5EZ6B

Crystallization and preliminary x-ray crystallographic analysis of a small gtpase rhoa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
179
structure length
179
Chain Sequence
AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 64
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ez6B00
3H0KA 2BBWA 2B6HA 2DB3A 2CEAA 3E5HA 1IXZA 3I61A 1WDTA 1EXMA 3FWYA 2QM7A 1G291 1CEEA 2GHIA 4JBXA 4ASUD 3KKMA 3QXCA 2MMCA 2QI9C 4US1R 5JS8A 4AYXA 1IY2A 2QTHA 5G3ZA 1Z5ZA 1GNRA 4ILEA 4M1MA 3QXXA 4Q19A 2QG6A 4KI0A 4ZKDA 2JDIA 1XEFA 4TLEA 4EDHA 4BGDA 2J3EA 5CITA 2BKUA 5EXSA 5F9HA 1LF5A 3EAQA 1VECA 2WWXA 5FTMA 1P2TA 1HT1E 1ZNXA 3EZ9A 4Q7MB 3DL0A 2LKCA 4FCWA 4ZIRA 1JPJA 4OQNA 3PUXA 5GVRA 4BASA 4ZKEA 1E32A 1I4DD 3AUYA 1E79A 2O52A 1XTKA 1E2HA 1S9DA 2AFHE 4MKIA 1AKEA 1JEEA 3AQ4A 1W44A 4C0HA 2UKDA 2VQSA 1PJRA 4LYHA 3B85A 5D3QA 5E7JA 4JT4A 4L5BA 5FPYA 2NO1A 2RGDA 1T3LA 3U3RA 5TDHA 1KMQA 4B2PA 2AKAB 3BS4A 3KX2A 3ZH9B 5FPKA 4GDFA 5L3QA 4TZ0A 2QMOA 3KJEA 1TQDA 1U0LA 4PHGA 1UFQA 2DFLA 2UVQA 3WNCA 3TMKA 3W3ZB 2OCAA 2WJYA 3M1IA 2JLWA 1ZINA 4IVQA 1X86B 5L3QB 1Z47A 2AK2A 2DWQA 1GL9B 5SZJA 4D4KA 4DUGA 1K5GA 1D8TA 2H92A 4PZLA 2Q9BA 1W46A 3P26A 2WPDA 4TYPA 3W5IA 4DT1A 2ZI3A 1GNPA 4P4UA 1OYWA 1G20E 4DJTA 3ZLJA 1S4QA 2GESA 3KB2A 2F1JA 3C41J 5JWRA 4JT2A 4DT1B 2ZI6A 2DHRA 4C2TA 2H57A 3IDQA 3UG7A 4US0R 4HUTA 4JIMA 5HZHA 1XF9A 5J40A 4ABYA 5BN4A 3U3KA 1DAIA 1RRGA 3CF2A 1U9IA 5DI3A 3M6AA 3SFZA 4IOKA 1II0A 3SC3A 4EPRA 3NH9A 3B60A 4TQAA 3LH5A 3SJAA 3ZQJA 3ZZTA 2XITA 4IOMA 4MYUA 1NN0A 4RFSA 2GWHA 4RY2A 1GAJA 4A15A 1W47A 2ZYTX 5TY0A 4DLYA 4AY2A 2ZVPX 3U6KA 3U6BA 3ZVRA 1KZ7B 4JL6A 3I72A 4M0LA 1CJKC 2ZS9A 3T5DA 3T61A 3R9WA 4KFRA 2VEDA 1NKSA 1TU3A 2F7SA 1CU1A 3G82C 4ZDWA 1E0KA 3DHWC 2KSQA 3CF6R 4PSVA 1OIVA 3BRWD 1CULC 3LXRA 2GXUA 2WIAA 3X1XA 1GVNB 3LD9A 2A9KA 1ZD8A 2GETA 2IS4A 2MMGA 4DIEA 4B34A 4PO1A 3NDPA 2G9NA 3RYTC 3RNLA 2KI5A 4BFYA 1R5OA 3IEUA 4Z8XA 2YWEA 5HZKA 3BK7A 3UMRA 1DOAA 1RJ9A 1NJGA 3EZ6A 3DDCA 2W6JD 3NDBB 4PAMA 1G19A 1JR3A 2JJ1D 4G01B 4Q18A 1JXMA 3W6PA 1YR9A 4V0NA 4BFUA 3PUVA 4F93B 3GEEA 3PUWA 1QF9A 4XIGS 4EPTA 5KPJA 2C95A 1E94E 3GLHB 2W83A 2BHRA 2FOLA 2QENA 2WKPA 4YQFA 4EAQA 1L2TA 3EX7C 3DO6A 4NDZA 1SVLA 1TL7C 1G5RA 4LYAA 4DKXA 2REXB 4NCHA 2IUSA 3VKGA 1OSNA 3HR7A 1YRBA 3VFDA 1JXOA 1NMXA 1KKLA 1BH2A 4FMDF 3R9IA 5DN6D 1O3YA 2UZ3A 1D2EA 2CE7A 2WWGA 3LY5A 1S3SA 2R9VA 3AVPA 1OHHD 2Z5FA 3QBVA 3LVQE 2OZEA 4TLCA 3WBKA 3QIAA 2YV5A 4KLZA 4IOJA 3TLXA 4L9SA 4BEBA 2GAAA 2PT7A 4RSGA 4XWKA 2FFAA 1ETUA 2QU8A 1Z6AA 4JVNA 4KV9A 2B21A 2ZE8A 1HQCA 5DHAA 1FOEB 2GJAA 3TUIC 4BLPA 2QROA 2WV9A 4AKGA 3QF4B 2YC2C 2BV3A 3EZFA 3RWOA 2ODEA 4HEJA 3T34A 2IXGA 2GXSA 2OBMA 2AK3A 4LJ6A 4QBFA 1H8HA 4G0NA 4LC1A 1B23P 1P9WA 1XTRA 2R6DA 1G7TA 4DDTA 1ZNZA 2X8AA 3BB4A 2W0SA 2JLUA 1YQTA 2FPKA 3H4MA 1NMYA 4MDEA 3A58B 1Q1ZA 2VHUA 2FGKA 2J0UA 3KQHA 1KAOA 2XXAA 1E1QD 1VYTA 2O8DB 3DOFA 1NLFA 4HLUC 5B57C 2OG2A 1XEXA 5L3SB 1XZQA 1LF0A 5H70A 2OCBA 4RFVA 2J59A 1S8FA 3FYHA 5KSPA 4TLAA 2ZRHA 3IBGA 4PSKA 2ZJAA 5D3MB 3D6TB 4RD6A 2QMHA 5HTKA 3H1TA 4OHZA 3W34A 2RHMA 4LC0A 1R7RA 1Z2CA 2B8TA 1WQ1R 1U94A 2FN4A 2HV8A 3C4JA 1G8FA 4NL4H 1OH8A 4FMBB 4EQ6B 4MRRA 2WVJA 1ZBDA 3DZDA 4NYJR 1HY3A 4ZO4A 2CVHA 3KFXA 1ZJ6A 3R7WB 2H17A 3TKLA 3AVOA 1FQKA 4MKHA 4Q7JB 1KIMA 4LGMA 5FBVB 3KKQA 4EPXA 1N6KA 3THYA 1QG2A 1N0UA 1HEIA 2N1BA 3K0CC 4WOPA 3MWLA 4PZZA 4M9ZA 2ZRKA 3CRRA 3QPUA 4BFVA 2QT1A 4B32A 5IDVA 1AZSC 2WM9B 2VP6A 5LBIA 4PANA 3VR1A 3N2EA 4FCVA 1W4AA 4Z1MA 4AI6A 1Z08A 5CDFE 3ZZ0A 2YOFA 2OILA 3QUSA 1H8ED 4C0JA 1G41A 2OLKA 3BOSA 3X1ZA 1N6OA 3CNLA 5CLQA 4LJ7A 1ZU4A 1WBBA 3NC0C 4JSYA 4LHZA 5DYGA 2ZJBA 1YKSA 4S2EA 5BW8A 1IAQA 2C2HA 3VKWA 3HWSA 2GILA 4OHWA 5FTJA 4KJZA 4L16A 4NCKA 1P75A 4HZIA 5BQ5A 1CR4A 1N6RA 2ZUCA 2ASEA 2QY9A 1T5IA 2REOA 2OAQ1 2ZI7A 1RRPA 1AGPA 3KB1A 1FL9A 2UZIR 2V8OA 2SHKA 5IRCD 2RGGA 4Q4AB 3QG1A 3MGCA 1UEIA 1A2KC 3K0FB 5EE5B 4DCTA 1OH7A 2BEKA 3AVWA 1E2NA 2CL0X 3CB4A 4TN1A 3D7MA 2BJWA 4QM7A 5EZ5A 1RRFA 1U8AA 2PZFA 4DVGA 3GLGE 1GP2A 3T1VA 3VQTA 1X6VA 3AP2A 1ZNWA 3OE7A 1M2OB 4AK9A 4NONA 4ZDJA 1X8JA 2A5JA 4UXHA 2NZJA 2CCKA 1IY0A 2WAYA 2RGBA 4C30A 3PJRA 3BORA 3QVUA 4H9GA 4HAXA 4UJ5A 1SHZA 2ZYUX 4UNSA 4RD3A 3X1YA 5KSOA 3OIVA 4Q4HA 1VCNA 3NBFA 4L15A 2WJVA 3O8CA 2GJ8A 2J46A 2QZ4A 3B8HA 4RD0A 2GK7A 1JNYA 1KI6B 1P3JA 1MOZA 3UATA 4HI0E 1JB1A 3RRMA 1XD9A 3SQXA 2V4ZA 3I3SR 4HAYA 4PQRA 3IIJA 3QXSA 4D6PA 1XEWY 1EX6A 2ZRLA 1XJ0A 3KJHA 3K0SA 1GL6A 3X2SA 1RW4A 3EIEA 2D2FA 2GCNA 2Z43A 4F7WA 1E1RA 3DKPA 3BFVA 1JI0A 4IDHA 1ZC3A 2H16A 5AWFC 3FOZA 3GMTA 5FUVA 3R8CA 1LW7A 5IHPA 5CB8A 3WMGA 4TT3D 4O0MA 3WNBA 2RGEA 4EPYA 4ESVA 2CMKA 4GP6A 1KSGA 1EK0A 3PUYA 4OQLA 1F2TA 1EESA 5AJWA 1F5NA 2XOKD 2V54A 4WA7A 3DVLA 5L3VA 2WAXA 4GT1A 5JBQA 3KUCA 4A82A 5F9FA 4RCZA 1F2TB 4RD4A 1XCGB 3UXMA 3THWB 1SXJA 3IGFA 2C8VA 4OQFA 3TW8B 4Q9IA 3RC8A 1MRSA 3QKSA 3VKHA 3AUXA 2GJKA 2VF7A 4HUQA 4HLQB 4FINA 1XXHA 1KNXA 1E9SA 3QKSB 5C1BA 4I1UA 3SI7A 3VR6A 1QDEA 3OEHD 4PHTA 3IIKA 2IHBA 1G7RA 3TSWA 3VNVA 3UANA 2K5UA 4G5GA 1XPRA 1VKJA 2FNAA 