3K9NA

Allosteric modulation of h-ras gtpase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
164
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEFDPTIEDSYRKQVVIDGETCLLDILDTAGQYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Allosteric modulation of Ras positions Q61 for a direct role in catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 60
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3k9nA00
5JS7A 2W6IA 4FN5A 2REBA 3AF3A 4FD2A 1CJTC 1YRBA 2NIPA 2FSFA 4DSTA 4JLDA 4QRHA 2EFCB 1XEWX 1FNNA 5HCIA 3P20A 3W6NA 4ARZB 1MO5A 1RRPA 1DAEA 1ZD9A 5KDOA 2ODWA 1CULC 2IBMA 2BVNA 1QHNA 2ASEA 5B2ZA 4C30A 3QG1A 5JMTA 5FPTA 5L3SB 2NO1A 4DCUA 5EUQB 2YWHA 1XD9A 2QMOA 3QPUA 1R0WA 1IXZA 1UDXA 2DHRA 1GUAA 2EQBA 2DB3A 2ZTSA 2ZITA 3HU1A 4N0EA 4AURA 4AYTA 2ZI7A 4KV9A 1II8B 1TF2A 3LQQA 1NN5A 2LKDA 2IEZA 3C7KA 3FWYA 4HDOB 3O8DA 5C18A 1P62B 4NU0A 2AD5A 2YNMA 2ZI5A 3CWZA 4O2LA 2REXB 4OBEA 2YJTD 4URZR 3RRNA 3IO5A 1U8YA 1WMSA 4LBVA 5FOTA 5M04A 3DVLA 2C96A 2BDTA 4Q4AB 2ZE5A 4OQMA 4RJLA 4D4MA 5CYOA 3EC2A 1M1YE 1HTWA 4LHYA 5L3QA 3BRWD 1E79D 1I4LD 1E0KA 4HAUA 4PO8A 2WTUA 4XD7A 3W8RA 2HXSA 2QPOA 3AGPA 2Q3MA 5E7JA 1Z6GA 4DUGA 3KJIA 1G3MA 4DZZA 1F5NA 3IEUA 4IW3B 3UANA 2RHDA 3BERA 2W2XA 3UKDA 5HE8A 1U99A 2V7QD 3K0AA 3Q5EA 1E2DA 2WWFA 3QKSA 1E2PA 1E4VA 1L8QA 2IYXA 1ZINA 3KKQA 2VO1A 5D3MA 3MCAA 1TQ6A 1Z0FA 3EXAA 2JLVA 4HAXA 5JI2E 1IQPA 1GVNB 4FIDA 4ACAA 1SVMA 1IY2A 5D3QA 4ERNA 3T61A 2XJ4A 1G7SA 3SBEA 2KBFA 5L3VA 2D3WA 1KI1A 2K5UA 1VYUA 2IYQA 1PLLA 3DO6A 3RC3A 3SQWA 3OIVA 2PEZA 2ZYVX 4QBIA 5K8IA 4G5QA 4MITA 4ZIRB 3M6AA 4WVFA 1IN7A 4JJZA 1OKKD 4Q4JB 5GJVC 2QI9C 3NBFA 3LX8A 3R7WA 4Q02A 3LFUA 5GADl 4JLOA 4P33A 3K9NA 2W83A 1CEEA 2J45A 2I3BA 1XTSA 1E2HA 1CKEA 2JATA 2ZROA 4ZKDA 3OAAA 1QZXA 5LPNA 3ZZUA 4DLRA 3UG7A 5G53C 2IWRA 1KDTA 1T0HB 5E7MA 2V54A 1ONBA 1GL7A 3THXA 4NL4H 1J7KA 2W6ID 1Z63A 2C2HA 3G82C 4LYFA 4V0OA 4EPTA 5KSZA 3IQXA 2YKGA 2ZANA 4TMWA 2A5YB 3UMSA 4JT2A 3QPWA 2C95A 2AKAB 4JYBA 1XTJA 2IK8A 4PAOA 4TWZA 2D7DA 3NBYC 1R10A 2E87A 4QBHA 4J0QA 1E9EA 3KJGA 1ZIOA 1MH1A 3PFIA 1SVIA 1CBUA 1AGRA 2ZJ5A 3KTAB 3KXKA 4P4UA 3BFXA 5FPYA 2CXXA 5AWFC 1T91A 5FPSA 4I4LA 3KXIA 1RRGA 1FMJA 1Q57A 2QTHA 3R20A 5FBLB 2CCKA 1N6NA 1KZGB 5DHAA 1NN3A 1E2IA 1YR8A 3PITA 3L43A 1F2TA 5FOVA 2J7KA 2ONJA 3NBZC 4B6FA 121PA 1TTTA 2R8RA 1HE8B 1US8B 2ZRDA 1KMQA 4Q9JA 3T1TA 2ZRKA 2FOLA 2PMKA 2IUTA 2PLFA 2C98A 5J5CA 1IY1A 2N42A 1XCPA 1JPJA 4XD7D 4ASUA 1RKBA 4DUGD 4Q03A 4X8OA 1V5WA 2AWNA 5KDDA 3C8UA 4RZ3A 3ND8A 1X8KA 3QJYA 2P0EA 4IOMA 1A4RA 2F1JA 3IIKA 2ZJYA 5AJXA 2ZSAA 5E3HA 1GRNA 5FTJA 2E1RA 1KIMA 1ZU4A 5JJKA 2YWGA 4Q7KA 1GNRA 1CR4A 3P27A 2NGRA 2GXAA 1QBKC 1KDOA 3Q5DA 3ASYA 3T35A 5FTLA 2A7QA 2ZEJA 4PC1A 3IEVA 2UVQA 3U5ZB 3W3AA 4P3YA 4EPXA 4AG6A 1KI6B 2OESA 2XITA 4G5GA 1OXSC 1L4UA 2OAQ1 3U7EB 3GJ5A 2CMKA 2VHTA 4O25A 2JIZA 1VMAA 4Q9IA 4Q4HB 3PEVA 4HLDA 2EFHB 1WDTA 2J87A 4KSCA 2O0HA 2ZAMA 4DCNA 3AVTA 3BGWA 3OAAD 3K0FB 3NTUA 2J0UA 2XZPA 5DLQC 3MGCA 1KHTA 3ZVRA 4HUQA 3QY0A 5FH9A 4KAXA 1XJ0A 4C0KA 5GVSA 1WXQA 3QOFA 3JVUA 5KOYA 2YINC 3A1WA 1YZGA 3P4XA 4QNMA 3VR4A 1DS6A 3T1VA 3ZQ6A 4OHXA 1UFQA 1S3SA 1WCV1 2BC9A 4M0LA 3HPQA 4P4SB 4P32A 1G7TA 1XX6A 4QNRA 2DCUA 3ICEA 5IRCD 4Q1FA 4DLUA 1NP6A 4GNKA 3UWKA 2V4ZA 1SVSA 3JZAA 2ZS9A 1NF3A 1ZVQA 1Q44A 2FPMA 5TMPA 1CLUA 3FMFA 4Q7LA 2VHQA 5F98A 1Q1QA 4IVPA 4UNSA 2ZYTX 4BFXA 1G1MA 3MG9A 3Q7PA 4JLJA 5DGXA 3QKTA 2P6UA 5BQ5A 5KSOA 1ZM9A 4Q7JB 1GRQA 3X2SA 3KKNA 1U8ZA 3U7FB 4R9UC 3MJRA 1G4UR 4CT5A 1CTQA 1XCMA 2HUPA 3TSOA 3V9PA 2Z0MA 4D6PA 3CRMA 1R2QA 3FTQA 3GLGB 3EWAA 4GFDA 4TL8A 3B9QA 1EX7A 1EFUA 3TAUA 4IRUB 1CP2A 4HLCA 2VP9A 4D81A 4GT1A 3P4YA 3K70B 4AKGA 3W34A 1RVDA 2IYZA 4PZYA 3T34A 4ASUD 4M53A 2O8BA 3GFPA 1EFRA 3PIRA 2VPPA 2V1XA 3VNVA 3BXZA 3KJEA 2PT7A 3BD9A 1E9SA 1XF9A 3OIWA 3WBJA 1RFLA 4N1AA 4AKIA 4B33A 1I2DA 3GLFB 3L0OA 4ARZA 3QXSA 1S1CA 1LS1A 3GLHB 3SI7A 2QQEA 1XFAA 2R6AA 1M7HA 5HKKA 1DELA 2IYLD 1JR3E 4MKHA 3GEIA 3VMFA 2F1HA 1F3OA 1ZM4A 1VDZA 5L3SA 5HR5A 2OXCA 2AK2A 1YZQA 1AZSC 3AB3A 5GJWC 1G41A 2ATXA 1VCNA 1ZNXA 4JJKA 1ZUIA 1AKYA 1LY1A 2H16A 3NEYA 5AJVB 3IUYA 5FOWA 1KI8A 1II8A 4MQBA 1BO6A 4NZYA 2BWJA 1UF9A 2JIZD 4LV5B 2JJ1A 3ASZA 3Q9LA 3UK6A 1GNPA 1LV7A 4TMXA 2QMHA 3AGQA 1E2NA 1Q21A 4H1VA 4PPGA 2QSYA 3EZ7A 3FVQA 1XPUA 4EJSC 3M4YA 1D2EA 3EARA 1XBTA 2WKQA 4A36A 3UMFA 2A5DA 2OG2A 2WM9B 4TQUS 2ZYUX 4LY6A 4ZKEA 3THWB 2P5TB 3RWMB 4EPYA 5FBWB 5JCZA 3H1TA 5DYGA 1GFIA 1OFHA 4MGIR 1NVVR 3SU8A 3K1JA 1XZPA 2RGNC 4OQFA 4EAQA 1YZLA 4BZPA 4B3DA 4Q5IA 2OSBA 3TVDA 4TYPA 3L82B 4C0BA 4C7OA 2ERXA 1E9BA 4LSGA 4OI1A 1VYVA 4GMDA 3U6KA 2LKCA 2OE2A 2OXRA 2A78A 4D82A 1U0LA 4E22A 4NKRA 3GLGE 2XNSA 2X19A 4E03A 3REFA 2AXPA 3BC1A 4V0MA 3F3YA 4XJXA 3MWKA 4HLUC 1Z28A 1WBBA 3CRW1 4DSOA 5H70A 4AC9A 3KKPA 2FWRA 2XSZA 2WSMA 1KSGA 4A4DA 1VIAA 3LV8A 1P7CA 2ZREA 2UZIR 2ZM5A 4ZIRA 4BFVA 2EYUA 1Z3IX 3EIHA 1C9KA 2GCOA 4Q4JA 4Q47A 2XOKA 4JSTA 2FE4A 3GLFE 4XTCS 3HYTA 4UJ5A 3RHFA 3WYFA 4B48A 1N0WA 2ZAOA 4EJSA 3GLHE 3QKSB 5IF9A 4Q00A 2W0SA 1QRAA 1LW7A 1T3HA 1KNQA 2C5LA 3CZPA 4CRWB 