3K9NA

Allosteric modulation of h-ras gtpase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
164
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEFDPTIEDSYRKQVVIDGETCLLDILDTAGQYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric modulation of Ras positions Q61 for a direct role in catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
molecule keywords GTPase HRas
total genus 60
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3k9nA00
1RJ9A 1P75A 4PQRA 3QKUA 2OCAA 4I99A 4MKIA 3DM5A 4TMZA 4B3XA 4E09A 4WOPA 1XEXB 5C46F 4Q19A 3QKTA 4ARZA 2O8DA 3B9PA 3BS4A 4JLAA 4BLRA 1CS4C 3L43A 2PEYA 1K6MA 3WMGA 2MSDB 2JJ8A 2O8BB 5FBLB 2ZUDA 2CL6X 2CXXA 4WZBE 3W34A 2H18A 4PZLA 2P0EA 3IILA 1CR2A 1ZM7A 1XMIA 1OHHD 4MKFA 4NCJA 4QNMA 2FDCA 1E0AA 3TSOA 1CIPA 3EZ6A 4C7OA 2BMDA 4KYIB 5IF9A 3ECCA 2VRWA 2HV8A 2PCJA 4JYCA 421PA 5H8WA 5J4LA 2FFHA 1ETUA 1G3QA 1JPNA 1WB9A 2VSFA 3U7EB 1U98A 2WWFA 1KJYA 3PFIA 2WMNB 1VHTA 1TTTA 1IY1A 5KDLA 4QRHA 4F92B 4HUTA 3AP3A 1W7AA 4Z54A 4D4MA 3AF3A 2EWVA 3BK7A 3B8HA 2OXCA 4RCYA 3UG7A 4POAA 4ZIRB 2ZETA 2CK3D 3CNNA 5FPKA 4HZUB 2CE2X 1EX7A 1WXQA 4FCTA 5E7MA 1VDZA 1W0KD 3OF5A 3O8BA 4A0FA 3OHMA 2AHOA 5TY0A 1VMAA 3NTUA 3IIJA 2QTHA 3EASA 2HEIA 4PAQA 1VG0B 4OI0A 4DIEA 4PO8A 4NCIA 1KO7A 1E2HA 4PSAA 4XIGS 3AKYA 3BORA 4JVSB 4GPTA 1R0YA 5LBIA 4Q9JA 2GAAA 1OW3B 4M9ZA 4DHEA 1JJVA 4H1VA 4AKHA 2BBWA 4EUNA 4LRWA 2ASEA 2FSHA 4JLPA 2FFQA 5EXSA 5JEDA 1EFRD 4IDHA 1OXXK 2ORIA 2QI9C 4PANA 4TZ0A 1IAQA 3B1VA 1E2PA 1JB1A 1NL3A 1E1QD 1HV8A 3VNVA 1QHHB 3K0FB 3KB1A 3MFYA 2A7QA 2FFAA 3B82A 1P2UA 4C0HA 1EWQA 1R8QA 4ZI2A 5KTYA 3IHWA 4YDHB 1YZUA 2FNAA 2HDNB 2OCPA 2QGZA 1C4OA 2XTMA 3QBVA 4TL7A 4BFYA 2ZRHA 1NSTA 1GNRA 3TK1A 1F3OA 3V9PA 3KJEA 2W00A 3RS5A 4MGKR 4PO9A 2QRZA 2PX3A 2G1JA 3EC2A 3DZ8A 1BKDR 3EA0A 4MKGA 4QM6A 3UIEA 1XCMA 3EZ7A 5F98A 4WZAE 3Q72A 5FL7A 3TSWA 5BN4A 1E0JA 1KI9A 4LYAA 5HTKA 1FP6A 1Z6AA 2QEQA 2J45A 3CX6A 2SHKA 2ZYWX 2KBEA 1MO5A 1NVXQ 3LD9A 2F55A 1V43A 1GZSA 4RSGA 4D80A 2GNOA 4CRWB 3SU8A 2HYIC 1XPUA 3K9HA 3MWKA 5L8VA 1G20E 3IDQA 1MRNA 4I1UA 1PZNA 2KBFA 3RRZA 5AJVB 3IIKA 4JLMA 4Z51A 1M7HA 5KSPA 5D3MA 1UBCA 4GOKA 1W49A 1D9XA 3LFUA 5JCZA 2W58A 3U60B 3SFZA 2YJTD 5JRJA 3MJHA 5KSYA 3CBQA 4DDTA 3T06B 1II8B 3ZZ0A 2F3RA 3ADBA 5J4HA 1Z08A 5ANRB 1GM5A 3SN6A 1U0LA 4YLGA 5D3MB 3LAWA 2WWXA 1JXMA 3KKPA 2GCOA 1XPRA 4Z8YA 3DKVA 3NH9A 4UXIA 1U8YA 3C41J 2BKEA 4NYJQ 5CYPA 4FW9A 3BB3A 1XXHE 3QE0A 4YMUA 3BFVA 1GL6A 3IQWA 2JLRA 4ZDJA 4D6PA 5KPDA 1KGDA 2ZJ5A 5B2ZA 1NY6A 1NVWQ 1L7VC 1FX0B 1TUIA 3KZ1E 4KCGA 1R7RA 3ZD7A 4LZZA 1P6XA 2WKPA 3QF7A 3K09A 1X1SA 3SQWA 2R6DA 1P2TA 2WICA 2IYVA 2ZYTX 4WZ6A 4Q9LA 2D2EA 5IK2A 1WBDA 1OT3A 3AP2A 1P9WA 4BRWA 1KSJA 1YVDA 1WP9A 3I3SR 3RC3A 2VSXA 1FX0A 3SYLA 3IBYA 1LS6A 1ZUIA 4KAXA 2QP4A 3PUWA 3VTKA 3T34A 3ICQB 1QHIA 2XOKA 3EZ2A 3SOPA 4QJ3A 5B57C 3GLFA 1VECA 4QG7A 2MSCB 1E32A 1II9A 1VYTA 3SS8A 1Z2AA 2WM9B 1D9ZA 1AQYA 1DAFA 4IDOA 5H68A 2CCGA 3WYAA 1NRJB 5F9HA 4N0DA 1VG1A 4JSTA 4ZI3A 1SGWA 4Q9KA 4YONB 5HZKA 1MH1A 1GOTA 1TQDA 2Z4SA 4B71A 1XBTA 4HUQA 1T3SA 3JZAA 5HCIA 3X1DA 4EFLA 3TUZC 1T5IA 4DSOA 1TF7A 3HWSA 1X8LA 1P9RA 2VPPA 3LA6A 1ZM3A 3REFA 1DBSA 1ZD9A 2HJGA 4HZUA 1KI1A 1XTIA 2ECKA 3UK6A 3GP8A 1U0HC 1XZQA 3MG9A 4M21A 4C0QC 1CTQA 3GFPA 1A82A 1W47A 4A92A 4MRRA 2YC4C 2X2FA 1TU4A 1NVUQ 1PLJA 1J99A 1MV5A 4QJ4A 1YHNA 1IONA 1J7KA 4IOMA 2DWOA 4XVRA 1IOZA 2ODBA 2IEZA 2VHTA 3K9LA 2ZE7A 2ZRJA 1XU4A 3QNUA 2QAGC 4FN5A 4L8GA 1KZ7B 5BN5A 5AJXA 4QHSA 4UQOA 3MCAA 3IO3A 2VIIA 2OILA 2BOVA 1XEWX 3VKHA 2IYRA 2J87A 5SZKB 4DCNA 2G88A 4R98A 3GJ5A 5AUPB 2P3SA 2O8EA 1QG4A 3N5CA 1F6BA 1PLLA 2ZS7A 5B58C 4TLAA 4ARZB 2O8DB 1QHHA 1T4GA 4HB4A 4HB2A 2D3WA 1OIXA 4LY6A 4RJLA 3ICEA 1Q3TA 3RAPR 1RYHA 1NN5A 3WNCA 3P32A 4DEYA 3PG5A 3PJRA 4HB3A 2JJ2D 2VP2A 2IYUA 4KSCA 1YR6A 5DIFA 4MUBA 3SQXA 2P2LA 1UKYA 2ERXA 3CRVA 3HPRA 4JJZA 4OI4A 5L3QB 2YWHA 4Q7MB 3AQ4A 3VX3A 2ZSAA 3M0EA 2P5SA 1E6CA 3DPUA 2AD1A 2GWHA 4Q4AA 2AFHE 1OH5A 1Z6GA 4M1SA 1QHSA 1N5LA 4IDQA 2JGNA 2AXNA 5HCNA 2UKDA 3C8UA 3QXXA 4AYWA 1R0ZA 1P62B 3QQ5A 5F9FA 2FSFA 3QKRA 1XCGB 3F3YA 4RD0A 4JYBA 5E95A 4GL2A 1FUUA 1XB2A 2FG5A 2ZJZA 3KJGA 1CULC 5AUOB 4O25A 1E2MA 2R6AA 1YZGA 2XJ9A 4Q1EA 1KMHB 1G16A 5F3WB 2OO7A 3AKDA 4XWOA 4TYNA 3ZVMA 2WIAA 4Q7KA 2J0SA 1KI3A 1KY2A 3RANA 3TR5A 4MRVA 5BYJA 4LJ8A 5CIWA 3PITA 4BEBA 3R9XA 4EFMA 2VLIA 1IM2A 1TAGA 1XXHB 2J59A 2O52A 3QJYA 1ZP6A 4RVCA 3L2OB 1TUEA 3QXCA 5TV2A 4B75A 2XNDD 3P26A 3THWA 3NBXX 3FPAA 4Q1BA 4PHGA 5P21A 2O8BA 4LPSA 4TL9A 1DO0A 4P0TA 4RFVA 5FFMA 2QPAA 4OJQA 1Z0JA 2RGNA 2VL7A 1OLOA 2RGNC 4FMBB 4KBFA 2J9RA 4ZPXA 2OFWA 3A37A 4O0MA 4II7A 2V55B 4MYTA 4IFEA 1XEFA 3SEAA 4AIIA 1DOAA 4P33A 3S1AA 3GLHA 2DFTA 1OIWA 1R6BX 4AYTA 5K8UA 1HQCA 3KKNA 1JR3D 4HLQB 3KTAB 4KYUA 4LWZA 4PSVA 1J8MF 5DH9A 1GSIA 2B8TA 5JBQA 4QHTA 2ZRPA 3UWOA 3O8CA 2IX3A 1H8ED 4C3ZA 3P4YA 4ASUA 2YWGA 4RCZA 2X2EA 2RGXA 1BMFA 3MWJA 5G3ZA 4Q4HA 3THXA 4FIDA 3B1WA 3FMPB 2PJRA 2C9OA 2WJIA 2ZRFA 4A8JB 1CU1A 5DSZA 2I4IA 2NO0A 4A4DA 4B2LA 1JI0A 4UJ5A 3T15A 4RFSA 4M9SA 2H92A 3B1XA 1JAHA 4PC7A 4XVQA 