3A37A 1QHNA 2QP9X 3QI2A 121PA 2X77A 3B1ZA 3W5JA 2Z0MA 2X1VA 4TQUS 3VX3A 5JI2E 3PEYA 1J7KA 3U4QA 3AP1A 1GKIA 2XNDA 5FI0B 5A4JA 4PO9A 4CRWB 2FSFA 3K09C 3OAAA 3C16C 4Z51A 4PC1A 4DUGD 5CIQA 1CRPA 2KE5A 4CGZA 2Q9CA 4TMTA 3W3AA 3LBNA 3EPJA 2ZM5A 2ZJ5A 2OBLA 3SBDA 1JQJC 3QKTA 2KWIA 4CZ2A 4OQMA 5AUQA 1FMJA 4W7SA 1QZXA 1GRNA 1E2QA 2GZDA 1HE1C 4ACBA 4JKIA 3VTKA 3H86A 1GG2A 2JLSA 1E99A 1IN6A 2F9LA 2B8WA 3QE0A 5JSZA 2ODBA 4NYIR 4ARZB 2PJRA 1DAEA 2YHSA 1BS1A 4PC7A 2D74A 1FPMA 2EWVA 3ND8A 4LHWA 4C0QC 2XZPA 2AD1A 4O2RA 1B0UA 4F4CA 3ND9A 3MD0A 4JS0A 4XSGA 2IBMA 1ZUIA 3SYKA 4WZ6A 3VR4A 4EFLA 5KNCA 4KSBA 2YNMA 4KBGA 4QKQA 4LX0A 5IK2A 4DLSA 1LNZA 1XTQA 4QOSA 4KCGA 3VHXA 1OFTA 1N6PA 2VHJA 4A2PA 1HYQA 4JLJA 5UKDA 1N6NA 2QNRA 4W5WA 2IWHA 4HB2A 2JLQA 1AQUA 3MJRA 1DAKA 2IF2A 5DH9A 4MH0R 4N1AA 1Z8FA 3A4NA 1OH6A 2VL7A 1VCOA 3VR2A 3GLIB 2EWWA 2I4IA 1G6HA 3ASZA 3NTUA 2QMUA 4QHYA 4EFMA 2O8CA 5JHHB 3RRYA 1U8ZA 1P4SA 3ONWA 4NHOA 4B43A 1DG3A 4XTRA 2C03A 2D7CA 1W0JA 4DDUA 5LB2A 5AUOB 2FSIA 2JGNA 221PA 4OK3A 1YZKA 4L8GA 4XWOA 1BOFA 1RE0A 4B48A 4JL5A 4QGGA 2A2ZA 4MA4A 3RRNA 4V02A 1VHTA 2KBEA 3S1AA 3K0AB 4WIAA 2I1VB 3RDPA 4DB2A 2Q3MA 5AR1A 4IDQA 1UEJA 3LDAA 1R5BA 2F1RA 3TAHA 3L0SA 2WSSA 4IRUB 4UKDA 1R2QA 1XEWX 4TL8A 5BYJA 3EARA 5FBRB 2WWWA 5KPDA 2PMDA 3DMNA 1NN1A 3LW7A 3GLFA 721PA 1GM5A 4R2HA 4FXPA 3K70C 1QHSA 2GXAA 2OESA 3CR8A 4DWJA 2XZLA 3KUDA 2PL3A 4M1KA 4P31A 2YWGA 3LVRE 2AL7A 4PO8A 4Q4JA 5EUQB 4XOIA 1P6XA 4ZI3A 4JLVA 5DGXA 2RGAA 3QKUA 1R0XA 3UWKA 2Q21A 3VHLB 3R9XA 3TW4A 4QRHA 3IO5A 3NEYA 3OEEA 3RS3A 4B73A 4IJMA 2V1XA 2PCLA 4PSAA 2PX3A 2YWFA 5CB6A 3SDZA 1KK3A 4DSUA 2IEZA 3QEJA 4KSCA 5BN3A 2GA8A 5AJVB 4TMKA 2QPOA 3QQ5A 4NBSA 1JR3E 1T3SA 4BRUA 4GP7A 2VYFA 1JEDA 4GFDA 1HV8A 3AF3A 1ZM2A 1RKBA 2QBYB 3Q7PA 3LBHA 4IFBA 1NI3A 1E2JA 4Q1EA 2ZR7A 1XTIA 5FTLA 4MUBA 3BE4A 2C9OA 1X8KA 4HLDA 2FE4A 1TAGA 2PZGA 1EX7A 2ZJ8A 3KZ1E 4LHYA 4OK5A 3N70A 2ZQ5A 1Q1QA 2F3TA 2JIZD 1US8A 2XNSA 4F4IA 4V0LA 2P6UA 4EJSA 4TYNA 1W4BA 1KI8A 2O0KA 1OV4A 4Q5IA 4M4SA 4ESHA 3WMEA 4G1UC 3HU3A 4IXMA 5E3HA 1E9RA 2GEDA 2C96A 2XJ4A 3EA0A 3Q72A 2QE7D 4URWR 4X8HA 4X8LA 5FOVA 4DB4A 1WA5A 2E1RA 5KDDA 1IJFA 4JMPA 1G3UA 1FX0B 3A1SA 1II9A 1P73A 3GJ0A 5GJBA 2O8FA 3PUZA 3KFVA 3DM9B 2VF8A 4FIDA 1XFAA 3GJ6A 5GVSA 1JR6A 1KO7A 1OPXA 3BH7A 2P65A 2ZRPA 1CTQA 4NP6A 4BFTA 5J4LA 2FFHA 1DELA 1N25A 2NO6A 3CH5A 4YMUA 2XB4A 3U60B 1QG4A 2DBYA 2XAUA 5H68A 3NWJA 1OB2A 1ZUHA 5SZHB 1IXSB 1L7VC 1P2SA 2GEUA 2NTYC 1MR3F 3RAPR 4R7ZA 1LS6A 1TMKA 4LBZA 3GQBA 1NLZA 2QMEA 2O0JA 2ZS7A 6Q21A 3ADDA 4P0TA 1G7CA 4URUR 3FKSD 5EE9A 3CNOA 1PLLA 3CWZA 4LDJA 1V43A 1P60A 4OYHA 4D2IA 2OCYC 4Z1MD 2WBLC 1E2KA 1AS0A 5FFMA 3KTAB 1TQ4A 1LVGA 3CONA 4XTCS 1HUQA 5AK0A 3U7EB 4LPKA 3WHKA 4DIDA 2GTPA 3HPQA 3ADBA 1L8QA 5G40A 4I1SA 2W6ID 1Z0KA 1COWA 1E4VA 4HAWA 1J8MF 2BIFA 2OV2A 3SEAA 2WWYA 2YOGA 3IPXA 3SZRA 1L4YA 3PIRA 4I1VA 1JALA 2KBFA 2VSXA 1KI3A 3L0PA 5A0FA 3AB3A 1SKYB 4XH9B 4Z8YA 5KUTA 4KHZA 2JJ8A 4GOXA 2NO9A 1UJ2A 3N2IA 3ZJYA 4B74A 4FW9A 4RZ2A 4K8OA 1QHHB 1HTWA 4CEIB 5E7IA 4DLRA 4TYWA 2GKSA 1CJMA 1CLUA 1UADA 2XEXA 3B5JA 4BLOA 1SZPA 1XB2A 1XU4A 4RKEA 4MYTA 4GI7A 3GFPA 4M8NE 5E95A 3OIYA 1NG9A 2L0XA 4LRWA 4Q9LA 4O3MA 2XSZA 1NIPA 3QXHA 1WBDA 1KO4A 1OFHA 4HDOB 5BN5A 1Q3TA 2GF9A 2IWRA 4DRZA 5ELXA 3U2QA 1CBUA 1M7BA 3CZQA 2YVUA 3G0HA 5HE8A 4Q03A 1CRQA 4M2LA 1HT2E 2VP0A 2ZI4A 3KL4A 1NNEA 1KDOA 3MFYA 1U99A 3HP1A 2QQ0A 4Q1CA 3BD9A 1NKTA 3W9YA 1G3MA 2G0NA 1KSFX 4GMXA 4TTQA 4NCNA 2FGJA 1N5IA 4IW3B 4PPQA 2JJ2A 4YMTA 3OF5A 4FWIB 4LYJA 1SGWA 3T1QA 2HCJB 2IXFA 5KO2A 2AFIE 4RJLA 1ZC4A 4WXPA 1DARA 1X1SA 4NKRA 3I5YA 3FMOB 1JJVA 2XTZA 1E2DA 1PV4A 1HURA 4TSFD 3CRW1 4BZXA 4LJ8A 5KSZA 5DO9A 2CNWD 5CK5A 3ZQ6A 4KVGA 4XD7D 5HKKA 4NYIQ 3REGA 4LCBA 1QVAA 5FR2A 4B33A 1C1YA 3W8NA 3ASYA 3BXZA 3CRVA 1G1MA 4D4LA 3ZZUA 2ZROA 4A2QA 1W4CA 3I92A 3ETLA 3GEHA 3TUZC 2IYLD 1D9XA 4PZYA 3EC2A 1AK2A 2FA9A 1AA9A 2ZE5A 3MJHA 4B2IA 1LTQA 2G88A 1Q1BA 3HJNA 1CF4A 2DFTA 2BC9A 5JCPA 3BGWA 1G3IA 2CK3A 3CX7A 1XMIA 3DM5A 2HLDD 4GBMA 1VPLA 1U0HC 2IYVA 1VG0B 2ZVQX 3L8YA 4KBFA 3TE6A 3CLVA 3UPUA 1E2PA 5DIFA 4KITB 1W48A 1Z22A 1ZU5A 4HB3A 4QJ5A 1XD8A 2E87A 1Z6GA 4QGFA 1VMAA 4D81A 1QHXA 4DEXA 2VRWA 1GTVA 1YZLA 4Q1DA 1FUUA 1VHLA 5TB5A 3ZIAA 3CO5A 3GLHA 4QG7A 2QSYA 4XVRA 4Q7LA 1CJVC 2J7PA 4LJ5A 3BH0A 3C7KA 4RD2A 3VAAA 5LPNA 1PUIA 2PX0A 1EFRD 2CLCX 2W58A 4YLGA 4GPTA 2J45A 2WWFA 4BRWA 2Q3HA 3NG1A 2CHVA 1YZGA 3GJ3A 4DZZA 1WE2A 1Z06A 2ERXA 2FJUA 2QGZA 2HF9A 1JAIA 2VIIA 4N3NA 1J90A 5JZVA 4XVUA 1YRAA 1KK2A 1N2CE 4G3XA 3ZGXA 1KO5A 1QHYA 3AF1A 5EE1A 4BLRA 1HH4A 3OFNA 2GBLA 1KKMA 4I4LA 4C9BA 1SXJE 2WJJA 1NN5A 3KJGA 4HLCA 4KVAA 5SZIA 1I4LD 1IN5A 3TUJC 4IHQA 2VHCA 2GK6A 1XXHE 4CEHB 2IYYA 5FL7A 3CPJB 4DSTA 1N6IA 4WXRA 1P5ZB 2R6AA 3IHWA 3QF4A 3FHOA 1E0JA 1OW3B 3J81k 1L4UA 5JJLA 4WVFA 1ANKA 4WZBE 2GCPA 1GITA 5CM9C 1JJ7A 2FF7A 4KO8A 3HR8A 5EXXA 3RRZA 4BFWA 4D0NA 5JLJA 4AWXA 3T5GA 5J4VA 2GDJA 1FP7A 4CVNA 2PEYA 1DAHA 1GIAA 1R5NA 1U0JA 1YZUA 5EP3A 4JL8A 2C98A 2O8DA 2ZSEA 1UBGA 4V03A 1Z0IA 1TEVA 1ZD9A 2ZRCA 5AUPB 