4IG9A

Structure of nad-dependent protein deacetylase sirtuin-1 (open state, 2.64 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
269
structure length
268
Chain Sequence
MRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Human SIRT1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-1
total genus 85
structure length 268
sequence length 269
chains with identical sequence C, E, G
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4ig9A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4ig9A01
2H2DA 3EYAA 3F6BX 1XLTC 3D4BA 2A1TR 5FYQA 2Q5QA 4FVTA 3D81A 3GLUA 5MF6A 2PGOA 1M2JA 2H4JA 4IF6A 1PO7A 2FRDC 3E9YA 1JSCA 4V1CA 1PTJC 5DGDA 1UPAA 2JIBA 5EJ9A 5BWOA 1POWA 2PGNA 5EJ7A 1YC5A 4L2IA 1EFVA 1YHYA 4UTRA 2VBGA 3FLMA 3CLUD 5BWLA 4K9PA 2UZ1B 3ZGOA 3GLSA 4D5EA 2QQGA 2AG0A 4RMHA 4K9KA 4IG9A 1M2NA 4BVHA 4F4UA 4RJIA 2B4YA 4BN5A 5EJ5A 4F56A 2H2HA 2A1UA 4X3OA 4MPRA 4HDAA 1NM5C 4JUBA 2EZUA 4JU9A 1PT9A 5FEMA 4QQ8A 2OD7A 4QELA 4UTXA 4I5IA 4KGDA 1EFPA 2Q27A 2VK8A 1OZHA 4BVEA 4J1TC 3LQ1A 4K9MA 4FEGA 2JI6A 2H4FA 1ICIA 3JWPA 4JUCA 2UZ1A 5EJ6A 1Z8NA 2EZTA 3CLTD 4X3PA 1J8FA 4RJKA 1PYDA 2EZ4A 1YC2A 3GLTA 4HD8A 1Q1AA 1PNOA 4K9OA 2JLCA 4BV3A 4UTNA 4BVFA 1YI1A 4MPJA 1M2KA 4D5GA 2HJHA 1SZCA 1ZPDA 4JD5A 4RJJA 4ZZIA 2VBFA 4KPUA 2IHUA 3D7KA 1U2DC 4MPPA 4MQ5A 2IHVA 4Y6QA 2H2FA 4UU7A 1Q6ZA 4FEEA 1PI3A 5EJMA 4KXQA 1N0HA 4JU8A 1POXA 3HWWA 1M2HA 4C7BA 2C31A 1U31A 4BN4A 4FZ3A 1M2GA 4R8MA 1Q17A 5D7NA 4BVGA 1YHZA 2Q5LA 4GM1A 4JT8A 2FWNA 5MFPA 3U3DA 2NYRA 2Q28A 3JR3A 4GPEA 5EJ4A 4UUBA 2Q5OA 4JUAA 3ZG6A 2H4HA 1U28C 4ZP1A 2WVAA 5K2OA 3PKIA 1Q14A 3RIYA 1YI0A 4C78A 1OVMA 1YBHA 1U2GC 2VJYA 4MZXA 4COKA 1UPCA 2WVHA 4V1CB 5EJAA 2OD9A 5DEIA 1V5GA 1Y9DA 4J16C 4O8ZA 3K35A 4K9QA 5EJ8A 2AG1A 4L3OA 4UUAA 2JI8A 3IAEA 4K9NA 2Q5JA 2OD2A 5K6TA 4GG1A 5K3SA 2NXWA 2DJIA 4V1CI 1OZGA 1PNQA 3EA4A 2JI9A 1QPBA 2BRUC 2VK4A 5MFZA 1S7GA 2W93A 3RIGA 4GM0A 4UU8A 3CLRD 4TWJA 4G1CA 1MCZA 2H2GA 4K9LA 4RMIA 2JLAA 3U31A 2WVGA 5IMSA 3FSJX 1YTLA 4JUFA 3PDHA 1S5PA 4IAOA 2H59A 1T9BA 1T9DA 2FN3A 4Q9DA 4GM4A 5AHKA 4UTZA 1D4OA 2OORC 5MGNA 1PVDA 1OZFA 2Q29A 2EZ9A 5BWNA 1E3TA 2IHTA 3PKJA 3FZNA 2FR8C 5K6RA 2FSVC 1SZDA 1BFDA 3F6EX 4Y6LA 1O96B 1O97D 2V3WA 3GLRA 4BVBA 4UTVA 4JT9A 2X7JA 3EY9A 3ZGVA 1MA3A 4BV2A 4BUZA 3CF4G 2H2IA 1HZZC 2OO5C 2VK1A 3HWX1 1T9AA 1UPBA 2EZ8A 2QQFA 2JI7A 2VBIA 4GP9A 5DGTA 4Y6OA 4TWIA 4JSRA 1DJLA 3IAFA 3CLSD 1V5FA 4JUDX 4RMJA 2PANA 3OE1A 4QPZA 1T9CA 1YNOA 4RMGA 1V5EA
chains in the Genus database with same CATH superfamily
