2H8GA

5'-methylthioadenosine nucleosidase from arabidopsis thaliana
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
246
structure length
246
Chain Sequence
ILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-Methylthioadenosine Nucleosidase
publication title Crystal structure of 5'-methylthioadenosine nucleosidase from Arabidopsis thaliana at 1.5-A resolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 80
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h8gA00
4JWTA 4YMLA 1YQQA 4OEHA 1NW4A 3LGSA 1JDZA 5EPUA 3KVRA 1I80A 4LNAA 4H1TA 4TXHA 3EUEA 3FAZA 5F73A 3DP9A 5CYGA 4OF4A 4OGLA 4DA7A 4FFSA 1T0UA 4LDNA 1A9RA 3O4VA 1Z5OA 3GGSA 1JPVA 1YQUA 4M3NA 2OC4A 1ULAA 1Z37A 3K8QA 1PK7A 3PNPA 1CB0A 1Y1QA 1PR2A 1VMKA 2QTGA 4YJKA 1RXCA 5F76A 3EEIA 2B94A 4NSNA 3NBQA 1V45E 4TS9A 2P4SA 3NM4A 1U1CA 4OY3A 3FNQA 5C80A 3BL6A 2QTTA 4RJ2A 1SD1A 4TXMA 4DAEA 3OCCA 4D8XA 2ISCA 1XE3A 4GMHA 1C3XA 3BSFA 4WKPA 4NS1A 3K8OE 1NC3A 3FWPA 1U1FA 1V3QE 1VHJA 3PHBE 4OGKA 1RT9A 1ODKA 4QAQA 3MMSA 4TXLA 5CCDA 2QPLA 4DA6A 1YR3A 2Q7OE 3PNSA 3UAZA 4DARA 3ODGA 3SCZA 1Y1SA 3UAYA 1QE5A 4KN5A 1ECPA 1U1GA 2OC9A 2HSWA 3EUFA 3OF3A 4M7WA 4TXNA 1T8YA 2GUWA 4TTIA 1ULBA 1OVGA 1VFNA 2PGAA 4BMXA 4L5YA 4OJTA 4BN0A 3F8WA 1FXUA 4WKOA 3KHSA 2AI1A 1RXSA 5CYFA 4G89A 2QSUA 2ON6A 5B7PA 1PR0A 1JYSA 1Z36A 1TGVA 1PR5A 1YBFA 4D98A 2A0YA 4R2XA 4WKCA 2QDKA 1K27A 4PR3A 4YNBA 4IP0A 4R31A 5ETJA 1A9TA 3IEXA 1PBNA 2XRFA 2HWUA 1A9SA 1PR6A 3C74A 3DPSA 4TXJA 1LV8A 1T8RA 2H8GA 4R2WA 1V48A 4D8YA 3FOWA 2BSXA 3GB9A 3LBAA 4YO8A 3TL6A 3KVYA 3OZDA 1ODJA 1RXUA 4TS3A 1RCTE 5F7ZA 1RYZA 1ZOSA 1PR4A 5B7QA 3PHCA 2HN9A 2IQ5A 1M73E 4DABA 1RR6A 4D9HA 1JP7A 4L5AA 4QASA 3BJEA 1TD1A 4F2WA 4GLJA 4PNPA 3OPVA 4DAOA 4L5CA 1RSZA 4K6OA 3IOMA 1PKEA 3KUKA 1A9QA 2AI2A 2A8YA 1OU4A 3KVVA 1JDUA 3E9RA 5DK6A 1A9PA 1K9SA 2RJ3A 3OZCA 4JOSA 4LKRA 3FUCA 5B7GA 3UAXA 1OUMA 4LNHA 4G41A 3U40A 1OV6A 5KB3A 1JE0A 3LA8A 4D8VA 4BMYA 1V4NA 1Q1GA 3DJFA 3FB1A 1NC1A 1JDSA 4EB8A 1B8OA 5CCEA 1Z5NA 2AC7A 3O6VA 5F78A 4DA8A 3EMVA 4DANA 5F7OA 3INYA 1TCVA 4I2VA 1U1DA 3P0EA 5CXSA 4QATA 3OOHA 5I3CA 3T94A 1YRYE 1PF7E 1PW7A 4LZWA 1SJ9A 1G2OA 4QARA 4BMZA 3OZEA 1T8WA 3OOEA 4WKNA 1JE1A 4F3CA 1Y1RA 3DDOA 1N3IA 2OXFA 5FAKA 4ECEA 1WTAA 1RFGE 1PR1A 2A0WA 3ONVA 3BGSA 1Y6RA 4F3KA 4F2PA 3DF9A 4TTJA 5EUBA 1JDTA 2AI3A 4DA0A 4QEZA 5JPCA 3UAWA 1LVUA 4MCIA 3E0QA 1A69A 4MARA 4EARA 1SD2A 1K3FA 1LX7A 1Y1TA 1Z5PA 3P0FA 3MB8A 3KU4A 1ODIA 1RXYA 3E9ZA 5EFOA 4F1WA 1ODLA 2OECA 4UC0A 4MCHA 4QFBA 3UAVA 1Z34A 5IU6A 1Z33A 1Y6QA 1TCUA 4NY1A 4U2KA 4G8JA 3ENZA 4GLFA 4WKBA 1A9OA 1CG6A 4X24A 5CXQA 1Z38A 4E1VA 3NM5A 3UT6A 2HRDA 5F7XA 3OZBA 1B8NA 5IFKA 4TYMA 4P54A 4TTAA 1PWYE 1V41E 1PK9A 2I8AA 1JDVA 1V2HE 5F77A 3QPBA 4L0MA 5K1ZA 1ZL2A 1Z39A 1TGYA 4GKAA 3NM6B 1T8SA 4L6IA 2A0XA 1OTYA 1Z35A 1U1EA 1VHWA 1OTXA 5B7NA 2I4TA 3D1VA 4JP5A 5F7JA 4M1EA 1SQ6A
chains in the Genus database with same CATH superfamily
2WE8A 1ZD3A 3DCNA 4WLEA 5FPTA 3V3KA 2Z5FA 3E1SA 5JSQA 5JNTA 4RHYA 1J9GA 1GNSA 1YQQA 5ALFA 1I30A 3ZWQA 1W0JD 1A8UA 1QGUA 4QPZA 3J7TA 5ALRA 5DWQA 3TW6A 1O0CA 1VPLA 1CFZA 2NSHA 3KVRA 1JHXA 1PQ4A 1JFVA 1QRRA 5G0SA 3SY8A 5KSWB 1B1AA 1BE1A 1L5YA 1Q1ZA 1JDJA 1R8YA 1KO1A 3RROA 3O2QB 1FS5A 3H3JA 5DGXA 5JNWA 3JQFC 5F5XA 4KO3S 4L9WA 4PO9A 3IODA 4V0ME 4Y1RA 3TWOA 4ARCA 2X86A 4YJ2B 3GO4A 5JHGB 4RJJA 2O1XA 1DO8A 3DM5A 5J4VA 2IELA 5KYVA 2HXYA 1L4FA 4JK3A 5JEDA 4M38A 1F9EA 2O2IA 3H9EO 5JH7F 4GI3A 2CT8A 1Z4LA 1UXIA 2MIIA 3PDWA 2CLSA 2OY0A 1FVFA 4WVFA 1EJ6A 4CMJA 3WYDA 4IH9A 3D8HA 4NF2A 3CT4A 4C3UA 1P4JA 2XKJE 3IAXA 1DCMA 3K0EA 2ZJAA 4U2FA 2DGDA 3MSXA 5AOBA 3WR5A 5BVHA 1CETA 4BLVA 1W87A 1CQZA 3OX3A 4Z2YA 3WLPA 4AJKA 1MJGA 1PK7A 1QH0A 3R3XA 1TIPA 4HR7A 1SA0B 4JGIA 1T0HB 4OQFA 2AJ8A 4L5JA 4PZPA 3WMFA 2VP5A 2QM3A 3SHQA 1ZM2A 1H05A 1PR2A 1RMQA 1GYQA 2IP4A 2ZJBA 3OFNA 4NHEA 4QPDA 4JNCA 4QOFA 3PX2A 1NNI1 4C30A 1QUEA 3VAAA 3A1FA 5IG2A 3ZVLA 1M8JA 1WWKA 1DV2A 3D3WB 2I62A 4WXYB 5LOVF 3GPLA 3V2IA 4UU0A 4UCQA 3BRQA 3TLZA 2QOEA 4DSZA 1AXGA 2ZM6B 1V6CA 1F2TA 1Q1NA 3N6VA 2IZ0A 3GUHA 4PCUA 2I2BA 1QO0D 4KX5A 5DV9A 3NM4A 3OE7A 3EZ9A 1U1CA 1N33B 3UM9A 1QTIA 3QM1A 5EVJA 3NC4A 1XKTA 3OJ0A 4J29A 1KH1A 1QCDA 2Y9PB 3BGWA 4QGBA 3A6HA 4OVKA 2GRAA 5HUJA 4J9VA 4YAOA 5DSTA 4EFLA 4L4UA 3ZTYA 2ZSKA 4C4TA 3HEAA 1UPXA 1VHDA 2AOTA 3PEUA 4GBJA 2PLWA 4Q4JA 4YDRA 5GV7A 2NPOA 1OXTA 4MYTA 1G4AE 2WQ7A 1QAMA 2YXBA 4ZYXA 1G9TA 5FPYA 5B1EA 1HLPA 4HUTA 4Y9RA 3EPJA 1A5TA 1L5RA 3ESAA 2X0FA 5JE8A 2BM8A 2C82A 1NI3A 1NVUQ 2V4MA 4G5SA 5F35A 3ED5A 4EJMA 1WXDA 3PA6A 2XMZA 4OBWA 4ND1A 1MVNA 1QVRA 3A04A 2B1QA 3FTNA 3HFRA 4OHKA 1DBIA 1GFIA 2G08A 3VPGA 2BDUA 2OCLA 1SHLA 2CD7A 3ZHVA 4CWAA 1NC3A 2XCIA 4OO3A 1U1FA 3UTCA 4D3DA 3CJQA 3OOSA 4OGKA 1EXWA 1X9HA 2AQ8A 1CULC 2PKXA 3T6KA 1XA4A 4LOLA 2ACEA 3VO2A 5DE3A 2WTUA 1ECLA 1DNPA 3OQMA 3LQQA 5HF8A 2IPLA 4G5FA 1QHHA 2C5GA 1QQAA 1SG6A 4D81A 2GK6A 1VCNA 3DH0A 5BQFA 1V7QA 1VL0A 2EZ4A 1QNLA 5CUQA 1XRNA 4NENA 4RPLA 1M1NA 2ZTSA 5C1BA 3DZFA 3FWZA 3OKCA 3I2JA 5ESRA 1JFRA 2B7CA 2W93A 3HB0A 4IHKA 1S9HA 3ODGA 3BD6A 