5EZ6B

Crystallization and preliminary x-ray crystallographic analysis of a small gtpase rhoa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
179
structure length
179
Chain Sequence
AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Transforming protein RhoA
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA
rcsb
source organism Homo sapiens
total genus 64
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ez6B00
1U8AA 1Q21A 1WDTA 4FMDB 5JWRA 1JR6A 3CR8A 4KCGA 2YZ2A 3WP1B 4MH0R 2DY1A 2IBMA 3EARA 1VG9B 3QEOA 1KI1A 2FZ4A 2DFLA 2GNOA 1P4SA 2WKPA 1G7TA 2QT0A 2WWIA 4JL5A 4IOKA 3AVTA 4UKDA 4ILEA 5GVRA 3C8UA 2QL6A 4D80A 1AGRA 3IIKA 2CLDX 2ASEA 1WP9A 4C0SA 4DDTA 4DDUA 1W7AA 1P9RA 1EFRA 1KGDA 4CEHB 5EXXA 2X8AA 4ASUA 4CRWB 4DJTA 2RKOA 5TARA 2NO6A 3C4JA 4BRWA 4ARZA 3ZD7A 1Z0KA 1GM5A 4M21A 4OK3A 3N2IA 1DBSA 1HV8A 1XWIA 2P5TB 4ZI2A 4XIGS 2VRWA 4DLRA 5CB8A 1MO4A 4P32A 3KB2A 2ZYVX 4KJZA 4GBMA 2GXSA 2V1UA 3HJNA 3AVPA 1H65A 3GJ3A 1G5RA 4M9SA 5E4FA 3O8RA 5FOTA 3F3YA 1TQ2A 3K09C 3OEHA 2JGNA 3RSOA 2ZJYA 4UJ5A 3CF6R 2OAP1 4O25A 3THYB 2EW1A 3A6PC 1QBKC 4D4KA 1R6BX 4W5WA 4BPBA 2VO1A 2ODBA 4JBYA 5HZHA 1SXJC 3FWYA 1E98A 4XH9B 4HAYA 1R5NA 2GCPA 5B57C 3U4QB 2PT7A 4A82A 2Q9CA 1II0A 1L7VC 3MFYA 4HB0A 2WJYA 1UEJA 2GXQA 5CIWA 5J4HA 1FP7A 1MO6A 4F93B 4CEJB 4EKDA 3THXA 5HKKD 1B0UA 3PUXA 3FMPB 1U90A 2FFAA 2IYYA 4FI3C 4NCNA 4LWZA 2BC9A 3U3KA 1GL6A 1SGWA 3REFA 3NTUA 2J45A 4QJ5A 1H8HD 2XOKD 4DXAA 2ZRNA 1NN0A 5KSPA 1RRPA 4NYMR 1NJGA 2R2AA 4H1VA 4R2HA 2V7QA 1XPRA 2MSCB 2BBOA 2QM7A 1WXQA 2PJZA 1AK2A 1ZRHA 4JT4A 4QL3A 3R9IA 5FPHA 2DBYA 4PZZA 5G40A 1G3IA 5AR1A 1E2JA 4B6FA 1NG9A 3GPLA 1W36C 3LFUA 3GFTA 4D4JA 4GPTA 3SHFA 2QORA 3D3QA 1T0HB 2GJ8A 4ON9A 1SVMA 1YR8A 3NG1A 4B3XA 721PA 2JLZA 1PLKA 2ZUCA 2XXAB 3KDSE 3D6TB 3F8TA 4BWYA 1AKEA 1XU4A 4Y0VA 3W8RA 5FOXA 3TGPA 2O8DB 5H8WA 4QFMA 3ZYCA 1I2DA 3EPLA 5GJBA 2D7CA 3H84A 4DDVA 3R8FA 4B2PA 1H8ED 3P4XA 2G1JA 4CDGA 1PLLA 3FDIA 1E2LA 1FW6A 4BECA 1ZD1A 2ZREA 3IIMA 4DRZA 5HTKA 3NC1C 1Q0UA 2H92A 5LB2A 3TKLA 4OL0A 2JASA 5C2JB 3GJ7A 4A8JC 4E5UA 3T61A 2HYIC 4Q4HB 1F48A 2YOGA 4V0NA 3VNVA 1XD2A 3VX3A 4B47A 3AF1A 2ZRCA 1XTSA 2Z6VA 3LQRA 1NLFA 1IY0A 1KI3A 2EFDB 2V6JA 1QHHB 2ZSBA 3QPVA 4LJ4A 4ZPXA 4R7ZA 2JDID 3GFPA 4AKIA 4XWOA 4IVRA 5CK4A 2C5LA 4DEYA 2GXUA 4RCZA 4Q9LA 1ONBA 1Z07A 3HU3A 4KFRA 4K81B 1G9XA 3QJYA 2ZTSA 1BO6A 4E07A 3RSLA 2CL0X 3L43A 1L2TA 1CR2A 1VKJA 1KY2A 3DM5A 4AG6A 5JZVA 4TMXA 3PXGA 3KKQA 3AVYA 3NHBA 4D25A 4TMWA 1ZM9A 2WM9B 2C9OA 3GJ6A 2QU8A 4LJ6A 4PPFA 3THWB 2ZRMA 4YMSA 3QKRA 3ASZA 2IEZA 4BFSA 3NWJA 4YDSA 4B73A 2B7BA 3V00A 4C30A 1G8GA 1K5DA 2EWVA 3BAFA 4Z8YA 4H1UA 2N1BA 3IBGA 4WZAE 4LHWA 3X1YA 4TYYA 4Q4LA 4LJ9A 2BKEA 4AY2A 3IIJA 3TW8B 3I3SR 1KO7A 1NSTA 1Q44A 3V9PA 4KSBA 2NO0A 3QY0A 1ZAKA 4JSYA 2OZEA 4LHVA 4OI2A 3MWLA 1X1SA 1GSIA 3W5IA 4IDQA 1T3SA 4ESVA 1X86B 4UJ3A 5D3QA 4F92B 1VCOA 2D2FA 3EA0A 4OK5A 2J0QA 4A6XA 1RRGA 4W9MC 2FV8A 4NZYA 121PA 3CWZA 3SS8A 3E1SA 2QTHA 521PA 2BCJQ 1WBBA 1XEXB 3AVWA 3EZ7A 3GJ8A 1KI6A 4HLUA 1I2MA 2HEIA 5DGXA 1TUIA 1E79A 2J0VA 3QE0A 2O8EA 1GOTA 4Q9IA 2IYWA 2ZR9A 2WVJA 4YONB 3NIBA 4PPGA 3FOZA 4RFSB 3X1ZA 2BEJA 1OSNA 3CX8A 3I4LA 1W4BA 3BBPA 4ESHA 4TMKA 2ZSAA 1E94E 1ZM4A 2XNSA 2ZRIA 1JR3A 1Z47A 1Q3TA 2VTKA 1TTTA 4S35A 1RYFA 3BB3A 3K0FB 4AD8A 1G6OA 1Q20A 2JATA 3HR8A 4OQMA 5DN6A 5F2EA 2ZE7A 4N0DA 3TJZA 2JLRA 4BFVA 1E1RA 1E2MA 5FTKA 3ND8A 621PA 4EPYA 1N6NA 2Z0MA 3VR3A 1UBFA 4EJSA 1OFTA 1DARA 3KKPA 3N5CA 2OILA 4MRVA 3RYTC 1BIFA 5JLJA 1NBMA 1JPNA 2FN4A 1SVWA 3OIVA 5DSZA 4XTCS 3ASYA 2H1LA 5DI3A 3KQHA 3UANA 3AP2A 4BZXA 2QP9X 3FE2A 1SKYE 1KMQA 3VR4A 4EPWA 3JZMA 1DE0A 2YINC 4P0TA 4PC1A 4B2IA 4C4PA 2AFHE 2WICA 5TY0A 4M0LA 2ZYWX 3OEED 4PO1A 4X8LA 3FYHA 2VSXA 4DLVA 1GFIA 4POAA 1UDWA 1JR3E 2AWNA 4Q4AA 2JIZA 3SR0A 1E2KA 3SFZA 4OI4A 2GK7A 3MAAC 5KDOA 3VFDA 3LX8A 2DWPA 3IHLA 3T34A 2FE4A 2W0SA 2ZS7A 2IXGA 1IN4A 2PH1A 1MO3A 2J0UB 2WKQA 4JVLA 1YR6A 5UKDA 4DKXA 3VMFA 4PO9A 1KSFX 5FR1A 3ZJYA 3I5XA 1JAHA 2ZJOA 3VHXA 3RRNA 4TLBA 3RHFA 2CJWB 1R5OA 2AN9A 4CEHA 1DAFA 1NIPA 4M22A 4HB3A 2IS4A 4IFBA 1AS2A 3LY5A 3H86A 4TN1A 2PMKA 3GJ5A 2ANCA 1KDTA 2R62A 1WBDA 3TVTA 3FMOB 3HU1A 4JMPA 4TSFD 2Q3FA 3KJEA 2VYFA 4LJYA 3AQ4A 5JHGB 6Q21A 2BBSA 3SJZA 3I62A 4II7A 4HYYA 1CU1A 2P3SA 5KO2A 4F4JA 1D6JA 3AUXA 4L16A 1P73A 3GLIB 1EFTA 1N6RA 2NQ2C 3K0AA 4K46A 1DO0A 2VP5A 3O47A 5KNDA 2JLSA 5KDDA 1YJ5A 4Q47A 1K8RA 1I4LD 2XAUA 3THYA 2WMNB 2CK3D 2ZR0A 3RRMA 3DKPA 2JJ2D 2QI9C 5AJXA 4C7OB 1X8LA 3L0SA 5FOSA 3EX7C 1HQYE 1ZIPA 1NRJB 3QBVA 2QY9A 4FMCF 5FL3A 3C14C 3CO5A 3UG6A 1ZM2A 3QXCA 3BXZA 5K8IA 5J4VA 3K0CC 1EX6A 1Q57A 4JLKA 3EZFA 3U4QA 3WXMA 1LNZA 1Z0FA 4NHOA 3P26A 2GEVA 3QG5A 1P2UA 4JLBA 5CLLA 5AJZA 4TZ0A 3A37A 3RC3A 4XOIA 3U3RA 3ZIAA 1JBKA 1E4VA 1XJCA 4ZCIA 1YE8A 3RS5A 4Z51A 4DLUA 3AVOA 4TT3D 3F0TA 3BRWD 1E2HA 4KU4A 4NPHA 2J41A 2V8OA 2ZXUA 2Q21A 3U3OA 2G6BA 1VHLA 2RAPA 3K9NA 1EESA 1S4QA 5DISB 2QSZA 1KDRA 2AD5A 4IOMA 1PLJA 4Q66C 5TMPA 3DVLA 5DHFA 1ZIOA 1ZU5A 2FG5A 2WAXA 2GK6A 1GILA 1E9BA 2R65A 3LVRE 1GDDA 3GJ4A 3QPWA 4B34A 1P7CA 2CNWD 