3CPHA 2NO0A 3SNHA 5L3SA 2BJVA 521PA 1WF3A 2HJGA 2EYUA 1LB1B 4QBGB 4PQYA 1OXVA 3I8SA 4HAZA 5D3MA 1DEKA 1R0ZA 4ERNA 1KDRA 4B3XA 4K81B 1BMFA 1YZQA 4YXWD 1E0SA 2EVWX 3P4XA 5GJVC 4D25A 4F4JA 4G5QA 4EQ6A 1VG1A 4FMCF 1J2JA 3WMFA 3BBPA 1EFCA 5JI3E 4BFSA 2G1KA 1XTJA 4TWZA 3QG5A 1LS1A 3BJIC 5FOXA 2V6JA 1UKZA 1AZTA 2DWOA 3R7WA 1OH5A 2RKOA 1GRRA 1W0JD 2OO7A 2VHQA 1W4RA 4RZXA 5CYPA 3RANA 1ZP6A 4W5JA 1U81A 4YONB 3CX6A 2NMVA 2GEVA 3ZS8A 2AN9A 1UKYA 2ZREA 4M9SA 3U3MA 3TSOA 3AGQA 4IEEA 3SHFA 3VR5A 1G4UR 2D62A 3ZVMA 2AWNA 1AN0A 2W2VA 3A1TA 2HXSA 1VCMA 1YJ5A 3A1WA 1W36C 4DSOA 4UXIA 3CF0A 4PHHA 2PLFA 1FUKA 4MRPA 1FNNA 3R8FA 3M0EA 1W0KD 2BCGY 2J87A 2BEJA 4CIDA 4CT5A 2DY1A 1TF7A 1KSJA 5JWHA 4FI3C 2NOAA 3AVTA 3U7HB 4AG5A 1XCMA 2IC5A 1HE8B 4ASUA 3SQWA 2XGJA 3H84A 2WOOA 1J70A 2PZEA 2XX3A 4D0GA 2V9PA 2AKYA 2VSFA 3U3JA 4URXR 1KNQA 1KO1A 4A8JC 3FHTA 2O8BB 2V7QA 4QGHA 2VTKA 3FFAA 2WJGA 4IDOA 1ZCAA 2QPAA 4Q4AA 4FN5A 4NE2A 2O0HA 4IDPA 1E2LA 1XBTA 3I8XA 1M8PA 3K0FA 3OESA 5FUYA 3K9HA 1LV7A 2HF8A 4C0BA 5BXQC 5B58C 1YHNA 5KTYA 1AGRA 1AKYA 3TVDA 1R4AA 2RGNC 5J4HA 2RGXA 3PVSA 1T8UA 4LPSA 3ZVLA 4HB4A 1Z63A 4ZV4A 2WMNB 1TADA 3FKQA 4RD1A 1A4RA 4U5XA 3UK6A 4CF7A 1M74A 2O8EB 1SKQA 3GLFE 3NH6A 3EWSA 1T9HA 4P4SB 4Q9JA 1XZPA 2JEOA 3CUEF 3ICEA 4YMSA 2GCOA 2ZS8A 1UAAA 4XWAA 4OI1A 1CXZA 2TMKA 2P6NA 3IHLA 3K0EA 4NU0A 4HAVA 1OKKD 2P0EA 3U44B 5DSZA 1KI6A 2GCOB 5GJWC 4JLKA 2HYIC 4XSHA 5F98A 4FD2A 1IXRC 2QAGC 4PXAA 4JVMA 4JJZA 1E4YA 5EE0A 1RYFA 4TMXA 3GJ7A 1C4OA 2WIBA 4YMWA 3FGNA 5TV2A 2QRZA 3A4MA 4V0MA 3REFA 1X3SA 4NCIA 2FDCA 4TL7A 2N42A 3DEFA 2IYUA 2BMDA 2IHYA 2QL6A 1P2UA 2ORVA 3CH4B 4BWYA 2IEYA 5FL3A 4AD8A 4HZUB 2F55A 5TARA 2JLYA 1Y63A 2ZE6A 4AG6A 2VO1A 1N6HA 2ZRDA 2EW1A 4QXAA 2Q3FA 1XPUA 2J0QA 1EWQA 1E2EA 4YMVA 2AXNA 3AVYA 1Z6TA 1GILA 3TH5A 3THWA 4LJ4A 2EFEB 4E09A 1NBMA 3FE2A 2IT1A 1NRJB 2YINC 4B3FX 2R62A 3ZVNA 2P6RA 2JDID 4BE7B 4HLUA 3WY9A 1E0AA 4LBVA 1YVDA 4AC9A 2HEIA 1RVDA 4KODA 4M22A 2YKGA 1KJZA 3VU9B 1I2MA 4OK6A 2IYSA 2BBOA 2X19A 2IL1A 5HCIA 1U8YA 1COWD 3TQFA 2G1JA 2FPLA 1G16A 4LV8B 4PAQA 1OIXA 3D31A 4Q66C 821PA 1E79D 1GDDA 2GJSA 3VX4A 4X8MA 2GZAA 2IS1A 4OQXA 4DLZA 1IQPA 2JA1A 4R9UC 3SN6A 5AUNB 5JCZA 4DCSA 1GKYA 1DO0A 4RCYA 3K70D 1IN4A 3AKDA 2GAOA 3W90A 3U61B 1VTKA 1ZMXA 3B78A 4N0EA 4BPBA 2DFNA 4Z54A 1J99A 1OYYA 2F43B 1W2GA 1VIAA 4Y0VA 1P7CA 2W6JA 5JECA 1G3RA 1SVSA 2G83A 3CPEA 2Q9AA 3A1VA 2WPDD 3QKRB 2A5DA 5CLLA 2OXRA 2WSMA 2JCSA 2JJ1A 2ZANA 3K9GA 4CYMA 1KY3A 5H1YA 3THXB 1LY1A 2A30A 3GJ8A 4M1TA 3ZYCA 4M1OA 3HU2A 2GNOA 1VDZA 1A1VA 1P9NA 2GXQA 4UNPA 3P4YA 4QL3A 1E2IA 3LBIA 1WMSA 2RB4A 1VG8A 1IM2A 5KHOC 3AVUA 1ZM7A 4TTPA 4ARZA 1DAGA 5CJPA 4H1VA 2ZJ2A 4A4DA 4EJSC 4M53A 1DE0A 1Q1EA 2ZEJA 1FMLA 3HPRA 2FWRA 1ZM9A 1OXUA 3DKVA 1Z0DA 2HDNB 4M21A 5DN6A 4QNRA 1GNQA 1Q57A 1R8QA 3P32A 4DLVA 5DNYB 4E5UA 2JLXA 2AHOA 3GFTA 2EYQA 3MMPA 3NBZC 3FMFA 5C4MA 2A7QA 2CL6X 1RYHA 2C9CA 4A2WA 4JBWA 2AXPA 2Z83A 3Q9LA 3C5CA 3PENA 1G6OA 3MUFA 3EW9A 4JBYA 4MUAA 4WZAE 3X1DA 3B9PA 1EG7A 5KNDA 5JRZA 2ZETA 2X2FA 1G17A 1KO8A 2DWPA 3FTQA 3Q5DA 4KYUA 4M9XA 3BAFA 3WBJA 4Q01A 4XJXA 4EFNA 3GLIA 2Q6TA 2QUZA 2YYZA 2REBA 4JLOA 1KK0A 4IEIA 3TK1A 3LFUA 4M1SA 3O8RA 4I81A 1NVXQ 5FBQB 1YE8A 1MO4A 4US2R 4HATA 2ZSBA 3A36A 1WRBA 1KGDA 1ZNYA 2FEMA 1JAHA 4TMZA 1Q0UA 2NIPA 1E1QA 1YR8A 3CKLA 5F3WB 3K9NA 2DCUA 2OM2A 3TSZA 4II7A 4MDFA 3EZ7A 2ZSFA 1Z0AA 2LKDA 3K0AA 4TYQA 5CK4A 3QJYA 4JLBA 3Q3JB 5KDLA 3GEIA 1AIPA 3CBQA 4C2UA 1JR3D 2ZSDA 2GRJA 2WHXA 1TTTA 2X2EA 4B3GA 5AJZA 1PZNA 4JZKA 3B2EA 4LUCA 1M1YE 1UKEA 2D3WA 1PLJA 4KAXA 1F3OA 1S1MA 3LLMA 1PUJA 2NG1A 1ZM3A 2HJVA 5J47A 5J4KA 4Q02A 2R2AA 3UG6A 1Z0JA 1Z0FA 1TPZA 3ZDQA 4JYCA 2QPTA 4CW7A 5JJIA 1W7AA 1S0UA 2ZR9A 3THOA 3EPLA 2H18A 4TLBA 4GNKA 5JMTA 4A0GA 1E6CA 2G77B 4HYYA 1II8A 4L9WA 1T3HA 3L0OA 3Q7QA 3WYGA 1F2UB 2XZOA 2Q0HA 1II8B 4NTZA 1ESMA 3T12A 3NHBA 3A4LA 3LWNA 2CHGA 4Q9KA 4FMDB 4Q1AA 1P72A 1YZTA 4NCJA 1MABB 5B64A 2FV8A 3E70C 1G18A 4GZMA 1H8EA 3NC1C 1AM4D 2QBYA 3GLGB 3GLHE 3GJ4A 4ZCMA 4GRAA 4DLTA 4QJ3A 4MGKR 1H8HD 2DFKB 1G7SA 4LOAA 2MSCB 5FOWA 1NG1A 1NF3A 1UF9A 1ZUNB 1KJWA 3QBTA 5HPYB 3CM0A 1JBKA 1U9IC 4Q1FA 4OHYA 2WOJA 2ANCA 4MGIR 3QF7A 1WP9A 1SVOA 4Q21A 4V0KA 4AKEA 4C0KA 2ZR0A 5B2ZA 1DAMA 3ECCA 3IIMA 4URVR 1XWIA 4LJYA 3IEVA 4YC7A 1GWNA 3SS8A 1UM8A 3WYFA 5FUXA 3IQWA 4F91B 3KQUA 2XTNA 4PPFA 1KY2A 1FX0A 8OHMA 3CWQA 1G64A 2F1IA 1AS2A 2FMXA 1NY6A 4O25A 4MRSA 5KDOA 5DE3A 3I32A 4AKIA 4B75A 2KJQA 2NPIA 4PC6A 4HAUA 2FZLA 3RABA 2C04A 4BZPA 4P32A 1Y3AA 5JFGA 2IYTA 4GOKA 2FG5A 3MRSA 2RMKA 4B2LA 4C0SA 1XMVA 3CW2A 1W5TA 2ZUDA 3KKOA 5JEEA 3T15A 3P27A 4OI2A 1SVMA 1XP8A 2CXXA 3RLFA 1OJLA 3NXSA 3WNDA 1N0VC 2CLDX 2WZQA 4X8OA 4P33A 1ELOA 3C5HA 3KKNA 3UKDA 1NJFA 4FWTA 1CJUC 1UBFA 3LAWA 3KXIA 2WWHA 4ZDKA 3KTAA 2BCJQ 3LX5A 1G5TA 2C77A 1KMHB 2ZRJA 4AYTA 1OE0A 3VMFA 3IO3A 1XJCA 2QSZA 2A3RA 5JS7A 1NVVQ 1OT3A 3AH8A 1BIFA 2PT5A 2ZJZA 4QHTA 1CIPA 3CX8A 2NGRA 1O87A 2EU8A 1XNJA 1D2NA 4HDCA 5TMPA 2AR7A 4KLNA 5DYIA 4G5OA 4TT3A 2ZI9A 1CKEA 1M7GA 2IF0A 5K8TA 1K5DA 3Q8XB 3RSLA 1A2BA 