3NDBB 2C5LA 4FI3C 2GZHA 2R6GA 3KB2A 3PEWA 4ZCMA 1LB1B 4JBYA 4HAXA 2QTFA 2JDID 2AL7A 3PIRA 3QPWA 4WBSA 1R2QA 5EE9A 3TJZA 4B73A 4PPQA 4BLPA 1TQ4A 3SJBA 4ESVA 2ZJ8A 5J4VA 3IIMA 1IXRC 1OYYA 4D4JA 4U02A 1GUAA 2WOJA 3GJ7A 3W6PA 2VO1A 3AF2A 4U00A 3LV8A 2GCPA 1G18A 1XD9A 3CX8A 4PPGA 4CW7A 4EIWA 4DB4A 4R2HA 2QM7A 5EE5B 2HF9A 3QSYA 1AGRA 2YVUA 4P3YA 4B76A 1HQYE 1XMJA 4US1R 5FR1A 3PEYA 2EQBA 1XZPA 4PQYA 1Z63A 2X77A 4EJSA 1AK2A 1EFCA 2FE4A 3FMFA 2VF7A 2IT1A 1ZD1A 4I1VA 4DEXA 2OM2A 2G0NA 1YRAA 2F1JA 5CJPA 3ZQJA 1NMXA 2ZR7A 4UNNA 1E1QA 4M2LA 2QENA 4TSFA 3BIFA 3HU1A 4GFDA 2GBLA 1P60A 1KSFX 1CR1A 4ITRC 1U94A 3WYGA 3CWQA 1JALA 4URYR 2QQ0A 3QXHA 4LJ7A 4LX0A 3TBKA 3RVBA 3BB1A 1H65A 3AF1A 2BJVA 2ZSDA 3RABA 1LVGA 4JZKA 4BLOA 3W3AA 2IYLD 3ZVNA 1KNQA 4Q4HB 4NONA 1LY1A 1O87A 3AF4A 521PA 4TT3A 4ZO4A 3CO5A 1WE2A 1E2QA 2A2ZA 3SYKA 4XTRA 1KDRA 1H8HA 5CIQA 2D06A 2CLCX 2GESA 5AUNB 4HAUA 3ZDQA 2WPDD 5AJWA 3OAAD 1E79D 1LW7A 5FOUA 1OXVA 3I5XA 2GF9A 3KTAA 4M53A 4C2UA 3N2IA 3R8FA 4ILEA 1M34E 1XTKA 2RGEA 1GL7A 2FV8A 2B8WA 2RGCA 1VCIA 3BC1A 1E9BA 1Y3AA 4BEJA 4QOSA 2I3BA 3FKSD 1I2MA 3C5HA 1DARA 1ZM2A 1F2UA 2HXYA 1Z07A 3DOFA 1KK2A 5AK0A 3THWB 4D4LA 2J7PA 1EFHA 2EFDB 1F5NA 1Q20A 3BH0A 5KOYA 4A8JC 5JWOA 2OT3B 4C30A 1S2MA 5AWFC 4BZXA 4EPWA 3T35A 2Q0HA 1GG2A 2Q9BA 3NXSA 4PAMA 1OFIA 1G17A 5CLLA 3ONWA 1DO2A 1SXJC 3C16C 2IYTA 3PENA 3X1XA 3QPVA 2BKUA 3GPLA 4MH0R 3OZXA 1KMHA 4QBHA 3U61B 2WPDA 4R71A 3K0CC 2Y8EA 2KE5A 3ASZA 1RRGA 1S8FA 2YYZA 4IXNA 1LV7A 1M8PA 2PEZA 2JLUA 2PLFA 1G5RA 2QBYB 1ZNWA 5JZVA 1HE1C 4MYUA 3I92A 3KDSE 4IEEA 4XJXA 3WP1B 4DCUA 821PA 2LWIA 3SBEA 5DYIA 1AZSC 4JVMA 4OQLA 4DDWA 3FGNA 3UMSA 3DMDA 2E9SA 3KX2A 1G3IA 1P5ZB 3Q8XB 3TGPA 3TAHA 4Q4AB 3CWZA 1WBBA 1ZRHA 2CHQA 4HDQB 4UNPA 1OPXA 3KKOA 3K0EA 3BWDD 3O8DA 5EQTA 1Z8FA 3PEUA 4F7WA 4D26A 3B9QA 3CR7A 4HYYA 3O47A 4DC9A 2FPMA 5JEEA 4B2PA 3AM1A 1ZUNB 2C96A 4QC2A 1PJRA 4A0HA 3FMOB 4KV9A 2ZI6A 4TL8A 4Z8XA 2YINC 3LO5A 5DN6A 3SJCA 1DG3A 2ERYA 3R7WA 2ZJYA 3M4YA 2ZQ5A 2JCSA 4B74A 5G3YA 3MJRA 5IT5A 2F9MA 4Y0AA 1JAIA 3RRYA 1A4RA 4DT1B 2FN4A 4BPBA 4LHVA 5CB6A 4B3FX 1SVWA 5FH9A 3U5ZB 4MGZR 3W6OA 5EXTA 4OQMA 3ASYA 4RD6A 3HPQA 4OYHA 2JATA 2ZS9A 4LGMA 5EP2A 3VR1A 3ADDA 1E0SA 3WMFA 2PH1A 2ZUCA 1W36C 3WMEA 1OYWA 3EZFA 2WWWA 1ZD8A 2NO9A 4QNRA 3U3OA 4MGIR 4Q02A 1G4UR 1Z29A 1ZU5A 3AKEA 3P27A 2VBCA 5FL7D 4A0GA 4CGZA 2VA8A 1DTSA 1ZNZA 1X8JA 2Q3HA 3BBPA 5TB5A 3BXZA 4X8MA 2ZI3A 5FTLA 2J0QA 4G5RA 3OEHD 4JJKA 1NSFA 4AKIA 1K8RA 5CDFE 4BQSA 3RNLA 1NN1A 1DAGA 4LJ5A 5GJBA 3I1FA 2JASA 4HLDA 4LHWA 2FF7A 3GMTA 2PZGA 4URUR 3PEVA 3A1VA 4OQFA 2GEUA 4M1MA 3HDTA 1GILA 2J3EA 3GCGA 3MD0A 2QL6A 3IEUA 3QF4A 1YR8A 2D74A 2FEMA 4HUQB 5KSZA 4HLCA 1L8QA 5EUQB 4F93B 2ZXUA 2IWRA 3U3KA 2A5JA 5KO2A 3CF0A 2R6FA 2WAYA 3WRXC 2Z4RA 2BM1A 4EPVA 5FI0B 2D4HA 3TQFA 4G5OA 3ADCA 1W46A 3CM0A 1RYFA 2REBA 4JL8A 4UNRA 3GLFB 1O3YA 4NCHA 2BDTA 2REXB 3RRNA 1E9DA 2ATVA 3C7KA 3B60A 1NN0A 3VAAA 3CZQA 1BYIA 1Z83A 5CB8A 5L3SB 2XITA 4BFTA 1KKMA 4V03A 5LDDC 1EX6A 1OFHA 3EG5A 4HDOB 2ZREA 2GF0A 3FKQA 3I61A 2KJQA 3A6PC 4I1OA 2QROA 3SHWA 3OIUA 4FINA 1G21E 5FTKA 5SZJA 1A2KC 1SKYE 1DAEA 3JZMA 4AI6A 3HU2A 2NIPA 2PMKA 4F38A 3WXMA 1VHLA 5FBVB 3ZVLA 1J70A 1W0JA 4LHZA 2QY9A 2WHXA 5FOXA 4L4UA 1YR7A 2JJ1A 4JLKA 1W1WA 4XTCS 3FWYA 3OFND 1KHTA 1Q1QA 2ZI9A 4R9UC 2GCOB 2GJAA 1TF5A 3X1WA 3QOFA 4PSKA 3K0AB 2CNWA 3ZIAA 5JECA 2VP6A 2ZRCA 1FQKA 1SXJD 2YNMA 1N6NA 1AJEA 3OIVA 3GFOA 2GJ9A 4M1OA 5AUQA 1E9FA 4V0KA 1Q22A 1OB5A 1II8A 1DADA 2R9VA 3GEEA 3WY9A 4A82A 4Q1CA 1HUQA 2B7CA 2OZEA 1Z0FA 2ZAOA 4LUCA 3VR2A 3K8YA 3AVTA 5JJLA 2NO7A 1T91A 2OSBA 4TZ6A 4KFTA 5HE9A 4EPRA 4L16A 1VYVA 1NG9A 2OXRA 2H8KA 1E69A 4J0QA 4CDGA 3VKGA 1L4UA 3E70C 4ON9A 1ZC3A 3ND9A 1NBMD 2QAJA 1LTQA 3RWOA 1J90A 3TW4A 3HR7A 3AP1A 5LB4A 1XMSA 1N6OA 3BH7A 5KNBA 2A30A 1G3UA 1F48A 1IN8A 3W9YA 1BOFA 4NTZA 4D81A 1ZBDA 2BCJQ 4DJTA 3KXKA 1EFRA 3E1SA 2Z0MA 3KFXA 5FOTA 2W0MA 2N46A 1IY2A 4TLDA 4X8HA 1T9HA 4DB2A 4JLBA 1G6HA 2WKQA 3TUIC 1JJ7A 3EPHA 1T0HB 1Z0IA 2WOOA 4M0LA 1NI3A 4NYMR 221PA 3CRW1 1U0JA 2Q6TA 1KK0A 2V9PA 2QMUA 2FGJA 2C8VA 2ZITA 3MWLA 3FKSA 4QBIA 2VYFA 4IEIA 4EQ6A 2OUKA 5DI3B 5HKKD 2GTPA 5C1BA 4TQAA 3R9WA 1ZW6A 3CW2A 3W8NA 3KQLA 3HU3A 1KK1A 4BLSA 3QXJA 1ZIPA 2J0VA 4C0JA 5J5CA 5DO9A 1KKLA 3VR5A 3KJIA 5G40A 4D2IA 4BFUA 1G3RA 1W36D 5EE3A 2AFIE 4ZCLA 2PZEA 3LLUA 1E2NA 1R4AA 4KI0A 1GTVA 5JJKA 1W4BA 2J5XA 2ZR0A 3MSXA 5FPHA 4QBGB 1HTWA 4BFSA 1GAJA 1HT1E 4N1AA 4FWTA 2BV3A 2WSMA 1N0UA 3H4MA 2F43B 4NDZA 3TIFA 5KSOA 4HLUC 4BFXA 5FUWA 2QPOA 4HB0A 1JECA 1Q21A 2GRJA 2F3TA 4PC6A 3BB4A 3SYNA 3CB4A 1OHHA 3CRQA 1JQJC 2V1XA 4TYPA 1TL7C 3GJXC 4ZIRA 3K9GA 4RD1A 4AKGA 4PHTA 4LJ6A 1E9SA 1DAMA 4C0BA 4LBYA 3KKQA 1E96A 1YZQA 3JVUA 2IK8A 4HAYA 2WJYA 4TQUS 4UNSA 2PX0A 1E4YA 2WAXA 4G1UC 5FOWA 4F4IA 3BD9A 2OBLA 4ZKDA 2C9CA 4QL3A 5IK2D 4FXPA 3DZDA 1MKYA 4HAWA 1KI6B 2ZE6A 721PA 2A9KA 2V4ZA 4PHHA 4JLJA 5H70A 1X6VA 4IOKA 1OFUX 1GKYA 3AH8A 4MUAA 2GETA 2JLYA 2JLZA 1G8GA 4D25A 1S1MA 1XD2B 4D0GA 4WXRA 4A2PA 5HKKA 2J7PD 5FOVA 2F7SA 2OCBA 3T12A 1OXUA 4HATA 1U2RA 2IYQA 3C5CA 4DZZA 