5EZ6B

Crystallization and preliminary x-ray crystallographic analysis of a small gtpase rhoa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
179
structure length
179
Chain Sequence
AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 64
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ez6B00
5FPTA 2FFBA 3MWKA 2ATVA 2ZJYA 2ZROA 4FMCF 1OHHD 2NGRA 4II7A 5DE3A 1Z06A 4BFSA 4XVUA 2O8DB 4BRUA 2NZJA 3A1VA 4IFEA 1OIVA 3ZVLA 3KB2A 2N46A 4JLBA 1MO5A 2GA8A 3Q3JB 2WKRA 5K8LA 4QNRA 1UKVY 1XMIA 1CR4A 2QAGC 1OXXK 5L8VA 1QBKC 3SJAA 1PVOA 2JJ2A 2RGXA 4LV5B 4LHZA 1GILA 1KYIA 1R0XA 1H8HA 5KSPA 1X86B 1RW4A 1F48A 2Q0HA 1S1CA 3EZ9A 4TZ0A 2O0JA 4W5WA 4C0HA 2ZQ5A 4MUBA 2VHJA 3W9YA 1D2NA 4PHFA 4PZYA 3NBFA 5F2EA 2OZEA 3MFYA 2BEKA 4C0JA 4CRWB 4I1SA 2RGGA 4PHTA 5C2JB 4RD6A 4OK3A 1N0WA 1UADA 2GJ9A 5E7IA 3REGA 4EPVA 3R7WA 1OIXA 4H9GA 4V03A 4DLWA 2J0SA 1EK0A 3R7WB 2W0MA 3R8CA 3MRSA 4MGYR 5JRZA 3B1YA 2IYZA 3A4NA 3GFPA 4TMVA 1UKYA 1ANKA 3GEEA 4ZO4A 2ZRMA 3IIMA 3LAWA 3K0SA 1U2RA 2R2AA 1S9DA 4K46A 3Q5EA 1Z8FA 4Q1EA 3X1XA 4LJYA 4DCNA 5FUWA 4A1FA 3L8YA 4YDHB 3BORA 3CX7A 5JS8A 2HJGA 1I4TD 2ZRDA 1SVLA 5DYIA 1MT0A 2BMJA 5H1YA 5DI3B 3RLFA 1YR7A 5TV2A 3RS3A 3V9PA 2X1VA 3CWZA 3BE4A 2Z6VA 4URVR 2YNMA 2OHFA 1LTQA 1NIPA 4XD7A 3QBVA 2V6IA 1LF0A 3GLHB 2CHVA 3QXSA 5FPKA 4Q1FA 1P62B 3KXIA 3PXGA 1CULC 2FV8A 3THWA 4DDVA 4NCHA 4QOSA 1W4AA 1SVMA 1EG7A 4L8GA 3THWB 3C4JA 1P73A 3LX5A 4IOJA 3L8ZA 1P61B 4URYR 1Y3AA 1E2PA 3LLMA 2B7CA 1UDWA 3QE0A 1MO4A 4HI0E 1YR6A 1VKJA 1OH6A 2QAGA 1RVDA 4LUCA 3LBNA 4HEJA 2JLYA 1S4QA 4HLDA 2QAGB 4S35A 4F38A 1KO5A 1IN6A 4OJQA 4OK5A 3GJ4A 4V0ME 1KO7A 4FI3C 5L3QA 2J0UA 3NEYA 2XNDD 3AEZA 2J0UB 2MSDB 3CB4A 2ZYVX 1XXHB 1JR3E 1G8PA 2HJVA 2CMKA 1NL3A 2QNRA 3LLUA 4KHZA 2ZE8A 1IXZA 2JDIA 2ZRCA 4MGKR 5G40A 2IC5A 1J70A 4Z8XA 3LXXA 2UZ3A 5FBQB 3EZ2A 3C15C 1PUIA 3W8RA 2RHDA 3CF6R 3IHLA 1G7RA 2XZLA 2NPIA 2EFDB 3KQNA 4RFVA 1KK3A 2FWRA 3HYTA 1RRGA 2V9PA 2CEAA 3FKSD 3U7EB 1T3HA 1EFRD 3UANA 4CIDA 2V3CC 4Y0VA 1S3GA 5JEEA 1JQJC 3BOSA 2XXAB 1Z83A 2ZANA 2XX3A 3THXA 3QY0A 1A2BA 1P9NA 3THXB 1GNQA 1OYWA 4TSFA 3CKLA 3CNNA 1MRNA 3GLGB 4PQRA 4Q03A 1NKTA 1Q1EA 1L4YA 4WZBE 5C46F 5TMPA 4IXMA 3CRRA 5H68A 3KKMA 2R9VA 4PSKA 4UQOA 3GJ3A 4TYNA 1YRAA 1R5OA 2ZREA 3BAFA 2BBSA 1US8A 2IX3A 2PZFA 2VHQA 2XB2A 1BH2A 1US8B 3CZQA 3PQCA 5AJZA 5DH9A 4FCTA 4M9XA 4IVPA 2ZRPA 1YZUA 1JEEA 3IQWA 4FMDB 4UKDA 3LQQA 4IDOA 4XWKA 3BFKA 1UKEA 1KTVA 3OHMA 2C77A 2GEDA 4F92B 1P3JA 2ZXUA 3PG5A 2F43B 2IW3A 3CF2A 3HU1A 4K8OA 4K81B 2REBA 4NU0A 5J5CA 4ARZA 4Q19A 1JPNA 4Q48A 5JJLA 3ZS9A 3AVVA 3UMFA 1Q3HA 1XJQA 4NCNA 4CDGA 3RNLA 2HV8A 2GJSA 1J99A 2QE7D 2C99A 3DDCA 3ND8A 2O5VA 2WJHA 3V4RA 2OUKA 2DFTA 3AF4A 1UKZA 3AGQA 1Y63A 3GLFA 1E2NA 3GFTA 1D9ZA 1FFHA 4HB0A 4WIAA 3A6PC 4Y0AA 3GLFB 5F9HA 4YLGA 3UMSA 1WCV1 1E98A 3IUYA 1KY3A 4B43A 3TNFA 1W46A 4NHOA 2KB0A 4KJZA 1AGRA 1WRBA 3ZD6A 2A9KA 3I92A 4TLDA 5FOXA 5GJWC 2H18A 4B6EA 1ZCBA 3CPJB 4AC9A 2JCSA 3IBYA 3LQRA 4BEJA 2C8VA 4JLVA 1KKLA 2ZI9A 4RCYA 2YJTD 2W6JD 2VP9A 4BFYA 2KI5A 3FWYA 1W0JA 2OV2A 1NLZA 1W36D 4QBFA 3KKPA 5GVRA 4ZDIA 4XSGA 3VR4A 2FZLA 5AK0A 3A4LA 2DFKB 4G5OA 4I1UA 5SZHB 3QJYA 1W49A 1G19A 3NDBB 4Q9JA 4D82A 2GCOB 2IF0A 1LS1A 5CIWA 4WAUA 1FP7A 3LXRA 1XZQA 4KVAA 2EW1A 1F2UA 1W7AA 4Q4LA 1F2UB 2IEZA 1P75A 1KJZA 1M6NA 1FUKA 1LV7A 1VYTA 3B2EA 3LA6A 5F3WB 1GM5A 1BOFA 2F9MA 2NQ2C 3GJ8A 3RSLA 5GJBA 1E9CA 2OO7A 1H8HD 3DO6A 2BKEA 4KBGA 4LC0A 1UEJA 3QXXA 2HDNB 2PJZA 1GKYA 3ZH9B 5L3RA 5GJCA 5IHPA 2GDJA 1OE0A 3FMFA 4AD8A 3G0HA 1E69A 1FQJA 2WZQA 1D5CA 4B3CA 2WICA 5KNBA 3K9GA 3U60B 4UNQA 1G9XA 4RCZA 5AUOB 2XJ4A 5KSYA 1RIFA 3WMFA 3P4XA 4XTRA 2ANCA 1R6BX 4ACBA 2CVFA 3AH8A 2HT6A 1VIYA 1XX6A 1KSGA 4DJTA 1LNZA 1XEWX 3SOPA 3K8YA 5BXQC 3EC1A 3I5XA 1U9IC 4DDUA 4IEEA 4R2IA 4GRAA 2AK3A 4BFUA 1FTNA 2C78A 4QL3A 4DWJA 3ADDA 3CRW1 3DM5A 4JKYA 2IK8A 1Q44A 2WTUA 1CLUA 3SEAA 4QM7A 2A5FA 4Q47A 3TSOA 5B30A 4D2IA 3CH5A 4H1VA 4HAVA 5DYGA 1G3RA 4O2RA 3T1VA 1E0KA 3E5HA 1U0HC 3P20A 1GKIA 4LV8B 4M22A 5EXTA 4LZZA 1W47A 5EP1A 1Q12A 3BBPA 3QVVA 4JBYA 5FR2A 2FGKA 2XZOA 3OEHA 3U4QB 1R0WA 4XD7D 4MGIR 5JHHB 4LY6A 3CPHA 4ZDJA 1HQCA 4LOAA 3P27A 1PLLA 1T3LA 4UXHA 3DZDA 3A1SA 3M1IA 4PFSA 4RZ3A 1DAFA 2QEQA 2QUZA 4ZCMA 1Z0AA 3WBJA 4M9ZA 2IYRA 3WYGA 4TL7A 3LBHA 4BFZA 1DG1G 1QHHA 5L3VA 4FMDF 4C4PA 1TQ2A 1G8YA 1QHHB 2QRZA 3GFOA 3W3AA 1PV4A 2IYYA 4DLXA 4X8HA 1G6OA 3T15A 2CNWD 1LY1A 1E9BA 5FUXA 4DLVA 5JI3E 2VP4A 4N1AA 3OFNA 1XEWY 4QG7A 3SYKA 1E79A 1KHTA 1II8A 1D2MA 1QHXA 721PA 1G18A 2NG1A 4TLBA 1I2DA 3CIOA 3I32A 4D26A 3HDTA 1A7JA 4RKFA 3A1WA 4PO9A 5CB6A 3ETLA 2QP3A 4Q1CA 2JDID 4FW9A 2GZDA 1O3YA 4OQLA 4JSYA 4M53A 3P1JA 3TQFA 2WAXA 1DBSA 2J7PA 2OESA 5FFMA 5KO2A 3QENA 2QT0A 1A1VA 1GWNA 4IKEA 1T6NA 1N6RA 2C2HA 5BQ5A 4CGZA 3GLIA 4M1SA 4MYTA 2ZRKA 1W5TA 4JSTA 1Z0KA 4Q21A 3GLIB 4LSGA 1ZM7A 4UNPA 1FTSA 1NNEA 1WXQA 3CNOA 3PJRA 1U9IA 5CITA 4Q9LA 4TMTA 4CEIA 3RRZA 5EUQB 2KBFA 3GMTA 3TVDA 1MH1A 2EFEB 3SS8A 4HLUC 4TYYA 4HLCA 2YZ2A 3WNCA 1P7CA 2QMUA 2ZEJA 1D8TA 3CNLA 3AP2A 4GDFA 2BEJA 2VEDA 1DPFA 4NCJA 3I62A 