4M8LA 4NG5A 1QB8A 3LGAA 2BFMA 2C61A 2PKEA 3ABQB 4JGBA 4BTLA 1NBWB 1QKKA 2NO1A 4WZBB 2Q27A 1NF8A 2XNCA 3AJRA 4PZAA 3RUIA 5K0FA 4BCDA 2DQKA 1BCSA 2JF0A 3ZQUA 2ACWA 2KSQA 4WNAA 5TY0A 3SQMA 3WXMA 2MSLA 3KJZA 4KXFB 4ZYZA 4MYUA 1L3IA 2XUOA 1LNSA 1WZNA 2E3JA 4XIGS 2B1GA 2QT0A 4KYTA 3QF4B 4NG4A 1FDWA 4RH0A 5CNIA 3WAKA 1RKXA 5IJAA 2VP2A 5F33A 3P9NA 3FFAA 4XTCS 3GJ7A 4N7JA 4BNNA 2B6NA 2W8BA 1CY1A 5H80A 1NKVA 2FEOA 3FFTA 4FDVA 4E5KA 3TB4A 4KVZA 4MEBA 1N6KA 1RS0A 3FMPB 4B6FA 3HDJA 3JQ7B 3SQWA 1SKMA 4LYYA 4QOHA 1O2DA 1K3TA 4B2YA 3K09C 3LCCA 3QU9A 3TPFA 4ZU1X 5JQGF 2OO5A 3ISJA 4UU7A 4WKOA 3ZE1B 4Q7KA 5L3SB 3ABRB 1PYGA 3NALA 5B3AA 4AIRA 4ZFNA 5A4JA 3BKWA 1A77A 2QAGA 3S2YA 3AXTA 4KVGA 3P9CA 1CDEA 2QSUA 1LU9A 5KQLA 4OHBA 1FFDA 1YB4A 1KJNA 2P5SA 2JIOA 3EOAI 5F5NA 4C01A 1XGKA 3GW8A 3VVMA 4GLOA 4BZXA 2JGEA 2FP3A 3QG5A 3TB6A 1XF1A 4UW9A 1UIMA 3H75A 2VXBA 4WJKB 521PA 3OQIA 3C8MA 3E53A 3WRXC 1D5CA 2Q9CA 4WERA 1G66A 3VHRA 3HC7A 1NMYA 2C8VA 2J9FB 4LE2A 4P5EA 3L43A 4J0KA 5FRDA 2OL4A 3K53A 2QVCA 2AXEA 4MHSA 5IF9A 4P0PB 2CD9A 5CM2Z 2Y67A 3L02A 1WM1A 3PKJA 1FX1A 2QZ9A 3CIFA 3QWFA 2WHYA 4MAAA 4WBXC 1DAEA 4FYIA 2J7KA 4XPIB 2DQ4A 4FE4A 3ZJ5A 1YS9A 5A6SB 3LKDA 4R31A 3ZXXA 4BNIA 3F6SA 3KZVA 2YVQA 3EXG2 1PT5A 1F8FA 4JLSA 5T57A 3RPEA 1NFQA 3BTOA 3SJCA 1A9SA 2JFOA 3L40A 2HJ9A 5JCJA 1V71A 5L53A 4P6VF 5FR2A 1KIAA 1FJHA 1OGIA 4RD6A 1M34A 2C0CA 4NEGA 3CCFA 5B2ZA 3TPZA 5AUNB 3AUAA 4OXKA 4CL0A 4G2NA 3NTRA 3QEMA 4LJ6A 1FP1D 2CNKA 4KXNA 4Z9BA 4LXUA 4YEDA 4E11A 4B75A 3SSNA 1T2AA 4I1RA 3OO1A 4KUGA 3V7FA 2W2OA 1T1JA 2O2XA 1XK6A 1AH2A 5BR8B 3QENA 5HM6A 3U4MA 3V8NA 1F8UA 4MA0A 1NZJA 4UKDA 3KXPA 2Q3LA 3MLEA 2NU8B 5A02A 6YASA 4LRUA 4AY2A 1U5BB 3DE2X 4WNIA 2PUAA 3AW8A 1YBHA 2DJ5A 2QUHA 4KRGA 2J7PA 4L0QA 1A82A 2J9ZB 4P22A 2CN1A 4KOEC 4I4NA 4B6JA 4EUEA 2SNIE 4IOMA 2Y93A 2OQVA 1NQVA 4DCOA 3BPSA 1JFFB 2Y1WA 3T3EA 3MFQA 4OHRA 3VOBA 3QVXA 1WXIA 2XWBF 1JIQA 3ZE7A 4BV8A 2I80A 2QD3A 4IF6A 1WF3A 1O6ZA 2W5UA 4G0NA 2VK2A 4NL4H 2D0PB 4CMIA 2YIVX 2NSJA 4PEVA 3T9CA 1EK5A 5KOJA 1TA9A 1V8OA 2JJMA 1PGPA 2XDWA 5DYNA 3QJYA 5B1SA 2PT7A 4R2MA 5E8JA 1Q7RA 1BD4A 1DHRA 2BT4A 5CBPA 3ERCA 3U7QB 5JV5A 3ESZA 4U6QA 4C0XA 3DQQA 4N3CA 1T8TA 4HDNB 4P9NA 1KARA 4L28A 3DEIA 3BXOA 3H65A 5LQMA 2X6RA 1T2EA 3EYWA 5EIAA 1G42A 2HAEA 3G2MA 4POOA 1V4VA 2FPOA 4GLBA 5G4LA 4F2GA 5C8YA 4YRGA 1JHZA 3JVEA 4B4VA 2H3EA 3N2NA 1S0UA 5B36A 4FOTA 4PBTA 1PL0A 5BSKA 2IPMA 3MBKA 4GR5A 3F9RA 1NJ8A 5K99A 1A9PA 4E22A 1LPBB 3EN0A 4UMVA 4Q0MA 5KQMA 4KU4A 5HOQA 3DCIA 2OBNA 4H35A 4E3WA 2NO6A 1AZLA 5I7UA 1P81A 1WY7A 4LNHA 5IAAA 4G0WA 4G41A 2H7CA 4ZVTA 3V42A 4J4HA 3EZGA 1TTHA 3HCPA 3DYVA 3NHMA 4HRAA 1Y8AA 1XIVA 1CZLA 4GMXA 4IDBA 3F97A 3LA8A 1SC6A 2C2ZA 2L2QA 3PQ8A 4RJTA 3VMMA 3V2GA 4B47A 1EESA 5AXBA 2AN1A 3AYXB 2H5IA 2I4LA 5KU7A 3WMGA 3J7AC 3D7MA 1G8GA 2O3TA 2HDHA 1CEQA 2HJGA 2WJWA 1TOAA 5CA1A 5CCEA 1AZTA 2A78A 3M81A 3T0IA 4MP3A 1XR3A 1YRQA 2BKXA 2O7QA 3FWNA 4RD0A 1YVEI 3RS8A 4WZ6A 1ISFA 1GFWA 1J2RA 1HLFA 2DG2A 3EEOA 2YQ5A 5B58T 3CLHA 5EINA 1TCVA 2O1EA 3SIXA 5DI9A 5J2UB 2I8CA 1N6LA 5DXAA 4KVAA 4I2VA 1PV4A 1H23A 5BPHA 3H11B 4KDCA 4F06A 3LPNA 1HT3A 1PL7A 2HI0A 1WXXA 2WE7A 4MV3A 5AI9A 4EX7A 3IEPA 5KOHA 1R0KA 2DBVO 2ZR7A 4OQZA 3KZKA 3M6LA 5CXSA 5ILQA 1NHGA 2C5LA 2XAUA 4BKOA 2JG3A 5B3JA 2JGKA 4PZZA 4C0LA 1Z08A 1ZA2A 4AWXA 4RFLA 4M1MA 1CP3A 3H13A 4JQSA 3FUXA 4MWTA 3ESQA 4QDTA 2GEKA 6GPBA 4XW2A 1ONOA 2QJWA 1TJ5A 3T7DA 4KBGA 4D9EA 2V8OA 5EZYB 4KREA 2CDNA 1S2DA 1U9YA 1EE9A 1PF7E 2VPTA 2BBOA 4LOJA 5DZSA 3EH2A 3PQCA 3L0CA 4OGFA 4IHQA 4WK0B 5AW0A 4G0UA 5HX7A 1UK8A 1EB8A 3K0SA 3QLVA 3TE7A 1HQDA 3CPSA 4YRNA 4IFTA 4PGAA 4RV4A 4ZOLA 3AR4A 5LD2B 2PZJA 2ZANA 4KNYA 3CYFA 4FOLA 1CY2A 3D5TA 4K9MA 4Q12A 4JELA 4PBSA 3CKMA 3EIHA 1S3FA 1PK8A 1A7UA 4TT3A 1CQPA 2CL0X 2Q6LA 4ZAVA 3U60B 3L7JA 5B58C 1MG0A 2QW0X 1SVLA 3GUVA 2K87A 3I04M 2EZUA 1PU2A 5B3KA 2YINC 1EGVB 3JQAD 3RC1A 3LCVB 3UGJA 5H81A 5CRIA 5IMSA 4I55A 4R2KA 2VJPA 4TTJA 1E2GA 1D04A 2F3QA 1QK3A 2Q3EA 1RQLA 3DMYA 3Q3HA 2IZ1A 5D7BA 5LXTF 3ZDEA 4CUJA 5CEFA 2QRVA 3CZ4A 4FFBB 5H82A 1LRJA 1OLUA 4YVFA 1G291 4BE7B 3MJSA 4R69A 5G0WA 4BC1A 4HNTA 2Y6VA 4UEWA 5CVJA 3SHWA 1SUCA 1UC9A 3PLAE 2BM0A 3LY8A 1UBFA 1HC7A 2WDPA 3COYA 1HFJA 1NG1A 4E31A 4DZRA 3GJ0A 4GRDA 4MARA 5GM2A 4D57A 4YV1A 4J1QA 1LVGA 2BFEB 1R3UA 2EGUA 2WZQA 1OJ7A 1IJEA 1GTL1 1XEWX 3RT1A 1GUDA 2OHIA 2I34A 2R6JA 4AWBA 5BR1A 3K70B 6AT1A 4KRYA 2XRZA 1R6XA 1C8LA 3FMFA 2PS9A 1JDNA 1YRBA 2HFJA 4P0TA 3USZA 3IOBA 4CEHB 4ILKA 1NUUA 2WNIA 5CM8B 4O2BF 2Z2IA 3AETB 1NY5A 2CW5A 5T8KA 3QY0A 2JFNA 3KV3O 2QEQA 3CRRA 5KNBH 1KR2A 4IHAA 1MIOB 5ALMA 3HCBA 3NIFB 1B6GA 3FETA 4JBYA 5JCPA 2UXBB 1Z88A 1VC2A 5HE8A 2QTWB 1Q83A 2WTNA 2JGMA 1Z74A 2AQHA 3RCBA 3UAVA 1KPIA 1EFHA 3E6AA 3DP7A 3IBFA 3FAKA 3W04A 1AGRA 2MSCB 5A3RA 1JT2A 4DT1A 4WKBA 1C7IA 2ST1A 4IZIA 4J2HA 2FN7A 4XDHA 4ZQHA 4E13A 3O1HB 3AZQA 4B76A 1AKTA 2G36A 1UC5B 1NDUA 2GCIA 4KQIA 4URFA 3FTCA 1ZI9A 1VP3A 1ZPDA 2OQIA 3QVWA 4O0LA 4U7WA 1D2RA 2BFCB 3AY0A 1MJHA 2YW9A 3HYTA 1SBZA 4CKEB 2QZPA 4G07A 3DEFA 3NDRA 2RAVA 1UT6A 2Y99A 3EEYA 4I14A 