4Q18A 2WWXA 3VHLB 1WP9A 1EFRD 4Q9LA 2G0NA 5JEEA 1TMKA 4NCHA 1RC8A 4HZIA 4ZCIA 1E2LA 3RSOA 1KAOA 4D2IA 4KFTA 1NSFA 1XMIA 1AK2A 2AWOA 1OSNA 1P2TA 3VHXA 2QY9A 1SHZA 1JB1A 2XNDA 4KSBA 5HKKD 1N6HA 2CLCX 1AA9A 2ORWA 3IIJA 2XB2A 4GOJA 2F9LA 3K9HA 4O2RA 5LB4A 2HCJB 4HLUA 5J4VA 4LYAA 3NEJA 4MYHA 2RAPA 4V02A 4TQAA 5JFGA 2ZRGA 4PTLA 3R9XA 4HYYA 4ACBA 2ZYWX 2BIFA 3EX7C 2F6RA 1E69A 2Q9AA 3NIBA 4PC2A 4KITB 3CPJB 5J4KA 3KTAA 1XTQA 4KI0A 3LNCA 4BFWA 3A1UA 1Z22A 5JEDA 3THXB 4GSYA 3R9IA 2JJ1D 2QQ0A 4BFSA 1R0YA 4M1OA 1RRFA 2GXQA 1YVDA 3FFBA 4TSFA 4V0KA 4LWZA 5FI0B 1DAFA 4OHWA 3A1TA 3TJZA 3F8TA 2J3EA 4MYCA 4TTRA 4QM7A 1X86B 2XX3A 2HCBA 3PQCA 3LWNA 1US8A 2Q9BA 1IN4A 1XJQA 5AJWA 4AKHA 3H2YA 4RZ2A 3RABA 3UPUA 2VHUA 3RS7A 1FTNA 3B82A 3NC0C 4KHZA 5AK0A 5K8TA 3QENA 2R65A 1WBDA 4K81B 1P2SA 2ZRCA 3KQNA 1E98A 1OYWA 1HEIA 1M74A 4ABYA 2E9SA 1OIWA 1TU4A 4JBWA 3VTKA 4FCVA 3L2OB 5F9HA 1M7GA 4TYWA 1U90A 3BH7A 3GP8A 2R6CA 4C0SA 5FPKA 1E96A 2PZFA 2Z4RA 1F48A 3CB4A 2BM1A 4OKSA 2A5FA 1W5SA 2D62A 3LBIA 2OV2A 3MWJA 4LJ6A 4LK2A 2YYZA 3LDAA 4FCTA 1TQ4A 2VLIA 4JT4A 5E4FA 4AK9A 4A2PA 1OW3B 4OI4A 5BN4A 2GTPA 2XSZD 3Q3JB 2ZE6A 3U7HB 1A5TA 4JYCA 3LAWA 2FFHA 1XMJA 1KI6A 1FL9A 1S8FA 4B35A 2QMUA 3DZ8A 2GETA 1IN5A 2CCGA 3DM5A 2F7SA 3CRQA 2XOKD 1Z6YA 4KJZA 4LPSA 4DEXA 3KB2A 2GZHA 4TTPA 4B74A 3X1WA 3OEHA 4EFMA 5TDHA 4TT3A 3L8ZA 3EA0A 4W7SA 1W0JA 1XJCA 2UZ3A 2RGBA 3CR8A 1R8SA 4KYUA 1RRCA 2PX3A 1FP6A 4IHQA 1W4RA 3U6BA 5C4GB 3CX8A 3FMIA 1JR3A 1VG9B 4ZV4A 3K70C 2ZJAA 5HTKA 1CF4A 4BLRA 3AVWA 1XTKA 1G5PA 5DSZA 1Z47A 1LFDB 1SVLA 4CF7A 2C77A 2AFIE 2UKDA 4TYNA 4P4SA 2X1VA 3K0CC 3EIEA 2JLQA 4UNRA 1ZP6A 2TMKA 2XNDD 1QHGA 3K09C 2JJ8A 1SKQA 2A5JA 4WA7A 2EU8A 3K9GA 4BECA 1CR2A 5JLJA 1UEJA 3MFYA 1B23P 5JWHA 3ZVNA 3OF5A 3A1SA 4KBGA 3BFVA 3DZDA 3NG1A 4OI2A 4XWAA 5AR1A 3AP1A 4DLZA 5CB8A 1MOZA 1Q3TA 2FFQA 1OE0A 3KQUA 3KZ1E 4A8JC 3DOEA 1M2OB 2Q6TA 4BPBA 1GKUB 4DCTA 2FDCA 2DWOA 3ZLJA 1OIVA 3U3KA 4TSFD 3TW8B 1MRSA 2VF7A 3L0IB 3DKPA 3U3OA 1EXMA 1JEEA 4NYJQ 2B7BA 3BK7A 4JLPA 1G8HA 2MSCB 3MAAC 3NHBA 5KYKA 3GLGA 1E2FA 4L8GA 1XPOA 2H18A 2J0QA 1XXHB 2L0XA 2FH5B 3KUCA 4D26A 1P5ZB 4O3MA 1JQJC 2WOOA 4PHFA 4A2QA 4C9BA 1IAQA 3BB4A 1C4OA 3WNDA 1G7CA 2CHQA 1U94A 1SKYB 2G3YA 2A2ZA 1QHIA 1YKSA 4LYJA 1SHKA 1Z2AA 2SHKA 4LHVA 4PSAA 5AJYA 4V0LA 3SBDA 4OQXA 1XMVA 2FFBA 3K0CA 2V6JA 5SZIA 3SR0A 3A8TA 4EKDA 3PJRA 1CU1A 2GJAA 1DTSA 4DCVA 4V0NA 1U0HC 3AKEA 3K09A 1UBCA 4XIGS 4LJ7A 3GLHA 4AYXA 2QRNA 2NZ8A 1ZAKA 4LBZA 1N6RA 2YC4C 3N2EA 3QNUA 4LI0A 4LDJA 4JIMA 4R2IA 1O3YA 3M0EA 4TMVA 4LJYA 5E7IA 1S9HA 1UJ2A 1GOTA 1XTRA 1RJ9B 3SC3A 3RNLA 2HDNB 4A8JA 2BBOA 3ZDQA 3QIAA 3BFKA 3ADBA 4HDCA 1P6XA 1R7RA 1XEXB 821PA 2WIAA 5J4HA 4PPQA 3OEHD 2DWPA 3DL0A 1GRRA 4TT3D 3SDZA 3LW8A 1PLKA 4Q19A 2GVZC 1W0JD 2AN9A 2QUZA 5C4MA 1VG8A 4MYTA 2GJ9A 4CGZA 4QG7A 2WMNB 1JR3D 4TYQA 5JCPA 2IC5A 1PLJA 1Z6AA 5IHPA 3THWA 4KLNA 3Q8XB 4FMBB 1N3BA 2Z83A 3LBHA 4S2EA 2R6GA 3AH8A 5EXSA 4AG5A 1JPNA 3PG5A 1NY6A 3SS8A 3CZQA 1YR7A 2R6DA 2WJHA 2WKPA 4MUAA 3V4RA 3SOPA 3CX6A 2FX3A 3ETLA 2O8EB 3TLXA 1D8TA 1YU9A 2WZQA 4XVRA 2ZVQX 2ZRMA 1OFTA 3WMFA 4RD0A 1NIPA 1G6HA 2BJVA 4G01B 1XXHE 2H7VA 2PZGA 4MDEA 4BZXA 1KY3A 3EPLA 1LF5A 1QF9A 1SXJC 5CJ2A 5KTYA 2BEKA 4C3ZA 2QG6A 5DHFA 5BN3A 4TLCA 4A0FA 5CB6A 2GKSA 3QBVA 1FFHA 3C16C 4FXPA 2PJZA 3W5JA 1JXMA 1W46A 4BASA 1SKYE 4ESVA 1SZPA 1DARA 2FU5C 4QHSA 4GP6A 4QOSA 3AUYA 3SZRA 2BMEA 3NKVA 4M1SA 4NCJA 4G3XA 3C14C 3SYNA 5AJZA 4C7OB 4QHTA 1TQ2A 1OXUA 2NOAA 4URVR 4DLXA 4KYIB 5HZKA 4KO8A 2GK7A 4FMDF 3WMGA 2QZ4A 2G9NA 3GD7A 4YONB 3GFTA 4M2LA 3SJCA 1A2BA 1P9WA 4L15A 1G5RA 1NLZA 3O47A 5EP3A 3K70D 4DC9A 1E6CA 1D6JA 3FFAA 4MH0R 2QRZA 1TU3A 3SJZA 1GWNA 1VHLA 4HLQB 4XH9B 2ZU0C 3P26A 4DLSA 2B7CA 4M1YA 5CK4A 2IX3A 4QGGA 1KMHA 4II7A 3IGFA 1RIFA 2C9CA 1TNDA 1YHNA 2LWIA 1N5LA 3AKYA 5F9FA 2Z5FA 2GCOB 5TVKA 3WRYC 2QPAA 5GVRA 4M4SA 4ITRC 2Q3FA 3ZZTA 2B21A 2ZIAA 3B1VA 4IFEA 4LV8B 3UIEA 2W0MA 2ZSBA 4EJSB 3Q85A 3PUWA 1H65A 4Q66C 4B43A 3AVQA 1YR6A 1AGPA 1KO4A 2CEAA 1VHTA 6Q21A 2NTYC 2YHSA 1R4AA 2Y8EA 4KCGA 2AK3A 1KDRA 4YMSA 4BRUA 1N5JA 2OCAA 3VX3A 5SZKB 1Q20A 4BFUA 2J46A 4FCWA 4YLGA 1Z07A 2IYYA 3CNNA 4GL2A 2GJSA 1BYUA 1N0UA 2I1QA 4MGKR 1KKLA 1AKEA 5DYIA 1OXVA 2WSSA 4Q48A 2PCJA 3U7GA 4URWR 1TUIA 5BW8A 5B58C 2JDIA 1OFUX 4UNPA 3I8SA 1LVGA 2FGKA 4LGMA 4Q7MB 4XOIA 5A4JA 1AS0A 4JMPA 2VP0A 1Z5ZA 5ANRB 4LV6A 1Q22A 2F1IA 3KDSE 3K0SA 3NDPA 2FPKA 3WHLA 4US2R 3ND9A 4Y0VA 2D06A 4HB4A 2NO6A 3QKUA 2XGJA 5FTKA 3B1WA 3DHWC 1TL7C 4CW7A 3AP2A 3R9WA 3WP1B 1FX0B 2FSHA 1E0AA 2BKEA 2B8WA 5J4LA 1HY3A 4WXRA 2WICA 3MJHA 4F93B 4ZCLA 2QGNA 1ZJ6A 5C2JB 5FTNA 3FKSA 4V0ME 1N5IA 2GVDC 1N6IA 5FUVA 2CJWA 2QT0A 2ZI4A 5JSZB 2PL3A 3MRSA 2PX0A 3S1AB 521PA 2WJIA 2NPIA 3SE0A 4O0MA 2XJ9A 5EQTA 4PAMA 3VQTA 4JLVA 3LX5A 1QHXA 5CLLA 3B7GA 1XD2A 3WXMA 1WE2A 1KKMA 3C5CA 5LD2C 3IBGA 1QHYA 3IO3A 3IQWA 5G40A 5FL7A 4URXR 4NHOA 4ZCMA 3VFDA 5A0FA 2MMCA 3EZ9A 3RVBA 3OFNA 5SZHB 3GJ4A 1OH5A 4Q1BA 1VKJA 4IFBA 1DEKA 1P2VA 4Q1AA 1W2GA 4M9SA 3PEYA 4AYWA 1MABB 1PUJA 2VSFA 1E9AA 4C2TA 2ZR9A 1CR0A 2EFDB 2P5SA 4NYMQ 