1NI3A 1TUEA 2CLSA 1J8YF 3AUYA 2ZRIA 1R7RA 2D4HA 2OCBA 4QM6A 2RCNA 2PCLA 2QENA 1DAKA 2IEYA 4RD2A 4MRVA 2ZRAA 1MKYA 1G8HA 3VTKA 3GQBA 1NY6A 1S2MA 1XMVA 2KSQA 4C3ZA 2FPKA 4Q66C 3EIQA 2H1LA 3SJZA 3VMFA 4BZPA 4AY2A 4WA7A 2X2FA 1U8YA 4TLAA 2GVDC 1HUQA 3TUIC 4LGMA 1U99A 5FOWA 2ZE5A 2HXYA 4F91B 1YZNA 5CM8B 1Q3TA 1G3UA 3ZGXA 1P4SA 1CU1A 2W58A 1EESA 1ZUHA 1SZPA 4NYJQ 4OKSA 4PZLA 2FJUA 3QI2A 1NVXQ 1W4BA 5KNDA 2ZTSA 4Q7KA 4O2LA 2GHIA 4URZR 1QG4A 1I4LD 1KK0A 2VHUA 5EE0A 2GEUA 1KOFA 1TQ6A 2OLKA 1ZD1A 1DAEA 1ZC3A 2CDNA 4LJ5A 5AJVB 3LDAA 2Q21A 4ESHA 1M7HA 3T12A 4GP7A 2X2EA 4JLPA 1JAHA 2MSEB 1P2TA 3L43A 1Z22A 2ZU6A 4GOXA 3MSXA 5AWFC 4BLQA 2CE2X 4PSVA 1EX6A 3GCGA 221PA 1VYVA 2H7VA 1AKEA 1NN5A 2IXGA 1N6NA 821PA 1IY0A 1G291 2DY1A 3AM1A 3R9WA 2J46A 2VSXA 3H4MA 4DLRA 121PA 2GESA 4V0KA 5DSZA 4B73A 1OH5A 2ZAMA 4HYYA 1QHGA 3RRYA 2DWQA 3LVQE 2PLRA 4HLUA 3DHWC 2GZAA 4RJLA 2P2LA 2C9YA 2REOA 4TMXA 2P5TB 2OXCA 4KFRA 4BGDA 2XGJA 4TYWA 1OB2A 3BB4A 3GPLA 2BMFA 1E4YA 3HWSA 4TL8A 2ZRLA 3GJ5A 3L0IB 3SQXA 4L4UA 4LWZA 5EZ6B 1E2QA 3KUDA 4RD0A 1FOEB 3IEUA 2P67A 1SULA 2OBLA 4QBIA 3GJ6A 2ZU0C 5FPHA 1AM4D 4UNRA 5C4GB 3U3RA 4A15A 4M1OA 5AJWA 3NHAA 1CP2A 3SN6A 1TNDA 2G1KA 1W36C 4ILEA 1IN5A 2BJWA 2QG6A 4WBSA 2VP5A 3Q72A 2ZRBA 4MRPA 2O8BA 2Q3MA 1SQ5A 1HQYE 1CJUC 4NYMQ 5EE3A 1VCMA 2WWFA 2ZR0A 1EFRA 4FWIB 1AQYA 4ZDWA 2GAAA 4DUGA 3OIWA 3BB3A 1BYIA 4XVRA 5D3MA 1EFHA 2WWWA 3VR2A 2GXAA 3KFXA 3OAAA 4LDJA 4W9MC 1XD2B 2J0VA 4KSBA 4DCSA 4V0MA 2LKDA 2ZE7A 1QZXA 4ERNA 2HYIC 3SU8A 1RZ3A 3I8XA 4EPWA 3CRVA 4Z1MD 5EJEA 4P4UA 2Z43A 4JLOA 4R7ZA 1N5JA 1JR3A 3AP3A 3RS2A 1UBCA 3ECCA 2HYDA 1E2FA 3DPUA 1OFTA 3U7HB 2Q9CA 2YVUA 3BH7A 3OEHD 2ZI6A 3WMGA 3WHLA 4C0QC 4QHSA 2LKCA 2BHRA 4B76A 3T06B 1RRFA 3HR8A 3THYA 3ZQ6A 1DS6A 3QEOA 3HPQA 2ANBA 4FCVA 4A8JC 4JL6A 1A2KC 2WHXA 3DKPA 1NSTA 3JZMA 3BJIC 4BWYA 4W5JA 4RD3A 2DPXA 2ORWA 1W48A 2EWVA 4MH0R 4PQFA 3KXKA 2ZI4A 1N3BA 1U0LA 1IONA 1P60A 2FFHA 2FFQA 2XEXA 3B78A 2E87A 3N2IA 2AD1A 2V55B 3BFXA 4G01B 4KV9A 2WKPA 1HTWA 1AZSC 2MMCA 1OFIA 2JIZA 4Q9KA 5JHGB 3V4FA 3EPKA 4CVNA 3EA0A 3L0OA 4IDHA 3QKSB 2Z5FA 2AHOA 1CJVC 3BS4A 3VAAA 1XD8A 1BKDR 5KYKA 4XWOA 1FW6A 4EUNA 3OFND 3RS5A 3RC3A 1E79D 4A2QA 4QGGA 4NCKA 1AJEA 5ELXA 4DSOA 1W4CA 5FBRB 1FNNA 1Q22A 1JBKA 2BJVA 3NVAA 4UXIA 3TH5A 2QPOA 2VPPA 2ZI5A 4M4SA 4DCUA 1KKMA 4ZCLA 4NYJR 2R6FA 1KI7A 3M0EA 5C4MA 1QRAA 4KXFB 1N6PA 3E1SA 4D0LB 4LJ9A 1XCGB 4CZ2A 3U6KA 2RKOA 1DADA 2J7PD 4E09A 2B8WA 4YQFA 1VYUA 4QGHA 2ECKA 4JLDA 2MMGA 2ODBA 2OT3B 1B23P 4D4MA 2IYWA 3QKRA 1KJWA 1S3SA 4MUAA 1T5IA 3UWKA 3QKRB 4Q00A 4A6XA 1W36B 2ODWA 1W2GA 4BLRA 4XJXA 3K0EA 4Q4AA 2FSHA 1TF5A 3T35A 2OSBA 5FTLA 2PX3A 2QP9X 2O8FA 2NZ8A 2GJKA 4BFTA 2O8FB 2G6BA 1XU4A 1E32A 3B82A 1X3SA 2FPMA 2W83A 3FMPB 2A3RA 1WBDA 1G5RA 5HE8A 1VCIA 4JLMA 4C0AC 1N0VC 3L0SA 4Q4JA 1FUUA 5GVSA 1OFHA 3OESA 2C03A 2B8TA 2PZEA 5AR1A 4M1YA 5LD2C 2AN9A 2H92A 1OXVA 2QI9C 4E03A 4A9AA 4Q9HA 2YWFA 3NC1C 1ZINA 4DIEA 2F3TA 4C0KA 2IL1A 2ZUCA 3SNHA 1VIAA 2ERYA 1G5PA 5DI9A 1R0YA 2EFCB 2CE7A 2GVZC 4A8JA 2C9CA 4A8JB 4C2TA 2C04A 3T1OA 1IQPA 1ZP6A 3U2QA 2HF9A 1OYYA 3BH6A 4R2HA 3Q7QA 2W2TA 2AFHE 4DLSA 2Q9AA 1OT3A 3OEEA 2NO1A 3HP1A 4D81A 3BD9A 2H17A 3AVOA 3PENA 1UBEA 3D6TB 2VHCA 2OEPA 4R98A 2N1BA 4HAZA 1G7TA 1VDZA 1X8KA 1IAQA 5SZKB 4NYIR 2UVQA 3RWOA 1IN8A 3T61A 4ESVA 2QL6A 2J87A 2R8RA 3NXSA 4KCGA 3RWMB 2AD5A 1YRBA 2EVWX 2YWGA 2JEOA 2CVHA 5HCIA 3TW8B 1OH7A 4NYMR 4JT2A 2QQEA 1M7GA 4Z8YA 5E7MA 2VSOA 5FUVA 1WQ1R 1IBRA 4JJKA 1AKYA 4L9SA 1P2VA 1IXSB 1T0JB 1ZIOA 3ZVMA 3FMOB 3TVTA 1XJ0A 4FD2A 2HUPA 4HDQB 5KHOC 5E95A 3UG6A 3CZPA 2WAYA 5E4FA 1MO6A 2FH5B 1YZQA 4OBEA 5KPDA 4AYXA 4F93B 2WJGA 2FSFA 3ZZ0A 3QXCA 2EYUA 4L9WA 4A2WA 2WMNB 5J4LA 3AVYA 1N6OA 3CH4B 5HTKA 3RAPR 3WRYC 3IPXA 4DDWA 2R65A 5FPSA 3SYLA 2DWPA 1SVOA 2AWNA 3O8DA 1KNQA 1ZCAA 5JECA 3ZZUA 3KQHA 1R10A 1TPZA 2XTZA 4TQUS 4MYHA 2CNWA 5TDHA 3F0TA 4NP6A 4V02A 2JAQA 4YMSA 1NN0A 2FA9A 1X1SA 5G53C 3QVUA 4GI7A 3RHFA 5L3QB 3B1XA 4OHWA 2SHKA 5LD2B 1KO1A 4MQBA 2YYZA 2Q6TA 4CW7A 2QA5A 4LHXA 2BKUA 3U3JA 4JLJA 3TGPA 3FMIA 3QOFA 4MGZR 2IWRA 4Q7LA 3TMKA 2ZR9A 4A92A 2GILA 3IO3A 2IHYA 4RD1A 3W5IA 4ZCIA 1CRQA 1OPXA 1TAGA 1YR8A 2CCGA 2QTHA 3QG5A 2IYVA 4A0RA 1E99A 1KI4A 4WZ6A 1G7SA 2DR3A 3PITA 1HEIA 3OF5A 4HB2A 2JLVA 1CEEA 2HXSA 1GAJA 1TUIA 2ZIAA 3CX6A 4DUGD 2G0TA 1EGAA 3MD0A 3TJZA 1KAGA 1D6JA 4GOJA 1XNJA 1YVDA 3SBEA 3OAAD 4IOLA 4E5UA 1S1MA 4HZUA 2V1UA 5EQTA 4WXRA 4EFNA 2GJAA 2N42A 3KB1A 4OI2A 1S9HA 4N0EA 4U02A 1E0JA 2CHQA 1ESMA 4PTLA 3A4MA 2YWHA 4Q9IA 1Z29A 5FR1A 1JR3D 1TF7A 2JLQA 4CT4B 1ONBA 3LY5A 4AKGA 2RGNA 2BOVA 3B1VA 3KQLA 2HCBA 3QPWA 1G5TA 2FF7A 3AV0B 5CYPA 1QF9A 2IS2A 1YKSA 1HT1E 3CPEA 3FTQA 2QZ4A 4ZDKA 5DHAA 2EU8A 3F3YA 2QSYA 4CYMA 3OIUA 4A0HA 2WJYA 1JJ7A 1KI1A 4ARZB 5DN6A 4DCTA 5GJVC 4EFMA 1JQLB 1FZQA 2ZI7A 5FBVB 1P2SA 3EPLA 3UG7A 4EDHA 1Z0DA 2JIZD 4LPSA 4B75A 1E2EA 1NG9A 4U00A 2H5EA 3VQTA 4JL8A 5JCPA 1V5WA 3T34A 1JPJA 5G3YA 3Q85A 1VG8A 4PX9A 2OILA 3ASYA 5AJXA 1N2CE 1IHUA 1ZAKA 4XWAA 4UJ5A 1KI2A 3SDZA 2VIIA 3OIYA 1F5NA 1G41A 2R6AA 4KAXA 3OE7A 