3PFHA 4B87A 4AS3A 2D0DA 3E9RA 3HDJA 3IUYA 3RVSA 3MA0A 1XHFA 2VAXA 1O0BA 1Z4NA 3KAKA 1MPXA 3VR0A 1I3OA 3RLFA 5JH7F 4EYSA 4OKSA 3UPTA 1G5QA 1PSWA 1YB1A 1ZNXA 3QEMA 2IS2A 2WAAA 1V9CA 2WK1A 1JLMA 4U8GA 3R74A 1BE8A 1VSBA 5DCWA 5FUQA 1XIVA 2WIKA 3DFUA 3SZOA 4D44A 2J9ZB 2EP7A 4RVCA 4XH9B 5TDHA 3ZN2A 4ASUA 1N8TA 4QUEA 4BN5A 1KFBB 2DRIA 4KQIA 5B7PA 5KOYA 1LLFA 2I67A 3GDGA 4NK4A 1JMVA 4OP1A 3RVJA 3WMWA 4CLOA 4ND8B 2PX5A 4D4LA 4PFJA 4Q02A 1G2PA 1GG2A 4YP6A 2CCGA 1JAXA 2FFJA 2NXNA 2GBIA 3E4CA 5AM5A 4DLKA 3A6FA 5EQJB 5BOVA 2BM0A 3DBRA 3K05A 4HGQA 1PZHA 2OGUA 1SQ5A 2AHRA 4JB3A 4JUCA 2QORA 5JY1A 5EQFA 1HSZA 2VF5X 3R44A 2VYQA 1JG4A 4DVGA 4EG4A 5I4IA 3VI3B 3AFNA 1WPRA 2V65A 3COYA 1C0EA 3S2IA 3UJPA 2GVNA 4EUHA 1P62B 3GNLA 3LLSA 4HDMB 4TN5A 1DKUA 3CPEA 1X8KA 2RIPA 3HKCA 1VPTA 3DZCA 3KU1A 2GYUA 4FN5A 2P11A 3U17A 3MF4A 3ESQA 3QXGA 4ZK2A 2IIQA 1AHPA 1T5BA 4B3HA 2KBFA 1GO2A 4MVJH 3S2ZA 3A6DA 1SXIA 2LKCA 4LK3A 3G8BA 3JQCA 3UATA 4D3DA 4HUTA 5B2EA 2XCRB 1N6OA 1QM5A 1A5SB 3JARB 4D8UA 2WHPB 2BSQA 1E0SA 1Q19A 3B7GA 1FTNA 1NMQA 3W5IA 4C7KA 3THXB 4RPLA 2CXOA 5GINE 3AKCA 4UEQA 2OY0A 1UFKA 2A4MA 3GVCA 1BS1A 4KMMA 4P7JA 2B5OA 3TDNA 5KHOC 1B16A 1M2FA 2FXVA 5T3YA 2QRPA 4TLMB 1Z7YA 4UNPA 1FYVA 4QPDA 1BXGB 4BNHA 3GA7A 3JQ6A 1R3DA 1CUJA 1UBCA 2HMVA 2ZRIA 3FWPA 4M9QA 1JVBA 4WFJA 4H59A 4FB5A 1E6KA 1JIQA 3F6YA 2OAP1 1NVGA 3HKEA 3PRYA 3DAYA 4JVSB 8ATCA 4P3YA 2IEIA 1I3MA 4UREA 3FMGA 3W1VA 5IK2A 3JS5A 1OAKA 3VQTA 2QYHA 4E09A 4K9LA 1UIRA 4D57A 3LT4A 3TRHA 2HU8A 3WHLA 1MFPA 1N4AA 3X1ZA 1XZBA 1PJBA 2H3EA 4C0SA 4WECA 1PVDA 1OZFA 3K31A 2V4MA 5CRIA 2VDQB 4TVBA 1V3VA 2JAOA 4ZT3A 1L5RA 4X3CA 1D4AA 2VTKA 3E8SA 3FETA 3LHIA 4B31A 4D9EA 1LBQA 1KH2A 4IVNA 4BPRA 1SR8A 4ZYWA 2FWRA 5TVKA 2IPNA 2ZSEA 5F9FA 1ZJ6A 1DMRA 2QX8A 4ONEA 2V6BA 3ZVLA 3BJEA 2FSUA 5C0OE 4KOEC 1JIUA 3IDOA 4B32A 3BWCA 4YMUA 3R5XA 2YYYA 1QOQB 1YKFA 1KJZA 1C7QA 2FJUA 3G8AA 1WMBA 4HLNA 4BQSA 4BS9A 5AUOB 5CTJA 4I99A 4LOHA 3HGQA 2PZMA 2J8ZA 3GZTB 3MVEA 2PT5A 5FL7A 2CVQA 3M5CA 2IELA 2XUIA 4HI0E 2CF6A 1ZI8A 2H00A 2K7ZA 1QHNA 4E51A 2MR5A 7MDHA 2I4MA 5KSYA 1Z6YA 4GUAA 1CY7A 3DFIA 2P9QA 1RBZA 2HQ1A 1T2CA 4MRPA 3PZBA 3IBGA 2FPGB 2OCXA 4XYEA 1BYIA 1YU6A 2NYUA 4JB0A 1RRVA 4JXXA 1V11A 1KSGA 5DP1A 3LDFA 4F56A 3R7WA 3THSA 4AVYA 4LX8A 2Q4TA 1WCIA 4J2OA 4Q6BA 1KJQA 5D01A 1DTEA 4A6DA 2HRCA 4HDCA 3EE6A 3MOIA 1MIHA 3AB7A 5L3QB 2Z5LA 3RWOA 1TMYA 1MNAA 4RSRA 1UBSB 1Q7EA 4LCEA 1ULSA 5KTSA 3WAJA 4L6CA 3ZZTA 3EGEA 1GILA 2XMQA 5IAKA 1H0SA 3RUEA 1PNOA 3C3EA 1L3BA 4J7XA 1YS7A 3C7TA 3TRKA 4KODA 1XN4A 3FZGA 4GPBA 2P1ZA 2A78A 3K71B 3PLAE 5KREA 4UMVA 3BD8A 1WPQA 3GARA 2C1EA 4L5IA 4LHZA 3IURA 4MAAA 4FSDA 4WOBA 3D0RA 2ZVPX 3OCCA 