7YA 3IMEA 3T35A 4DR7B 1BOFA 3DKVA 1ZY2A 1K0FA 5CLIA 4BDSA 5HK9A 4O4LB 1JFFA 5C5IA 4FLMA 2F6RA 4KN8A 3ASUA 4QL3A 3NT4A 5IU6A 1CG6A 3CMCO 2QJOA 2N47A 3GT3A 1YQTA 4PC1A 5DK6A 1J42A 1T4BA 2YY6A 5T67A 3J7AC 4RHUA 3QLTA 4J3FA 1L7XA 3I0MA 1VYTA 2JFWA 4WLEA 4DUPA 5ALYA 5FQNA 4ER5A 2DFKB 2FFHA 3AG6A 4NEQA 3SLGA 1T6YA 5F98A 1I9CA 3F6SA 3DZHA 2JCVA 3KHTA 2IYPA 3JAMA 2J08A 1C9EA 2QX8A 4DR3B 3L7NA 3JQAB 4GVLA 1TYEB 2GBCA 4TQAA 1ZX1A 4R1UA 1PLJA 3TW0A 3FVWA 3GN1A 4P83A 5KTMA 3QSYA 2FPIB 1GSHA 1FSGA 3DVQX 2JFNA 3A0RB 5EY5B 4ZMRA 2HBZA 1ZUWA 2EARA 1DAOA 3WGHA 5HQ3B 1SKQA 4WX2B 3V32A 4F60A 5TGTA 3R4CA 3DE0X 1GCUA 4MCIA 4TZ0A 2UYQA 3Q0TA 4RA6A 2CNDA 4G6ZA 3BMQB 4YNBA 5KJ6A 1WPRA 4X92A 3MEQA 2L82A 3DMTC 2ZVJA 4ND8A 5AHWA 4NBNA 3ZDYB 3ZE2B 4BVJA 3OO1A 1KXZA 2FOIA 2ZIEA 4ZOLA 2BLLA 3HP1A 2HL6A 4CMGA 4C08A 2FPSA 2V7QA 5JZ9A 2XA2A 1T2FA 2UZ0A 4ODIA 1U4NA 2FE1A 1H3FA 3ZDEA 5TPZD 5BYAA 2RDMA 1IHXA 3QE4A 3TB6A 3ZTWA 2X3FA 3TLXA 2V9PA 1J0AA 3HSSA 3CX3A 3TLMA 2V0GA 4GQBA 1J21A 4V0QA 5KAMA 3UJHA 1S7GA 2AV6A 4N3BA 5BUSA 5BW6B 1DUVG 1NVKA 2JNWA 1N6LA 2Y67A 4KQKA 4RMHA 4HDNB 2WY2D 3TQQA 1LSJA 2RHCA 3IKLA 4FE4A 4B2LA 3ZZMA 3P20A 4PBSA 1XVLA 3HJRA 2HF7A 2W90A 1GNQA 3T1YB 1BDBA 2WW8A 2NG1A 3PQCA 1ZOIA 2WAYA 3KQSA 3Q5EA 3QRWA 1SBYA 1P0IA 1N8SA 2DX7A 4LQ4A 1DLJA 3AT1A 1JMYA 3LKZA 3N1UA 4G1UC 4CTNA 3U3DA 3KQKA 2V98A 3C7CB 4J16A 5B1EA 4IOKA 4YFYA 1MEOA 1LDMA 3C87A 3OZAA 4LDPA 4B7ZA 4CCAA 1F48A 2QT1A 4MW7A 4G09A 2C2OA 5BYJA 2ZFUA 3FDJA 3FFXA 3NV7A 4R98A 1YFZA 3G0HA 1E1RD 2RHOA 2B0CA 2CNWD 5T4BA 2G06A 5BWCA 5MF6A 5ALQA 2ENUA 2C77A 3DL0A 4KZPA 3P0RA 5ALRA 4F6RA 5TEVA 1ZUNB 2HK6A 3LD9A 4EA9A 4FM9A 3PJRA 4MQEB 5EMKA 3UFBA 4JBLA 3AHGA 1GADO 2D3TA 2GWRA 1BS2A 1E4EB 1KJZA 4K6OA 1V1JA 3RIXA 4LRUA 3WADA 1NX9A 