2GAOA 2OUKA 3KJIA 4MUAA 4HUQB 4Z1MA 3RLFA 3UWOA 4R2IA 4I81A 1OH7A 4PO8A 4PSKA 4EQ6B 3GJ0A 3UATA 2X19A 2C96A 2BMDA 2XXAA 3KQLA 2YVUA 4PZYA 1R5BA 1O3YA 4MUBA 3IUYA 4FMDF 4GSYA 4HAZA 4BLRA 4DHEA 2O8DA 2L0XA 3UG7A 2MSEB 4DLSA 1OIVA 3AF4A 3SYKA 2FSFA 1CR4A 3CZQA 4A2PA 4KXFB 1AGPA 1KZGB 4DSUA 2VHUA 4FWIB 8OHMA 3FMFA 4JVNA 3ND9A 1T0JB 4DCTA 1E99A 2O0HA 1KMHB 2BV3A 4CGZA 4Q03A 4Q4HA 1YRAA 3UMFA 1IHUA 4LOAA 5ANRB 2CCGA 4DLYA 2A78A 2RGBA 1UPTA 1PVOA 1VIAA 1NVVR 3VKHA 1RE0A 3I8SA 3LDAA 2ZJBA 3FHCB 3RVBA 1KAGA 1T6NA 3BD9A 1R8QA 1DAGA 4HAWA 1QHHA 2EYQA 3QIAA 3CLVA 4PHFA 3AM1A 1Z8FA 5KHOC 4NYMQ 2QP4A 4I1OA 2QQEA 3HYTA 5C4MA 1HE1C 1N6OA 1S1MA 3OAAD 2W2XA 2J7PD 3T1TA 3F5FA 2VSFA 1TF5A 5CJPA 1D2EA 2BHRA 2FFHA 4DCVA 2BWJA 1RPZA 1UBGA 4ZV4A 2ZYUX 1QHXA 4LJAA 1A2BA 1KI9A 4A15A 4PQYA 2Q3HA 1XF9A 4R98A 1Q22A 3B1XA 5EP2A 4U7DA 1TNDA 4AYXA 3K0EA 4HB4A 4AIIA 2HDNB 4Q21A 1XD8A 1Q12A 2GJSA 1JQJC 1O87A 1R0YA 1NL3A 2DB3A 4GZLA 4OKSA 1VYTA 2QQ0A 1R0XA 3HPRA 4TMVA 4N0EA 1VG1A 3Q7QA 4F4IA 2JJ1D 3LX5A 1U9IA 3BH7A 3KKNA 2JEOA 4W5JA 4OBEA 4URVR 4QGFA 4IDOA 3UK6A 3GLGB 2IYTA 2VP2A 1P72A 1SXJB 4TWZA 5D3MB 5EXSA 4UNRA 5JJKA 3R9WA 1IXSB 2E87A 2IC5A 4PTLA 1RIFA 5IK2A 3CNOA 3IPYA 4V0ME 5FPKA 5KDLA 3AVVA 1JXOA 1J90A 1GKUB 1DTSA 2EVWX 4WA7A 1QRAA 1HE8B 4JKIA 4E03A 3T1QA 1E4YA 4RFSA 5F98A 5EP3A 3T1VA 1P2VA 3GLFB 4BASA 3AKDA 2G9NA 1Z0IA 2R6FA 2NG1A 1E9CA 2FZLA 3A36A 1W5TA 5JMTA 4L8GA 2KI5A 3KUDA 4QBIA 1LV7A 2D62A 1N5KA 2O0KA 2OFXA 2OG2A 2OCAA 3V4FA 3K0FA 3EIEA 2IF0A 4XVRA 2CHQA 2GZDA 3N70A 4XSHA 4BQSA 1M8PA 1W36B 4LHYA 1BKDR 1XXHB 4LYFA 1G19A 5KU1A 1G17A 3DDCA 3A4NA 3AUYA 3V4RA 2ZJ2A 2QBYB 1XNJA 1CJKC 3IO5A 1KKMA 4FINA 3AF2A 3PIRA 3HP1A 1HUQA 4D0LB 2NPIA 3L0PA 3WMFA 2IYZA 2W6ID 3I8XA 1N3BA 5KTYA 2PZFA 4U02A 3WMEA 1F2TB 4US0R 4E22A 2D4HA 2G0NA 4CZ2A 2GILA 5IF9A 4JLVA 2P67A 1OXVA 5DYGA 3SFVA 2JCSA 5AJYA 2G88A 4JVSB 3B85A 3FTQA 1ZNWA 2ZJAA 4Q9KA 3LXXA 2JA1A 3BB4A 4C0JA 1G1MA 1GUAA 4JKYA 1P60A 1N5LA 1NMZA 3FB4A 2PLFA 4GRAA 1IN7A 4JLJA 1W46A 2RGNA 4A8JB 3B5JA 4NCHA 4ITRC 4MDEA 1GG2A 1XMIA 1DAIA 3BJIC 4TTPA 2PZEA 4ZDIA 5IT5A 4FMBB 2XITA 1E3MA 1FMLA 5B58C 4Q9JA 5BW8A 4NYJR 4O2LA 4TYWA 4LBVA 5TB5A 2D74A 1KK2A 3SU8A 5C46F 5FBLB 2X1VA 4MRSA 3FPAA 3P20A 2QE7D 2CL7X 1ZJ6A 4KFTA 2DHRA 2ZANA 1JJVA 1RKBA 2CJWA 5E95A 5TDHA 3W34A 4C3ZA 4C2UA 1KI7A 2R6DA 2GEDA 5L3QB 2CEAA 3TSZA 2ZE8A 4BE7B 4JL6A 3FKSD 4LCBA 4DVGA 5GVSA 3PVSA 2WWFA 1GNRA 1R2QA 3I61A 3KQUA 2JLUA 3M6AA 2CHGA 5GJVC 2WJJA 4WXPA 1IN5A 4DIDA 4IFEA 5C1BA 2YOHA 3GEEA 3ZVRA 3RS2A 2GCOB 3AF0A 5LD2C 3SJCA 2K5UA 5CYPA 4G3XA 2XB2A 4A92A 2IUUA 2J87A 1G64A 5CYOA 2DWQA 3TAUA 3EZ9A 1T5IA 1VMAA 1ZBDA 2FA9A 4K8OA 5DLQC 1MH1A 2HLDD 1D9XA 2B92A 2MMCA 4A2WA 4US2R 1P61B 5JS8A 5K8UA 2VF8A 1QHGA 3WNCA 4JSTA 4KFSA 2QMHA 3TQCA 4C7OA 2JLYA 1G7SA 4JBWA 4Y0AA 4MITA 1IQPA 1GITA 2YV5A 4RY2A 5L3SB 3LW7A 3WHLA 2CE2X 3PFIA 2VLIA 1DEKA 1Q1ZA 2NIPA 1JPJA 4QBFA 4DLWA 3CIOA 3TVDA 4HUTA 2Z5FA 1II8B 2FH5B 3S1AB 1G41A 2H17A 2IEYA 1TQ6A 1DAMA 4QJ4A 4TLAA 5JJIA 3QKSB 1FUUA 4JL8A 3LO5A 3EXAA 2OEPA 4M1MA 1FUKA 2EYUA 2F6RA 2HF8A 1LB1B 2WWWA 4IDNA 4LJ5A 4BFWA 2ZI9A 4M1YA 4TMTA 4QXAA 1CR0A 4D0GA 3H4MA 5DHAA 4O0MA 3Q7PA 1A1VA 4NCKA 5BYJA 2CHVA 1E2FA 4IKEA 4Q1EA 1E9AA 2W2TA 3T12A 4BFYA 4A2QA 3KFXA 4QGHA 1KTVA 2GWHA 2N46A 3TE6A 3RRYA 4R9UC 3EASA 1E2EA 1FOEB 2QEQA 3U7EB 1KDPA 1WF3A 2O0JA 2CBZA 5LB4A 1QHIA 4WOPA 1M7HA 2OLKA 2CCKA 4HUQA 1KSJA 2G83A 4Z8XA 4C0KA 4EQ6A 4Q1DA 2A7QA 1OJLA 1KIMA 2ZI5A 3HR7A 3EIHA 1U8ZA 5FTLA 2WPDD 4I99A 3OZXA 2QNRA 4RZUA 3OE7D 1P5ZB 2WHXA 4LHXA 5FTMA 3P1JA 4EFLA 1NY6A 3G82C 5JI3E 1YZTA 4KI0A 3WNDA 4URZR 2YKGA 1D8TA 4JLAA 3UXMA 3L82B 4AI6A 4EPTA 4LZZA 1T9HA 1TAGA 1P9WA 3A8TA 2YOFA 3LBIA 1PJRA 4W7SA 1CTQA 5JS7A 4C0QC 1KMHA 4HAXA 2GZHA 4U00A 2QM8A 1XMVA 4AK9A 3SQWA 1N25A 5E7JA 2A3RA 1G291 2D3WA 1SQ5A 1ZUHA 2B7CA 2OM2A 3JVUA 4BEBA 3UKDA 4LHZA 5FPYA 3T1OA 3B60A 2IS6A 2RGEA 2OO7A 4GOJA 1XD9A 3AH8A 4W5HA 2PEZA 3TR5A 1VIYA 1I4TD 4HLDA 4TQ9A 2V3CC 3A1VA 3NBZC 4V0KA 4DLTA 5FUVA 1DPFA 3SZRA 3GJXC 1OPXA 1KO8A 2NZ8A 1AS3A 5KOYA 2YC4C 1DAKA 4GZMA 2QRNA 2ZRGA 2FJUA 4UXHA 4BFXA 2XSZD 4WIAA 3IEUA 4O3MA 2BEKA 3CWQA 1A5TA 2F1JA 3CM0A 3E2IA 4QBGB 5CM8B 2ZE5A 1J70A 1EFRD 4A4DA 1MABB 3VR2A 3RS7A 4RZXA 1EK0A 3OHMA 3K09A 5M04A 1A7JA 3ZD6A 4JIMA 3W6NA 4LYHA 4UNNA 3VNUA 2QMOA 1Z0DA 4NONA 2ZE6A 1Z28A 2FPMA 1CR1A 2GRJA 4KVAA 2PLRA 3GLGA 2EFCB 1J99A 1ZD8A 1SXJA 2GBLC 3LQQA 5D3MA 4D4MA 2ORWA 1BOFA 3H1TA 4XD7A 4HB2A 4QM6A 4BUJA 2DFNA 2YYZA 4HLUC 4DUGA 3P27A 4PQRA 3SBEA 1X8KA 1Z2CA 4IXMA 2XB4A 1V43A 4KBGA 4C0AC 1XTKA 1F5NA 3MGCA 2ANBA 4BLQA 4B48A 1ZP6A 2VSOA 2WIAA 3GLFA 3JZAA 4OJQA 3MWJA 5CJ2A 1F2UB 2W0MA 3K70C 1OH6A 1ZNZA 4RD1A 3QI2A 3VX4A 2ONKA 2IYLD 4XSGA 2ZRPA 4NDZA 4XWKA 3U6KA 1G18A 5TXGA 4J0QA 1AJEA 4DLXA 4DB4A 2O8FB 2UZ3A 1S3GA 1XXHA 2F1IA 4EJSC 1XFAA 1DVRA 5CK5A 1GL9B 2RGAA 3EWSA 4ACBA 3PUZA 5EE3A 421PA 3PR1A 1SULA 2ZSEA 4Q1AA 4GFDA 2V7QD 1K6MA 2VHTA 2MSDB 1F2TA 2OE2A 2VHCA 4AKHA 1OT3A 4H9GA 2JLXA 3W6PA 4B74A 3LV8A 2HXYA 5J47A 1KZ7B 2IF2A 1SVLA 2QGZA 4Q7KA 5DIFA 