1PI3A 1O08A 2D5CA 2CXNA 4WLVA 4GKVA 4FZ3A 3KVRA 4LMPA 1LFDB 3UHFA 1S02A 2CXSA 3KELA 3JQGB 3KQWA 4LQLA 2CXQA 5EMHA 3ZCSA 2I1VB 5D1NA 1QHFA 1U8YA 1BS9A 4Z1MD 4U2FA 3OM1A 1E69A 4PCUA 2H07A 1CPYA 1DSSG 1QK5A 3MT7A 2XUAA 3N28A 5KAMA 2OFXA 5CX1A 3I53A 3H11B 3GOQA 4CQLB 2J3EA 1JBQA 3AY6A 3BILA 1BIFA 1VKNA 4AN0A 4MH0R 1QVVA 1MB2A 4PZUA 1JMYA 2C61A 3KQMA 4H18A 3H1EA 1O95A 2XAUA 2QLNA 1XU7A 3CEHA 3PWKA 2BGIA 2VRBA 5BSWA 4WUTA 5FI0B 3LY5A 4YXFA 2IQIA 4D45A 4YCLA 1W52X 5BURA 2O2GA 4Q19A 4L5YA 1AKVA 3TLMA 2DUWA 3ZHSA 4NESA 1SPXA 1FMLA 2BFDB 2FY8A 5LD2C 3QE9Y 4WVFA 4TUYF 3FUCA 3FTPA 3RO7A 5AW2A 2WF9A 4YMIA 4G8BA 1NJ2A 4O0LA 3EMKA 3DZJA 3GAZA 5A4MS 1AC5A 1L5OA 1ZNYA 2D2VA 1LVUA 5EERA 3RJ9A 1SQ0A 1W85B 3HP7A 4C3VA 5B6IA 3GCXA 1JG1A 5K0JA 1XZGA 3CKLA 4IF4A 4B0OA 3O2QB 1Y8AA 1PGOA 3ZZUA 4N3NA 4BNIA 4CM4B 3EOZA 2CHEA 4FQ8A 1L5KA 4GNRA 2C4TA 4DJJA 1K7EB 2YNMD 1U8AA 4M8LA 2QUKA 3QTBA 5ADUS 1O5IA 2CLSA 2DWCA 5F78A 2R751 1V5FA 4TSFA 4NU8X 3F5DA 3P7MA 2PANA 4HGPA 4TLDA 3PQDA 3O9VA 1TUBB 1OX4A 4OHKA 2IU0A 5I7OA 5DHFA 1EIWA 4ODIA 2BFAA 2G3YA 2Q6KA 4A82A 3DBIA 2PFGA 1W85A 3G9ZA 3AJ9A 3WJ7A 2L42A 4FKBA 4KO8A 4OLBA 3WWZA 5JCOA 1B41A 3PQEA 3KOYA 4IXNA 5J58A 1D2HA 3Q87B 4B7AA 3BH6A 5IAEA 2BGMA 1IIRA 5HCUA 4QYIB 1NVEA 1VL1A 4D80A 3UKJA 1BCRB 2YKGA 2H4WA 1CP2A 3R7DA 3GLGE 3TZEA 1IZ8A 4B3XA 3P71T 3DFZA 3SS9X 3S1LA 4LE2A 4MKXA 4ZEWA 2IUYA 5CH8A 2CFIA 1X42A 4C88A 4EGQA 3A4YA 1O7JA 1QZUA 3DKPA 4JHXA 3NDPA 1ZH8A 4KFSA 4QFCA 2B7BA 1ONBA 3MK31 3OF3A 1SHKA 3ZY2A 1WCWA 3R2JA 4LOLA 4V02A 4EQZA 4U5QA 1DJMA 4Y30A 2I2AA 1PGQA 2BKEA 4V3BA 4JQZA 5KVSA 3M9XA 1K6MA 2D0PB 3FR8A 4NSNA 4OXYA 4BV3A 1BTOA 3CIFA 4JMLA 1RTKA 1LSOA 4BVFA 4GD3Q 4R1NA 3TLGB 3ZHOA 4K3UA 1H8ED 2EERA 1R0LA 1ESDA 1KA9H 1U2SA 3DBHA 5EIBD 4L15A 4ASUD 3SMVA 1SZCA 3MOSA 2VBFA 4WADA 3KLOA 4WNIA 1HR0B 3U81A 4R9UC 4GI5A 4L7VA 3DLAA 2G5CA 5LM3A 1ZXBA 1M2HA 2DHQA 1E2BA 1RJ9A 1GQOA 2WNHA 3MYYA 1KDOA 3DLIA 4ID9A 3BMCB 2MYNA 3PD0A 5DT2A 2UYYA 2WTXA 3QK7A 2Q5OA 1ZOSA 4X94A 3G2LA 5CT4A 2MDTA 5ALOA 3WRVA 3HY6A 5A6VA 4LXYA 3GYGA 2WDZA 3X3HA 1SHZA 3ZJVA 1A77A 1P3Y1 1QS0B 1NBME 2QMOA 3W34A 1RRGA 2Q2WA 1D7AA 2PRYA 1EH5A 3IEMA 1I5OA 1PK9A 1DTSA 3JR7A 2JHCA 4DJFC 4CRWB 3ZY4A 3P9RA 2FTKE 3NJ8A 2DWQA 3A6LA 1ZGJA 2IPOA 2PKRA 2ZSDA 3ACDA 3QKSB 3O2NA 4F3NA 1HBJA 2E89A 2WF8A 3PQ2A 1KI4A 1V8FA 3HA5A 4CYMA 1RSZA 1WW3A 4PAQA 3M3DA 5K8VA 1MN6A 4LA4A 2WE8A 2OORA 3DT9A 4KAJA 4YJ3B 1EI9A 3IVMA 2RHDA 1L4KA 5JLAA 5EZQA 5K99A 5DZSA 1SIUA 2A5FA 4ZICA 2MR6A 1L5GB 3WY9A 1AGRA 4GC9A 4U2GA 2D2IA 1ORIA 4QDZA 1IYZA 1TCVA 2SBTA 2OM2A 2VTEA 1H42A 3UANA 3ISTA 5JRZA 