4CEJB 4LNUA 3KZOA 4KI0A 4P54A 1UDXA 2AG8A 3PGLA 1K08A 4NFHA 3R23A 1H8HA 4IXNA 1E6MA 4ZOAA 5D86A 4BVFA 2WNHA 5SICE 3LBYA 2XKBA 3NTVA 2BGTA 2QROA 1IATA 2JEOA 2RG1A 1ZVJA 2FPLA 3A1SA 1XALA 3ZIAA 2AKYA 2NOAA 4ZVUA 3FDFA 1ZMBA 3KOOA 1KI9A 1YQWA 1JUDA 2E5FA 3KWFA 1XJ0A 1TKBA 4LWPA 1DPGA 1TVCA 1NQXA 3OZWA 3ND7A 2QB5A 3NM6B 1A1SA 1KO5A 1XDWA 2OAGA 3DBHA 1NOIA 4EI9A 2HA3A 2XXAA 3NKLA 3I3OA 1E3EA 4FR2A 1G20E 2AG5A 1N4AA 2CMKA 1MV5A 1Q2UA 2CE2X 2IC5A 2R4UA 5K3SA 4I8DA 4NWIA 3U19A 3JW8A 1QDUA 4BX0A 4OSPA 3ORQA 5EXTA 1G6Q1 3WWCA 1YFJA 3BA1A 1X2EA 1ZP6A 3NVMB 4TLCA 3FSRA 4BQOA 3B1JA 4ARAA 5B64A 3E9MA 4WEOA 3TFWA 5C2JB 3DD5A 4O2LA 4DCCA 1J9ZA 3ILXA 5FPQA 4DPKA 2ZCVA 2JJYA 3CUKA 4TXHA 1D7OA 5L4SA 4Q4AA 3GGOA 3DBRB 4MYDA 2FOXA 3IPLA 3VDNB 3BIFA 3AFNA 5EJFA 4F3NA 1ZWKA 4WXMA 5JXGA 4OGGA 1U5CA 1Y8CA 1JU3A 1J24A 1NRIA 1NSFA 1S2MA 2ILVA 3AHFA 4TLAA 4JIMA 2QYTA 3C6QA 1MB9A 3CPJB 3N0VA 3GD7A 3NLLA 3O3CA 4HTFA 3VXKA 4A15A 1NNEA 3FI9A 3KQUA 3GAFA 3EGIA 1N2ZA 4H7EA 4YMWA 4CF6A 1C5KA 5HGXA 4JV5B 3NNDA 4BBPA 3D81A 1SR8A 3E0XA 2PL9A 1W29A 4K8OA 5DLDA 1CZNA 1JB1A 2K5UA 1AOXA 2DFLA 4MRVA 4E70A 2NTEA 3R77A 2HWKA 4F46A 4XUGB 3LKVA 5B4TA 5CB4F 1RRMA 3PUYA 1M8FA 1TAUA 1PJ2A 1KQNA 3OOYA 2WAXA 4G97A 3KTOA 5H70A 1V1RB 5DYTA 1VLHA 2YHIB 5DEIA 4NZYA 3U7RA 2X0RA 2PN1A 1ID8A 4QJ4A 2JVIA 3L9WA 3SN6A 4RELA 4DV3B 4W6ZA 1OYOA 4ZRDA 3OURA 1YQXA 1ENYA 1OX5A 1ZFNA 3ESBA 5LIPA 4OHFA 1NUQA 4XIYA 2AUTA 1V8BA 3IP6A 4KJXA 4XOIA 2YNMA 3GEGA 3EZ6A 3IIJA 4KLRA 2PJDA 3A05A 1FDOA 5A0FA 2GLXA 5KREA 2ZBPA 3QXXA 3OTIA 4TN5A 1P62B 4I1SA 1DJQA 1T2VA 1T29A 1BJTA 2VYCA 1PZFA 2XT9A 1WNTA 2IYAA 3A3YA 3RLIA 1FY2A 5CDGA 4L4RA 1QYRA 1YS4A 1HQCA 3ESRA 2ZRAA 3QOYA 3RYFA 3FOFC 2PUVA 2YRXA 2C2HA 1I0LA 4NBWA 2FW8A 3TVDA 3UB2A 1KOFA 2CE7A 4M8SA 2WUVA 3RUFA 4AIIA 4WX2B 5BRAA 1YDFA 3CZMA 4WLVA 1O9HA 3AZOA 2PKYX 1OLSB 4M49A 3V00A 4G4GA 3WMWA 2QYHA 4OATA 3CLSD 2BZSA 3QUBA 4RMJA 2QRPA 1GZ4A 3GLKA 1F8XA 1FFXA 1GQSA 3UUWA 6REQB 5DNYB 1DRUA 1MD9A 3RF6A 3RT7A 1SVUA 3QW2A 4JI3B 3TD6A 5H3CA 4YDSA 4AJEA 1L7RA 1UANA 3R3UA 4KGXA 2FGKA 2FW0A 2WUEA 3FBWA 1XV5A 3GWZA 5D85A 2Q7OE 3TINA 2LNDA 3AEZA 3AVQA 3V4OA 3MT0A 2VBFA 3AGPA 5DBHX 1P5ZB 5JFGA 3VYTB 3WK8A 1H0KA 4BNKA 1Z7EA 3KSRA 1VJ1A 2YIJA 3SCZA 3ZHZA 5JU6A 2XYHA 2N3ZA 3WDKA 1QE5A 1EDZA 1NPYA 2D5LA 2VUSA 5K51A 1PIWA 1DTEA 1QC5A 2LIPA 4KFRA 3IVCA 1E3SA 5LQNA 4U9HS 2PYZA 1MXHA 1OKKD 1WR8A 4TVKA 1DAFA 1DSSG 1NU8A 1TL7C 2QI9C 4JHXA 2Q99A 5EA2A 3GP5A 4EZBA 3TG2A 1RCFA 1V96A 2QRMA 5DYGA 4GI1A 4B3BA 2B69A 3BZBA 3OZGA 4M0UA 4DY4A 2B99A 1OB5A 3I8OA 1XNRB 1J23A 4Q1CA 1G59A 1XOIA 2EFGA 4ZRNA 3WVNA 4QHTA 3V8EA 2NM0A 1NT2A 2D06A 1UR5A 2I7XA 1II0A 3NHKA 2HGSA 1X13A 2FY8A 1E2UA 2FPMA 4JC8A 1AXEA 3BMNB 3TD2A 5JZSA 2WNSA 4K3UA 1EQAA 3DZBA 2XRMA 2VDLB 3H86A 4NK4A 2DECA 3UK7A 4MUEA 4KE6A 2NADA 3OH8A 5KUTA 4M1TA 1ODTC 3RASA 4PZLA 1O4WA 3PNMA 5HDQA 1RPAA 4B4KA 4EY6A 2ZEJA 4J49A 5KYWA 4FIDA 3ZHQA 2XB6A 5T64A 2NIPA 3SJ7A 2AE1A 1WMBA 1XAIA 1KMHB 2C42A 3U3KA 3LNTA 4LK2A 4POAA 2ZWMA 1XEAA 5D3ZA 2HCRA 1SBNE 3SFTA 3PB3A 4Z4HA 3CLUC 4ZQCB 4EKYA 3CHYA 4Q1EA 1MV8A 3PX3A 1EFVA 5AHXA 4NDAA 3UOWA 3JYQA 1EH5A 2OO5C 5K0NA 4KR2A 1DPFA 1VMAA 3OQJA 4B7ZA 4B6RA 4BKQA 3STHA 1O03A 4E3ZA 5FI3A 1HR0B 3KKKA 4P7FA 4CKXA 3ITEA 1TGVA 2Q9UA 3A4IA 1PQWA 3D8RA 5IC6A 4RA9A 4LJAA 4RVCA 4W82A 1Z5UA 5CU7A 2COKA 1FUYB 4BCBA 2GCEA 1O96A 1UBMS 4M76B 5JNVA 4UPVA 3SEFA 2EQAA 5IJ9A 3HZOA 2O4CA 3BILA 4RPCA 2F6RA 4YCNA 4ZTUB 2RHRA 3GXOA 4BNFA 3B89A 4GM0A 3LFTA 4OHOA 1A9TA 4OI2A 4U00A 1QP0A 1RI2A 3NGLA 3TLGA 1D2NA 3ABIA 4TN1A 3W3AA 4JLAA 5IVPA 3USCS 4LHEA 3PPWA 4N41A 2G3YA 1SXQA 3CV3A 2GCNA 1V7ZA 2HU7A 4FFOA 1RAFA 1VJ5A 5K05A 1I3NA 1G7CA 3VR1A 2ET6A 3QX8A 1L2TA 2P9BA 4BL5A 1W7AA 3JYOA 1CR2A 1SG9A 2GK4A 1T0PA 2Z4RA 3PE3A 3TFQA 3ZUGA 3I45A 1A96A 1KEEB 1U8TA 1OBOA 1Z6GA 3B85A 2ZZKA 5KBYA 3KFVA 4IS2A 2RBEA 4AUKA 3E9EA 5KKCA 1E3QA 2ZXFA 5HKKD 3AKCA 1DIHA 1L6IA 1NP6A 2CHGA 1NI4B 3A11A 2BR3A 5TQVA 1ZSNA 2RK4A 4HHEA 1Z2CA 1URPA 5FFNA 1DX6A 1M83A 3EVZA 5C8DA 2WICA 1J2TA 2WOJA 1UP7A 1XLTC 2FUKA 1JH9A 4N5IX 1H8ED 1WAMA 5FLEX 5FQOA 3F73A 3TCNA 3A1DA 3KHUA 4DR3B 5AICA 3WK5A 4OLHA 3HUDA 4U7DA 1MC5A 1G5FA 3DMNA 3MQFA 3PFKA 4UAVA 4UHBA 5HILA 3VR3A 3VU1A 1H3EA 2YHAA 5IM4F 1XNHA 2AR7A 1E5VA 1C0IA 4D4LA 5K8IA 4NKRA 1OASA 3RVJA 3THOA 1KI2A 2QLTA 3MC1A 3OIFA 3THWA 4CTNA 3GIDA 2YZMA 2HDWA 3ZCSA 1KSGA 2EFDB 5G4KA 2QP4A 3T0GA 2HQBA 3T61A 4EHBA 5FI1B 1UK7A 1SBQA 1VQ1A 3GGPA 3R7WB 3ZDYB 3C3PA 3OU7A 1MNQA 2C92A 2F9FA 1CQIB 2H48A 4ENVA 1KFJB 1W1IA 5DO9A 4NCJA 2DT8A 1LBHA 4BO6A 2UUCB 1QVZA 3FPFA 4CFSA 3LPMA 4HQ6A 2BFFA 5NLLA 2WBLC 2WD7A 4GP6A 3AVYA 2QT9A 2BFBB 1Z4QA 3K70D 1JWBB 3DXXA 4S05A 4AMBA 2H9IA 1KQFA 4MDFA 4P4SB 4I3FA 2WG2A 5JC8A 5A5GA 1VKOA 2VATA 4QJBA 1Z47A 4WVLA 4BGEA 2ZUBA 2J9RA 2Z6UA 5HJEA 1B2RA 3ZU6A 4FSHA 4K46A 1YOVB 1L9KA 3FHJA 2XE4A 3WK9A 2VZ0A 1R16A 1XQ6A 4BO3A 1N2EA 3SDSA 4BO9A 2QZZA 3I42A 3P71T 2P90A 1GN9A 2HMYB 4A5SA 3U7EB 3TM4A 4ML3A 3IX7A 3N2IA 3PUVA 3U40A 1I6WA 1VZ3A 1ZH6A 3GFBA 1F6WA 5THKA 1EXNA 3B8HA 1WD7A 1P7WA 3BXFA 2PTHA 