5EZ6B

Crystallization and preliminary x-ray crystallographic analysis of a small gtpase rhoa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
179
structure length
179
Chain Sequence
AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein RhoA
total genus 64
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ez6B00
4DLXA 2CL0X 5DLQC 2IHBA 1LW7A 1XTQA 4Q7JB 5JEEA 5LB4A 3TVTA 4Q1CA 5ELXA 4CDGA 3LX5A 4B74A 4HAXA 5DH9A 3U3RA 2FF7A 1ZM4A 5J40A 4B6EA 1N0VC 1GOTA 2Q6TA 3GJ5A 1CF4A 1GZSA 1HEIA 1W36C 3WMFA 1T0HB 4MH0R 1NY5A 3R8FA 4TQ9A 1KMHA 5FPTA 3SHWA 3IILA 1LV7A 4CEJA 1XEWX 4LJYA 3MWLA 1NY6A 2BMJA 3NVAA 1ODFA 1E98A 2O8CB 1JJVA 4DZZA 2OAQ1 1VG1A 4C0JA 4BEBA 2YINC 2EU8A 3NH6A 2QE7D 5FOTA 4C9BA 2ZYUX 3BE4A 3BK7A 3P32A 4KAXA 2G6BA 5IT5A 4C0AC 221PA 4M2LA 1HTWA 1RRGA 2OHFA 4TMKA 3SE0A 4BFYA 4Z51A 1YZGA 4IEIA 3U44B 1US8B 2BVNA 1EFTA 2NOAA 5BYKA 2RHDA 3QKSA 5FUVA 3C14C 2XOKA 3IEUA 3CPEA 4WZBE 1NN1A 4FMCB 1QHHB 2EYQA 5EJEA 1X8KA 1KSGA 4LPSA 2VH5R 2NMVA 4F92B 1UM8A 3JZMA 4JKYA 1ZUHA 1TF7A 4GL2A 2VP9A 3KJHA 4NE2A 2BIFA 4QHYA 4AYXA 1R8SA 1NRJB 3K0EA 4X8MA 2C77A 3IO3A 1L7VC 1JR3D 2ZJBA 3L0OA 1IXSB 2ZRIA 1J90A 5EXSA 4DLZA 4BLOA 4M53A 3GCGA 2RGDA 4FMBB 5DI9A 1TX4B 2YWGA 1E96A 2HCJB 1TPZA 3VMFA 2P5SA 2IS1A 4GP7A 1QHIA 1BYIA 3DDCA 1Z63A 3SYKA 2V9PA 1RE0A 1G8PA 2ZU6A 2V6IA 4LYFA 1S2MA 3VHLB 4XVUA 5A5GA 1PUJA 3VAAA 4BLPA 1CR4A 2FG5A 5J4YA 2XSZA 3UKDA 3BWDD 1KIMA 1XPRA 1G7CA 1WCV1 4A0RA 1KK2A 1YHNA 2R6CA 4OQLA 1JAHA 3UG7A 4YMVA 1W4RA 3A6PC 2CEAA 2AKAB 4ZPXA 4EFMA 4B2LA 121PA 2GEUA 4HAZA 1JR3E 2OBLA 4JLBA 3W9YA 4Y0VA 1TAGA 2C95A 2GTPA 1KYIA 1KY2A 2HYDA 3FVQA 4ZO4A 3B82A 4PPNA 4DDVA 2R2AA 4A92A 5HE8A 1KDTA 4D80A 4RY2A 2R6GA 4DEXA 2ZRHA 3IPYA 1CU1A 4JBXA 4PXAA 4N0EA 4PPGA 5H8WA 2QTVB 3CBQA 4MITA 2F1RA 2ORVA 3FOZA 2EWWA 1XCMA 2W6IA 4QC2A 4HUQB 4JLDA 1TQ2A 1XJ0A 2FH5B 1I2MA 3F3YA 3CF6R 4L15A 5HCNA 1IN8A 2O8BA 2GBLA 3TQCA 2VYFA 4XTRA 3S1AA 1PLJA 4YDSA 4BEJA 5FPKA 3LXXA 3CX6A 2CNWA 1FQKA 1OW3B 5LB2A 3RS2A 4JBYA 2HXYA 2VSXA 5L8VA 2OT3B 2XZOA 2ZUDA 2OZEA 4LBZA 4PAMA 2FSGA 3THOA 1O87A 1ZD1A 2QAGB 1NLYA 5IK2A 4C30A 3REFA 4ZIRA 4PAQA 1SVKA 3CPJB 2ZU0C 1L4YA 2QPAA 5DN6D 2VHUA 1HYQA 2A5JA 4P4SB 4JIMA 2HF8A 2IK8A 1Z6GA 2Q9BA 4JLVA 5L3RA 4Q4AA 3QEOA 4ILEA 3EA0A 4B3GA 2F1IA 1DVRA 4RFSA 3V00A 4LJ7A 3KKQA 2QMUA 1RVDA 2WSSA 5DI3B 2BMDA 5KNDA 4LYAA 1XD2A 5CJPA 5UKDA 2P6RA 2GJSA 4Q1AA 4Q01A 1QVRA 3QPVA 3EZ9A 3NTUA 4L9WA 2RGGA 1DO0A 2JLQA 5FOWA 4NCNA 1PJRA 1NN5A 4F7WA 1M6NA 1E9CA 3AVUA 4G01B 1OXVA 3U5ZB 4EDHA 4IXMA 4AYTA 3DKPA 2OCPA 2JIZA 5FPSA 2WJGA 4C0KA 1UPTA 2XTZA 5CK5A 1Q22A 5BW8A 2QN6A 1WP9A 5KNBA 5L3QB 4H9GA 4Z54A 3GEHA 3M0EA 3BFXA 2UKDA 3VFDA 1J70A 1DG3A 2KI5A 4KBFA 4NP6A 4M4SA 4MRRA 1U8YA 1XTJA 3MCAA 2B8TA 2R9VA 2C99A 3DOEA 3IKJA 4Q7MB 2X77A 4TSFD 1U99A 3NKVA 4TL9A 5C2JB 1LY1A 4M1OA 3P4XA 4P33A 4P31A 2Q9CA 4TL6A 4IDNA 2QSZA 2Q21A 1W0KD 2ZTSA 4PZZA 2XX3A 2CHQA 1AQYA 3U6KA 5AJVB 4LCBA 2WWXA 4PHTA 2WZQA 3T12A 2LKCA 1XEXA 2PT7A 5DYGA 2ZI3A 2QENA 4AG5A 4QGHA 4TTPA 1QDEA 5CIQA 3TGPA 4B76A 2JLXA 3TNFA 2CCGA 4QJ4A 4V0ME 2D7CA 1VHLA 1P61B 2WSMA 2G9NA 3T06B 1UF9A 3AM1A 4AKHA 1V5WA 4OI2A 1T8TA 4IDQA 4BLRA 2H5EA 1W36D 1Q1QA 2B7BA 5AUQA 2QAJA 1GM5A 2V3CC 1A1VA 4I1SA 2H57A 3W5IA 2PZFA 3RS4A 3KXLA 4DB2A 3NBXX 4NKRA 2F43A 1KSHA 4PO9A 3HYRA 3TMKA 3FHOA 1E0KA 4DEYA 3ZQJA 3O8RA 2R6DA 2QQEA 5IHPA 1VG9B 3T15A 3KL4A 3RC8A 3LH5A 5EXXA 3THXA 3UXMA 2HUPA 2ZYVX 3BOSA 4RSGA 1W49A 4LJ8A 5SZHB 4HUTA 1FX0B 4Q1DA 2JLZA 4TZ0A 5JFGA 1L2TA 2MMGA 3KUDA 1KHTA 1TQ6A 3X1YA 2IYTA 1ZM9A 4GZMA 5JWRA 4BRWA 4OI1A 3GLGA 2EW1A 3AVQA 1G41A 1T5IA 1LF0A 1YZLA 3CNOA 3GD7A 4K46A 2CLSA 3WMEA 1D2EA 4CT5A 3IQXA 1JNYA 1N6NA 2J3EA 3VTKA 5IK2D 1J8YF 4FWIB 3BJIC 5ANRB 4EQ6A 1QG4A 4B3CA 3AB3A 3PQCA 3KQLA 4KU4A 1YU9A 4Q21A 4PX9A 1PLLA 1Z0FA 1JEDA 4OI0A 3E70C 2GZAA 1ZINA 4YDHB 4URYR 1KJYA 2XB4A 1U9IC 5GJWC 3EW9A 4PC7A 3TQFA 4KFSA 3ETLA 1S3GA 3QEJA 2FDCA 1WBDA 3WNDA 1N0WA 2RGAA 3MWKA 1G21E 2ZREA 2OESA 2X2FA 3I1FA 4NYMQ 2DYKA 4ZKDA 2QROA 2AK3A 3LRPA 4GMXA 3QQ5A 1TMKA 3LW8A 4QGGA 2YVUA 1GNPA 1R7RA 2FOLA 3Q7QA 2OCYC 1K8RA 1WXQA 4FMCF 1NVVQ 1Z22A 1GP2A 4JKIA 5BQ5A 1VKJA 4BASA 1W0JD 3MWYW 4B35A 2WHXA 2P5TB 2PH1A 2PLRA 4PFSA 1E1RD 2WWHA 4A2QA 1RZ3A 2VA8A 1J2JA 2N42A 2BBSA 1GL7A 5CLLA 5JHHB 1FTSA 4CGZA 5F9HA 4MQBA 2GAAA 3UMSA 4MGKR 1KI2A 4P3YA 1H8EA 1EWRA 2QAGA 3LWNA 3U61B 4DSOA 6Q21A 2QAGC 2XB2A 3U4QB 1EK0A 5FL7D 1J99A 4P4SA 1R2QA 1T8UA 3TE6A 4FWTA 1BYUA 3AP2A 2CHGA 1E0JA 1D9ZA 4ARZA 2WJIA 4URUR 2I1QA 1E69A 2F7SA 4BFXA 3CR8A 4U5XA 3K0AB 2V7QA 1UEJA 4KSCA 1ZW6A 2V1UA 2VQSA 3Q72A 4LV6A 2YKGA 2BEJA 1E3MA 4OQMA 4DIEA 1GRQA 3UATA 1W44A 1MO3A 2Q3FA 2V1XA 4HZUA 3KQKA 2AD1A 3MMPA 2ZRAA 3NXSA 3AVVA 3DO6A 4EJSA 3WP1B 2ZYWX 2GJ9A 1LFDB 1ZNZA 2X8AA 1FMJA 4I1VA 4QHTA 2QRNA 2WIBA 4RD6A 4BFUA 1KKLA 3GLIE 2ZRFA 2HT6A 1JR6A 2F55A 5H70A 3PITA 1XMJA 4I99A 5HR5A 2SHKA 1MO4A 1NVWQ 1P72A 2WSSD 2PX3A 2QE7A 3AGPA 3IHLA 4PO8A 5KNCA 5C1BA 2QORA 1L4UA 1P3JA 1CJUC 3KDSE 1G7TA 2R44A 4DJTA 3RS5A 2BC9A 2J0UA 4MGIR 5DIFA 2QBYA 1YR9A 