2ATXA 1UAAA 1U8AA 4B6FA 3UPUA 3KX2A 2Z4RA 4GPTA 4LJ6A 2OE2A 1KMHA 3MUFA 1J90A 5BW8A 2A5DA 2FSIA 1NSFA 2ZJ8A 1N5LA 4IVRA 3CUEF 1P9RA 1R8QA 1ELOA 2ZSFA 4GFDA 1MABA 1Q1ZA 3J81k 4F4JA 1LS6A 2W6ID 2WIAA 1MABB 5C18A 5KUTA 1ZM9A 1NN3A 4BFWA 3U44A 1L8QA 4H1UA 4HB4A 1F3OA 1XCMA 4MYUA 3GJXC 5KSZA 1DAGA 3U44B 1Z08A 2WIBA 4LK2A 1TMKA 1TU3A 2IUUA 5EXXA 2ZRNA 2R44A 4M9QA 4JVNA 4RVCA 1YZTA 3LBIA 4F4IA 2YWEA 4CEJA 1J8MF 4S2EA 4YMUA 3PR1A 4NKRA 3TLXA 2JLXA 2PL3A 1JI0A 2OBNA 1OB5A 1GUAA 3EIHA 2ZJ2A 1PLKA 2B7BA 2FU5C 4JS0A 3QF4A 3ICQB 3FPAA 2IS1A 5BYKA 4LHVA 4LHYA 1IN7A 2ODEA 1KI6A 2A7QA 1CF4A 3IGFA 2ZRGA 3CX8A 3NHBA 5LDDC 3DZ8A 2OAQ1 3UMRA 5HZKA 3KXLA 3SC3A 5TARA 1IJEA 4JKIA 4A6PA 5JBQA 1NVUQ 2QN6A 4PXAA 1P9WA 2BCJQ 2I1VB 4LBWA 4GZLA 2OFOA 2VTKA 3OEED 5GADl 2F55A 3BH0A 2TMKA 1T9HA 3TSWA 2AXPA 3BB1A 1K6MA 1CR1A 2DWOA 4NDZA 3B1WA 4LCBA 1DE0A 1E2MA 5E7JA 4DLZA 4TTQA 4US2R 5J47A 1V43A 1KSHA 2O0KA 1T8UA 3M4YA 2P65A 4D25A 3SR0A 2R6DA 4HSEA 4FWTA 2B6HA 2FNAA 1P2UA 3EASA 4QHYA 1XBTA 2GRJA 2J0QA 1U0JA 1M1YE 4B71A 4Q1DA 5KSOA 1VG1A 3MCAA 4Z1MA 3KJEA 4GL2A 3BXZA 4B48A 4Z54A 1ZNXA 2ZYTX 5KDOA 3VU9A 3NKVA 4CEHA 4JZKA 3NBZC 1QVAA 3CO5A 2GXQA 1GRQA 5CLQA 1IY1A 3VU9B 5IRCD 4CEHB 5HR5A 4IDNA 5L3SA 4ZKEA 1Q21A 5FUYA 3TAHA 2ZRJA 5L3SB 1NF3A 3C41J 3NH9A 2IYSA 4GNKA 3ZVRA 1KZGB 1F2TA 1FQKA 3ADKA 3EW9A 3ADBA 1R5NA 1Z6XA 2ONKA 3GP8A 1XTRA 1AK2A 1WDTA 2F6RA 2ODNA 2Z4SA 3WNBA 3HPRA 4ABYA 2JATA 1Q57A 1N5KA 4JLKA 4JVSB 4BLSA 2WPDA 4HDCA 4NMMA 1BMFA 4AYTA 4MDEA 2A5GA 4KU4A 3V00A 4AG5A 4URUR 5K8TA 3K0FA 2G88A 2JASA 1SXJE 2BBOA 2IWHA 2F1RA 1P72A 2QRNA 1NVVQ 4PC6A 2QGZA 4IXNA 4LHWA 3PUVA 1ZU5A 1II8B 1SKYE 4KI0A 4G5GA 1E2KA 2NO0A 2R6GA 1E9FA 2G77B 4US0R 2IUTA 3L82B 2D2FA 2FPLA 2WOOA 2J45A 1NIJA 3W5JA 2OCYC 4IDPA 5B2ZA 4C9BA 1G8FA 2PMKA 1DOAA 1WE2A 2FN4A 2KE5A 3GLGE 2AR7A 4AKEA 3IPYA 4P4TA 3W6NA 5AUNB 4GMDA 1EFUA 5BN3A 4FXPA 1T8TA 5H70A 1OXTA 5CIQA 2VRWA 4TZ6A 4DHEA 3NH6A 1XTIA 3P32A 4KBFA 2OLJA 3BK7A 3MWJA 2OAP1 1G8GA 4BEBA 4CEIB 2VSFA 2FGJA 2IS6A 1M74A 2DFLA 1UEIA 3U61B 4M0LA 5IF9A 1G64A 3PUXA 5SZJA 3ZIAA 5LB2A 3K09A 2VHTA 2F9LA 2BIFA 5HCNA 1X8JA 1PZNA 2FEMA 4YDSA 1M7BA 2J7KA 5CYOA 4BE7B 4IVQA 3KKQA 3DEFA 1ZJ6A 5FOVA 4G0NA 5EXPA 3WBKA 1KI9A 2DBYA 2JLSA 1M2OB 2CL0X 1GTVA 2OCPA 3T5DA 3HU3A 1JR6A 3O47A 1E9RA 4PHGA 1UJ2A 5JRJA 1OSNA 2AKYA 2F7SA 4M2LA 5FH9A 3AUXA 2AX4A 3VX4A 1AIPA 4O0MA 1MRSA 1DAMA 4PPFA 3LW8A 4C0LA 2BWJA 1YZLA 1E9SA 1GNRA 1CJTC 5DN6D 1N0UA 4BLTA 4PPGA 5KDDA 4LRWA 2GBLA 4KYUA 1W0KD 2OFXA 4EKDA 1R8SA 1WF3A 3W90A 2Z83A 1UM8A 4I81A 1ZVQA 1I4DD 2QT1A 5BWMA 3BGWA 4IOMA 5FL7A 3FHTA 4ZI2A 1KMQA 2NOAA 3C8UA 1N5IA 1T91A 1D9XA 1FMJA 2FZ4A 5FOTA 3FHOA 3H0KA 3RABA 4B74A 2C98A 2FG5A 3LWNA 2CL6X 2WMOB 1A4RA 4POAA 4AKIA 1XTQA 2QQ0A 4MRNA 3EG5A 3OE7D 4AURA 1E4VA 4IEIA 5J40A 4BECA 1XDBA 5KTYA 3IEVA 1EXMA 4X8LA 4HB3A 1GOTA 3WP1B 2WJIA 3KUCA 3KDSE 5HZHA 1AS2A 3ND9A 2QSZA 3U7FB 1TU4A 1KGDA 2ZSDA 4XH9B 3RANA 3LO5A 4LJ8A 1IJFA 5JEDA 1YU9A 1X8LA 5J4KA 2P6UA 4M1MA 2FFAA 2QMHA 3AKYA 3NEJA 3SHFA 2WWXA 2WWIA 3IHWA 5JWHA 5JS7A 3AKEA 3EIEA 4TL6A 3TR5A 1GSIA 3LH5A 1TEXA 2WM9B 4HDOB 2FX3A 4HLQB 4J0QA 4YXWD 5JLJA 3I72A 3DMDA 3AVUA 4WW0A 4NPHA 1MR3F 2HCJB 3KL4A 1QHIA 2PJRA 1UBFA 1X6VA 2F3RA 3EA5A 2VF8A 4LC1A 4MRSA 3I73A 4NL4H 5CLLA 4ZKDA 5J4VA 1AZTA 3BWDD 3THOA 1IXRC 4QRHA 1LB1B 4XVQA 4M21A 1KSJA 3N70A 4JBWA 1EWQA 4BLOA 3ZYCA 2ZYWX 5B58C 4BZQA 3RRNA 1ZMXA 2H8KA 3VFDA 1NBMA 2WJVA 3KJIA 3QUSA 2O52A 4URWR 2G9NA 1Q1BA 1ZYUA 2XSZA 2BMEA 3JVVA 1T0HB 3CF0A 3S1AA 1NVVR 4OQNA 1HY3A 3S1AB 4LI0A 2YOGA 2IYTA 2CCJA 4UXJA 2X77A 4LYFA 4P4SA 4QXAA 4OQMA 2QM7A 2AXNA 4JYBA 1CTQA 2ZAOA 3AQ4A 2O8BB 1NMZA 5AUPB 1Z3IX 3L2OB 4F4CA 1XPOA 4RZ2A 4I4LA 4TLCA 3BRWD 4GP6A 4C7OA 3ZVNA 3HU2A 2G3YA 3I61A 3TUJC 2CL7X 1NN1A 2QMOA 2ZJOA 2JLUA 4KFSA 4DLYA 5D3MB 3K70D 5JI2E 4BPBA 1GFIA 4QGFA 3N2EA 1K8RA 1QVRA 3QF7A 4IFBA 2PEZA 3K9HA 2ZS9A 3ASZA 1C1YA 4EAQA 1E2HA 5C1BA 4AWXA 2PEYA 4JLAA 1XMJA 1EX7A 1PJRA 4AI6A 5JFGA 4B3FX 1VCOA 4B47A 5FPYA 1DELA 4DBLC 3VHLB 3LV8A 4QHTA 3R9XA 1JXMA 4EJSA 1CR2A 2XNSA 2VP6A 3PUYA 1GP2A 3W3ZB 1DVRA 3THYB 3ZQJA 3SFZA 2C96A 1KJYA 2BCGY 1E9AA 1E2GA 1DO0A 2L0XA 3VKWA 3RDPA 5CB8A 3RS4A 1OV4A 3DVLA 1DAHA 2WPDD 3P26A 4XOIA 4FINA 1E3MA 3SBDA 4A36A 1BMFD 1E0SA 2W2VA 4DSUA 5K8IA 1KI3A 2Z0MA 5DGXA 1UPTA 4TQAA 4D4LA 1SGWA 3U5ZB 2BDTA 3O8RA 1YR9A 1W5SA 2IYQA 1RJ9A 4MKIA 4B3BA 1RJ9B 5AUQA 4LBZA 1ZC4A 3KFVA 2ZVPX 2NO9A 1GL9B 3H86A 3UWOA 2D2EA 5BYJA 4DIDA 3CR7A 4D4KA 2J1LA 1TL7C 1FX0A 1K5DA 4EIWA 1FX0B 2YOFA 2ZJAA 3DKVA 6Q21A 1VHLA 2X8AA 1CR0A 2IA5A 4LJ7A 1VG9B 2ZRHA 4ASUA 3WYAA 2QMEA 1S96A 1CS4C 2A78A 2W6IA 1RYHA 4XTCS 1GDDA 4NCIA 4EPTA 1E2DA 3X1DA 5KPJA 3GEIA 3U6BA 3MLEA 5FBLB 2I4IA 1AQUA 3C5HA 4QGAA 4Q4AB 5KU1A 3QSYA 1NMXA 3FE2A 4L15A 2WSSA 4P3YA 4GMXA 5B64A 1CXZA 3NG1A 4PC3A 4B2IA 1L7VC 1XRJA 2LWIA 421PA 4UNNA 4F7WA 1W2HA 1MO3A 5CDFE 1Z2CA 1ZW6A 2ZUBA 3ZIAD 3FOZA 1MOZA 2YKGA 1NKSA 3KTAA 1K5GA 4Q4JB 2FSGA 1G20E 2O8DA 2ZSBA 3KTAB 4NE2A 2VP0A 2QORA 4KITB 4BUJA 1OH8A 3RS0A 4LV6A 5FI1B 4Q1AA 