2QROA 4M22A 4DLYA 2FN4A 1Z0KA 3JVVA 4JL6A 1W36B 2MSEB 1NSTA 3SYKA 2ZR0A 3A4LA 4N3NA 2Q3HA 2ONKA 2XB4A 2KJQA 3B1XA 1N6PA 4P31A 1NLFA 1T3SA 2ZRAA 4Z54A 4CYMA 3ZS9A 1T9HA 2NQ2C 1ZIPA 4MGYR 1CR1A 3IPXA 4G5RA 2HF9A 3GQBA 2CBZA 1QVAA 4QGFA 1PVOA 4PC7A 3TW4A 3D3QA 2KE5A 1I4TD 3GJ6A 5CIQA 4K46A 2JLZA 3IPYA 1ZNZA 1YQTA 2RGXA 4HDQB 3IILA 4NMMA 2CE2X 1MO3A 4JLNA 1XRJA 1Z08A 1NY5A 3KQLA 1M7BA 2WSSD 4IEEA 1CJVC 1HE1C 4MKGA 5FOXA 2JLYA 5F3WB 1P61B 5FR1A 2JDID 3H0KA 3DEFA 4RD4A 4CDGA 1ANKA 2G0TA 1XXHA 2GJ8A 1OXXK 3GJ8A 1GG2A 4RZUA 3AKDA 1DAIA 4IDQA 4BZQA 3OE7A 3O8CA 3FHOA 5EE3A 4B2IA 4F4IA 3AVYA 1JJVA 4UNQA 3LVRE 3AF1A 2YWFA 1VECA 3QXCA 5K8LA 2CVHA 3ZIAA 1KK1A 2WHXA 5CM8B 1J70A 4M9QA 2CHVA 2ZU6A 4DT1B 4JZKA 1CXZA 4YQFA 4F4CA 1R0XA 2AKYA 4ILEA 1XWIA 4UXIA 5EP4A 4YMTA 2OFOA 4LC0A 5EZ6B 5LB2A 4A1FA 4TN1A 1GITA 1P9NA 4Z51A 1Z0IA 2P3SA 3FKSD 3TSWA 1JAIA 1FP7A 4W5HA 1GKYA 2HYDA 4G5SA 2A9KA 3QI2A 4BEJA 5EE0A 2VYFA 2IYUA 3PVSA 3VX4A 4BLTA 3QEJA 2IS6A 5JRZA 5UKDA 1P60A 2ZI9A 3LBNA 2PJRA 3CNOA 3PEWA 1SGWA 2YZ2A 4JL8A 5H8WA 1RJ9A 3MWLA 2HF8A 3OESA 1RZ3A 3ZZ0A 3CR7A 1DG1G 2CCJA 2NO0A 3VR3A 3EPKA 3OZXA 3FPAA 4WIAA 2CK3A 1XEXA 2AX4A 4WAUA 4LHZA 1X6VA 4QGAA 4FMDB 4FINA 5C1BA 2IF2A 2WWIA 3EA5A 1H8HA 2CLDX 3ZQJA 3LLUA 5KDLA 5FL7D 4DB2A 1Q3HA 2N1BA 4LZZA 4XSHA 2F43B 3PV0A 3OFND 1HT2E 4A6XA 5IK2A 3KX2A 1XNJA 3EZ2A 1G21E 1GSIA 3A1VA 1JJ7A 5EE5B 2BMFA 1Z29A 1JQLB 3THYB 4UKDA 1G4AE 4E5UA 1W4AA 2PMDA 3CIOA 4HB2A 3X1ZA 4QFMA 4RFSB 4A8JB 3B2EA 3TUZC 2ZRLA 2ZS7A 3PR1A 3TH5A 2VQSA 1ZBDA 3F0TA 3N70A 3FE2A 2O8EA 1XMSA 1M34E 2VHCA 4I99A 2WJJA 2YOHA 4DLWA 4OJKA 1LF0A 3QVVA 4GDFA 1G6OA 1UBEA 3RWOA 1GNQA 1ZD1A 4BLOA 4JBYA 1T8TA 5TXGA 2IS1A 1W1WA 4I1OA 3DMNA 2DWQA 1JAHA 4PSKA 3CKLA 1TEXA 3W6PA 4ZO4A 1FMLA 3H86A 4NCNA 1W7AA 1VTKA 4DEYA 1SVWA 1DADA 1NBME 2A5GA 4WBSA 2R44A 4B3GA 3I73A 4EPRA 2J0SA 2FEOA 2ZI6A 1EFHA 2WJVA 3GEEA 4JVMA 2HJVA 3TQCA 3LW7A 1KJWA 3ONWA 3EASA 1E99A 4ESHA 4NYJR 4YDHB 4HUTA 1NVXQ 5JS8A 1BYIA 1TF5A 2DYKA 3OE7D 1KSJA 1E1RA 2F3TA 2RKOA 5ELXA 4ON9A 1EWRA 3AF4A 2D74A 4TL6A 5FPHA 3TRFA 4IDOA 1OIXA 4ZPXA 2IW3A 3FOZA 1X3SA 3ZIAD 1UBGA 4PHTA 2G88A 3W6OA 1OFIA 1BS1A 1P9RA 4A0RA 4BFYA 1EG7A 1LS6A 1TX4B 1JECA 2GF0A 3U60B 4R98A 2FF7A 5EE9A 3I62A 4F4JA 1F6BA 4JLMA 2IXEA 2QN6A 2V9PA 2ZQ5A 1SVKA 4M9ZA 1L4YA 1ETUA 3RC8A 2JA1A 4PZLA 4OK6A 2OHFA 4RCZA 4S35A 5C46F 3CLVA 4Q1CA 3W9YA 4IDPA 4WZ6A 4JVSB 1W4CA 1BMFA 3HU3A 2IWHA 1T3LA 4WOPA 1ELOA 1G3RA 1ZM7A 2VF8A 4PO9A 5CK5A 4POAA 2OBNA 3CW2A 3GJXC 3GPLA 2O8FA 1LB1B 2WJGA 4IVRA 2CK3D 4M8NE 2RGNA 4U00A 2P65A 1H8HD 2VP5A 2W2VA 1KMHB 4KXFB 1XP8A 1G7RA 1KI4A 3H4MA 3I72A 2X2FA 4LJ5A 5EXXA 4TL9A 4CVNA 1S96A 4PANA 5IK2D 1E1QA 1W49A 1CJMA 1GL6A 4JKYA 1OXTA 2RGDA 2VP4A 5FBRB 2ZPTX 3Q72A 1SXJB 2RMKA 2GEDA 2EVWX 4B44A 4A2WA 1G9XA 1R5NA 2FZLA 2GA8A 4C2UA 1W47A 3PEUA 3A4MA 4MA4A 4EQ6B 1E0JA 1TAGA 4CT4B 1W36C 4CEHB 4B3XA 1IM2A 4NYIQ 4B6EA 3U3JA 2OBMA 3SN6A 4ZDJA 1FX0A 5JJLA 1B0UA 3CPEA 3A6PC 4RD2A 3DDCA 2AD1A 3FDIA 4L9WA 2O8CB 4F38A 2B92A 4PHHA 1MO4A 2ZSEA 4U7DA 3MSXA 5JSZA 1XU4A 1T4GA 3S1AA 1ZC3A 4KVAA 4DRZA 1ZYUA 1N6OA 2FJUA 3BBPA 4YC7A 4Z1MA 1K6MA 4HAWA 4Q01A 1ZM3A 1RE0A 4LUCA 8OHMA 1UEIA 2ZVPX 3K53A 1GILA 1MV5A 2DY1A 2I4IA 2QAJA 2NZJA 4B47A 3GLIA 2ZRBA 3BB3A 4A0HA 2W00A 3QPVA 4RCYA 3IKJA 2N46A 3QUSA 2XAUA 4YMUA 1IN8A 1Q1ZA 1E1RD 1F2UB 2Z4SA 1OH8A 1HYQA 2GILA 2VP2A 3BORA 2J5XA 2CJWB 1GP2A 1KO1A 1MABA 1KJYA 1Z0JA 2D2EA 2J1LA 2RHMA 3I32A 4LHWA 3RAPR 2Q0HA 2RCNA 4JKIA 2H1LA 1G291 3SNHA 3L0PA 2QP9X 2ZI3A 5DI3B 3RS5A 3TUJC 5FR2A 3KB1A 4TMZA 1KO7A 3V00A 2HT1A 1E9CA 1KO5A 1IJEA 4PC3A 1HUQA 4M1TA 3I1FA 1SVOA 2OT3B 4M1WA 1XD2B 3WMEA 2PBRA 1ESMA 3QXXA 3DOFA 3T1QA 5KNDA 2P67A 4D4LA 4PQRA 1Z6XA 4E07A 2HLDA 3RANA 1ZUHA 2GZDA 4GP7A 3QF4B 5F2EA 4B3BA 2DFKB 3EPHA 2ODBA 2CVFA 4HAVA 3WY9A 3D8BA 3TR5A 1SXJE 3VKWA 3LA6A 4F92B 1I4DD 2HYIC 1BMFD 5FFMA 5BYJA 4EPWA 4QC2A 5JI3E 1Z8FA 3U4QA 3E2IA 4K8OA 1CRPA 2BCGY 2EFGA 5P21A 5J40A 1RYHA 2XTZA 3VKHA 2RGCA 5DISB 1FUKA 1WF3A 4MRNA 1MO6A 1QHHB 2W58A 4HEJA 4PAQA 4DXAA 4EIWA 3ZVLA 1YZTA 5AUQA 1M6NA 4D0GA 1E1QD 1II0A 1JALA 2JGNA 4NBSA 4JLAA 1J90A 2WBLC 2ODEA 1E2JA 1GAJA 5A5GA 4Z8XA 2G1JA 3X1DA 2EFEB 3WBKA 2VTKA 4JVLA 4MRPA 4I81A 5G3ZA 3CM0A 1P3JA 2GXSA 4UXHA 3B5JA 2C99A 3U61B 1TPZA 5DH9A 3FB4A 3EAQA 2GRJA 1NBMA 4W5WA 2IUUA 4DT1A 4URUR 1UKVY 3HP1A 2GCNA 3K9LA 4MRSA 5LD2B 2J9RA 2QORA 4B32A 2FA9A 4UQOA 3AUXA 4B71A 3R8FA 1KI7A 3GMTA 3PUYA 3U2QA 1KTVA 4HZUB 2EWVA 1GDDA 1XTIA 2CL6X 3CRRA 4CEIB 2WMOB 3IIMA 3TBKA 2QM8A 2ZRFA 3DMDA 3VAAA 4TTQA 4Z1MD 1EFTA 3KKMA 4DIDA 2GCPA 4L4UA 3WNCA 2W6JA 4FMCB 1R8QA 2XXAB 3PUVA 3DKVA 1NJFA 2YVUA 4MRVA 5EP2A 3RDPA 4D4KA 5KPDA 2YOFA 2C78A 5KU1A 5JWOA 2F43A 4RD6A 3VR6A 2YC2C 3KL4A 3PXGA 3VKGA 2V55B 4TLBA 3W3ZB 4CEJA 3KFVA 2CDNA 5DIFA 1G20E 2P6NA 2VRWA 2ORIA 4AD8A 2IS2A 2ANCA 3PCRB 4I1VA 2IYRA 4RKFA 1COWA 3RRMA 3TMKA 1N0VC 3THYA 4RD1A 1J99A 1NG1A 1W36D 1TEVA 4H9GA 4V03A 1P2UA 4RFSA 5KNBA 1AQYA 4DDUA 2ZJOA 4NYMR 4YDSA 4HB0A 1Q0UA 2QGZA 2VSOA 4IXNA 5EXTA 5HE9A 1ZCAA 4JS0A 2FSIA 4GZLA 4R2HA 