1ZJZA 3F0TA 4IMRA 2HMAA 4OHVA 5HMMA 4KRYA 5I4KA 5FOSA 2GM9A 4B48A 1T5IA 5ITZB 1T3TA 4PC2A 3WYFA 4F5DA 3U5ZB 4Q0MA 2IUSA 3GFVA 3A8TA 4LE2A 3SHWA 1KDTA 4TWJA 1T6ZA 3ESDA 3JAWB 3QWIA 4HGRA 4IRMA 5TS2A 4KDFA 2EF0A 5DGDA 2RGAA 1U5BA 2FUKA 2AOWA 2W2LA 2FQXA 1TUGA 3VPCA 1BQEA 4P7JA 3TSWA 3LWDA 4K05A 4NWIA 4ZICA 2I34A 2PZ8A 4FZVA 5KEIA 2EWWA 3S1SA 3E5HA 2WKSA 1T34A 2OPHA 1WXEA 2CB0A 1IIRA 2OC9A 1Y5RA 3VYWA 1CRWG 2FCRA 2MSCB 1N3LA 1PN3A 1PFVA 3HR7A 3G9ZA 3I64A 3NASA 4P1ZA 1O6CA 1WBJB 2PE5A 3D7LA 5DBHX 2HR1A 4I0WB 1ZAKA 5TGZA 4L02A 1T36B 3QBJA 2H31A 4ZVUA 1M2EA 2I2FA 4RWEA 4UVHA 3K09A 1IBLB 1SXQA 3K8YA 2XITA 3BS4A 4ZVOA 2PKQP 1FLVA 5CLGA 3V8RA 1U2QA 2CCJA 3S29A 7ADHA 4YP7A 1IEWA 1OGYA 3BJRA 4YV2A 1F06A 2Q3MA 2NV6A 3Q9SA 4PO1A 1EUYA 4RVSA 3BRWD 1L5NA 1G16A 2X7XA 1UOPA 1CDDA 4Q4LA 4M55A 1FVOA 3QYPA 1RM4A 2PS3A 1PR2A 5EHIA 5B7NA 1Q92A 5KMGA 4JH0A 1HBJA 2DWUA 2QPLA 5GPBA 1M0TA 1QGAA 2GPAA 2HU5A 4C78A 3BE5A 4RPCA 2WTUA 1JECA 4PCAA 4TMYA 4MUBA 2CY0A 3H5NA 4DLZA 1XR3A 2XYPA 4K46A 4IFTA 3UC9A 4OA5A 5JDCC 4CJXA 3PEUA 1E18A 3TW8B 1U4SA 4RHTA 3C1OA 2WJIA 3EZNA 4HS4A 5LQJA 1U8CB 1V8PA 4ZAGA 5G1NA 3AR9A 4MVJM 1VA5A 1ID8A 5L40A 3KCQA 3KEGA 4GC9A 4A0QA 2ZRFA 3OM9A 4I8IA 1LWNA 5BRAA 4DR4B 2BTOA 1EK5A 4H7JA 4CIVA 4D8YA 3RK0A 4OREX 1E1NA 1YZTA 1P9NA 3IVAA 4HPJB 4LZJA 2B9EA 3BMOB 4YK7A 4O3FA 5K05A 3V1KA 3FNHA 2Y27A 3JQCA 3OHMA 2EF1A 2WMNB 3HU3A 3IBFA 1NSTA 3L2OB 4QSHA 2OXFA 1FYFA 3T9CA 3H3FA 4Y6PA 1WCIB 2JCSA 5CVVA 3Q1KA 4HN9A 2AN3A 2P3QA 4XLTA 2R1TA 2FJ0A 4JBYA 4EB8A 3T3OA 1FRZA 1C7ZA 1G5PA 3Q11A 1CDEA 3DE2X 3H1BA 5DASA 4EJMA 4ZO4A 5F73A 3QHPA 5AK6A 1Q50A 3G59A 5LU9A 5EJAA 4RU1A 3DUFA 1ADYA 3QNUA 4ZT7A 1D3AA 1TK9A 1SCQA 2WABA 5CYPA 1QQ6A 1QKJA 2QUKA 1KO8A 1O0CA 2PDAA 1DZIA 3MWKA 1WDTA 1Q0UA 