4M1TA 3AVTA 2GK7A 3X1YA 5J4YA 1JB1A 2JLZA 2B92A 3A1UA 1CBUA 1XP8A 2JLWA 1N6LA 4R9UC 2GETA 4IHQA 4IJMA 2VYFA 2JLRA 4RZUA 4DC9A 4QJ3A 1XMSA 4JMPA 4M1WA 4BQSA 2NPFA 1ZIPA 4PPQA 4ACAA 3C7KA 2IYXA 3SYNA 2XJ9A 3RYTC 4RKEA 3SJCA 2QU8A 3AF1A 3K0CC 4MA4A 1KK1A 4ZPXA 1R2QA 2RB4A 3MGCA 2ZJBA 5FTNA 1TEVA 2RGEA 1ZNZA 2P5SA 4DDTA 4LYJA 5FL7D 1XF9A 4OI1A 4KO8A 4OHZA 3X1ZA 3CLVA 1TF2A 4P33A 3Q9LA 5B57C 1W4RA 2C9OA 2E1RA 2PLFA 3OZXA 3X1WA 4TMZA 1Z63A 3EPHA 4G5QA 5FL3A 3QXHA 1SXJC 1YQTA 2YINC 3A58B 4TMKA 1CIPA 1MV5A 4P31A 5DNYB 2ZPTX 3CWQA 4D80A 3U3OA 1O87A 1H8EA 5HKKA 4ON9A 4M9SA 5EE1A 1RRPA 4AG6A 4WXPA 3ZS8A 4HATA 5EZ5A 2QM8A 1Z0FA 4BZXA 4OHYA 1XPRA 1QG2A 2WVJA 2RGNC 4FIDA 1RFLA 5TXGA 2QAJA 3MJHA 4KVGA 3B60A 2YOHA 4R71A 1NBME 3GJ7A 3IDQA 4OI0A 1L4UA 4US1R 4QBHA 2PMDA 4WZAE 1RE0A 2EWWA 4MDFA 4LPKA 4BFVA 3TIFA 1G3IA 2ZUDA 4YC7A 1TADA 2I3BA 4X8MA 4CT5A 4RFSA 5TB5A 5DI3A 4N3NA 2NO7A 1U94A 4RFSB 3UIEA 2Q3HA 2OG2A 2WJJA 1QDEA 3I4LA 1G1MA 1NP6A 1G3MA 3AKDA 4KODA 5FTKA 2D74A 2Y8EA 4RSGA 521PA 1DO2A 3EC2A 4EPXA 5SZIA 5A4JA 5TY0A 3GLHA 3A36A 3R20A 4BLPA 3X2SA 3E70C 4GT1A 3KJGA 4TT3A 5FBWB 2WWGA 3K9LA 1RYFA 4PQYA 4TMWA 4WVFA 4N0DA 2CK3A 2IS4A 4QC2A 4YMVA 3GD7A 4B2PA 1KO8A 2GNOA 2A2ZA 3AVPA 2DHRA 4B3XA 1JNYA 1GZSA 1B0UA 1L2TA 3B9PA 3FB4A 1HT2E 1UDXA 1T4GA 1NBMD 4TTRA 4EQ6A 1NLYA 2GJ8A 1YZKA 1Q1QA 4EQ6B 3HYRA 1KAOA 3AVWA 2XSZD 2BC9A 3D8BA 1T3SA 3E2IA 5F98A 3F5FA 4HAYA 3VR6A 5FI0B 2HEIA 3TQCA 3LD9A 3IBGA 3NBXX 3PEUA 3GEHA 2P3SA 3B7GA 1M8PA 3ICEA 4NH0A 1YE8A 3K0CA 1G4AE 2QPTA 3MWLA 4P32A 3I5YA 4JJZA 4PO8A 4CF7A 3PV0A 1R0ZA 1XXHA 2WKQA 1XEXA 3K9NA 2WBLC 3BERA 1BIFA 1XEXB 3QKUA 5EE9A 3D7MA 1U8ZA 1HE8B 1XTKA 2CLCX 2IHBA 3FFAA 1SHKA 1ZUNB 1C4OA 1SXJA 4QNMA 4HZUB 4LBVA 4PO1A 1TTTA 2A5YB 1SXJB 3AB3A 2GAOA 2AK2A 3QBTA 3O8BA 4PHHA 2XAUA 2QGNA 4DB2A 4JBXA 5JMTA 1GNPA 4KFTA 1SKYB 4MKGA 4PAOA 3R9IA 3CRMA 4U7DA 1LFDB 4NBSA 1E0AA 4G5SA 2XXAA 1ZNWA 1KZ7B 1GITA 4A82A 3PFIA 2BMDA 3WRXC 3VNUA 3GLGA 1SVIA 5DISB 1SVWA 3CM0A 3TBKA 5AJYA 3NBYC 2D62A 4DCVA 1E1QA 1E96A 1NLFA 2ZSAA 4RZXA 1Z6AA 2J3EA 4OK6A 4LYAA 3TAUA 3RRMA 2RH5A 4TWZA 1OFUX 3H2YA 1W0KA 3EXAA 3SQWA 2XTNA 3MWYW 3FGNA 4V0OA 2I1QA 1T5LA 4TL9A 2VA8A 4W5HA 5CJ2A 1HE1C 2GCNA 1BO6A 3BIFA 3VX3A 1JXOA 2QTVB 4DXAA 1XWIA 4GZMA 2F43A 4I1OA 2PT7A 1E9DA 1VMAA 4PZZA 1NJFA 3K70C 1COWA 1XTSA 3IIKA 4DT1A 4HAWA 3ZD7A 2P0EA 4DT1B 2BVNA 1OKKD 4PC1A 1NJGA 1AN0A 1G4UR 3WY9A 2FDCA 4QBGB 2EFGA 1SKQA 3Q5DA 3SHWA 1AS0A 3VR5A 1OJLA 3CRQA 3D31A 1ZU4A 3T5GA 4M8NE 3EWSA 1KMHB 4PPNA 4ASUD 3AF2A 2HF8A 1E2LA 1KSFX 4B35A 1XZPA 1FP6A 3QPUA 1DTSA 1FPMA 4DSNA 4U5XA 4JYCA 4ITRC 3VR3A 2VLIA 1VTKA 3IIJA 4ZV4A 4PAQA 1UFQA 2IYUA 4JT4A 3AP1A 2ORIA 2WSSD 2NO6A 1C9KA 3K1JA 1DG3A 3PUZA 2HLDA 4HZIA 1WB9A 1DAIA 2ERXA 4YXWA 4CEJB 2Q3FA 4I99A 1HURA 4B34A 4LJ4A 2JGNA 2B21A 4D0NA 1KDTA 2OXRA 3LX8A 3FDIA 2IYLD 5CM9C 3AF0A 2QPAA 3FKQA 4AKHA 1W1WA 2CXXA 4MKFA 4DEXA 2F1IA 2GCOA 3QF4B 2VF7A 2C5LA 2IXEA 5J4HA 3EPJA 3FVQA 3KKOA 1XPUA 1KI6B 3RC8A 4TYPA 3AVXA 4QJ4A 3W8NA 3FFBA 4MKHA 3AF3A 5DIFA 4JLNA 2JJ2D 4TLEA 2C95A 1P6XA 2AFIE 3RVBA 3GJ0A 2D7CA 4BRWA 3EX7C 1W44A 1N6KA 4W7SA 5A0FA 2WSMA 3W6OA 1DEKA 1QHYA 2PH1A 3C14C 2RAPA 2YC2C 1OW3B 1CKEA 4ZIRA 4YONB 3PVSA 2ZR7A 2J41A 2RMKA 5JSZA 4ZIRB 2VO1A 2GXSA 3TSZA 2MSCB 5JSZB 4HAUA 5HPYB 4NONA 3GLHE 4Q5IA 2WWYA 5HKKD 1H8ED 3K70B 1ZBDA 3K09C 1YZGA 4B32A 2WWHA 3CW2A 1UF9A 2GZHA 2V7QA 2ZS7A 4IOKA 4RD4A 5EE5B 3QNUA 5LPNA 3I3SR 3DOFA 3NTUA 2KBEA 2YV5A 2IF2A 2ZI3A 3B5JA 3IILA 4JIMA 4A0FA 1F6BA 1N6HA 3L0PA 4FMBB 5JWOA 2IBMA 2KJQA 1Z28A 1YHNA 3C5CA 4KLZA 4Q02A 2K5UA 5EP3A 2FMXA 3LVRE 3UATA 4OI4A 5IK2A 2J9RA 1Z2AA 1KIMA 1F2TB 2W00A 4DKXA 2PCJA 1JALA 4OHVA 1E94E 2VP2A 1XFAA 4RY2A 2GBLC 3NC0C 3NIBA 1XXHE 2CCKA 1UBGA 3SI7A 4ZI3A 2RGAA 2G83A 2ZJZA 4DB4A 2OM2A 2V6JA 2F1HA 2X19A 1KI8A 5UKDA 3EARA 3U4QA 2QBYA 2DFNA 2ZE6A 3VKGA 2QBYB 3B8HA 3QKTA 4Q7MB 1Z6YA 1LVGA 1E1RA 2PZGA 4AIIA 4TT3D 3K0FB 1TX4B 2CK3D 3ZZTA 3I8SA 4D6PA 3WMEA 1IN4A 2FEOA 1S8FA 3AVQA 1SHZA 4HUQA 2NMVA 2VL7A 2GXUA 2CLDX 2ASEA 1Z6TA 4B3GA 1VCNA 1KO4A 4HUQB 2BV3A 2XOKA 2GWHA 2YHSA 4M1KA 2RGDA 3Q7PA 4Q7JB 4Z51A 1KDPA 2REXB 3EZ7A 3H84A 3WYFA 4B2LA 1Z0IA 4KSCA 5E3HA 2DYKA 1VHTA 1NG1A 1KNXA 4MRRA 4IW3B 2ZETA 4GBMA 2A5JA 2RHMA 4NZYA 1GRRA 2VQSA 1OXUA 2NIPA 1R5BA 1ETUA 2EYQA 1LW7A 3FHCB 4QFMA 2P6RA 1XCPA 4QJ5A 4OQFA 3TRFA 1U98A 3MG9A 4FN5A 3TKLA 3KQKA 4TYQA 4TTPA 3TE6A 1FL9A 5DO9A 1E6CA 3EZFA 4OL0A 1SXJD 3PEVA 3PIRA 1EFTA 3AGPA 1JEDA 4JVLA 5KDLA 1P5ZB 4JVMA 3P4YA 1QHNA 3M6AA 4URXR 4DZZA 2GCPA 3PEWA 3MMPA 2XB4A 3I1FA 4KLNA 5F9FA 4KFUA 1PLJA 2JJ1A 4DLUA 1JJVA 1VECA 4WOPA 1OHHA 4C2UA 2GF9A 3U3MA 2DCUA 1KDRA 3BFVA 3KZ1E 1JAIA 1XTJA 3UKDA 1I2MA 4PR0A 2ZM5A 4PAMA 3SJBA 1NRJB 1WA5A 2ZITA 4LX0A 4OYHA 4PANA 4TSFD 5FOUA 5P21A 3LW7A 1X1RA 3GLFE 2GKSA 2BBTA 1E1QD 4DSTA 2OBMA 3WHKA 3JZAA 3T1TA 1RPZA 4NTZA 5K8UA 3RSOA 1YJ5A 4Q4HA 2DB3A 2OCAA 3TW4A 3ZLJA 4Q4HB 1WBBA 1OXSC 2FE4A 3A8TA 3EZ6A 5EP4A 3FYHA 1AS3A 5LB4A 3MJRA 2ONJA 3T1QA 1KY2A 4GOKA 5CDFA 1ZUIA 2GK6A 5JWRA 1QHSA 1RKBA 2YC4C 