5JHHB 3GLFE 1IN8A 4MGYR 2ZRKA 2OHFA 3RDPA 3MJHA 4MRPA 4MGIR 3EA5A 1CJVC 3KL4A 1JI0A 5EE0A 3BFXA 2WOOA 2AWOA 4A8JA 2ZVQX 2C77A 2QA5A 4CF7A 3T5GA 4GMXA 3W8NA 2C03A 2EFGA 3QEJA 1XXHE 4IJMA 1E9DA 2F43B 3AVUA 3WNBA 1FP6A 2R6CA 5JI2E 2QAGC 2IUSA 1VDZA 2WWYA 3D7MA 3AKEA 5H1YA 3T15A 3VR6A 4BFTA 4Q01A 3W6OA 2IWHA 4BLOA 1G5TA 5L3QA 4LY6A 5KNCA 2AKYA 4NTZA 4Q1FA 5P21A 3AVXA 5FOVA 4D6PA 4LUCA 2ZUDA 4C2TA 3KQNA 4LV5B 4UXIA 3BFVA 3N2EA 4TYNA 1E9EA 2CK3A 4QGGA 3DL0A 2GCOA 2ZRDA 1BMFA 3HDTA 1XB2A 4FN5A 3KXKA 1S1CA 1E2PA 3I5YA 1E1QA 1W0KD 3A1TA 3TH5A 1C4OA 1XPOA 2EFEB 1QVRA 1EXMA 4B43A 3KB1A 1Z6TA 3SN6A 1E96A 1ANKA 3FHOA 3WYAA 4N1AA 2A9KA 4CYMA 1Q1EA 2F55A 4NYIQ 1R0ZA 2JLQA 3E70C 3HPQA 4JLNA 2J9RA 3LNCA 1YR9A 1OB5A 1N0UA 2N42A 3VU9B 3MUFA 2JAQA 4LSGA 4PR0A 5L3SA 5AUOB 1UKEA 2GKSA 3B9QA 4G0NA 5FL7A 4Q18A 2FGKA 1II8A 1NBME 4NYJQ 3S1AA 4V0OA 1EWRA 4HDOB 3J81k 3QKSA 2FF7A 3IPXA 1ZU4A 3Q85A 1GL7A 3CKLA 2ZI4A 4M4SA 4ACAA 2IYRA 3TR0A 2JLVA 5BN4A 1OFIA 2YWHA 4UXJA 2FOLA 3BFKA 1TUEA 1XMJA 4YDHB 2F7SA 4ERNA 3ZLJA 4P4SB 4OHZA 3U2QA 1YQTA 1OB2A 4M1OA 1FTNA 3QXJA 5J5CA 5SZHB 3GLHB 1KNQA 4Z54A 1CJMA 2EQBA 4KO8A 1M6NA 1Z08A 1E79D 3CPHA 4KLNA 2ZM5A 2V54A 3TK1A 1OHHA 1ZMXA 3UMRA 1G3UA 2X77A 1IXZA 1G21E 1P62B 1ZCBA 1QG2A 2ORVA 3B82A 3GFOA 2BBTA 1NN1A 1AM4D 1AZTA 4URXR 4WBSA 2HCJB 1D5CA 3M4YA 2ZRFA 3IO3A 4QG7A 1JR3D 1E2NA 2D06A 2H57A 5AUQA 3K70D 1AN0A 1XRJA 2V6IA 4G5SA 4BEJA 1Q1QA 1W0JA 1JJ7A 2VBCA 5DN6D 1MOZA 2ORIA 1OIWA 3Q5EA 1G8PA 1G4UR 1DOAA 1E1RD 2ATXA 2A2ZA 3W3AA 3RAPR 3EC1A 2ZU6A 1K5GA 2G1KA 3FMIA 1GNPA 3NH6A 3O8DA 3K9LA 2OBMA 3MG9A 1MT0A 5EUQB 2O5VA 2I3BA 5JEDA 4CEJA 4KBFA 1S9HA 4LJ7A 2X2EA 3PEUA 3ZZUA 4QNMA 3W9YA 2CVFA 1IONA 2HJGA 2J59A 4TYQA 1SVKA 4PAOA 4Q19A 5FPTA 3QBTA 4BZPA 4JJKA 2C9YA 1NF3A 2UVQA 3RS4A 2KJQA 4URWR 1LS6A 1N6LA 2B8WA 4HZIA 1NG1A 2ZI3A 1OW3B 5L3VA 4MKFA 2QSYA 1GTVA 2E1RA 1OLOA 3B1VA 2O8BB 3M1IA 4RKEA 2JIZD 3NDBB 2QPOA 5EE1A 3VQTA 4Q1CA 1C9KA 2QAJA 2P0EA 4L5BA 3PCRB 4B3CA 1Z5ZA 1YZLA 2I4IA 2QENA 4KFUA 2IS1A 3B9PA 2HYDA 4KYIB 4M1SA 1PUJA 1ELOA 1YHNA 3OESA 4I1UA 1IOZA 5FBQB 5B64A 4EAQA 2ZJZA 4KSCA 2VPPA 5CLQA 2E9SA 4WXRA 4B71A 1W1WA 2FNAA 1RRFA 3K9GA 4NMMA 4RZ2A 3HU2A 4DIEA 4MRNA 1M7GA 1MV5A 1D2NA 1HH4A 5LDDC 4YLGA 1YKSA 1U0HC 3TRFA 5LD2B 3LWNA 1D9ZA 1G4AE 4P4UA 4A6PA 2XNDA 3U5ZB 3WYFA 3CBQA 1EFCA 1MABA 2HCBA 2R9VA 1RVDA 2UKDA 4XWAA 5DH9A 1X6VA 3QOFA 5SZJA 4D0NA 2VF7A 4RD3A 1UKVY 1Z6YA 5A4JA 2Z4SA 2OFWA 4Q48A 1HA3A 1XTQA 4TL7A 3SQXA 1XJ0A 4M9ZA 1DAEA 1TL7C 3ETLA 4ZKEA 3VHLB 4NL4H 1G16A 2BM1A 3ZQJA 2F1RA 1Y3AA 2WJVA 4NU0A 2ZVPX 2W6JD 4OHWA 4PHHA 2H16A 4DCUA 2YC2C 1W4AA 3MWYW 1XEWY 2B8TA 2GEUA 2ZI7A 3EPHA 4DCNA 3Q5DA 1FNNA 1WCV1 4U5XA 2BM0A 3K0CA 4TQAA 1G8FA 3X1DA 2PJRA 2Y8EA 3QPUA 1N6HA 1Z6GA 4BFUA 2ZRAA 2BOVA 3AEZA 1WRBA 3TIFA 4CIDA 3SI7A 4ZCLA 3RNLA 3RS3A 1W47A 2QTFA 2VP6A 1XEWX 2FFBA 1N0WA 1U99A 2FX3A 2W6IA 1F2UA 1FMJA 3KKMA 1M74A 3NH9A 4CVNA 4OQLA 3THWA 1TF2A 5EZ6B 1FPMA 3B13B 1Z06A 4IDHA 5EXTA 1NSFA 1YVDA 3ICEA 4MYTA 3ZVMA 3ZVNA 1HEIA 5J4LA 4LV8B 2O8FA 1KOFA 4G5GA 3NBFA 3TUIC 3WY9A 3KJHA 1GRRA 1AIPA 4GOKA 4A0FA 4G5RA 4B3DA 1Z2AA 2ZRJA 3AP3A 3EIQA 4JJZA 3I73A 4OHXA 3U7FB 1KNXA 2C99A 4IVPA 3PG5A 4Q7JB 4PC6A 1RRCA 1OYWA 4RKFA 1ZUNB 1KK0A 1GWNA 1OIXA 2FSIA 4P4TA 4IXNA 1CF4A 2ZPTX 3VR1A 3CRVA 1CLUA 4JLOA 3W3ZB 1OKKA 3DOFA 2A30A 2RHMA 3P32A 1MRNA 3G0HA 1UJ2A 1ZW6A 4FWTA 1NVXQ 5J4KA 4OK6A 4PQFA 2OCBA 4LBYA 2QE7A 4QBHA 5C4GB 1Y63A 2LKCA 5EE9A 1XCMA 1XEXA 2IHBA 1KSHA 2RGNC 1AA9A 2C95A 1R10A 1EFHA 3B1YA 4M1WA 4TLDA 1U8YA 3RABA 1D2MA 4QHTA 4BGDA 1NY5A 1RJ9B 2QTVB 3IDQA 3R7WB 1SKQA 4XVQA 2EFHB 4DLZA 4XTRA 1E6CA 1AKYA 3SYNA 3ZGXA 3MSXA 1CKEA 2WWHA 5JBQA 1V5WA 2VHJA 3LLMA 4YXWA 3BGWA 3MWKA 2HUPA 1JALA 1COWA 3QENA 2V55B 3BC1A 4JLDA 2V9PA 2GTPA 4MYHA 2F9MA 4C0BA 1NLYA 4MRRA 4AYTA 3AKYA 1CBUA 2HLDA 2WWXA 2WSSA 4JYBA 3BB1A 2JJ8A 5EP4A 2OV2A 2BMFA 3U60B 3BWDD 1LS1A 4FCWA 2CDNA 1KYIA 4OI1A 3D8BA 3QXXA 1KSGA 4QM7A 2XJ4A 1IY1A 1HURA 1KKLA 1XCPA 4OHVA 3AP1A 2RCNA 5AUNB 4DCSA 1KO5A 2VL7A 3CUEF 2RGXA 4Q7LA 4F4CA 2XGJA 2P65A 2SHKA 2XZPA 1GKYA 3DO6A 4PC7A 2XZLA 1NP6A 2HF9A 3ZQ6A 1U81A 1HQCA 2DFKB 4RSGA 4HI0E 1L4UA 1UFQA 2WSMA 1Z22A 5F3WB 5F9FA 1SZPA 4UNPA 1L4YA 1XMSA 4TLEA 4DEXA 1NN3A 2IHYA 1XPUA 4I4LA 3SE0A 1UBEA 1Q1BA 2A5GA 2NO9A 3VU9A 2AX4A 2XTNA 1FQJA 1M1YE 2J0UA 3QNUA 1MRSA 4LGMA 5EJEA 2ZIAA 1YRBA 3C7KA 4HAUA 1G3QA 3SBDA 1S96A 4B33A 2QPAA 3L8YA 821PA 1TF7A 1Z3IX 2LKDA 1QHYA 2P5SA 2VEDA 4WZBE 2G0TA 2OXRA 1J8YF 5JRZA 2IW3A 5C18A 4AKEA 5G41A 4D82A 1E9SA 2RGGA 2H5EA 1FX0B 5KPJA 1LY1A 2PX0A 3GEHA 1W2HA 4C0LA 5BN3A 3Q72A 3W90A 1N5IA 1KK3A 3A4MA 1JQLB 2IXFA 2WV9A 1VECA 3PUYA 3QXHA 4Q00A 2R44A 2Z83A 1HT1E 4BFZA 2F9LA 3L0IB 2NGRA 1GRQA 3ONWA 1N6IA 5GJCA 3TSOA 3ADCA 2ZSFA 5BWMA 1VCMA 4P4SA 2R6AA 3K70B 3RRZA 5IK2D 1G3MA 2Q0HA 3GLHA 5J4YA 2PL3A 4JVMA 3GLIA 4D26A 3WMGA 3VAAA 4JLMA 4URYR 3NVAA 3QF4B 4QNRA 4KYUA 2RMKA 5FI0B 3GEIA 3TQFA 3BH6A 3AVQA 3QQ5A 3SDZA 4MDFA 1Z63A 3TUJC 4EJSB 3EPJA 1KO4A 1TEXA 1S3SA 4ZCMA 1R0WA 1CRPA 1KHTA 2AD1A 3X1XA 4DSNA 5HKKA 2FDCA 