4CKEB 3MYYA 3OPYB 1KEEA 3ZWDA 4U9IS 1SVLA 2XYVA 3NV9A 2ISQA 4ITVA 5DHPA 4YRPA 1NW9B 1O94C 4R9SA 1HOXA 1QLHA 5FTMA 3TQCA 4YBZA 1OLSB 1H1DA 2XSZA 5JQGA 5TNXA 4BMYA 4L85A 1PVDA 4AL4A 3EGVA 4PSDA 3RSOA 2FETA 3UMRA 3W5SA 1NMZA 2XE6A 3X1JA 2EZ9A 4MR8B 4NARA 2HNAA 4B4OA 4B8YA 4NE7A 2VUTA 1HLGA 1T8TA 2OB1A 3DOHA 1LV8A 1MXHA 2GLXA 5DNVA 1R12A 2VAMA 2H2DA 2HXYA 2I4IA 2VPZA 4P3NA 2W22A 1E61A 3DVRX 3EIFA 4XH9B 4WXRA 3T0IA 2BEJA 4R1SA 4BQFA 2QVYX 1CUAA 1U5CA 2X9VA 3FLBA 1L5SA 1KC1A 2OORC 3HPQA 4QYIB 3SAJA 4BNIA 5HG0A 5BSRA 3AVPA 1JEAA 2NM0A 2ZUFA 2ZT7A 4Y18A 2XR1A 4LMRA 2BMVA 1SBCA 2PY6A 4UOQA 3G8DA 2MINB 2HW8A 4QUBA 2PH5A 3RIGA 1BRTA 1YZNA 1AXEA 2BH9A 2ZXEA 1YONA 4NF2A 2NZWA 2GK3A 1RZRD 4BQOA 2DFTA 5J2TF 4NH4A 2CJXA 3I52A 1NI4A 1X9GA 4H6PA 3NMUF 2FW0A 5KNDA 3GGSA 1NMQA 4JR2A 4XPZA 3M0EA 5GJCA 4AZ0A 4F91B 2D0DA 3SX4A 3HCFA 4R2HA 3DBLA 4EFLA 1YA4A 2PZJA 3T5GA 1PJ8A 4L27A 5KOYA 2NT4A 4C1BA 4MWSA 5NLLA 5AW7A 1RYHA 1EX6A 3SOZA 4EG5A 3IE0A 2OO3A 5FB3A 3OFJA 2A9VA 4ZJZA 4LDZA 5B2ZA 4LIPD 3C41J 4NV3A 4TUYF 3B5EA 3TAUA 2OWEA 5BOVA 5CEEA 4BFYA 2VRCA 1L5HB 1LFAA 2DFVA 4ER0A 2WNSA 3HM2A 1U0TA 2PLFA 1E9BA 2DBRA 1FTNA 2HXSA 4MJ7A 5AVKA 3VX3A 5REQA 3WLQA 1NY6A 2WPNA 4YAIA 5CA1F 3A4VA 4TYMA 4DKJA 3T3NA 3ECCA 4JLKA 3BDVA 1OREA 3FSJX 3ZIAA 4BGEA 2Z6AA 1U7DA 4FGLA 3BORA 4IOMA 1TM7E 1KQ3A 1IJEA 2EP5A 1ESDA 4P35A 3HXQA 1T0HB 4QODA 4CKZA 3FCCA 3TFQA 1AK2A 1XF9A 4QXMA 3FCUB 1TKCA 3I8SA 4LQDA 3U7EB 4IWNA 2MJLA 2VUUA 4J49A 4J0GA 4BNVA 4F86A 2YWHA 3BXOA 3JYQA 1C9KA 4KXNA 1WB9A 1VL6A 2Q1SA 3W6NA 3WLPA 3MUEA 2H59A 4IIEA 4FYKA 4X54A 2QLBA 4XQCA 3TM5A 2IXDA 4KDCA 2BGNA 2X1HA 2BEWA 5IH7A 1JHDA 1X19A 2EG9A 3E9YA 3F3KA 5DHSA 5LP6F 5FLXA 2HPHA 2R96A 4BY9E 5JHGB 1IZZA 3H9JA 4JQYA 4N5LA 4M9XA 2GGSA 1JKIA 1A69A 