2F3RA 2YWHA 2V7QD 1FTNA 1XD2A 2XOKA 1BO6A 2GBLC 4ZDIA 1Z07A 1OF1A 1PLKA 4AKHA 1WCV1 621PA 3SR0A 1QHHA 5GJCA 4K46A 1XD2B 3JVVA 3RS0A 3KQNA 4CEIA 2J0SA 5GADl 3DZ8A 3T35A 4DLWA 3GCGA 4EPVA 2B7BA 3BFKA 1NP6A 4QBIA 4ON9A 4BLQA 3RHFA 2D7DA 5EUMA 2NQ2C 2DR3A 4PPGA 2JLRA 1ZM4A 3E2IA 3OEHA 4KFSA 4QHSA 3FDIA 4JLMA 1FW6A 1R6BX 2YC4C 1KTVA 2EQBA 3I1FA 3BFXA 3SFVA 4ZIRB 1BYUA 2F6RA 2BBSA 3CZPA 1GL7A 3JZAA 4UXJA 4TYYA 3OE7D 2ONKA 4RZUA 5FPTA 2V55B 3EPHA 3IPYA 4AYWA 1Q21A 1MO6A 4BEJA 3IUYA 5G41A 1TNDA 3KXLA 2V3CC 2A78A 3DMDA 5BYKA 2EFCB 3ZS9A 5KOYA 3OZXA 3K70B 3IQXA 3WYAA 3EG5A 1YZNA 1RZ3A 2OFWA 2CBZA 2QM8A 2QT0A 1K8RA 1TUEA 2J9RA 1G21E 4EUNA 2MSEB 1TF2A 2CL7X 3BC1A 5K8IA 4URYR 4LJ9A 4F92B 3B82A 1U90A 2RCNA 1OB5A 1K6MA 1NLYA 1W49A 4PR0A 4LHVA 4A36A 5K8UA 3K9LA 1E2FA 2R6FA 3L8ZA 1N6LA 4IFEA 4WAUA 3T1OA 2GJ9A 3EXAA 4GL2A 4UNNA 1E1RD 1KJYA 5JHGB 4F38A 5FUWA 3UMSA 5HE9A 3PCRB 1DADA 1G9XA 4QNMA 3DPUA 1XTSA 2B7CA 3TGPA 1P2VA 2I3BA 5G53C 1DG1G 4UQOA 4V0OA 3AF2A 3TJZA 4LYFA 2OSBA 3MWYW 4ZCIA 2Z4RA 4LSGA 4JYBA 2ZJOA 2VP2A 1MRNA 1NBMD 3TIFA 4UJ3A 1E98A 4KFUA 5DI3B 1A7JA 4DDWA 2ZRGA 3EA5A 1SXJD 3F5FA 1H65A 3AKCA 4D80A 1S9HA 1ZVQA 1YR6A 3W6NA 1SULA 2R6CA 3VR3A 1GRQA 3QPVA 4DC9A 2QTVB 4MITA 4D4MA 1R0YA 1UDXA 5LD2C 4WW0A 2P67A 3K8YA 3K1JA 4N0DA 5C4GB 3T1TA 4JKYA 4QC2A 5G3YA 4C7OA 2JATA 3NBYC 4RFSB 2ZITA 2WJIA 4MGZR 4I1OA 3BB1A 2W00A 3IILA 3ADCA 4MKFA 1OIWA 1R10A 2AX4A 1W36D 1C9KA 1XDBA 3PV0A 4C7OB 4V0ME 3AF0A 3QNUA 1ZAKA 1R0WA 2BMJA 1KHTA 2CJWA 1Z2AA 1AS3A 1T5LA 1UPTA 2ZRBA 2EFDB 3QPWA 5BWMA 2PJZA 2CJWB 4PHFA 1DTSA 2VBCA 2XNDD 4Q7KA 1HQYE 2H5EA 2ORWA 3V4FA 3OAAD 5DI9A 2FSHA 4NYMR 2J0VA 2ZRMA 2G0TA 1EGAA 3TVTA 4IKEA 5C2JB 3PXGA 1NBME 3L2OB 3F8TA 2ZIAA 3QEOA 3WHLA 5KNBA 1S96A 1RJ9B 4M1WA 5FBLB 4CEHA 2BVNA 3SJBA 3B7GA 1SVIA 2O5VA 3BIFA 4DLXA 3LLUA 2GF0A 2ZAOA 3U3OA 4MYCA 4PPNA 1G5PA 3A8TA 3U7GA 4Q1BA 1M6NA 1GZSA 2IYRA 4XVQA 1S1CA 4BUJA 3BH6A 2WICA 4Q4LA 5HCNA 5LDDC 3L0IB 2ZU0C 2EFHB 4JSTA 5H8WA 4RKFA 4DCVA 1NL3A 5FOSA 1RIFA 1TQ2A 3P1JA 1F6BA 2CE2X 3NVAA 1MV5A 4LY6A 4OI0A 4DSNA 2F1HA 1CS4C 3NEJA 3WRYC 3V9PA 4DBLC 4GSYA 4KU4A 3LRPA 2P3SA 1ONBA 2B92A 1DAFA 1R8SA 1NN3A 5FOTA 5IK2D 4U02A 5A5GA 1KZGB 3UWOA 1VYUA 4GZLA 4A6XA 2IS6A 5EE3A 1ZYUA 4MGYR 2ZI5A 5IT5A 1P62B 4TL6A 4IXNA 4QGAA 5FPHA 1IONA 2W0MA 4BLTA 2D06A 1W2HA 4QM6A 3B9QA 3RS2A 1KDPA 1EFUA 4BFZA 1G8HA 3EWAA 1GSIA 2ZYVX 4D0LB 3W8RA 2QP3A 2OBNA 3NHAA 1AJEA 2P5TB 1NVUQ 2R65A 4OJKA 2PCJA 5CJ2A 3AF4A 3PEUA 1JECA 4ITRC 2VA8A 2JIZA 2WWIA 3MG9A 3BERA 4NPHA 1EFHA 1Z28A 1SXJC 2IYQA 3SU8A 2ZTSA 3TR0A 1VG9B 2J0UB 1XPOA 2XXAB 5FOUA 3RVBA 2ORIA 5DHFA 4DHEA 2C9YA 1GKUB 1MO3A 2DYKA 1Q22A 2QE7A 2ZYWX 3OIUA 5JJKA 1E2GA 1XEXB 3C8UA 4E03A 3AVXA 2OT3B 2OEPA 2IUUA 1Z6YA 3LXXA 1ZIOA 5EZ6B 1E9EA 1GUAA 2VP5A 2DPXA 1VCIA 4GMDA 5C18A 2ZSAA 1E69A 4LBYA 1XCPA 2WSSD 4R71A 5M04A 3VNUA 1KDTA 4Y0AA 3AM1A 4MQBA 5EXTA 4RZ3A 421PA 5FR1A 1W5SA 3KKPA 3NBXX 4ZCLA 5SZKB 3TAUA 3RC3A 4GOJA 4E22A 3GLIE 2VP9A 3KQKA 4LV6A 2VLIA 2FSGA 2QORA 2OAP1 4EIWA 3QENA 4LV5B 2O8BA 5B30A 2BKEA 4JJKA 1IN8A 4Q00A 3TRFA 3THYB 2QA5A 4LZZA 1E9CA 3SHWA 2PMKA 2HYDA 1JPNA 3OEED 5CM8B 3ZD6A 4D82A 3FKSA 3RS5A 3O8BA 3EZ2A 1MT0A 2QGNA 5P21A 1CR1A 4U00A 3V00A 4PX9A 1TX4B 1ZRHA 4JLDA 1UKVY 3UIEA 3HYRA 4I99A 5LD2B 5E4FA 4NMMA 3UMFA 4B3BA 3EASA 1M7HA 2V1UA 4B35A 3FFBA 4BZQA 1Q44A 1Z29A 2O8EA 2W6IA 4P4SA 1IJEA 1E3MA 4LBWA 1EFTA 3AKEA 4URZR 2Z6VA 3RWMB 1I4TD 2ODWA 3PR1A 4JVSB 4LK2A 5JRJA 1RRCA 3IKJA 2LCFA 2ZRFA 4CEJA 3U44A 2C99A 4R2IA 1XRJA 3MSXA 2ZE7A 4IOLA 1G4AE 4HSEA 4CEJB 4H1UA 3WRXC 5J4YA 1T4GA 1MKYA 3EIQA 3I73A 2AWOA 3PITA 4A0HA 1A82A 4W9MC 3G5UA 2R44A 1DPFA 5AJXA 2GZHA 1KI2A 4RVCA 3I5XA 2JLVA 2BMEA 1M34E 2JLZA 4MRNA 3SOPA 4JLAA 3SYLA 3GP8A 1OFIA 4O2LA 1KAGA 1KYIA 3DOEA 2BBTA 3AGPA 4HB0A 3M4YA 2FU5C 1NVWQ 2E9SA 1ZW6A 3GFOA 2V6IA 3HDTA 3LV8A 4LHXA 3B1XA 2FZ4A 1T0HB 1DO2A 2QTFA 4NZYA 4QFMA 5DISB 1WB9A 1DBSA 3RS7A 1OFUX 1FZQA 1T91A 2FEOA 4HZUA 2OXCA 1DVRA 5EQTA 3QXJA 4QJ4A 5FBWB 2ZRAA 4MYHA 4A0RA 2VP4A 1G8PA 1NVVR 5FTNA 4JLPA 2ANBA 1G3QA 4ZPXA 3ICQB 1D2MA 1D9ZA 3PG5A 5LB4A 1Q12A 3LX8A 2QEQA 4UNQA 1XMSA 4POAA 1YU9A 4Q4HB 3B1VA 4AURA 1S3GA 3TR5A 4E07A 1E9AA 1UBCA 4IVPA 3CRQA 5TVKA 4TMVA 4KXFB 3SJZA 1TF5A 2A5GA 4A92A 4Q9HA 4C0LA 2BM1A 2RH5A 4YDSA 2QP4A 4J0QA 4YDHB 4ACAA 4JLNA 1D5CA 3VU9A 4TSFA 1NMZA 2RHDA 3F3YA 3JVUA 2H7VA 1QHGA 2CNWA 1CP2A 3B1YA 4XD7A 5EP2A 4A1FA 2IYZA 1TUIA 2ZUBA 1Z83A 2ZU6A 3KQLA 4PFSA 2IYXA 4B71A 2Z4SA 1F60A 2FPMA 2PEZA 3MCAA 3KJIA 2ZJYA 5EP1A 3GJ5A 2G6BA 2XB2A 1E96A 1OXXK 1KI4A 2WKQA 4B6EA 4A9AA 3PEVA 1KSHA 1P9RA 1FNMA 4EKDA 2HLDA 5KSYA 4TMWA 4OI4A 2R6GA 1UDWA 1P61B 2F43A 2NPFA 1RPZA 3ZD7A 2WMOB 2OUKA 1SXJB 2NO7A 1W1WA 1IN7A 4QBHA 4L4UA 4PQFA 2VSOA 2GVDC 3K0CA 3QKRA 5EP4A 4HUQB 3WXMA 1FTSA 4C4PA 1Z6XA 3FHCB 5L8VA 1XXHB 2P2LA 2VHTA 4JVLA 3MWKA 3THXA 1ODFA 4MKGA 1XJQA 4TTRA 2IYWA 3SYNA 2J41A 5L3RA 2IS2A 4KFTA 1X1RA 2XSZD 1KI9A 2OFXA 1W36B 3AVQA 2JAQA 4NH0A 4B6FA 3SBEA 3TBKA 3N5CA 1CR0A 1EFRA 2FFQA 3WP0A 4BFXA 3L43A 1TQ6A 2OHFA 2HT6A 5KYKA 