2IW3A 1XEXA 2PL3A 2J0UB 2VHJA 3U6BA 2BWJA 2XZOA 2OESA 1Z3IX 4TN1A 3P1JA 5JSZB 1XJQA 5EP3A 3VR6A 2VEDA 2BEJA 2BM0A 2K5UA 5DYGA 1YZLA 2CJWA 2HT6A 1KTVA 4HAZA 4DLSA 4WW0A 5KNDA 3H86A 2XAUA 3KXLA 3EARA 3HYRA 4V0OA 4A6XA 3TRFA 3VHXA 2D7CA 1SVKA 2ZYVX 4IRUB 1XJ0A 2XTNA 1UJ2A 3IKJA 3FFAA 2BC9A 4IFBA 4DLYA 1AS0A 4EDHA 2BBTA 3B7GA 2V6IA 3SE0A 3KQUA 5TDHA 2D62A 2REOA 5DHAA 4RZ3A 2ODNA 2J41A 3K70B 2R44A 3EPKA 2B92A 5K8TA 3RS0A 4DCSA 3IBGA 2X1VA 1KDOA 1EK0A 5M04A 3AVUA 1EGAA 1BMFD 2RGBA 2OE2A 3TVDA 4ACAA 4A0RA 4V0LA 1CBUA 1ANKA 1N5IA 2OAQ1 4JLOA 2H7VA 4LHXA 1KOFA 4EPXA 3TKLA 3CLVA 1RRFA 3L0PA 3DDCA 2W2VA 1T3HA 1FL9A 4FD2A 2ZJOA 4G5GA 1CJMA 4Z1MA 4ZCIA 1S9HA 2QQEA 3GQBA 5CLQA 4IDNA 3QVVA 1G41A 4WA7A 1JR3A 5BW8A 2FWRA 4BUJA 1G4AE 3B6EA 1F60A 3THOA 4M1TA 1ZIOA 3PCRB 1OJLA 2VP5A 2JIZD 1G8PA 3K1JA 3B78A 3B1ZA 4M1YA 3SJZA 5TARA 1W5SA 1XTSA 3OFNA 4LSGA 3THYB 3UKDA 3IHLA 1U8AA 2QSZA 5JS7A 4GMXA 2P65A 5KDOA 1EG7A 1ZAKA 4ERNA 5JFGA 4XSHA 1OKKD 3AVVA 1CXZA 1R5OA 1CR4A 3FDIA 2HYDA 1P2SA 4N3NA 1NMZA 5DHFA 5C4MA 1XFAA 2AX4A 3A8TA 3CUEF 4FMDB 5CITA 3R8CA 1P73A 2VHUA 3NHAA 1W4RA 2IBMA 2V7QD 5DI9A 3MMPA 4QGGA 2V7QA 1W4AA 1GRRA 1G8YA 1W0KA 1DG1G 2W2XA 1N6IA 3GLIB 3CIOA 2CK3A 2IYWA 4YMSA 2AK3A 1US8A 3NVAA 3GLGE 1VIAA 5CDFA 3VQTA 2XXAB 2WWIA 2F43A 4JVLA 3RRMA 4DLXA 1UEJA 2VP4A 2C95A 5TMPA 1FNNA 3OAAA 1G7RA 2ZJ2A 1AIPA 3GLHE 1ZNXA 3FMIA 3EPJA 4JMPA 5L3VA 4Q47A 4AD8A 3T1OA 2H5EA 4YXWD 4G3XA 4OBEA 2CJWB 4WVFA 3VU9B 4Q21A 2OG2A 1SZPA 4DLZA 1MOZA 1DVRA 2YWFA 1YRBA 1MABB 4EKDA 5CK5A 2W6JD 3QKSB 1U9IC 2BMJA 4FCWA 2GA8A 3FE2A 1AKEA 1OB2A 5CJ2A 4KFUA 3B13B 3OEHA 1ODFA 2A78A 3DMNA 4XD7A 4D4KA 4ABYA 3VHLB 3WBKA 3H1TA 2D2FA 5GJVC 2F6RA 2G1KA 3BERA 2QUZA 1IXZA 1UBGA 1IQPA 3WP0A 1NJFA 3U2QA 1KNXA 2Z5FA 4YMVA 4Q4JA 1QHNA 5FTMA 2GKSA 1DAKA 2CL7X 4PPFA 1QHXA 2XX3A 1C9KA 4KLNA 1F2TB 4FMCF 2W6IA 3PR1A 3RHFA 1W2HA 3N2EA 5B30A 3BJIC 5FTJA 4TLCA 3UANA 3CR8A 3QPUA 4ZDKA 5EXPA 4JT4A 5C4GB 3AKCA 2HCBA 4LDJA 2V54A 3U44B 1D5CA 5HR5A 1W5TA 3RSLA 4OJKA 4TYYA 3TR0A 1JEEA 3GJ8A 4WIAA 4GOXA 3R9IA 2BVNA 5FBQB 1CJTC 1Q1EA 2FPLA 1T6NA 2DBYA 2FMXA 3QY0A 3VKWA 4JS0A 4H9GA 1IBRA 4W5HA 4RZXA 2VP9A 3U3JA 4DBLC 4XH9B 4MRPA 1ESMA 1Z28A 3FHTA 2QAGA 2WWGA 1SVMA 4KBGA 2HCJB 4GDFA 2JDIA 2IEYA 5TXGA 4BZPA 4CEJB 1G64A 2WMOB 4LV6A 2G6BA 2R8RA 1M7BA 2I1QA 2OFXA 4NHOA 4OHVA 5KYKA 2IS6A 2V6JA 3SDZA 3K53A 3LVRE 3IQXA 3WRYC 4BLTA 5KNCA 3ZZUA 2EW1A 3K0AA 4YQFA 4C0LA 1VPLA 4TMVA 2CCKA 2ZRLA 1JXOA 1DAHA 2B7BA 2CLDX 2F1RA 2FFBA 4V0NA 3WHKA 4CYMA 5LD2B 5FPTA 3ZS9A 1FMLA 3EAQA 1Q0UA 5GVRA 2W6JA 3ZJYA 1OH8A 3RLFA 2NPIA 4LC1A 6Q21A 2Z43A 5DE3A 5EE0A 3RS7A 4TYWA 3U4QA 1KYIA 1JQLB 1Z06A 2BMFA 1E1RD 2JLSA 3G0HA 4MA4A 1W44A 2OV2A 3GLGB 2IYXA 4Q18A 3RS4A 1SXJA 2ZE5A 4DLWA 5AR1A 2NG1A 2Q3MA 4B3DA 3RC8A 3AVWA 4E03A 1EFUA 2FSGA 4BGDA 1YE8A 1I4TD 5FUVA 3UG6A 3T5GA 4HEJA 2VF8A 4HZIA 4IDPA 3W90A 2EYUA 4P31A 1ZNYA 5C18A 1GKIA 4MKHA 2ONJA 2OAP1 1NIJA 2ZSEA 4NYIR 4QXAA 4NCNA 3UXMA 3ZQ6A 2XZPA 1HY3A 2NTYC 5FOSA 3I8SA 3NC0C 1K5DA 1KO8A 3RWMB 5F2EA 2Q21A 3C14C 2GEDA 3K9NA 2ZUBA 2X19A 1CRPA 3U3RA 1IN4A 4ZV4A 3CF2A 3KQHA 2GHIA 5FPYA 1G6OA 1RIFA 4KITB 2O8FA 4U7DA 2EFCB 3AVPA 4JT2A 1UBFA 2N1BA 4CEHA 4NPHA 2X8AA 1T5LA 1E2EA 1Q44A 2EFHB 1FZQA 4GI7A 2B21A 2FX3A 1R0WA 4LOAA 1COWD 2CEAA 2ONKA 3LNCA 3PUZA 2GXQA 4RKFA 1Q1ZA 5JCPA 3C4JA 3VMFA 3F8TA 1SVOA 1N6HA 1SVLA 4NYIQ 4TMXA 4QGFA 2N42A 4JLDA 2EFGA 5FPSA 3A1TA 2F9LA 3T61A 3P4XA 4M4SA 3WBJA 2YOHA 3NEJA 4IVQA 1RFLA 4PAOA 4URZR 1N3BA 1UDWA 1IN6A 2AK2A 3Q9LA 4Z1MD 2IYSA 1XD8A 1Z6TA 1TQ2A 2AD5A 5BXQC 4URXR 4NMMA 1ZVQA 3UMFA 4M9QA 4AG6A 2G3YA 4DUGA 3BH6A 4QKQA 3CH5A 2NMVA 4BASA 2CBZA 1IN7A 5BQ5A 1FPMA 1OF1A 3PUVA 3AVXA 3NIBA 1G7SA 5CM9C 3CF6R 5DGXA 1T3LA 2C03A 1G1MA 1N25A 1TX4B 2ZRKA 4ACBA 4NKRA 3UPUA 5JHGB 5GADl 3NG1A 3V00A 1B0UA 1GNQA 5LPNA 3N70A 1UAAA 2KWIA 1HH4A 2HT1A 1JNYA 1P7CA 3QEJA 2C2HA 3QBTA 1DE0A 5HPYB 3V4FA 2BHRA 1EWRA 3KXIA 1XTRA 3LLMA 1XEWY 5CM8B 3F5FA 3VNUA 3TVTA 4DLUA 3CONA 2TMKA 2AXPA 2O8FB 1UEIA 1EESA 2HXSA 2P6NA 2GJKA 3QG5A 4G0NA 5E7IA 1E9RA 2CL0X 3V4RA 1CP2A 3FHCB 4C4PA 2W83A 3CH4B 4L15A 5LD2C 1Q1BA 1E2LA 2CDNA 3VR4A 2NZ8A 3D6TB 5KUTA 2EFEB 2ZIAA 2CE7A 3U44A 4OI1A 2F1IA 5SZIA 4A9AA 2H16A 3CPHA 2R6CA 2RB4A 1MT0A 2QBYA 3NBZC 4HSEA 3SNHA 3D31A 1LF5A 2P67A 2MMCA 4B32A 4CZ2A 4TLEA 1TPZA 5B64A 4CIDA 4PC2A 3HJNA 4MRNA 3CPEA 2PT5A 2XNSA 3EC1A 1EXMA 1EFTA 1N2CE 1SXJB 2Q3FA 4D0LB 4JLNA 1NMYA 1HYQA 3OEEA 2VQSA 1Z0AA 2GAOA 2QORA 4BFVA 3SR0A 4XVUA 4X8LA 4UJ3A 4E07A 3U4QB 2H1LA 1A2BA 5JI3E 3D3QA 2XGJA 1G3MA 4AKEA 4UNQA 1HEIA 1FW6A 4MQBA 4WXPA 3WNDA 3GLFE 1NVVQ 3FHOA 2C9YA 3FOZA 3L0OA 5EP1A 3BAFA 5KHOC 3B85A 3QI2A 3GEHA 4LBZA 1VCMA 2QZ4A 4IHQA 4DXAA 2AN9A 4JL5A 4O3MA 2FGKA 2ZR9A 3WHLA 3KL4A 3EPLA 1X8KA 4CEJA 3SHFA 3LQQA 4Q1AA 2WIBA 5SZHB 4Q03A 2QAGB 1DS6A 1I4LD 2CVFA 4KO8A 4UXJA 1NP6A 1OXSC 3L0SA 5J4KA 1FTSA 2IS4A 1CJKC 2J46A 2DB3A 3U7FB 2VHQA 4PZYA 3BGWA 3BFKA 1FTNA 3Q7PA 4IKEA 2ORVA 1YQTA 3GEIA 2G77B 5JI2E 1QZXA 1II0A 3DO6A 4HDCA 2YHSA 1G9XA 4JVNA 1FQJA 2YC2C 2DHRA 3PUXA 1Z6YA 2W0SA 5FR2A 