2HLDD 3T5DA 4IEIA 2QBYB 4GPTA 4KVGA 1NG9A 2VP6A 1QG2A 1MRNA 1T8UA 4DDTA 2CL7X 2ZE7A 3RRZA 1E3MA 1T5LA 1DPFA 3FKQA 3KJHA 1EESA 3GJ7A 5SZJA 5DI9A 3U3MA 4NCIA 3ZJYA 4ZI2A 1GKIA 3EWSA 4NONA 3PENA 1G18A 2AFHE 4QJ3A 2EWWA 4I1SA 2BOVA 1YZUA 3CF6R 4GZMA 3T15A 1DO2A 3VR5A 3I8XA 1TF7A 421PA 2X2EA 3T12A 1FUUA 3D7MA 3C15C 5GJCA 4A6PA 3AVVA 4YXWA 4NCKA 1LNZA 4AKEA 4Q1EA 3TE6A 2XZOA 2BHRA 1NMZA 2ZXUA 4PC6A 1IOZA 1G17A 5L8VA 1II9A 1KYIA 2HT6A 4BFTA 1UM8A 2KBEA 3SQXA 2X77A 3K0EA 4R71A 4L9SA 4D80A 5EZ5A 1NKSA 4XVUA 3JZMA 2CNWA 2FNAA 1NBMD 3QSYA 2GZAA 4OL0A 3B8HA 2G83A 3WYAA 2ZRNA 4HAYA 1TADA 5CM9C 1P73A 4TQ9A 4RD3A 2YWEA 2F1RA 3HWSA 5IT5A 3E5HA 5BN5A 4D0NA 2ZRHA 1UPTA 2FSGA 4PHGA 1J8YF 3QVUA 4QKQA 2JAQA 2O5VA 2CLSA 5TV2A 4IOLA 3QXHA 5CYPA 2GBLC 3AV0B 1Z06A 1KAGA 2CE7A 2J41A 2H92A 5DN6A 4ZI3A 4P0TA 2IF0A 1GL9B 3TK1A 2B6HA 2IXFA 4FW9A 4P4TA 2CL0X 2I1VB 3NH6A 4BFZA 4FWTA 2IYWA 5KHOC 1JI0A 1K5GA 1LTQA 1ZW6A 2VBCA 1JBKA 2W6JD 2H57A 2J7PA 2XTNA 3A58B 4TL7A 4DIEA 5FUWA 5G3YA 2VHJA 2EYQA 1S1MA 1NN1A 3C4JA 4UNNA 1CRQA 2OFXA 3ZD6A 3KKOA 5FBQB 3AQ4A 4WZAE 3P32A 1NL3A 2O8DB 1TQDA 2MSDB 1GIAA 1OJLA 1PUIA 2BMDA 2WWGA 4RY2A 3TSZA 2RGEA 4ZDWA 4DKXA 1SXJA 3SJBA 1AN0A 1COWD 3HDTA 3CO5A 3EZFA 1Q12A 3LRPA 3FMOB 1UAAA 2P2LA 2IYTA 2R2AA 721PA 2O8FB 4EQ6A 1FTSA 1XB2A 3RRYA 2Q9CA 1HQCA 4CEHA 2A30A 4PPNA 5B30A 1X8LA 4LBYA 2HEIA 3BB1A 3IBYA 3MWYW 1DAGA 4OJQA 1KY2A 2CHGA 3P1JA 1QHSA 1JXOA 4A0GA 3HYRA 3UXMA 2G6BA 2VIIA 2O8CA 4LJ8A 4GMXA 4BEBA 2GBLA 3D31A 2W2TA 4EFNA 2DFNA 4MGZR 2RB4A 4CIDA 2Z43A 3TNFA 4LBWA 1KI3A 1N6KA 4XWKA 3KUDA 1E9FA 1WA5A 4B3CA 1AS2A 2QMEA 2OILA 2PT5A 2KWIA 2QTFA 3CH4B 3HPRA 3PUZA 3U3RA 4YXWD 3I61A 4MDFA 2GXUA 4LHXA 1A2KC 3UMRA 1NNEA 2ZSFA 4RZXA 4FWIB 4LC1A 2QAGB 1HV8A 1PJRA 3AVPA 3CH5A 3R8CA 4AWXA 2REOA 2JLWA 4QHYA 2OUKA 5CDFE 4X8HA 1F2UA 4LJ4A 2QNRA 2QU8A 3AVOA 4NPHA 3I3SR 4DWJA 1G8YA 4URYR 1N5KA 3CRVA 1U98A 5CITA 3CNLA 1G64A 2CNWD 1T0JB 1RYFA 2ZRPA 4LRWA 5DI3A 2ORVA 2ZUCA 3FMPB 5EUMA 1E2MA 1I2MA 4BLQA 3LXRA 1ZCBA 3B1YA 3HJNA 3SFZA 1X1SA 4D0LB 3BAFA 2GF9A 1KSFX 1K8RA 1AS3A 3GLIB 1PV4A 2NO7A 1JR6A 3V4FA 2FMXA 2QT1A 1KJZA 3QF4A 4LX0A 4Z8YA 1NI3A 4TZ6A 3N5CA 3CUEF 4I1UA 5DN6D 2OCBA 5JHHB 2WWHA 4KU4A 4OHYA 3QKRB 4XSGA 1OF1A 1G3UA 1NN0A 4BWYA 1KI9A 3VNUA 2C8VA 4C4PA 4M1KA 2J7PD 5FL3A 2XTMA 1ZRHA 4AI6A 2GAOA 4PSVA 4B2LA 4XVQA 4DLVA 1QHHA 1R6BX 3BS4A 4TMKA 1HQYE 4HB3A 1G8GA 1NVUQ 1UBFA 2IYVA 3LY5A 4C0QC 4MKIA 5BXQC 4W9MC 2IEYA 3KQHA 3REGA 4TZ0A 3BIFA 3SYLA 3AKCA 1P72A 3VR2A 1XPRA 4LCBA 5FTMA 3TKLA 1JNYA 1SXJD 1NKTA 5LBIA 2WIBA 4D25A 5FOUA 1EGAA 4MUBA 1AM4D 4OI0A 2B8TA 3WNBA 5JZVA 2AXNA 2QP4A 3BH6A 4IKEA 4MYUA 2IUSA 4QGHA 4B76A 4DSUA 4F91B 3U4QB 4IVQA 2WPDA 4QL3A 2AR7A 2F3RA 4EDHA 1VG0B 2O52A 4TYYA 1DBSA 1V43A 4LJ9A 1KO8A 4RKEA 4BLPA 4LYHA 3RYTC 4DDVA 3B78A 4FI3C 4NYIR 2PH1A 4EUNA 2GEUA 1NVWQ 4LPKA 3G0HA 5AUPB 2GAAA 3AEZA 1BKDR 4HZUA 2QE7A 1S0UA 4DBLC 4CEIA 4XTRA 2ODNA 3L8YA 5H68A 1IONA 1KZ7B 2IT1A 5AUOB 2OBLA 3CONA 1TUEA 2QPTA 1C1YA 4ZDKA 3OHMA 1W2HA 4NP6A 5G41A 1FOEB 1BIFA 1E9DA 1R5OA 5TY0A 3SJAA 2XXAA 3DM9B 1DG3A 2R9VA 4PQYA 3O8BA 3GLIE 1UADA 4U02A 2GDJA 3A4NA 5CIWA 1XEFA 2GNOA 5JJIA 2BKUA 4YMWA 1G19A 4GOXA 4PR0A 1ZD8A 1OPXA 3CBQA 4KFSA 3L0SA 3NXSA 5FI1B 4DVGA 1T5IA 5K8UA 3AVXA 5JRJA 3WP0A 1XEWY 5FBVB 1MR3F 3QE0A 4QBFA 4NDZA 4GRAA 1DOAA 2NO9A 2RH5A 3T5GA 621PA 2HJGA 2GHIA 1Z0DA 3D6TB 3FYHA 1SQ5A 1Z0AA 3EC1A 2JEOA 3G5UA 2PEYA 3FGNA 3BE4A 5HCNA 5KPJA 3U44B 1FQKA 3TIFA 2O0JA 2ZJ8A 1GM5A 2QBYA 5KO2A 1SULA 1AQUA 2IS4A 1N25A 3NVAA 3VU9B 2AL7A 2IYSA 1MKYA 4M21A 2EW1A 3IDQA 2P6RA 1K5DA 2IA5A 3I5YA 221PA 2JLRA 1YR9A 3I92A 1CIPA 1W0KA 2J59A 2OCPA 4KLZA 2C03A 4IOKA 3ZD7A 4CEJB 2NPFA 2R62A 4E09A 5BYKA 3ADDA 5DO9A 4KBFA 3Q7QA 3J81k 4QJ5A 1OB5A 2ATVA 4AIIA 3K8YA 5B57C 3NH9A 1YZKA 1JEDA 4PFSA 1ZM2A 5JHGB 1UDWA 2BJWA 2JLUA 3B60A 1MT0A 3TUIC 3QQ5A 3GJ0A 1OLOA 1G5TA 5J47A 2JCSA 3T06B 2VA8A 2IL1A 1KNXA 3W8NA 3LQRA 2IHBA 1W5TA 1YRAA 4YMVA 3A37A 2C04A 2IXGA 3FHCB 4JLBA 3HU2A 5KUTA 3F5FA 3QF7A 3IHLA 3THOA 3E1SA 5DNYB 4OK3A 4ZDIA 2WPDD 3VR1A 3OIYA 3SEAA 2ZJBA 1HT1E 2BMJA 2WAXA 2Q21A 4G0NA 3TR0A 2ZUBA 4US1R 3GFOA 4EPVA 3MD0A 1XD8A 1Q1EA 1E2EA 3DPUA 4H1UA 4DCSA 1RPZA 3ICQB 1S9DA 1R0ZA 4OHZA 1FZQA 3C5HA 4FMCF 2ECKA 1A7JA 4Q9KA 4DLTA 1S4QA 3NDBB 1T6NA 1WRBA 2FV8A 3QXJA 2QE7D 3LVQE 4Q1DA 4Q4AA 4DHEA 4B3FX 4DB4A 5CDFA 2QSZA 1H8EA 1VIYA 1Z6TA 3W90A 2G77B 1OHHA 3CF0A 2A3RA 2D2FA 2QEQA 1W44A 1ODFA 2VH5R 4D4JA 3W5IA 2C9OA 2FPLA 1VCOA 1UKEA 3SFVA 1A1VA 4AY2A 4Q9HA 3AM1A 1FPMA 2O0KA 2GWHA 2IHYA 4MRRA 4C0LA 2OM2A 4B34A 2JLXA 2FG5A 2H17A 3BH0A 3RS3A 2ZETA 4MKFA 2KI5A 3ZH9B 1N6LA 1YE8A 3RS4A 3ZS8A 2QAGC 2OLKA 4KFUA 1E2GA 4OYHA 2O8DA 1KK2A 4GOKA 4BGDA 1KOFA 4IXMA 1QVRA 3HR7A 5TB5A 1E4YA 2RGGA 3RSLA 2BEJA 1OB2A 4BLSA 4IOJA 2WKRA 5L3QB 2QP3A 2OZEA 1ZMXA 4WW0A 1CJKC 2ZUDA 3QG5A 4US0R 2BBTA 3KXLA 2G1KA 3B6EA 1YZNA 1D2MA 1DO0A 2WWWA 5FUYA 3TVTA 3K0AB 2GJKA 1OH7A 4F7WA 2KB0A 3LLMA 5D3MB 2VSXA 2BBWA 3SHFA 1OH6A 1W0KD 4JSYA 4A9AA 2ZR7A 4QJ4A 5J4YA 1W4BA 3GCGA 1AJEA 2BV3A 2NMVA 1G3QA 1J8MF 