4BECA 1WXQA 2CLSA 4P3YA 1RC8A 4NYMQ 4TZ6A 1U98A 2IXEA 2PLRA 3IBYA 4EPWA 2YJTD 2HCBA 2R8RA 3QOFA 3U4QB 1S2MA 1SKYE 2JJ2D 3B6EA 4A8JA 3A6PC 5JWOA 2XTMA 2ATXA 3BB3A 2H1LA 5E7MA 1IOZA 1EWRA 5C46F 2YZ2A 5F2EA 4PC3A 3B1WA 4B47A 1G8GA 4B44A 4A8JB 3NKVA 1OHHA 4B3DA 4TLDA 3SJCA 3LNCA 1XMJA 3AVVA 1F48A 4WBSA 4M1YA 3JZMA 5HKKD 1PVOA 3X1WA 2P5SA 1Z3IX 2PH1A 2RGNA 2RAPA 1QBKC 1SHKA 2QN6A 1NSTA 5DLQC 2ECKA 5CIWA 1KK1A 3SE0A 5EJEA 5JSZB 1BYIA 1N5JA 2ZRIA 2HUPA 2VPPA 4LWZA 4C3ZA 4FCTA 1IHUA 2FFBA 4DXAA 2D2EA 2FH5B 1KI7A 4ZI2A 3CIOA 5HR5A 1RFLA 2CHQA 2ZXUA 1E9FA 1MO5A 4S35A 2CK3D 5J5CA 1E9DA 5AJYA 2RGCA 2IA5A 2C78A 4BLSA 3GD7A 3LQRA 2ODNA 4OKSA 4DCUA 3KDSE 3GPLA 3D8BA 5JEDA 1N3BA 3CR7A 1AQYA 2CVFA 5CDFA 5CYOA 2QAGA 2QQEA 3E1SA 4UNRA 4LJAA 1GFIA 1I2DA 3Q85A 1J8YF 3ZIAD 3P20A 4M9QA 4YXWA 3D3QA 3HU1A 2J7PD 2QAGB 2OLJA 3RSOA 1YR7A 3C15C 4IVRA 3HYTA 4OJQA 1JQLB 3I62A 3OHMA 4DCNA 3U7FB 2ZAMA 2FX3A 2ZRNA 4B76A 3PEWA 3ADKA 2I1QA 2IK8A 4OL0A 1MH1A 2KB0A 4MRVA 3RS4A 4D26A 2O8CB 2ONJA 2H8KA 3I4LA 2LWIA 5TXGA 2CCJA 4DEYA 5FH9A 1DS6A 2XJ9A 1UBEA 1NY5A 1QHIA 4G5RA 1ESNA 4KYIB 1N5KA 1FQJA 1F2UA 2A5FA 3LA6A 3OFND 3CNNA 1NSFA 4IDNA 1T0JB 2QAJA 5K8LA 1OLOA 2AD5A 2HT1A 2F9MA 3O8DA 1VYVA 1FP6A 1MABA 2Y8EA 3C14C 2J7KA 4NYJQ 4OHXA 4CDGA 2CDNA 2J5XA 4P4TA 1U2RA 3FPAA 3S1AB 1A5TA 5FL7D 2PBRA 2EFGA 2W2XA 4PC2A 3KXKA 5IF9A 3QVVA 4U7DA 1QRAA 3GLGA 2OCPA 2IX3A 3V4RA 1W0KA 2D4HA 1T8TA 4OBEA 2J1LA 3GLFB 4BQSA 2VH5R 2QRNA 4TL9A 2BDTA 2MSDB 1CJTC 4Q47A 3BWDD 1Q20A 1KOFA 4B3CA 1N5LA 4Q4JB 3K53A 4G5SA 4A0FA 2WTUA 3R20A 1XX6A 4OHVA 1IBRA 2BWJA 2IW3A 2WJHA 3WP1B 3MAAC 3W6OA 4TQ9A 1GOTA 3AKYA 4LI0A 2BOVA 4DLUA 5EXPA 4D4JA 1NIJA 4CT4B 3OIWA 4AIIA 1OXSC 3K09A 1FFHA 3LO5A 3CRMA 1HA3A 3MWJA 2HXYA 3Q5EA 1D6JA 1V5WA 1QVRA 1IY1A 5FPSA 3PQCA 3T06B 2BM0A 2NZ8A 4Q48A 1BMFD 5KU1A 3FMPB 1SVKA 2OFOA 4R98A 3EPKA 1T6NA 3LQQA 4C0AC 1BKDR 1ZIPA 4HDQB 3H2YA 2ATVA 2W2TA 3TNFA 1SVWA 1TEXA 3EIHA 4PTLA 3L82B 1VIYA 3AP3A 1CR2A 1X8LA 3LW8A 3FB4A 2YOHA 1ZD1A 1G8YA 4FMCB 3AEZA 3EC1A 4PAOA 2N46A 1OKKA 5FTKA 4DDVA 5ANRB 1E9BA 1US8B 3A1UA 3O47A 4EJSB 1TU4A 2ZPTX 3GJXC 2JASA 3FMIA 3FVQA 2G3YA 1LFDB 2C5LA 3AV0B 3QSYA 4W5HA 1Q3HA 1ZCBA 1SQ5A 1KMHA 2ERYA 1OXTA 3PFIA 3U5ZB 2OE2A 1KI1A 1E2MA 2BMFA 2GVZC 2A5YB 2WKRA 3QY0A 3NIBA 3TQCA 2IUTA 3MLEA 4A6PA 2O8FB 2CCGA 5FI1B 3F0TA 1N0WA 3B13B
chains in the Genus database with same CATH superfamily
2Y1KA 2Y4OA 1RQNA 2BBWA 2AC4A 3E6AA 1XZ8A 4YREA 2CEAA 2DB3A 1XHLA 3E5HA 3IDFA 2C8LA 4QSHA 5CDTA 4J8PA 3C3PA 2NPOA 5ALIA 4N47A 3DO5A 3QFTA 3OLQA 1CEEA 4KL8S 4S3MA 4HVTA 1L5YA 2OV1A 3QVWA 3H3JA 3SDSA 3TQQA 3UK2A 3KRTA 3SPXA 3WV4A 2IBSA 4ITUA 5JS8A 2BFNA 4RZSA 2DLNA 3IQDB 1IY2A 2ACVA 2QTHA 3E9MA 3KPUA 3PX2A 4F9GA 1P3Y1 3O4FA 1AUQA 1SOMA 4A8HA 3O75A 5CM2Z 5E6UB 1PBNA 4TLEA 2OHGA 1I01A 3WFJA 4AJJA 4GC9A 4AIRA 3N75A 4QOHA 3FDZA 3EAQA 1VECA 1X1EA 2WWXA 1DBIA 3CYFA 3OUTA 2EIHA 2GFQA 4FKZA 3W9SA 4YLEA 4ND8B 2JFGA 4UCXA 2H4JA 3CT6A 1X7YB 4FYWA 4RXUA 4ZIRA 3RGGA 1SPXA 1JPJA 3PXUA 3PUXA 5GVRA 2QTBA 5DBHX 1IN1A 2CZGA 3R40A 1E32A 3DXZA 4PN3A 3U3ZA 2O52A 1XTKA 1S9DA 5DM60 4LE2A 4C0HA 1WXHA 2CLHB 2HIAA 5AIAA 2PGJA 1HE2A 3I28A 5D3QA 4GF5A 4AMYA 2TS1A 4KJXA 2FSVA 3MYYA 4N3AA 1BN6A 1UODA 1KMQA 3BJZA 4M8KA 1Q0TA 3KX2A 4CKWA 2OD2A 4O59O 4MHSA 2VSNA 2JGDB 3K32A 3E61A 3EFEA 1E63A 5E3IA 3N7AA 4S1PA 1Z7EA 3WNCA 3W3ZB 2JLWA 2C2XA 3M1IA 3TB4A 1G0OA 3NC4A 4NBLA 1GL9B 1WL8A 1SUDA 5B5SA 5DNVA 4G9EA 5KWJA 3VVMA 3E4DA 1RI3A 1NULA 2L19A 2WPDA 3P26A 2E37A 3D6NB 3LSTA 4MUGA 3V4OA 3I6IA 2ZI3A 2ZBRA 4KN6A 3JWJA 2CXQA 4P4UA 3RYCB 4KPGA 1SRQA 2ACEA 2F1JA 3MCWA 3HM2A 1G98A 4N49A 5ETJA 5IMSA 3WBBA 4C21A 3R6GA 5CNMA 2C4MA 2JFHA 1IOLA 5ITZA 3Q8KA 1MG0A 3IDQA 2ZWPA 4US0R 4HUTA 2CUTA 3BJRA 1DUSA 3SM9A 3A3PA 1PVDA 1XHFA 2QQFA 3IMKA 3LUDA 1DAIA 1G5QA 1QGOA 3CZAA 2YY5A 2R66A 3TD9A 1H93A 5TT0A 1V25A 3QE2A 4KR0A 2D5IA 4J2OA 1T4DA 3FCAA 2H4XA 4NCBA 3M6AA 3IODA 4IOKA 1AA6A 3NLLA 4EPRA 2XDQA 3NH9A 4I66A 3LO8A 2VPWA 5F9MA 3JQFA 2XITA 3ZZTA 4L0CA 4BO8A 1SC1A 1EK6A 1F2DA 1V95A 1CS0B 1PJSA 4IH4A 5F2NA 5I7WA 1PEKE 5MFZA 1NVDA 3ED5A 3U0VA 3T3PB 1GARA 5JSUA 2P2GA 2ZVPX 4UAVA 3INNA 1NQWA 1Y5RA 2ZUEA 2B35A 2AN4A 2XMZA 4JL6A 2HOQA 4BP1A 2P9BA 4A7PA 1D07A 3J7TA 2VEDA 1R6DA 3WXBA 5IEBA 2F7SA 1CU1A 1KKUA 3HCOA 4ZDWA 3FD8A 2BFDB 1ZK3A 2KSQA 4PSVA 3L93A 1WO8A 2R6R1 4I9NA 5I4KA 2WE7A 4FYJA 3AEKA 3KZCA 3H9BA 4L6CA 3LXRA 3BHNA 2PRYA 3I2KA 3X1XA 4NIMA 1JR2A 2QXYA 2A9KA 4K9MA 5EERA 2BZGA 2MMGA 3MBOA 3T7TA 5HZMA 3NDPA 3DD1A 5F1YA 1EUQA 3EUFA 4HUJA 2G9NA 2D0IA 5BUQA 4JENA 1T2DA 2C4NA 4Z8XA 2JHGA 3UMRA 4RGBA 4Z49A 5DIZA 1DOAA 2WFLB 4P7FA 4WN9A 1SXQA 3BD7A 5CXQA 3ZJTA 5DT9A 5EHXA 4PAMA 1T9KA 5JLAA 5JFTA 2YV2A 2BJHA 4G01B 4H7PA 4Q18A 4MPJA 3G23A 1YCHA 2RJ3A 1C4WA 3P5BA 5KVVA 4AO8A 1HGXA 4F93B 3PUWA 1SOAA 3QX8A 3IEKA 2C95A 4BYGA 4JR2A 3GLHB 4E2FA 4J6EA 3S2YA 3VNRA 1PL6A 3IVAA 4FYHA 1DC7A 5A04A 5FX2A 1UZAA 4OGFA 3EX7C 5A02A 2BM9A 3CA8A 5C37A 1V37A 1E3WB 1EQ2A 1SVLA 3QU9A 1R0BA 3N2KB 4IIJF 4LYAA 4W82A 4DKXA 1I5RA 2Q2OA 4RELA 5KYTA 4JOSA 