3CNQS 4JKOA 4HXYA 4WI1A 4ND8B 3BEDA 3DFFA 4BO5A 1U81A 4BBJA 2E87A 3VPHA 4TM8A 3WB0A 3RUDA 4ZDWA 2HJWA 4FDUA 2H06A 4HWKA 5JS7A 3SK0A 1XMPA 3WBKA 5FWDA 4F8EA 1IYZA 2FJ0A 1X1RA 2V96A 4O4JF 3WNZA 4MR8B 3UUGA 4BKMA 3VH4A 4DWWA 5JSUA 3WYGA 2V7WA 2X8WA 1HDCA 1NKTA 2XADA 4MS3A 1FS6A 3JWPA 3PFGA 5ALKA 1NVFA 3PDIA 4AULA 1BG6A 3EXEA 4QRHA 4UTVA 2XTMA 1UXOA 3EC2A 3HCCA 3OM8A 1ES9A 3WV4A 1EUCB 2JLRA 3WFJA 4ZZIA 4UM5A 4FC6A 4ZCQA 3DT8A 4TOIA 1BQEA 2AFRA 4HDMB 2E4YA 3EA5A 2EIXA 3EWNA 1IPEA 2VJCA 3D9QX 4LBYA 3DE4X 4B40A 1QPZA 1U1DA 5TC4A 5HQ3A 6ADHA 2VF7A 1PZMA 4YT4A 3Q12A 3F67A 1NN1A 1CCWA 1E4EB 4V02A 5F2EA 3CH7A 5CVTA 5LPNA 4FYJA 2IV7A 1N2CA 1JMYA 3H5IA 5J2TB 1RYHA 4JR0A 5KAPA 2XOKD 5E1OA 5HEKA 1XU9A 3RH0A 1D1PA 1F3OA 1XZBA 1YASA 2J6IA 2XDYA 3D4IA 3RFXA 4LHZA 1WDMA 2PYIA 3DDSA 1E1CA 1IBSA 4IMIB 3HJGA 2FK8A 2HU2A 2W6ZA 2OWEA 3TPCA 2VYQA 3M33A 5CD9A 2SCUA 4MVJF 1MQSA 4MWBA 1CFJA 1I1HA 3N2KA 4RSMA 3PJDA 121PA 1F2UA 1JI3A 1T8WA 2WG1A 3GT0A 4GRAA 3EDOA 4WKNA 4RCZA 5DI3A 1ML3A 4U3JB 3T7TA 3TLAA 2JIRA 2GB4A 5BV0A 3PPIA 4P98A 3DDWA 3CRZA 4P4UA 3C7TA 2JFPA 3G85A 2G83A 2JAOA 3UYLA 2C2WA 2JHCA 5FTKA 4E03A 4OXNA 4HGOA 2CJPA 1TPZA 4PWYA 3OJCA 1QRDA 3ONVA 1NW3A 1GNTA 1Z7WA 1DT5A 2AFVA 3TZHA 1D2CA 2OLJA 4RQTA 3MWDA 1LS6A 3KZ1E 4GUAA 1BMFD 3M6FA 1WEHA 4XASA 4NV1A 3WJ1A 4C7KA 1CUIA 3JQPA 4TKMA 3TBKA 5ITZA 2JVJA 1SFRA 721PA 1IBLB 3E7WA 1Y89A 1VGRA 1PUJA 3B5EA 3QITA 5DM60 4DS3A 1KNQA 1KYQA 2A3NA 3I12A 3TRDA 1VPWA 3K5IA 1U2GA 1Y9AA 4EGAA 3QU5A 4DJFC 5ALTA 3HP1A 1KL7A 2ECQA 3OCXA 4H3KB 2ZI6A 1O0SA 4H1VA 4LMBA 3RFUA 3WHLA 4HGQA 1KAOA 1ZH2A 1JYFA 2JAPA 3R76A 4B81A 3WJ2A 2AWOA 2R8XA 4GZ5A 5A9SA 4XKJA 1BX0A 3PWTA 1X92A 2I71A 2QRKA 2WF8A 4LOHA 5TF0A 2F59A 3O1JC 4C7MA 5KIAA 3FKQA 1W34A 5HW0A 3GMTA 1TVKA 2G0NA 5B1YA 2TMKA 4DCMA 4AP9A 2P9EA 4YXWA 1EEHA 1NVVQ 3BX1A 4HZGA 4IIGA 4OOFA 1IH8A 2C7BA 1WO8A 1YK1A 3NKVA 4HC4A 4QHYA 3PYLA 4DMMA 5D87A 4MP6A 2XYQA 1ECJA 3QYAA 2QP3A 1JU9A 1TADA 2Y66A 3LPDA 4BQPA 1RXYA 4UJ5A 4CG2A 1CIPA 4EI2A 1TJYA 2V7VA 2DUJA 2YWRA 2GFIA 3CFYA 3GPBA 1IY8A 1ZH4A 1ZNZA 2IOFA 3CUUA 2OLKA 2F2TA 3KD2A 3QOWA 1EYZA 1N5DA 3A6PC 3TDNA 3WLIA 3OTGA 4J8PA 2R2AA 4M1YA 4A5OA 3VR0A 2QRLA 3H6HA 4ZN6A 3LXRA 5C52B 5CA0A 2QSJA 2GM3A 3LP6A 3ZHYA 4Z4EA 4NAVA 3V55A 5BNWA 5BN5B 4YR9A 4X24A 2FG5A 5T8KC 4QLBA 4RACA 4C4XA 3VKGA 5HKOA 3UT6A 1WU8A 2C0QA 3A0UA 3FGOA 4R98A 3OUTA 4DCJA 2X2EA 1N6PA 2FE1A 3OETA 5DBGA 3DHNA 2PZLA 5I01A 3R9WA 5FF9A 1A04A 2WIAA 3DA8A 1F7VA 5I51A 2E5LB 3N39C 1H2ZA 2G9QA 3CZ9A 3BM5A 3IEIA 2WWXA 4M1KA 2BMDA 2AFHB 2PSFA 2PVPA 2G80A 1QQ5A 3ICOA 4J0FA 3AL0C 5D51S 1Y8QA 4NPCA 1E5QA 9MHTA 3F6CA 3AV0B 1QLHA 4WXPA 2DX7A 3LY5A 2VHTA 3PUKA 4X00A 5AM5A 1E20A 2O52A 4AJIA 3N87A 3IVGA 3Q2KA 4DUYB 2O0JA 1BWPA 1C1XB 1KO4A 1X8JA 2Z2YA 3JTEA 3VR4D 4HV4A 4GU5A 1KR5A 2LRHA 2ZROA 4EGJA 4ZYLA 1TO6A 3GRRA 1F5NA 1JR2A 2BHLA 3G49A 1I2DA 3PWKA 1E0JA 4TTTS 3I9KA 1C29B 3A1VA 3EZLA 2C2XA 1G2IA 4EW6A 4RZQA 5JTTA 3WK4A 4DLVA 3R0IA 2D1TA 3I39X 4PYLA 4DQ0A 4CF7A 3IELA 4HH1A 4ZC8A 4S2EA 4GBED 4MUYA 1Z7GA 3ZBQA 3R4CA 2G17A 2IQIA 2GR9A 3SQNA 2A67A 1IY0A 2VH1A 3WRWA 4PX3A 4XUEA 1CNEA 3RSQA 3LM8A 3IBTA 1IUOA 1QG6A 1KFEB 1SZPA 4DYVA 2D7DA 1TCAA 1J2JA 1E2QA 1FDUA 4UHDA 1GPNA 1JG1A 5HCNA 1H94A 4LWQA 4X1IB 4CF5A 1G38A 4HF7A 2O3RA 1SEVA 2FFAA 1YMVA 5TT1A 1H85A 4XGKA 2FE4A 3FAZA 1JKIA 5EWMA 4Z49A 2GCPA 3AUXA 1UIRA 3GYGA 4BN4A 4CLRB 4G0PA 1G0OA 3D8UA 4DWOA 1ZD1A 3N7UA 4EH1A 4RKRA 1PN3A 4DA7A 4RM2A 3L0PA 2XNKA 1OT5A 3RJ5A 1L5KA 1RZUA 4PPQA 4XQ0A 1JW9B 1TO2E 4PG5A 2UZ1B 1O89A 4P32A 4OIFA 4EZIA 2O8CB 4BX3A 1B3RA 1CRLA 1WL8A 1KH3A 1GZSA 1IULA 2YZ2A 4R8RA 5A3QA 3ANMA 3WIEA 1T4MA 5T3UA 3R9XB 5IKMA 3F6YA 3JR3A 1MBZA 3AEUA 2JCSA 3OU2A 3L7LA 4V2UA 4XUDA 4DXAA 4MWOA 3E5MA 1QM5A 3H5OA 4MB2A 1IXKA 1MMFB 3G17A 4MVJD 4OK6A 4OM7A 1LTHR 2QMZA 2QRQA 4UEKA 5T6BA 1N5IA 1D1SA 1P1FA 1T6ZA 2VS1A 2Q21A 4IPTA 4NBLA 4ZJUA 1E96A 8MHTA 2HNAA 1ORTA 2QTGA 7GPBA 2P2LA 4OFBA 1IJFA 4CM8B 3DE7X 4EG1A 1NE7A 1OMOA 4X90A 5E6RA 1JEQB 5FLYA 2GH1A 4FCCA 2EHDA 4GI2A 2ZSFA 2O1WA 1KQ3A 1EWKA 3VDRA 5A05A 8OHMA 1ACLA 2B7LA 3JD2A 2FETA 4JN6B 4EKDA 3DL2A 4TKVB 3ZGXA 4YMUA 5ENZA 1HG1A 2QRUA 3KJEA 1T9BA 3T7CA 4C7OB 3EZNA 1H2RS 4BLTA 3GDHA 3IEVA 2E2WA 4NABA 5KCZA 4Z4IA 4FR0A 4UNNA 1YZHA 2QTTA 4IM7A 5CGZA 1Z22A 4R7TA 2BGIA 4CL3A 4HYTA 4UQPA 4CU5A 1IQ0A 2JBHA 2V1UA 4MWZA 4A16A 5IANA 3K0KA 1KWKA 4IG9A 2B8WA 4K6CA 3AF4A 3P96A 3KQVA 2TRSB 3HUEA 4O4IF 1QP7A 3HDQA 1TAGA 3BQ9A 3W5JA 1O3YA 2NSDA 3R0JA 3EQ9A 1X0XA 5T67A 1Y8RB 1JBQA 2MDTA 4D56A 4J9UE 5JSKA 4IO1A 1C8VB 3UMCA 1DQNA 4DUGD 2Y05A 3H5AA 3N2LA 3V6LA 2BDTA 1AA6A 1WNFA 2GZHA 4TZKA 2VWHA 2WYUA 4R1TA 1IVNA 1BKDR 3NJ4A 4Y6PA 2VTBA 3OLXA 3ETEA 2HWXA 3Q3IA 1MB0A 1ZXXA 5K3AA 2ZWVA 1SUWA 3NHSA 2JFYA 5CDYA 4NU0A 1OYVA 1N34B 2B3DA 5L8VA 4NZPA 1K6MA 5E6SB 3DKRA 3LWNA 2EKQA 4TXLA 4EJFA 3GMSA 3AWDA 5CYOA 3GBVA 2IIPA 2NYRA 2RGEA 2GXQA 5BT9A 5EHIA 2ORVA 2XUPA 1KAEA 1BYUA 3KQTA 3GLUA 2AHRA 3VPAA 5F3DA 1GVNB 2BLLA 2AW3A 2WWIA 4WHMA 4QYIA 3G2HA 5HJ2A 4QPNA 3LW8A 3O8DA 3O8OA 5JOQA 1Q7EA 2MU1A 3ITKA 1DE0A 2BR4A 