2BCJQ 3T1OA 1DAMA 2V3CC 5KNCA 2WWYA 4OHVA 4OQNA 4IDNA 4PO1A 4PZZA 1EX6A 5E95A 3AF2A 5LDDC 2QM7A 1DAHA 4L16A 1VCIA 1IHUA 4L5BA 1Y3AA 3UG6A 1D2NA 3R7WB 1X8JA 2NG1A 1EK0A 1UKYA 3RLFA 1O87A 2QAGA 2QTVB 3EZ6A 5FOSA 4C0HA 3ZGXA 2AHOA 1M8PA 4PQFA 3ADKA 3I5XA 1U9IC 1Y63A 3ECCA 1L2TA 3RS2A 2X8AA 3M1IA 3MMPA 1J2JA 4A82A 5HPYB 1U81A 1YJ5A 1CJUC 2DFLA 4HAZA 4JL5A 2C9YA 4N0DA 4PXAA 1NMXA 2ERYA 2VL7A 2DPXA 4JLKA 2PCLA 2ANBA 1GZSA 1W48A 2VEDA 1P75A 2H8KA 1L7VC 1E9RA 3GEHA 4HI0E 2V6IA 2ZS8A 1U2RA 2D7CA 1OT3A 1AZTA 4UXJA 1IBRA 4GI7A 1NLYA 1KI2A 4RSGA 3WRXC 4BRWA 4BUJA 4HATA 1KDPA 4OQLA 3WHKA 5L3RA 1Z2CA 2GEVA 2F55A 4NE2A 3UATA 2WV9A 1NJGA 4C0AC 1H8ED 1KSHA 4DJTA 3QKRA 1VCMA 4IDHA 5B64A 3AVUA 1OHHD 4BE7B 3AF0A 5TARA 1D9ZA 4X8LA 1E2QA 1QG4A 3SHWA 2WOJA 2OCYC 4GBMA 4QBGB 4EFLA 1KK0A 2GK6A 4WXPA 1D9XA 1NRJB 1GTVA 3LO5A 1Q1BA 4B73A 3LXXA 4CZ2A 4NTZA 3OEEA 2V1UA 2GESA 3RS0A 1U9IA 1F2TB 4C0JA 2WJYA 2WVJA 1ZNWA 3O8RA 2PZEA 2OEPA 5HZHA 3QEOA 5H1YA 2ZSDA 3OIUA 3CPHA 3QBTA 1XZQA 2JJ2A 1ZC4A 1UKZA 5EE1A 1A82A 2FZ4A 4RFVA 5EJEA 2YV5A 1IJFA 1CS4C 4JVNA 5IDVA 1IY0A 1KK3A 3NWJA 4XWOA 4U5XA 4G5OA 1U0JA 1DE0A 3UWOA 5CJPA 2JASA 4Q4HA 4B2PA 2FEMA 3WYGA 1E0SA 1G3IA 5CLQA 3K0FA 4W5JA 1E2KA 2R6FA 1QDEA 2KSQA 2YOGA 3EW9A 3CWQA 3GJ3A 3B1ZA 4JBXA 2OLJA 3A36A 4UJ3A 1X1RA 3FHTA 2J0VA 5AUNB 1OV4A 4KODA 4TLDA 1PZNA 4R7ZA 1ZU5A 3EPJA 3I4LA 4QXAA 4Y0AA 5KSYA 2V8OA 2ZE8A 1VPLA 2WAYA 2LCFA 3CX7A 3NBXX 4TMTA 3NHAA 4QM6A 2JLSA 4TLEA 1XCGB 1P4SA 4HSEA 4X8MA 1VG1A 3KQKA 1HA3A 4WZBE 1IXRC 2D4HA 4KFRA 4LJAA 4DSNA 4LOAA 1ZNYA 2QA5A 3TQFA 3X1XA 2HV8A 2J0UB 2FGJA 2FFAA 2ZRIA 1EWQA 4HUQB 4B75A 1NVVQ 3ZVMA 2ZJZA 3H84A 2XEXA 3PUXA 1BH2A 2XZLA 1E79A 1VYTA 2HXYA 1IXSB 1XDBA 2OAP1 5JBQA 5BWMA 3LH5A 1D5CA 3U44A 5JECA 5GJBA 4NH0A 1EFCA 1NMYA 4M9XA 2H5EA 2QL6A 1IN6A 1NIJA 2V7QA 1G8FA 1G8PA 1N2CE 2RGAA 4Q21A 5DE3A 3C41J 3VU9A 1WB9A 4G1UC 4OK5A 5KSPA 1U8AA 4BQSA 3ZYCA 3MLEA 1E32A 3HR8A 3CF2A 1HURA 3BJIC 1HH4A 2ZRJA 3E70C 2BBSA 1FQJA 1AIPA 2DBYA 3BWDD 3ADCA 4RVCA 4A15A 1F60A 1RW4A 2Z6VA 3AP3A 3TGPA 4PPFA 1S2MA 2OFWA 3EG5A 1FW6A 5EXPA 5JWRA 2ZJ2A 1OYYA 5EP1A 3GLFA 1ZUNB 1OKKA 3OEED 2PLRA 4M1MA 3B9PA 1R5BA 2QENA 3IHWA 3NC1C 1E94E 3N2IA 1KGDA 4TLAA 2OO7A 4IJMA 4Q4LA 5FUXA 1DAKA 3B13B 1FNMA 1Z83A 1BOFA 3TAHA 1ESNA 2DFTA 2JJ2D 1S3GA 3B85A 3BOSA 3X1YA 2O8BB 2BM0A 2MMGA 2DR3A 2F9MA 3LD9A 4A92A 3MUFA 4PX9A 4DDWA 1DVRA 1WQ1R 3EIQA 3KFXA 1G16A
chains in the Genus database with same CATH superfamily
1E3QA 3PLNA 1OZ0A 3RHTA 4Z1OA 1Y33E 1RBYA 2NIPA 2Y1FA 2FSFA 4DSTA 2I34A 4GRIA 4QO8A 3VJMA 1YHYA 4R1LA 1TTQB 5ITVA 1XEWX 1ISHA 4OP1A 3DT9A 3W6NA 4UM8B 3NAMA 4QQKA 1MO5A 3Q4GA 4CLOA 5MFZA 1GZ4A 1KS9A 3H3JA 2F59A 2ODWA 4NG4A 4YV0A 5EQJB 3KPVA 1KMIY 3G5MA 3A2KA 4RMJA 3I12A 4U6NA 3PDUA 2XKAA 5JMTA 2XNKA 5FPTA 4BQQA 1I1HA 4DCUA 5EUQB 2YWHA 2LIPA 1Y3HA 3HCCA 1P91A 2EX1A 1YA8A 4MZDA 2G7MC 1UDXA 2C3MA 2DB3A 4YRZA 3ROKA 4M98A 4QLAA 2YJ6A 2V0NA 4AURA 1VIDA 2ZI7A 1XQXA 1II8B 1WKCA 1UPBA 3LQQA 1FSZA 4FYHA 3ENVA 2Q4BA 3FWYA 3WB2A 2YN2A 4Z9AA 1JSLA 1SQFA 3W0LB 1L9KA 5DM0A 5I7HA 5K0EA 3QKWA 2IZ1A 4NU0A 4DADA 1NMQA 3CWZA 1CUDA 2ZI5A 4LC9A 8ADHA 1LD3A 4E6EA 3M6UA 4LBVA 3LFTA 5M04A 2IU6A 3FMGA 1YR1A 2TS1A 3G7NA 1A8IA 5JVDF 3HCAA 2OGZA 3AB8A 2EBFX 3L5KA 4QWWA 3WWCA 2NXWA 4D57A 5HJ5A 1GZUA 5CYOA 1A9YA 1EINA 2P1ZA 2PD4A 5ITSA 2NACA 3BRWD 1V48A 3G9TA 3MMSA 4GX1A 1RPZA 2I8AA 3GEGA 4HAUA 1K63A 3GCDA 2BMVA 4JJ6A 4G65A 2L2QA 4QEDA 1Z6GA 3NWEA 4DUGA 4HQFA 1PKXA 3RLIA 3EGOA 3FUVA 4IW3B 4FZJA 2W2XA 3UKDA 1Y8QB 2JA2A 1E2DA 1XGKA 4B6QA 4LVOA 4ZXFA 4LA4A 1B8NA 4NBNA 5T4BA 4EG4A 2WFLA 3SF8B 5JI2E 1DWPA 3BE8A 4FIDA 3TZEA 1DDOA 3T5CA 4CV3A 5B36A 2X22A 3T61A 4B3IA 1RXUA 2XJ4A 1L5NA 1G7SA 4F6LA 2KBFA 5GTDA 1DPGA 1P39A 4R0VA 1V11B 1GY8A 1KI1A 2AG6A 3W9UA 1PLLA 1VP3A 1Z4KA 2C4HA 3OIVA 1NM5A 3LX6A 2ZYVX 8ABPA 5K8IA 2A1UB 3OKAA 3R4CA 4ZIRB 2DBRA 3UB4A 1XWWA 1NC1A 3PNKA 4Q4JB 4Z0TA 3PGXA 5GJVC 2QI9C 3NBFA 3LX8A 1WKVA 2HIGA 2VDMB 3NNSA 4J29A 3GEPA 1VSQA 4JLOA 4P33A 4YNBA 3FRHA 3U9SA 3H2KA 1F4PA 2WW8A 1E2HA 4H7EA 5FNZA 3PXXA 1Q74A 2VKQA 3LF2A 5D2CA 4B31A 2VXYA 4M0KA 5LPNA 2Q4RA 1ESDA 1T0UA 2I71A 2PYIA 5G53C 2CLLB 3SC2B 1EJBA 4YUXA 3OJWA 3TXXA 2V54A 5MN5A 1GL7A 3BTSA 4NBVA 3MNFA 2E55A 1VMIA 2AJBA 2C0QA 2V7XA 5HBGA 4DA8A 1JIKA 1VSVA 2LR0A 3COZA 5K9ZA 2W6ID 5GGYA 4D5EA 1PR4A 4EENA 3EISA 4LYFA 4CM5A 4RJTA 3ROZA 4G63A 4EPTA 4QPJC 4WBNA 3HRKA 1BXGB 4NV3A 1JAXA 4TMWA 4LZPA 3UMSA 1H6AA 4WZBA 4JV5B 2I1WA 2W11A 3HGTA 1PZHA 4HYTA 3KJZA 3ZDRA 4FFSA 2DKNA 2IK8A 4PAOA 3CR3C 2AMJA 3EMKA 2D0OB 3GGOA 3NBYC 4H6VA 1QQBA 1R10A 4GBJA 2QRGA 4K9OA 4QBHA 4WN9A 4YRTA 4S1VA 3MOGA 1CQZA 1VIMA 1V3QE 5IXSA 3PFIA 1SVIA 3HYLA 4EO7A 4U6SA 4BFLA 1CBUA 5A9TA 4R01A 5KVCA 2QWXA 5ICCA 3KXKA 1DC8A 2Z1DA 3BFXA 1JLLB 2CXXA 3D6FA 5AWFC 5B1SA 5IZCA 4LF9B 3EGIA 3QSGA 4YASA 1RADA 1T91A 2XTJA 4M49A 3LFHA 1TLLA 1I2AA 2QTHA 3ESZA 3R20A 1ZCZA 4OQDA 3UAOA 4EY7A 2LCIA 2QMZA 1RSZA 2P9YA 4PIMA 3T7SA 4RZSA 5JE8A 3DEZA 1EEHA 3WDSA 5BSWA 5BV8A 4LGYA 4QATA 2XE4A 2J7KA 1OZGA 5E4TA 1JEJA 1Z26A 121PA 1ZSVA 