3EXHC 4I8IA 2B9EA 3HR7A 4L4RA 5BSMA 3SLRA 3VFDA 3EGXB 3GUCA 5CLJA 2N9UA 5JAMA 1VKNA 3DPSA 4PGAA 1ITZA 1O3YA 1VSVA 3DEJA 4WCDA 1NUPA 5IBRA 1Y0BA 4DMMA 4EABA 1D2EA 3UJPA 2WWGA 3LY5A 4X1IB 4EW3A 5FA8A 5TIIA 5JXWA 3AVPA 3V46A 3W9UA 3WK6A 2WYHA 2P7IA 3R5JA 5G1OA 3U40A 3Q2IA 1EUCA 3E3MA 1R16A 1HRDA 2GAAA 2PFGA 1WPQA 2PGAA 3F5QA 2FDXA 5KNDD 1WSDA 2IZZA 4BLPA 2B21A 2ZE8A 2GJAA 2RJOA 1B74A 1RR6A 3MBIA 1YVRA 4KDEA 4TRNA 4Z3KA 5A2GA 2WV9A 2PGOA 3SF0A 4BKUA 2PUAA 2Q1WA 3QF4B 5TEWA 4LOHA 5L53A 2F4VB 1NMSA 3CLRD 4UC0A 4ZT6A 5JG7A 2WA1A 1YVUA 3IDOA 2B4RO 2A1TS 3LUBA 2IXGA 3ZWVA 5LYYA 4N3BA 1P2DA 1QQ6A 1YS4A 3A4VA 4MNTA 3ZK9A 3W6UA 2PXHA 1XTRA 2R6DA 2EZ8A 3Q15C 3IBCA 1PGQA 4N82A 1K8QA 2XTJA 3WDLA 1JSZA 3ZDYB 2BR5A 1L7PA 4OB6A 1PEDA 3UYLA 3AY3A 1OA1A 3ILSA 4UASA 5T8KC 3G89A 2IX3A 1BRTA 3ONNA 2VHUA 3GDGA 3PJFA 3NMUF 2B98A 2CXTA 1SR8A 2O8DB 2H5IA 4FN4A 3ELYA 3LQ4A 4HEA6 4UREA 5DJ5A 5F64A 4LDAA 4BKOA 4UM8B 3RTCA 3COJA 5HM8A 1JIKA 1ZK1A 4MVJF 4U9UA 1UP6A 2P62A 3WK7A 2NM0A 2L69A 4EF6A 3HRKA 1LC0A 5KSPA 4QDXA 3DMFA 4M7WA 5C5DA 5DSTA 4PSKA 3K6SA 1K9VF 2R8EA 3MXOA 4OMCA 1KYXA 5AW1A 2M9MA 4B4KA 5HJ2A 2ADMA 1R7RA 1YH3A 1C3EA 1P1FA 1WQ1R 2MSKA 2WUGA 1TMOA 1U94A 3LJKA 4GGPA 3RKSA 5T41A 1X7DA 4FMBB 3W6ZA 5EZQA 3HA5A 2J3IA 4MRRA 1ZBDA 4NYJR 2PV0A 4P7KA 3KYDA 2JRLA 2QTZA 2R2GA 4RKYA 1FXWA 3OM0A 5IU6A 5JQGA 3QEKA 1BHO1 3B6MA 3AVOA 3EJWA 3H9GA 3IAHA 4N03A 4OA5A 5K3FA 5KI6A 4DLKA 5IG2A 5FBVB 1IZ7A 1F8YA 3P71T 5F73A 4D7AA 1VYHA 4R5MA 1N6KA 1JXAA 3L01A 2ECFA 4FHGA 4FEYA 4MP6A 2R00C 4UOQA 4FZ3A 3KJQA 1FDUA 5EYPB 5C3MA 1J8DA 1ZL0A 2ZRKA 3X43A 2QT1A 3GCDA 5IDVA 4GZ3A 1U6KA 2WM9B 3RC9A 1DFHA 2YXPX 1E66A 1H2RS 1XR3A 1ZGJA 3G0CA 3KJZA 4PANA 4E2YA 1WR8A 2VWPA 5HRUA 3DAPA 3OC6A 4AI6A 1Q17A 1Z08A 2AN5A 1PZXA 5CDFE 3FJOA 4CMGA 2OILA 1NC3A 1VE6A 2XQFA 1QFZA 2A3NA 2C94A 1QE3A 3PI7A 3GH1A 2EDAA 2CYBA 2QR3A 3ZCTA 1H4TA 1SHJA 3DFUA 2HQBA 1VPTA 3NC0C 4LHZA 4QULA 4ZICA 3EDRA 3ITEA 1QP0A 1RLUA 5BW8A 1XAJA 4NOLA 1X1DA 2G70A 4CLHA 1U0EA 4HN4B 3A27A 3HWSA 2HMUA 4OHWA 4B7XA 4L16A 4GMKA 1DU4A 4PS1A 4AY3A 1UBUS 4MR9B 2GR9A 2D6FA 2YW2A 4RBNA 3SAJA 3DMTC 1DKQA 3IOCA 3QGMA 1JHXA 1WDMA 3KSMA 4M37A 2REOA 2P4EA 1T5IA 4DUPA 2JCYA 2OAQ1 1RRPA 3RJTA 3OPYI 3A7DA 3N7TA 3E8SA 2V8OA 4P93A 2SHKA 5DNEA 4RA6A 3MJ4A 4UTVA 4OHRA 5JS6A 5I9LA 2WF7A 2H6EA 4ABTA 3BDVA 4Q1VA 1MC8A 5EJ9A 1OH7A 2WJPA 4AF7A 4B40A 3AOEA 3WGVA 3AVWA 4KMMA 1RMQA 1E2NA 2CL0X 1P7VA 4UTZA 4RGVA 2DEUA 5KJCA 1HEUA 4D8UA 2BJWA 1V35A 1ZH0A 4UHEA 1KZ9A 3OVMA 1X80A 2JAHA 4BO6A 4EG7A 4QM7A 1W4LA 9LDBA 2H4ZA 2VJNA 2Y1OA 4JSRA 1X6VA 4ESEA 1MX9A 2HDWA 3TX2A 1YQXA 4PZPA 1PQWA 3WV5A 1Z8DA 1NSYA 3ZHOA 1U2EA 4AJHA 2AZ4A 1K08A 4KG7A 4FEAA 2WTNA 2CCKA 5LP6C 4X0EA 4G0WA 4NNPA 3HKEB 1Y3HA 2PUJA 3DJFA 2RGBA 4C30A 4PG8A 1H66A 3G2NA 4UNSA 3X1YA 7AT1A 5KSOA 3UENA 3ZV7A 3OIVA 4DHWA 4HVLA 5CFPA 2R7KA 4GRIA 4L15A 4QLAA 3O8CA 2BISA 1NFFA 2NXJA 3NPAA 4L1KA 1KI6B 1P3JA 1MOZA 5DBIA 3AEYA 3HACA 3W77A 3WKAA 4C20A 5BRAA 1O6FA 2HFJA 1JB1A 1UCFA 2BFCB 2X8LA 1XD9A 4INJA 4EOGA 3JAKA 4N54A 4ND2A 3IIJA 5AOCA 3WI7A 4D6PA 1N2XA 3ER9A 1ISPA 2OC9A 2O8NA 2WYWA 1XJ0A 3KJHA 3DTNA 2GYWA 4IGIA 4ENRA 5JZBA 3K0SA 3X2SA 3EIEA 4X62B 3FNIA 4WLUA 1VC2A 4RKRA 1CEXA 1Z4IA 3D4LA 4ND7A 1EXDA 2P9CA 3HBLA 4PYKA 3H6HA 2ADOA 1GNLA 3FOZA 3ITKA 2JI7A 3E27A 1H4QA 4FNOA 3TKYA 1LW7A 3WDSA 5BV2P 3OQMA 1LUAA 4S1TA 3WNBA 2I4MA 4EPYA 3VU8A 3LK6A 3L06A 3FUCA 2PLAA 4RPLA 3QUBA 5ERYA 1IIBA 1EK0A 1UZUA 3PUYA 1F2TA 2VPZA 5K0EA 1UWCA 4PLYA 5LJIA 1F5NA 1Q0SA 2OHOA 3KETA 3TW8A 2BEWB 2FYTA 3G2LA 3CHYA 5M34A 1Y9DA 4L95C 4GT1A 4RPIA 4A82A 4CUKA 2FPRA 1F2TB 2SNIE 1F5SA 1T0BA 4FBMA 2NU9B 4EMTA 1ODJA 4NCAA 1ICEA 1G8SA 3DOJA 2C8VA 5AI6A 3TW8B 3WC4A 1MZPA 5AM0A 1VL5A 5F21A 2CDAA 4QXRA 4BVLA 2WTBA 4HLQB 3NPMA 4CCYB 4U9IS 2IDZA 3OJXA 3RK1A 2AJDA 3WZLA 1CJBA 2EBHX 3A6ZA 4EG3A 3U56A 3GLTA 5C1BA 2XT6A 3VR6A 1Q92A 5MHTA 1Z75A 3BXPA 1KQOA 1Z37A 3SC2B 1NYLA 4I9HA 3T3MB 2YQ5A 1G7RA 3VH2A 3H2ZA 2GBFA 3LYAA 4N8SA 1NE7A 4WRRA 4ZT4A 4G5GA 4G5FA 3B36A 1XNQB 3A37A 3H3XA 1WW3A 3GPIA 1HRKA 1QHNA 2FKAA 4URHA 3UK0A 3RUCA 4HQNA 2Y9PB 4IV8A 5DCUA 4EKYA 2V74B 4PZCA 4LY0A 2FMUA 2IOFK 3AP1A 3WJ2A 3QVKA 4UNIA 3MT7A 5G0VA 4MTCA 4WNAA 3ZHRA 5A4JA 1TKAA 5AMXA 3AFHA 4CRWB 5DX1A 3RYHB 2FPOA 3RRJA 3NIFB 3RUFA 4Z51A 2FTKE 5IFLA 4C78A 1C5KA 2K2QB 3IKMB 3JZIA 4R68A 5TQJA 1D1TA 1MIOB 1N4DA 3OSUA 2FSPA 3EPJA 3CCCA 2IP4A 2OBLA 2XGMA 2FSUA 3D5QA 2WZDA 3UVEA 1CG6A 3DZIA 1EA7A 2Y1XA 1H2HA 2I80A 1QZXA 3D0KA 4TM8A 3L0CA 1EUYA 3WLMA 1E2QA 3TTYA 4UM5A 3VTKA 5I4BA 4B0OA 4F9TA 2ODAA 2OL4A 3OTIA 4AJOA 4C6TA 1T2EA 4BAZA 2G5PA 1RLJA 5DPMA 4BJ5A 4PR3A 4NYIR 4ZQHA 2Z30A 4E15A 3R3JA 3SS7X 2PG3A 4WACA 1PGOA 4KXXA 3RUPA 3OQBA 5KC8A 1GTMA 4KVZA 4PC7A 5JRDS 1Q6ZA 3L7YA 1N8NA 1EWVA 5EJ2A 3WWZA 4BVJA 4DOMA 1FPMA 3ND8A 3AESB 3GGDA 3NCHA 4J91A 2FX2A 3EMBA 3ET4A 1PZEA 4Z9AA 2AD1A 2XUPA 1HYBA 4JS0A 5HG0A 4F72A 1AUOA 1ZK0A 1ZUIA 4FFBA 4OHKA 2XGJA 3OZDA 4WZ6A 3VR4A 3ASVA 5KNCA 3PUHA 2YNMA 1UBMS 4NPCA 3MJEA 5IK2A 4DLSA 1F38A 1XTQA 3C7AA 4QOSA 3VHXA 1PO7A 