3GJYA 3DAFA 3HYNA 3JCZA 1HE1C 3O4RA 1ZMOA 4LQDA 4RTJA 3M6UA 2ZUFA 3EBLA 2G7MC 3VU8A 5CDFE 1Q21A 2L19A 4HH0A 2GYVA 1RWNA 1W4RA 4LK3A 5BMOA 4D0RA 3IKTA 4O2AF 1NT4A 1N2JA 3EDQA 3L82B 5K0ZA 1CZOA 3QEKA 5HFJA 2Q49A 2IPXA 2YY7A 1AK2A 2V6BA 4C4SA 1UMBA 5ALDA 1G9XA 2OLEA 2PM8A 2AJDA 2QQFA 2Q2QA 4G5RA 1V5GA 4I50B 3MWEB 5CX1A 5IDQA 1TO1E 3FOZA 1PWZA 2FSHA 4KZPA 2HU8A 3FPLA 2ATXA 3TEMA 3AM3A 4RDIA 4DN6A 1UJMA 2PH7A 1KIFA 3TRKA 2OD2A 5A6VA 1ENPA 1TA0A 1GRVA 3OI7A 3ZPXA 5KYXA 2VUHB 4R3UC 3KVOA 3C48A 1NAHA 3AZPA 4I5DA 5TR9A 3ZDFA 1ZN2A 2VDWB 3RVMA 5HM8A 4RMIA 3WL4A 1B0ZA 2NG1A 3IV6A 4REOA 4HS4A 3RTCA 2WYVA 2JLAA 1D03A 1SVIA 3AFOA 4RMNA 4U6SA 1VE1A 5LU8A 3P26A 1OAAA 1RWPA 2P9JA 4NMHA 1H2BA 2BGRA 3TTVA 5EJ6A 3OFJA 1LSOA 3REFA 5FNZA 4EF5A 1QGUB 3KQKA 4IX9A 3LOQA 4CV0A 4MR7A 3EMBA 1EFRD 3WP0A 4QBIA 1V16A 3BT7A 3G2KA 2BGNA 2OFPA 3TW4A 3VR5D 1DEOA 3W2FA 1X7XA 5ED0A 3V8QA 1JXAA 1ONSA 2VEDA 5EWJA 3GLFE 3U81A 2AZTA 1P1IA 3QZUA 4Y1RB 2ZIUB 4MO9A 4L3OA 3DWGA 2WIDA 2JFUA 1S2NA 4KYIB 4XB2A 2JI9A 1QWSA 2XT0A 1W94A 2OCAA 3DNMA 2IOHA 4GT1A 4O4LA 3NW9A 3WGKA 4PRYA 5IS2A 2QTVA 2HPZA 1ZHFA 1OBFO 2RIRA 3ZWXA 4URXR 4MVJH 5DEOA 2RC6A 2ICAA 3HUUA 3S28A 5JTUA 4X6XA 5JJ5A 5HWSA 1W4LA 3PWSA 2DEUA 3KBBA 2ZE8A 4ZVQA 4YAUA 4EG7A 1X77A 2ZQYA 4IQ8A 5DT2A 1MO2A 3JASA 1XTUA 4LI0A 1KO8A 3LYUA 1N36B 3BHIA 4JC0A 2FPXA 4V03A 1GDTA 2DAPA 3VSBA 3U1BA 1FTWA 4GPEA 1RADA 4UNPA 4WFIA 4RQUA 1Y37A 3HEMA 5GM1A 3FGNA 2WMYA 4MTLA 4JI1B 2ONJA 2X6TA 1F7UA 1YV9A 1ORRA 5FLKA 4EO4A 4V0KA 1ZUNA 2YV5A 5KYYA 3CX6A 1BHO1 2QLJA 3K1AB 4BE4A 3U9SA 2COEA 3B3AA 3RVPA 4YRJA 2ZYAA 1U90A 2QHXA 4XSVA 4GMFA 5BN4B 1IM2A 3DKIA 1G8AA 1KYYA 4Q93A 1M74A 3ZWCA 5JSZA 1WP9A 4QLAA 1E9FA 5JBNA 1CF2O 1UBUS 1Y3DE 2IYWA 2VO1A 3L6UA 1TM5E 3U44A 1H4VB 1NQOA 1KZGB 4R0MA 3Q5DA 4K81B 2JFGA 4N4AA 5ED4A 1AKUA 2DFKB 4FWBA 4EKGA 1XTZA 4MLCA 4ER7A 4HNGA 1IBMB 2GEUA 2OCDA 3HPRA 5CFOA 1W88B 2HV8A 3H5NA 4HI0E 1K63A 2A9VA 2SKCA 3BKXA 4L75A 4PG4A 3R6WA 3M1LA 1RQPA 1RYZA 2JI6A 4PQRA 5BMVB 1HNNA 4P7GA 4N1AA 3ROGA 4XFJA 3CJTA 1Z45A 3ITNA 4FNMA 2PRJA 3PHCA 1QZUA 4RKWA 4HNVA 2BYTA 3ZK9A 1XYGA 1ZN9A 1MNAA 2A3RA 4KQXA 4RTRA 2QN1A 3BFXA 2PGLA 2PQ2A 1E1KA 3DL7A 1I5OA 3STUA 5JJCA 2V7TA 2A7QA 3ZY3A 2QVZX 1WMEA 4CKBB 4JKIA 5KYGA 5GIPE 1E1RA 4UU8A 3BJZA 5K4AA 6PFKA 3DAPA 1SZCA 1VCIA 2FSVA 4OFXA 4Y2PA 1RIFA 1YZGA 2CHUA 1A4UA 5GJWC 2LCIA 1RZRD 4B4DA 2IRWA 2XCQA 2QLMA 4KI7A 4M6WA 1JQ3A 4N8DA 1TXGA 1ICIA 4KQCA 1VL2A 4RZSA 3SIPA 3EXG1 4WESA 4Y9UA 1NMQA 2V03A 4FYPA 3WKDA 5AVRA 4D4IA 2Q46A 3R3JA 3TW8A 4LMPA 3CG0A 3EGDB 3QP9A 3MMNA 4MW5A 1XD8A 2FW1A 3FYTA 5HA5A 2ILTA 4YGXB 4AMVA 2Z8YM 4JLVA 1USVA 4JVLA 4WNAB 4MQUA 4GE0A 3KYCB 3COPA 4RZXA 3P2YA 3AG5A 2BM9A 4IUBS 5FUVA 5K2OA 2O48X 4OL9A 3FIUA 4A8JB 1YE5A 3DBLA 4W5JA 3JQ8A 3MJDA 4TMZA 1NC1A 1JJAA 2DHEA 3A3OA 4J1SA 3DUFB 1CYDA 2VSFA 3OD5A 2AT1A 1JEAA 3PS9A 1OV4A 2W43A 3DBOB 4FEAA 1J8MF 5BOSB 2LE0A 1MO4A 1X38A 2NYVA 1FK8A 2WRZA 5E9WA 4KXYA 1W5SA 3RVDA 4X60A 2RHCA 1PNVA 3KXDA 3F49S 4RK4A 1R9JA 3UAGA 1H0SA 3Q88A 4Z4GA 1NPDA 1KE1A 1QVWA 1N1EA 2NTYC 2GWHA 1H4SA 3DTVB 5CJ2A 2R1ZA 2X5NA 1XAJA 3C8ZA 1P0QA 1UZAA 2QL6A 2VRNA 3GFTA 1HBJA 2DBZA 3LKBA 3PI7A 4XSGA 4DLBA 1H3NA 2X0IA 3F4KA 1AKRA 2HMUA 3LVQE 1DEHA 4BHTA 2EZ8A 4WNCA 2QAGB 1NBMA 4BNDA 1EZ1A 1M2JA 4MAFA 1SBHA 2WUFA 3OOHA 4II7A 3VR5H 5GTDA 1IPHA 5HTOA 1Y4ZA 3JX9A 4JJFA 3OJLA 4TMXA 1AM4D 2QV0A 3HABA 4YMIA 5L7YA 3F3KA 4L07A 4L6CA 3IQFA 3UGQA 5K09A 1WUHS 3O47A 3L0IB 1WCYA 5JVDB 5JXWA 5K8CA 2IS1A 3P1JA 3OQIB 1TMYA 3QA3E 5AW3A 3OZEA 3DO5A 3TTXA 1QG4A 4FFDA 1N9GA 5K3FA 4YMVA 1DQZA 4F3CA 5C3MA 1O9GA 2A7XA 5JNUA 2VKQA 1FUIA 2PMEA 3QTLA 1SKYB 2YIDA 4CU2A 4BO7A 1N3IA 5ECGC 5T7BA 3HDGA 1V3VA 3IAS1 2D5IA 3KT0A 1MPTA 1NN3A 1K8ZB 3DE3X 1RPZA 3FKSA 3DR3A 5DSXA 3OT5A 4P34A 3U17A 3GRUA 5EAIA 4BGDA 4FYXA 2DWOA 4IWXA 1Q74A 1E2FA 3IBCA 4Q3DA 4TMWA 4B3HA 2WUWE 3EQ2A 5D3MA 3IQGX 4RZHA 3B12A 2OESA 3C2QA 1SVSA 4RSHA 1RJFA 4HSGA 4LSMA 5EUBA 1N57A 4ZHQA 1XMXA 1U0FA 4MQ5A 4YQEA 1TJ3A 1LWOA 3G2PA 1D6JA 1EU1A 2B0CA 2C9YA 3IIEA 1LBIA 3HZZA 2HXSA 3EDRA 1N5MA 4JLNA 3QEMB 3X0DA 3FRJA 1LRKA 3A9CA 3LTNC 2YWJA 1KAMA 1YS7A 4FW8A 3H0KA 4P80A 5C31A 2P35A 1BH2A 3UAWA 2C7OA 4JC4A 3LF2A 1NQAO 4S0ZA 3ROMA 3KE9A 1XPUA 1Z83A 1UT8A 2AFIB 1B26A 1Z6XA 1EX7A 1GNPA 2ZDQA 1NRJB 2XD4A 2ZBQA 3C15C 4JA2A 4MS1B 4NP6A 2Q1YA 4OOEA 5AH0A 3TXAA 2OFXA 4BU0A 3I5YA 3OKPA 1U2GC 2FEPA 2ZSAA 4WFQA 5AQEA 4PSKA 4MVWA 5JCXA 1TAHA 3RVKA 1GQYA 2C4KA 1C80A 4R4JA 4LRSB 3P0FA 3TQQA 1GUZA 3GQBA 4GOKA 4HAZA 1CS0A 2C4TA 2I7DA 5TQ2A 1RYYA 1K5DA 4Q3EA 4DCUA 2MYNA 4BASA 5FL3A 5LZ7A 3W5SA 1UDBA 2OCGA 2ETVA 4JYMA 4KQFA 4DM3A 1FLDA 1IRIA 1Z73A 2FPIA 4HOYA 2AE2A 5L3ZA 1YA8A 4GC9A 5JASA 2WJ6A 1OWPA 4CMIB 2EEPA 2CJFA 3GFPA 3M70A 3F0TA 1RZVA 3IMGA 5ECDA 3VI4B 2FFQA 3FJOA 3OA0A 3Q0EA 4M0CA 4P08A 3ZDXB 1PR3A 5JW6A 2WAMA 3K16A 1RM0A 4YP7A 4WK6A 2ECKA 3GEIA 1A5SB 5BSRA 4ND2A 1MH9A 2VJLA 3CBQA 5EJGA 3L77A 2G0AA 1Z38A 1P3DA 4ZQEA 1HO3A 4ZT6A 1MOQA 2GPYA 2XB4A 2GHRA 3JQRA 1X7ZA 5AKJA 4NOJA 3RW9A 3LL7A 1PGNA 2WFLB 2J3JA 3H5VA 4BNGA 3HI6A 3T7RA 