2R60A 5IDWA 2QD4A 1NPTO 1JB9A 1U6IA 2X42A 4LA4A 1JSCA 1YB5A 2QE7D 3WA6A 1OXSC 3HYTA 5ECDA 1AF4A 3JZIA 4WK0B 3U17A 1T8SA 4H0CA 2NZJA 4F46A 5BMVA 4RVFA 1XBTA 5HCUA 2HJSA 5AXAA 4F93B 3H5AA 2H63A 4LFAB 1TVMA 3HA7A 4I9FA 1A97A 1IY9A 3QLVA 4NQZA 2PFGA 3IGFA 5DHAA 1B42A 2HMUA 4QRDA 1C1HA 2Q5JA 2R1VA 1RRKA 1XWIA 3GJXC 3KQYA 1DWOA 3I4CA 5CTJA 1NVMB 3ZE8A 1G4UR 3I2YX 4YP0A 2X0JA 4YXFA 2HA7A 1YQGA 2F59A 2VLIA 1X2EA 1BXRB 3IBCA 1S1CA 3N53A 3HO8A 5ALFA 1G2IA 1XL1A 5LBUA 6ABPA 4JL6A 2NU8B 1PGQA 5HS6A 3P94A 4OFBA 3ZDFA 4K6GA 4NHEA 1VLQA 4F4CA 3R4VA 3CT6A 3LZDA 1LTQA 1QFYA 2H5JA 4A2WA 3PNVA 1U7OA 1GIAA 1S3GA 2JHGA 1AA9A 4LYEA 1FFDA 3SN6A 1E94E 2QQFA 2A1TS 1JV2B 3Q41A 4P7BA 4WZ6A 5THXA 2BKUA 4YHHB 4FCTA 2UUPA 4IIBA 1D9XA 5KNBD 4QUAA 3DJYA 5K09A 3LF2A 4KLNA 1SZPA 4RH3A 3PI7A 1CZKA 2WUVA 3AFNA 5K20A 2HDNB 3T0FA 4D02A 3BCRA 1W34A 3Q7TA 1KY4A 1PTJA 3OIUA 3CEPB 3PGVA 4PINA 4WOPA 4W1SA 3M70A 1N75A 4B5KA 3IQDB 2DY1A 3HCBA 1I2MA 4JJIA 4KXUA 4EF6A 1SD2A 4Q6WA 1I5OA 2GJ4A 1Z0KA 3QU4A 1GG2A 1U0HC 1D2CA 2E37A 2Z83A 3BH7A 3D0KA 1UDCA 4I1PA 1OA1A 4DSTA 1R6VA 4G0PA 2HU7A 1Y6QA 2JGMA 2PLNA 2Q27A 3ETJA 2OD2A 5BNWA 3VU3A 1JAXA 1U8UA 1A4XA 4WMLA 2CV0A 1DCMA 5FBQB 3U3ZA 3HRHA 1CQZA 2PQMA 1ULZA 2C8LA 4JLAA 4Y98A 2QRVB 2XVZA 4WZBA 5FOUA 3P2YA 4Q4HB 1YMVA 5MGNA 10MHA 4LF6B 3HCDA 3JD4A 3ZV4A 4JENA 3CCCA 3P97A 1J9ZA 4EUKA 1SU4A 3RRJA 4QARA 5A9SB 1V5EA 3LUHA 4H7IA 4R2JA 2ZRNA 3GUYA 4PYOA 2BL4A 5EYPA 2G5TA 1W44A 4ZVTA 3ZXYA 3IQXA 4RV5A 4C21A 4OUDA 1XJQA 5JEDA 2AJTA 2FQQA 3ID6C 2DE0X 2BOVA 2UV8A 1JQKA 3B1KA 4DDKA 3TPCA 1ZIYA 5LMUB 4OJYA 1FSZA 3K4QA 2D5BA 2PA0A 4HZUB 4YJFB 1I7QB 4NXNB 4Z49A 2WF5A 3UVEA 4WEQA 1KZYC 4QLOA 1W6RA 3EOBI 1CZHA 1T4CB 4FDMA 3ZLVA 2AEEA 2W6MA 4ISCA 5SY6A 5EHXA 4TSFD 3T54A 5JRDS 3QWAA