1TTTA 4IGIA 1HE8B 3H87A 2B30A 1US8B 1Z18A 2O23A 2ZRDA 3EFEA 1IG0A 3K0BA 1PR3A 2PMKA 4X97A 5DHSA 1APBA 2C98A 3G7SA 4QOGA 1NMSA 4KUGA 5FBZA 3X1JA 2IXTA 1AGNA 1LC0A 2RFLA 3O1LA 1O95D 2X6QA 3HBFA 1WXIA 2DVMA 5K0ZA 4JCCA 9ABPA 1UK6A 3T7JA 3G9XA 3IQIX 5KC9A 1PGOA 1EFDN 3UK2A 1QVVA 3AR2A 3AHGA 1N2SA 2H31A 4WKBA 3EDOA 4W1PA 2PMEA 4HQ0A 4RZ3A 2YCBA 5AD1A 1P33A 3L0BA 1YB7A 1IHYA 2KM1A 4B3MB 1V16A 4BQIA 2BZ0A 3IIKA 1D4OA 3T3NA 1W4LA 2M6RA 3SEZA 4AX8A 4V39A 4Y2UA 4M60A 5AESA 3FNIA 2OKGA 1GRNA 2XXJA 4QOJA 4YR7A 2E1RA 3KVNA 1QDUA 2YMQA 3F3SA 5JJKA 3D6JA 1W25A 1KC1A 2GD0A 2PSFA 5ALSA 1JKJA 1WLYA 1CR4A 3GRKA 3H1FA 3H5RA 3P27A 4Y6GB 5JDCC 4B4VA 2OZPA 4XYMA 5KWJA 1BA2A 1WDMA 3W77A 5AXCA 2NU8B 3W3AA 4P3YA 4IUYA 5IWAB 4AG6A 1M5UA 2B98A 4Y1RA 3IP9A 4KN6A 3GJ5A 2CMKA 2FP4B 4O25A 2QZJA 4PZPA 2JIZA 1VMAA 4J2HA 3U7QB 3USES 1ZCJA 1WW8A 2OECA 2DPLA 3GK3A 4FEYA 4UQPA 4FHZA 2EFHB 1WDTA 2J87A 1IZ9A 2QR2A 4KN8A 3WRVA 4EARA 4ENUA 4DCNA 2V59A 1GCOA 2QN9A 4TRNA 3RWBA 3AVTA 2QSUA 3JASA 1J2UA 2P91A 3PL5A 5TQ0B 3QY0A 4MPTA 2AOUB 4I8IA 4JBLA 5FH9A 1USIA 2Z8YA 4XGIA 1QVZA 4C0KA 3UYKA 1BW9B 4D74A 3C3YA 5BOVA 1J49A 1WXQA 2J9FB 5CGQB 3RRBA 3ZWAA 7AT1A 2PUEA 2GUWA 3ACDA 3A1WA 3P8ZA 3WBFA 2NT3A 3FPKA 2DQSA 2YVAA 4OHXA 1YF3A 3DLIA 4CQMA 4A8TA 3AF5A 5I7AA 3UAWA 2BC9A 5KTPA 2UYQA 4II3A 2DC1A 3G13A 3QKIA 4CT0A 1SKMA 2DECA 1G7TA 1MMFB 2Q5LA 1YIOA 3FRJA 3QV2A 3V4SA 4R8LA 3R7BA 1XX6A 3B8EA 2DCUA 5M29A 4Q1FA 2NVBA 3WGIA 1NP6A 5G0UA 1J8QA 4PGMA 2RCYA 2OCIA 1Q44A 2GZMA 5AH0A 5AVRA 5MHTA 2I6SA 4UEQA 3AIMA 1N9KA 1K6JA 5F98A 3GT0A 5A5VA 2JGDA 1U0OC 1JIQA 4RLQA 2ZYTX 1EVJA 4A2CA 3I5AA 4GPIB 4JD5A 5KQGA 3GLSA 4IF4A 3SK0A 3L77A 5BQ5A 5HP4A 1ZM9A 3EWNA 1ZVKA 5DF1A 1Q7RA 3S8EA 1MHPA 3OQJA 3IDOA 1KYQA 1HQDA 1U8ZA 3USZA 2GCEA 4R9UC 3ZE7A 2QVYX 1VSUA 1PR1A 2ZWOA 3JWEA 1KBZA 2FRDA 4QLBA 2DLCX 4OU4A 1QXSA 2P1DA 3G9UA 2PX2A 3GLGB 3HKCA 3JAKA 4LWQA 4TL8A 5DOZA 2H9YA 5LWQA 1KEVA 3IQZA 5T3UA 5KYWA 1K5PA 1JS1X 4V2UA 4AKGA 3WGTA 2NNLD 2OR3A 3T34A 4CI0B 1Z39A 2O8BA 1EFRA 3QUQA 2HK6A 4KWIA 1Z2EA 2CXUA 1E8NA 3VPAA 4YRFA 5IN4A 3C4VA 4ENQA 2WNIA 2Z3ZA 2PT7A 4ZRNA 4HEA1 3DXYA 4YJHA 1BMDA 3WBJA 5JR3A 1T9DA 4KUEA 2Z9BA 4AKIA 2XVYA 1I2DA 1PJTA 2QSJA 5REQB 3L0OA 3CU5A 5JAMA 2X8JB 2VYVA 3W6ZA 3HWWA 1XFAA 2R6AA 1SELA 2B78A 3E15A 3VR6H 4P92A 1QDLB 1OBFO 2IYLD 2YJ4A 3CJTA 3PQEA 4MKHA 1ZM4A 4GXQA 3NHZA 1BD4A 4UCWA 2ZYIA 1USGA 5CDUA 1GPAA 3MJFA 5HR5A 1POXA 3I58A 5GJWC 5HMLA 1FYDA 1O5IA 3P2JA 3CLHA 5GM2A 1XFDA 1XK7A 4X92A 2H16A 1AKYA 3K9WA 3DE1X 5AJVB 1R00A 4KOEC 4RTRA 3VOBA 1KI8A 1JSXA 3ORYA 4MQBA 1DU4A 5DSTA 3RVLA 1OI7A 1VHQA 3WAGA 1YTUA 1UBKS 5EIHA 5CT4A 3Q9LA 1IOLA 1B6GA 1N3YA 2YRFA 4KTVE 3ZHYA 1GU7A 4TMXA 2B25A 2QSYA 2RK6A 2XNJA 3E9MA 1WEKA 4MJLA 2X14A 3TNYA 2OXTA 1FTGA 3HA5A 1XBTA 3EQ2A 4QUHA 1HXHA 2J3DA 1NW5A 2A5DA 2OG2A 4ZANA 1UQRA 4NI5A 3SQLA 1LGYA 5DYGA 2BONA 4YEDA 1GFIA 4NCAA 1OFHA 5HNKA 1E7RA 1BCRB 2PZAA 5A5EA 2WIDA 3OPXA 4JX8A 2ZPUA 2R7NA 2JJQA 3VR5H 1X7DA 1SBIA 4IM7A 4GZ6A 3TQTA 4HWSA 2F67A 4ND4A 4YCCA 3O4RA 4GKVA 2CC2A 5BUQA 1E9BA 4LSGA 4KLRA 5FV7A 3VO9A 1IEWA 3RTDA 2QX4A 4BX3A 1MAVA 2PJDA 2XF8A 3GRZA 5LVAA 1U0LA 3KZKA 4NKRA 2XBUA 5ENDA 1T2FA 2D59A 3GPDG 3KQPA 4E03A 4EG8A 4ZFNA 1UMDA 1Q7CA 4V0MA 4PQEA 3LGXA 3F3YA 3NDIA 4YBRA 4B8WA 4FYWA 3MWKA 4HL6A 1M2FA 3P9CA 5DHQA 1CF9A 4HLUC 1Z28A 3QBEA 3RYFB 4FDMA 1JLHA 2ZBDA 4EJ2A 2P6PA 4AC9A 1V45E 1WXEA 2A8YA 1XZIA 2C2WA 4H17A 3TRIA 3IHKA 3KKPA 2EF0A 4NJEB 4N5IX 3OKCA 4EFKA 4GYKA 2HRZA 2IPXA 2BAGA 3QX8A 2P27A 1RWWA 4BFVA 2IY9A 4QUKA 2EYUA 1Z3IX 3EIHA 2APJA 3DCYA 4CXMA 1I3NA 4Q47A 4N5NA 3TE7A 2W37A 3DOJA 1QWOA 5ES4B 1TYCA 3H6HA 4K9SA 4ZT3A 1EP1B 4MVJG 4YAKA 3WNVA 5HUHA 2D54A 5HCUA 3A14A 2Y76A 3QA3E 1QQ6A 3WLHA 4JP2A 2R4TA 1QAMA 1QRAA 1MENA 3CZPA 4CRWB 5ALJA 4Y2HA 5U4XA 3FLMA 2P9EA 4EUSA 1EDBA 1XKTA 1FLVA 3BMQA 3FTNA 3FYTA 4XWYA 3OOSA 2G0NA 2J3LA 2QR3A 3UM9A 3JQFA 4EP1A 4K05A 4UMEA 1ML3A 5FWXB 1PT8A 2DBVO 5C1DA 3T5MA 2WILA 4I0WB 3DMRA 3K30A 4HZIA 1EBFA 2EKLA 2LDXA 4MQUA 2C2GA 2GN9A 4IEFB 2IIBA 3P71T 3ZNPA 4AW9A 1V9LA 1XMIA 4GO1A 1UXJA 4P8RA 4LQLA 1U6JA 4Z0NA 1SHZA 3V48A 1JB1A 1Y4ZA 1KAMA 3K70D 3MA0A 1AA9A 4JGBA 3BPSA 1LSUA 1NP7A 1WB4A 2HCJB 3ADOA 3WWEA 2H08A 3ZHTA 1K68A 1O77A 3L7LA 4P82A 4CLDA 3FWHA 2V9ZA 3AY3A 1E69A 1IWBB 3NIBA 3SYTA 5LQKA 2G4CA 1RCTE 2NT4A 1XTQA 1SCUB 1G9TA 2P11A 3HLYA 2IHVA 4I8XA 4YYEA 3P2IA 3THXB 2C9MA 4GSYA 4L9AA 2QQ0A 4BFSA 4O29A 5FHRA 2WJZB 1T8SA 2G5CA 5JNLA 3F7NA 4LWZA 3GL9A 3R3XA 5ALTA 1DAFA 2ZVJA 4OHWA 1C3EA 1LDMA 4QM7A 1EJ0A 4OHRA 1LTHR 3VV3A 2HCBA 3LWNA 5CW1A 4BCBA 4LMBA 1H2FA 3HCNA 1B8VA 1P3DA 4P7GA 4PZCA 3KD2A 4AKHA 3H2YA 5HG0A 2V7VA 3RABA 1WJGA 2ASVA 3C0KA 1E3DA 3RS7A 5DK4A 4KHZA 3NC0C 3EJ6A 2IUEA 4PS0A 4WXHA 1AH2A 2H3HA 4YRMA 3CTPA 5CTAA 2WJ6A 5K0FA 2QL7A 4QRIA 5FUQA 4O4HA 4HH4A 2BR3A 1C4WA 4D9GA 3VTKA 4ZCRA 4KO2S 4I50A 3IUEA 4ZOCA 3TQOA 1Z2NX 1VLJA 4IBOA 3ZU5A 4HH0A 1SMKA 2B2CA 3BH7A 1JFSA 4CKWB 4KXQA 4TSRA 3ZUGA 3CXRA 2Z4RA 2E4VA 4AO8A 2HGSA 4RHEA 3SHTA 4UVHA 1LLUA 3H1PA 1E7QA 4LJ6A 4U6QA 1YQGA 4FCTA 1TQ4A 1UOEA 3F97A 