5AI5A 1XD9A 1E7SA 3F6EX 3B38A 1TO6A 3H1BA 4BO6A 1SXQA 3LQRA 3D4PA 1VJRA 4P3OA 2A84A 2HWYA 4QOSA 1O9GA 1PFGA 2O19A 3DUWA 4MGYR 4TL6A 4E7OA 1C80A 3E1KA 4GH5A 1ZISA 4O0MA 2ZRJA 2EJVA 1QG6A 2VDMB 2QNIA 2AXNA 4TWIA 3I9NA 3MRVA 1FXUA 4TXLA 1RXWA 2I03A 2OLEA 3OM9A 5FXMA 2CMHA 4C0XA 1KDZA 3LQYA 1RYYA 1Y82A 1U98A 3JVVA 1B6GA 1FZQA 1KAHA 2OENG 2XMCA 3HHEA 3HU2A 4YAFA 3L0YA 5SY4A 3SEFA 4UHKA 2JLUA 3GX1A 5CA1A 4BBPA 1F3LA 1M5RA 3TOSA 1P1RA 1RS0A 1K6JA 3DCIA 3HNPA 4L2IA 1MV8A 4UE6A 2ZETA 3IAAA 4QFBA 1JHQA 2ZJ3A 3SQXA 9GPBA 4C4TA 4ER7A 2PWPA 4YCBA 1JLSA 1XN1A 2Q6TA 2WYHA 3EZ7A 3UK6A 3V46A 3KHSA 3PD1A 5T4HA 5HM6A 4HEHA 2Y6UA 4IQ0A 4ARZA 5D3MA 3AETA 1GN8A 2P0EA 3BC1A 5LZ4A 3WGIA 4AMGA 4UUPA 2X8AA 1PT9A 2IIBA 3OZTA 3AIKA 1LS6A 2AR0A 4WNYA 3INRA 1Y1SA 4DSZA 1OAAA 7REQA 2O1XA 5D6NA 3SZLA 4DA4A 2YCLA 3NHRA 1NRJB 1AS0A 4MS4A 1P0PA 1T2VA 2GN8A 2CE2X 4YWHA 1QOPB 4KO4S 1F4LA 5GOZA 2AL7A 1VIDA 1QFJA 1PS8A 2GCOA 2OWDA 4BRWA 4QLBA 1SUPA 5KUTA 4PSDA 5J2UA 1M0EA 4Q1BA 2Z95A 4G8JA 1UJ2A 4HEQA 4TV8B 4QT0A 4ZQFA 3CEJA 1NJGA 2WWRA 3QMWA 3FX2A 4REQB 1VLHA 1Z2PX 4QXMA 3ZZ1A 1UWVA 4IR7A 1OLUB 5JS2A 4PG8A 5AJHA 1ORHA 4P80A 3UWPA 1E7RA 1O95D 3UK0A 3GLGB 4DWJA 3WO1A 2X5XA 3LBHA 2B1IA 6Q21A 2WKQA 3UCFA 1BJKA 1MO2A 4J7UA 5KYGA 3C41J 4X63A 4HDMA 2EIXA 3OZAA 3Q5GA 1YUMA 3V4VB 4JP1A 3AOEC 5GONA 3U0BA 1GG8A 1ZSYA 4ZVUA 3SEAA 2IVFA 2J0VA 1TCAA 3IP8A 1KKMA 2JRCA 5DM4A 2QM3A 4M88A 5IW8A 5C5EA 4V0SA 1IQUA 1V43A 4BNKA 4A0FA 1L4HA 2IUEA 4IICA 1W581 4PWYA 2QRGA 3DM5A 4Q1FA 3FM9A 3UG6A 1X7ZA 2JI9A 3L7KA 3R6DA 1T25A 2BCJQ 2FW0A 1AO0A 1HRDA 2P68A 1CUEA 1NXWA 4DL9A 1IK6A 3A4TA 3AYXB 4R83A 1Z5NA 1EQAA 4E7PA 3B85A 1XCGB 4DLWA 1NDUA 3FSJX 2QAGA 3AP1A 5IAGA 4B84A 5IDWA 5AJZA 3LWDA 2PZGA 3I64A 2QDXA 1E3JA 5JS7A 4MQBA 4WCFB 4G36A 2PTGA 4O2RA 4RZSA 4YJ2F 5EJIA 4FOSA 1BGVA 2WUWE 4IIGA 1C3JA 1C9JA 2PV7A 4CF7A 4M1TA 3BQMB 1RYHA 4XQ0A 3BZBA 4B82A 3JW8A 1EDDA 4PQFA 1YVUA 1YVDA 4RESA 5LZ8A 1VE1A 4LBZA 3IO3A 3T5TA 4XUCA 1QRAA 3NM5A 4GHWA 4BIMA 3GLGA 4GIBA 2HADA 3O8CA 1DQYA 1N2CB 2J0SA 3M5PA 4Z4CA 5IFKA 3I9KA 3A05A 2GA8A 5ARDA 2XGJA 1NJFA 2V7TA 1ISJA 3GZJA 3T6KA 5DX8A 4UHEA 2W6JD 3G0GA 1UDAA 2ZJ6A 3KRTA 5C1IA 5C3MA 3EQZA 3I76A 3FTEA 4TZ0A 3M4NA 2I4LA 3UWKA 3MWKA 1NBAA 1DKOA 2AYZA 2V7PA 5EJ7A 5AXDA 2V03A 4Q16A 2VZLA 4KWHA 5DGHA 3U61B 2EJCA 1GAJA 2UZAA 4HS4A 3NYRA 4DYDA 4DE5A 4E12A 2I4RA 4PINA 3ZIDA 4B76A 4YRIA 3O7WA 4F3KA 4FSHA 2CVPA 1RM4A 1U81A 2BP7A 2ZW9A 2CXHA 1FC0A 1SQFA 3PF8A 2CBGA 3PK0A 4ND4A 3PNPA 4QUDA 4S1OA 4DANA 5M3BA 1XZLA 4PG5A 1JDPA 2RI1A 2YNMC 1P0IA 3IMEA 1QVZA 4L57A 4GP7A 4JDPA 3JTMA 2H9AA 3GV0A 