2ERYA 2ERXA 2ZITA 4KODA 4CW7A 4DT1B 4DSOA 3MJRA 5A0FA 3PJRA 5CM9C 1H8HA 2IYUA 2XOKA 4NCJA 1G20E 3HWSA 2ZRLA 4MYCA 3CH4B 3NBYC 4OYHA 2CL6X 1P2SA 1I4DD 1VHTA 4WVFA 5EQTA 2BVNA 4DBLC 4ZI3A 3IBYA 4R71A 3LW8A 2QMUA 1OFUX 1FL9A 4EIWA 3GLHE 1RYHA 2OBLA 3KXIA 4HSEA 3GLIE 4NP6A 4C0HA 1MR3F 2ZS9A 3UWKA 4X8OA 5L3RA 3PQCA 1AS0A 1XTJA 3TNFA 3OIUA 2XSZA 5HPYB 2F1HA 221PA 3EPKA 2ZUBA 4UNQA 2QAGB 5H70A 2FSHA 2O8BA 1NLZA 2YJTD 2CMKA 1KAOA 1VPLA 3A1WA 1H8EA 3JVVA 3OFND 1GNQA 4OQXA 2Q9BA 1ESMA 3DKVA 3Q3JB 2X2FA 3U3JA 1Z0AA 1UBCA 1UKYA 4B3FX 3PEWA 4YMTA 3CPJB 5HE9A 2IXEA 1KJZA 1II9A 1DG1G 4X8MA 1SHKA 4Q1BA 5IDVA 5JWHA 3AF3A 2ODNA 3U7HB 1M7BA 2AL7A 4Q02A 2NPFA 3K0AB 2JDIA 1U98A 4FW9A 5CB6A 1OH8A 4C9BA 3BIFA 4D2IA 3MLEA 4A0HA 2GZAA 1XBTA 1TU4A 3QF7A 2GESA 5KNBA 1EFUA 3A1UA 1J2JA 1W2GA 4V02A 1XP8A 4WZ6A 5KUTA 2WWGA 2FSGA 2C04A 3I1FA 3C16C 4YMUA 2DPXA 2GAAA 3WBJA 2AFIE 4CT5A 5FTJA 4TZ6A 4TL8A 3DPUA 1XZQA 3IILA 1VG0B 4RD0A 1CJUC 2PCJA 4NE2A 1DELA 1GKIA 1KI8A 2KB0A 2KSQA 3R20A 1E2GA 2VQSA 1KK1A 3OF5A 3SJAA 5JCPA 1EGAA 2VP4A 4MKGA 3NDPA 4HDQB 5HE8A 3B8HA 1VCNA 5IRCD 2ZROA 1XZPA 4G5OA 5JRJA 5ELXA 4QJ3A 4FD2A 5FBVB 5JFGA 3BORA 1Z6XA 5FOWA 1OH5A 2B21A 3KUCA 1AQYA 2HJVA 5KYKA 2GETA 2FFQA 1J8MF 1UAAA 2GJKA 1NIJA 1TEVA 4M9XA 5G3YA 5B2ZA 4PXAA 3KXLA 1N6PA 2WIBA 1B23P 5LPNA 1FNMA 3RS0A 3TLXA 4E09A 1M34E 2J0SA 4Q4JB 3VKGA 3BE4A 1IJFA 1Q3HA 4EFMA 4ASUD 2VH5R 3W5JA 1LW7A 1ODFA 4NKRA 4AG5A 2IYSA 1E32A 3I92A 3CW2A 3U3MA 5E3HA 4LX0A 1GAJA 1PZNA 4LBZA 2NOAA 3B6EA 3PV0A 4KV9A 1NVVQ 4RVCA 1IJEA 3KTAB 2OESA 1X1RA 4F38A 4Q7MB 1LVGA 2WKRA 5AJVB 2ZETA 1VTKA 3DM9B 4PPNA 1YZQA 4X8HA 4M1KA 4P31A 1E9RA 3OEHD 3MD0A 2WJIA 3EZ6A 4QC2A 3RWOA 2XEXA 3CF0A 4P3YA 4JS0A 1OXSC 1ZM3A 3DMNA 3SOPA 5GADl 4WAUA 1QZXA 1G3RA 2OSBA 1CRQA 3DZ8A 1JECA 2DCUA 3CNNA 4M2LA 4ABYA 2H18A 2P6UA 3NBXX 2W00A 5JECA 1HT2E 1T91A 1TU3A 1UEIA 1U2RA 4EUNA 1RJ9A 4CEIB 4RJLA 1W5SA 3R7WA 1WMSA 2BKUA 3IEVA 1ESNA 1ZNYA 3QSYA 2B6HA 3KX2A 2P2LA 1SVOA 3A4LA 3LBNA 2BCGY 1KO1A 2AR7A 4IOLA 2J5XA 2PX3A 2ZR7A 1CP2A 1ZC4A 1JEDA 2CLCX 4IHQA 1W0KA 3BK7A 2IS2A 1E2QA 1ZYUA 2WJHA 3MMPA 1G7CA 1TQDA 2PT5A 1U0JA 3OEEA 4A9AA 2A5DA 3EG5A 3GLGE 2QBYA 1SXJE 2PZGA 2FU5C 2OCYC 1T4GA 1KI4A 1X8JA 2CXXA 1ZVQA 2ZAMA 4PHTA 4B3BA 4FXPA 4AYWA 3FHTA 3DZDA 1KY3A 1CEEA 2TMKA 2AKAB 3C15C 4PAQA 2V4ZA 3GMTA 4I1VA 2REOA 4IW3B 2YHSA 1KDOA 2PBRA 3QKUA 5JSZB 3TUZC 4OQFA 4GP7A 5SZIA 4HDCA 2IT1A 3IQWA 1G8YA 2BIFA 1TPZA 2FEMA 1NJFA 2C2HA 2OCPA 3NEJA 4LPSA 3DMDA 1QHSA 1ZD9A 4EDHA 4M53A 5BYKA 1US8B 1WB9A 2R8RA 5DI9A 1DAHA 5TV2A 3CB4A 5FBWB 2ZEJA 1G8HA 4TSFA 4US1R 2J3EA 2Z43A 3A1SA 2C98A 5IHPA 2GBLA 1MKYA 2XTZA 4NBSA 1IBRA 3X2SA 1FX0A 3B78A 1N2CE 3ZS9A 1U0LA 1XX6A 2VHQA 3NC0C 5FBRB 2KWIA 2J7KA 3U6BA 1SXJD 2JJ2A 2IA5A 4LBWA 5BN5A 2ATVA 2ZS8A 4XD7D 2AXPA 5FPSA 3SHWA 1QHNA 2FWRA 3WHKA 4F7WA 1T3HA 2ODEA 1YR7A 4DUGD 1S0UA 3LXRA 1LFDB 2IL1A 3CX6A 2VP9A 3QF4A 3UMSA 4QHYA 4JT2A 1OXTA 4MGKR 2QMEA 1JNYA 1NN5A 2YWEA 4QHSA 5HZKA 3U44B 2ZSDA 3AV0B 3PUWA 4ZDJA 2KBFA 2QG6A 5DO9A 4MKIA 1IXRC 4A36A 3WYGA 3QXSA 2C8VA 5J40A 2IX3A 1R7RA 2PMDA 3FFAA 4DT1A 1WQ1R 1W48A 1LF5A 3MRSA 4TT3A 3SNHA 1RC8A 2IYVA 1NMXA 4KAXA 4HZUB 1XTRA 4HATA 1W44A 4HLCA 1P3JA 3EWAA 1W36D 3OIWA 3I72A 2O8CB 3B2EA 4FIDA 1A2KC 4QGAA 1W4RA 3TAHA 1RFLA 4M8NE 1QF9A 2GF0A 3Q9LA 5EUMA 2W2VA 3EZ2A 4KLZA 2CNWA 4ZIRB 1FFHA 2WJGA 3KZ1E 4RD4A 5B30A 1NKTA 1G7RA 4BZQA 2AK3A 3NEYA 3O8BA 1EWQA 4GP6A 3PEYA 1KJYA 1JXMA 2G3YA 4YMWA 1ZC3A 2ZJ8A 2J46A 4FCTA 2VA8A 1OF1A 4PX9A 1BH2A 3WP0A 1QDEA 3VTKA 3LBHA 5CITA 2W58A 1DG3A 2F3RA 2QAGA 3WBKA 3ZZ0A 1G5PA 2WAYA 2OAQ1 4YMVA 1KI2A 3TSWA 1UF9A 3KKOA 4HLQB 5FH9A 1OYYA 2OFOA 3LAWA 4OQNA 3P4YA 4JLPA 4XVUA 1CS4C 3X1WA 3IQXA 1HTWA 2QGNA 2P6RA 3ICQB 1E0AA 3BOSA 4PPQA 4UQOA 2OXCA 4BLTA 2ZRBA 4PZLA 1RZ3A 5BQ5A 4AKGA 4B3GA 5FUXA 1ZCAA 1NMYA 2WZQA 2W6JA 4M9QA 2XZOA 2NZJA 4EPRA 4ZDKA 4RD6A 4IRUB 1DADA 1P9NA 4MKHA 1XTIA 1TMKA 4YC7A 2WOJA 2QPTA 3BH0A 2QUZA 2A5JA 3LVQE 2J1LA 2GJ9A 3C5CA 3K1JA 4V03A 2BJVA 3EW9A 3OAAA 4DC9A 2J7PA 1NBMD 2A5FA 3U7GA 2P6NA 3BS4A 2GVZC 1BMFD 2V1XA 1JB1A 2R6GA 1OE0A 3D31A 4QOSA 1MO5A 1E1QD 1P75A 2HT6A 1GP2A 4IEIA 1XJQA 3TW4A 2D2EA 1C1YA 2OLJA 4G5QA 2ECKA 1ZM7A 1JEEA 4IOJA 4KVGA 2ZU0C 3AGQA 3M0EA 3GQBA 2IWRA 4EPVA 1LF0A 1DO2A 2XX3A 1VG8A 1S8FA 3PEVA 1YZGA 4B76A 2GHIA 2RH5A 3WRXC 3FFBA 4NH0A 4LDJA 1ZNXA 1T5LA 2DWOA 3GCGA 5EP1A 2DFTA 2GJAA 4ARZB 1KJWA 3ADBA 4JBXA 4MQBA 1XEFA 3IGFA 4TLCA 2JLWA 3DEFA 1IM2A 1GRNA 3OIYA 4PHGA 4MA4A 3E5HA 4TL6A 3ZDQA 3KQKA 1AZSC 2JJ1A 1E0SA 1XDBA 3CR7A 5FL7D 2AK2A 3QVVA 3DOEA 3H2YA 5HCNA 2XTMA 4Q4JA 1CJTC 3CF2A 4RZ3A 4B75A 5DYIA 4D81A 1ETUA 4AC9A 2WTUA 3NKVA 2A5YB 1SHZA 2NMVA 2G77B 3ADDA 2BMJA 4BLSA 4A1FA 2C9CA 2ZQ5A 3B7GA 1VCIA 1HY3A 4HAVA 5G53C 4F91B 3T35A 3CRW1 5FUYA 4TTRA 1U9IC 4GNKA 1IN6A 2CCJA 2HV8A 1UADA 2GA8A 2LWIA 3CONA 4WW0A 1YU9A 5FI1B 4PAMA 4GDFA 5AWFC 5LBIA 4V0LA 4TMZA 1S9DA 3KTAA 3K9HA 3VKWA 1QVAA 2DYKA 3UIEA 3ZH9B 3G5UA 4GI7A 1OHHD 4LJ8A 1HYQA 3PITA 4URUR 5HR5A 2FPLA 2IUTA 2PCLA 5FTNA 1TX4B 2H8KA 2Q9AA 1EX7A 2VP0A 4JZKA 3THXB 2Q6TA 