4FQ5A 4GEGA 4HD8A 1OX4A 3DQZA 1OW3B 2A88A 1JW9B 1F7VA 5C5IA 1ZA2A 3FZYA 1V5EA 4TRMA 4W63A 2ATCA 2ISCA 3HXTA 3V3TA 3V55A 4C7KA 3LT1A 1LRLA 1UR5A 1USKA 3NV7A 1KI6A 1H9AA 2JFGA 4RZHA 4MV8A 1P19A 1XAHA 3CRQA 2VCHA 3SXJA 1QB7A 1Z5PA 1L7DA 4HYEA 5A04A 1RWOA 3HL0A 4YECA 3KB2A 2GZHA 4B74A 1ODKA 5JSUA 3OEHA 4ZOLF 5TDHA 4TT3A 3L8ZA 1XRMA 3D64A 3EA0A 3KG2A 4IIHA 1WW2A 2OO3A 3K2EA 3EHDA 4XCXA 4MV1A 1VPTA 4W7SA 3VNQA 4V3CA 4JBHA 1SUCA 5KHLB 3BXGA 4ZYTA 4UMFA 4HDMB 4WK4B 1RRCA 2PX3A 4IHQA 1JIIA 5CX1A 3U6BA 2UZAA 4CG0A 1K5HA 2FPUA 4OF4A 1VG9B 3V9AA 1TD1A 1OZAA 1Y3DE 1HSZA 2XWPA 3AUJB 3IEPA 2YHIB 5JQGB 4MWTA 3HDJA 1G5PA 1YUBA 2CVPA 5DBEX 4D92A 3OWXA 4GC5A 2A9FA 1EGHA 3D43A 3MWEA 1WHTA 2PZMA 3ZXSA 4EWLA 1SVLA 2FLVA 4LXQA 1WXGA 2P79A 3C3PA 2C77A 2QVXX 4CF7A 1OH5A 4UU7A 4V24A 4P4SA 2X1VA 3HB5X 1NPDA 1QIGA 2BELA 5DKFA 5JT1A 1ZP6A 1T4MA 5J2UF 4C04A 3IUBA 3MJCA 2GAIA 4P36A 5EIBD 2JJ8A 5CA0A 4BTLA 2A5JA 3GDFA 4TWAA 1GGMA 3PIDA 5HHTA 1RZVA 3QUAA 1UEJA 4FBMA 2VTBB 1YMVA 2AYZA 1GPKA 3BCUA 3I1IA 4M99A 4W6QA 5JWHA 2NXNA 4DUYB 3ZVNA 1MJ5A 3SZLA 3A1SA 2G28A 3TSCA 3WICA 4MP8A 2JLCA 2QQ5A 1CY2A 2ECQA 2ZRQA 3DZDA 3OTIA 5FIUA 3S5JA 2DWUA 4WLFA 4B5KA 2A58A 3BN3A 2NZYA 1CLEA 1W5AA 2PR2A 3NRBA 4ITVA 4JOBA 4RA6A 3OUTA 1M2OB 1UJ4A 3T1HB 1X0XA 3DQQA 3S8YA 3ZLJA 1A50B 3A1FA 4WCFA 3U3KA 1Y8RB 1N8TA 4TSFD 3TW8B 4BMVA 2VF7A 4D02A 2B7BA 4HFNA 4UM5A 4JLPA 5KYKA 1GAXA 4GLFA 3TFOA 3QBJA 5L9AA 3E3OA 4HR7A 3OEYA 3U4CA 4E5MA 2J0QA 1JMKC 1KJ9A 4DLBA 3RV4A 4OX9B 4R31A 3EEYA 1T9GS 4D26A 1AY0A 1P5ZB 2EKPA 5G4KA 4A2QA 2YWBA 4Y7CA 1QLHA 2ZYGA 4L4SA 2V6BA 3O2QB 2BZSA 3VTFA 4CM6A 5KTSA 1A5AB 3K35A 1HYHA 1X2EA 2B4TO 1FVHA 1Y1RA 2PGNA 5J23A 4PSAA 1SHKA 1C8BA 1Z2AA 2R87A 4L74A 1UDBA 1ETHA 4OQXA 2FFBA 2CXNA 4J8PA 2BYTA 3PJRA 1CU1A 2DUMA 4M46A 1CUXA 1NR1A 4DPMA 1I3CA 1U0HC 1FEZA 5GZ6A 1BHO1 1ONPA 4LJLA 4XIGS 4LJ7A 4AZ3B 4AYXA 1A7UA 3QVOA 4EY8A 3RKUA 2YC4C 3N2EA 3QNUA 4LI0A 4LDJA 2ZWVA 3DOUA 4R2IA 5G02A 5AM2A 1ZD5A 4TMVA 5EVCA 2HREA 1KYVA 4LJYA 4NFYA 1XTRA 1PNOA 4ZODA 4NFLA 4YQZA 3TGWA 1KMNA 2BBOA 4Q4DA 2YZGA 3BFKA 3D7NA 4MHTA 3ORRA 2BDUA 3FPCA 3DMTA 4U3JB 3SNKA 3WDMA 3LDHA 1C2TA 2XRMA 2DWPA 1I2ZA 1Q84A 1YE5A 2OHVA 2R8XA 3LW8A 2PUCA 5ECWA 4C5AA 4DNFA 3STTA 4UMVA 3VO2A 4ZC8A 4E2FA 1FXWF 1IJBA 4MYTA 4DY6A 3LPLA 3TTYA 2OO5A 3RIYA 1NV8A 1UPCA 1GZHB 2FEAA 4A0SA 4DA6A 2IC5A 1Z6AA 2HL6A 4AS3A 3ELBA 4ANFA 1MJGA 5TVGA 3FPJA 5EIAA 1TC2A 3UV7A 1R3UA 4AMZA 5EXSA 2WYOA 3KEGA 2Q4TA 3ETCA 1JPNA 3PG5A 4CV1A 1SQGA 1NY6A 3I6ZA 1NXPA 4KLCA 2OM6A 1G8SA 2WJHA 2WKPA 4JMLA 3SOPA 3CX6A 4Y3UA 3BXHA 3B12A 3GB9A 2O8EB 2Z1NA 5K0BA 4X1IB 3TI7A 3EBLA 2WZQA 4H0CA 4M8KA 4MJXA 1MVNA 2A7XA 2ZVQX 4WACA 2ZRMA 1NIPA 2CLKB 4RGQA 2H7VA 5EHIA 2DX7A 4LF4B 2PLAA 1P7ZA 1LF5A 1MB0A 2FPXA 4TXMA 1J9EA 2BEKA 4C3ZA 4MW0A 3QX7A 3F74A 4MV0A 4RU1A 1DHTA 3FVWA 4FFOA 4GVPA 1OOEA 1N2GA 1ZI8A 4ZRDA 1SZPA 1DARA 4WV3A 3I09A 5L7WA 5BSEA 5FLKA 4LFAB 4QOSA 2GEBA 1EJ2A 4NZ9A 2BMEA 3OJFA 5KHAA 3TAXA 4M36A 4TQGA 3OA2A 1PL0A 2ONZA 3K5WA 4DLXA 4KYIB 3WLMA 2ZJ0A 2Q3LA 2A9RA 2QZ4A 2AI1A 3TZHA 5A0VA 3GFTA 1C7QA 5JZ9A 2AEFA 3SJCA 4MJ7A 4L15A 4DZTA 3DHEA 1RLMA 1YB6A 2FQQA 3DDOA 1T4CB 1UPUA 3ELWA 5EP3A 4MV5A 4L6CA 2PGXA 3EVNA 1D6JA 1E63A 3O1IC 2PIAA 4FFMA 4J7CA 2QRZA 4MH0R 4REOA 5KYXA 4XYBA 1GWNA 3N59A 4L8LA 4XWTA 5JG7A 3V6MA 2OK8A 4XH9B 2QTGA 1L4EA 4DLSA 1MPTA 4X66B 2OXEA 2OKCA 1N2OA 2O6HA 4MO9A 1UC4B 2J5BA 3U3DA 2WAMA 2B8NA 5T41A 2Y0DA 4RVGA 4II7A 3S1SA 1RIFA 1UWVA 1TNDA 1YHNA 3I5UA 2R1TB 3F6CA 4UCQA 2GCOB 5TVKA 4X93A 5GVRA 1J8DA 1XQWA 4ITRC 4ZO6A 2Q3FA 3HBNA 2JGFA 2D4AA 4IFEA 3MWDA 1GNSA 2X5XA 4GM1A 1H65A 1OLXB 1PR6A 3AVQA 4B43A 3AHDA 1DIGA 2FN3A 3MEQA 3UH1A 1BXZA 1RRVA 4JJEA 4QE3A 4S05A 1I2BA 2B1QA 1YTLA 3SPXA 4ZQIA 2Y8EA 4KCGA 3SE7A 1KDRA 4L5AA 4HWKA 4X1YA 2GEFA 4UBJA 5D51S 1IHXA 4UC0A 1Z73A 3N05A 3UPTA 3PA8A 2YXPX 1Z07A 2IYYA 5F4ZA 1AGYA 1ZVJA 2GNAA 1Q14A 1W96A 3H11A 1GTG1 4QYMA 4UARA 1B74A 4MGKR 1KKLA 3V4VB 2DQ4A 2DGDA 2AOTA 4F86A 2FUKA 1YCHA 2PCJA 4HDRA 4K6CA 4KFCA 2P2DA 3GXOA 1O89A 3DF7A 4UUQA 3P0IA 3IUNA 1QU3A 4C22A 1UJ6A 1TUIA 2JBAB 3A7EA 1R0KA 3H9CA 3OE5A 4Q7QA 2GDZA 1CIJA 1CT9A 1RC1A 1FFWA 1LVHA 4EVQA 2FGKA 4LGMA 1T8RA 4RPGA 1PFUA 4YUAA 5A4JA 3EVDA 1NRXA 4KXLA 1HYBA 3K6SB 3NAGA 4NLLA 1WY7A 2F8SA 1Z5ZA 1U28A 1UBMS 3N0VA 1FA9A 3AQIA 1Q22A 2F1IA 1H4SA 4DIMA 1WY5A 3CIFA 1EEXB 1JMYA 1YS1X 2TSYB 3EY9A 3FOAA 3T5BA 3WHLA 1Y34E 2XD9A 4KR0A 5MFPA 3MT0A 3QKUA 2O8NA 1T2AA 2FPIA 4KIGA 1VJ1A 5FTKA 3KPJA 2WHQA 3DHWC 4JKOA 3R9WA 2KPOA 1YV9A 4G37A 3KVOA 3SX4A 3WP1B 1VMEA 5CFRA 1E0AA 2YVKA 1ORHA 1SEPA 2RHBA 2XYGA 2DZDA 2EZUA 5CB0A 1HY3A 4GMGA 3A3KA 3MJHA 3NORA 4ZCLA 2QGNA 3VC7A 4KACA 1C8VB 2PKQP 4FGJA 4RVDA 1JIJA 5C2JB 2OCGA 2WHPB 4FXOA 4Q9NA 1U1GA 2CJWA 1ZH4A 1ODLA 4GBGA 3L93A 1ZAYA 4OOFA 2QUKA 1J0AA 1Q0SA 3KYCB 4PF1A 5LMUB 2GN0A 1KQNA 5ELMA 521PA 2WJIA 3H9JA 2XJ9A 4JLVA 4CKZA 4GPZA 5FCDA 3MMZA 4C4YA 4LXIA 4B4UA 1ND5A 2OMKA 1XD2A 3I9KA 4B5LA 4DBVO 5HVNA 3NHKA 4RK1A 3WXMA 1BDJA 1FMCA 3B38A 5FXMA 1Y3IA 1KKMA 3C5CA 4KPFC 3R7NA 3UT6A 3RYCB 1EWVA 1L8XA 1QHYA 