4MUGA 4NX2A 3BWVA 4DLRA 2DPXA 4K6OA 1U94A 3V33A 1ZIXA 3W5CA 3F8WA 5HQJA 2XUZA 4YIHA 1IXZA 1Q6YA 1Y6QA 1DKQA 2UVPB 2WE7A 3EZFA 4EITA 1DCTA 3C5HA 2BLLA 2YWCA 4K8RB 1F7UA 2R6GA 4RD1A 1QO9A 1Q7TA 2QSJA 1UOQA 4RHTA 4Q34A 4LYHA 3LY7A 1BKYA 4J90A 1FUYB 4MROA 3F3YA 3JSXA 5H80A 4UU1A 1UADA 1IBKB 3KQNA 2QRZA 3M0EA 3OE7A 1UMCA 2YV3A 1AMUA 2P90A 5FOXA 4INJA 2C8VA 2GNPA 2HM7A 4LRQA 4ZTBA 1WXFA 5AXBA 3TCKA 3KG2A 1YFZA 4XCQA 4GLBA 4A6XA 4EI7A 4AL4A 3GFTA 4UUBA 2IOFK 3PUVA 4OI4A 4EPVA 4EBFA 4NXMB 4GEKA 2B8TA 4L9AA 5JCJA 5HWSA 4JAVC 1G7RA 3G8DA 2Y77A 4LOJA 4ENSA 1U2GC 2VJYA 3E5HA 2CJFA 1ZVKA 1OLSB 1VFNA 2FUEA 4H15A 4V1CB 2YZKA 1SKMA 3VPCA 3A4LA 1PJ3A 3TXAA 1Z07A 5LXTA 1V2GA 2BKUA 1O0SA 1M2OB 1AUPA 2JB9A 2M6RA 4ND1A 4NZPA 5F7OA 3MWEA 2N1MA 5CT9A 2V74B 3JWIA 3ZQ4A 1V71A 3A9CA 5E1MA 3VPHA 1LRLA 3GJ3A 3RTGA 1R8XA 1WXEA 4ALJA 4UAVA 4R40A 2JIPA 2IYPA 1KYZA 3L7OA 3DHVA 3WAKA 5KYXA 3JVUA 1TT5A 1G7CA 1V1MA 5D86A 3RS0A 3UQZA 4BNGA 1TYAE 4IAOA 1N5LA 2FN3A 4BBZA 1IY0A 4CQLA 3TMAA 3U3OA 1WD7A 3ODPA 3TSZA 2Q6VA 4HNAB 4IFBA 5IJ0B 3LO8A 3QEBZ 1G1MA 1MORA 1S3GA 1IOVA 3GA5A 3ZR4B 1PQWA 7AT1A 2FEPA 3TQSA 2XMSA 1EFTA 1UUFA 3ITKA 3JZMA 3MJHA 3PCXA 2A9OA 1KJWA 5LP6C 3ZKAA 4RSHA 4TX1A 1MC1A 5DYNA 3GIWA 3W5HA 1O58A 4LHVA 4LMAA 4J4BA 3TOVA 3TZKA 3EVBA 1JU4A 5C5IA 3CM0A 1ZC3A 4YRTA 2BLNA 1KU0A 1S7CA 4IOJA 2CCKA 4XB6B 3EPJA 4MZDA 1X8LA 2Q2QA 1ISMA 2YW2A 4DZRA 3EPLA 3HCWA 1UEIA 2XDQA 1ZUD1 2CDRA 4NEQA 1N92A 1GU0A 2QZSA 3EEBA 4B8WA 3X2SA 5L6LB 4Y1EA 3OMXA 5MDHA 5LQDA 2ERXA 2XMRA 3B9RA 1ZJZA 3EA5A 4N01A 1EB9A 5E2IA 4B7XA 4NBUA 3GGGA 1CVIA 2BTQB 1OXVA 4YASA 4AYWA 5KC9A 3DCJA 3I0NA 4FYXA 2R2GA 4J6EA 3KDAA 3UTCA 1P2FA 1RKVA 1MF7A 3M2PA 5IVPA 2C9DA 1TUBA 3NHWA 3VISA 3NUZA 1G8AA 1KH3A 1D0SA 3HB0A 1R8JA 4RKRA 5BUSA 3LWNA 4HY3A 4A3SA 4OPMA 4YAUA 3LFTA 5CHEA 2I2CA 4B73A 3VUEA 5CH5A 4E2ZA 5BVGA 5EUQB 1CX9B 2RHMA 4YLGA 2DKNA 1JV2B 3AG5A 2ZIFA 4EK9A 4P86A 2ZGVA 2R97A 3MWJA 3UJBA 1BDHA 2JVJA 4XVUA 3T95A 2AZXA 3WDKA 2CE7A 1GKKA 3LXUX 3H9CA 5A4AA 3BJRA 3TDMA 4QYMA 3HK2A 5IC6A 1UT8A 5J59A 2J3HA 1JEDA 1F8FA 1XF1A 3HVHA 4CMBA 1U1CA 2EX1A 3AU9A 1IUKA 3ZY3A 4ZHQB 4QGAA 4Y6QA 1CDZA 1MJGA 2PVPA 3KUDA 3ER6A 3OQIA 2PUHA 1N0HA 3HCNA 4M7WA 3NDRA 4FD3A 4HMPA 3CF6R 3MAJA 4PO3X 3CNQS 4ZIRA 4PLFA 2ZR8A 4KPYA 2JDIA 5KJEA 3X2EA 2R6DA 2Q28A 2X7HA 1A4IA 3Q8WA 4O5AA 2ODNA 1NMEA 1K66A 3WOHA 2YIDA 1L5LA 3DKVA 3DKKA 3U6BA 2DX7A 1BE6A 4AIRA 3VC3A 4RY9A 3C98A 1R64A 1XKQA 1CUGA 3EF1A 3R5KA 2Y99A 5ECGC 1QH8B 4R3NA 5KU1A 4L8FA 4BZZA 3AFHA 2W8BB 1PZFA 2BC9A 4FHCA 1C7ZA 4LI0A 3MWDB 1UXOA 1IN6A 1US8A 1G63A 1VFPA 3OTWA 3PWSA 4GW3A 