1C30B 1Q3HA 1UWVA 2EU8A 2WSYB 3BXEA 3BSYA 3E2MA 5HR5A 3HVKA 3GOQA 3CGGA 3D7SA 1ATIA 1ZGJA 4FFVA 4QJIA 4AYXA 1EBBA 1X0VA 5AW8A 2PUEA 1KI1A 4J43A 1E92A 4EBFA 3VDQA 1YKSA 3ORFA 4R9NA 1C0PA 4MV8A 2ZBGA 3OFVA 5KX5B 3BA6A 3QPBA 5FO1A 3G2LA 1Z4PX 4JJGA 4BMDA 3DXYA 5AVYA 1RRCA 2Q41A 3D6TB 2BI7A 2QI9F 3GFFA 1XL0A 3O8QA 2RGUA 2A86A 1TGYA 5FOTA 2XMDA 3CMMA 5FWXB 1GVHA 2DE0X 1PTKA 4IYJA 2XMBA 4AMGA 4OXRA 3ZDDA 1P7CA 1OTYA 3AERB 3PFHA 4QODA 2EVWX 4HYQA 4DMFA 4L72A 2TECE 2FFBA 2QW1A 2XB8A 1UQTA 4L8GA 2H51A 2N9UA 4B73A 4D3SA 4KLNA 3OC6A 4EY4A 1GPLA 5ALVA 2C1EA 3WL3A 4DREA 1BHSA 4G1BA 5F7JA 4M1EA 1OC4A 4KCGA 1PAUA 2W71A 1J4AA 1XKQA 1I4EB 5FQNA 4E51A 1YZ3A 5DRTA 2WKRA 2XTNA 4GPAA 1QOQB 3HLKA 2CCKA 4L27A 4OLAA 4FBLA 2RSLA 2CXQA 1X74A 1GG8A 1T2UA 2BCGY 2D1SA 3AVUA 5A0VA 3T7JA 1TPYA 2ZR0A 1BN7A 2XCOA 5DM1A 3NWJA 2IP2A 3HWWA 1OHHD 1JKFA 1X7DA 2A5LA 3CJRA 4YASA 2B8NA 4BNWA 4CLDA 5FP0A 5DRYA 1G21A 1A97A 2QRJA 4MLZA 3CWQA 3YASA 5KSZA 1YVDA 1B8PA 5FPPA 2X3FA 2QQ0A 1VBKA 4LDNA 4XCQA 5H5JA 3ETNA 4TSFA 1A9RA 4V0SA 4I4TA 1X80A 3IT2A 1N0WA 2CLHB 1U8EA 3HO8A 5CPBA 1AGNA 1WHTA 4WV3A 4MUFA 1NXTA 2O0MA 3L7BA 3VC7A 3COJA 4NOLA 1QGOA 4BZWA 1DS6A 4LBWA 4A2PA 2FPUA 4M3NA 3MTJA 4UM8B 4ER3A 1JHRA 1FSSA 5JUWA 5IYZF 2XNDD 2Q5HA 4NR0A 2VR1A 4YAGA 3S6JA 5AVSA 2F90A 2X14A 3R41A 1J0CA 3IVAA 1GGHA 1VP9A 4ENQA 4JJZA 2UZIR 1RZ3A 1XPJA 5DOVA 4CIXA 2DR3A 5JR3A 3NBMA 2XCSB 3HDYA 4MWCA 4UARA 1Y0BA 2Q8QA 2XITA 3JAWA 4X7PA 4QNMA 5IJXA 4IH1A 4TV8A 2H1VA 1W44A 1AURA 3O74A 2VNSA 4F4JA 1H9CA 5EYPA 3OY2A 1D1QA 1TI7A 4O2BB 4UEOA 1S3IA 4ZWNA 5AD1A 5EXSA 1UZUA 2BHSA 2IT1A 4QIHA 5IBCA 2N75A 4JA0A 4D02A 1RWMA 5IAEA 4WLOA 4G5HA 1KEUA 2N1BA 2IA5A 3H2YA 4LXQA 3K9WA 1F0YA 4TTQA 2DPHA 3IGFA 4PLYA 5KMGB 3RTAA 2WLSA 4CM4A 2SKDA 2Z3WA 5CMLA 5EMNA 1RXVA 1BXKA 2BHRA 5HKBA 2GHQA 1AKQA 2QGZA 4W9NC 4IFEA 1UKCA 5IJWA 2HWYA 1KVTA 3HVHA 4JJ8A 3FCSB 5L3QB 3ZDBA 2K2WA 2FN9A 1XELA 2QG4A 3MNFA 2HR1A 4TV9A 2GAFA 2JCGA 1SCBA 3OFND 2W90A 2YWXA 5DHQA 4X91A 5KQRA 2C88A 1F3LA 1TFRA 1XTKA 2H0RA 3UB3A 1JDBB 2EZ9A 3I6IA 1GV0A 4PQGA 2FWIA 1MZVA 2I2FA 2W11A 3ANXA 3WGUA 1ARZA 2VUUA 4CUZA 4AZ3B 3K8OE 5G53C 2IH5A 2H4FA 3ETLA 1F48A 4PIPA 1YC5A 1SULA 2KM1A 1J2EA 1SC1A 1SELA 3OE7D 4FT4A 1WDWB 3LFUA 1TD9A 2VI5A 4K9QA 4E4TA 2GN9A 2C95A 4OUKX 3TSWA 3EVTA 2CLEB 3QQ5A 4E5PA 4AY4A 3JARA 4TT8A 4DT1B 1JXMA 3QU2A 4BMVA 4X41A 1PZHA 3VV3A 1H4TA 4HLCA 4KPGA 3J80A 4BZPA 2ZIEA 1B0AA 3N6XA 3Q2OA 1BROA 2EGGA 5K8JB 4LHYA 2XLCA 3CF4G 1YJ8A 4HDQB 1GCUA 4AY3A 2B37A 2QTNA 2OUKA 1POXA 3ET5A 5SY9A 4LNUB 2OC9A 3Q10A 2AXNA 2VP0A 4TUYA 1Y7HA 4JJ4A 4P4GA 5TQJA 3HYLA 1BN6A 1K88A 1ANKA 1SWWA 2R6CA 3UV7A 2OM6A 3PRKE 4TXNA 2QR3A 3OD1A 2VTEA 2W0SA 4ZPXA 4KGZA 4B48A 4QBFA 3LT0A 5C8YF 1W36C 1RC1A 1GEGA 3EBOA 4MI6A 1X7GA 1VL6A 4XD7A 2VN8A 4GDMA 2XYVA 4WZAA 2YCLA 4DG5A 2RDMA 1AO3A 4NDNE 3AI1A 4PYIA 4IX1A 3T12A 1SD5A 2A9OA 2WG0A 2RB4A 5U4XA 4KACA 3ISVA 1ZCFA 3S29A 1BGWA 1L9XA 3V7UA 2NNLD 1KS2A 3HBNA 4H60A 5A2QA 1C9MA 1J6UA 1P1CA 1TUGA 1XFAA 2JIDA 4L78A 4NBVA 3LW7A 4LCEA 2VT6A 3ZTWA 1NJ5A 2EP8A 1P9NA 4FGLA 2TYSB 2BFWA 2ZITA 3JVIA 1U63A 4R8MA 3K0BA 3I6BA 1UINA 1VHLA 2I2CA 4GH5A 4R8VA 2PH1A 3L0ZA 4GICA 4L0CA 4NECA 5IAOA 3MGBA 1XA0A 2IKQA 2W6JA 4Y30A 1SB9A 1P2GA 3DMPA 1ADYA 1RXIA 1E9RA 1DTWA 2I2XB 1JHQA 2VQ6A 1N5KA 5CA1F 4LF7B 4MI1A 4PTZA 2B7BA 1S89A 2I29A 2HQOA 2JFVA 2J6HA 2H7VA 2VT7A 3KQWA 4GPIB 4NMLA 4YRRA 4C0KA 3BMOA 1RKVA 4JP8A 5ITWA 2YH2A 2OHXA 2V59A 4ETIA 5BQOA 1E4OA 3HJNA 2GCGA 4ETWA 1AUPA 1PR5A 3QUAA 4V0MA 5CXXA 3W5BA 3BCRA 3CZCA 1ONNA 4ZV7A 3BWEA 1JG2A 5DTMA 1F0PA 3GVCA 4QUDA 3WLFA 3QFCA 1UJ5A 4RD1A 3KJNA 4OXQA 1SBIA 3CRNA 3ICCA 4UU1A 5GWXA 3RE1A 1R2QA 3AONB 3CLUD 3M82A 4O1MA 1HTTA 3S81A 3SBEA 4E07A 2EWWA 4F6RA 1U8AA 2GNPA 4BVBA 4YY3B 1KZ6A 4K05A 4YNBA 3WICA 1ZCBA 3G7SA 5HPYB 1ZGGA 2X8LA 5ETJA 1BVRA 2B78A 3I4FA 1G3IA 2XRFA 1Z0AA 3NPAA 4FD2A 4UJ3A 3T3PB 2RAFA 3L7KA 2O8EA 1GZ6A 1X1DA 2YMMA 2QT1A 1VIAA 1T4BA 2C98A 3DPSA 4PCLA 1KQPA 2PEYA 3ENVA 3K2IA 1NTOA 5CBKA 5IJ0B 3TUZC 2PUBA 4N8EA 2IITA 4UFPA 4Y9SA 4G5YA 4ZOLF 2R9VA 4BFCA 1L4LA 1GFZA 1QBGA 3AHCA 1NI5A 1Q3TA 2D7CA 3SSAA 4C03A 3O4IA 5IDVA 2PS0A 5D5HA 2CWWA 2GZ2A 1Y4SA 2P5YA 2MR5A 3VDMA 1LA2A 3LUPA 3L0BA 2WU4A 4RC9A 4A0HA 2UYGA 2CV0A 2I91A 1GILA 1VLLA 4F0JA 4EHLA 4FOSA 3AJ9A 4EB6A 3DOCA 5EXDA 2EFJA 4PSDA 1U8XX 3ONWA 2WOOA 3GB9A 1IEVA 4ZO4A 1WDKA 5MFZA 2O8DA 1EVYA 1W73A 3OAAA 3FROA 4HNRA 4ITUA 5REQA 3UG7A 2C7PA 4YYEA 2A58A 2C5FA 1ULSA 4K9DA 5EIFA 4Z4FA 3LUJA 3QVSA 4I55F 3PNQA 1KOLA 3RQIA 4AD8A 2ZJ2A 4C6SA 4Z9AA 4LZLA 2H1FA 1ODJA 3WZLA 3R7LA 3DB2A 3GPCA 1YF3A 4FDAA 2ERCA 1T0JB 2JAQA 1U8UA 5JCJD 4N0PA 1MXFA 1NXSA 1ZGAA 2Q0XA 5CB6A 1NOKA 4HDSA 2P0AA 4EPRA 4X85A 3RADC 5FOQA 1J8VA 3AOEA 3H9CA 4I9HA 1JLMA 2WM3A 1CUWA 2DMRA 2WWFA 2WVJA 2PGIA 4U5QA 4UEJA 1U3CA 2VPZA 4Y1FA 1JR4A 1SQSA 4PGMA 4HEQA 2WJJA 1CJCA 1MP0A 1YJQA 3EF0A 3MMZA 4LEIA 2GS9A 2J3KA 3AB8A 3RJMA 3TTUA 1I36A 1ZGCA 3FMVA 2F1IA 4K6HA 4HX9A 2H31A 1QHSA 4QXAA 4RFSA 1KBOA 1BA3A 3C6ZA 2YV4A 1T36B 1T4CA 1XZIA 2J7PD 3N3BC 2R0QC 3ZWNA 3ZQKA 3J81k 2V58A 2VUTA 