3T5DA 5JJLA 4D4LA 4EFNA 2BBWA 3LRPA 1QG4A 3REGA 4QRHA 2C78A 3FVQA 3SYLA 1W0JD 4LV6A 5FFMA 4PFSA 4CEIA 1FQKA 3GP8A 1T8TA 2PEYA 1OV4A 5EE5B 2ONJA 5L8VA 2QROA 4L4UA 1N6KA 1CIPA 4PC2A 1PV4A 2WBLC 3IKJA 4S2EA 1AQUA 1R4AA 3ZIAD 1Z83A 4OHYA 3PUVA 2IK8A 4DSTA 2KE5A 5KSZA 4TL9A 1XCGB 1T8UA 1YZUA 3EAQA 4M1TA 4KITB 2ODWA 3AGPA 3LLUA 1E0KA 2EU8A 2FGJA 2GCNA 3QKTA 3O8CA 2QP3A 3LA6A 2ZRHA 4RFVA 4DWJA 3KFVA 4V0MA 4TYPA 3NHAA 3DHWC 5DNYB 1G6HA 2CE7A 3R9XA 3ZZTA 1M2OB 3CX7A 1E2DA 2ZYTX 1BS1A 3ADKA 1GVNB 4LI0A 4Z1MD 5JSZA 1CULC 1A82A 3CH5A 3SC3A 4RD2A 1Z0JA 4Q5IA 4ZO4A 2RHDA 3T06B 4GMDA 1UM8A 2QT1A 3THOA 4XJXA 5K8TA 1E0JA 3BERA 3R8CA 4LPKA 5DE3A 4QKQA 2H7VA 3K53A 2Q3MA 2XJ9A 4BRUA 1XD2B 3FKSA 3KJGA 1NNEA 1US8A 4L9SA 5H68A 2F43A 2HXSA 1Z6AA 2XNDD 5EXPA 4B32A 1DS6A 3QUSA 3SJBA 4LYJA 2WMOB 1GZSA 4B2LA 1L8QA 1E9FA 5KSOA 4LRWA 1RW4A 2AHOA 1PUIA 1VYUA 2REBA 5BXQC 1X3SA 2YWGA 5TVKA 4NCIA 2I1VB 2ZAOA 4DZZA 1NKSA 2NO7A 1T3LA 4PANA 3TBKA 1JAIA 3NXSA 4IVQA 3FGNA 4CT4B 4DDWA 1BYUA 3AKCA 5KPDA 3CRMA 3VR5A 5E7MA 2GDJA 4B44A 2MMGA 4TQUS 1P2TA 3Q8XB 2QZ4A 3QKRB 3L0OA 1OXUA 2NO1A 3L8ZA 4KHZA 1N5JA 3K8YA 2REXB 2VIIA 2FPKA 1VYVA 1F6BA 3ZS8A 4L15A 4A0RA 1F60A 2CVHA 3ECCA 4LC0A 2RGCA 1UKZA 3QG1A 3CNLA 2BDTA 5FR2A 4JYCA 2YWFA 4IEEA 3U44A 3RANA 2IYXA 2NTYC 3IHWA 4AURA 3MCAA 3CPEA 4G1UC 5A5GA 4LC1A 1GIAA 3B1ZA 2GXAA 5G3ZA 4GL2A 1LTQA 2I1QA 5CDFA 4EPXA 1NI3A 4LK2A 3B1WA 1J7KA 4HZUA 5AUPB 4ZKDA 2GVDC 5K8LA 4UNSA 2O8CA 1U94A 3K0SA 1ZUIA 4OI0A 4G01B 4HEJA 3HYRA 1OXXK 5EZ5A 4N3NA 4NYIR 4ZDWA 4FCVA 3SEAA 1KI6B 5JEEA 4L9WA 3U61B 3H0KA 4OJKA 1ZINA 2O8EB 3OFNA 2EWWA 4ZIRA 2UZIR 3I32A 1SKYB 1WA5A 2AXNA 2W83A 4FMCB 3ZVLA 1IY2A 1BYIA 3FKQA 2F3TA 4B6EA 1FZQA 2QRZA 5JCZA 4MGZR 5FUWA 1OKKD 2WPDA 4DB2A 3WRYC 3RWMB 3RC8A 2OT3B 3OE7A 5E7IA 4PC3A 3C5HA 1WE2A 2O52A 1Z29A 1P6XA 2ZI6A 1N0VC 1UDXA 1A4RA 5KSYA 5SZKB 2QN6A 3L2OB 1NVWQ 2RGDA 2CLSA 2GF9A 4GOXA 1E69A 2OBNA 1TQ4A 1YZNA 1YZKA 1W49A 4O2RA 1TADA 2RB4A 5CDFE 3LH5A 3CRQA 3UPUA 3GD7A 1IAQA 1NVUQ 1EG7A 1SVIA 1SVSA 4GT1A 4YQFA 2FMXA 4TTQA 4RCYA 3PENA 4A0GA 5CIQA 2KBEA 3QVUA 3AB3A 5AK0A 4Q9HA 4MYUA 1R8SA 4IDPA 4LYAA 2IYQA 4I1SA 4PSVA 2FEOA 3A58B 1W4CA 3EC2A 1FTSA 5JWOA 5AJWA 2Z4RA 3CZPA 2YNMA 2ZJ5A 4YXWD 4P33A 5DI3B 3CRRA 1F3OA 4BLPA 1CXZA 1COWD 3TMKA 2DR3A 3C41J 5GJWC 2BMEA 1S2MA 4B35A 1E2IA 4AWXA 2BJWA 2LCFA 5HCIA 3LD9A 1OFHA 5F9HA 2HT1A 2D7DA 4PSAA 2WSSD 5FOUA 4Q4AB
chains in the Genus database with same CATH superfamily
5DOZA 4CKCB 4FMDB 4HQFA 1I10A 1T2DA 4KQEA 4XSVA 4BV9A 2QR2A 4FYYA 4M76B 3NW9A 2DY1A 4MH0R 2CUTA 4TLLB 1AXRA 2R7MA 2HREA 3FPLA 3M89A 4KR6A 2R11A 3ONDA 3CLUC 1G7TA 1XUOA 2QT0A 2W2KA 3JU3A 2EEPA 1C1XB 3GNLA 4IOKA 5E6SA 3TKAA 3UA3A 3V7WA 4JXKA 3AVTA 3OVMA 4TKUB 4UKDA 5GVRA 1EVLA 2QL6A 3WADA 5LQJA 3ABRB 3VHXB 2H1CA 2CLDX 4X54A 3CNEA 5EPEA 4C0SA 1SIOA 1V3TA 1P9RA 3CLRC 3OPYB 3R3YA 1E3EA 2VDJA 2Y1DA 4TUYF 3WJ2A 4C6TA 5C31A 1Q5PA 2HTFA 2O7SA 2X8AA 5FNVF 1O2DA 1E1DA 4EX6A 3HB9A 1G8MA 3F6RA 5KVVA 1K9SA 4UMEA 3JQ9A 1N2SA 1QP4A 1PGNA 5ESDA 4M21A 1R4MA 3JSXA 3HCDA 1DBSA 3T7TA 4N5IX 1QG6A 3WSWA 1P7YA 1JVNA 1PYOA 1WTCA 1FTYA 5ADHA 2VRWA 3QUCA 4XDYA 1MQ8B 3ZZ1A 5C1PA 3GCXA 3SF8A 3MJ4A 1VSTA 4KJZA 3KETA 2G1UA 3HJNA 4DYDA 4JN6B 2UYOA 4N49A 3PDHA 3GJ3A 5BT8A 1VB3A 2XUGA 4EYSA 2WK1A 2JVKA 1NNLA 1KJQA 1Z7YA 2G1AA 4ZVQA 3OEHA 3T5CA 1LK5A 1GT6A 3RGGA 2WJZB 1KDYA 4FFPA 3THYB 1FJGB 3WK7A 4G8CA 1QBKC 2PKYX 4KWIA 4D3DA 4BPBA 2W71A 5K51A 2FPIA 1LJUA 3VDXA 2C20A 2IU0A 1EP3B 1NBOA 2ODBA 1O58A 1CEXA 3CXUA 4M9RA 4JBYA 4ZAZA 4MQEB 5HZHA 1SXJC 4XH9B 1M2FA 5EMLA 4HAYA 1NYQA 2PZJA 1J8VA 4RSRA 2GCPA 3U4QB 1FTQA 2WD9A 3H16A 1II0A 3RC2A 4C4XA 4JUCA 1UEJA 5J4HA 2YIDA 3EQ7A 1V5IA 2QX8A 3EGCA 4LXHA 1SUEA 4P3NA 2CFTA 4R4JA 1B0UA 1BRTA 1XZ8A 2BC9A 3L40A 1Z75A 3U3KA 3REFA 1I6WA 5H80A 1QOPB 3EAFA 2PJUA 2XOEA 4RELA 4CMBA 4ZVSA 1H8HD 3H1EA 1WMEA 3CC8A 1NN0A 5KSPA 2R3SA 3VPDA 4IO1A 3X2FA 2JFZA 4OXQA 2GO7A 4ETIA 4ZP1A 2V7QA 4KPUA 3U13A 2QM7A 3IODA 1AK2A 4JT4A 5T8KA 4YIHA 2DXIA 1RM5A 3TOVA 3IR7A 5F1KA 4PZZA 2VKQA 1X0VA 1L5MA 4FUQA 3EZXA 4U0KA 5B4TA 2Z2IA 4B6FA 1W36C 2X86A 2JIBA 2V98A 5KHLB 3D4BA 3GFTA 1LZLA 3L79A 4NU5A 5BUSA 2IH5A 2Q7XA 1ID8A 3R0XA 2EX0A 3FTFA 1BFKA 2A92A 1T0HB 2GQ0A 1SVMA 1YR8A 2GSWA 1MNQA 3LXMA 5E3IA 1CY0A 3M1YA 3NIFB 4MHSA 2WA1A 4E1BA 2AB0A 4PS1A 5CVJA 4LXXA 1PFWA 2TSYB 1VB5A 4Y0VA 3W8RA 4AO6A 5FOXA 2O8DB 4ZVKA 4QFMA 2W2QA 1NQAO 1I2DA 4RNCA 4AZ0A 4EG0A 3EPLA 5GJBA 3H84A 1XQVA 2BZSA 1LKZA 3PLNA 4B2PA 3ER8A 4JIGA 4ARCA 2HHCA 2K7ZA 2PDAA 3AHEA 1XN1A 3KDPA 4FE3A 3UJ9A 4CDGA 1JG6A 1K8ZB 3GFQA 2ZREA 4DCJA 4DRZA 5L7YA 2RH9B 1AN9A 3NC1C 3TKLA 1ZEJA 2JFFA 2Z8YA 4TWJA 2JASA 5C2JB 4A8JC 3AUJB 1ISSA 2IOYA 3P71T 4OP2A 5AVJA 2HYIC 2TMDA 3O8OA 3ZJ4A 3IE1A 3JV7A 3TLZA 3E9QA 1Q2UA 5AXDA 3AF1A 4IIUA 3VX3A 3VU3A 4B47A 3WB0A 3SSOA 2ZRCA 1EP1B 2JHGA 3TR6A 2Z6VA 1CQZA 3TQOA 3HI4A 2GTIA 4FFLA 2AXQA 3JTMA 3W7BA 2X0DA 4ZPXA 1FYDA 2JDID 2EFJA 1E8NA 2H9IA 4YCNA 4RC9A 5DYTA 1MC1A 3PQDA 5H16A 1PDOA 3T7EA 4IV0A 4O4LB 4ZI7B 1DV2A 1GG5A 3HU3A 3U19A 2XTAA 1GPNA 3JD1A 3QJYA 