5DLQC 1E79A 1J2JA 4IW3B 1E9CA 1AS2A 2GXAA 1CF4A 4A2QA 4KVAA 1BYUA 1XCPA 1GNPA 2VTKA 2WJHA 2JJ2A 1E9EA 3LBHA 1XF9A 3EWSA 4Q01A 4P4UA 4B3CA 1W36B 5G53C 4Q4JB 1G8FA 1OFTA 4M1KA 2JIZA 4DCTA 2BCGY 2DFKB 3H2YA 1CEEA 1GVNB 4M1WA 4M8NE 4MITA 4NYMQ 4YC7A 3W3ZB 2ZRAA 3SI7A 1Y63A 3GJ0A 1VCOA 1PLKA 2AKYA 4URWR 1MRSA 1NIPA 1N0VC 3ZLJA 4LJ9A 3G82C 2NGRA 2WJVA 1DEKA 2PLRA 2ZJAA 3QKSA 4IVRA 1TF2A 1KAGA 2WV9A 3LY5A 2C78A 4C0KA 2PT7A 2Z6VA 5A0FA 1T8UA 3VU9A 1CKEA 2DCUA 2G83A 4I1SA 5E3HA 3CPJB 3OE7A 1NBME 2MMGA 1KDPA 4A6PA 1OH6A 3SFVA 2ZPTX 4AK9A 3UMRA 3LDAA 3CRMA 4DUGD 1MO4A 4FCVA 1E2IA 4B34A 4BRUA 2XXAA 2ZSBA 5EUMA 2OEPA 2H57A 3RS3A 1W4CA 2ZRBA 2A5FA 3R20A 3IPYA 3ZZTA 1W0JD 1YR9A 2QRNA 2RGGA 2XSZA 4GSYA 1XPOA 3I62A 4XWAA 5L3RA 2WTUA 2FJUA 3THXB 1MO6A 2FZ4A 2OLJA 3Q3JB 4E5UA 1YZTA 2ZE8A 1IJFA 1IXSB 1R5BA 1ZMXA 2GVZC 2ZRDA 1LNZA 2C98A 3ZIAD 2DYKA 4DCVA 2O0KA 3FB4A 4B47A 2OBMA 1QRAA 4NP6A 1KK3A 3K0CA 1PUJA 4PPNA 4DKXA 4CEIA 3BRWD 3A1UA 1NJGA 1D2MA 2HLDA 1R0XA 4C2TA 4UKDA 1TADA 4S35A 3U6KA 4C0SA 1N6RA 3TW8B 1JPJA 3AGPA 4OK6A 3EW9A 2P6RA 1COWA 2GCNA 5UKDA 3S1AB 4B43A 2ZI7A 4F91B 1JEDA 5JSZA 1M7GA 2B6HA 1RE0A 1ESNA 2GDJA 2IYYA 3IUYA 2ZI5A 2QSYA 1U81A 4E22A 1WMSA 4ZDWA 1NG1A 2DFLA 1WCV1 1SVIA 2YKGA 3THYA 1BS1A 1VYUA 1P61B 4HLUA 4W7SA 1NN3A 4K81B 1P3JA 3PVSA 1OKKA 1XD2A 3A4NA 2GILA 2QE7D 2IXGA 5D3QA 5BYKA 2KB0A 4KXFB 5EZ6B 3ZYCA 1P4SA 1S3GA 4PZZA 2EYQA 2RKOA 3NBFA 1UKZA 1SXJE 3OIYA 3TSZA 2VH5R 4FMCB 2QMEA 1KI6A 1XMVA 2WSSD 2FU5C 3LH5A 4L9WA 4JKYA 2AKAB 2FOLA 3Q5EA 4CEIB 5DISB 1QVRA 5ELXA 3IO5A 5HZHA 2C77A 1E3MA 3OEED 4OL0A 2J7KA 3GLIE 3KUCA 4GP7A 3W8RA 3TE6A 3NWJA 4N0EA 2PMDA 3W5JA 2O5VA 2ZS8A 1UKEA 2KI5A 3AUXA 1ZU4A 4RD2A 1VKJA 1J8YF 1UDXA 3AVOA 1QHGA 5G41A 1XJCA 5FBRB 2P6UA 1GITA 1KSGA 4MDEA 4PX9A 1SKYB 2A5DA 4G5SA 4NCKA 4K46A 2RGAA 3UATA 2V1UA 3K70D 1S4QA 4I4LA 4MRSA 4PR0A 5L3QA 2NQ2C 4YMTA 1Z22A 1HT2E 4KFRA 2E1RA 3T1QA 1NNEA 1NLZA 5JS8A 4KVGA 1KZGB 621PA 1S0UA 1P72A 1UADA 1JR3E 1T8TA 4DSUA 4TMKA 4Q48A 2CCJA 4OHXA 1TNDA 1KO4A 4F4CA 5EJEA 1SHKA 2PBRA 2V3CC 2J0UA 2UZ3A 2XEXA 3D7MA 3DL0A 4EQ6B 3TAUA 4EPTA 3K0SA 1E2DA 2O8EB 1RZ3A 1Z6XA 5E4FA 1TEXA 3FFBA 1RW4A 1GKUB 2O0JA 4PQFA 4Q1FA 1Z5ZA 1Z2CA 2IC5A 4JLVA 1RRCA 4UXHA 4OK3A 1L4YA 4XSGA 1Q57A 1YZKA 3E2IA 2QMHA 4LBVA 4WAUA 4P32A 2CHGA 2QTVB 4RZ2A 1BO6A 5J47A 2IXFA 2QN6A 1PVOA 2GEVA 3AEZA 1QBKC 4M22A 4H1UA 1AA9A 4W5JA 1X3SA 2ZJBA 4TTRA 4DSTA 4U5XA 4ASUD 2G9NA 1D2NA 4B35A 3MLEA 1AS3A 3HR8A 4PC1A 2EVWX 1AZTA 4JBXA 1QDEA 4KU4A 4MGYR 3LX5A 4OQNA 3F0TA 4PTLA 4Q7LA 4AWXA 4KODA 2IYZA 3L8YA 3U7GA 4GZLA 3ND8A 5KU1A 3NDPA 2R62A 1CR0A 2IF2A 1G291 3A36A 1CRQA 1ZCAA 2YOGA 4AC9A 2UZIR 1OIVA 3PQCA 1ZINA 2W2TA 2JLVA 3SJAA 1M1YE 3FVQA 5AJYA 3LWNA 2JJ1D 1NKSA 2QP9X 1UM8A 3NKVA 3QG1A 4NZYA 1N6PA 2DWPA 3LXXA 5FBWB 2R65A 2WKRA 1KSHA 1RRPA 5DI3A 2VSOA 2IS1A 4RZUA 4YMWA 2J1LA 1RVDA 1TQ6A 2GZAA 2E87A 1R8SA 2QT1A 2D7DA 1GL9B 1TMKA 2OFOA 1RKBA 1I2DA 1U9IA 3I8XA 4L9SA 5J40A 3RYTC 3Q85A 4BZQA 4IVPA 5K8LA 2G0TA 4TWZA 3DVLA 3I4LA 3CRRA 2NO6A 1M6NA 3I73A 4Q9HA 1UFQA 5JWHA 1N6LA 1ZUHA 2HLDD 3IEVA 3T5DA 3AB3A 1G7TA 4OHZA 4V0MA 3ZGXA 4QM7A 3NBYC 3BE4A 3LXRA 1IHUA 3LRPA 3REGA 1KJZA 1MR3F 2WZQA 1VG8A 2XOKD 2ZVPX 2WWYA 2BBSA 1L2TA 5JWRA 4MDFA 4YDSA 3LQRA 2GK6A 1P9NA 2ZTSA 1XX6A 3BOSA 1E1RA 4EPYA 4G5QA 1M74A 2LKCA 2C04A 5FUXA 5GJWC 4B3GA 1E9AA 4R7ZA 1ELOA 3RDPA 2AWOA 4BFZA 1JR6A 1OH7A 1S3SA 2A3RA 1KJWA 2CHVA 1A7JA 1OSNA 1XTQA 2DR3A 4ZDIA 2VHCA 1ZYUA 4BLQA 2ODEA 3AVQA 1E2GA 4LJYA 3ZD6A 4B48A 4GRAA 3TLXA 3VFDA 1KO5A 1R5NA 2ZU6A 3FYHA 1YU9A 5IDVA 1FUKA 1HE8B 4TMWA 2IUTA 4JBWA 2DFNA 1AQUA 1LF0A 4OK5A 2F1HA 4TSFD 4C0AC 1G5TA 1SQ5A 1N6KA 3M1IA 3M6AA 3Q7QA 4IOLA 2BMEA 5AJZA 1IJEA 1ZJ6A 4PHFA 3GFTA 1VIYA 2OBNA 4IOJA 1XDBA 1XNJA 4KSBA 4LI0A 4Y0VA 4HAVA 3UWKA 3KQKA 2LKDA 3QXSA 1MO3A 1GFIA 3PV0A 1N5JA 2FSIA 4I81A 4F4JA 5EP4A 1ONBA 1XRJA 1HURA 3L8ZA 4A1FA 3B5JA 4Q5IA 4LYFA 1V5WA 1YKSA 4IJMA 2Z83A 4OKSA 2JAQA 4Q66C 1CLUA 2ZRGA 2WVJA 1S1CA 2CLSA 4EFNA 2RHMA 2ANCA 3KFVA 1KI4A 4Q4LA 3LW8A 4JL6A 3GJ3A 2ZRMA 1KI7A 2IXEA 2UVQA 2W6ID 3GJ6A 4NE2A 5CK4A 5EXXA 2EWWA 4D0NA 3DOEA 4B3BA 5DN6D 1WA5A 3CX7A 4LJ4A 5L3SA 2XB4A 3GJ4A 1OV4A 2QA5A 4A2WA 4B2IA 1A5TA 2HF8A 1GDDA 3NH6A 2IF0A 3K0FA 1P2VA 3ZS8A 5H1YA 4B6EA 1KY3A 4LK2A 5HE8A 2IHBA 3PXGA 1XP8A 4Q9IA 3ZH9B 2NZJA 3NC1C 4PC3A 2ZU0C 5IHPA 4Q00A 1I4DD 4QHYA 1WQ1R 2R2AA 3J81k 4FMDF 1IY0A 1QHYA 3MGCA 2ANBA 4CEHB 3TH5A 4DLTA 2Q9CA 1E2KA 2CVHA 2YOFA 5FUYA 121PA 3I72A 2RGDA 2QPTA 4BWYA 3L82B 3QF4B 2QM8A 1KMQA 4QJ5A 2GK7A 2ZSFA 4US0R 5J4YA 1UPTA 3U3MA 2XNDA 4PO1A 3SBDA 4DVGA 2WJJA 3LBNA 4MYCA 3U7HB 5LB2A 2XJ4A 1Z0KA 2JLXA 4QGHA 2IS2A 2QE7A 5FTNA 3EIHA 2ZAMA 3CKLA 4B6FA 3QIAA 3KJHA 1PUIA 2PJZA 1K5GA 2FZLA 5E7JA 4GOJA 4OI2A 1GP2A 2H17A 1C1YA 3QVUA 3X1YA 1E99A 4R2IA 5EE1A 2CMKA 2YZ2A 1SULA 4AURA 5A5GA 1FP7A 5JMTA 2PCLA 3K09C 1FOEB 3AUYA 2WJGA 4B33A 2RMKA 3E5HA 1KI2A 4GBMA 4GNKA 3GLGA 1NVVR 1DELA 3EWAA 1W48A 2ZVQX 4C7OB 2QT0A 4GZMA 4AY2A 1UKVY 1CJUC 1A1VA 4XOIA 3DKPA 4LV8B 4CF7A 2XB2A 1N0WA 3QEOA 5KDDA 3OIWA 1DPFA 2QG6A 