4HAXA 4IRUB 5BN4A 3JVUA 1G17A 4DRZA 3EAQA 5FTJA 1R4AA 5G3ZA 2FOLA 1COWD 1XD9A 4G5RA 3W34A 1CJKC 1SVSA 3F8TA 1BS1A 2VH5R 2A30A 3D3QA 4E07A 4IDQA 2QROA 4O3MA 1ODFA 3U7GA 4E22A 1HYQA 2G1JA 2XZPA 5DLQC 8OHMA 2O8EA 5CK4A 4D4JA 4EPRA 1IOZA 2O8EB 1HV8A 4BASA 3A37A 5H8WA 1PUJA 3SFVA 4EJSC 4LBYA 2ZRFA 3VKHA 1II9A 2ZJ5A 2ZSEA 3BC1A 2BBWA 3ZDQA 2KWIA 4OJKA 4MITA 2PT5A 2EQBA 2R6CA 2V54A 3R8FA 4G3XA 5CJPA 2H57A 3TR0A 4AK9A 2D3WA 3NDPA 1SVKA 3VHXA 4XIGS 1N25A 2J5XA 4FCWA 1IY2A 3B13B 1D2EA 3WP0A 1OIWA 1G21E 1LF5A 2O8CA 1XB2A 1ZD8A 1A82A 1GIAA 2HLDD 3ONWA 2O8CB 3VNVA 1Z6GA 1AGPA 1EWRA 3LNCA 4FMCB 3H1TA 1W0JD 4TN1A 3UXMA 3TUZC 1RC8A 3UK6A 1ZNYA 3QEJA 2V4ZA 3DMNA 3KQUA 4A4DA 1KK2A 2UKDA 4Q01A 1BYUA 2JJ8A 4P0TA 2P6NA 3PCRB 4BFXA 2ZVQX 1G7CA 1ZD9A 4V0NA 1FMLA 2RGBA 4LYHA 5EP2A 2D06A 3G5UA 4YMWA 3MAAC 4OHXA 2V8OA 1OF1A 3QQ5A 2D7DA 1G6HA 2ZYUX 3IQXA 1N6IA 1ZM4A 1XEFA 2W2XA 3QXJA 1VG0B 4PC2A 1J2JA 1OLOA 4KYIB 621PA 4P4SB 3CR8A 5ANRB 4AYWA 5HE9A 1XJCA 3EWAA 2XNDA 2AKAB 5A5GA 1WP9A 3CONA 3DM9B 1NMYA 4PC7A 2BM1A 5FOSA 4C7OB 1IM2A 3DL0A 5JJIA 3QIAA 2BM0A 1ESNA 2J59A 4OQXA 1ZRHA 5JCZA 4HUTA 2Q9BA 4NYIQ 2QTFA 1M34E 4C0SA 3HJNA 3K0AA 3A1TA 5EUMA 4O25A 2IT1A 2ORVA 4B44A 1RRCA 2V7QD 3K0AB 3W6PA 2R62A 3QPVA 2W0SA 3B85A 3B1ZA 3B6EA 3C16C 3WXMA 3LRPA 2XITA 1NY5A 4A2PA 3FKSA 3KKNA 1JECA 3ADCA 5IT5A 1U81A 4EFLA 1A5TA 2G0NA 2WOJA 5TVKA 1S0UA 4YMTA 2IUSA 2CJWA 1WMSA 1NVWQ 5CK5A 4EJSB 4UJ3A 3REFA 2CJWB 1XD2A 1EFCA 1ZM3A 2CHGA 2GEVA 1Z0JA 1E9EA 2UZIR 5IK2D 3TK1A 5JJKA 1F60A 3AKCA 3Q8XB 1ZM2A 1VPLA 4LJAA 1J7KA 3HR7A 4DLTA 2ZS8A 1G16A 3G82C 3RS7A 5D3QA 3VR1A 4G1UC 1FNMA 3DOEA 2EFHB 4MYCA 1AA9A 1G3QA 4XSHA 2XTMA 4A0GA 2AWOA 5DHFA 4L5BA 3N5CA 3KJHA 1E1RD 2F1JA 3PEYA 1U90A 1CJMA 1Z47A 3PUWA 4I1VA 3O8CA 4D0GA 2GF0A 2O0HA 2OFWA 3B9QA 5EXSA 4EPYA 2VBCA 3U3KA 4DEYA 3GLIE 1Z07A 2V1XA 2IXFA 5KOYA 1GL7A 2AL7A 4JL5A 2JA1A 1OKKA 2QP4A 1HA3A 3IKJA 1E2IA 1II0A 4QKQA 4C0BA 3K53A 2XOKD 1Q20A 5FTMA 5KNCA 1HH4A 1TQDA 2QE7A 3QKSA 4Q1BA 4B3DA 2LCFA 5JZVA 2RGCA 1KDOA 3NWJA 5IDVA 2E9SA 4GSYA 4L16A 2PBRA 3ZJYA 5LBIA 2HT1A 1GG2A 2QY9A 4Q18A 4B33A 4DVGA 2H16A 1Z5ZA 4UNSA 1GL6A 1GVNB 1GKUB 4X8OA 4V0LA 5M04A 1DARA 2WV9A 1Q0UA 3SZRA 2GTPA 4C30A 1TQ4A 3IO5A 5BN5A 2PX0A 4PSAA 1CRPA 2NTYC 1H65A 2W6JA 3CBQA 3WNDA 3LFUA 4TQ9A 2CBZA 3OIVA 3SE0A 5G41A 1E2JA 1GRNA 3QG1A 2JJ1D
chains in the Genus database with same CATH superfamily
3L8GA 4C89A 3QUAA 1SOAA 2QAIA 2ZB2A 2RHTA 4O29A 2PL5A 3A1VA 2RI6A 4EHAA 4OG2A 1UCFA 2C2YA 4PZEA 1EKXA 4HBZA 2FKNA 3RRJA 1SOWA 4ZHQF 1VLJA 1CQZA 1K5PA 1QQAA 1NA5A 2N46A 3O1JC 3GBSA 3Q3JB 4HQLA 1GVHA 4B09A 1PWYE 3CBGA 3FSGD 1OX4B 2WAMA 1UKVY 1YMUA 4JBNA 4QNRA 3DFUA 4A27A 1WMFA 4DJAA 2PUBA 4XJVA 2C7GA 5I9MA 3UMCA 4C5BA 5L8VA 1CLEA 3N8KA 2EARA 3B20A 3TPCA 3U0BA 3MWDB 3SJAA 1NKVA 1PVOA 4MR9A 2RGXA 2WUGA 4KN5A 5CPFA 3VU1A 3NJ8A 1R0XA 4IJUA 3P0FA 1ENPA 3HABA 5ALGA 2VEOA 3D0OA 1X86B 4MUMA 1JDNA 3L9XA 4DY6A 2UYQA 2DFPA 1RW4A 5AVOA 4P83A 2Q0HA 2R00C 3OCZA 5GP1A 3WA6A 4CMAA 1EP3B 5I6DA 3S29A 1E77A 1ABEA 4TZ0A 5D84A 2ZQ5A 4MUBA 4Y67A 3IELA 3W9YA 2ZPAA 6LDHA 1O0CA 2IIQA 4HFRA 2OZEA 4E0BA 4PV7A 3KT0A 1XUOA 3M9XA 3F98A 1F06A 4C0JA 3U7IA 3N05A 1T6XA 2RGGA 4PHTA 1SKBA 1XTVA 1YXMA 3DVSX 1ZR2A 1N0WA 1UADA 4FQ7A 3REGA 1QGUA 2P4HX 2PZKA 1E6MA 5B58T 2IDJA 4V03A 3P7MA 1Y1TA 3L6UA 1KH1A 4MVJI 2OV1A 5JRZA 2YY6A 5BVGB 4DQVA 4AWBA 3M34A 1JTEA 2Q1UA 2PZ8A 2WJ6A 3TNJA 2EKPA 3TM4A 4ZO6A 1XQ6A 5DW0A 2C7RA 1UBJS 1B41A 4ZQIA 4KTVE 2SKDA 1U5BB 2OGTA 2V7XA 3DFZA 4Q1EA 2AMYA 2E6KA 4KIFA 4ZQEA 4A1FA 4YDHB 1RLTA 1USGA 2M1XA 3BORA 5G4LA 1KMNA 2ZYHA 1I6MA 3G2LA 3ZWMA 3E0XA 5U1PA 4YRIA 2C2KA 4P7JA 2ZRDA 4W8OA 3K2BA 2EHDA 5TPZA 5H1YA 3EXG1 3CHYA 3RLFA 4DCJA 4YQEA 3WLFA 3L7NA 3GUVA 3RVQA 2IGTA 2P4SA 3A0RB 3I6BA 2PKEA 4B7CA 1J09A 5LUAA 2XXBA 4N65A 1MJHA 3NTXA 4HAIA 4N0PA 4XRGA 3QVOA 1ODKA 3ED1A 3HZZA 3L7KA 3MQ4A 1LTQA 2J8ZA 4RGQA 2WNSA 3EF0A 4MW7A 4Y1GA 2IOYA 1WPRA 5PNTA 5EKSA 3WLMA 2I6XA 2BTOA 3ICPA 3OWHA 3Q11A 1LF0A 4WLUA 3VO2A 4AB1A 4D46A 1ICEA 1Y7PA 3E9MA 5FPKA 3EQ2A 4KPUA 1M75A 5ALEA 5D01A 2IOFK 2O3JA 1P62B 1FYDA 2ZBEA 3I09A 3O1IC 2RSLA 4L5YA 3PXGA 1MX3A 4WE3A 3ETDA 3Q98A 1L5KA 3UAXA 3ZGYA 1SVMA 1EG7A 4L8GA 4MCHA 3THWB 3C4JA 4IOJA 3DEZA 3JQ9C 2C3MA 4URYR 4ENWA 5DHSA 3GROA 3LBFA 2GBGA 2B9EA 2J9YB 5DWQA 4H7JA 2QAGA 3T7RA 3D0QA 3LBNA 5ISMA 2JLYA 1R4NA 1XA3A 4CQJA 4MPPA 2W2QA 1IN6A 2N1MA 5I4CA 4V0ME 4PCAA 4XGKA 4LDRA 3WC4A 2HSZA 1T2FA 3G2MA 5KYXB 1B6GA 2XNDD 2IV7A 4BJ3A 3PR3A 3CB4A 2LDBA 3VMMA 3W78A 1Y8CA 1TJPB 4PINA 2P8JA 2CMKA 1UQRA 2Q8QA 5LOVB 4KHZA 2W6ZA 3KOZA 1JFVA 2ZE8A 1VKRA 1IXZA 4LGCA 2JDIA 3E2PA 4S2UA 2X0EA 1ZOPA 2WFZA 3S81A 1GRCA 2ZIXA 1PN3A 3SKVA 1UM9B 3M81A 2DPHA 3DR3A 5FBQB 5HILA 4C4OA 3W8RA 5AHRA 3WAJA 3V80A 4Y1RB 4LF5B 1TO2E 3KQNA 1A7KA 2IXDA 4XCXA 2C3YA 3R7DA 1KK3A 1EHCA 2C5BA 3FKSD 3HYTA 2CEAA 3HJRA 4U3JB 3U7EB 4BC1A 5JCXA 1EFRD 4CIDA 2AJBA 4Q3OA 2NQTA 4RZIA 4Y0VA 4AAYA 3PQEA 4MJLA 4CIXA 5JEEA 1KYVA 1TJNA 2GARA 1ZCJA 2XXAB 2ZANA 1K9VF 4OFBA 1ZESA 2ADMA 3B9BA 2C3UA 3THXB 1PYOA 1OAAA 