2H1CA 3MTJA 5G40A 2GBFA 4RY0A 5FL7A 5DK6A 1E5QA 1DKNA 2MMCA 5A0FA 4CQLA 1M72A 1I1QB 1UOPA 3GJ4A 5JMOA 3LU1A 3BXFA 3R7FA 5HZMA 1TKCA 4ZJUA 2R11A 3QPAA 1P2VA 1THMA 3JD2A 4M9SA 2IOQA 3FHLA 3HY3A 1SUSA 3GZNB 2DWCA 1MABB 1PUJA 2VSFA 5CXSA 4C2TA 3MZ0A 1IBCA 1CR0A 2OGUA 3AW9A 4C87A 3W2EA 4NYMQ 2BEWB 5LZ8A 3QVMA 4G0UA 4QFBA 3SKXA 3WGLA 4ETNA 2ONYA 2QXUA 4MW6A 1Z0KA 2BFFB 2C07A 2R1VA 4CLRA 3IT0A 1CF2O 4N3NA 2Q3HA 5I8WA 4KAJA 4EY5A 3KUXA 4C03A 4DQXA 5LDGA 1F4LA 2ZYSA 4JVOA 4A5OA 3ZS9A 4MGYR 4P2BA 4ZWNA 5AVYA 3OQNA 4GKAA 2RHLA 2TRSB 2C5FA 4V2IA 3Q9SA 4TMFA 2YXNA 2VUTA 3ET4A 3LBFA 1GTJ1 5DHUA 1QVAA 4QGFA 3RSGA 3NBUA 2ZIZA 4JNKA 3VPXA 3D3QA 4PFJA 5KQPA 1I4TD 4QXPA 4Y6OA 4K46A 3KQSA 4UUAA 1LQ2A 3IPYA 4UTPA 2YUIA 3BZBA 2RGXA 1N1EA 1XU7A 3DOCA 4HDQB 5EMMA 3ZV5A 4N48A 3KB6A 2H4WA 3ZZ1A 3E22A 2CE2X 4G97A 3ZE8A 2YQZA 3NQ41 5DNEA 2Z5GA 3EZLA 2WSSD 3WWYA 1K0UA 3AB7A 5F3WB 4IDBA 1UKBA 1YSCA 1BJTA 2ZZMA 4ALNA 1T1IA 2JDID 2QTBA 1NNUA 2XKBA 3ABZA 1G60A 3FCSB 1NQXA 2G0TA 2IYAA 1GZDA 1VA5A 5I7EA 1D0SA 1OC4A 1FX1A 2IVZA 5K0NA 3VDRA 2JI4A 3NMUF 4PNZA 3KYIB 4LMAA 1CYEA 3URMA 2YDYA 4IDQA 4GHWA 3Q2OA 1N77A 4IGEA 3OE7A 1QWSA 1P44A 3FHOA 2PL9A 4QPZA 4FGLA 2PO5A 5HQ3A 1M2HA 3M4NA 1TM4E 3B6IA 3TTSA 1VECA 3QXCA 5K8LA 1J00A 3Q5GA 2CVHA 2Z04A 2EGGA 4HQRA 4D9BA 4M9QA 2CHVA 3HHPA 5GPBA 3IQGX 1AKNA 4DT1B 5KSWB 1R0XA 5IYZA 1B00A 3M5CA 1WDWB 1W6RA 3Q6NA 2GZ3A 3HG7A 3QLJA 4UXIA 5DX0A 4YA6A 2ZYDA 4FDUA 4LC0A 5EZ6B 4A1FA 4MQFB 4FIZA 2ID9A 3I9OA 2XDYA 3B5IA 2P2SA 3K1AA 5HQJA 4QT0A 3PHGA 4FYXA 3EZGA 2C3YA 3FKSD 4X3PA 5CAEA 3RG8A 1R3DA 4ARUA 4RLHA 1G66A 3QI2A 4RGVA 4Z9FA 5EE0A 2IYUA 2O2DA 3NT2A 4K8RB 4UM9B 4C14A 1N4DA 4EO4A 5JRZA 2XVXA 2YZ2A 3PEWA 4C1NA 3OO0A 2CCJA 1DG1G 2NO0A 3VDNB 4NCBA 3B53X 5H5JA 2A5LA 4YAIA 3OZXA 3AEXA 1T0PA 1TB4A 1XEXA 5AOVA 3TCKA 5D7BA 3IJRA 5C1BA 3H83A 1XDWA 3DL4A 2PBFA 5BW5A 5JQGF 1PWHA 2IF2A 2WWIA 3EA5A 1M67A 1RAAA 3PWKA 3EXFA 1AXEA 5KDLA 5BMOA 1P31A 2G09A 1ECFA 1V7ZA 4LZZA 5HIMA 1T3TA 1JIVA 4XSHA 4BYMA 4HF7A 1HT2E 3DD1A 1XMOB 2DTEA 4CM4A 5IK2A 2V7WA 3FYDA 2I91A 1G5HA 3GEBA 3KX2A 3HADA 2XLCA 2C7RA 1MVLA 3JATA 5CXUA 1L5RA 1SQ6A 1BWPA 3A1VA 4UVGA 1TE2A 2BMFA 1Z29A 2I6GA 2JAPA 3E5MA 2I62A 3E9QA 4FFRA 3E61A 1XVVA 4NZPA 1W4AA 2EGUA 2XY4A 4ZEXA 2PMDA 4LKOA 4F7DA 4YAUA 2H1SA 1G8JA 3B2EA 2OV1A 4ZVKA 3N70A 4WFQA 3FE2A 2DPHA 1M34E 2NZXA 5IMSA 3E9YA 3G79A 4M7PA 2W98A 2YOHA 4R4JA 5LIPA 1U3TA 5K4AA 2EDCA 4CNBA 3OZIA 5BUCA 4XYGA 1G6OA 1QP0A 3RWOA 1ZD1A 2G25A 4CF5A 6AT1A 1XDUA 5TXGA 3O4GA 2Z3VA 2CDAA 2H9AA 3BSYA 4D9FA 2DWQA 3T3OA 3FGOA 1SZCA 1QORA 4PSKA 3WYCA 4CFSA 1TEXA 1YS7A 3DE5X 3X3HA 2GSDA 2D0PB 2P9HA 2IHTA 1FU8A 3H86A 1V8DA 4I19A 3PSAA 5JADA 4Y6QA 1W7AA 3HCPA 2BH9A 4HDKA 5JS6A 4IVNA 3L4EA 1DADA 1NBME 4X7RA 5IBRA 3SFTA 4YRJA 3OCUA 4LNAA 4C06A 4X84A 4E11A 3HCEA 4P35A 1EFHA 1FDTA 1QQ7A 2FUEA 2GYYA 3GP3A 4RYDA 1JLKA 4QJIA 2O3JA 1KJWA 1WD7A 1XAGA 2IQ5A 2CNKA 2JAXA 3LZCA 3OBIA 3WGMA 2PT9A 4JOSA 4NYJR 4HUTA 4ZYXA 1KEKA 4BV8A 4UEOA 3BKWA 1KSJA 2PVSA 1E1RA 1R8XA 2RKOA 4HH3C 4CNQA 5AW7A 3QVJA 3AF4A 5FPHA 5IAKA 3TRFA 3IOMA 3ILXA 3VTAA 2M6KA 2ZBPA 2VPXA 1O9HA 1XL1A 3AT1A 2G88A 6ADHA 4IV8A 2X0DA 3H18A 1WCXA 4A0RA 1JR2A 4RXUA 1KPGA 1U1DA 1JECA 1BWQA 2GF0A 3E1GA 1W94A 3FUUA 2HIHA 3GRCA 3H2ZA 2FF7A 3PJGA 3ZZMA 4F4JA 4N65A 3ZBUA 3I62A 2LRHA 2FW0A 1Y4SA 2IXEA 2BP7B 2JK1A 2ZQ5A 2HSWA 1FYXA 3OTGA 5BN5B 3E3NA 1A69A 3UUEA 2UDPA 1K8ZB 3PKZA 1NXSA 4L7VA 3STHA 1FTQA 5KQLA 1P2FA 1BC5A 2RJ3A 2VPIA 4H0FA 4RCZA 1N75A 3IRUA 4J7XA 5SYMA 3O4HA 1QH9A 1C3LA 2P75A 1PWZA 3AESB 3U0BA 3VBCA 3OT1B 1F9EA 2LIVA 2NZ2A 3HU3A 3IVXA 4LYEA 2IPMA 2VF8A 1I24A 3VR3D 4POAA 2OBNA 3CW2A 3GJXC 1XZNA 5F5LA 5L51A 4OSOA 1LB1B 3P9ZA 4HO1X 2WM2A 2C7VA 3HKDB 1M2EA 3BRQA 2XUDA 1V7PC 1X7WB 1H8HD 4KIUA 3JQ8A 4QDUA 3SSMA 4TS4A 1ZSNA 4N3CA 4IR7A 1I7LA 3H4MA 2Z6QA 1Y1LA 2WU0A 1Z36A 4Q3AA 4LJ5A 2G7ZA 4PANA 2FG7C 3TBHA 4EG7A 5BW8A 4QVIA 1W49A 1Z56C 1OXTA 3PA6A 3TX6A 2RGDA 4INJA 1QB8A 2J9XB 4HH1A 1AB6A 2RMKA 4FFLA 3HBMA 1R5NA 1QS0A 4ZGBA 1FIUA 4Z4HA 1LPSA 1AUXA 1W47A 2O2JA 1IB6A 2WU3A 3H5LA 4FZ3A 2GBPA 4MA4A 2GNPA 4N41A 1W36C 2EJTA 1U8EA 1NQOA 3HSYA 3OZAA 4B79A 1U2DA 3I4CA 4CEHB 1U4OA 2KYRA 4NFHA 5JJLA 4D8UA 2AKEA 2QXTA 2XUQA 2HJRA 4FKBA 3A6PC 3DDCA 1YBAA 3FJOA 2AD1A 4FU0A 2GLXA 4L9WA 2H4ZA 2YW9A 3SHOA 5K03A 4QELA 5DPMA 4F38A 4F2PA 2XYQA 4MPRA 3WIVA 5EHZA 1TGYA 1NDQA 5FADA 2XUGA 2BRUA 2ZOSA 3OJXA 1XU4A 3F49S 1MT3A 4TUYA 5JSZA 3HTXA 1OD6A 4X1KB 5H3HA 1ZC3A 3D5EA 3ZWXA 1LSSA 5JMWA 1XAIA 4DJAA 1N7IA 4DDVA 3BBPA 3ECSA 1TECE 3JRNA 4QSMA 2UU9B 2JFYA 4I4CA 3UT5B 1LPPA 3M81A 4PZAA 1H6DA 3QMPA 4WKCA 5ALIA 2ZVPX 1NPYA 2A0UA 1MV5A 2DY1A 2I4IA 2QAJA 3DR5A 4B47A 2O3RA 3CN9A 1J25A 2XDWA 4E4RA 5HW0A 4D4IA 4LF6B 2AUMA 1KR2A 4ZVTA 3FPBA 1XKLA 4RWZA 1QQTA 3BB3A 2XYHA 1IPFA 2W00A 1TM7E 4DQUA 4RCYA 3CUUA 3IV9A 3IKJA 4D7AA 2FI1A 4HTFA 1F2UB 1TCAA 2I2AA 4X63A 2GILA 2VP2A 3T0FA 1GP2A 1NGSA 3QYJA 2J1LA 5MF6A 1CVIA 3I32A 3D3WA 3CINA 4P22A 2Q0HA 5TGDA 3WC4A 3SNHA 1JHZA 3L0PA 3OOHA 3RUAA 2ZI3A 1EM6A 5FORA 1QK4A 3PE3A 4ER0A 2NTNA 3AI7A 1AN9A