3S1AB 2ZSFA 1RYFA 4LBVA 1X86B 1OH7A 4A36A 3QENA 2IUSA 2Z5FA 5DN6A 4W5WA 1ZRHA 1QHGA 1VDZA 2F9MA 2QZ4A 1R10A 2VRWA 3KXKA 1LVGA 4AK9A 1HQYE 3W34A 3THWA 3K0SA 1KNQA 1N5LA 4BLQA 4A6XA 4EPWA 3TR0A 4E5UA 5AJZA 2FX3A 4HLUC 4M1MA 3FDIA 1P9WA 1W48A 3AVPA 3F8TA 1OXTA 1VYUA 2AN9A 4B33A 1IHUA 3T34A 3VR4A 1F2TA 4LX0A 2PZGA 3GQBA 4Q9IA 1GDDA 4Q9KA 1IOZA 1G3IA 3PUVA 2FFAA 1DAIA 5G41A 2BOVA 4GI7A 4M1SA 4OHVA 1SVIA 3LD9A 2R62A 5EXPA 3RSLA 4RCYA 1JECA 2BEKA 4TMTA 1KI3A 1FTNA 2JJ1D 2OXRA 1E2LA 4G5GA 2OXCA 2VHCA 5SZKB 4MYCA 4QBFA 4CYMA 1R4AA 3R20A 1P5ZB 1U2RA 2QP4A 2H8KA 3VR6A 3A1VA 2VP6A 3IQWA 2BJVA 3MLEA 4DLVA 1G19A 3D7MA 3RLFA 2OEPA 2DHRA 1XEWY 3GLFE 5CYOA 2JJ2D 2REXB 4XSHA 1KDPA 1KOFA 2GETA 4DVGA 2XTNA 3W5JA 2KSQA 3VR3A 2ECKA 4IRUB 4JBWA 1E32A 2ZPTX 4LUCA 1XMSA 2ZS8A 4DRZA 4URWR 3SYNA 4ZDIA 4II7A 5KSOA 1AS2A 4NMMA 5BYJA 4BWYA 2JLUA 2HT1A 1IONA 3TSOA 1M7HA 4W5HA 2PMKA 2IYSA 4JS0A 3VR2A 4RZ2A 4W7SA 1S9DA 2OUKA 1W4AA 4DBLC 1Z5ZA 3HR8A 4QOSA 1AJEA 3AH8A 2VHTA 4NL4H 4IOKA 3GLFA 1E0AA 1GIAA 1NMZA 2GAOA 1M74A 4PHGA 5FOUA 4LDJA 5LBIA 2IEZA 4H1VA 1EFHA 1COWD 1WF3A 2GCOB 1ZU4A 4NH0A 1A2KC 1Z07A 2DBYA 3N2EA 1P6XA 2VIIA 4ZCIA 3QXHA 1JB1A 3MWJA 4LRWA 2ZUCA 2FV8A 3C4JA 5CB6A 3KX2A 1RKBA 2NPIA 1XB2A 3BS4A 5JCPA 2QI9C 4BFSA 1HE1C 2VP0A 1OIXA 4GBMA 2ZE6A 2CLDX 3Q3JB 1QHNA 4IKEA 4M9SA 3QKTA 1DEKA 3OAAA 4KV9A 2AX4A 3JVUA 1Z8FA 1VCIA 2GILA 4Q4HB 1XTSA 3GJ0A 3OHMA 5JI2E 5L3SA 4US2R 1Z6TA 1R5NA 1E9AA 4AYWA 3VKGA 4S35A 1BIFA 4FCVA 4Q48A 1F5NA 1P2TA 2OCAA 4G5OA 2NPFA 1E2QA 4DCSA 1E79A 1G6HA 2WWFA 1AM4D 3A36A 2GXUA 3DMDA 3KJIA 4GPTA 3EAQA 3L0IB 4H1UA 5EXTA 4ZV4A 1W46A 2ZI9A 4Z8YA 3ADCA 2QEQA 2BKUA 3L43A 3CPHA 3P4YA 3WP0A 2IC5A 4ASUD 2Z4SA 2J87A 2ZM5A 4R71A 4Q19A 4EPTA 4UXIA 2QL6A 3AVTA 1XEFA 4D4LA 3TAHA 3CX7A 2FN4A 2IS2A 1TTTA 4HB4A 3EIHA 4JL5A 3MJRA 1WRBA 1EX6A 2ZIAA 4V0MA 1OH5A 2CVHA 1CBUA 4Q66C 3A1SA 3AVWA 3LVQE 4UXHA 1Q3TA 3M6AA 1RYHA 1ZU5A 2ZVQX 3I3SR 3UWOA 1S9HA 4KHZA 4C3ZA 4LHVA 2QMHA 5JMTA 4OQNA 3ADDA 1XNJA 3DEFA 3CRQA 2W2VA 4WXRA 2JATA 4D0LB 3FTQA 3EIQA 3NIBA 1GSIA 1P60A 3IIKA 2FEMA 4B34A 4BFVA 2PCJA 1NBMD 3I61A 4CEIB 1XTKA 3VQTA 4KITB 1Q0UA 2X2EA 4O2RA 2JGNA 1G64A 4GMDA 2WOJA 2ZRMA 3EWAA 2J1LA 3KB1A 1KO8A 1VYVA 1N0UA 3LO5A 4QG7A 1K6MA 5GJVC 1W2GA 1G17A 4WA7A 3RAPR 4B75A 4TLAA 4OHZA 3VHXA 1VTKA 3TSZA 4R98A 4KLZA 2J5XA 1XFAA 2NO0A 3IHWA 4EJSC 1FUUA 1M7GA 3SFZA 3D31A 2QMOA 2EFHB 3CX8A 3REGA 4D4MA 2D74A 4KODA 2RAPA 2J7PD 3R7WB 3RANA 3RRZA 5CDFE 3TUZC 3B1WA 1Z6XA 2N1BA 2J0UB 4IJMA 1ZM7A 2W0MA 5AK0A 3NG1A 3B13B 4TMZA 1OXUA 1KO5A 3DL0A 1SVWA 1KZ7B 1KMHB 4NYJR 3HDTA 4DCVA 1E1RA 2OLJA 4EAQA 3LQQA 3THWB 1E4VA 1W4CA 2B7CA 3MUFA 3HR7A 3QF4B 1QG2A 4DHEA 3ND8A 3PEWA 1P73A 1R6BX 2AWNA 5FH9A 1DARA 1YZUA 5DO9A 4BFWA 2RMKA 4Q00A 2K5UA 3C5HA 521PA 1YRBA 4LHXA 2H18A 5FBLB 5FUWA 1OYYA 1W4BA 3FMOB 3TAUA 1DADA 1M1YE 2FFHA 2HJGA 3BB1A 3OIVA 1LF5A 1SXJA 1OFTA 2QP3A 5CDFA 3G82C 3K0AA 2D2FA 3U3OA 3T5DA 3QF7A 1ETUA 5KPJA 5CB8A 2O8FA 4TZ6A 4HB2A 5FI0B 1E9FA 5J47A 3B7GA 1I4DD 3AF0A 2AKYA 4HZUB 1GAJA 1P7CA 2Q0HA 1Z3IX 3TJZA 3ZDQA 5CM9C 3BIFA 1TUIA 3RC3A 3U60B 1ZVQA 4CEHB 5EP4A 1Z0DA 421PA 1XBTA 2V54A 2ZRBA 3WXMA 1W7AA 2E87A 1N6LA 4N3NA 3KKMA 1H8HA 4ZKEA 1XRJA 4HATA 4DT1A 4CF7A 2IXGA 1GL6A 2VSFA 1MV5A 3WMGA 4FMDF 1CR0A 1OJLA 2JDID 4JZKA 1Z6YA 2FMXA 1Q12A 3WBKA 1FP6A 1GRRA 1US8A 2ERYA 3CH5A 1ZUNB 1ZC4A 3IUYA 5C18A 5DE3A 2GVZC 3HYTA 3LLMA 4G1UC 2WWYA 4RD2A 2V55B 2ZE7A 2CXXA 2ZJ2A 5K8UA 1MH1A 3JVVA 3I5XA 4NCJA 4D82A 2AD5A 5JRZA 1E9BA 3EIEA 1OH8A 3PEUA 4D26A 1AN0A 2BBWA 4D4JA 2I3BA 1W5TA 2EFGA 3AF4A 3CRW1 3PVSA 4HLDA 2WPDD 4PO1A 2XZLA 3CZPA 4TT3A 1GG2A 4Q4LA 4TSFA 2DPXA 4JSTA 5B64A 2REOA 3GMTA 4Q7KA 4X8LA 1ZC3A 5KHOC 3RS0A 1N6OA 4KVAA 1JALA 2WIAA 1ZD9A 2FU5C 2QY9A 3OE7A 5H68A 1TF2A 2QT0A 2W00A 5FUYA 4A82A 2J0SA 3K70B 2ZRGA 1KSFX 1JJ7A 1ZCBA 1UBFA 3SBEA 2O8BB 4ACBA 2DR3A 3P27A 4MUBA 1SZPA 3U7FB 4LHZA 2YV5A 3IBGA 1KI7A 2P6UA 2HDNB 2PBRA 2DFTA 3K0CC 4PPQA 2VLIA 5TXGA 3UK6A 1EFCA 2J59A 1O3YA 1ZP6A 4YMUA 1E9EA 5JJLA 4NCHA 1MOZA 4LWZA 3LAWA 1Z83A 1N6PA 1EG7A 2FFBA 3LW7A 1KAOA 1P75A 3G0HA 3SBDA 3ZIAD 3CR7A 1LB1B 1DPFA 2DFKB 3LDAA 4Z8XA 2ORWA 3HPQA 3TUIC 4TLEA 4L16A 1T3SA 3LBIA 1HQCA 2P2LA 2EVWX 4HB3A 4F93B 3ZD6A 2HXSA 3QKSB 2FJUA 2PJZA 1T5LA 4LV5B 4NTZA 2QU8A 3R9WA 5DGXA 1RIFA 1A5TA 1P9RA 3NWJA 2IXEA 2J46A 3TKLA 4JVMA 4M9ZA 1BS1A 2FSFA 1GKUB 2PLFA 1G4UR 3BRWD 4C7OA 3FGNA 3W8RA 4XOIA 2XOKD 4GOXA 1VCOA 2NO9A 1M2OB 2AHOA 3FKSD 4A0GA 3QNUA 4IDPA 1CEEA 4GZLA 1SVLA 2F3TA 1NLZA 4JYCA 4TYPA 1UBGA 2RGBA 4YMTA 1DG1G 4EKDA 1OHHD 3PFIA 3MAAC 4ESVA 1NI3A 2C04A 3AV0B 5JWHA 1IY0A 2Z4RA 4MKHA 4W5JA 2HYIC 3OEEA 4QRHA 4HLQB 5FL7A 2CE2X 1Y3AA 3T35A 2R6AA 4GOJA 3ICEA 2J9RA 1UDXA 5DI3A 3ONWA 2Y8EA 1C1YA 3ZYCA 3KJGA 2GXAA 3LY5A 4DLRA 1N3BA 3FYHA 2KBEA 4QJ5A 1H8ED 1LS6A 5FTKA 5TDHA 5JBQA 4OL0A 2G0TA 1WMSA 1CXZA 3KXIA 2C9OA 1SHKA 1YJ5A 3KJEA 4TLBA 4EFNA 5FTJA 4OHWA 3PUYA 5F9FA 1NVUQ 2ZEJA 3GEIA 5D3MB 3CWQA 2ZRPA 1OIWA 3CRVA 4WVFA 1Z0JA 5TARA 1GKYA 4PZLA 1BH2A 2IWHA 4MGZR 4QHSA 3T1TA 4UXJA 1OFUX 1D2MA 