4RGVA 5HZMA 1H23A 1MC8A 5H68A 3JPWA 1MOSA 2OFOA 4WY5A 4DCTA 1ZH6A 1XLWA 5T7BA 3C7KA 3C74A 1CJVC 3JQEA 3KTAB 4RS4A 1I5RA 2E0IA 4ZXPA 2UXCB 1FVHA 3GLIE 1RAGA 2ZYAA 4M0MA 4RTLA 3ADDA 1L8LA 1H2BA 3DQZA 2ZU0C 4FW9A 3I45A 4TMWA 4OAOA 2RGGA 4Z0TA 3NM4A 1WMSA 2YRWA 3JVEA 1EWKA 2DUMA 3KSZO 3P9SA 3Q15C 2PA3A 4YPOA 1KOFA 2EHDA 1E6MA 4IIDA 3K1YA 4O4IB 1KEEB 2JVIA 4R05A 4R69A 1YDMA 4W63A 4PZLA 3WGYA 5C37A 4I8DA 3RC7A 1K68A 2B5VA 4PANA 4RL4A 4M9XA 4OQQA 2LIPA 1NXSA 2GFIA 2ESRA 3GJ5A 5BYJA 4KR2A 4LSMA 4BFTA 4YQZA 4X95A 1YZYA 3HHPA 2RHRA 1ITZA 3OETA 3TW8B 5ALJA 4B83A 4KL8S 1CFZA 1PWHA 4CGYA 3FPEA 4IXDA 4BIIA 3E8XA 4WZAB 1AV6A 5H9VA 3FCYA 3RYFB 5ADWA 1N0WA 3KPUA 4A92A 4G4JA 2A1TR 3IUNA 4FVTA 1L1FA 4QKQA 1NNSA 3NHMA 3T4XA 5B36A 1I5EA 2IE0A 5CDUA 3VDRA 3IKJA 3ZCUA 5JJKA 3H4VA 3OEED 4EGFA 2F6RA 4JROA 2AGVA 1XNJA 1E89A 1FPMA 1OASA 3I2HA 3KKEA 4PCLA 5K09A 4ZA2A 3K0CA 2J6BA 3ULKA 2VRNA 3NH6A 2QQGA 3QM1A 2O5RA 1KZYC 4QASA 2XNJA 4IG9A 5CIQA 3VSCA 5JEDA 3B48A 2AJ8A 1P0CA 3TX2A 1JB1A 2VNJA 2ZB7A 4MW9A 4NH0A 4BMCA 1M6HA 2X8BA 1ST3A 5I45A 3S3TA 1W88B 4HGYA 3K1JA 1SPBS 4TT3A 4ND8A 1FDTA 1GXSB 1L5MA 4E6PA 3PD7A 4NI5A 5AK0A 4YCDA 4AQYB 2J3LA 2HSGA 2QMUA 5D84A 3DNPA 3ZGZA 4AKIA 1U3VA 1M34E 2DF8A 2W2OA 2Y27A 3FSGA 4RHCA 4LQ4A 2EVWX 4YRGA 5BQFA 1PNTA 2NUTA 1FMTA 3VDXA 2ZT6A 3UUGA 4UMFA 3PHHA 4N5NA 1HV8A 2XZPA 3FUTA 3M3HA 4UHFA 4EYQA 5GJBA 2KHZA 4HLCA 2HWWA 2PJUA 3B6JA 4P7BA 1IPEA 1K0FA 1Q57A 4WNCA 3WKDA 2FSFA 1DRUA 1XELA 4XYGA 5ALIA 4EUKA 5I7VA 4TZ6A 1P33A 2GXUA 3OHSX 3KNZA 5B1HA 3V34A 3D7KA 4AY2A 5TQVA 3BM5A 1NC3A 2IHVA 2VPQA 3ER8A 3H04A 3PNSA 4RD0A 3T5AA 2O8CA 2G72A 2LVBA 4GFDA 3RRXA 1T9GS 1XKTA 4NULA 3QFSA 2P8JA 3A4IA 4DWVA 2NXJA 1WDKA 1NQXA 2PIDA 4IW3B 1GFIA 1TK9A 1CETA 3LF1A 1GA1A 3CRNA 5JDIA 1F3OA 3DEHA 1Q21A 1OXKB 3U6KA 4ES6A 3AHEA 3N6VA 2GO7A 3RSSA 5BR4A 1UBGA 1II9A 3GHHA 1TF7A 4HVAA 4LC0A 4MZXA 3E2PA 2IF2A 2P4EA 4L50A 4EO9A 3SWWA 4UOEA 1HOXA 4J3JA 1FE8A 3NX4A 1P1HA 2X3YA 5F76A 3SYKA 1UIMA 3OM8A 2NQTA 1NE2A 3DV2A 3BFVA 4WAUA 3SSNA 1A9TA 4TWZA 3VU3A 3L4SO 5AOBA 1XNHA 4ZQIA 2OHJA 3R3ZA 1V6SA 1VJTA 3NNNA 3H0CA 4TL8A 1Q0HA 3NUGA 2YH2A 3AM5A 3A04A 2FWMX 4LJLA 4CV3A 5BMVF 1DDOA 2H2GA 1ZI6A 4OJYA 3FRIA 4R41A 4OXQA 2ZTVA 2JL1A 2DUNA 3NPAA 3RIMA 2OGTA 2GKSA 5EP2A 5I6DA 4GKJB 5KSOA 2CNNA 4L0DA 4RXMA 3UXMA 4Q4CA 4DV6B 2X9GA 2ZSHA 1QCYA 3NOOA 2HUPA 4FIDA 3H16A 5FULA 4NJEB 2VJMA 4Q9NA 2R00A 1BRTA 3NXKA 1KMCA 3TB6A 3DVQX 4W5HA 2OQRA 5JJBA 3UGTA 1P0MA 4EI8A 3BERA 3C8ZA 4MA0A 3A9SA 4H08A 2ZBUA 5E9QA 4I50F 4DXDA 5FTWA 2RB4A 4JUDX 2FW7A 2OVFA 5JNRA 4XOUA 5CD9A 2ZXUA 4IV5A 2RKBA 5CFNA 