4TYMA 4JLJA 4ALKA 1A0OA 2QNRA 2V65A 3FNEA 4W5WA 2IWHA 4BVFA 4HB2A 2CNDA 4JOQA 1O96B 2JLQA 1XQVA 3PHBE 3ZU6A 2O1EA 4UZFA 3A9CA 1XEAA 1SH7A 1VPDA 1D6NA 3RHTA 1JG1A 1BWPA 4PLVA 5LQKA 3DHNA 4RHUA 4Q7QA 3GC6A 4GYJA 3GLIB 2I4IA 1GDHA 1QRSA 4DNQA 1FSGA 1NQAO 3EH1A 4DTIA 1U8UA 1A69A 3D2LA 2R85A 3PIDA 3ONDA 1C9JA 4JK3A 1U8ZA 3ONWA 4B43A 3VSAA 1DG3A 5AK5A 2RJNA 1WHTB 1XN1A 2QJTA 2X1HA 3HJRA 4K9KA 5JJBA 1Z9BA 4MR8B 221PA 2ZPUA 1ZOLA 4OK3A 1W34A 1MORA 4MWOA 4B48A 1JVNA 3FYTA 2H2FA 2IH4A 2J67A 1J9GA 2CUZA 4JL5A 1PFUA 2EKQA 4QYWA 2A2ZA 5DCYA 2CHEA 5A3VA 4DLPA 4EL0A 2VJPA 3PDHA 3W0LB 4CJXA 3UO8B 1VHTA 3S1AA 3FI9A 2CMGA 3ZCVA 3OQ1A 2Z57A 1XTBA 3HJAA 4XWGA 1CY2A 2JH9A 5AR1A 3QFCA 4MQEB 4IDQA 4PN7A 2XMCA 2XOXA 1D5WA 3LDAA 3MVEA 2F1RA 3O8NA 1WSBA 3TAHA 5A06A 3A9TA 3OEYA 5ERXA 2XYPA 3T7DA 2R5FA 3PQDA 1HDRA 4G0MA 4UUBA 5BYJA 3HR4A 4FQ8A 1NN1A 4J0FA 721PA 4RA9A 1SUPA 4BQEA 1LDNA 3K70C 4HQKA 1L5KA 2OESA 2PGIA 3AQIA 2XZLA 4LF5B 3KUDA 3E5RA 3VSDA 1ZH2A 4J7UA 4PO8A 4RHTA 2IYNA 3TWOA 5SY4A 1GTG1 1P6XA 1L3BA 4KZKA 5A71A 1MO2A 2WT8A 3O3NB 3ETGA 5I6DA 3K9WA 1UR5A 2X8BA 4M7OA 5H0IA 4ZWNA 1SBNE 1DIRA 1R0XA 1UFRA 2AA3A 4X41A 3VHLB 2WB2A 3NEYA 1LA2A 3RS3A 3LL4A 4CTKA 2C20A 1X1BA 1R74A 2Q9UA 3OO0A 3SDZA 1KK3A 4KX5A 5JALA 4WD3A 4I1PA 2Q3LA 3D2BA 3W7VA 5FI5A 2VT2A 3MJDA 1KRHA 3GXOA 5AJVB 4LWPA 4IQFA 3HMQA 4YHHB 4NBSA 4GP7A 4QQRA 1GL3A 3ET5A 2YRFA 3C87A 3GY0A 3N05A 4GQIA 1QO9A 2PXAA 4K6CA 5T3YA 3UJ3X 1ZM2A 2OFFA 1ZOSA 5EXEA 3VDNB 4DNPA 3Q8WA 2WAOA 4QWMA 1E18A 3Q7PA 4JEMA 2OG1A 2GF2A 2C9OA 2H07A 4FFLA 3R76A 4B5KA 2FE4A 1CDEA 1MJGM 1TTHA 3HJHA 2RAUA 5E4JA 4E33A 3KZ1E 1KYQA 3E9DA 4OK5A 1DIGA 2CNKA 3BJMA 3N70A 2XDWA 2ZQ5A 3IE2A 1BXGA 4WL0A 2X4DA 4Z7JA 2HJWA 1ZVVA 1O54A 1QMGA 2IHUA 5GZ3A 4JA0A 4LNHA 1L4GA 3CLUC 2HSDA 3ZGVA 1BXGB 4PLHA 4IXMA 2J3JA 1JH8A 2C96A 2XJ4A 3EA0A 5CT6A 3WWEA 1TMGE 4CMHA 4LF9B 4TZKA 5ICCA 3ZU4A 5KINB 1ENZA 3C3BA 5FORA 1A4XA 2RHWA 1I0ZA 3GJ0A 3WMWA 1DEXA 3CLTC 5D5PA 4BATA 2FQYA 3NT5A 1IVYA 4RYDA 4YUVA 5GVSA 3NHSA 4WKBA 1TEHA 4W8GA 3BH7A 1ISRA 4PYQA 3BSYA 4BO1A 3EXEB 4BO4A 2PU7A 2CBGA 5H3HA 3TLBA 5HRCA 5J4LA 2AN1A 2FFHA 2CLEB 3O38A 2XUDA 2DBYA 5K3AA 4BRSA 3UCXA 2DU8A 5AM5A 5H68A 3GVCA 5EA2A 1ZUHA 4R2KA 1IXSB 1L7VC 2ONZA 4C76A 2F2TA 2ID9A 3GARA 3QLEA 3BMQB 1X2BA 3QU5A 5CA0F 1TMKA 5EEHA 2FPIA 3RVNA 3H1AA 2B1JA 3Q1KA 1G4HA 1Q0HA 1ZO8A 2QMEA 5IYZF 3OE4A 3ZCSA 2BGWA 1WCXA 3TPZA 3AUTA 3CWZA 2KX7A 1M6WA 2O7VA 5ICEA 1P60A 3HGQA 2BSQA 5BW5A 4HNAB 3U31A 4Z1MD 3UTCA 1EJ6A 4OHPA 2HGSA 5FFMA 3NVKI 1D4AA 3CVJA 2RHCA 3MQFA 4X1KB 3H5IA 2VJQA 2WSIA 2P11A 3CONA 4KQ9A 1MPTA 1PAUA 2P9TA 5AK0A 3U7EB 3EGVA 4G8CA 5DWDA 4HH0A 3EYWA 2RG7A 4BZWA 3V1LA 1EM6A 1XXLA 1X38A 3LECA 2VHYA 2BDEA 2EGGA 3R2JA 1L8QA 3DEHA 1TCCA 1UPUA 4QODA 5G40A 2ARKA 3VTAA 4RJIA 1COWA 5B4TA 4RF3A 3SEAA 2WWYA 3IPXA 2Y6VA 1GZ7A 4BNIA 3OCCA 3BXFA 3U7QA 1L4YA 3PIRA 5IAJA 1PR0A 3KT8A 2KBFA 2VSXA 2VUSA 3A0RB 1QTNA 1FFXB 2QTWB 5L95A 2AW3A 1SKYB 4XH9B 4IUCS 4Z8YA 1TT7A 4PV7A 3U7QB 1JTEA 4B87A 2JJ8A 4S05A 2X8WA 1UJ2A 3OOHA 4F6RB 1JG6A 1MNQA 3FYUB 2WF6A 5IP5A 1A9XB 4FW9A 2O2EA 1C8BA 2WZCA 3JQDA 2M1ZA 1IWPB 1OTXA 4IIEA 4K8OA 3SD7A 3PD0A 3H2HA 3U3DA 3O5AA 4II3A 5A9RA 5E7IA 1R0CA 4RGQA 4WZAA 4RETA 1HF3A 5ALJA 1JMVA 1W88B 2GKSA 4LFCB 3RYIA 5AVWA 3FSGA 1FYXA 1GPNA 2JW5A 1ZOOA 3D6MA 5ENZA 3ULKA 5AVZA 5IKMA 4RKEA 3B6ZA 4MYTA 1XZFA 4DA7A 3GFPA 4M8NE 4WZAB 4ZJYA 5E95A 1VPWA 1MOQA 2R3SA 4Q9LA 1WSWA 1IU9A 1YJXA 3NANA 1WBDA 4WEOA 1HDOA 4KDRA 1URPA 2P1ZA 4RZHA 5H4GA 3S8EA 1LBTA 1Q3TA 4L8YA 1FY2A 4UCQA 5ELXA 5DCWA 4AW9A 4HRYA 1M7BA 3N9IA 1MX3A 4QZVA 5HE8A 1RCFA 4Q03A 3JSAA 3ZQ4A 4GOMD 3RBXA 1NNEA 4EB8A 2A86A 4CLXA 3O0DA 3WJ7A 1U99A 3HP1A 3BD9A 3LUHA 1NKTA 1THTA 3W9YA 1G3MA 3ME5A 1KSFX 4G8JA 3UMVA 1Y5NA 4NCNA 1E8NA 2JLCA 2OD7A 2OK7A 3KVYA 3L8HA 4FNGA 5FLEX 5GONA 2ZWMA 5KTKA 3OF5A 2WI8A 4LYJA 1C2TA 1DOZA 1SGWA 1YRYE 4Q3CA 3T1QA 3WB2A 3KZNA 4YCCA 5B6IA 1PQYA 2FR0A 2P79A 4RJLA 1QRTA 2PRKA 4WXPA 2XT0A 1PL8A 4TV8F 2YWXA 2UZ1B 3KLBA 4TSFD 2JGLA 4KQGA 3CRW1 4MVJM 4E7OA 1A5AB 1M1YA 5JT1A 4LJ8A 2REQA 4FFVA 5DO9A 1V5IA 4YNBA 5I9TA 4XD7D 4NYIQ 3W7AA 1ST3A 2CFTA 2YJNA 1QVAA 3N6XA 4ZU1X 1D04A 3D1LA 4NJMB 1YFKA 2A0XA 2NXNA 3NTVA 4ONEA 3WIVA 3AI3A 3KD3A 3W8NA 4DMUB 1IRXA 4DV7B 2IEDA 3BXZA 4D4LA 3ZZUA 2ZROA 1GTSA 5MN5A 4RDHA 5AOAA 1FVFA 5B3JA 3KQQA 3GEHA 1EXWA 4HDSA 2R8YA 2R7MA 2ZKLA 4Q7EA 3PX7A 3EC2A 1JHVA 1K8XB 3K0HA 2ERCA 4BTLA 2VDJA 2JFBA 4XQCA 4ZO9A 4IRMA 1G3IA 3S81A 4LK3A 4YGXB 4G0VA 1KWGA 3GLUA 2BELA 1BH6A 3GGOA 1U0HC 1NLMA 2B2CA 1J49A 2CF5A 4QXMA 2RHLA 2KLBA 4X65B 5KKNB 2QXUA 1YBVA 3LGSA 5DIFA 4P84A 3G8YA 4UFOA 2Q3CA 4KRFA 4RU1A 2PVCA 1H2ZA 4HB3A 1BGXT 3ID6C 4DZRA 2X3YA 2P4QA 3R6LA 3KYJB 1M2KA 1N1EA 2C3UA 3PZBA 1GTVA 1MB3A 3EUEA 1JEYB 3GA5A 4CUZA 1RI2A 2DBRA 4XVRA 1SC4A 2EF1A 3BH0A 3TRIA 3VAAA 2VK2A 1WQ3A 3RUEA 3TDMA 2QX9A 3E5NA 4OGWA 2UUCB 4FFMA 2W58A 4OP3A 2IOHA 1SXIA 4G1MB 4YLGA 1Q3KA 3KG2A 4ZCRA 4MUIA 1XNRB 1KEWA 4BRWA 2Q3HA 3NG1A 2CHVA 2NSHA 4Y7DA 4E2ZA 3ZWXA 2A0YA 2W98A 3FG9A 3U48A 1VLQA 1YBFA 4GE3A 3FRJA 