5KNBD 4LQCA 4CLEA 3F6BX 1L2TA 3DT8A 1KY2A 2DHCA 2O2HA 3DM5A 1FY2A 3U37A 4WOCA 4DV4B 4ND8A 2FPRA 1VGVA 3NHBA 3KUUA 1X7XB 5HIAA 2WM9B 3GJ6A 2ONZA 2GD6A 1Z33A 4RK1A 5CTAA 3WIUA 4PPFA 1HLFA 2JAPA 4YMSA 5A9SB 4KQWA 2RHCA 2DUJA 2BGGA 4N5HX 4RZQA 4YDSA 3DZKA 4CLRA 5K01A 3QU2A 3BAFA 3CLRD 4BB0A 1E3IA 3H4VA 4Q4LA 4LJ9A 3JZIA 2CUKA 3C74A 3EEFA 3TW8B 4COKA 4Q82A 1SA0A 1NSTA 1M1ZA 4WLOA 5E7QA 3JZDA 4L5CA 3BQNB 3PXUA 4KSBA 2NO0A 2E37A 3G9QA 3RV3A 3SQNA 1OWPA 3F7MA 1ULUA 2JKYA 2PUCA 4OI2A 2I2DA 4CKYA 2QU7A 2QD4A 5IVHA 1DZ3A 4IDQA 2H65A 2AMLA 5EWJB 3W5IA 1KOGA 1PJBA 1CLEA 5EWLB 1QYCA 3LQYA 5B36A 4I9FA 4DY4A 4Z2YA 4F92B 3IQGX 4OK5A 2Z04A 3QELA 2WD8A 1GAEO 1RRGA 2XMBA 4RMIA 2JGFA 3DBLB 121PA 1AQIA 1TVMA 2A67A 4TGLA 2QTHA 5CDHA 2CFIA 3EQ8A 1WBBA 4FYVA 4FNOA 1C4WA 1XEXB 3EZ7A 1UOQA 4ZOLB 4HLUA 5DGXA 5DULA 1Z5PA 4W1SA 5KJ1A 1XOIA 3QE0A 1DUSA 1GOTA 3S5JA 3VR4H 2VHWA 3HKBB 3HDQA 3BCSA 1VPDA 2AFHA 2BEJA 4ZYXA 5TIIA 2FN8A 3FUUA 3BBPA 3TG2A 2ZB3A 4Q05A 1JR3A 4JASB 4ZT4A 4LXTA 4WDRA 2JIPA 3FIUA 2RD2A 4AZSA 2VTKA 1TTTA 4F72A 2RC6A 5K5EA 4F21A 1G6OA 2Y0BA 2JATA 5DN6A 5EERA 3D6UA 5EEGA 2ZE7A 1RQRA 1N9KA 1XLVA 4EB6A 1E1RA 1U3UA 1EZZA 2DJIA 4QQFA 2MSLA 2JBWA 4N7RA 5CNIA 1WUYA 1XKQA 1XZBA 3MT9A 5G02A 3QGMA 3LSTA 4DA7A 2VWQA 1E8MA 4P0PB 3DUWA 1DARA 2F8MA 2J31A 3QA9A 4R9RA 1B1CA 5M5BA 1O94D 1F2VA 3RARA 3RYTC 3ESZA 5HW0A 5JLJA 4Y2TA 2PSEA 2V5VA 1U7UA 1JPNA 3ADPA 3I05A 3LOQA 4KWEA 2FN4A 4PEVA 4K0KB 1XNQB 1IZYA 3H9BA 2PSJA 5DSZA 3GDGA 1Y8RA 4MW6A 2W2NA 4YRKA 3P9SA 5LMCA 3NGMA 4JI3B 3AP2A 5A2QA 3K7EA 3BIXA 4BNIA 1KMQA 3EIOA 3VR4A 2IZ0A 3ORQA 4BKMA 2CXHA 1DRJA 3U9TA 2YINC 4Z4EA 1MOPA 3MJDA 2AFHE 5TY0A 4PO1A 1OBCA 3EG9B 4X8LA 5LLSA 1IIBA 2VSXA 3CBGA 2ZUFA 4B3SB 2VATA 2CUNA 2DR2A 3NT2A 3LUGA 1JR3E 4B9AA 4N6GA 4UUQA 4YUZA 3SFZA 1E6UA 2TMYA 4CKCA 4M1EA 1X14A 1E77A 4LRQA 4QUDA 1C50A 1YJXA 3H5NA 3F4BA 4PCVA 4XLZA 1MW9X 2XZDA 2M6SA 2DWPA 2FETA 3C1TA 3PU6A 5AOAA 4ALKA 3F1LA 1A9OA 2F90A 5DT2A 5KNDH 2PH1A 1DHRA 1JG4A 1T3ZA 5SICE 2WKQA 2GAJA 2GTHA 2VYND 2OPHA 3I5AA 4WOBA 5B4VA 1RYMA 1C1XA 5UKDA 2H85A 3VMFA 1F06A 1WMDA 4TKUA 2JEZA 3R24A 3KYDB 4OQPA 3WI7A 5BWOA 2ZJOA 3VVBA 3VHXA 1NBEA 5ALSA 1FYEA 1XZEA 4MAMA 3L6DA 3WLNA 3TLJA 3OPYA 1VE1A 4BQRA 5IAGA 3BHMA 4UZEA 5KZMB 1T5TA 3DE3X 4IFBA 3EAGA 5EGNA 3RAJA 5DCYA 2PMKA 1EYZA 2ECOA 1WD7A 2ETXA 3FRHA 3TXAA 2TS1A 5I8ZA 4X20B 4ZQBA 1Y3CE 1VJRA 4E32A 1YR3A 4AVYA 1MC5A 4BEWA 1HEUA 3HU1A 3ZE1B 2HPAA 4JMPA 2ZJ3A 5JANA 3VJLA 2DGDA 2YXLA 2Q3FA 4LJYA 1XZGA 2VYFA 4XRGA 1PFVA 5IJ9B 2ZGVA 1LFAA 2HHAA 6Q21A 5JHGB 2GM5A 4BN4A 5TQ2B 1CU1A 3OX3A 5F5XA 4YV2A 4L16A 3AUXA 1N6RA 2PXXA 3K0AA 1THTA 4K46A 4PHCA 4QOEA 3RK4A 5AW3A 2YJ4A 3O47A 3NDRA 2ES4A 1SNYA 2JLSA 3C85A 3O90A 4XJTA 1X19A 3H2ZA 5HF9A 1YJ5A 3PD7A 4KAFA 4KXUA 3ZXYA 3CF4A 3ZIDA 4MX8A 1EXNA 1RBZA 5LU9A 3THYA 2IOQA 1I2AA 1KFBB 2CK3D 3PYXA 3VZDA 4UAVA 3C3WA 3DKPA 1JZQA 4C7OB 1RWOA 2W4MA 4S1PA 1FIUA 5BOSB 3L0SA 1R0CA 5TPZD 4K6FA 1HQYE 4FEEA 3QBVA 3EC7A 5FL3A 3VNQA 1EPUA 3C14C 4MQEA 1ECPA 2QR3A 1ZM2A 3GRYA 3UG6A 2HA3A 1PR6A 5J4VA 1F4VA 1LQ2A 3ZG6A 1Q57A 1T4MA 3SIRA 1WKCA 3WXMA 3U4QA 1TO2E 3KLOA 3Q5GA 3VDNB 3TD6A 2YDYA 3N1UA 4BTEA 5CLLA 2G04A 2GD2A 1I30A 3KVVA 1HI9A 4W5QA 2VJAA 1K8QA 4UTOA 3U3RA 1DAPA 1XJCA 1MH9A 3L6CA 3VUEA 4YACA 3C6KA 2BP7B 1KRHA 1U0NA 5ALNA 4OSOA 1CHNA 4KR9A 3U3OA 2G6BA 1VHLA 3QLTA 2J9FB 2I34A 4D02A 4E13A 5C8ZA 3CMMA 1KORA 1KDRA 3H5IA 1SOVA 3DVLA 1ZIOA 1ZU5A 4UATA 4XB2A 3MXOA 4XVCA 4N65A 1GILA 1E9BA 2D1TA 2R65A 2NTVA 4B34A 2UUBB 1P0CA 1V5GA 2WYWA 3CF4G 4Q0MA 2DE0X 3D4LA 4R2IA 2NVUB 5IAAA 1OH7A 4OPMA 4PSKA 4UDXX 2C96A 1ISGA 2BMDA 4J4BA 5BQOA 1UJMA 4JOCA 3DW3X 4NDNE 4D9MA 3KQLA 3AWDA 2HOQA 1R5BA 5C51B 1O3YA 1Z37A 4FMDF 4AIRA 2QJTA 1IWPB 2PSHA 4B3JA 3KPYA 4J0KA 2BFMA 2K2WA 2L0XA 3L92A 2C94A 2ZB4A 4PGAA 3UG7A 2O8DA 3OCJA 4DLSA 5G0VA 3RT9A 3FLBA 3IPRA 2Q45A 3AF4A 1U0OC 3SYKA 3CR3C 1ICIA 3LJKA 2IY7A 4DSUA 4C21A 3VOSA 1KQGA 4QX6A 3RHTA 1T0JB 1NP7A 1PJLA 2O0HA 5H4GA 2NZVG 1A95A 4CGZA 4OJTA 1UXOA 4V38A 2QN3A 1IHUA 1OI7A 3OTQA 4LOAA 5ANRB 1PVOA 2RGBA 1UPTA 3S68A 5AK6A 3EWNA 2C4TA 3VKHA 1RE0A 5AH0A 1NZJA 1ISRA 3LDAA 3EMKA 3HDHA 3KT6A 3RVBA 3ZE8A 3KG2A 4AW9A 4EFDA 2WIGA 4HAWA 4UVHA 3MQ2A 3QIAA 1CVLA 1SC4A 2V7TA 4UHKA 4CKZA 3GBSA 4HQRA 4NYMQ 1RWBA 4YX9A 2PL5A 1RHRA 4O4LA 1QGZA 2YIJA 5JNUA 4ZI7A 4JX8A 2GZ2A 2RKBA 2Z8XA 1SEVA 4ENTA 1X1DA 2J7PD 1N33B 1OH8A 2ABWA 1TF5A 1NA5A 2YFYA 1JEJA 1QWSA 3CVJA 4OHBA 4X85A 4EG1A 1X7XA 1VGQA 2MCFA 4F56A 3IAM1 5I9MA 5L4LA 4PYJA 4G1FA 4Y6OA 1UBGA 2RONA 4Z3DA 3ZN2A 1EFKA 3S7TA 2JKVA 3DTVB 5DRTA 2Q1SA 1QHXA 5A9SA 2WU4A 1A7UA 3KEGA 4I9GA 3OPNA 1PZHA 5EN4A 2C1EA 4OSPA 1XF9A 5P8WA 3WLEA 4DFDA 4GBED 1Q22A 2Z9DA 1THMA 1OTXA 4PX2A 4RM2A 1HG1A 3QNMA 4R2XA 2EGUA 4OHKA 2HBZA 4F2GA 4DMCA 3VPCA 4BS9A 3IJEB 1HMYA 3TW8A 1BXKA 2IIQA 3UWDA 1ZH6A 4AIIA 2ZJ0A 2W9XA 1XD8A 2A0YA 4HRXA 3T0IA 2EFYA 1AHHA 3WQQA 1JZSA 4PF1A 3ZE7A 1OUMA 2OORA 5EUCA 3ZWQA 1S2OA 3V4PB 1VG1A 2QVCA 4B6GA 2JJ1D 2P62A 1U9IA 5AYVA 4W5JA 4NZMA 2IOFK 2NPOA 2O2IA 1F20A 2WILA 1VM6A 2V7VA 2YXNA 5EWLA 1U9JA 