3LX8A 3A4LA 1G5PA 5FL3A 1OXTA 1F2UB 1QF9A 4DT1A 1LS1A 1E98A 1AKYA 2JEOA 1VTKA 2JLQA 2ZEJA 3EZ9A 3LVQE 4AYXA 4A15A 2XSZD 4K8OA 1SVSA 3EIQA 1JBKA 4C9BA 1N5KA 3R7WB 1Z0DA 4ZKEA 1E94E 1RJ9B 4LV5B 4OHYA 2KSQA 5FI1B 3GD7A 4NBSA 3B1YA 4PXAA 2BJWA 4BFWA 5CYOA 4JSYA 4W9MC 4PFSA 3VX4A 2ZRNA 3MWYW 3AV0B 3O8RA 1E2FA 2I1VB 4OHWA 2P5TB 4Q7JB 3P20A 1VCNA 4LBWA 3T1VA 2RCNA 1LFDB 1FFHA 2RAPA 4X8OA 1AGPA 5JHHB 1DAIA 4D82A 2BEKA 2NO1A 2Q9AA 1AN0A 1KDTA 4W5WA 2AWNA 3ETLA 1U99A 3HP1A 3KUDA 2CNWD 4O2RA 4XD7D 2WWHA 3DM9B 3TMKA 4QFMA 2AR7A 2FH5B 4US2R 4DWJA 1G7CA 3BFXA 4G01B 4KJZA 2PZFA 2ZROA 3QUSA 1F2TA 5IRCD 1Z47A 2EU8A 4RY2A 3EIEA 1R10A 4DDVA 1ZM4A 4KLZA 4YXWA 3T1TA 1BIFA 1TU3A 4EJSB 3C15C 3AVYA 4TMTA 1D2EA 4DLVA 1WRBA 1ZM9A 2V8OA 4JKIA 2DWQA 4V02A 2GJSA 3SZRA 3LW7A 1VG9B 2L0XA 4RD3A 4EAQA 2QMOA 2ODWA 3A1SA 1B23P 3ADKA 2IL1A 3VR3A 4NL4H 2WBLC 1IN5A 1RPZA 2BIFA 2O0HA 4HI0E 4A36A 1MABA 1CJVC 3NHBA 2RHDA 4DRZA 4TLBA 4DDUA 1QG2A 4LJAA 4P4SA 1Q3HA 1NY5A 2GZDA 3AGQA 4GMDA 3W6NA 1KO1A 2OHFA 4GT1A 4TYQA 4DLRA 1SHZA 1ZCBA 5JRZA 2MSEB 2O8CB 4LCBA 5JLJA 4DSNA 1KI8A 4V0ME 3L0IB 4P4TA 1UBEA 4ESHA 1G8HA 1OE0A 3I5YA 1T0JB 2QP3A 4RFSB 3DEFA 1H8EA 3MRSA 4LHYA 1US8B 1S96A 1KIMA 1FMJA 4LC0A 2ZI4A 4A8JA 1U90A 3GLIA 2ZYUX 1HA3A 1XTJA 3OESA 1WF3A 1GIAA 4QBFA 4TQ9A 2ZRIA 2IWHA 2JA1A 1H8HD 3W5IA 3IGFA 5GJCA 3B2EA 2GVDC 3CNLA 2DPXA 3RSOA 4RD4A 4NH0A 4TT3D 3WYFA 4CT4B 1X1RA 4URVR 4NU0A 5EZ5A 3HYTA 3Q5DA 2NOAA 2FEOA 3QENA 4LYHA 3TNFA 4KHZA 2O8CA 4TL6A 4TTQA 4LPKA 3JVVA 3OE7D 3CNOA 4XWKA 2HUPA 4S2EA 3MAAC 2WSSA 1RC8A 5GVSA 3H0KA 5KPJA 3KQNA 4P4SB 3X2SA 2DY1A 2VP0A 3GLHB 4FWIB 5TVKA 2GJ8A 1YJ5A 2IA5A 3RS2A 3KKMA 3FTQA 2YWEA 3K70C 3I32A 3AF0A 1NLFA 2YV5A 1TEVA 4O2LA 2LCFA 5K8IA 3LBIA 4BECA 3G5UA 2IUSA 3SC3A 2FA9A 1GWNA 4MYHA 5BWMA 1XXHA 5DNYB 4Q1DA 2GBLC 2IHYA 2QU8A 4JIMA 1UF9A 4TTPA 5A4JA 1E2JA 2NPFA 2OCYC 1G19A 1NF3A 2FPKA 1S9DA 3IPXA 3DHWC 1D8TA 1E4VA 3NEYA 2C99A 4LYJA 3ZVRA 2RH5A 1GRQA 3WNBA 3X1ZA 1AM4D 2QNRA 3CZPA 1X86B 8OHMA 4NYJR 3H84A 1KAOA 3PUYA 2A5YB 3QKRB 2GXUA 2IUUA 3EX7C 1PV4A 2BBOA 4B44A 4M9XA 1QVAA 3A58B 3TQCA 2ATXA 2XTZA 4AG5A 2ZM5A 1D6JA 1ZC4A 1YZNA 1Q12A 5BN3A 2GXSA 4DIDA 4RKEA 3TUJC 4CT5A 4CVNA 4QGAA 2ORWA 1W2GA 4IXMA 5C2JB 1XWIA 4GP6A 2XZLA 1NBMA 3EXAA 2JLWA 1WDTA 1M2OB 1NLYA 2ZANA 4KFSA 2A5GA 4OQXA 3A1WA 3MUFA 2HJVA 1FNMA 3A4MA 1GRNA 1U8ZA 1SKQA 3EA5A 4EJSC 3D8BA 1NKTA 2OLKA 4L5BA 2QGNA 5JJIA 4BE7B 1BH2A 1E0KA
chains in the Genus database with same CATH superfamily
1RJ9A 1Y5MA 1B15A 2FPGA 2WF8A 3QKUA 4LCEA 4X1YA 4OQDA 2R8PA 3ZEAA 1SRQA 1W1IA 3DM5A 3MXOA 4G23A 1HGXA 1E3JA 4LC9A 2BFEA 3GAAA 1RAEA 1EHIA 3L5KA 4D8YA 5JC8A 5F4ZA 2O8DA 2PYIA 2W2NA 4JLAA 4BLRA 5CB4A 2BFNA 4EJMA 2PEYA 2MSDB 2OENG 5BQ3A 1S4MA 1WU7A 2CHUA 2TECE 2ZUDA 3L8FA 2O8BB 4YAKA 1EBFA 1JDVA 4PZLA 1YL5A 4RF5A 2P0EA 4MTCA 1RPJA 4BV3A 4DY4A 2OQRA 5IJ9A 1XMIA 4FGZA 3JQGB 4E94A 1FLAA 1J06A 2YS6A 4DF3A 4B9EA 4C7OA 1V0JA 2P78A 3SMQA 5IF9A 4IXWA 4CHTA 3RK0A 1H2WA 4RH0A 2PCJA 1DRWA 5AVKA 421PA 5H8WA 3VO8A 1SHTX 2XQGA 3UHFA 1ETUA 3G0BA 4L0CA 4GUDA 4JN6B 4B80A 4PLZA 3QEAZ 4H1WA 5G0VA 1CV2A 5C1IA 2O3UA 4D3ZA 1LLUA 4PG4A 3I6BA 4QRHA 4YGXB 4OYYA 5ENVA 4ZCQA 3C3CA 4OP2A 2QRPA 1Q2UA 3AW8A 1N3IA 2C2WA 2V6GA 3PQ4A 5KWVA 2OXCA 2QVCA 2Y0PA 1IBKB 3QX8A 1QG0A 1WTCA 3AL3A 1NDUA 4EG7A 2ZETA 4Y9SA 4RJIA 2ZZKA 3ZC3A 5CTAA 1DI0A 3O8BA 4ZANA 1VLVA 1F4VA 1DV2A 1Q1GA 3PRYA 2KYRA 4DGQA 3FLMA 5TY0A 4CUJA 4I2VA 4Z1OA 1YJQA 2QTHA 4YCAA 2B0CA 2ZUTA 1UH5A 3I39X 1RD4A 4NCIA 3ZH2A 1C30B 2JFZA 3QEMB 4IIVA 4XIGS 4JVSB 4MA0A 3HXTA 3LYUA 3MTBA 3P0JA 4CIVA 1KJQA 4Q9JA 3HI6A 1IY8A 1QAQA 1JXAA 4NX2A 1V1RB 4HQOA 4LRWA 2ASEA 2NYVA 1L5RA 2FLKA 4OHRA 3RVQA 2WUEA 4R9NA 3I04M 5EXSA 3PRHA 3LU1A 4NDAA 5FIUA 1JQ5A 1IAQA 3TDKA 4XWOA 5FI3A 1XTVA 4TUYF 1NL3A 1VE6A 3SSMA 1CCWA 3VNVA 1QHHB 1XL0A 3MFYA 2RCYA 4TVSA 4R16A 2O6HA 3FB1A 3GPBA 2F8SA 2FFAA 1DFGA 2OECA 1WEHA 1KVSA 2ZATA 3IHWA 4YDHB 1GGFA 1YZUA 2B0JA 2FNAA 2OCPA 3L3BA 2NAPA 1N4DA 3MUEA 4NJMA 4BO5A 5GZ6A 3GOQA 1GNRA 5IU6A 1MB0A 1E1CA 4AJLA 3COPA 1C8KA 1WHSA 2GN9A 2HA5A 2AJDA 1TFUA 2W00A 3NM6B 4LOHA 3M4XA 4OHBA 2QRZA 4PO9A 5AO9A 2PX3A 3R3WA 5LA6A 5AKYA 2JHPA 4UEKA 1ARZA 1LVHA 3DZ8A 4QM6A 3QE9Y 1NXVA 5C37A 1DC4A 1B16A 4RM2A 3G6WA 5FL7A 3IOMA 5LVAA 3TSWA 1K0FA 1TA0A 4MVJM 5BN4A 1KI9A 4LYAA 5CA0F 3TTUA 2QW1A 4O6VA 1Z2OX 1G2QA 1QGAA 4H7IA 4HJRA 5E8JA 1MO5A 3I09A 1V43A 1IZ0A 3O5AA 1VCHA 2AZXA 4CRWB 3FCAA 2HYIC 5JZSA 3L40A 3GARA 3IDQA 3K92A 3NX4A 1MRNA 2C94A 4WCVA 5IAKA 4V38A 3GQVA 4NE7A 5T3YA 3WKDA 5DW0A 1M7HA 1E4EB 2BZ0A 1DKQA 2QI9F 4FQ8A 5AP9A 3EQZA 4C78A 4GR9A 3LFUA 4Z4GA 1U1CA 1XXLA 4UU1A 1EUDA 5JRJA 3DONA 3MJHA 3CBQA 1XHEA 1II8B 2JLAA 3GFSA 5KYYB 3AM4A 2Q5FA 1P1FA 1XAIA 4MUJA 3VNRA 1ZMTA 1T4BA 3SN6A 2A5LA 2I7DA 3BSYA 2P7IA 1S02A 5B7NA 1E1LA 4RVNA 4D9HA 3RFTA 3DHNA 1FFBA 1UJNA 1J00A 2BKEA 4Q39A 2Q99A 4KKXB 4RPHA 2ICAA 1E3WB 1A9TA 2EERA 1XN4A 4UULA 4X6UA 1UXIA 1R6VA 3RV3A 4B3IA 5BVGB 1FIUA 3IDOA 3ZCTA 3EFHA 2JLRA 5HVNA 1HNXB 3PQ5A 5EPUA 3VC3A 5ALKA 1M0WA 3KZ1E 4XIJA 1PGQA 3CHYA 2ZBQA 3IVMA 5D5PA 