4ZAYA 5A1TA 1JAIA 4YRMA 4R9NA 5JXHA 1FLAA 4HTFB 1M66A 2XCOA 1KK2A 3D54D 1GQOA 4J7XA 3C3DA 1IEVA 1KO5A 1T1RA 2GRAA 2PK3A 5EE1A 5CFNA 3DDNA 4UEQA 3RB8A 1FUIA 2RDMA 4ZFNA 3O2QB 4HLCA 3VC2A 1H2WA 4PE5B 1I4LD 1B16A 4M0UA 2AMFA 3CNEA 5DP2A 1LLCA 2QL9A 5FUBA 3T7RA 1YJCA 4N5LA 4PNEA 1DNPA 4IJKA 1ND6A 2HREA 2ISSD 2XVAA 4MZDA 4RTQA 4DSTA 4ZYZA 2C9ZA 2HPZA 1X9HA 3ZG6A 3LUAA 1B1AA 1M6EX 1N6IA 4WXRA 5FWNA 3DC7A 4MW9A 1E0JA 1JHDA 3DXXA 2Y6UA 3E7XA 1Y3FE 3JQAB 1ANKA 4V1CB 3IURA 4LDPA 5P8WA 4YRAA 5T6MA 1YQWA 3FFTA 4BNJA 1N7HA 2J9FA 3RC7A 2JK1A 1X19A 2VHEA 4MW1A 3ZH2A 4ZJPA 5I7EA 3AIIA 4CQJA 5JD4A 3HR8A 4D0NA 2Q1TA 4AWXA 2HSEA 5J4VA 1Z0SA 2PEYA 4GR4A 4L0DA 1DAHA 1T8SA 4TV9A 4IAOA 1U0JA 1UL1X 1QFYA 1HPLA 1WS6A 1YZUA 2AX3A 2C98A 5BO5A 3M3DA 1NAHA 2G9RA 2HSGA 3KXPA 5E6RA 3V8PA 3VJLA 2JAWA 1ZD9A 2QLNA 3OFSA 3JTMA 1RQPA 2ZRCA 3CKYA 3CPHA 4TV9B 5LA6F 3SNHA 3ESZA 4FGKA 2VWHA 4RACA 521PA 3T7IA 4JC5A 3NYWA 2FXVA 1LB1B 1JKMA 4H6XA 4QBGB 4YX9A 3I8SA 2O3JA 4PTZA 4DQKA 2Z9DA 1R4NA 4EYOA 4BGUA 3WLPA 4F5ZA 5CRIA 2QR2A 4JP8A 1BMFA 2FRVA 4A5SA 1NZDA 3V7NA 4J43A 2EVWX 3OPVA 1L4HA 1R4NB 3PZRA 4H27A 4EQ6A 4PFKA 4KN8A 4D44A 3A1FA 2BMAA 3U3XA 3ZJUA 4PLTA 4PIPA 4DC1A 2JF0A 3UCFA 1LS1A 2AQKA 1NUTA 3U80A 2VTVA 3BJIC 1HO3A 1OLXA 1DIBA 1RWBA 2V6JA 2X6TA 3A4TA 4OYYA 4PGMA 5LQRA 4G1VA 1OH5A 1HFKA 5CVJA 3BF8A 1T5SA 1W4RA 3BWXA 3I9V1 4INZA 1ZP6A 4WQMA 1A1SA 5DZSA 3GLRA 3IB6A 4B80A 4KACA 4YONB 5HW0A 1SUBA 1LPNA 1N7IA 3EF0A 2VWQA 1Y37A 3GMIA 2AI2A 3U3MA 1PNRA 4BLUA 2Y0BA 3BCSA 3SHFA 3VR5A 3K4QA 4TKUB 4L5CA 1TA9A 3HGTA 2W2VA 3ON5A 1VCMA 1LCIA 1TO1E 1G2QA 2GI4A 3TTTA 2YHUA 1QQAA 4CTJA 4W6ZA 2PYZA 3CF0A 2ZTVA 2NV0A 1NVFA 3EVCA 2OY0A 3MS7A 2JKYA 1GKLA 1ZX1A 2B25A 4PHHA 1LSUA 4UEOA 3CZRA 3T5MA 3FPJA 2EFJA 3L1HA 2OFPA 1BSVA 3I45A 1REQA 3M0EA 4FUTA 2BCGY 1FBTA 4EGAA 4CT5A 4WKCA 3GEDA 4BMVA 2XUJA 2Y71A 4FLEA 4KXWA 1XVTA 1B76A 3I6ZA 1FJHA 4MS3B 1R37A 4YCNA 2VYCA 3AVTA 3U7HB 4MMYB 4K86A 4YS6A 3U37A 4XCQA 2HK6A 2XE8A 4ASUA 5H83A 3R9IA 4DE5A 4J9VA 3SQWA 2PZEA 1XN4A 4D0GA 1KMNA 1P29A 2G82A 1VL6A 2AKYA 2V9PA 2FRDC 2HR1A 4A8JC 3ZDBA 4I14A 1CIVA 4ATNA 2OM6A 3JR7A 1LFAA 3JALB 1GPWB 2Z9CA 4O02B 4IDOA 5CURA 3ZK8A 1ZCAA 4LXUA 1CUIA 1VRWA 3INRA 2I34A 3ZE6A 1HDYA 1DQNA 4NE2A 3EWIA 1XBTA 2W6ZA 4X6YA 4C0BA 1AC5A 3D3KA 3LQ2A 3BXGA 1E1NA 5B4VA 3G2HA 4K9LA 1Z4MA 5BXQC 4DTCA 1AKWA 5BPFA 4EEKA 3FA2A 4LZNA 2YXNA 1W0CA 4W9NA 4OXIA 2F62A 2RGNC 5J4HA 5HQJA 1T8UA 1GPAA 1ORHA 3V8EA 2WMNB 2XXBA 1TADA 4ZOEA 1A4RA 3BMXA 1TCAA 2O2DA 2YYYA 3N2NA 4LOIA 1BZYA 1I3LA 2WHEA 2H0QA 4CF7A 2O8EB 1ZY2A 4ZOBA 4WK0B 4KPFC 2FUKA 4Q9JA 4R31A 3WX0A 5TE9A 3CUEF 4DF3A 3IRUA 4E2WA 1OAAA 4YMSA 5CCXA 3ICEA 3GRPA 1FRVA 2Q1UA 2R79A 3AY7A 3RFXA 3REQA 2AOUB 2VJMB 2IH5A 3K0EA 3IHLA 3CF4G 3K9QO 2P0EA 3DHYA 2I7DA 2OZVA 4NU0A 4K03A 1IQUA 4XRGA 5JU6A 1H5QA 1VMKA 2I55A 2QLFA 4AY6A 2QMYA 1L7XA 4J0KA 4LZJA 3LUJA 4XSHA 5LDGA 1RLOA 4AICA 1DXYA 3DKRA 3HK2A 3Q12A 4U2DA 3TQRA 4ZVMA 3KNZA 5JAZA 1GPYA 3DR5A 1J7JA 4JJZA 4ZANA 1RYFA 3X1MA 3UB2A 4YMWA 3FGNA 1X15A 5GIOE 4RH3A 5KCZA 3JAMA 3GVHA 1JWBB 3RIEA 1ODLA 1WOYA 1X3SA 1V6AA 2OYSA 3C6XA 1SB9A 2N42A 4NCIA 4TL7A 4Z2YA 1L5HA 2DCMA 5A4DA 1C3XA 3VSEA 2IYUA 1NM5C 1SHUX 1O0BA 1PJ4A 3CH4B 5HUHA 4MUKA 1NBAA 3L9XA 4HGPA 3KS9A 2PX6A 1L5ZA 5TARA 2V5UA 3AU8A 1A9QA 1GSOA 3VYSB 3ETEA 4ENTA 2Q4OA 4YO8A 1N6HA 5AXAA 4A8PA 2Q3FA 1XPUA 4PONA 4QTZA 1E2EA 1NOIA 4BP8A 2AXNA 4MCAA 2HMWA 3JS5A 3PFCA 3HDVA 5KCMA 3THWA 2O5EA 3ENKA 4X7MA 3F47A 3PRHA 2HRBA 1NBMA 2VBFA 1Q50A 2IT1A 3FE2A 4CN8A 1NRJB 4B3FX 2R62A 1VHDA 4BE7B 4LHSA 1SC3A 2Y0CA 1NI4A 3R74A 4LNUA 4GXNA 2Z1NA 5EKXA 1B4DA 3SK0A 4AC9A 4M22A 2YKGA 3TLEA 3OQIA 5L7YA 4XIFA 5ICFA 2C97A 2QMQA 4OGGA 4OK6A 2IYSA 1MJHA 2X19A 3D6JA 3HXPA 5HCIA 1U8YA 2OV6A 5CCEA 1CQPA 1NQTA 2J5QA 4XM2A 2C83A 3H7IA 4GSLA 1PR2A 3A9UA 3QW4B 4E5NA 2XRZA 4M76B 3VX4A 1T0IA 2O7RA 4WE3A 1SZCA 2AJ8A 2GZAA 2IEIA 3C45A 3CW9A 3H18A 3OPYB 1Q7TA 3R7LA 1IQPA 2YY6A 1LEHA 4N40A 1H1TA 2XWQA 3DP9A 4R9UC 2IDMA 2RHGB 5AUNB 4E88A 1PV2A 2OLEA 4Z0PA 5K7SA 1UQTA 3QXGA 2VDQB 2HMSA 4FONA 2XHEA 5T4EA 2X0KA 3U61B 4Y2VA 1DDIA 1ZMXA 3CUVA 2FCRA 2XY4A 3WVNA 1SJ9A 3FAKA 2F43B 1W2GA 1VIAA 1PZFA 3EFHA 3P5SA 4OHCA 1DJNA 4MV7A 3OWOA 1MHPA 2G83A 3CPEA 2ID4A 3GCWA 4FGSA 2WPDD 3TNLA 3LQ1A 4UBKA 4NESA 2ID7A 1A7KA 2JCSA 2JJ1A 3K9GA 3TL3A 4CYMA 4CGYA 4UMVA 4N7MA 1LY1A 5H1YA 3ZYCA 2EKLA 4LOLA 3HU2A 2GNOA 1P9NA 2J4DA 1RWPA 1Z4PX 4KP7A 3GOHA 1DEAA 4CWAA 2NWQA 1GPUA 3FSEA 1JRLA 3MFQA 2I6TA 2CSXA 1XWFA 1O8CA 1PJ2A 1T2UA 3A31A 3C6BA 2F67A 1NDHA 2DSNA 1LK0A 1M2VB 2ZJ2A 1MJGA 4H1VA 1KQPA 3K5PA 3UT0A 3FB1A 4A4DA 1R9NA 1DE0A 3U4DA 3AYXB 4EA7A 5BNTA 3GMDA 2FWRA 1NUAA 3TIVA 3H0CA 3K6JA 3JAWA 4U5QA 5CH5A 2EZUA 4LRXA 4M21A 1PS9A 3GWGA 4G84A 4QNRA 4QLBA 5E3JA 4OLAA 1IRIA 1BXRA 4E5UA 2FZVA 4PRLA 2HHAA 5LLTA 3IAS1 5C4MA 3O73A 2BGTA 3IPRA 1YASA 2CL6X 1RYHA 4MQ4A 3S44A 3OLCX 3JXEA 2PS3A 2XBUA 3C5CA 1WVMA 4WZAE 3EW9A 4F5YA 3C6KA 2OB1A 2CFSA 4GWKA 3RVKA 5JRZA 4FC7A 4P22A 4HRXA 4DKJA 5E4YA 1ECBA 1S2LA 4M9CA 1JQ3A 1KO8A 1MJ5A 3D8TA 4KYUA 2OXEA