1XMIA 3IGFA 4AC9A 1U81A 1G3UA 4UNPA 4DCNA 2W6JD 5G53C 3WHKA 5L3QA 5C46F 4A15A 1AK2A 1GUAA 1OE0A 1TU3A 3QSYA 2DCUA 3A37A 2VF8A 1BKDR 2A2ZA 2ATVA 2YOFA 3HJNA 3R9IA 2J45A 1U8ZA 2RCNA 1E2EA 3NHAA 4MKFA 1CJKC 1NN3A 2VTKA 4MUAA 1BMFA 3C16C 1OPXA 8OHMA 1V43A 1U9IA 2VO1A 3FFBA 2ZYTX 3L8YA 4TTRA 3CF0A 1N6HA 1NG9A 2R65A 4ACAA 3W6OA 3VR1A 3BORA 2OFOA 4DLUA 5GADl 2YWHA 1WE2A 5FOXA 5AUPB 2CJWB 5FTMA 3TSWA 5TV2A 3H1TA 3SR0A 3H4MA 5JS7A 2GEVA 4IVQA 2BJWA 4PQRA 4A2WA 1E9DA 1UJ2A 2O8FB 4B71A 5LD2B 3TVDA 3L2OB 1N6KA 3GPLA 4EPRA 4MA4A 3ZIAA 2QTHA 3ZS9A 1A2BA 1XZPA 2P0EA 1X8LA 1TUEA 5AR1A 4LJAA 1X1SA 4LGMA 4E09A 3IBYA 2J0VA 4RZUA 3CW2A 3WRXC 1UEIA 3KFXA 4NCIA 3UMRA 3K8YA 1HURA 1J7KA 2FGJA 4MRVA 2WWIA 1QHHA 4MYHA 3QF4A 1XX6A 2AWOA 3TH5A 1KTVA 3FKQA 2WWGA 2ZSDA 1QZXA 4DLSA 2CL6X 1BMFD 4HAWA 4NPHA 5HPYB 4EPXA 3CUEF 4TQUS 2ZVPX 2LWIA 1KZGB 4NDZA 2F1JA 2XXAB 3AQ4A 3W8NA 4GDFA 3SFVA 1ONBA 3OF5A 2A7QA 2ODBA 3LBNA 1QRAA 1DBSA 3PR1A 1KJZA 2ZSBA 2CDNA 4BZXA 4Q9LA 3N2IA 1IN4A 2PEYA 3QE0A 4YLGA 5JHGB 1ANKA 1TEVA 4Q9HA 2FFQA 1Y63A 2GRJA 3DVLA 3C8UA 3Q9LA 5EE5B 5TY0A 3TR5A 1Q3HA 2BMFA 3O47A 2FWRA 4KLNA 3ZVRA 5LD2C 1R5BA 3L0PA 1TU4A 2D7DA 3ADBA 3PEVA 3CRRA 2F1HA 3B1ZA 2C98A 4B2PA 4LJ5A 4DSTA 4V0KA 3QPWA 1FQJA 2O8DA 2D2EA 3U6BA 2IXFA 2VF7A 2YWEA 3B2EA 3W6NA 1G16A 4NZYA 2TMKA 4DC9A 4DKXA 1IN5A 2OO7A 5F98A 1II8A 2QMEA 3CNNA 3T1QA 1JQJC 1ZM3A 2G3YA 3IPXA 2JDIA 3FE2A 4KXFB 5CITA 3VX3A 1GITA 3IDQA 2ORIA 4TLDA 1DS6A 5HCIA 3SN6A 3TW8B 5JECA 1FL9A 4QFMA 5EZ6B 3Q5EA 3KQUA 1P2UA 1ZMXA 2OFXA 4L5BA 2O0JA 2DWPA 3FHCB 4URZR 1X1RA 3LFUA 4OBEA 1TF5A 1KMQA 3TBKA 1E2PA 4QBGB 2ZITA 1VECA 3THXB 4OKSA 5GJBA 4MRNA 4XWOA 2VBCA 4PC2A 2ZR7A 4CZ2A 4X8HA 2ZRDA 3EZ6A 2ZJZA 3W3AA 4UJ5A 1QHSA 1W1WA 1X6VA 4B47A 4KVGA 3EA5A 5FBQB 1XZQA 2JLRA 1VIYA 2AK2A 2ZRKA 1FFHA 4M1YA 1E2GA 3ND9A 4RKEA 4O3MA 1C9KA 2KJQA 3FMFA 3LQRA 2A3RA 1PUIA 2HLDA 4V02A 4IOMA 5KPDA 1KO1A 2WMNB 4I4LA 1N5KA 3PUXA 3A4LA 2IX3A 5IRCD 5FL3A 3SJCA 4Q9JA 1WB9A 2P6NA 3MJHA 2BM0A 2QPOA 3BD9A 1PLKA 3DZ8A 1II0A 4U00A 3SS8A 1P4SA 3X2SA 4EPYA 4U7DA 1Z2AA 3OIYA 1RFLA 2EWVA 2DFNA 2B21A 1GL9B 3QG5A 1Q57A 4Q1EA 1UADA 5BWMA 3ADKA 1SVOA 4JJKA 4C2TA 2MSCB 1NKTA 2ZRCA 4A6PA 2WAYA 2C8VA 4ITRC 4E22A 1DAHA 1G5RA 2C78A 4BLSA 1DAFA 2F6RA 1Q20A 1RJ9A 3NDPA 1VIAA 1ZIPA 3OESA 2IUTA 4M8NE 4OI4A 5HZKA 3AUXA 2VHJA 2D06A 5TVKA 4LHWA 2VP2A 1DAEA 1K5DA 2VL7A 3GLHB 1FPMA 4D6PA 4AWXA 4CRWB 5EUQB 3VKWA 5KSYA 1IY1A 4LJ4A 4KSBA 2GXQA 5TB5A 1IJFA 4M22A 2BM1A 3C15C 3ZLJA 1Z28A 3M1IA 2E1RA 2GF9A 2ZRLA 1Q21A 4XH9B 1U98A 5D3MA 5DYIA 3UIEA 4DLYA 1AIPA 3OFNA 4V0NA 2RGCA 1YKSA 1YZTA 5GVRA 2A5FA 1W5SA 1RRFA 5BN3A 3F0TA 1E9RA 3RHFA 4GP6A 5AUNB 3GLGE 2V7QD 2X19A 3A1TA 5E7MA 2EYUA 1ESMA 3SOPA 4FW9A 4N1AA 5FBVB 1AZSC 1NIJA 1F3OA 3FB4A 2FNAA 1G1MA 1YZQA 4FCTA 2PEZA 4MYUA 5BN5A 1EGAA 2BBTA 1IY2A 2CJWA 2JJ2A 3NHBA 1WBBA 4NU0A 3A4NA 4JLJA 1U90A 5B2ZA 1S3SA 4TMXA 3LVRE 4LJ6A 4OQFA 1D8TA 4MYTA 4TYNA 2GJKA 3RABA 3ZGXA 2NTYC 3BH7A 2IWRA 3GLHE 3B6EA 2BKEA 4G5SA 4IXNA 2DWQA 621PA 2XITA 2ZROA 1UKVY 4FINA 4P32A 4EJSB 5KSZA 2WICA 2ASEA 1P62B 4EUNA 2Z43A 3NDBB 2ZS7A 3UPUA 5E4FA 2JA1A 1A82A 4CEJB 1E1QD 4FN5A 5JCZA 1W0JA 2FPMA 5IF9A 2XGJA 3L82B 5JSZB 2QGZA 2IHYA 3KUCA 5HKKA 4LI0A 1W36B 4Q4JB 2CL7X 2JCSA 3LXRA 2CK3A 4LBYA 1ZYUA 4DUGD 1G5PA 2XJ9A 3U44A 2ZI5A 1YR7A 3K0FA 4PAOA 3UANA 4C0QC 2Z6VA 3UG6A 1DO2A 2B6HA 2BWJA 4PC3A 4A8JA 3B1VA 3EARA 4C2UA 1U94A 2FPKA 1FW6A 2I1VB 3GJ3A 3HU1A 4KO8A 4C0SA 2YOHA 1F48A 1ZIOA 4LK2A 1E4YA 1KK0A 2QGNA 4JSYA 4HZIA 3VU9A 1Z6AA 1NJGA 3RS3A 4CVNA 4E07A 1GFIA 1HH4A 5B30A 3RYTC 2O0KA 5HKKD 2KWIA 3NBZC 4YXWD 4AKGA 3GFPA 3K9GA 1ZNWA 4BE7B 5C4MA 1G8GA 1MT0A 2OAP1 2EFEB 2G88A 4HDCA 1G7SA 4AG6A 2O8DB 2EFDB 2BHRA 1ZNXA 4C0HA 1CKEA 1N6IA 2JEOA 3BFVA 1MO6A 3SC3A 5BXQC 2VP5A 2J7PA 2XJ4A 2YC2C 2OG2A 4QBHA 2IBMA 4S2EA 2GWHA 4F4CA 3CONA 4YONB 4Y0AA 3T1OA 3W6PA 4Q4HA 4B2IA 3WYAA 4CIDA 2JJ8A 1E2HA 2GESA 3ZD7A 2C9CA 3T5GA 4M1TA 1P9NA 3ZZUA 4HDQB 3TRFA 1JAIA 2WKQA 3EXAA 2ZANA 3NH9A 4UNRA 1CULC 2O0HA 3X1WA 3EPLA 3SQXA 2YJTD 4BUJA 4V0OA 1E2JA 3B78A 3BGWA 4MDEA 4TQAA 4G5QA 1DAMA 3BB4A 1SKYB 2XZPA 2FZ4A 1R8QA 3QI2A 4LY6A 5C4GB 2XNSA 2PJRA 3VNUA 3P26A 5KU1A 1QF9A 2H92A 3OEHA 3FMPB 4RZ3A 3OFND 3FMIA 4KFUA 2XAUA 2XEXA 4JVSB 4G5RA 2FSIA 1NF3A 1KSJA 1SKQA 3HP1A 3A1UA 4JL6A 3K0CA 4QXAA 4A2PA 4BECA 2J0QA 5E7IA 1FUKA 4QJ3A 1CLUA 4A0FA 2KE5A 4UQOA 4WBSA 1JXMA 4JLPA 5F2EA 3QKUA 5FPYA 1LTQA 4BZPA 2FPLA 3B1YA 5LPNA 1OLOA 2QQ0A 4M21A 3SHFA 1IN6A 4ZDKA 1R0WA 3KB2A 4IVPA 1IXRC 2GZDA 3D3QA 1G8FA 4M1WA 1KK1A 1JXOA 5EE9A 2JASA 4JT4A 1F6BA 1S1CA 3ZVNA 1JI0A 1OHHA 2WJHA 4WZAE 5L3SB 4XSGA 2W0SA 2QM7A 1KI1A 1XD2B 3K9LA 3GLHA 2YNMA 2JIZD 4LYHA 2HLDD 1ZAKA 3MSXA 1CR2A 5M04A 4LV8B 5FTLA 3E1SA 1HA3A 4IDOA 5JWOA 3KTAB 4QBIA 3LLUA 1NNEA 4LHYA 3FPAA 4URXR 2OBMA 2CLCX 3PXGA 3BH6A 2HCBA 1OB2A 3WYGA 3LX8A 1TQ4A 4FIDA 4NBSA 3EPJA 1XXHB 4POAA 3T61A 4GNKA 1RJ9B 4KFTA 4Q02A 2D4HA 1KGDA 4GT1A 4Q4JA 1VCMA 1Q1EA 3DMNA 4LYJA 1MABB 3THYB 2JLVA 3AKYA 5DISB 2IYRA 1PVOA 2O8EB 1TL7C 4PC1A 3RNLA 3LNCA 2G0NA 