1NOIA 1CUCA 1FA9A 2R11A 4UU1A 5ALUA 5GGYA 4C87A 5CEEA 2ZJ3A 1QH0A 1Z13A 1ZJ4A 4R68A 4UBOA 1JFRA 1JHZA 1K68A 4DUZB 4DJDC 5GM2A 3QFSA 3KKMA 3BTSA 2R9VA 2O0LA 5A71A 3GH3A 4ZVMA 2E7ZA 1RI2A 5DBHX 5K9ZA 1I94B 2IX3A 1LBEA 2BFAA 2ZR8A 3NXKA 2BGTA 1BH2A 1US8B 2RI0A 3M5WA 3PQCA 4QOHA 2XB2A 4FCTA 1ATZA 1FRQA 2EJWA 3KKKA 4BU1A 1RT9A 2B37A 2CVQA 2VBIA 1NRXA 3I42A 1L4BA 2X7JA 3OHMA 2MSKA 5EZYA 1JEAA 3FN4A 4FCCA 4NU0A 1YHYA 8MHTA 4WWHA 2G4LA 4FD3A 1UOEA 4NJEB 1JPNA 1B1CA 4R84A 2VPIA 3BDVA 3QZUA 1KFKB 4RJKA 5DM4A 2AOTB 4JQOA 3WZMA 4RTJA 3PGLA 1XJQA 1YRWA 2EOAA 1TO1E 4G0MA 4NZ9A 4HPXB 3VSDA 5JTTA 1OY1A 4CKBA 4G0XA 3P9NA 5HIIA 3V4RA 2H9IA 3AGQA 3ZBQA 3L4SO 1CUDA 4GQIA 3DUFB 4HWKA 4BQPA 5JS6A 1MTOA 1BQ4A 2Y1KA 3TB6A 3GFTA 4WIAA 4Y6SA 4HB0A 4WOBA 4Y0AA 3EDCA 2C00A 4BCDA 3GLFB 4YLGA 2CLMB 1SHLA 1AHPA 1D1QA 3MBOA 2Q6OA 3EMKA 3GVHA 3S3TA 1KY3A 3OPVA 4TM7A 3UMGA 5DMHA 1J21A 4NHOA 3QX3A 2NU8A 5C32A 4MUIA 3DZBA 4B2YA 3I3OA 3MGAA 4KRGA 3ZD6A 1KXZA 1ODTC 4EJ2A 1T3GA 4YWJA 4UBIA 3LPNA 4LGVA 1JTFA 1B6RA 1J20A 5EHQA 3TWOA 1CT9A 2WUWE 4C7KA 1V16A 2C8VA 1CZNA 5CT6A 2HC9A 3LZDA 4FOOA 2W6JD 5E6UB 1UMBA 3GC6A 3JQCA 1WKCA 1NLZA 5GVRA 1M72A 5CG2A 4ZDIA 1DX6A 1DIOB 3VR4A 2J85A 2PS0A 3NIFB 1YFKA 3A4LA 3V48A 4D42A 5B1EA 3KT8A 3QJYA 2NYRA 2QLBA 2VZ0A 5CFLA 4HEA1 1MNAA 4XYMA 3ZD9A 2O54A 1RQ2A 3DULA 5KTRA 3G59A 2J3QA 2R7KA 3ESDA 2IZZA 2GCOB 4GC5A 5KTKA 3M6VA 3EB9A 2JJQA 4WAUA 3LXRA 1XZQA 1HDXA 1ETHA 2DPYA 3KZOA 3Q1LA 4Q4LA 2V9ZA 1HRKA 1AKWA 1RBYA 5G1NA 1F2UB 5K0TA 5KTPA 4L51A 1P75A 1VYTA 2R2GA 3LA6A 4OFZA 5E9JA 3WWEA 4JYZA 2OCIA 4BYMA 5F3WB 3WK9A 3PRHA 2GRUA 2NQ2C 2IU0A 4PBTA 1YA6A 2WF5A 3L18A 4LRSB 1P29A 2BKEA 2NT4A 2Z2XA 5ENDA 1EDZA 1GKYA 1QG6A 2PJZA 1DP4A 4RQBA 1G21A 4KQMA 5L3RA 1GPNA 1XTBA 1XG5A 3K5PA 1DWUA 2GDJA 3EGXB 1ZUWA 5KWEA 4R1PA 4JAVC 2XVMA 1E69A 4XLZA 3RYFB 3A11A 4F3CA 4B3CA 4C20A 3EMBA 2WFMA 3W05A 1SZJG 3GUYA 5T8KA 4B46A 1U04A 1EUDB 1G9XA 1QZTA 3ZXUB 1EBUA 2BHLA 3MGBA 3DPSA 1L5MA 3TTTA 5IVDA 4OQEA 4XI9A 1XALA 4ACBA 16PKA 1JPVA 3PFBA 3F46A 1TIKA 1VIYA 3EBPA 5D1NA 1KSGA 5BXQC 3EC1A 4HGOA 1U3UA 5DTIA 1U9IC 4LFAB 3G9ZA 2A35A 5CBKA 1RLIA 1Z5PA 1FTNA 1NTOA 5CAEB 4RKRA 3PK0A 2HRRA 2IK8A 1Q44A 4RKYA 2QRHA 2HPZA 1CLUA 2NNWB 4L6AA 4RQAA 2WVAA 5F52A 3SEAA 3WADA 3CH5A 2JGAA 2D0DA 4J0CA 2IW1A 3PX7A 3BX1A 3E5HA 3DW3X 2YVLA 5AKKA 4MUKA 1WU8A 3WDKA 5EXTA 3A05A 2H2GA 4LZZA 4JC0A 4X85A 1MAWA 1COZA 3T7JA 3N8DA 3T5BA 5BP7A 3EQZA 4Z4QA 4JT8A 3QVVA 4LDAA 5I4KA 1SPBS 1RSZA 5BNTA 1FNDA 2FGKA 2DHQA 1OQAA 1VRWA 1HOTA 2P62A 4E4TA 3CR3C 2ZVDA 1R0WA 1ZVKA 4XD7D 1M2VA 4MGIR 5DYYA 3KUKA 2A4MA 4PCLA 4WLEA 1EJBA 1WXGA 2G9RA 2ZAIA 3CPHA 4US2R 1JJAA 1ZIYA 2G5TA 2O2DA 1XLUA 2VJYA 2WYWA 3BMCA 3JATB 1M34B 3M1IA 3P27A 4UXHA 5EJIA 1HKHA 2GM3A 3DDOA 4IIYA 4YRLA 1A7AA 3V7UA 3WBJA 4M9ZA 4PG8A 1JAXA 1YCFA 4FW8A 3VR5H 1ZBQA 2P91A 4C4PA 1AH2A 3WGKA 3W3AA 4X93A 1WB6A 4HP8A 3I2HA 5EZYF 4F4HA 2YWJA 1L3CA 1Z5WA 1QK4A 3NNSA 2H2FA 1YUBA 1TYAE 3OG9A 2CNWD 3CNBA 5HFNA 3UJBA 3SPXA 3ZU6A 3UC5A 4DLVA 1YA4A 3TOVA 5BSMA 5H4GA 4QG7A 4XE5A 5HBRA 3SYKA 2PYIA 5K0GA 1K9SA 1D2MA 1GCIA 1QHXA 2XE8A 1CZUA 1JKXA 2YFYA 4HWGA 3INTA 2NG1A 2RHGB 3P9CA 4K6CA 4MVYA 3ZE0B 3CIOA 1V8ZA 3HDTA 1A7JA 4I6JA 2CLHB 1PJ3A 4K2AA 4CXMA 3R3SA 4CLRA 3GAMA 5AVQA 1FNSA 1QB8A 4PO9A 4YCJA 5TF0A 3BRQA 1KKUA 4FW9A 4TKVA 3UJ3X 3UXHA 4ZK2A 6AT1A 1P33A 4IYJA 4HDNB 1RHKA 1EIWA 1R6XA 5KO2A 1T1JA 2CNKA 3GA5A 2F62A 1A1VA 1JG1A 2KQUA 4KWHA 1T6NA 1N6RA 2C2HA 3MZ0A 5BQ5A 4OXYA 2NSJA 4YBZA 4FYPA 5JD3A 3RT1A 3UTDA 2ZRKA 1V39A 2WUVA 1ZM7A 4LSGA 4UNPA 4URHA 2FI1A 1KQNA 2QL9A 1YCDA 2C5HA 3NHJA 1YI1A 1P7YA 3PHBE 2L82A 4Q9LA 1UC9A 4CQMB 4CEIA 3HHEA 1GPH1 3C6YA 2J08A 4ZMBA 1T4CA 4Q3LA 1P81A 1B76A 2HK7A 1LQ2A 2JAXA 2VDWA 3DH0A 3GMTA 4HN9A 5BV0A 2ZUEA 3GXBA 1JIJA 4JYPA 1MH1A 2EFEB 2IELA 5JCOC 4FKMA 4BIIA 4TYYA 3P2EA 4JFRA 4BP9A 1OASA 1GQSA 2GN0A 1YACA 2QMUA 3K9CA 1D8TA 5FYQA 3TAXA 3U1VA 3QE9Y 4YJ2B 2VSYA 3G23A 1RHJA 2AN4A 1GSHA 2A84A 1DPFA 2VFAA 3EUEA 4KWIA 1NI3A 3PUKA 4RDHA 4WTOA 1SUIA 5IEBA 3AUYA 4UREA 5A5FA 5BQFA 2ZRIA 2D4HA 3N0VA 4FLFA 2RCNA 4JJ4A 1YULA 4TVBA 3PGJA 2IJGX 1TK2A 5HUQA 4N9WA 4LF7B 3LHDA 2XECA 4BBZA 4C3ZA 3AI3A 1B42A 3GQBB 2FPKA 3DE4X 1KZ9A 3IKLA 1JDBB 2H1LA 1GXSB 3K05A 4AVYA 4CMKA 4EEXA 5AQ1A 3CVOA 3JWJA 1X19A 1GY8A 1W5AA 3I2FA 4JZYA 1Y7TA 3FLEA 4WA7A 3PWTA 2AZXA 2GVDC 5CFRA 1XZCA 1U99A 2HXYA 1J0CA 2NZYA 2ZTVA 2AA3A 3MD9A 3HY3A 5CM8B 2H4WA 2DT5A 1N2SA 1P4SA 3VHRA 2Q62A 2JFYA 2K7FA 1GSOA 3E8SA 2Q2WA 1XYYA 1URPA 4UBNA 1NE2A 4NYJQ 4OKSA 1BJTA 3NBMA 2CDAA 1BWRA 5KNDA 5CCDA 1FXSA 3LDHA 4HDSA 5E2AA 3ZN2A 3D3WA 1Q0TA 5JJBA 5JZSA 3JARA 2XE6A 3LYUA 2WK1A 5HBGA 4KXMA 1I4LD 2Q8NA 2GEUA 1GV0A 1NPYA 3CZ4A 1ZC3A 3UO8B 2CDNA 4KJXA 3DXZA 2BUCA 2PXAA 2ZB8A 3L06A 4FWBA 4I36A 8GPBA 5JNTA 5IBPA 2H3HA 4ESHA 4U2KA 2DKFA 4RY8A 4G1VA 3T12A 4GP7A 4OYYA 3FRIA 4D0RA 5LL6P 1YRLA 4MXDA 2JCGA 1JAHA 4Y2UA 1NZDA 3AUSA 1Z22A 3PTLA 3HCDA 1SRQA 1U7XA 3D2BA 1DCKA 2JI9A 3K8OE 2L19A 4BLQA 2LTAA 1GUDA 3ZLBA 4DRXA 2XGGA 1W73A 4DV2B 3GCGA 4IS3A 3RHZA 2VN8A 1I33A 