2CSXA 3CVVA 4ENRA 1EA5A 2AA3A 4KDCA 5CM2Z 3OUTA 1M6NA 5HK9A 3EYAA 3I2GA 1QYWA 1U9YA 2XIQA 4M6WA 1WHSB 3L7LA 3QOXA 2ETVA 1DEOA 1XNRB 4O2AB 4WZZA 2WPDA 4C89A 1CLEA 4LPKA 1JHDA 5EXEA 2ZFUA 1W29A 2F8LA 2XNDA 4AZ3B 2FR1A 4DY4A 1UDBA 3WWDA 1YK1A 1GPUA 1KWKA 2BM9A 2XLCA 1DQPA 3ZVKA 4RHYA 1I7QB 1U11A 2V5AA 3GEHA 2WQZA 5FA6A 2H2AA 3ZWKA 3DZ8A 3PFBA 1SC4A 1ZI9A 3RRYA 2A5GA 1FXWA 2KSQA 4RVGA 4B0PA 1KK1A 1B0UA 1TQ2A 2JJYA 3QPAA 3DE1X 1WEKA 3TZBA 4B74A 2K7FA 1KRWA 3K5WA 1XTKA 4FINA 3A6PC 1Z4KA 1H6AA 2B20A 1DT3A 5M29A 4JOQA 1H69A 1U1DA 2BY4A 3MMNA 3GVPA 3C3XA 1BX1A 3HI6A 3PXBA 4B40A 3OUZA 3CLTD 3QPCA 4L4SA 2CVHA 1MOQA 3PYXA 1QKIA 3Q6MA 4MWCA 2WIDA 3MYRA 2ZJOA 3FR7A 1BC5A 1FVXA 3LW7A 3MUOA 4BWFB 1O8CA 4DNOA 1FVFA 2XVAA 3B3JA 2D74A 4F6LA 4Z49A 1G8JA 5FADA 5C7IO 2HJHA 1O3YA 2WB4A 3ISJA 2NZ8A 2AI1A 5LUAA 3EZ9A 1M0WA 1UP4A 4EW6A 1Y9JA 1LUAA 4LDAA 4K5QA 1X80B 4AYTA 3BZUA 2FMIA 2PBLA 2PZLA 3RYFA 3W2GA 5AW7A 3H4IA 4CBVA 1IWPB 2LCFA 4MUXA 5HILA 2C0PA 1KGSA 3IUBA 1GOTA 1FQWA 1VYTA 2F43B 3X2FA 1H2AS 4HH1A 3AM1A 2VF2A 3EUWA 1KAQA 1ENOA 3AHGA 1JJAA 1EXDA 1E61A 2G9QA 4KPGA 3Q3CA 4WLNA 5E38A 3LC2O 4Z8XA 2BFEA 4CEIA 4CCAA 5JALA 4GYKA 1Y34E 1Z56C 5G0UA 1IU9A 3THRA 2V4ZA 4BOYA 3D2CA 4JLSA 2VNAA 2BMJA 4FYHA 3SY8A 1AV7A 1HG0A 4YT5A 1JJBA 1K9SA 1QZXA 3TJZA 3PYLA 1QHXA 3W5AA 2VPXA 3OD5A 4OJTA 4U7TB 1PVVA 3E35A 5AHRA 5FOQA 5BQ5A 1Z8FA 4GXQA 1YCDA 3EFBA 2HK9A 4UATA 3LT5A 1YTUA 2IC5A 2XA9A 3H5IA 1D6JA 1QBGA 2B25A 1V9SA 5FJIA 4YVFA 3DEKA 1O2DA 2HDHA 2N1BA 3SZ3A 3TZQA 4Z0HO 2BZ0A 4B6OA 1H6CA 4B4OA 2Z98A 4P6VF 1AXGA 2IHTA 4A9AA 3DLTA 3HM2A 1KTIA 4ETMA 1U7DA 5HFNA 2XMGA 5DIZA 3S2YA 2GPBA 1T3TA 2JDID 3K2QA 2QTZA 3QYPA 5ECDA 2IU3A 3KQQA 3OZCA 3IA7A 4FUTA 1TM2A 3AH8A 1TM4E 1PWZA 2H2WA 3QELB 1WP4A 1H9BA 3G5AA 2R6CA 4NC9A 3V9AA 3FFTA 2P3SA 1ATIA 2P9FA 1RI5A 3V00A 1E63A 1R6VA 1DCFA 3HDHA 3ENNA 2Q4BA 3DMYA 3O26A 3R3HA 4O4LF 1W34A 2VP5A 1MMFB 4AUEA 4DBLC 1LC3A 1MKYA 1ZD8A 1UMBA 1YR7A 3P0FA 3FPCA 2HLHA 5JTUA 3IIKA 3SHFA 4HGZA 3O21A 1X87A 4DQDA 1E6WA 2PGOA 1C1YA 2FRDC 2C4VA 2DUUA 2W43A 4AUMA 3KQLA 4CL3A 3M7IA 1U8EA 3P9KA 4LQCA 1O4VA 3UBMA 1NSTA 2ZE5A 1J5EB 5D3QA 3BVPA 1R2QA 5KPJA 2HSDA 4EARA 4IRMA 3U1BA 5CEEA 2OBXA 3QLJA 4NZNA 2QD2A 3U7HB 5JCXA 3W8EA 3WADA 2XKJE 1F7VA 1GTG1 1N6IA 4R81A 3VVBA 3ENQA 2C9MA 2OV6A 3WGLA 1RPZA 1Z08A 5JD5A 3N8GA 4G5GA 3DAPA 4HMQA 1D4ZA 2ZIAA 3CZ5A 2B82A 3GGCA 1Q7CA 5DI9A 4FLMA 2QSUA 5CDYA 1QE0A 3OD1A 4BCDA 3KUKA 3OOYA 5BPFA 2HREA 1VKRA 4DIMA 1D9ZA 2B7LA 2FMXA 4F3CA 5DU2A 2Q5IA 2CYBA 3LBNA 3PCTA 4JK3A 3RTBA 4BQQA 5A9RA 1EHCA 3AB3A 1E3EA 2WD9A 2CLCX 5FWAA 3C39A 2Q99A 