2IYYA 1KI8A 2VPPA 3H0KA 3PIRA 4KYUA 5FFMA 4UNSA 3B9QA 2VSOA 1EFRA 4R7ZA 3MD0A 4BRUA 3JZAA 3NC0C 4UJ3A 5P21A 3I73A 2UZIR 4NONA 2GJ8A 2FEOA 1AKEA 4L9SA 5E3HA 1YR8A 1OH6A 4LBWA 1Q44A 1AGRA 3WRYC 3QG1A 3G5UA 1HV8A 2ZRNA 4JL8A 3RSOA 4EIWA 2ZJOA 2IYWA 1LS1A 1OKKD 4X8OA 1JPJA 2GK7A 2WKPA 1HT1E 4B43A 1CJVC 4DIDA 3GJ8A 2D62A 3CB4A 3X1XA 3ZH9B 3ECCA 3N70A 4HAYA 3V9PA 4UKDA 4DSUA 5JSZA 3D8BA 3SI7A 1CJMA 5F3WB 5H1YA 4A4DA 3B5JA 1GVNB 1XDBA 2OILA 4UNQA 4JVLA 4IEEA 2ZJ8A 1DAGA 3PUZA 5KYKA 3BBPA 3AP3A 2O52A 2ZS9A 1M8PA 3K09A 4LC0A 1II9A 1R0YA 3GJ7A 3R8CA 3E2IA 1KO7A 1IXZA 1G20E 3ZZTA 2W2TA 3MGCA 1CIPA 2WV9A 2G1KA 3K9HA 4MKIA 3AGQA 4PHFA 1GILA 3RRNA 3U3KA 1VG8A 3AVXA 4RFVA 1AQUA 1HE8B 4IFBA 1E2MA 4TYQA 1Q1BA 3WHLA 1QBKC 4TLCA 2A9KA 4ESHA 1J8MF 1SVSA 4Q03A 3GJXC 4Z1MA 2G83A 3K53A 4WZ6A 5K8LA 3GLFB 2KB0A 2QPTA 4YC7A 5DHFA 4A8JC 3K1JA 4HAUA 5HTKA 3HU3A 1H8HD 3Q8XB 4B3FX 721PA 1IM2A 4RD3A 2CBZA 4D0GA 2Q3HA 4MKGA 3EG5A 5EUMA 4C0LA 5EZ5A 2GXSA 1Z0AA 4EQ6B 5G3YA 1EX7A 2IF0A 3PG5A 4OYHA 4G0NA 1F60A 2P65A 2MSDB 1D2NA 4GSYA 2RGNA 3AKCA 3QPUA 4AY2A 4DCTA 3IEVA 1MKYA 1BO6A 2AXNA 3B60A 5FI1B 1OIVA 3KFVA 5EE0A 2C9YA 2GBLC 4V0LA 3AUYA 3U3MA 5FR2A 3A1WA 1FMLA 4DDWA 1XF9A 4WW0A 2L0XA 2B92A 5EP3A 4A9AA 2H16A 2ZJAA 1E1QA 1I4TD 3U3JA 5GVSA 2FZLA 2LKDA 2NGRA 5FTNA 4BFTA 4HI0E 1CRPA 1XWIA 1N6RA 1YQTA 3H2YA 2W2XA 5AUOB 4BZQA 1HT2E 2CHVA 3MRSA 2IS6A 2O5VA 4PANA 2VHQA 1G291 5FR1A 4AURA 3HWSA 1E6CA 2BDTA 4PPFA 4A8JB 1T3LA 3C41J 1Z0IA 1NMXA 5AJWA 5J4LA 3CNLA 1CTQA 5JI3E 2B8WA 5EE3A 1FNMA 1G8HA 3CRMA 3P20A 3U7GA 1HUQA 4AIIA 5EP1A 2W83A 3GJ4A 3EZ2A 1IQPA 3N5CA 4Q7LA 4JLMA 1W0KA 2R6FA 1GKIA 2W6ID 5CJ2A 4DB4A 4M0LA 1KI4A 4FI3C 1GWNA 2GKSA 2IYUA 3B1XA 3I32A 5KUTA 1KDOA 5DNYB 1VG0B 3CKLA 4QNMA 4E03A 1UDWA 2ANBA 2GCPA 1JEEA 3DKVA 4GRAA 2JLYA 2J41A 2FE4A 4LJ9A 2P3SA 4TMVA 2W6JA 3U4QA 3VX4A 3W90A 1ELOA 4DCUA 3QXJA 2C03A 2CMKA 4LPKA 1G7RA 2JLWA 3H84A 1R0XA 2IF2A 3P1JA 4IVRA 4XVQA 2AFHE 1ZJ6A 3CH4B 3RWMB 2WM9B 3KZ1E 4AI6A 4NHOA 4Q4AB 3ZVLA 2RGNC 2WTUA 5J4VA 1EXMA 4XIGS 1L8QA 3SYLA 4EFLA 3QKRB 1CR1A 5HZHA 2IYVA 4DWJA 3AVYA 1YZKA 2RKOA 1FP7A 1U8AA 2AFIE 3EASA 5EP2A 3A58B 2J7KA 4B3BA 4QKQA 1E2FA 3QBVA 3U7EB 2AXPA 1VYTA 2ZE8A 1Z47A 3UMFA 2IS4A 1TNDA 3OEED 3RRMA 2ODNA 5DSZA 1TADA 2RHMA 4B44A 4QM7A 4F91B 1CS4C 3SJBA 5CM8B 3FKSA 4JYBA 1RC8A 2OM2A 4ZIRB 5AWFC 1WDTA 1YRAA 1FOEB 3KKOA 4PQYA 4D4KA 1SQ5A 3TK1A 4BFZA 4HB0A 4C7OB 3KKPA 3NBFA 3W3ZB 3K9NA 2QBYB 1JQLB 1SXJC 1SXJE 4V03A 5E95A 2CVFA 1NKSA 4RVCA 1KI6A 3OZXA 2WWWA 4Z1MD 4UNNA 1I4LD 4A1FA 1BOFA 1XD9A 3D6TB 3EC2A 4I1OA 4MGYR 2NQ2C 3OAAD 3Q7PA 4PZYA 2PX0A 2ZAOA 5HE9A 1CRQA 3ZS8A 1GNQA 4FMDB 2ATXA 4XD7A 2X1VA 3M4YA 5J5CA 2H17A 1NBME 1XXHE 4CEHA 4R9UC 3ASYA 2QNRA 4TWZA 4IOJA 2XNDD 4AKEA 1E2NA 2IA5A 5CIWA 4RD0A 3K70C 4PC6A 4HLCA 1NMYA 2PL3A 3AF3A 2A5YB 4ZDJA 2I4IA 4R2IA 2IL1A 3MG9A 5G3ZA 2YOGA 1QHXA 1XPUA 2ZR9A 3DM5A 4F4JA 3FWYA 1XPOA 3OE7D 4IW3B 2GZHA 2P67A 1S1MA 3DOFA 3B85A 4US1R 1AS3A 1Q1ZA 4ZI3A 4B32A 5DHAA 2C96A 4OHXA 3X1ZA 1QHYA 2F9LA 3I62A 4YQFA 1G3MA 1XXHA 1QVAA 4IHQA 1P2SA 1DE0A 4PHHA 1A4RA 3WNBA 3AP1A 2QTFA 1GNRA 3B9PA 4KI0A 1RW4A 1GRNA 1II8B 1WA5A 1FNNA 1MABA 3EC1A 4WXPA 5D3QA 2Q9AA 3B8HA 4HYYA 3WNCA 3THYA 4LSGA 1NVVR 2A30A 3RDPA 2MSEB 3I4LA 3PJRA 1NG1A 2OE2A 2UVQA 4OHYA 1EFRD 4OK5A 1NSFA 4TT3D 2D3WA 2WAXA 3NEJA 3HU2A 3AEZA 1OV4A 3NBYC 3BXZA 4NYMR 4ZCLA 4DDTA 2VP4A 5KSPA 2ZR0A 2WOOA 4FCWA 3CIOA 1VCNA 1D5CA 2A5DA 1SGWA 2NO6A 4J0QA 1PV4A 5SZIA 3ZQ6A 1YZNA 1JPNA 1UAAA 4WIAA 4ZI2A 2ZXUA 3LBHA 4OK6A 2ZI7A 3FFAA 5E7JA 2GDJA 4MRSA 2GCOA 3DM9B 2A78A 1SKYE 4D2IA 3EPKA 2OLKA 2XSZD 3GFOA 1N25A 3IIJA 4KBGA 4F38A 1OYWA 1KDRA 2G1JA 4D0NA 1I2DA 4QM6A 1AGPA 3ZJYA 3K70D 2ZSAA 2JLSA 4RJLA 3E5HA 1N5IA 3RS7A 4PR0A 3VR5A 2WJJA 1XCGB 4YMWA 2IW3A 1RPZA 3BERA 3O8CA 2OCBA 3BB3A 2QUZA 5LDDC 4DLTA 1S8FA 4US0R 1SULA 4B73A 2HEIA 3KKNA 1OF1A 4KCGA 3QVUA 2ODWA 3WY9A 2ZI6A 2E9SA 4TMWA 1SHZA 3I8SA 1G6OA 1VMAA 4OK3A 2DWOA 1XCPA 1SXJD 4U02A 2C5LA 2BCGY 1NJFA 1T91A 2V8OA 2WKRA 3L0SA 3O8DA 3Q85A 4ERNA 3TLXA 2GHIA 4QGFA 3F5FA 5FOSA 3DPUA 1XMVA 2PMDA 3QBTA 2AR7A 1UBCA 2CNWD 2CK3D 3CZQA 1E2KA 3OEHD 3PV0A 1DAKA 2IEYA 3SQWA 3WBJA 3GJ6A 1Z08A 2QA5A 1NVXQ 3QXSA 1G8YA 2YWFA 1XJCA 3L8ZA 2WMOB 5SZJA 1F2TB 3DZDA 2OBNA 4ARZB 1F2UA 5FBWB 1DELA 5EE1A 4JLNA 4ABYA 3EWSA 5B58C 3AKDA 3I72A 4Q1BA 4XVRA 3LA6A 1ESNA 2QM8A 4XTCS 4EPVA 1YR6A 3C7KA 3EZ7A 1KKMA 3RVBA 5JRJA 3SEAA 5KTYA 1CP2A 1NBMA 4MDFA 1OSNA 4L8GA 1G3RA 4PQFA 5GJCA 2VEDA 3OIUA 4XJXA 2GJAA 2PCLA 2H7VA 4TL8A 4B3XA 1IBRA 5IDVA 3X1DA 3ZVMA 1T9HA 2EQBA 3WYFA 4XWAA 2QP9X 2IYXA 1CJTC 5KOYA 2Z0MA 4FXPA 1Z06A 2WJVA 4GOKA 2GVDC 4FD2A 1XTRA 2ONJA 4NYIQ 2YC4C 4DDUA 2V4ZA 1Z29A 1U0JA 3SU8A 3MFYA 4QL3A 1X3SA 1OFHA 2LCFA 1ZNYA 1Z2CA 2ZETA 1N2CE 2CE7A 1EESA 1JR3A 5B57C 3SDZA 1KNXA 2ERXA 1R0ZA 2ZAMA 4LZZA 3AVOA 4JT2A 2ZE5A 3KQHA 4LOAA 4N0DA 2UZ3A 3NC1C 821PA 5G40A 3ICQB 4K81B 1G5TA 1KI9A 4TN1A 1SXJB 1UKEA 4WOPA 3KQNA 1NP6A 1UFQA 5K8IA 2O8CA 4D25A 4JLAA 1NSTA 2WVJA 3PCRB 1TEXA 4NCKA 4DUGA 2NIPA 3QVVA 4GFDA 4KYIB 2A5GA 