3UK6A 4RTJA 2I91A 4H7HA 3VJKA 3RK0A 1AQLA 1P72A 2EJWA 5D3MB 5EXSA 3AO0B 3R9WA 2E87A 5JYEA 3ZJYA 3DBLA 1RIFA 2Q2NA 3CNOA 4IM7A 2A9JA 1LV8A 3AVVA 1K7CA 1PU2A 4ZOLA 3AILA 3OE1A 4RIIA 3OTGA 3C3PA 3IS3A 1E5TA 2XMGA 4L2IB 4P3KA 5I8WA 1QRAA 1HE8B 4YRBA 3HKBA 4X7BA 3ZDCA 1B8UA 5I7WA 3CNQS 3T1VA 2P75A 3GLFB 2P4SA 1G9TA 3AKDA 5H3LA 5L51A 1MVNA 1L5ZA 2R48A 2EKQA 1BN6A 1TTQB 4QBIA 3TJRA 1T9GR 3LDUA 2D62A 2GLXA 2O0KA 1JFRA 3AHCA 3G2PA 3R3WA 1SBNE 3NETA 3EIEA 1I33A 4RVUA 3I39X 2IF0A 3RWBA 2ZCVA 3VKVA 3ER9A 1JHXA 1ULAA 3DTTA 3T4EA 1M8PA 1I5RA 4RHYA 1GLVA 3O31A 4LHYA 4PLZA 1G17A 4EHIA 3V4RA 1GTL1 1NYRA 1QQTA 2XB9A 1CJKC 2ZJ2A 1KKMA 3FJ1A 2CW5A 3PIRA 4CLDA 1W87A 4DIFA 1EIWA 2CJFA 4NMHA 4WLUA 3WC4A 1T1IA 2X9LA 4UQPA 1P7PA 2ZSKA 3DF9A 5AKLA 3WMFA 2PU5A 2W6ID 3BZWA 3K2QA 3TTVA 2PZFA 1Z16A 1D7OA 4U02A 2Q5IA 1XA3A 2I1WA 4US0R 4EW1A 1K3UB 2ICAA 1WHTB 2GILA 4PLHA 2QI9F 2HSZA 1N2CB 2P67A 4K9KA 4Y9UA 5DYGA 2HADA 4BNFA 1KETA 3E48A 3USZA 3L7LA 2W11A 4INZA 3ABSB 3KBOA 3TLYA 1ZKMA 5I7HA 3EG9A 4HVAA 1MQ9A 4OHMA 1G1MA 1NULA 3TDMA 3V97A 1GGMA 5IDYA 4A8HA 1GUAA 3PWTA 3UHPA 2RHRA 4TWAA 3A4YA 2WSBA 2A4MA 2ZXEA 3HU5A 4CF4A 4ZFNA 3VV2A 4ZI7F 1HO3A 1XDZA 2PLFA 1JLMA 4WE3A 1W46A 3SF0A 4NCHA 2QN1A 1UPBA 3TG8A 4FOTA 2X7JA 1XMIA 3BJIC 5FIUA 4ZDIA 1CY7A 2VZEA 4DM3A 1QIKA 2RHHA 4J76A 5DCLA 3UJCA 2GX6A 4NK4A 1PK8A 1DWQA 1L4FA 2PGXA 1IRIA 4INAA 1YAJA 4O2LA 4PYIA 4PGMA 2A9OA 1KS9A 5E9QA 3R74A 5BR8B 2HMVA 2H1RA 3Q0TA 2Q2WA 3FPAA 2CL7X 4H3KB 3W34A 2DHRA 1JJVA 1RKBA 4TV8B 3WGVA 2FQXA 3AI7A 4R1PA 4C2UA 4AZTA 3HEMA 5L3QB 2B37A 3H3FA 4G84A 3V46A 3RRXA 3TSZA 2ZE8A 4DVGA 1I7PA 5GVSA 4WKPA 3PVSA 2WWFA 1GNRA 4X20A 2VDRB 5JDIA 1OBOA 2XDQB 4GYWA 4DLKA 2JLUA 2CHGA 5GJVC 3VH1A 5IDXA 2F1OA 2QD3A 4WXPA 4IFEA 1TJPB 4ZGGA 4WHMA 1VBKA 4TXHA 4YO7A 5BNIA 5IJ9A 2CLMB 2CVPA 2RJOA 1MVLA 3IVMA 3IAS6 3VH4A 5TQ2A 4BP3A 5CYPA 2VUTA 1NI4B 2O05A 2PUHA 4OQYA 4A92A 2J9ZB 2PAAA 1G64A 1TKAA 3V9AA 3C6ZA 3L3BA 1BH6A 1QV9A 1FS6A 2XIJA 4LGVA 1FNCA 2A1TR 3TAUA 3EZ9A 2HBQA 3DEJA 4OF4A 2FA9A 3DJYA 4HFRA 4LYEA 5AI5A 2XV1A 4K8OA 3X43A 1M2KA 4W9RA 2MMCA 4NBKA 4A2WA 4D5EA 2C3UA 1BD3A 4LNUB 1BWPA 4R54A 3WNCA 4HGRA 3A10A 1GZ5A 4ZOLF 3VPFA 4C7OA 3TM5A 1G7SA 4JBWA 1H1LB 5BOSA 3GIDA 1GITA 3W5BA 4ZGBA 1L4BA 4P2BA 3QOWA 2GPSA 1XRNA 1FSPA 1QHFA 3LW7A 3E15A 4AX4A 4Z5XA 1RI1A 4PZEA 4G9EA 4BP9A 1YIDA 1KERA 2BRUC 2RARA 1LLDA 1QGYA 3TVDA 1II8B 2J3KA 4RF4A 5C1OA 2I9KA 4DADA 2H17A 3KTFA 2BI4A 1L9XA 3DZGA 1YKFA 2CLOB 3E1GA 3QKSB 4NWIA 1WD5A 3L0ZA 2B1RA 4LF6B 1MN6A 2Z95A 1WL8A 1E4EB 2EYUA 2DP4E 2HF8A 2LE0A 2R1VB 3CJRA 4FBLA 5EHIA 1SR8A 2FMFA 3DMYA 3T7SA 2AS0A 1HG0A 2BP7A 4M1YA 1OBHA 3P94A 1CR0A 4QXAA 1FQWA 4TXNA 2OY0A 2ZYHA 3GEDA 4OBXA 3LC7O 1A1VA 2CHVA 3ABQB 1XT6A 2J9FA 3T12A 4FZ3A 4BFYA 4A2QA 3GLSA 3KFXA 4QGHA 1KTVA 5JD5A 2N46A 4R9UC 3I30X 3EASA 4H2DA 4OGFA 4Y0NA 1JTFA 1FOEB 1Q1GA 2AHRA 3D3EA 3FUWA 3U7EB 2CBZA 3P9PA 4LF9B 4WOPA 2CCKA 4QYTA 1KSJA 5EVCA 1SZJG 5DEIA 4OP3A 2LD4A 2NADA 3DZBA 5GWXA 4BC1A 4BU0A 4HPWA 1OROA 4R2JA 1I3NA 1RI2A 3BMCB 4X90A 2XECA 3EIHA 3ZW7A 4TV9B 4CFSA 1QG0A 4RZUA 4B84A 5K4GA 3KSBC 3OE7D 2QGFA 3GT0A 3P1JA 5E8JA 1UDCA 3G82C 1BWRA 2HBRA 3O2QB 4X1IB 4EG6A 1JG1A 1LJ8A 4ZZ0A 5I7EA 3GO4A 1E58A 3ZX4A 4DBVO 2P3QA 4WADA 4KQCA 3UUWA 2XQFA 4EPTA 4LZZA 4QDTA 1H05A 1YMVA 5AVKA 4IKOA 3HBMA 5GAJA 2WUDA 3VVLA 3WNZA 1PQWA 5JS7A 1FXWA 1H93A 3A6KA 1IBLB 4GYYA 4BMNA 1B16A 2LV8A 3E7FA 4X92A 2GZHA 3Q9NA 2WIJA 3FNGA 3O83A 5CCEA 5EJ7A 1EVJA 1BW9B 3QHQA 4AK9A 3KJXA 4CHTA 5DU2A 2A3RA 1C1HA 1G291 3ORSA 1ZUHA 3EVNA 2B7CA 4CV1A 1MUUA 1OAOC 2IW1A 4EK9A 1JEQB 4C0XA 4CQNA 5FPYA 2FTKE 1QBGA 1QAMA 1XD9A 1K3TA 1K6JA 2KMLA 2QL7A 3CCCA 3I2KA 3P96A 4QQ8A 4RU1A 1VIYA 1I4TD 4TQ9A 2V3CC 4ITVA 2UUAB 2R79A 3IP8A 2X1HA 2KS6A 2F4VB 1QE5A 3C5WP 4DLTA 5SY9A 1CSEE 4KQJA 3GJXC 3M6VA 1PIWA 2EJVA 5IYZB 2OC9A 5J5VA 3L8CA 2C1XA 4LTMA 4FYWA 4IFTA 1ZJZA 1AD2A 1WSAA 2Q1UA 4C5CA 5KKNB 2PO7A 2QRNA 4FLEA 2QJWA 1QYIA 4MI9A 5FEUA 4OMUA 4ZZ2A 4MWGA 5HM8A 1NQTA 4RCVA 3TPZA 1B26A 3M8KA 1FDVA 3RVSA 1U2TA 4IIJB 2E2WA 3BDAA 3N8KA 3OOYA 4Q3KA 4FFNA 4U6SA 1SD2A 2VDLB 3F9IA 3OJXA 1YC2A 4KMSA 2WNHA 1FXUA 3WIOA 4RKWA 1EK0A 4WFIA 1DLIA 5EPUA 4F1KA 1J00A 1OU0A 1K2VN 1PT7A 1RQXA 1XHLA 3ODGA 2QJRA 3FSRA 3THSA 2ZJ7A 1B6RA 3D4IA 3HE3A 4FS8A 3ZWDA 3HYSA 4RH0A 4UEWA 2ZUVA 4CV2A 5J58A 4JYMA 3HJFA 2QMOA 4Y6LA 5JALA 1DBQA 5JY6A 2ZE6A 4MJLA 4XA8A 3UJ3X 1IEXA 3H6KA 5BNWA 2OV6A 4KTTE 3AESB 2GBLC 1CUIA 4OREX 5D3MA 4ZVTA 2R5FA 4DC0A 5HIKA 1T9ZA 1BOFA 1X9HA 1YI0A 2KM1A 3DSRA 5IKOA 5BSGA 2O9JA 3B12A 4CUZA 1LH0A 3L8DA 4LDPA 4BUJA 4I8XA 1QO0A 3VGJA 1JHMA 4OU4A 1BHSA 3OZBA 3UJNA 3U31A 2P7HA 3F96A 1U6IA 4JSRA 4CMEC 3GBPA 2QX6A 3L01A 2CXNA 5IJAA 4L2IA 3WK4A 4B6PA 4IXMA 2XB4A 3ZHYA 4X61A 4E14A 1ZD4A 1XTKA 1R27A 5CXXA 1VKNA 3T95A 2AYXA 3GGDA 5I8PA 1ODCA 1ZP6A 2WIAA 3GLFA 1OGYA 4NFYA 3MWJA 4E5PA 4KO3S 2VVTA 1WTAA 3IAXA 4L51A 2X14A 3VMMA 3VX4A 2AN3A 3WGQA 5C37A 1TJ3A 3INTA 4C6HA 4XIJA 1Z68A 1QRUA 2JFQA 4XWKA 2O20A 4JC5A 1G18A 5ALLA 5TXGA 4JI4B 3A3OA 2YL2A 4DB4A 5LZ9A 5DM2A 4HMQA 2W6PA 1S3GA 1VL8A 