1R7RA 1HETA 1GADO 1N1EA 3G68A 5G2OA 2AF3C 5CT6A 1ORTA 3FCCA 1GRCA 1SK9A 1UDAA 2ASVA 5F4BA 4UE6A 1CVRA 3RHSA 3EEOA 3F6RA 2FWIA 3I6MA 3STXA 1WBDA 4BX0A 3ORFA 4I55F 3DP7A 4KQ2A 1M73E 3KUUA 3KG2A 1DJOA 1Y3HA 2BFPA 3EVFA 3JR3A 2CDRA 1OU4A 1GD1O 1R27A 2EHDA 3CINA 4RE5A 3PKJA 3DE1X 4B45A 3O3NB 3ICQB 1NV8A 3EEIA 5BVGA 2EJVA 4QDJA 1QIEA 3FXAA 1MJGA 2OZPA 3O4IA 5B57C 3K0KA 1VECA 1GU0A 1II9A 2O2GA 2WM9B 3UY4A 2A1UA 3MJCA 5CVDA 4TM8A 3S0JA 5H68A 4L0MA 3WYAA 3TWOA 1NRJB 3DL2A 3ENKA 4BMZA 3PT9A 1OXMA 4B3SB 1VG1A 3CQ9A 4R01A 1TLTA 4RF3A 1GARA 3V2IA 4RPJA 4AZVA 4ZI3A 1D4AA 5CIYA 1EUDB 1RKXA 1T3SA 3IUEA 3D4OA 3JZAA 3GIWA 5HCIA 4M8IA 1UK7A 5GZ3A 1KYQA 2R87A 2VCHA 2VJAA 2JIDA 4YJHB 4DSOA 3TUZC 4M9UA 1EGHA 3D3KA 1X8LA 1E4EA 1I5RA 3A1NA 5CCDA 4ATNA 4XX1A 1RKUA 1I6MA 3C8ZA 3ID6C 1DBSA 4HZUA 2GKOA 3V7UA 2XB8A 1EDDA 3NAZA 2Q2NA 4M21A 1XZQA 3V6MA 4C0QC 1S5PA 1Q11A 2CJXA 3A9VA 1TYCA 3GFPA 3WDLA 3MBIA 4ZFNA 2G8LA 9GPBA 2BFFB 1T3ZA 2ZYSA 4MRRA 3WGUA 3RCBA 3G2KA 2X2FA 2C7PA 3ZGVA 2GFIA 1TU4A 3U39A 1NVUQ 4Z4EA 4U5QA 1DQNA 2HNAA 4CUKA 4UDYX 3HYNA 1LI5A 4RPIA 3UAXA 4DYHA 1FJGB 1OAOA 4ARCA 3BDIA 1IOZA 1GZ7A 1G1AA 4EPWA 3K9LA 2ZE7A 3EGXA 1XU4A 3QNUA 4FN5A 5LA6B 2J5RA 3OD1A 5KOHA 4B7XA 1P77A 1UIMA 2XTAA 1Y0BA 2X6QA 1E59A 3O1JC 2XVXA 4MVJG 3FAZA 5DBGA 3S6JA 4BOYA 4QOGA 3FAKA 1D1QA 3AFIA 3TEMA 2C2BA 2O9JA 4C20A 3D8NA 1O97D 2UUAB 3F98A 1NNLA 2M2IA 1PLLA 3PHGA 2PTGA 1VZ2A 4TWIA 5ALVA 1QHHA 5E9WA 2QRGA 3CPSA 4HB2A 1S2NA 4RS4A 4MA5A 3FPJA 4F4HA 3RAPR 1NN5A 1NWHA 2C5FA 3FN4A 4B0PA 5K0SA 2V97A 5K8CA 2BISA 4EX6A 4Q05A 4NFHA 1QQ7A 1GTMA 5IWCA 4KVFA 2OHXA 4KSCA 4TYMA 2WR8A 3H5VA 3KQTA 4IICA 5U9CA 4MUBA 5IKPA 1A8PA 1EYZA 1UKYA 2P2LA 1S6YA 2ERXA 1EEHA 2OCIA 3CNHA 1JP7A 1TJYA 1VMIA 1PBTA 3ETHA 3PI6A 4JJZA 1EP1B 1E8DA 5BWNA 2OV1A 4HXEB 1JG6A 3DQPA 5L3QB 3X1KA 1EWKA 3VX3A 2P5SA 2ZWIA 1I3MA 1RZVA 2AD1A 1AQIA 4R2WA 4YCSA 4KIUA 1NASA 1N5LA 3KR9A 3O1LA 1KQNA 2ZBVA 3O92A 3O4HA 3GLQA 1T4DA 5IF3A 1EFDN 2AXNA 5ALEA 1KEEA 4M6WB 1GVHA 2QKYA 2XWJI 3HDYA 2O1WA 1E7SA 3QKRA 1AC5A 3F3YA 4JYBA 1GPKA 4QUHA 5H82A 4GL2A 4EKEA 1XB2A 5ARBA 3LFHA 3RIEA 4ECAA 1AUXA 4O25A 2PN1A 5JH7F 3UMMA 1Y6ZA 1KMHB 5B12A 2GN2A 4TYNA 2OD9A 4FKMA 1J24A 2WIAA 5BQFA 3ES9A 2MHCA 4ZQIA 3B89A 3G2LA 2J0SA 3M8KA 1KY2A 2AFIB 3PC8C 3PF9A 2AC7A 4GOMD 5BYJA 2VLIA 4K6MA 1DCTA 1UOPA 4JITA 1TD9A 5EFOA 2DAPA 2GZ2A 4C5CA 3VVLA 1MQAA 3L2OB 1TUEA 3QXCA 1Z8NA 1FS6A 2UYCA 1EGMB 5TV2A 3MT9A 3NKFA 2XNDD 3P26A 3THWA 3NBXX 5ECWA 4Q1BA 1AQ6A 2O8BA 2M1ZA 5FFMA 3I9KA 2DGDA 2QPAA 1WO8A 2N75A 3LDGA 3M4JA 2RGNC 4ZI7A 1SCKA 3BQ9A 3OCXA 2J9RA 4XM2A 2OFWA 4YP1A 3HO6A 2EJBA 2NZXA 3AIIA 4YQYA 1RXYA 4V39A 5KTMA 4MYTA 5K3AA 3VU8A 3DPIA 5CA0B 1IPHA 4P33A 4BO0A 1I5EA 2ZTMA 3IT3A 2P2GA 2Q6IA 2HJ9A 1QC5B 2CVQA 3PC8A 3KKNA 4HDRA 1DWOA 1CQJB 2E4YA 1Y4UA 2NWQA 1PTJA 3PC6A 5BV7A 1J8MF 1WUHS 4I4CA 3R6LA 3H1PA 1I0LA 2XVAA 1Z36A 5DH9A 1K88A 1G5IA 3I42A 4H7KA 2PO5A 3PU6A 4RTKA 1E20A 2CYBA 3C45A 1X94A 2ZRPA 3UWOA 4MR8B 5TGDA 4FB4A 4JOSA 2ZTHA 1YZFA 4HHEA 2G70A 3WS7A 4PE5B 1TC1A 1F6WA 3P4YA 4AN0A 1GT91 3SC6A 3K8OE 2X2EA 4RCZA 4I4TF 3HABA 5G3ZA 3L41A 4Q4HA 4YV0A 1UPCA 4BBZA 4MPTA 1YFJA 4UVEA 1V3VA 2WJIA 4YT2A 3OETA 2PA0A 1O6GA 2PUBA 2HPVA 3K6KA 1DKLA 1WZUA 1TYBE 2GEFA 4OREX 3DB1A 1AKQA 3MTAA 5AW0A 4B2LA 3IAS6 3TSCA 1HQKA 4FWBA 1XKLA 1XU7A 3ELYA 2H92A 1O6FA 1JAHA 4PC7A 3UAYA 4JBLA 2QTWB 5I7VA 4WASA 3PL1A 3PEWA 1PU2A 1LB1B 4JBYA 2JDID 3OQ1A 4WN3A 1ZCFA 4UBOA 4LY9A 3NIWA 1AO0A 2QYHA 1NR1A 3PDJA 1KP9A 3H1BA 3L7BA 4FHDA 2QRHA 4D43A 1GUAA 1ZH0A 2PH5A 2VO1A 4UW9A 4MVCA 2PFSA 2XI4A 5CX1A 1JTVA 3JQ9A 5JCJA 4EIWA 3E05A 3O93A 3R2JA 5K3BA 2Y6VA 5I45A 4DB4A 1P1CA 2YWRA 3Q7EA 3N58A 4HGYA 4BQNA 3TLJA 5EYPB 3Q2KA 3O8QB 3SX0A 1U3WA 4NBLA 5CEFA 1W1UA 5HFAA 3DD5A 4UM9B 1FMTA 1CNEA 1D6MA 1E6LA 1E60A 2V98A 2ZIFA 3C3KA 3L6BA 4FGLA 4KQEA 4DR2B 2VF7A 2QVXX 2IT1A 3OVMA 1DFHA 1ZD1A 4ZAVA 4P5DA 4F2GA 1J5PA 3IKLA 4MUEA 4R54A 4A6DA 3DBOB 3SYMA 4F2DA 1E66A 4I5IA 2H51A 3K4QA 3SQOA 5HW0A 1NMXA 1GSOA 1P4JA 3R74A 2LIVA 1E61A 4TSFA 4E13A 3BIFA 4JC5A 3I1JA 4HQ6A 4ITRC 1OLXB 3MPOA 1QMPA 3ZHZA 5BUCA 4XQCA 3E15A 4TUYA 1EFPA 1KYWA 2P9BA 4LJ7A 5CBKA 3LY9A 3RVBA 1Z7WA 3AF1A 1OZHA 4W5TA 3FOCA 3W3AA 5F3RA 1NM5C 5TJHA 4DUYB 3CGWA 1KNQA 2H29A 3DFUA 3RUHA 3GNTA 3KEMA 3L7DA 5IK2D 3ZIAA 1TW3A 4RTNA 2BM9A 5EWJA 2Z98A 2C3PA 5E6UA 4HTAA 2VPQA 4B31A 1H8HA 1WLSA 4CQLA 4YROA 4N76A 1H0HA 5CIQA 2D06A 5AUNB 2UUOA 2Y1KA 5LC1A 3WGOA 4CV3A 5LA6F 3P97A 3R4VA 4CLOB 5FOUA 1FUYB 1OXVA 4TKVA 1QF6A 4X66B 1V11A 1L1EA 3B2NA 3RU3A 2GA9A 1M2EA 1YAHA 2Y93A 4NCXA 1DWPA 1HWYA 4WY5A 1PR5A 3GZNA 4DG5A 1V37A 3FF1A 2Q29A 2PS0A 2RGEA 2RGCA 1RLOA 2B8WA 4D9CA 1VCIA 3CY6A 5D1NA 1ZD5A 1E9BA 2ONYA 4F60A 2AZMA 2MDTA 1A1SA 4BX2A 2B6NA 4ZC1A 1SEVA 2ZUUA 1CEQA 1V9SA 2GR9A 3LVFO 3QFHA 5E1OA 5JVDA 1F2UA 5M3BA 3TF5A 3DOFA 1EGVB 4G67A 4D4LA 4RU1A 2VJPA 5JYDA 5BUSA 1DG9A 5KOYA 1FNCA 4C30A 4I50F 5AK6A 3T35A 5TEWA 3R9XB 1X1EA 2WSIA 1USWA 1VE7A 3ASVA 4TN5A 4B17A 5J23A 4K9RA 3O3CA 3WLNA 4IDBA 4NULA 4E5PA 2BUAA 5JJKA 3WZLA 4IINA 3X1XA 3QPVA 3O95A 1J22A 