2ANCA 3QKRA 1S0UA 3FHTA 2OV2A 1EFUA 3VU9B 1UKYA 1SVMA 2H1LA 4ZCMA 4XWKA 1E79D 2IYLD 2V6JA 1EWQA 4IOLA 1TQDA 2N46A 3V4RA 1K5GA 4HAVA 3J81k 1T4GA 1ZUIA 4Q18A 2RGXA 4RD1A 2NZ8A 2YHSA 3AKEA 3PUWA 5CLQA 4BPBA 2CCKA 2GEDA 2QT1A 4QGAA 1E9SA 2HF9A 4O2LA 5FBRB 3IIMA 1ZD8A 3QXCA 3QXXA 3BH0A 3UWKA 2YYZA 1N5JA 4DT1B 5JJKA 4LC1A 4MRPA 3LV8A 2RH5A 4NYIR 4O0MA 2DY1A 3EPHA 3SJAA 3EZFA 3TW4A 3K0FB 4HEJA 4RZXA 4IDHA 4HLUA 1COWA 1P2VA 1M34E 3U7HB 2ONKA 4AKIA 4CT4B 4TTQA 1S96A 1DOAA 3GEEA 2R8RA 1KAGA 3GLIA 1KJWA 1M7BA 2XXAA 2F3RA 1IN7A 1KI6B 3CLVA 3AF2A 1X8JA 4M9XA 1MR3F 2BCJQ 3PENA 4IFEA 3SNHA 1AS0A 5FUXA 1C4OA 3A8TA 2BV3A 4JMPA 1IJEA 4OQXA 5L3VA 1OKKA 5J4HA 1W47A 4RCZA 4B6FA 2NZJA 3ASZA 2JAQA 4I81A 3DHWC 2WPDA 1JBKA 4PSVA 3VNVA 5FOVA 5J4KA 2PZEA 2WJYA 2IYZA 3SZRA 1UKZA 1D6JA 1VHTA 3TIFA 4BQSA 3HPRA 1YVDA 1NIPA 3QJYA 3I92A 4HDOB 3R9XA 4R2HA 2NO1A 3I5YA 1XP8A 1G4AE 2EFCB 2MMCA 3GP8A 5TMPA 3BAFA 4RKFA 1KY3A 4JVNA 3U2QA 2REBA 2BBOA 2ZRJA 5KDDA 4HSEA 4ASUA 2PT5A 1A7JA 4ZDWA 2Q3MA 1B0UA 1HY3A 3CF2A 3IO5A 1XJQA 4I1UA 1NLFA 3QOFA 2ZSEA 2W58A 1T6NA 4BGDA 1D9XA 1R5OA 1KK3A 4A0HA 3ZZ0A 1VPLA 1MRSA 4JLKA 1H65A 5AJYA 3CO5A 4Q1FA 4AD8A 2NO7A 3SJZA 4YMSA 4YXWA 3A4MA 3AF1A 5JEDA 2YZ2A 3VKHA 4JLOA 2QG6A 2XTMA 1RRCA 1AKYA 1OB5A 4C0BA 1OFIA 1LNZA 4WAUA 4KFRA 4P4TA 1G3QA 1XU4A 4F4IA 4Q47A 1U0HC 2XNDA 3V4FA 2KBFA 2QSYA 3BFKA 1MRNA 2DFLA 2IYQA 4HUQA 2GA8A 5AJXA 3KTAA 5JZVA 4DSNA 2IT1A 4XD7D 4K8OA 3PEYA 1ZM2A 4PSKA 4NYJQ 5EQTA 2WBLC 5KDOA 4BLTA 3T1VA 1PZNA 1ZBDA 2FGKA 1ZCAA 3NEYA 3OIWA 4URVR 1T3HA 1AZTA 2RGEA 1NN0A 1XD8A 2BMEA 2ZUBA 2GF0A 1U0LA 1E0SA 1OT3A 1GTVA 2ZQ5A 3QIAA 4DXAA 4CEIA 3Q5DA 4TYWA 4O25A 1WQ1R 2FA9A 1XEXB 1AA9A 4RD4A 4M9QA 1OXSC 2ODEA 4B48A 3QY0A 1W2HA 1Z0KA 5FPHA 1F2UB 1T0JB 3CM0A 4JJZA 5JLJA 1E2IA 4M1KA 4TYYA 5BN4A 4RFSB 3EX7C 2HV8A 1OXXK 1E2DA 3BC1A 4D81A 3O8BA 1B23P 4OJQA 1E94E 2ZI4A 4OJKA 4L4UA 2IUUA 5K8TA 1S4QA 2G77B 1XTIA 1FZQA 4TL7A 5JS8A 3R7WA 1RRPA 4P4UA 5KDLA 5CYPA 4DLWA 2ZJYA 3RWOA 2ZJ5A 2GNOA 2F43B 5A0FA 4W9MC 2AL7A 2HJVA 1G18A 2GK6A 5KO2A 4B3DA 2FSHA 2JJ1A 1DTSA 1MO5A 1KO4A 3GFTA 3QUSA 4KJZA 4PTLA 1IAQA 1YE8A 3C5CA 3RRYA 3TUJC 4Q5IA 3H86A 4CW7A 2DB3A 2O8EA 1G9XA 1E99A 2QRZA 1UBEA 3K09C 5CK4A 1FX0A 5JJIA 4QNRA 2OSBA 2Z83A 4C4PA 2OFWA 4PSAA 4P0TA 1NL3A 2RB4A 5A4JA 2GCNA 2CCJA 2C2HA 3GLIB 4ON9A 3CWZA 3I8XA 4G3XA 2NG1A 3GLGB
chains in the Genus database with same CATH superfamily
2IZ0A 3OU2A 2JFWA 4EY6A 1FVOA 3SF8A 1TA9A 1OVGA 2VK1A 3PQ3A 5JEEA 2WE8A 1QLHA 1RHKA 4FYWA 4CDGA 4HAXA 4K1XA 3U3RA 4J94A 1EUCB 1ZM4A 4B6EA 1CF4A 1DBWA 1N0HA 1YC2A 3IP5A 3V2UA 1H9AA 3D0KA 5KTKA 2C4WA 4MH0R 2C2GA 5KQSA 3R8FA 4TQ9A 3S68A 3IILA 4CEJA 1Y8RA 2D1SA 3ENZA 1E5LA 3MWLA 3Q98A 5C8DA 1PQ4A 4OYYA 3ROXA 1KQ3A 4C21A 2OAQ1 4HN9A 4F5EA 4UPVA 4C0JA 4BEBA 1DKRA 2K2QB 3NH6A 4UDYX 3U1VA 1MHTA 4Y6PA 3UHPA 5BSTA 5AW2A 1YQEA 3G23A 1QQAA 1KTIA 3TIIA 1SUDA 221PA 3Q1KA 1HTWA 3CZCA 4JK3A 1NT2A 4WECA 2FJ0A 1E3EA 3HB9A 3U44B 1MIHA 4UM7A 5F7JA 2FK8A 1KMMA 4MTCA 3U81A 2BVNA 3ORYA 2O3UA 5DNAA 2QD4A 3QKSA 5CTAA 4F9GA 2HMYB 3L8GA 1C1XB 3DGFC 4CPDA 1AF7A 2X0NA 1GT91 2EYQA 3KS9A 4K6GA 4IV5A 3MVEA 1UBTS 2I4NA 3NIDB 4LPSA 3WK4A 4BMOB 2WDPA 2O50A 2IDKA 3H1GA 3JZMA 4EMSA 5J63A 1BE1A 1ODTC 5CHYA 5BVHB 4GL2A 2BMAA 4IIJB 1C7JA 2GA9A 3JAKA 3H4VA 1C5KA 2C77A 3H42B 5EWJA 1Z45A 3KT0A 3IT2A 2EL9A 3MTAA 1N77A 5CRIA 1TKAA 1EM8A 2P41A 5EXSA 1SXHA 4G4GA 4HDRB 1V6CA 1MQAA 4D9FA 2Y0PA 5C1IA 3ETGA 2WJZB 3OFJA 1FF9A 1YIOA 2LDBA 1C1DA 3T1YB 2NX2A 3REQA 4F11A 1GUDA 2YN4A 2DAPA 4UAUA 1TPZA 3VR5D 4NABA 3S8EA 2IS1A 2YWXA 3DDCA 3M6UA 3EDRA 1D4ZA 1SRQA 2V9PA 3C6MA 1C7FA 2CF6A 3GGSA 2OHJA 3KV3O 2VSYA 4XVUA 1PUJA 3VAAA 1L7OA 1TUBB 2FG7C 1CR4A 2FG5A 3CKKA 3GJRA 3K35A 1FXWA 4WK0B 3DFKA 3BWDD 3WGJA 4M8SA 4WWHA 4XQ0A 1KIMA 1XPRA 1S89A 3PXXA 3NZEA 4OHRA 4N12A 3AXSA 3QVWA 2Q2OA 4OQLA 4RF2A 5G2OA 4CM8B 4F21A 3ZDXB 3A6PC 2AKAB 2XA9A 4B2LA 1FDWA 2XBMA 4D97A 4OQPA 1D03A 1KXJA 2R1UA 4A73A 2GEUA 4ZVUA 1G9SA 5KVSA 1HRKA 4R9VA 1V71A 2QYHA 1HG0A 5GM1A 3ZY4A 2MYNA 1CYEA 1GA1A 1TAGA 1HL3A 4LMPA 2B78A 1EEXB 3FVQA 1ZH2A 3B82A 2QU7A 3HUFA 3U9LA 3BYZA 3EIXA 3EWNA 1KDTA 4OHOA 3RJTA 3F3SA 3HXQA 2R6GA 3G13A 4K28A 1CQIA 1CU1A 2I67A 2H48A 3H2BA 4PXAA 4RVOA 5AK3A 5H8WA 5JNWA 2F1RA 2F2TA 2ORVA 1NNI1 1QCDA 4GU5A 2GJ4A 4RK0A 1PU2A 1X74A 1XCMA 2W6IA 3OLQA 3C3YA 1N2ZA 4HUQB 1XJ0A 3FFWA 4JLDA 2ALJA 4MWOA 3RC1A 4BVEA 5HCNA 3FPEA 5HG0A 4QARA 4PLFA 4A91A 1RNLA 3TQCA 3H2IA 1R4NB 2ZVJA 3P2JA 5LB2A 2I4OA 2ROQA 2AFIB 4JBYA 2VSXA 3NOVA 2OT3B 2V8BA 3GL9A 2PFSA 1IBLB 3JPWA 3N05A 2OZEA 3PT9A 2RJNA 1JIKA 1ZD1A 1ZHFA 2YH2A 5EWMB 4DG5A 4PAQA 3A1DA 3KOYA 1VGVA 3ZLUA 1WD5A 2ACEA 3PRHA 1J7JA 5DN6D 4UM9B 4RTJA 2HF8A 2Q9BA 4JLVA 3HXTA 4AMZA 2BGUA 4P54A 1NMSA 1V1JA 2R8ZA 5FQNA 3QEOA 2FWNA 4ILEA 5H0IA 4EKNB 3TLJA 3IR6A 2XF2A 3C8ZA 3BWYA 2JH3A 4LJ7A 1C0EA 1T0PA 2QMUA 3LP5A 1TC2A 2AFRA 3L93A 3O6VA 5JE8A 7ADHA 1XD2A 5DM2A 3DCYA 4OL9A 4EF6A 2P6RA 3OTIA 1RPNA 2GJSA 5IASA 1JHZA 1BRTA 5AQ1A 3CCFA 4JB8A 3EZ9A 4C6SA 1XAIA 2E6UX 5ITZB 1TT5A 3P0IA 1NN5A 1KMCA 