2E1PA 4EJSC 1XFAA 3GG9A 4IHKA 3IOBA 1WXEA 1YZVA 3JYOA 4ZD6A 3R0IA 2AQHA 10MHA 3PUZA 1FXWF 1ZJ4A 5B58T 5EE3A 421PA 1UFKA 1N3IA 1LPSA 2R5NA 3PGA1 3MBIA 2BGMA 2MSDB 3BHNA 5AKIA 1C3OB 3HQ4O 3HUFA 3Q1KA 3E5NA 1IVSA 1WHTA 4H9GA 5JJBA 3W6PA 1JQBA 1N2CA 3LV8A 1UAGA 1AXGA 5EWMB 3PGXA 1D0SA 1KZ7B 1QQ5A 4INJA 4CI0B 3CRNA 2AKEA 2NZXA 1WSBA 3ESBA 5DIFA 4GM4A 3R7LA 3V3TA 5CB4B 2A9FA 1IN8A 1P0QA 2PWAA 4OP1A 4R1OA 2GNAA 2H7YA 5JHHB 4MGYR 2G0AA 2VPQA 2EDCA 2OHFA 4DA0A 1T4CB 5GONF 2HY7A 3QLJA 4LKOA 1STOA 5JO0A 3K6RA 4Z9FA 1CJVC 1WAMA 1JI0A 2VBGA 3IEKA 1U7OA 2EDAA 3P0JA 4Z86A 1UJBA 2RHJA 3IQDB 2PG3A 5E6UB 4EVRA 4CF7A 4GMXA 2C03A 3Q3HA 1XLTC 2EFGA 2AMYA 2A3NA 1Z4IA 1UWVA 2NZ2A 2VOJA 1SBIA 5AXCA 1VSUA 3EEIA 3GCDA 2CYBA 2I1LA 2R6CA 3DW1X 4DDMA 1F8UA 1G4HA 3GZ4A 4WX2B 2Q3DA 5ALFA 5JI2E 1OZ0A 5IUKC 5NLLA 4QUHA 4EZIA 1IL0A 4K0RA 5I01A 1BG6A 5FULA 4TV8A 2WJWA 3LK7A 5BSMA 4Q01A 1HOTA 1XG5A 4BLOA 4IO0A 4YT2A 5AI6A 5L3QA 2AKYA 4NTZA 4Q1FA 5P21A 4H1WA 3GEGA 1XDGA 3K3PA 2X1LA 4PINA 3UGTA 2GBFA 4C2TA 5ILOA 4RF5A 1U63A 1KAEA 2XDQA 1DBIA 2BHNA 3MJTA 4UXIA 4MXDA 3ZTYA 4BO4A 4QXRA 3DO8A 4IL5A 2BFOA 3I28A 4EAAA 2AYZA 3MTJA 4AS2A 2HA7A 5DVZA 3DL0A 2IUYA 3PE4A 1BMFA 4FN5A 4PLVA 1M76A 5HJ5A 1NI4A 3R3SA 1S1CA 4NZZA 2XT9A 2PUFA 3Q41A 2IHNA 2BGIA 3AU9A 3O1IC 2VQ6A 4LZAA 3VBEA 2FEWB 2VXCA 3O4VA 1EXMA 1XKTA 4K86A 3UMBA 1UKAA 1BE6A 1G8AA 1P9LA 2VF5X 4LNUA 1RE1A 2Q99A 2F55A 2HO4A 3KT3A 1BHQ1 3R4CA 4JXJA 4ZYLA 3E70C 3HPQA 1H1LA 1YXMA 2FW6A 3LNCA 3MVEA 3UMCA 5IZCC 1N0UA 2GK4A 2ZBRA 3BD8A 2ZIZA 5FRDA 3MUFA 5H4HA 4OHOA 3VU9B 4LSGA 3DE0X 4PR0A 4B85A 2W48A 4YJHB 3AHIA 1WZCA 1V9SA 1UKEA 4E5KA 4XPIB 3OC6A 3GV0A 4AJOA 1JIVA 4G0NA 3HM9A 4P53A 5GGXA 5CVUA 4L28A 3LDFA 1II8A 1NBME 2ZULA 4XWYA 3IP5A 3QKSA 1WVIA 2FF7A 4UULA 1E4EA 2R1VA 1TD1A 1U5CA 1Z18A 4NMWA 4LFCB 1K2WA 3MERA 1HT3A 5BWLA 3UYLA 5L9AA 1IG3A 1V7ZA 4RULA 1OFIA 2CVZA 1NVDA 2YWHA 4FFVA 4OHPA 2NXNA 5DNCA 2K2QB 5CYFA 4QARA 1L3IA 3IC5A 3EVFA 4Q3LA 1GGJA 1K92A 3P0HA 2W90A 4NQRA 4OHZA 4FZ5A 4QUBA 5J5CA 1FTNA 5SZHB 3TL3A 4XX0B 2Y67A 2OPBA 5F3RA 1JEYB 3BT7A 2J3MA 5DMXA 2EQBA 4K6KA 4NPAA 4G25A 1I5EA 4H18A 4KLNA 4G24A 4LN1A 5BR4A 4NNJA 3IP9A 1OHHA 3TK1A 1ZMXA 4OQ4A 3UMRA 3NXKA 5MN6A 1ZCBA 1S2GA 4Q37A 3N0WA 5TS3A 1OI4A 3BMCA 4D6XA 4B17A 2C4WA 3DE7X 4TV9A 2ZSJA 3FTCA 2XUDA 4WBSA 4QG7A 5KWVA 2PX2A 2VRBA 4HRVA 1LD3A 1AN0A 2V6IA 4G5SA 1TYAE 3NJ8A 1Q1QA 1W0JA 4P7JA 4X1IA 4BEJA 2X7XA 2M1ZA 2ZBPA 1JJ7A 1YUMA 2ORIA 1G8PA 4JC8A 3RBZA 1VKRA 2ATXA 2DUMA 3U48A 4YRSA 3PL1A 1K5GA 2I7DA 2GZSA 1KARA 1XVLA 1MBZA 3FMIA 5KYUB 4KWTA 2OBMA 1GSAA 3PI6A 1RHKA 3FCUB 5EUQB 1A9QA 3DMHA 4DJDC 3I4FA 1LPMA 4KSYA 2PTGA 5T64A 2A14A 4TV8F 4RJIA 1AC5A 1ZGJA 4MYRA 5EHNA 1BW9A 3L7MA 2IYAA 2XIQA 3GGGA 3D2CA 1IAVA 1YUBA 2NTEA 1A5SB 2Q4OA 4M88A 5AT1A 4RIGA 1VMIA 4XYLA 3JPWA 4MEJA 4CIVA 1JEQA 1U65A 1XROA 3ZD9A 2C9YA 4Y2JA 2UVQA 1FDOA 4EEXA 1RQPA 4N5DA 1ZL0A 3COPA 1N6LA 4HZIA 4IHAA 3CKKA 3N0VA 1GTVA 3H65A 4RIEA 5E2AA 3M1IA 3ZHBA 1M0EA 3D8HA 1C9YA 3EJWA 1NVAA 3NDBB 2QPOA 2YBEA 1C9KA 3BQ9A 4ZRNA 5IYZA 1VMEA 5DM1A 3AJ9A 3PCRB 4G5FA 4JI5B 1WWKA 4IG4A 3OM9A 4M1SA 2G08A 2QMZA 1YHNA 2FMKA 3F47A 3G68A 3KCNA 4EAQA 1KR2A 4FHCA 4KSCA 1I7LA 4ETMA 3OC0A 4WXRA 1YZHA 1YK1A 4GUDA 4H6PA 1RRFA 2QJOA 4RZ2A 4WFQA 3BFPA 1ENOA 2JJQA 2FSVA 1UC8A 4L0CA 1MV5A 4MRNA 1U8CB 3M6FA 1D2NA 4FSXA 2QTNA 3FNHA 5LDDC 1QU3A 2C5HA 3AOEC 4B3RB 4Z3OA 1Y1RA 3FCSB 1T15A 1G4AE 1GZUA 1UPAA 3CSDA 1MX1A 2GJ4A 3B6IA 4I46A 4P4UA 5GMOA 1K6EA 3CBQA 3AHJA 1QCCA 3UHAA 4XWAA 4DQDA 5NULA 1YFLA 4XQ9A 1TT5B 1SQ0A 3A6JA 3DTYA 4RD3A 3ZY5A 2Z4SA 4EJ2A 5CX1B 1L7EA 2PV0A 4M36A 3TQIA 1HA3A 1XTQA 1NE2A 4N3BA 4TL7A 1EXWA 3FD8A 5DYWA 3KU4A 4YRNA 3O9MA 1YQ9A 7GPBA 4NL4H 1HE4A 3L8EA 2AF4C 2F1RA 1Y3AA 3IQEA 4K1XA 3QA3E 3ZQJA 4DCUA 5JXIA 4TMFA 4KDCA 1OX4B 5KC8A 2BHLA 4GX5A 5GM2A 3AESA 1W4AA 2VAPA 4WKCA 5DNWA 4J3JA 4BNMA 2GEUA 4LYYA 2PRYA 2BM0A 3IH5A 3M4NA 2PUWA 1G8FA 1YU6A 3CEAA 3IUQA 1U7DA 1ZCJA 2C7QA 4S12A 1I2BA 2G4VA 3WHPA 4QQKA 1WRBA 3ADOA 5AW5A 4XUGB 3BWEA 3PL5A 3BWCA 4ABTA 2VJOA 3BF7A 3C3AA 1U2PA 3G1TA 4OH1A 1RM3A 2QTFA 4F84A 2HWUA 1IZ9A 4EY6A 2I8CA 2Q4EA 4KH0A 4CR7A 2OOKA 3AR7A 1E7QA 3KZXA 4XJSA 3WSVA 5K9ZA 1U99A 3RYFB 2FX3A 4TV9F 2J4DA 3A9SA 3Q98A 1DQSA 4LVNA 3PXCX 3CZCA 4OQLA 4HNUA 5EZ6B 1FPMA 2CXUA 3AR2A 1S3IA 3AUUA 2D1FA 3OTIA 3SMQA 4C3OB 1ABBA 3ICEA 3ZVNA 1JXQA 4EO9A 3NANA 4DILA 4LV8B 1KQ3A 5CW1A 2MINB 3FDXA 4IXDA 3VH2A 1MAAA 3K1AB 4M0EA 4GOKA 5BO5A 2ZRJA 3AP3A 1VA4A 3LT0A 4OHXA 1L7PA 3RU9A 2D1QA 4P7GA 1SVUA 4ZRMA 1MV8A 2FPSA 3PG5A 4UM7A 2X9VA 1OYWA 1XTBA 3C5VA 5KBYA 4OFWA 1WUIS 1M8KA 5AW4A 4P4TA 1I7DA 1C3OA 4IXNA 1JHRA 3FOAA 4LDRA 4ZOBA 5K0BA 4J6EA 2WVAA 2O6LA 3VO2A 1ZNQO 1XNHA 5EWMA 2XCTB 3RODA 1AGXA 4KFCA 2PO5A 1UC5B 1U2QA 2HA2A 1MRNA 2JIOA 3DBOB 4NE7A 3G0HA 2PKQO 3EULA 1NJ6A 4FWTA 5K0EA 5CB4A 1PDVA 3AK4A 5J4KA 3C3CA 3VSDA 2QE7A 4R0VA 5C4GB 5E1DA 1T4CA 3N28A 4BKUA 2D5IA 4QLOA 2YRWA 3PUJA 1A9TA 3RG2A 3ISJA 5ALHA 2VBFA 1KVQA 4JA2A 4GPIB 4RGBA 3B1YA 1HZJA 3TX2A 4WZAB 2R5WA 3ZIUA 1CUVA 1K98A 4QHTA 5FQOA 4BGDA 1RJ9B 3IERA 1BDHA