1U7OA 4JEUA 5K3EA 2G0TA 3FLBA 2TSYB 3SM9A 1OU4A 1MA0A 1P2UA 5BUQA 3QVGB 3UENA 5AKYA 4UAUA 1NJ6A 1GPDG 2DKOA 2HTEA 1IIRA 4G26A 1DFHA 3WLKX 4CKCA 4ZMSA 4XRRA 1NATA 4JOSA 4QVIA 1A4XA 3B13B 2RFLA 2ZUWA 3QE0A 2WVHA 4N5MA 1WSAA 5BXQC 2RGWA 1P91A 1J0BA 1AMOA 5ELXA 1OIWA 3FNHA 4MW6A 1LF5A 5EL0A 4YRAA 3WAGA 1DWQA 3WGIA 3GRYA 2RGGA 3CX8A 2QNRA 4FHCA 3L8GA 4TVSA 5HIJA 3IHKA 5K03A 2PX8A 1A98A 2V6FA 4P3YA 3NWPA 4ZXFA 3WGMA 3W79A 2QMHA 1U2DA 5F52A 5BPFA 2UZ0A 4Q3AA 1Z5NA 3SF0A 3GA0A 2NZUG 4S1NA 1HL3A 2AV6A 4QM7A 2EKDA 3NT4A 2ESRA 1V8ZA 3W06A 2UUBB 4FEEA 2R6FA 4OP2A 3N5KA 4IUCS 4QXOA 3EQ8A 2YIMA 1DP4A 1EX9A 1K5GA 2HREA 2VKTA 4G85A 2FLVA 3O1IC 1I7SB 1PQUA 3I6QA 4XGNA 1B23P 3KOUA 3ON5A 5G3YA 1F17A 3B51X 4AMUA 5KYWB 3WBFA 2E9SA 2UYOA 1V11A 2GA9A 1EGHA 3SKXA 5DISB 1J7KA 1FU4A 3LDAA 4EY5A 1V4BA 1VCHA 3IH5A 2A1TR 4FP9A 4COKA 4AW9A 1Z2NX 3WS7A 1YRYE 1EFVB 5KI6A 3WO1A 4JNKA 4JUIA 1JJVA 5C8XA 5EJEA 3ASVA 3HPQA 5ABPA 3CE9A 2F1KA 1NXPA 4OIMA 4WH0A 4YROA 1P5FA 3VOAA 4B87A 4JUDX 3FI0A 3CVXA 5AK3A 2VZEA 2PMBA 2XCTB 2H4HA 1QGYA 3NBFA 4OQXA 4PTYA 1JE1A 2E48A 3W7BA 1Y1RA 2KBFA 2FMKA 3GVIA 4IDNA 5DH9A 1FZTA 2YY6A 2EDCA 2RH5A 1GD1O 3CUSA 1FXSA 1BS9A 2YOGA 4NBSA 4ASUA 1DKQA 4DA4A 3TIGA 4A26A 4DF3A 3X1ZA 1GU0A 2V3WA 1ZD4A 1EFCA 4QA9A 4UBKA 3RB8A 2PRYA 2VPIA 5JY6A 2ZJFA 4CCYB 1Z06A 1KYVA 1JMVA 1MTZA 1U5AA 2CXXA 3QSGA 4H0FA 5HF6A 3DVSX 5EUMA 2QK4A 3EGWA 3L5OA 3DT6A 3II6X 4IXMA 2AOUA 3NBXX 4BTVA 3FNEA 2FV8A 1C41A 1JAYA 1H65A 4QDJA 3WLJA 1VSTA 4OHUA 2BFDA 4FHZA 4BVHA 4E15A 2RHWA 3F90A 3TL3A 5EMLA 3WQSB 4WBSA 2MYPA 4QEZA 3WGHA 4FOPA 2EIHA 3HJTA 5JS6A 1GA6A 3U5TA 1RC0A 4IDQA 3RAJA 3OMLA 4IIDA 1N4DA 1G4UR 1C4WA 4D9NA 2M6LA 1QO7A 3JQDA 1CUCA 2W4MA 2V74B 1Y9ZA 4GPD1 4MCIA 2RB5A 3NCTA 1Y3FE 2MJLA 3M1IA 4YA6A 2OYCA 4LF5B 1O97C 2GF2A 2AK3A 1AV6A 2YFYA 4TT3D 3P9YA 3Q7TA 5M29A 4QPJC 5E7IA 2KE5A 3NBYC 2PCJA 1Y1TA 3V8MA 3DMDA 1W93A 1QSGA 2G09A 3MTQA 4DVJA 3OM0A 4PHFA 3ZV5A 5E9QA 8ADHA 4UTPA 3OHSX 2C1XA 1XD9A 3OWOA 5F64A 3GR6A 1GTJ1 1XCBA 3U4QA 3W0LB 2GO1A 1T5SA 3T3DA 2I55A 2IUEA 2CLLB 2W2VA 3GLQA 3OZAA 4GQBA 5TMDA 3AUKA 4BEJA 4O2RA 1I7QB 2OHVA 2MCFA 3CX7A 1U2EA 4M0FA 3UMBA 3EXIB 4IQ0A 3ZHBA 5C8ZA 3GLGE 1QU3A 1Z34A 5IU6A 1E1DA 4IFIA 2MYTA 3PC8A 5LC1A 1Y6QA 2GK7A 3A10A 5EJAA 4BBAA 2VPYA 4MGKR 5AVJA 4JXXA 3EDCA 4X1YA 1GRRA 1AKWA 2UVPB 1KZ9A 1R74A 3P9IA 4EPVA 1A9OA 4H4EA 5ER9A 4DBZA 3U6KA 1XDDA 1YS1X 3KYJB 3OM1A 4MQEB 3DL4A 1GG2A 2ZLBA 1Y81A 1B76A 1I7DA 5JD4A 4Q4CA 1MA3A 2IUYA 4WPGA 5F7XA 5M2QA 3U5ZB 4K2HA 2FPPA 3PXCX 5B6IA 4MWGA 4DCSA 2AG0A 4G5OA 5DVZA 3LK7A 4G1UC 3B6JA 4LGMA 3HB4X 3MW8A 4TTAA 1VIDA 3T15A 4B32A 3EXHB 3OSZA 1Q15A 4C2BA 1MAAA 2OT3B 2ZTHA 2PRSA 3LWBA 2XIQA 2RBGA 4EYQA 4WACA 2PMFA 1VG1A 3CRQA 2PSEA 1G3MA 1CJBA 4XJTA 4WECA 3WI7A 3AINA 4NZ9A 4RTLA 1ZNYA 1CZUA 5HHTA 5H02A 1FRVA 1SH7A 3T9AA 5I5GA 1ZR2A 3N59A 3NBZC 1DQYA 4HAUA 4LHWA 2FUG1 3E03A 4HQKA 4KQHA 3BG5A 4XLLA 3QKWA 3GDFA 5EWLB 3RGWS 1CKEA 3EVDA 1FJXA 2EQ5A 1SCUA 1D4OA 1JQLB 1IWOA 1GA1A 4G36A 1XJCA 2A0XA 1GSIA 4XLZA 2C29D 3C3WA 3CW9A 3IFSA 2IODA 1DUVG 1HQYE 2C5EA 2I4TA 2C9CA 3NVDA 1Y48E 3G9QA 4ND4A 1PQYA 2W6CX 4MO2A 2QN6A 1SQ6A 4JHLA 4JSYA 1H8HD 1OREA 4YMLA 5COAA 2G1JA 2JHFA 2F55A 1EP9A 1JB9A 3VA7A 2ODNA 3SQXA 1NW4A 4CTKA 4I1OA 3NANA 1P44A 2DCMA 2GI4A 4PLFA 5HQJA 1SUPA 2L69A 4UEQA 3BE4A 2KJQA 1JTFA 3IQIX 2MMGA 1UXHA 3ZIAD 4LDZA 4OLBA 3DP9A 16PKA 4OKIA 4XJXA 4W8HA 1UEIA 1YQGA 1AQIA 2XV1A 4II2A 5B4UA 2ZSEA 3FA2A 5EJ5A 4KRXA 2DHCA 4XA8A 4DJ5X 3M5PA 4LRQA 5KWVA 1XXHE 3AI3A 4RF2A 5B6JA 4A27A 4YJDA 2Z95A 3NC1C 4RPGA 4NCBA 3U3XA 2QJFA 1NW9B 2BPOA 2WB4A 5IEBA 3OZFA 1SIWA 1JPVA 1QS0A 3LUBA 5BW8A 2SCUB 2LWIA 4PANA 2O2SA 3HBFA 3IP1A 1L7BA 2QTZA 2CXNA 3FNBA 4RM3A 5CLHA 2RGRA 3JWEA 4NCAA 4PQYA 4OHCA 5ILGA 5JYEA 1LY1A 3A9UA 4B44A 1UKVY 3K0AA 1RKUA 4JLDA 4B4OA 4C04A 3MRXA 1OROA 4GMGA 4KR7A 4EGSA 1II9A 1J0XO 3WWEA 2ZBDA 1QFZA 1SURA 1U65A 1LF0A 2VT2A 4QQNA 2OR3A 1N2IA 1WW8A 3V1KA 2FJUA 5AM4A 2C07A 3ZCTA 1L7OA 3HGTA 1UPBA 3ZWYA 2QWXA 3CA8A 2J09A 3D2BA 4XLTA 1K5HA 1UT5A 2IJGX 4YI5A 4CQMA 5LQAA 3IQEA 2VWPA 3PHLA 1OWMA 2L0XA 3FJ1A 3DLIA 4DMRA 3PE6A 3JD0A 5U1PA 1YVPA 1BYIA 4XPZA 5IXSA 1KJ9A 3OCYA 1HWYA 2X2FA 1JQBA 1GL9B 3LUFA 5CT6A 3ZUPA 5EHXA 1MJ5A 1Z4MA 2YN4A 2Q3MA 1U9IA 2I4NA 5BP7A 1XQ9A 1V47A 1RI3A 2QM0A 2BFAA 2IH2A 1JWAB 1IXSB 1D2HA 3GDWA 4C0JA 4CKWA 2JIZA 2R66A 4I9GA 5DCUA 1GU7A 1TVKB 4QNNA 1II8A 4GI7A 3BGDA 2FCAA 5DB4A 3H5LA 5HIMA 4ZYWA 3ZEIA 4ALLA 1E9AA 1PBTA 2CJWB 1OW3B 3BSFA 1VYUA 5A9RA 3KZNA 3OESA 3NX4A 4DZZA 1ZKMA 5HKLA 2ZWAA 1G8YA 1SHZA 4J1NA 4FM9A 3WQHA 1MTOA 2P4UA 3E18A 1D07A 4Q00A 2V7PA 3QMWA 2ZM5A 4R41A 1EWQA 3SMQA 5IKPA 3G9ZA 2HO4A 5ALIA 3M6VA 1GLNA 5TNXA 3OPMA 4JCCA 2NZYA 2QPLA 4C2AA 2Z9CA 1ZJYA 2QJTA 4L8YA 1KDRA 1TF7A 2XUFA 3JS5A 4BNUA 1MRNA 5DIZA 1YR2A 3CWCA 2BM1A 2YNMD 4U9UA 3KR0A 4B3JA 1JBKA 1KDOA 1UCFA 5F21A 3UAZA 1E0DA 5AUQA 1NNUA 1ZC4A 5I7EA 2NQTA 1BW9B 4OBXA 4B0PA 1U8ZA 3GLGB 3UAYA 4WINA 2UVQA 4ZU3A 2I76A 1V1MA 3BICA 3QWBA 4CGYA 2W2XA 3LLUA 1W30A 1MQ8B 1U1GA 1RRFA 3F6EX 1XHFA 3HKCA 1H2EA 6LDHA 2GN4A 