1NN5A 3BGIA 1AUVA 3KVYA 3R7NA 3WKAA 1EFAA 4L8VA 3EZXA 5JUWA 4RYDA 3KELA 1CV2A 3L7CA 3NT4A 4BRSA 2W4IA 1LPAB 4Y2TA 3AM1A 4P84A 3ZDYB 2AMVA 2J46A 3W2GA 2VSXA 1RWWA 1SKAA 4Q3BA 4DLRA 2ZAMA 3DCYA 1RCUA 3G2OA 2CZQA 2Q6LA 4XIYA 3M49A 1V1RB 1JSZA 3ACCA 4H7FA 2HDOA 2GZAA 2EJVA 1DKLA 2PGNA 3FUVA 5DXAA 1I2ZA 1LLDA 2AJCA 2FZGA 2V03A 1SD5A 1VKZA 2C9YA 2P2LA 3GL9A 4S1OA 1M1ZA 3KLMX 4QUEA 3BB4A 1HG0A 1IPEA 1Y3HA 2C83A 5JXHA 3NW9A 1TTPB 5EVJA 2VYVD 4YBRA 2Y0EA 3C48A 4L4UA 3DLIA 1UJ5A 3FOAA 5EZ6B 2Q7OE 4KI7A 1VKOA 3I5MA 5KB3A 1ZD2P 5KWVA 1XAGA 1D2GA 4QBIA 1ABBA 2JIMA 4S05A 3LUAA 3IDOA 4FT2A 4GGOA 1QIKA 5KTTA 1PWHA 4A15A 3ZZ1A 5PGMA 3SN6A 3V4LA 3A6ZA 1WF6A 4ILEA 1LBSA 2VWHA 2CHUA 3DXXA 4K6FA 3DYIA 4WBSA 1Z2DA 3ZE1B 2GPSA 2ZRBA 3CJTA 4Q7QA 5DZSA 1U7OA 4QUDA 1SQ5A 3S4YA 4G09A 1CJUC 1P1IA 2WWFA 4YRAA 3M8KA 1DDIA 4IQ0A 1EFRA 5EUCA 4FWIB 1M2EA 3G2JA 4YJGB 1PS0A 2D5IA 4JR2A 5DV9A 4DUGA 1O6FA 5BRJA 4FE7A 4E4YA 2IBTA 2WWWA 4UUMA 3VR2A 1I4EB 2HTFA 3OAAA 4LDJA 2GASA 1CD5A 3NVDA 1OBHA 2ECQA 1JG7A 2J0VA 3EGWA 4G36A 3SMVA 1E3IA 3RIYA 3SC6A 4DMCA 3IDFA 3PIIA 5FF9A 3MS7A 3N86A 4P4UA 5SYMA 5M29A 1Z88A 4QAQA 2I9PA 4ND1A 1DQSA 2L2QA 3FJOA 4O0LA 5EG5A 5KAMA 3H8WA 2C4KA 2VF4X 1WW3A 2COUA 2XUQA 2QX7A 3DPUA 3KU4A 3MUNA 3JQAD 1UXKA 2BHRA 2LKCA 2VJLA 5JD6A 1J0BA 1VBFA 4S1TA 5AIBA 1UH5A 4MVCA 3TIGA 1DINA 3ZQ6A 3LQFA 1NNUA 3HPQA 4FCVA 2IU6A 4IIXA 4A8JC 5KMGB 2FW9A 3PDIB 3HKBB 3JZMA 3WHIA 1Q17A 1HSZA 4W5JA 1W48A 2EWVA 3OJWA 4MH0R 4GMGA 3WMXA 4FDMA 3KXKA 3RIEA 1KYYA 5E9QA 5F5XA 1P60A 4NARA 3HDGA 1EXNA 4E5SA 3N2IA 2AD1A 3BFXA 3JQ6A 4UMDA 2WKPA 1HTWA 5E9WA 4JI6B 4B8WA 1C8LA 1EK5A 1A9YA 1BWPA 5LYYA 2XXJA 3U49A 1FUEA 2YRFA 1CJVC 1HLPA 3BS4A 4R2MA 1JMKC 3X1JA 3MILA 2NSLA 2WTUA 4I9UA 4RVDA 1MUUA 4BKPA 3L7IA 1Q7CA 1E79D 1XRMA 4A2QA 4D97A 1V0JA 1U0SY 3EBOA 1GR0A 4DSOA 2EQAA 1W4CA 4WZBB 3OU7A 1RE1A 3NVAA 2Z57A 4PNZA 1KEEA 1WNFA 2ZI5A 1OWLA 4ZYZA 4DCUA 5D2CA 3AY7A 2E82A 4X71A 4HGRA 3RFXA 4ME6A 3LYLA 2AJLI 1ADYA 4Z2YA 1QRAA 1N6PA 3QUBA 1Q83A 4LJ9A 3U6KA 1DUSA 2RKOA 3T5CA 3PJEA 5EINA 4X00A 5J1TB 1VYUA 2R7AA 1TFRA 4EYOA 3IKMB 3EUFA 4KQGA 4WFIA 1B23P 3B1JA 1XF1A 1YR3A 2IYWA 4GOLD 3AWIA 2V3WA 3BGVA 2ZXEA 4KXQA 4A6XA 1T5IA 4CMIA 3QKRB 3H9UA 1W36B 1ZN2A 3RSHA 2CDBA 4FFSA 1CF9A 4BLRA 1M6WA 4XJXA 3K0EA 4Q4AA 1OPRA 2ZJ0A 3A9SA 1H6DA 1N0HA 5DLEA 4Y2QA 2PYZA 4NOLA 2D0PB 4PR3A 4WXYB 3O5AA 3QWBA 4KQKA 1VZ3A 2H29A 4PRKA 3KPUA 1XU4A 2FETA 1AK9A 2FWBA 4MRMA 4K0RA 2FPMA 2FRDC 1DQYA 2I3DA 2BI8A 4YJ3B 4DNXA 4Z5XA 4DMUB 5F7XA 4JELA 2BKAA 2OORA 2H1IA 4WFJA 4PGAA 4DHWA 4Q4JA 3PEFA 2P9ZA 3KYJB 2CN1A 1ZIDA 1OFHA 4ZVPA 2GN6A 2RGYA 1H0HA 1JDVA 1DEOA 4MR9B 3TGWA 5IBCA 4PZAA 3I2YX 4ND3A 3J7AC 2PZEA 3NYQA 4RE5A 1VDMA 1E5XA 2H92A 2QI9C 3BF7A 3HA2A 2H1RA 3O3MB 3R5KA 1OT5A 4QPZA 4Q9HA 5A1TA 3IJEB 2C2BA 4PX2A 2C1EA 1V4VA 2F3TA 4QEZA 2QLJA 2FUG6 4EHIA 5T3YA 3KSMA 4RENA 3JRWA 1G5PA 2JBWA 1HX7A 1Q1GA 4YWHA 1R0YA 4KLCA 2EFCB 2I4NA 2NW6A 1WXFA 1RDFA 1ZW1A 4H7DA 1QFMA 4C2TA 3CN7A 3MRTA 3T1OA 1IQPA 2BFNA 3GRVA 2BHNA 3I28A 1OYYA 1QGUB 4M9CA 4PGHA 5A5VA 3LPAA 5AHXA 3OLXA 1CQIA 3OT4A 5LZ7A 3RASA 4D81A 2H17A 3AVOA 4WY2A 2X1LA 1NI4A 3ILHA 4ZZIA 2VHCA 3T3OA 3KR9A 3AEKA 4QWMA 2H2WA 3AX6A 2GS9A 4HAZA 1VDZA 5SZKB 3VUFA 1A77A 1SPXA 4DF3A 1KP2A 2BF4A 3NP9A 4X20A 1PEYA 1ZCFA 4CU2A 2QL6A 1NOJA 1IY8A 5DLPA 3FR7A 4KCGA 4H4CA 3TW8A 2EVWX 1USWA 2YWGA 3G49A 5HCIA 2BY4A 4RHXA 3GLFA 2QD2A 2P11A 4ER0A 4NYMR 1BVUA 1NLUA 1V45E 1WZIA 3HLYA 2IZ7A 2QQEA 1Z2PX 1VJ1A 2IZ5A 1J33A 3WYDA 2TMDA 3LQYA 3F6PA 1K6JA 4WOJA 1AQLA 5AKGA 1WQ1R 1YCGA 1IBRA 4A10A 2OHHA 1P2VA 2IP4A 3K15A 3QLUC 3DCJA 2W8BA 3ZVMA 5ESDA 2MINA 3T9DA 2WD9A 3FYDA 3SC2A 3WJAA 4BLWA 5KHOC 5E95A 5B4TA 3HKDA 5K0JA 4JC4A 5JNRA 5IDXA 1UBMS 1YQUA 2JZCA 3FUXA 3FJ1A 1BE0A 1CVLA 4F93B 3ZZ0A 2EYUA 1YBAA 5J4LA 2W98A 4L0CA 4P4NA 3ZGNA 1KMCA 2J4DA 4IAOA 5GONA 1E7WA 2FMIA 4P7BA 5HF6A 3O8DA 1JQKA 1KNQA 3IUPA 1RLUA 1G8KA 5JECA 4DIBA 4W5TA 5KYGA 2QS9A 3U16A 5K3SA 1LK0A 5CA0F 1TPZA 1X7WA 4DLNA 1V9SA 3F2IA 1BS2A 4MYHA 1QS0B 3MJTA 4UU0A 2CNWA 4RJJA 5GOZA 1ADBA 2Q3EA 3KHUA 2ZUFA 3GVXA 2JAQA 4KO1S 4YMSA 2FA9A 3P0IA 1R4NB 2OZLA 4HWOA 3DAHA 5G53C 4GI7A 1Y9JA 5EXEA 1QGAA 4BNJA 3RHFA 4IIFA 4OHWA 1V71A 1L1FA 4N9QA 2QTTA 2D3TA 2I99A 2Q6TA 3MMSA 1GZUA 3CFYA 2BKUA 5JARA 3TGPA 3EPRA 5G0SA 1FU8A 4IHJA 3JQBA 1H2ZA 4GX0A 4Q7LA 4XM0A 1YS9A 4JBGA 3H5LA 3AF6A 3WRWA 5JAOA 3SQMA 2PTGA 1TAGA 4K7JA 3W77A 1A4XA 2CCGA 3IUQA 4QTYA 4DV1B 1I6LA 1TAHA 2DVMA 3HXKA 3GGJA 4V2IA 4Z0TA 3O4JA 1HSOA 5EJ6A 5I7HA 2XGMA 4CM8B 3EDYA 3PITA 1J1ZA 3NPAA 5H3HA 5DF1A 1HBJA 1LLUA 2B30A 3OF5A 4HB2A 2JLVA 1CEEA 5GV8A 1CUEA 3VU3A 3D02A 1W52X 3C0KA 1JZSA 3D4BA 2G0TA 1EGAA 1ZGZA 3MOIA 1U8UA 4ZGGA 1KAGA 1D6JA 4DBVO 3FNBA 1YVDA 4E5UA 4PYQA 1IRIA 3O8OA 4HZUA 4OYRA 1NVGA 3IMCA 2V1UA 1O6ZA 4EFNA 3N2LA 4RHTA 3QW2A 4XR4A 2MHCA 1UZUA 3QU9A 2B8NA 4NAVA 1AF7A 5IVKA 3WR5A 2CHQA 3A4MA 2YWHA 2OK7A 2QIPA 1JR3D 5KX5A 4C1BA 2W6OA 1ONBA 3AJAA 3Q3CA 2RGNA 4LZNA 4U39A 3QPWA 4IG9A 4GRIA 2NUTA 3V7NA 4E5KA 5CFPA 3NPMA 2W42A 2VJQA 1QTIA 1YKSA 3ZDEA 1RTKA 