1T8RA 2H1SA 1S3IA 3IAEA 3AJ8A 3R7BA 1D1QA 3HRHA 5B37A 1H3NA 3L6DA 3KYDB 4IXMA 4UBOA 2A7XA 3DKPA 2H85A 3KCNA 2CHFA 3D59A 4PEVA 5AW3A 1QFYA 1EDZA 3MF4A 5BW8A 5CK5A 1QK4A 1MOPA 3CMCO 1LPNA 2QN6A 3NKFA 3G17A 5DBIA 5M5BA 5AKYA 3FDXA 3G5TA 3L6EA 3IUMA 3AEUA 1DEHA 3BXEA 2DM6A 4RO0A 2FF5A 4BTLA 4MO2A 4L2IA 3ETEA 5HMLA 1C81A 2KI5A 4PFQA 2H65A 3PCXA 3GRCA 1WSDA 2C1EA 3HJBA 4FGUA 1PZMA 5ALNA 4EEKA 4EMTA 3G2MA 5KWVA 3CLUC 3ONDA 4B4DA 4CM4B 5KYYB 2TRSB 1N92A 3OT4A 3LC1O 2YY5A 3PGLA 4K2AA 4EJMA 2VHZA 3NKVA 5C2JB 3U17A 4UMDA 2JIDA 4JAVC 3P4XA 2Q9CA 1BFUA 3JVEA 3CRZA 1ZA1A 3ZZ1A 1EUCA 1U2SA 1HNZB 3ESYA 4BNHA 3EIWA 5FDFA 4EHFA 2IPAB 3I9NA 4HG2A 1T35A 1Y3IA 2WZQA 1G2PA 3ZVKA 3MAGA 2O20A 2YW9A 5DYGA 4AX4A 5JMOA 1EUDA 3UWPA 4TTPA 2C4NA 4FFRA 5ALHA 2BP7B 2Z4TA 5LBUA 3HWWA 1WB6A 2YL2A 4UW9A 4QJ4A 3R0ZA 2C2ZA 1F8XA 1MIOA 1P61B 2WSMA 3HCNA 1UODA 3KIPA 2EKBA 3DVAB 4HH1A 2BEWA 4RV9A 4TVSA 3ETJA 4ZYZA 2YIVX 1T1GA 2QTCA 4I4CA 2HV9A 1TD9A 1RAFA 2QMZA 2QR5A 3UICA 2M32A 4N0PA 4UUQA 1DMRA 3IXLA 1D2HA 3UB3A 4JLWA 1W36D 1BJRE 1DL5A 1E5VA 1Q1QA 2B7BA 4HN2A 5AUQA 1KDVA 2CJXA 2OO3A 5AOBA 1GM5A 2V3CC 1KETA 1E62A 3DLPX 3GN2A 4RPGA 1A1VA 1FYWA 2PZFA 1CUGA 1LC3A 2FZKA 3KXLA 4DB2A 1VPDA 1YCDA 3NONA 4NKRA 4BMSA 5B7PA 2V7VA 1TGVA 1LA2A 4PO9A 1FDUA 2ZBEA 2ZGVA 5E1BA 3FYCA 3KLPX 1P5RA 5BVHA 2C42A 2WFMA 3KL4A 2BKXA 3LH5A 3RUDA 3JAKB 4EYQA 5CYGA 4RSGA 4M36A 3I52A 4HDKB 2GZ2A 3RREA 1JEYA 5SZHB 3VYRB 3O3MB 3PC8C 5C4IA 1JFRA 1M6HA 4YI5A 4Z0PA 3BSYA 3L3BA 1WXIA 1KHTA 5B3JA 5KB3A 4KNYA 1DAPA 1V39A 2PZAA 1ZM9A 1GR0A 3OX1A 1QHFA 2H08A 3P5SA 3FLEA 1PEYA 4KN6A 5SY6A 4QYIB 1D0IA 4BAGA 1E7QA 1B0AA 2C4UA 1H6AA 2EW1A 1G41A 1T5IA 3OP4A 3GD7A 3CNOA 4K46A 3SM9A 3WO1A 1L7EA 4QUKA 4D8TA 1N6NA 5IK2D 1J8YF 3U3XA 5ANRB 4B3CA 4K0RA 1T2EA 1A1SA 1IHPA 1TZ2A 2ZSKA 3WTCA 1C3JA 1D1SA 3DL4A 1JQEA 3FDJA 4ODIA 4FEYA 5ESDA 5EWLA 3UMMA 3H2GA 1STOA 3CG0A 1KVUA 1Z0FA 2ZYRA 4RBNA 3GVPA 3OD1A 4YDHB 4FOSA 2Y71A 4Y2JA 3KHSA 5K5EA 4RJ2A 3KVOA 1QFJA 3QYAA 3TQFA 4KFSA 4HX2A 1WBDA 3KTFA 4MP6A 3ON5A 3LTEA 1EGVB 4IRMA 4P2BA 4MMZB 4WOKA 3UAYA 1R3DA 3W2HA 2Y1LA 4CKWA 4J0CA 2OXEA 1JPUA 1XKQA 2AK3A 3ICOA 4HDNA 2OGZA 5BW5A 4CIXA 4IBOA 4LXHA 5D3ZA 4B3RB 3LW8A 2IP2A 3LJKA 3VU8A 1V5EA 1GUFA 5NULA 4CL3A 4J3FA 1W93A 3Q7QA 5JFTA 2OFFA 1WXQA 3O92A 3B53X 1LLFA 4ZALA 1HDZA 1XZNA 5CW1A 5BQ5A 1DQYA 4BASA 4QYWA 4I08A 4R01A 4X7BA 3BA1A 3FSEA 2PLRA 1ECBA 4F3RA 3IKTA 2WWHA 3L18A 2VA9A 1EIZA 3H8SA 2LCQA 3PXAA 2BZ1A 3UCFA 2EIHA 2BBSA 4ZEWA 4DMRA 3F5DA 3GARA 5E8RA 2WPNA 4BZZA 4LTDA 1QZTA 2HQOA 2HNBA 1PR1A 5F9HA 1DNPA 4Q9NA 3PNPA 4H7EA 4WDRA 1TZCA 4GHWA 1VLHA 2G9RA 4YJ3B 1L4EA 4B9EA 5BOSA 3LWNA 5DGIA 2O2EA 4DSOA 4IX1A 4GQBA 1YMUA 1JEQA 2RH4A 6Q21A 1J9EA 3B1JA 1T25A 1QQ5A 4IDGA 3DOUA 1JX6A 3ASUA 3AC0A 2XB2A 3U4QB 3S44A 4U3JA 5IKEA 4R3WA 1DFGA 2HC9A 3C97A 3EH2A 1BYUA 3AP2A 3TNLA 2CHGA 4FWTA 3DE6X 3ZI7A 3AJRA 4QG3A 2XMGA 3JQAD 4I55A 3VR6D 2I1QA 4H1HA 3TQQA 4JLUA 2WM2A 3AI3A 2XYHA 3K0AB 3CVOA 2V7QA 2EJCA 3N2KA 4RKRA 4CL8A 4M1QA 1ZW6A 2XCOA 3DJFA 3ME5A 4EF4A 4R1NA 4IG4A 2ZTVA 2YKGA 4MNTA 4HZUA 1LJUA 2QW1A 1WB5A 3IR7A 4F06A 3AVVA 1TCCA 1HTTA 2ZRAA 1Z6ZA 1I1QB 5KNLA 4EJSA 5K0LA 2LRHA 3C1AA 2ZYWX 3LE8A 1GZ3A 1P2FA 4G89A 4I1VA 1FUEA 4M37A 5LP1A 2QRNA 2J3LA 4BGVA 2FYTA 1CFZA 2JVJA 1K7CA 2FPXA 3VR4D 4QOIA 1DIRA 4WK6A 2ZIUB 1QO7A 2X6QA 1FDSA 4WKPA 3H19A 3IQEA 2VH2A 5JXHA 1NPDA 4QAQA 3CEMA 3KSUA 5AHKA 4YO8A 1QFMA 2H63A 3DEZA 4I99A 3JD1A 4JA0A 3EGEA 3RBZA 5AI8A 1KARA 5A4FS 3AEKB 4BMZA 4A1OA 1P1BA 4I19A 4EY3A 4L2IB 4Z99A 4ALMA 3EEFA 2ODQA 2EZ9A 4GF5A 1SHLA 5GONF 1UDCA 2ZKIA 1G7TA 2CDRA 3KZNA 1LDBA 5AP9A 2QHXA 4HLNA 3RS5A 3WRYC 5DIFA 3W2EA 3D2CA 3PB3A 3S1AB 1RYFA 2QX6A 1OH7A 4KV7A 2IUSA 2Z5FA 4O2AA 2XD9A 3IVGA 1O9GA 2F9MA 2Z2IA 4G4IA 4ZEMA 3K6RA 4NBNA 1BX3A 4M8LA 3K31A 2QLTA 2C3UA 3F98A 1LVGA 1A95A 4AK9A 1B0PA 4G0MA 4ZHQF 1U5BA 5BSMA 2FPSA 5ES3A 4DY6A 1KNQA 4RTQA 4EB8A 1O0CA 4HNAB 1J97A 4WI1A 4PCLA 3A28A 3KWFA 1N9KA 2P7IA 5L53A 2QYOA 3Q87B 4M1MA 3U13A 3NHUA 1W48A 3BF8A 4B82A 5BQFA 1OXTA 3OPMA 4DQ0A 1F2TA 3V46A 3CJTA 4QRDA 4AO8A 2PZGA 1NKVA 4ZOCA 3FX2A 1G3IA 3E7XA 1MIOB 3PUVA 3PL1A 1MX5A 2Y1EA 1DAIA 1GCOA 1ULBA 2BOVA 3EFOA 3IB6A 4GI7A 1SVIA 4QYSA 3HABA 3RFXA 3ITDA 3LD9A 5EXPA 2BW0A 4JJIA 4HV4A 1PWZA 2BEKA 1JECA 2AG5A 4I4TA 3NC4A 2I7TA 1TM3E 1TKRA 5KYVA 4H3HB 4LXYA 3T7RA 1FQOA 5K2MA 2JJ1D 4TKZA 4ZOLB 1ZUNA 3INTA 4G5GA 2OXCA 3T38A 5E6UA 3R20A 2Q4RA 3EQ9A 4BMDA 5LP6F 4RTRA 5IVDA 4JNKA 2IBSA 4UAVA 2OD2A 5JZBA 2RH9B 4J0KA 3OA2A 2Z8YA 2C3YA 4KMOA 1GZ6A 2EBFX 2FW8A 1UMDA 3WGMA 5C8ZA 3VNQA 5BT8A 4MVJA 1G66A 1SHTX 1U6KA 1ZMRA 2ST1A 2CYBA 5B3JC 5BMOA 4UEOA 1CC1S 3OX2A 1KOFA 1QOPB 4YAJA 2XTNA 2Q41A 2NZ2A 3VR3A 4CQJA 4DVGA 3VI3B 1R64A 1DZIA 1QS0A 4JBWA 4LOJA 1NZFA 1XMSA 2G8LA 4LUCA 4MIOA 4Q3OA 4URWR 4V3BA 1CE8A 3H04A 4IUDS 4ZO7A 2VNJA 3GH1A 3SYNA 5KSOA 4GI3A 2P9FA 4YY3B 3L6UA 3M33A 1ML4A 1QLJA 1JG4A 3EXFB 4YJDA 3G49A 3I34X 3L6CA 2A1UB 5BYJA 2HT1A 2IYOA 3NBMA 3VBCA 5FNVB 5GINE 1AK9A 3NALA 4CMIA 5K0NA 1S9DA 1JBEA 3NUGA 1YO6A 3L92A 2YN0A 2DBVO 3ONNA 