3D6FA 1CY0A 3PPIA 4MH0R 2W9XA 3PDUA 4XJVA 5KAPA 5IJZA 3OZXA 5KHLB 2ZYRA 4ENPA 4E2FA 3IT0A 2EGUA 2IPNA 2P68A 3P19A 2YYZA 2PRKA 1M8PA 5EQJB 1U8UA 3UJ6A 3RVKA 2PLFA 1RI3A 3IVCA 4I6GA 4U4AA 3FZEA 3S27A 4E31A 2QHXA 1O97C 1ZITA 1PFGA 4KO2S 4WCDA 3F74A 4B87A 5A5EA 821PA 1WNFA 5C7IO 1IBLB 4DDWA 3VC1A 3UMSA 3DMDA 1XVUA 1G3IA 1HSOA 3HCPA 4BVEA 1KRWA 4UCXA 1B14A 1NW8A 1OD6A 2BN4A 5AM3A 1EMDA 4QU0A 5FORA 4D26A 1BW9B 1Z8FA 3PEUA 3SY8A 2HRRA 4JOQA 1UANA 1NP3A 2AC2A 3ND6A 4CFSA 2WWRA 2KX7A 1IUNA 4NV1A 4ZK6A 2HSDA 4TROA 4DC9A 5LP6A 1KEKA 1TKBA 2HSZA 4KTTE 3COZA 4RM3A 4WD3A 1ZUNB 2Y71A 1U4OA 3OX3A 5I8PA 3IBFA 4BWGA 4A0HA 4EA9A 4KV9A 4R31A 1T5TA 3JW8A 1T2NA 2B82A 1KC3A 1KPHA 2YINC 3HY3A 1WS6A 3SJCA 1DG3A 2ERYA 4N01A 5HZMA 2ZQ5A 2JCSA 1T13A 2IYAA 2OZKA 3N2GB 5F77A 5G3YA 3U7IA 5JY1A 2GBFA 5IT5A 1E2BA 1YRHA 2YBDA 3GXBA 3OBBA 4Y0AA 3ROXA 1JAIA 4ZZ3A 3RRYA 5JAPA 1A4RA 2X9QA 1BMQA 2ZJ0A 3CZAA 2FN4A 3GAFA 4Y9RA 4EWLA 5DM70 1TRHA 2QD4A 1RZRD 1AKTA 1ZJ4A 4TS3A 1SVWA 3DFKA 4KH0A 4L1KA 4MGZR 3W6OA 5DN9A 3KR0A 5EXTA 3CO0S 5BSEA 4OYHA 4HH0A 1GGNA 1NLMA 5JG7A 3G5MA 2RSLA 2ZUWA 1WCXA 2ONZA 3HBJA 4HNRA 4LGMA 5G1PA 3ADDA 3L0YA 3AYZB 3JQ6A 5ERYA 2ZUCA 4DM7A 1H4SA 3EG9A 3Q7TA 1NX9A 5DBEX 1M72A 2ZTVA 4UDXX 3E61A 2C7RA 2C07A 1YRQA 2W2QA 3OCWA 3LY7A 5EXEA 3AKEA 4A0GA 1B74A 4Y2HA 1IJKA 1X9IA 2VZLA 4KI7A 5B3AA 3K5IA 4YX9A 4GI5A 2ZI3A 4KXVA 5AJTA 3F5DA 1UFKA 1NSFA 3LCMA 1K8RA 2NX2A 3TZQA 5CDFE 3MMNA 4MHTA 4MULA 4B8WA 3LT1A 2JASA 1ORHA 5C7OO 4RIHA 4O29A 3VU1A 2FVXA 2G5PA 4MMYB 3TM4A 3HXOA 2F3PA 2GEUA 2GZRA 4M1MA 3IHKA 1GILA 2J3EA 3U09A 5CBPA 3QVXA 2R7LA 5DXFA 2IFTA 2AR0A 3P9XA 1YR8A 4WBNF 2D74A 2FEMA 3E81A 1TMGE 1XLWA 4HUQB 4HLCA 2ID4A 3WLRA 5BUQA 2ZXUA 1LLQA 3ED1A 1X38A 1G2OA 3H9BA 3OA0A 4PLTA 1KMIY 5DX8A 3U3KA 2A5JA 3ZNPA 4K86A 5A5FA 1ZJWA 2WAYA 4C3OB 2P2YA 4IHAA 1NLUA 4FYWA 4EPVA 3MS4A 3BGSA 4LZNA 1CUWA 3VJMA 4HRVA 2R4UA 3CM0A 3L8MA 1RYFA 4IJ5A 5C1DA 1ZA1A 3O84A 3AC0A 4E32A 1DBRA 1O3YA 2WU3A 4UAGA 1SUCA 5BO5A 4BZWA 2BDTA 2NP7A 2XECA 2REXB 3G8DA 4D3FA 5CDUA 3M5CA 3A14A 1NN0A 2ISCA 1U7WA 2V59A 4YN3A 4II2A 3AY3A 4EVIA 4N3CA 2EKLA 2P90A 4IGIA 4E88A 4HDOB 1R4NB 2XLCA 2ZREA 4GC5A 2GF0A 2P3OA 1VHJA 4JR1A 4UREA 4E1BA 2AJBA 5F7XA 2KJQA 4EX7A 4YV2A 3A6PC 4EY7A 1PWHA 2QROA 1ZIYA 3SHWA 3OIUA 4KIGA 1G21E 1XNGA 3FTCA 1A2KC 2ZJ1A 5FFNA 2XUFA 1P8AA 3E9RA 1GTJ1 2F8TA 3HU2A 5I01A 3G1WA 1I33A 3ROKA 1O95D 3VI4B 3PFBA 3WXMA 2UYHA 2QOEA 3BWYA 5H16A 4TXJA 2L42A 3EXHB 1J70A 1W0JA 3HBNA 1B6GA 3PFNA 2H1CA 2WHXA 1XCOA 2H11A 5HA5A 1O89A 3NWBA 4JLKA 3LCCA 4XTCS 4FJ2A 1RFGE 2WDPA 2M6KA 2FP4B 4LOIA 4OH1A 4F06A 1KHTA 3NWPA 4EKIA 1I2AA 1K8ZB 2VJKA 1R6DA 4R9UC 2JFQA 2DEUA 3ZU3A 4NBWA 2Z9DA 1ODKA 5JAQA 3X1WA 5JECA 4Z4CA 1Y4SA 4O2AA 3JWIA 2VP6A 1PI3A 2ZRCA 3KBOA 1SXJD 2YNMA 1ONNA 2RJ3A 1RQLA 4QXMA 1YDFA 1XNRB 2LIPA 3RRNA 2GJ9A 3HZHA 3B70A 4ES6A 1W9HA 2BR4A 1CUUA 3UQZA 1A9XA 2EP7A 1V8FA 1DADA 2ZDGA 3ZPXA 1X80A 4JJIA 1PZGA 1IB0A 4ZICA 4QAQA 4QREA 1FDSA 5LFAA 2NO7A 1STOA 5EAIA 3I1IA 4FEYA 2HHJA 4EPRA 4ODIA 5B2EA 1VYVA 4IV8A 3S44A 2FW0A 4MUMA 3MT8A 4UDNA 1KVTA 1CDOA 3EGWA 2OPBA 2NU8B 3HB9A 1BEUB 4AMYA 1FYFA 1IFXA 1XO1A 1Y89A 1NWCA 4JLWA 3S7ZA 3BGOS 4R1SA 5B1YA 2OB1A 2PUTA 1GA6A 2OO5C 2AN3A 2ZUVA 1XRLA 2Q4BA 3N05A 4WKBA 3UJDA 4GYJA 5KNBA 1I7DA 2CT8A 1JUDA 3RYHB 1N5OX 3LO8A 1BOFA 3ZGLA 1POWA 2G28A 4PYOA 1QB7A 2BCJQ 4UUOA 4D81A 2YY7A 3ZE0B 1V5FA 2GWRA 1GY8A 2HDOA 5EKUA 1AKRA 2EZ4A 1WZIA 5FOTA 2J4CA 4CETA 3H16A 5FWNA 3F90A 5JPCA 4K2AA 2WKQA 3I0MA 2GTIA 5C8VA 1JJ7A 1OFGA 2JJQA 4OLHA 2P5UA 1Y34E 3DAOA 4RHCA 1XL1A 221PA 2TMYA 1J5XA 2V9PA 3B6ZA 3LC1O 4BNMA 2C8VA 1XZNA 1GSHA 2Q8QA 2ZITA 3H8SA 4I4TA 5BWBA 3HRHA 5LKRA 2SNIE 3HCCA 2VYFA 1YQWA 5EIBD 2OUKA 2PZ8A 2QDKA 3D6NB 2GTPA 3GRKA 3H2HA 2FSUA 1ZW6A 3F8WA 3MT7A 4IJWA 3W8NA 5KOIA 8LDHA 3KQLA 2JGLA 1TK2A 3INTA 5DZSA 4BQFA 2Y2VA 3AFNA 1NRIA 2J0VA 5J5CA 3Q41A 3KJIA 2HUNA 4HS4A 5DKFA 3H9EO 3WLQA 3JASB 1VKZA 4U2BA 3ROFA 3D54D 1W36D 4GP9A 5J63A 1WULS 3BGIA 2F1KA 2CNOA 4RQBA 3T5MA 1DWQA 1GTVA 1W4BA 1Q7EA 2ZR0A 3BREA 3LYHA 4P36A 4RENA 3V3TA 3VSEA 2P62A 3NOOA 1QF7A 3KCNA 1EUCB 4QBGB 2FLWA 2ZYGA 3T4UA 4BFSA 4P3NA 4FWTA 1Z2NX 1PL6A 3B3FA 2H52A 2F43B 5ES3A 4DANA 5A9SB 4HLUC 2VUTA 1CUYA 1Y7PA 3F6PA 3H6HA 5GY7A 3PTAA 2Q1SA 2GRJA 1Q21A 2F67A 3BB4A 4I8XA 3T7IA 3T7JA 2B4KA 3CRQA 3MQ4A 9ABPA 1H0SA 3MAJA 3GJXC 3CVVA 4HH1A 4P5EA 3G8AA 2HU8A 4MV9A 3T9FA 1XMQB 4AKGA 2Q4DA 3G9XA 4LJ6A 1L4MA 1DAMA 1KZ1A 1OC4A 2MYNA 4JVOA 1A71A 1Y8CA 1E96A 1QKKA 1X7ZB 3JVUA 5ARCA 4B5KA 4N5NA 3GFVA 4CM4A 5FOWA 4G1UC 3G17A 4L5JA 1U3FA 4KTVE 5A9TA 1FPQA 5KHAA 1Z38A 2CNNA 2MOKA 2FG6C 3T3HA 4ZKDA 1MKYA 2NTEA 3LPNA 4WLEA 2H1FA 4S0ZA 5IAGA 4Z5XA 721PA 2JBAA 2I34A 4G2NA 2DPMA 3T5BA 3TOSA 1DTEA 3UBTA 1X6VA 3FA2A 3FHJA 2J3MA 1FQWA 1Q0QA 4IOKA 5A7FA 3UO8B 1NW7A 4ND3A 2JLYA 1YI0A 2JLZA 3E3LA 2JGDA 3QUAA 2WUGA 1SAYA 3LKZA 3RJZA 2J7PD 1LJLA 4F6RB 2RAVA 4KREA 2Q07A 4YJFB 2F7SA 5CCBA 2BTOA 5BRNA 2QX9A 4HATA 2I55A 3EHEA 1TA9A 1JHUA 2WVHA 2EKDA 3UGKA 4EEZA 1H3EA 1Q0PA 1HK7A 2G9UA 2PL3A 4X0EA 3FSGA 5DXAA 4ZV7A 1YA8A 3U6BA 