4KPFC 3EUFA 4P2GA 1LZLA 3MGKA 1YU9A 3IERA 1ZZGA 3E1KA 3WNCA 1R0YA 4FT2A 3K9NA 3GAMA 4GPTA 4OQQA 4S1TA 4LGCA 1U3UA 4ZT3A 4AMZA 3OQOA 3LECA 4NFYA 4N7MA 3PNYA 2C0PA 2Y4OA 3A36A 1UZMA 4AN1A 4HGRA 4TTSA 2GBLA 3GG2A 5JLJA 1D0SA 3R5JA 5FOSA 1J56A 2GLUA 3VPXA 5KQGA 2PGAA 2ODWA 3LLCA 5C4GB 1DC8A 4O4HB 3S2IA 4TTRA 5F23A 4LWZA 4L1KA 3TLMA 4R1PA 1E2NA 5L95A 2RIPA 1RHQA 1JTVA 1OH6A 2Q1XA 1UFVA 1OC2A 2I3DA 3PDJA 5FEUA 1G20A 3CR8A 2DUWA 2FR0A 5LMUB 4CL8A 1T0IA 2VDRB 3MFYA 4PHTA 1RHKA 1G8SA 5IUNC 3RSFA 1AF4A 1W46A 5G3ZA 1YACA 3FSEA 3V4VB 1MAUA 4YCBA 5JSYA 4ZT5A 5ADUS 5EJ9A 4Y6GB 2QLBA 4ZDJA 2ZTUA 3VYRB 3ZNOA 5K5EA 1Q0TA 2ON6A 3PBKA 4FHFA 2Q3FA 1Y9JA 4PYKA 4ZARA 1Y5RA 1OA0A 3E4CA 2GTPA 4K1XA 4WKGA 1DEAA 2X42A 4Q9IA 2C94A 2XWQA 1Y9DA 4IIJF 4F4HA 5HOEA 2WSSA 1ZIXA 4DKXA 4H16A 4YJ2A 4YUAA 10MHA 1J0AA 2O7VA 3A4LA 5A0TA 3LY7A 4YAKA 3SBXA 2PG3A 1KFKB 1E9DA 5CX4A 3BBLA 4PFSA 4ALJA 3TR6A 4EHHA 3ELBA 4C1NA 3SSMA 4I99A 5DXFA 1QP4A 4LWOA 3GP8A 4WE3A 1KDZA 1I2AA 3KC2A 3F5SA 1N6RA 3I34X 3WG9A 3L8CA 4Z9YA 4C7JA 1HEIA 3LMKA 5C5EA 1XDZA 5FUQA 2E37A 2WF9A 2WYIA 1JEDA 3DZ8A 3P4XA 4KXUA 3VOSA 3AEUB 3OEEA 1KVUA 4ZEMA 1R37A 2PZ8A 1SA0A 3K6KA 3IP5A 1I5RA 1VE3A 4MLDA 3TJRA 1RQNA 1PZGA 3B8EA 3IHLA 1I6LA 1X1TA 3ND9A 2PAFA 4PQFA 1XTIA 3HY3A 2QX4A 1T8RA 3KS9A 1U8CB 1DOZA 2PQ6A 3VHXB 2GN0A 4IJMA 2C7RA 2BONA 3PXAA 2VQFB 4NMMA 4UDXX 3PPXA 4EG3A 3UJ7A 1CS4C 1TLFA 1IONA 1KSHA 5E6RB 3R6DA 4CNQA 4WCFB 3FYUB 1I7PA 4F91B 1UC8A 1P0CA 3I6YA 2EBFX 2B5WA 2AEFA 2HBQA 3AF2A 4Q66C 4EUFA 4RV5A 2I8LA 3Q40A 4MEAA 1HZZA 2A0FA 2P27A 3NHPA 3WYNA 2IXEA 4MPTA 4DCVA 5EE0A 1R4NB 5AI8A 4LKOA 5HGJA 4BCCA 4HGYA 2XGJA 1QP8A 4Q1AA 4HXGA 3N2YA 5DK4A 3U4CA 4ER6A 2DH5A 2WKSA 5FH9A 1JEYA 2RK3A 3OCUA 1K8YB 1PLLA 4LPSA 3QIVA 1EHYA 1UBJS 3EMKA 4G09A 3KG2A 1YMUA 2M6KA 3W3AD 4OFZA 5CCXA 5C53B 1J5XA 4K6GA 1CRQA 1I1NA 2PR7A 3DOIA 3NI2A 4BV9A 4N8SA 4E7PA 3ZV4A 1EEXB 3T5AA 3AFMA 1P7YA 3PRHA 1VSVA 1N25A 4OB8A 4FJ0A 2PGJA 4D3ZA 3KSMA 4L8FA 4WEQA 5SYMA 3FUUA 4WOCA 3GGCA 3HKEB 1S96A 1YXMA 1IBKB 4I7EA 2G71A 2ZAIA 3PRYA 1F2VA 2Z5VA 3P4YA 1LC3A 5M34A 2FRVA 2J0VA 2WFZA 3PLRA 4A0SA 1PWEA 4KN9S 4B6EA 4XDZA 4DAOA 2VTBB 4CV1A 3CUVA 1YVUA 4RXTA 1JS1X 1FUKA 3PUWA 4KO2S 4TQUS 1GADO 4JLKA 5J63A 3P0RA 3R5KA 1PKEA 1TRKA 3AOEC 3R7AA 1FFAA 3PI6A 1YQ9A 3CLTC 4G63A 1VPDA 3IQZA 1YE8A 2J9YB 5JJBA 4KPEC 3T4EA 1NLYA 3D5QA 5B2EA 1KI8A 3D4NA 1QUFA 4HAVA 3TQSA 1BDIA 2CLIB 3VR3D 2PGNA 2ZT6A 3CVVA 1D4AA 2C2OA 2E6UX 3A6KA 3NWBA 2HYDA 3QLJA 2CXPA 4NMWA 4QYIB 4RE5A 3PNVA 4RLQA 4TKUA 4WZBA 3UK2A 2AJBA 3R8FA 1J8QA 1REQB 2Y9MB 3MWYW 2YWHA 3TEFA 4OQEA 5CA0F 4LF9B 4OI4A 1XZDA 1LK0A 5JY1A 4DIOA 5FUBA 5GIOE 2QLFA 2VDOB 1GZ3A 5IASA 1YCDA 2VHXA 1BC5A 3LCJA 2ZAYA 5DHAA 4CTMA 1P4SA 2XQVA 1PHRA 5GVRA 3QF4A 3UMGA 1EBFA 1YR9A 1ZOLA 1MN6A 4RGYA 1E3TA 4FSXA 4D9BA 1TUBB 1XD2A 4L51A 3RSLA 3W3ZB 2H18A 8AT1A 2JD0A 3GUZA 4TYQA 3WFZA 3AVOA 3IAUA 4JYBA 3RODA 1EIWA 5GZ1A 5JDIA 2V9PA 2VA9A 3RKRA 1DTSA 3D8SA 3GH3A 5CTAA 4R84A 2FPGB 2DCUA 3LLVA 4WGFA 4ARUA 4OHYA 1NASA 3JQ7A 4R01A 5BRNA 1LEHA 4KQ9A 5ITVA 1AX9A 1SUDA 5G0UA 4QYXA 5KYXB 3NC0C 1UOEA 2AZMA 2PTGA 4QT0A 4JROA 3KDPA 1N1MA 2WT4A 3GGDA 2OCXA 3RANA 4EEZA 1U2DC 5L3SA 1PSDA 3M1YA 3H99A 2IWRA 3RJ9A 1E66A 3G2QA 2OBXA 4JI5B 4O63O 4BGUA 4GHWA 1NG9A 3BORA 4BO0A 1Y7IA 3V4FA 3EEFA 5LCXA 4XE5A 2NXNA 3ZNNA 2XI4A 5EHQA 2WWYA 1NBAA 3HXTA 3UA3A 2UUPA 2JA2A 1BU8A 1KA9H 3IAFA 3LQ2A 4OI1A 1WXEA 3EVCA 3HVIA 2RKOA 4FBGA 2J9FA 3IVRA 5AK6A 1UJNA 1KJ8A 2F00A 3TQRA 5CXUA 3FWHA 4KN6A 4WCDA 3PUHA 4IQFA 1MO5A 2IOYA 3L6EA 5TS2A 4KODA 3LL4A 2H08A 4O4LB 2NSLA 3BQMB 1JZSA 4MDEA 1P39A 4A2WA 4B71A 4XPIA 3TQOA 3UOGA 5A6SA 1MX3A 1ORVA 2A0WA 3OOWA 1JI0A 4WQMA 4AJJA 2I7VA 2HDOA 3OZ7A 4P81A 7MHTA 3VVCA 2OBLA 3VKFA 3CM0A 1PS8A 4DSAA 5TPWB 2H4XA 1FB5A 1K98A 2PXXA 1E7RA 3FH0A 1JDTA 4GSYA 4LXGA 4QU0A 1FYVA 1E18A 4N6GA 4NJOA 4KPUA 2VJOA 2GSWA 2IYUA 5A1TA 3G7NA 4XM1A 4D4KA 1ZCJA 3AILA 4R8SA 1EA7A 1U6JA 4F93B 2QVBA 3W90A 4PAMA 2YS7A 3WRYA 4CQJA 4DEVA 3CNOA 2NU8A 5CDHA 3H0CA 3OCJA 4KQMA 5F51A 4PG8A 3SGLA 1U5BA 4INPA 2QMUA 1H9AA 2Y4NA 1ZRNA 5HUHA 1FTNA 2ZB7A 1O08A 2D1QA 2D5BA 5JSZB 1V7PC 5KNDA 2QXUA 4TWZA 4I8IA 2MT9A 2X8AA 4D1YA 3RFVA 4ZGWA 1JFFA 2IHYA 4BNYA 3W3AH 3PQ3A 2X1MA 3G79A 4JEHA 2YZGA 1VBNA 3AVVA 3WHIA 2OGUA 3AUUA 4EPTA 1ODIA 2QTAA 1VG8A 4HPXB 3EC7A 5IDYA 2R47A 2VP6A 3AYZB 3OT1B 5K8UA 2FLKA 3T3OA 3SEAA 3B9QA 2BW0A 2DJIA 2NUBA 3WLNA 1ODLA 3RK0A 1Z0ZA 2Q2OA 2FFRA 2RGCA 1IQRA 3TZ6A 2O0HA 3RBAA 3WSWA 5F2NA 3EGEA 4IDGA 3REOA 1E1LA 2HT6A 2VNAA 1RHRA 1E60A 1Z8NA 3HGMA 2QSYA 2UV8A 1JAHA 1BNCA 4QTZA 5JARA 1E7MA 1DBPA 5K0JA 3MUOA 5IBQA 3U7QA 3R24A 3W7AA 4MUHA 5JROA 1U8FO 1H0RA 3H5WA 2ZJ3A 5G1PA 1BQ3A 1ZCZA 3P9RA 1IN8A 3WYFA 1EVLA 4OA8A 4ZZ1A 3UCXA 1DLIA 3RYHB 3OIDA 1R7RA 5U4QA 3L18A 3DFIA 1HYEA 1YQEA 3CO5A 4INJA 4UUMA 3PC8C 2ZWOA 1H66A 3ZDCA 4GD3Q 2RJNA 2WF6A 3DAGA 3JZAA 4YXWD 2ATVA 5L51A 3I52A 5H4HA 2PL5A 4M6WB 4EVSA 4FFWA 2QRGA 1M1ZA 5M3BA 2RGBA 2UYQA 3PFNA 5I5EA 5MN6A 2I8AA 1PZXA 1N5OX 1QMGA 5JT1A 1PGJA 1V2HE 2CLFB 3HJCA 1FYEA 2I9PA 4CMEA 1HETA 2P3SA 4X45A