5ARDA 3UT6A 2Q4OA 4LF6B 3WKBA 3GFGA 2QSYA 1CETA 4ABTA 1I3CA 2PIAA 3QEMA 1F0KA 3RQSA 2P8SA 2OHOA 2GBCA 3ETEA 4IKPA 3OLWA 3KSAC 4HADA 2PQMA 2B99A 4PLHA 3L6RA 5H59A 1U11A 3R44A 1FZQA 1U0EA 2DE0X 1P2SA 2ZI7A 3NFYA 2PSEA 2YRWA 4B40A 2Q0XA 3GGCA 5AHOA 4LPSA 5D1HA 1E2EA 1NG9A 4HDRA 2R4TA 2QPLA 1BA2A 5JCPA 4ND8B 3B7PA 4K9DA 3BHMA 4UM7A 1IHUA 4XWAA 2AOVA 4REQB 1NNI1 1VPVA 3EG9A 3IOBA 5CNKA 3SNKA 4BMVA 5FOQA 5LMCA 2DLCX 2NZ2A 4TXLA 3BA6A 5THKA 1YIDA 4Y9UA 1JEYA 4H3VA 5IN5A 1U8AA 3H8JA 3ZTWA 1YFLA 1XDZA 4NRDA 3ZE6A 3PE3A 4E21A 3MUFA 3ILVA 3RFTA 4N8EA 1RM3A 4J49A 4FDAA 1NSFA 3CKYA 4RMGA 3CUEF 3OJFA 4URFA 1V16B 2O5CA 1D1TA 4R2XA 4GFDA 5AHWA 1P91A 3T99A 1MABA 1UIMA 2DM6A 1UMBB 3JZDA 4J1QA 5C18A 3IR6A 1NN3A 2O07A 2HBZA 4HB4A 1F3OA 1UT8A 3C5VA 1U4NA 3P96A 4FLEA 5KSZA 3U44B 4XWGA 1ONNA 1Z08A 2WIBA 1T9DA 3S5JA 4TXHA 3NZEA 4LMRA 4PRYA 3VOTA 4Q05A 1PTKA 4EFLA 2Y99A 1Q74A 1GUBA 2V9CA 1AG9A 4BNUA 1NXOA 2H00A 4RTOA 2PUEA 1MMFB 1JLMA 3KUUA 4WHMA 2YWEA 4CEJA 1W5BA 5LQMA 3LO8A 1C7JA 3HVIA 3D6FA 2X8BA 4MR7A 1DMSA 4ZQHA 3LVBA 2JLXA 2PL3A 2C84A 1U1GA 2X7HA 3N8HA 4C6TA 3PQ4A 5E9AA 3EIHA 2ZT8A 2FZ5A 1Q92A 4JD5A 4MHSA 4BO4A 4DCMA 1PLKA 2B7BA 3QE3A 3WYCA 2F1OA 2PH7A 3F6RA 5GONF 1AZWA 4U7FA 2IS1A 5BYKA 1Z5OA 2HMUA 4PNHA 5L9AA 1HNZB 3A2KA 1MP0A 4LHYA 2ODEA 1G21B 1KI6A 1NX6A 4KB5A 4U4AA 2A7QA 3OPNA 2HI0A 1QX3A 2WNIA 2YHUA 3OVMA 3KQMA 3NHBA 4QXPA 2OAQ1 2WG0A 5CEJA 1EE2A 2NO5A 2ILTA 3VR3A 4HEHA 4FHFA 4EGFA 2RJNA 5I9LA 4A6PA 1PP4A 4K9OA 4NWIA 4MS1A 2MT9A 3VAYA 2R751 4CIVA 4IZIA 4N5NA 3OEED 1E63A 5TSDA 1NLMA 1RHQA 2P4UA 4AN4A 4GKJB 2JH3A 2F55A 3JQ8B 1T9HA 2PRIA 3NBUA 1XK6A 1XQVA 4FFBA 5EWMB 1FFBA 4IHJF 5KJEA 4UTRA 4E1BA 3RLIA 1EVYA 4PEVA 1L7AA 4LCBA 4S1VA 4EYEA 5JY1A 4AJOA 2Y71A 3L41A 1PJ4A 5E7JA 3RU3A 1V7QA 1V43A 1UJ6A 2O0KA 5AM3A 4CMHA 2P65A 3GLRA 4OV6B 2R6DA 2DPLA 1JDTA 3QUTA 3U26A 2CMHA 5CFZA 1SEPA 4HFNA 4C08A 6CHYA 2J6HA 4Y2RA 1LD3A 3RYCA 3L4EA 5E2BA 1M1YE 4B71A 2V7GA 4EMBA 1GTSA 2ZJ7A 1MA3A 2YJ4A 1H9AA 2X22A 3MWEA 4KQ6A 1AUPA 4CEHA 1OI4A 4JZKA 4K9RA 5ALRA 1QVAA 3CO5A 2O4CA 3RWBA 3VU9B 2O7QA 3KZCA 1IY1A 4PLVA 4BU0A 3AEQB 1AKVA 1CVRA 1QB7A 2BFWA 1F4PA 5L3SA 4EKYA 1VL2A 4JP5A 2O05A 2HMAA 2Y9PB 2ZRJA 3L6BA 4RY9A 5EYPA 5K3CA 1WCWA 1NF3A 3R0VA 2G7MC 1XFDA 1JMYA 1KE2A 3ICWA 4GNKA 2DJIA 3EW9A 1E3SA 2Q1SA 1FYEA 3CUYA 3H1PA 1R5NA 4NMWA 5KX5F 2H0QA 4RTSA 3NIDB 3PRYA 2GNAA 2VDKB 1ZUD1 3F6YA 2ODNA 2Z4SA 2G09A 3IAHA 1I30A 4ABYA 1OWOA 1N5KA 1Y8RB 2WM3A 3VPSA 5INTA 9GPBA 2AFRA 1KWKA 1X13A 4HDCA 4R8KA 4U7WA 1GQQA 5HMMA 3TTSA 3H8VA 3K1TA 2R7MA 1CF2O 1O8CA 2QTLA 4XB2A 4AYTA 1T5SA 4MJXA 3P2JA 4BV3A 3FUWA 5E1BA 1BXZA 4URUR 5K8TA 3K0FA 1YR1A 2V74B 1WDKA 3CINA 2BBOA 4EKEA 1WCYA 4CIYA 2IGBA 4J16A 4GYYA 5A2GA 3VA7A 4CM6A 2HMYB 2QGZA 3DEKA 1P8AA 2HA3A 3KWMA 4J76A 3R5HA 3RVKA 4LKRA 4U7TB 3V1MA 4LHWA 4LIPD 3KQVA 1QFZA 5FLYA 5F7OA 2XW6A 4KI0A 4J0DA 1G2QA 2R6GA 4LF8B 3CKKA 2CXSA 3NASA 3GZ4A 1VC2A 4IUDS 4F2GA 2GR9A 2PY6A 4UVHA 3W5JA 5CB4B 3L6CA 5FFNA 3P9QA 2C5SA 1DOAA 3NCHA 5C37A 2DLNA 3KAQA 4BTEA 2KE5A 1YDGA 1JN0A 2AR7A 2Y1FA 3GLKA 5E1OA 4D3FA 3IPYA 5JZVA 1VE7A 5CDTA 2PXCA 1CUXA 3ISTA 4NDAA 4G4SP 3E35A 3OJXA 4FEGA 1Z4KA 4CKXA 3KUXA 4GMDA 2HA0A 1EFUA 3DLAA 5IFLA 2ZWOA 2FMUA 2JBAB 5AP9A 5TS2A 1OXTA 2CLIB 5BN3B 2VDNB 4DHEA 4YRJA 1XTIA 5FPQA 1Q19A 3P32A 4XQ9A 4KBFA 1XHEA 4G0OA 2OAP1 4V39A 4CEIB 2IS6A 2VSFA 1YVRA 3BWCA 1M74A 2JJMA 2DFLA 3FPKA 4D8UA 1P19A 1PDOA 3H16A 4MLCA 3OQJA 1XHLA 3E22A 5IF9A 3BXFA 4P82A 3PUXA 3PXUA 5SZJA 3U61B 1Q0RA 1VMKA 2B35A 2K4MA 3KG2A 4IIJA 3TZLA 3ZIAA 5ADHA 5B2FA 1X87A 5BQPA 2F9LA 5HCNA 3VTFA 3RH0A 1X8JA 1RI5A 5DNUA 1M7BA 1F8GA 2GHRA 2J7KA 2VHEA 3KKQA 4MQFA 3HA3A 4O2BF 3DEFA 5CYOA 1FS5A 2P79A 5FUBA 5FOVA 2PWBA 4E6PA 3F78A 3NNNA 1C9EA 2CL0X 2CYAA 1Z5GA 2NTEA 2OCPA 2GFHA 2JAOA 3OX3A 1R50A 1MQSA 4DC1A 3GX1A 4FB5A 2AKYA 1AA6A 5KHLB 3SR3A 1I51A 4YRSA 3LL7A 4CM7A 1OA0A 1VMIA 4O4IB 1MRSA 3MIZA 2HU7A 5SYNA 3T5TA 1IHOA 3TLGA 3V1KA 3TLCA 4DJ5X 4WY8A 2GWRA 2IEBA 1QKKA 1EVJA 3E23A 4PPGA 2Q3JA 4LRWA 3ZV6A 2MTBA 4EEKA 4BVGA 4IFTA 3O94A 5DNWA 4QWWA 4ZOQI 3BKXA 1WF3A 1HE3A 1U5CA 4HN4B 1T5HX 1UM8A 1YDHA 4I81A 1QC5B 1ZVQA 3F71A 4IX9A 1IBMB 4DR3B 5CH8A 3LMKA 5GINE 3WIOA 1D0SA 1N5IA 4BNGA 3D3WB 3ITDA 5JDCC 3TKYA 2P9HA 3UUWA 1AC5A 3O3CA 1WXIA 4UBLA 3FHOA 3RABA 3NVMB 4FOLA 2C98A 3IOCA 3TCXB 1PFQA 4GLFA 1Y9EA 3ZEIA 2B4RO 2C97A 3EG5A 3N8GA 2ZYSA 3O92A 2VZ8A 4WSOA 1PR9A 4FNMA 4EBFA 1EXMA 3S8EA 1N4DA 4HB3A 3PGXA 2P3LA 4W1QA 2GB4A 1THGA 5HZHA 3U4IA 4K6HA 4XJSA 2E4YA 3I2KA 3H0CA 1DBIA 1ZJYA 2ZWVA 4TLMB 1SCUA 1L4LA 1RXIA 1SBQA 3RANA 2V98A 4HX9A 4Z53A 4N76A 2Q28A 1PNRA 5DP1A 3RJMA 4TTSA 1XZKA 1YU9A 5JNWA 5JS1A 1X8LA 3K2QA 3OZ7A 5HKAA 4G86A 3C1TA 4IO0A 1T2VA 2Z98A 4MVJH 4YACA 4DRXB 2XHZA 3DP7A 1H2EA 3NLLA 4YUWA 5MN6A 2ZCJA 3D5EA 4ZAWA 3WLIA 3I2JA 4ZQCB 4ER3A 5AI4A 3VZQA 2H11A 3HMKA 4PG7A 5JYCA 2DUJA 2I8CA 1GSIA 3LH5A 4C4YA 1NRIA 5B3LA 2AI2A 3FBWA 2HCJB 3AEXA 3VJLA 1ZY2A 5F9MA 1RKUA 4MW4A 1T36A 1CRLA 1E1KA 1MFPA 1NUAA 2GT1A 4C2BA 2ZIZA 4UBMA 1Z56C 4LC1A 2PRJA 2VF8A 2CBXA 4G25A