4JC0A 5EP3A 2YIDA 3HFGA 5AVUA 4BQIA 3SZOA 3T4XA 1J9GA 2HT6A 2O07A 4HAZA 5G1NA 3ER6A 2EXXA 3H86A 2XAUA 4DLSA 2W4QA 3EARA 3GF4A 2FPRA 3TXYA 4PLGA 3E3NA 3NQ41 4CM4B 5A03A 1PVVA 1XJ0A 4CL2A 2VT6A 2FI1A 2A86A 3IKJA 3D8RA 3L7AA 4IZ6A 5H83A 2WY2D 4Z6KA 3CXRA 4KR0A 3WL7A 3K5WA 5LDHA 2BGRA 4N3GA 5DRYA 1BMTA 3PPWA 4RLFA 1JEJA 2HREA 3MC1A 1ZOIA 2AJLI 1L7DA 1K7XB 1SMKA 1YOVB 2B92A 3DWGA 1ZL2A 5K8TA 3RS0A 4DCSA 5JMWA 3IBGA 2BEVA 3ONDA 3AVUA 3QVTA 5M04A 2G80A 1RWMA 2WJ6A 3ZI4A 2NVUB 5JASA 3A2KA 1U65A 4JUFA 1CBUA 1N5IA 4GM4A 5FLKA 3HUFA 2H7VA 3Q8KA 1KOFA 2AR9A 1CUVA 1XLTC 5GPBA 1RRFA 4XJTA 3L0PA 4URFA 3QLJA 3LY8A 1L3CA 1T3HA 5FUQA 3JVIA 1NOKA 3D9QX 3UAVA 3EHDA 3GQBA 5H3CA 3QVVA 1TKCA 3I3OA 3CUTA 4QU8A 4WA7A 3DBIA 2CLEB 2FWRA 1J07A 1GCOA 4JB0A 4MWBA 4J0CA 3KC2A 5D85A 4AY4A 3HG7A 1JRLA 5DXJA 4ZARA 4IWXA 4GXRA 4MW9A 4QDXA 5LZ4A 3QMMA 2DKFA 5JANA 4LY0A 2A9PA 1T9CA 1AG9A 3V8MA 4A73A 1H2BA 1LVUA 1X1DA 2R5WA 3GG2A 3K1JA 3RYIB 1FNDA 3HB7A 1TT5A 1XTSA 4QQFA 4ZU1X 5TARA 3UKDA 4WLNA 1GQRA 3IAM6 3H8JA 5KDOA 2PE5A 2R1TB 4KMMA 5JFGA 1XZFA 2Q5IA 1BN6A 4XSHA 4LOJA 1ZCJA 4ERNA 3AVVA 4DFDA 4K2HA 4RVGA 3H4TA 2DP4E 2E5LB 2CN1A 2GUWA 4INZA 4R1OA 4BC1A 1R5OA 3BRQA 3OLWA 5IT4A 2YQZA 3FDIA 1QCCA 4N3NA 2GYVA 4DEVA 5LP6F 1NMZA 3E9YA 1Z4NA 3CUEF 4NJEB 4WJZA 3DBHB 1V5EA 3IV7A 4L3OA 4UUMA 2VBGA 4OXXA 5AMXA 1QGZA 1U7PA 2XNHA 1W88A 1UBHS 1Y1KE 3IS3A 4X6YA 4YJDA 1DT3A 5G0SA 1L9XA 2X58A 1EVEA 2VDQB 3MMPA 5AM2A 5IVPA 2V7QA 1J33A 4CNBA 1G8YA 1ZGBA 1MA0A 2I2AA 3O1HB 1YCFA 3KT8A 1SC3A 1PD0A 1RQ7A 2CWWA 2XODA 3B5IA 5KEIA 3SSNA 5IH3A 1N2OA 4ZYXA 2Z56A 4YCLA 3VQTA 3WOVA 1A5ZA 1J0XO 3RRMA 1UEJA 4G89A 2A0KA 3U4AA 1O0CA 2EBUA 3FCXA 3ZEIA 1FNNA 3ROGA 2X8BA 1G7RA 2O7SA 2JKZA 1KZYC 4NZPA 4KXLA 5GGYA 1F8GA 4R8SA 4AD8A 4G3XA 4OBEA 3H17A 4WVFA 5TQ2A 4HV4A 1F17A 1SZPA 2D5BA 2OG2A 4Q21A 4X7MA 1Q92A 1DVRA 1W94A 2OHIA 3JWEA 3ZE7A 5DYNA 4C14A 2VJBA 3V33A 5CW2A 1AHHA 2C83A 2W6JD 3CEHA 1YZ3A 3VYTB 1Y82A 2VRCA 4EJ0A 3AFOA 1DLIA 3CNBA 4DYVA 2VQ3A 3PFCA 1V4BA 4KFUA 1QH8A 4CU5A 3OEHA 5HTOA 1JYFA 2C3YA 2A78A 1THMA 3DMNA 4WECA 3VA7A 2QLMA 3H2GA 3DLAA 1EVZA 4D4KA 3ENNA 1ECCA 3H1TA 4RUKA 5EZSA 3OKAA 3DZFA 3PZBA 4D9EA 1OFVA 3D4BA 5GJVC 1HE3A 1ORIA 2G1KA 3BERA 1SELA 2G4LA 2QRJA 1ZXLA 4RXMA 1P0CA 4CMCA 4FLFA 4NENB 1U2SA 1NJFA 1YBMA 2XBUA 3V4SA 3BIXA 4I1YA 4Q4JA 2HK7A 4QOJA 1DRUA 1PJAA 4RK0A 3SHTA 1HTBA 1T9ZA 1DAKA 2ZTLA 2CL7X 4Z7NB 1C0IA 4G37A 4RZSA 1F2TB 2XCQA 3BF8A 4KMRA 2Q2WA 2I4OA 2FPWA 2MYPA 5TT0A 3RHFA 3VZPA 5JISA 1E89A 1MGPA 3AZPA 2IGTA 3IRVA 1E0DA 3BJIC 4C22A 4EB6A 5B30A 2WU1A 3UANA 1A76A 1R1DA 2C97A 2DPHA 2Y6UA 3CR8A 3N86A 4KE8A 1WG8A 5U4XA 3W4KA 1UWLA 4RV5A 3ZWNA 4YA6A 3BQNB 5C4GB 2HCBA 3ZUPA 3HO1A 4LDJA 5GQSA 3NPMA 1NR5A 3SXJA 3HDGA 2AUMA 5ALGA 2ZWMA 3GWZA 2UZ1A 2JGFA 3TR0A 4GOXA 1A8SA 1DRKA 4KRYA 2OBXA 1UBTS 2JIOA 2ZT5A 1T6NA 2DBYA 2FMXA 1NW9B 2GBGA 4GGPA 4OP1A 4W5HA 3VKWA 2ONCA 3C43A 1KH2A 2BFMA 4FYJA 3BN3A 3BTSA 4RZXA 3CTMA 5FV7A 3U3JA 1ESMA 2RGWA 3PWZA 2A9QA 1FY2A 3J81A 3FHTA 4GDFA 5EHXA 4UNIA 2IEYA 1UPUA 1VM6A 4D3YA 4YUZA 3W5SA 4J0EA 2R7MA 1FTWA 4NHOA 5CTJA 2G6BA 3G3EA 3TQIA 4EG3A 1I3LA 3LS2A 2R84A 3C48A 3W0LB 2RGYA 1HDOA 2Y0EA 1IZYA 3IDZA 2E37A 4BLTA 3ZZUA 4HDNA 4CL8A 4NARA 4H3VA 1ESEA 4YQFA 1UKCA 4Z49A 3CVXA 2DJ5A 2CLDX 5E6SB 2FFBA 5IZCA 4Q3OA 4QPDA 1PFYA 3EF3A 2JJYA 3VKVA 1EM8B 1QYCA 1IEXA 2Y1DA 4FFOA 1H0RA 3DOIA 3ZDRA 2R97A 4EP1A 3BCUA 3AONB 4Y2VA 3UA3A 3WGYA 4YRZA 3ER9A 2LDBA 4LC1A 3RK1A 5EE0A 1KJNA 4FOPA 4E5VA 1Q1NA 2JLSA 3DTYA 4R1LA 4J7XA 4MW5A 3VZDA 2H4JA 2O2EA 1MNQA 4A7PA 1PDOA 3TTWA 1M6EX 1YVRA 1W44A 4FUTA 3W5AA 2IYXA 4G1FA 1D09A 3T3PB 1MXHA 2ZE5A 3W8EA 4BE4A 4DMFA 3KVRA 3RQSA 4DLWA 2VP3A 2LV8A 2EJUA 1B1AA 4E03A 2PX4A 1CX9B 1EFUA 2GJ4A 2R0QC 1J8QA 1N4AA 1I4TD 1IEVA 2WUVA 1U7OA 2G7MC 5FUVA 4BTLA 3G2MA 3PJGA 2VRCD 1DEAA 3PC4A 1KARA 2XUAA 5HBGA 2XUKA 1UINA 5KVAA 4H7DA 4BLUA 2ONJA 4O5AA 3K6SB 5DTMA 5LMUB 2ZSEA 3VDRA 1NNSA 2RBGA 1P7PA 1QYWA 1U3DA 2JLBA 5FOSA 2KS6A 4L57A 1JDBC 1QM5A 5K3SA 2E49A 4R1PA 4EO9A 5TLSA 5EWMA 1XKQA 4G4SO 1W96A 2H9IA 3ADOA 4NU6A 4GE0A 3FOFC 1ESZA 3EDCA 3K9NA 2ZUBA 4I08A 5AVTA 2X19A 2IXTA 4C7JA 2QVGA 3CF2A 1A97A 1SUSA 1G6OA 1RIFA 1PR2A 1I10A 2GHTA 1B3BA 4XQEA 4Q6BA 3EIWA 5IM4F 2N1BA 3LUGA 3PKZA 4JEMA 3G89A 4TV8A 4GI7A 4YWHA 4FK8A 3GNLA 1V39A 3MYYA 3EE6A 3NNDA 4LCJA 2CEAA 2ONKA 3LNCA 3PUZA 4JX8A 1JHOA 1Q1ZA 3MOSA 3OECA 1XZAA 2ZUEA 3P0FA 1SVOA 3R24A 4MK4A 1SVLA 1CHDA 2CB0A 4ZT6A 2O4CA 2PUHA 2Z2KA 3OY2A 1TUBB 4JLDA 4NOMA 4Z2YA 3NFYA 2C0CA 3HYSA 2XMGA 4ZMRA 2VH1A 4W5OA 1YL7A 3H99A 3TN7A 3A6KA 2OCGA 3CEJA 2XKJE 2ATEA 3MB5A 4M4SA 2YOHA 3D0OA 4Q12A 4XQ9A 5AHKA 5T64A 1UJ4A 3S70A 5I7OA 1LPMA 2VR1A 1ES9A 2NZ2A 2VCYA 3L7CA 3S2YA 4RLQA 4QELA 4NWIA 3R6DA 3UK2A 2WTBA 4YP9A 3ZJVA 1GZ6A 4BKQA 1IN6A 1HYHA 4LWPA 3Q9LA 3UJBA 4ENWA 1U2DC 1RWKA 4FOOA 1PQ4A 3UXYA 4RTPA 1FBTA 1G98A 1DINA 3BHMA 4URXR 5GIOE 1ZL0A 2P69A 4JI0B 4OAOA 4M9QA 1UXOA 3BMQB 1N2IA 4QPJC 3TXXA 2QIOA 4YUVA 3OT5A 4AG6A 3L9XA 4QKQA 4QTZA 4ZVLA 3NYWA 4BEVA 4H7HA 1RCTE 3HA2A 5JFOA 1BS2A 1IN7A 1FPMA 4KW7A 2G9VA 1N0HA