5LIPA 2HIHA 1V37A 3HH8A 4MI1A 4R6WA 3E3OA 4DQKA 1A4UA 4QOSA 1AJEA 2VHTA 1DBVO 4JWTA 1I6WA 3HZOA 3AJ9A 3HCDA 1KFJB 2YUIA 4H6XA 1YI0A 3TRJA 3RADC 1P4RA 4GH5A 1XCOA 1M74A 2PGAA 3G89A 4L8WB 4NULA 3H18A 3VV2A 4H1VA 1RQ7A 1EFHA 1CG6A 3UAGA 4ESEA 3E3AA 2UVPA 4WK4B 1Z07A 1P6XA 3ZWPA 3DF9A 1H2YA 1QC5B 3VDXA 1H69A 2VUSA 3P4UA 3OWHA 3I6QA 3K72B 3MS7A 2QVCA 3TS1A 5BSVA 1AKWA 4Y8VA 1C2YA 4BFSA 2IZ7A 3I05A 4H0NA 3CEPB 3WVNA 4GPZA 2UYCA 3EVGA 1E2UA 1VJ0A 3ROQA 2VTBB 3MXOA 5JMWA 4Q4HB 2ODPA 5EKTA 1WCYA 5L3SA 1Y8ZA 1XTSA 5IJWA 2AG8A 5JI2E 3I9LA 4US2R 1EGMB 1QIDA 1R5NA 1Z6TA 3A3OA 2ONZA 3LGAA 3VOTA 1FSSA 1I13A 3OO0A 3PWZA 4FSDA 2IOQA 3V9AA 4I8DA 1DT3A 2VAVA 4ZJPA 1XVIA 1Q2UA 2YIMA 4KX5A 5JXIA 3T3DA 1UBOS 2C58A 4WH0A 3A36A 4M0PA 4YECA 5ARBA 3L0IB 1PFYA 1PP4A 3GAZA 4H1UA 3EY4A 3S2UA 2IYPA 1GV1A 1Z18A 1T9AA 3GQVA 2QNIA 4B4VA 3EBOA 1B6RA 1IWPB 2WRZA 2X23A 4M38A 3WP0A 2H59A 3QSGA 2Z4SA 1BHO1 4NEGA 1PT5A 1RTTA 2J87A 2G4VA 5CP8A 3DYIA 4R71A 4EPTA 1K6JA 1KAHA 1VBNA 3IYLW 3MWDA 4GZ6A 3DDUA 1FFEA 1VA4A 1Z88A 4L3WA 3N59A 4N5DA 3CX7A 3NHSA 3COYA 3VO1A 5C8VA 1M2HA 1K5HA 3UN1A 4JL5A 3NGXA 3UMCA 3E7WA 4IO1A 4K3VA 2ZIAA 4ZT4A 3ZOKA 1PK9A 3WAGA 2ZWIA 3VPCA 3A6LA 1OH5A 4I4NA 4OSOA 1QKKA 3WKAA 3EN0A 4UXHA 5FT9A 3M6AA 1BXKA 1FS4A 1RYHA 1MFZA 2ZVQX 3KC2A 4LW8A 1Z4OA 5EI5A 1I4OA 1PSDA 3CW9A 3ZZNA 1HNXB 2O7NA 3RC2A 5DPMA 4DFDA 3UHAA 2DH6A 2W2VA 5A3SA 4JXZA 4NBWA 2JATA 3FTQA 1GSIA 5LZ2A 1I94B 1NBMD 3F4KA 3L77A 3VQTA 4TUYB 4XZ3A 3Q8KA 1V3VA 2D0OB 4O2RA 1C8KA 2X2EA 4I5DA 5HJ2A 3QTTA 4ESOA 1Q0TA 3EWAA 3PTLA 3L79A 5DW3A 4Q7QA 2AI2A 2GD6A 3KB1A 3OQJA 1RKQA 1ZMBA 4JITA 4KZPA 3FFXA 3V8QA 1UOQA 5ABPA 2FQ1A 3GT4A 4KAAA 4DIUA 3Q3EA 3SYRA 3G2PA 4BMYA 4PLHA 1S2GA 2OL4A 2E4YA 2FWBA 4QFBA 1YFLA 4R98A 1C9YA 3T7DA 2PAFA 4YRAA 2NO0A 4AP5A 2ZZNA 2BAGA 3V1TC 4CQMB 3ANMA 1M7GA 1DIOB 2ZBVA 3D31A 5CR9A 4LGYA 3PCTA 4J7XA 4BE4A 2B69A 4RGBA 4MB6A 2RAPA 5CDFE 3R7WB 2A9PA 3FZEA 4Y18A 4IJMA 1ZM7A 3UJ3X 3WWZA 1NUSA 1KE1A 4JBNA 4TMZA 3HEAA 2LUOA 2JIPA 4DCVA 1JIUA 2QL9A 2YYAA 5IU6A 1ND5A 2BZSA 5JNUA 1I0LA 2OLJA 4DMMA 3E5MA 2W6QA 3L46A 3KALA 3GEMA 3LQQA 5JD5A 1U5BB 1E4VA 4YP0A 2B7CA 1A5AB 5TEVA 2VLBA 2IE8A 3ND8A 1XYGA 1R6BX 1YZUA 5EUCA 4MR9A 1ENYA 1HZZA 1Q0LA 1B2RA 2Q0XA 1OLSB 4BFWA 2XVMA 3IALA 5BWOA 3ZBPA 2R87A 1OYYA 3TAUA 1DADA 1X1TA 2IY7A 3GC6A 5JNLA 3F96A 2FFHA 3A3YA 2IRWA 3AJDA 1N1GA 3OZFA 3SEFA 3X1JA 5B4UA 3LO8A 4HXYA 3GFFA 3PUHA 4GX2A 4LMAA 1IAVA 1XDGA 2VZ0A 1ACJA 2P5UA 3K9WA 2PQMA 3HP7A 1NVBA 3PJFA 3PRJA 5L4SA 3FPSA 3U3OA 3HADA 1RYEA 3VJRA 1ETUA 2O8FA 3WHIA 4MS1A 1E9FA 4Y9TA 5DRYA 5IT0A 3INRA 3B7GA 3GVIA 3R7DA 3KQWA 3AF0A 3PR2B 1XQWA 3LQ2A 5TF4A 4CM6A 2Q0HA 1A97A 1O97C 2ZUVA 2BLNA 3ABIA 3I2FA 3L7MA 3NBUA 4YLEA 5CM9C 5FLYA 2O3RA 2HSGA 3BIFA 1TUIA 5EG5A 3DUFA 3U60B 1IBKB 1VBFA 5EP4A 3BRWA 4QXRA 5K8JB 3K8ZA 3HSYA 4AM8A 2CD7A 5BXYA 3HKBB 2EX1A 4RM2A 5K0EA 1P74A 4HATA 4RQTA 4DT1A 2IXGA 1GL6A 2VSFA 3WMGA 5ICEA 2L19A 3M5PA 4KQJA 1OJLA 4KXUA 3ZJUA 4B09A 4CE6A 1YJQA 3G2QA 3HC7A 5T5QA 1FB5A 1Q0RA 1RYZA 2FVXA 3C6ZA 3KVYA 3ESAA 5AXAA 1Q12A 5BR8B 3DB2A 3F3KA 4OVKA 3WBKA 4AJPA 5HW0A 1GRRA 4NFYA 2ERYA 3CH5A 2PWYA 4MUJA 5HIIA 3TPCA 4CCAA 5KKCA 1PJSA 1ADCA 5K0FA 2OV6A 2HHAA 2J48A 4RD2A 5HWSA 3WK8A 3IOBA 3JV7A 3Q7TA 3L7LA 2AN5A 3GP3A 2FLKA 3JVVA 4OO3A 4R3NA 4E33A 5GV8A 4NCJA 5TQJA 1YS7A 2OUIA 1WPXA 1CUXA 1PJLA 2W7TA 5JRZA 4EW1A 3TECE 4RHYA 2Z2ZA 3PEUA 2B5WA 3IT0A 4D26A 1AN0A 3PVSA 1E3JA 2YWBA 1UFVA 3I3OA 4MQEB 2A84A 5I9SA 1JF8A 3A05A 4EG7A 1SBTA 4NS4A 2DPXA 4EUFA 5G1NA 4GR4A 2REOA 4XLTA 1V1MA 1N6OA 5IAOA 2EZ4A 3KXPA 4FNMA 1IBCA 2ZK7A 4U7TB 4DAEA 1GPKA 3KAQA 3VJLA 3RGWS 3S1SA 1KOGA 4DA9A 3D54D 2QY9A 3RYCA 5H68A 1TF2A 2OY0A 4A82A 2G67A 1JJ7A 1Y8CA 4D44A 1CP3A 5JXGA 2O8BB 2DR3A 2RC6A 2VTBA 4MPPA 3H9QA 4JP1A 5F64A 3RK1A 2WG0A 1KI7A 3IBGA 4DMCA 5EZYB 3IV6A 1M75A 3IDSA 3K0CC 5KS2A 1A8HA 2VLIA 2WWVD 3GDHA 4YBRA 1EFCA 1E6WA 2HMSA 1ZP6A 4YMUA 1E9EA 1HT0A 3H13A 1I5OA 1J0AA 4NCHA 1DUVG 1HYGA 1KZ4A 3WMWA 3GEDA 5KIAA 1C8BA 4GMGA 4CU5A 1ACMA 1IZZA 4KBYA 1IHYA 3O5AA 1N6PA 3L0ZA 2IZ6A 3AUUA 3LX4A 2W2NA 4CKBB 4CV2A 5KTNA 4DV1B 5A03A 2JGLA 1W7AA 3G0HA 5E1MA 4U2FA 2I8CA 4MWCA 1LB1B 4Z8XA 3GFSA 1FMCA 2BFEA 1FFGA 3MJSA 3HPQA 3LVBA 4GXQA 3TUIC 3ZWVA 3BD7A 3LKZA 4DSZA 3LBIA 2QTBA 4PNPA 4ZREA 3ZD6A 3QKSB 2FJUA 4R6XA 3I2HA 4EHBA 5DGXA 1RIFA 3FNIA 1A5TA 2Q5CA 1P9RA 4GE3A 5A02A 2P1DA 4OGLA 2PUDA 1OZHA 5DK4A 1Y5IA 1E9VA 3IOCA 2FSFA 1G4UR 4RVUA 1WXHA 1CY2A 3D6AA 2XOKD 4GQAA 4JVOA 4WMLA 3DMFA 2NO9A 1E77A 3FRJA 1GTL1 1M2OB 3T5BA 3W5BA 3IKVA 3JX9A 1JZSA 4GZLA 8GPBA 4Z86A 2PJDA 2XIQA 4UFNA 2F3TA 1YAHA 1N2BA 1QRSA 1NLZA 3TIVA 1EUQA 3A1FA 2NXCA 1U0TA 4JYCA 2CJFA 3CF4G 3S27A 2RGBA 4G5YA 3K1AA 3VJKA 1A4XA 1SBCA 3PFIA 5H82A 1GGHA 2JGMA 2V7EA 3DKIA 1W581 4IZHA 3REQB 4JLSA 1EQUA 3D4NA 2D00A 3QP9A 5JWHA 5JC8A 1NHGA 1A3CA 4EMUA 2X4IA 1XA0A 3C5VA 5ALKA 5AM5A 3VX3A 3OEEA 4HMOA 4PZEA 4HLQB 2CE2X 1Y3AA 1D7AA 3E5RA 4W1RA 3ICEA 2GX6A 3D3EA 2WC1A 1RHJA 5A3VA 5DI3A 2NADA 2V7XA 3FR7A 3ROKA 3KJGA 5DWDA 4DIFA 4BLWA 4D7AA 4GKAA 1N3BA 3FYHA 1V5FA 4UQLA 4UHDA 5TDHA 5A2QA 3MZ0A 4OL0A 2G0TA 3DMTA 4GDFA 1CXZA 4RF4A 4DZRA 4YJ3F 2G1AA 3MCZA 4UBIA 2RKBA 1G4HA 1QFSA 1X7WB 1ZK1A 2OGWA 1T8WA 3KJEA 3NTLA 4HRVA 2VPZA 3WIVA 1E61A 4IZOA 4KI7A 1XDZA 1ZUWA 2PT6A 4G56A 1VSTA 2DPMA 1N9GB 3MELA 3SSAA 4ZVPA 2P1RA 3WK9A 4QHSA 3C87A 2ZIXA 2X9LA 3IGFA 3T1TA 3ZX5A 4AC9A 3HR4A 1U81A 2GFIA 1QNFA 3NP7A 4GLFA 4OTZA 4UNPA 4ECEA 4WJLA 1CQIB 1RZRA 5G53C 2XUQA 4Q3AA 4BNTA 1Q6ZA 1ETHA 4CIYA 1TU3A 1Z5PA 3A37A 2VF8A 2VQEB 1RLTA 2EEPA 2A2ZA 2G09A 5ESXA 1HRDA 3P2IA 4ZQCB 4F2GA 1M5RA 5FJIA 1UFKA 2YV2A 1B7GO 3ZV6A 5A2GA 1RFGE 2B0JA 1DKLA 3F47A 1R15A 3ICCA 4XIYA 5DRTA 3TLGA 5JALA 1JGTA 4UUNA 4AMYA 2F8MA 3NV7A 3PGJA 3SZGA 5CDTA 1JE0A 2C84A 5LN1A 4EI7A 4CL2A 1XTUA 1U9IA 3F5SA 3CURA 5L51A 2BHTA 2ENUA 1XLWA 2R65A 3QBEA 3DUFB 3W6OA 1T1JA 4WCFC 2JGDB 4PYJA 1QH1B 2I3AA 4N03A 2J0EA 2OFOA 2RHBA 3TZCA 2G1UA 4E4YA 4RAQA 5JDIA 3SDBA 5FOXA 2AKEA 1E7RA 3F7NA 5AUPB 2CJWB 1UC9A 4R2XA 3HYSA 2W6MA 5JS7A 2KS6A 3JSXA 2ZJ1A 4V0SA 3VR5H 5FLXA 4S0XA 4DR6B 1UJ2A 1NW5A 4BMVA 2RARA 3TVDA 5EQDA 3L4JA 2R6HA 3CSDA 4CBVA 4MA4A 3ZIAA 4EPRA 1AMUA 3QX3A 2QTHA 3ZS9A 4UTVA 1PEDA 5AR1A 1U1FA 4L3VA 3G02A 1U2GC 5BPHA 3EVCA 5JRDS 2FW1A 3IBYA 3NHLA 4AAYA 2NV6A 1YQUA 2QIOA 3VC7A 3CW2A 3ZBTA 3GRAA 3WRXC 4YJGA 4XQGA 4WPGA 3KYDA 5EXDA 5A6VA 3AYZB 3WTBA 4C1NA 2FGJA 2QZSA 4F97A 1QHHA 4MYHA 2OA0A 3VU0A 3U19A 1NJ8A 2EW2A 2B1IA 3N2GB 3O9VA 1YR2A 5DTJA 1U3FA 1AG9A 3AFIA 4QXQA 1J42A 4JGIA 1EWYA 2DSNA 1Q7RA 2X8LA 3FSRA 1ZQ1A 1XL0A 4GYWA 3ZXUB 4MQFA 3S8YA 2WWGA 3DLTA 3O90A 3R2JA 3CLSC 2CL6X 1DAOA 4HAWA 3TG8A 2D3TA 1BA2A 2ZSIA 3AERB 5HPYB 4HAOA 4I50A 1SEVA 2OC4A 5BOVA 1QAOA 3UHJA 1CUVA 1OPRA 1PT8A 1P6QA 3AQ4A 3F5MA 3W8NA 3I9KA 3ZV5A 4JROA 4WESB 4M7PA 3O3CA 5CDYA 1GR1A 3EPRA 1DBSA 2AG1A 3G9XA 3PNYA 1UK7A 2EF0A 4RA9A 4BX3A 3DG9A 4FT2A 1ANKA 2RDMA 4JASB 4FFWA 4IMPA 1LW6E 1NRWA 4ZAGA 2FWIA 2BMFA 4WCFA 3ZVRA 1MB0A 3L7JA 5CXSA 2EXXA 1R5BA 1ZOOA 2P2NA 2XMQA 3L0PA 3DE4X 4FLFA 4XWYA 2VEOA 4B46A 3ADBA 1SC6A 3H5WA 3HLYA 3TQHA 2FI1A 4R9RA 3WK7A 4UARA 4B6SA 2B61A 4DYHA 2HU2A 1EHCA 3LDHA 3AHDA 4ZVKA 1MAVA 4I3GA 2NU7B 1G16A 1LJ8A 2TMKA 1TPYA 2DT8A 2YMLA 4TWBA 3RD5A 2I65A 1IN5A 2E0IA 4J4TA 4Q93A 2IV3A 3MS2A 1CS0A 2QMEA 4URFA 1MBZA 4NVRA 1ZM3A 2FOIA 4JI4B 5LSAA 1WNFA 1P45A 2D13A 1S3FA 2WUVA 3FF1A 3ZWAA 2JDIA 4DMUB 5CITA 4BEVA 4IG9A 3IDQA 2ORIA 3GVCA 5DHSA 2BGTA 2BT4A 1DS6A 5KJ6A 1KQGA 2GEKA 3Q5EA 4GEGA 3K0KA 1P2UA 1ZMXA 2H2AA 1H0HA 2OFXA 3ET4A 4U5QA 3E1KA 3O2QB 5TF0A 4EBFA 3LFUA 4D8XA 1T0IA 2RHHA 2CLHB 2XWPA 3FJYA 3HVUA 4GG1A 4RPKA 5E9AA 1TF5A 1KMQA 3KCQA 4OHKA 3RBXA 3NM4A 4JJGA 4JQYA 1AKVA 1Y8AA 4FILA 1UPFA 5AKKA 1RDFA 5SY9A 5EKUA 3TOZA 4XWOA 2VBCA 5EL0A 2ZR7A 5ALIA 4CZ2A 2ODAA 4UJ5A 3EZ6A 1C9DB 1X6VA 5EJ8A 3E9CA 4B47A 4LWPA 2HDOA 4P22A 4PN3A 1XZQA 2I1LA 4G97A 1NI4A 3NHYA 5I5EA 2XA2A 2ZRKA 1FFHA 4MUGA 1Z5WA 2VTEA 1RM5A 3G2IA 1X2EA 2R751 3CTMA 3HMQA 3ND9A 4QBTA 1C9KA 3TRIA 2KJQA 3G7NA 5C80A 4AJLA 1QQBA 2A3RA 4GI2A 3CH7A 2XOXA 1TJPB 2B34A 2BHNA 2JI4A 3VO9A 4BO4A 1N7JA 2WMNB 1NDUA 4OHCA 4F3NA 1DIGA 1M66A 1X1CA 5FADA 5C51B 4J16A 2IX3A 3HB4X 5F4BA 1VJ5A 3FPBA 4GYJA 4BWVA 4DARA 3ENWA 3WL8A 1RVV1 1ZOPA 3FPLA 2J07A 5KQMA 3DZ8A 3JQ9A 1II0A 3OPYI 3AHHA 4U00A 3ZWBA 4XFJA 2D0DA 3EVAA 5IKXA 1GL9B 3AILA 3FWHA 5KJEA 1Q57A 5HNKA 5J2TA 1UADA 1GQ2A 3ZCXA 5F7OA 5DYWA 4JJKA 2AZMA 2MSCB 1NKTA 4TXLA 2ZRCA 3FPJA 1ZZGA 3HV2A 3GQBB 4UBJA 2C8VA 4E22A 1IN1A 3OMWA 1DAHA 1RU3A 3M6IA 5JVDB 1OGIA 1AMOA 4AJ1A 1Q0SA 1RJ9A 1VIAA 5GP1A 5JZMA 3OESA 2IUTA 3NVKI 3B2NA 4OI4A 3AUXA 3BQNB 2ZDGA 2VHJA 2D06A 4Y1FA 1EE2A 2VP2A 1ZJWA 1K5DA 1WHTB 3DP9A 1X2BA 3D1JA 3IXQA 3QVGB 4L7VA 1ZRSA 4X1IA 3TIXB 2YFHA 4AWXA 1A9SA 3TI7A 5GM2A 2GXQA 4R81A 1XL1A 4MWEA 5DMHA 3PKZA 1U2DC 4LZWA 3EHDA 3UJPA 3MEQA 5AKXA 4R68A 5AKZA 3WS7A 3FZYA 1Q21A 2EKDA 1U98A 5D3MA 3UNXA 4V0NA 3WLIA 4WACA 2MHCA 2RGCA 4Z5XA 1YZTA 4JI5B 1NAHA 3FWZA 1RRFA 3BXGA 2FFRA 4GL4A 4K9DA 2ORED 1QWOA 3BCHA 3RHFA 4GP6A 3NATA 3PJGA 2V7QD 5EMNA 5AUNB 5IC4A 5ICMA 2E85A 2GRAA 3N39C 1XTBA 3FB4A 1F3OA 3HNRA 3WLTA 2VYQA 1DXOA 2E7ZA 1R6XA 5BN5A 4UVGA 4I6JA 5CLIA 5CNJA 3MJCA 3HYLA 2BBTA 5JPDA 2JJ2A 2CJWA 5JNVA 4CCYB 4LMRA 1IATA 4JIGA 2H11A 3QELB 3U62A 4B7XA 4F2WA 3PK0A 3LVRE 3OF2A 4K6CA 4P2GA 4FHCA 4Q39A 3KZXA 3HL0A 4F72A 3T7CA 1GPWB 1OOEA 3H1BA 1I1NA 2VT3A 4AJJA 5EZQA 3B6EA 3LOUA 4G5SA 1H0SA 5JV5A 2DWQA 3AOGA 4GPBA 5EJ4A 4QULA 3FRHA 5T3UA 4EJSB 4BUCA 4EJ2A 1P62B 4RH0A 1IZ8A 3NDBB 2OBFA 2QRVA 5E4FA 5BOSB 4RTLA 2P79A 2ZT7A 4REQB 3UVEA 2VPYA 1ILEA 2FR8C 1W0JA 2FPMA 2WE7A 3E8SA 3G7UA 3H5LA 1QZ3A 3IP6A 2H2DA 2AMVA 2IHYA 2NXWA 3GVXA 4PG5A 5HRAA 4LN1A 4PQEA 4Q4JB 4LXTA 1N4AA 2CL7X 2GD1O 2JCSA 3HB1A 4Z49A 3P9KA 3GXOA 2Z56A 1G5PA 5E38A 1UMCB 2XJ9A 3DB1A 1X7DA 1E6MA 5A6SA 5L6LB 2A1TR 3PHBE 1V1RA 2Z6VA 3UG6A 3DBRB 3HB0A 4XGRA 3WYEA 4POOA 4WFIA 2QTTA 1SM4A 1PQPA 2Q4DA 3GV0A 1W29A 3CW8X 3K2EA 3TN7A 2FPIB 3QMVA 4O2AB 1AA6A 3HU1A 3BZWA 3RGGA 4FDUA 4MW5A 2YHAA 3RSGA 4G1CA 1PBNA 3ASVA 1J00A 1KAMA 2OHIA 4IMRA 2FPOA 1Z6AA 4M8KA 1X7XB 4TLMB 3KBBA 4WFJA 2F64A 3ZGZA 3G2HA 2ZUTA