2O5CA 2WUGA 4RXUA 1YE3A 5KVQA 4WXMA 2DE0X 3GYBA 3KXPA 3B6IA 1YUNA 4JC8A 4G5QA 1FDSA 2WAXA 3ORRA 3LHKA 5CP8A 2BFDA 1ZMOA 2ARKA 4G1VA 3T7JA 1UT6A 5CA1F 1F1JA 4MRAA 1L4BA 2F3TA 2YFKA 1YB5A 4OP2A 4WIAA 1YH3A 5HSGA 1IM2A 5FAKA 1NPTO 1NDQA 3PUWA 1EP9A 1P9WA 3MEQA 5LOVA 2NUPB 1OGIA 2Z2JA 3GHYA 4OUDB 4ZCIA 2XD4A 1SUAA 2BGUA 1Z74A 4UNIA 3LK6A 5K3DA 1YBAA 2Q1UA 1L5ZA 3AJAA 4G1BA 2B34A 3GJQA 1C3VA 5EY5B 3VJKA 1G3UA 5FQOA 3ZJ5A 4JX9A 5CDSA 2FEAA 4J0GA 5EUMA 5A06A 3M89A 1PW7A 1WDMA 3TD2A 1ISGA 4CM6A 4RAQA 3RRZA 1JF8A 2OB1A 1K8XB 1SIOA 3R7AA 3RK0A 3ILSA 5LOVF 1M2VA 2BDTA 4URHA 5KJ1A 2VSQA 1R0BA 2HT1A 5I7HA 3PQFA 1NUSA 2O1SA 5EIXA 2GCPA 4KO3S 2FSIA 3S40A 3G7NA 2Q2NA 4DC1A 5IX8A 3L1JA 2DQZA 4ZOQI 3PR2B 3U40A 1QKKA 1I0LA 4TWJA 1NMXA 1SVKA 1UBKS 2XADA 4LJKA 3JWEA 2BHSA 3QFTA 2E1RA 2A59A 3G0OA 2PAAA 2DULA 1T5OA 5GVRA 3QJYA 2P35A 2HO5A 2ACWA 5DJ5A 3T9DA 2D8MA 4QRIA 1JQLB 3GP3A 3TGPA 1USVA 4MYDA 1P5ZB 3DS8A 1E79D 2PSFA 3WQBA 2FZ5A 4JIMA 4H0FA 5IJAA 4TL7A 4G84A 1R5JA 3DBVO 3UMCA 2ONJA 4M9UA 3GJZA 4BQOA 1E99A 5EUCA 5AI8A 4JMPA 2DUJA 4FKMA 1RWQA 2GXAA 2AE1A 2QX4A 1OFVA 2H08A 2P67A 4BFVA 4AULA 1ECJA 3WYAA 2FQQA 4DM4A 4JSRA 1DC6A 1WXGA 2V96A 5H59A 3G6KA 1OE0A 1UJ6A 4B3CA 2PMCA 1DRJA 1LGYA 1RABA 1XTPA 1PFUA 2OHIA 2R6ZA 3KWJA 3PJFA 4HFJA 5JATA 3MCVA 1WXXA 2BI7A 3EISA 4KFTA 4CEHB 3IBTA 2JCGA 5B3JC 1VC2A 3FD8A 1NUHA 3SQWA 4IGKA 1MW8X 3GJ7A 1XKLA 3IAM6 1FRZA 1HO3A 5LA6B 4BC1A 4UM5A 1I36A 5SY9A 1NBWB 1Z75A 2Z56A 4GPAA 4RPHA 3ESYA 2W22A 4TRJA 5FWNA 2I91A 4P9NA 1WLYA 3OTGA 1CZRA 1C7RA 4Z2YA 5EZYA 3J81A 2J0QA 1MVLA 3EW7A 4G24A 4M8KA 4LYAA 4TTPA 3PX2A 3HWRA 4N82A 4BDSA 1W46A 1VMKA 2XT9A 2YWBA 3PPIA 3FI0A 2R6JA 4L73A 2OP0A 4ARZB 4Z54A 3NBYC 4IVPA 2Y68A 1DIGA 1YOBA 3PJGA 4U4AA 5AD1A 4OQLA 1B14A 1N6HA 4EY5A 1T13A 3CX7A 1OWPA 4JLJA 1Q1NA 4HRXA 3WL7A 4ZT6A 1G8KA 1BSVA 5CT8A 2MINB 3OJOA 5SYMA 4DJAA 1KEEA 4O4HB 4NLLA 1YC2A 1D5WA 1RPTA 4MQMA 1GUZA 2RMKA 1IEQA 2CL6X 1D3AA 1OROA 1XDDA 4WA7A 5EVJA 3JD1A 2IEGA 3R5JA 3BFPA 4YHBA 5CEJA 1ZZEA 3CMMA 4O29A 1J0XO 4YREA 3ZWVA 1U4NA 2I2BA 2Y2UA 1BA2A 1IZ0A 3K1ZA 5SY6A 2GM9A 1Y1KE 2NXCA 4D0NA 3G8CA 5E9AA 1TJYA 4JI5B 4UU7A 4ZCMA 2CZGA 2HRBA 1ZSNA 4G89A 1G5FA 4MI9A 4XI9A 1PL0A 4WKBA 2FWNA 1UMKA 1M1UA 3ZHVA 2G9NA 4IDQA 5KNCD 3AFGA 4EY8A 3GLIA 2DLCX 2AJDA 4ZQGA 4KLAA 2PSDA 2CDNA 3FFWA 2X1MA 1Q84A 4A2WA 3WZLA 1UKBA 5MN6A 3FPFA 4EA8A 3ZIAA 4FYJA 2JAWA 4FNGA 2ISCA 2ECOA 3O1JC 4Q7KA 3HCPA 4MYHA 3I5UA 4FGLA 1NVVR 1QV7A 2NTJA 1X13A 3E9ZA 3M6VA 1BKSB 2Q9AA 1IN5A 2BEUB 1TIPA 3QA3E 4HNRA 3D4LA 4MUHA 5CK4A 1P0FA 5EIAA 3L7CA 1WHTA 4RDCA 4MV0A 2EEZA 3DEZA 4HDKA 4Q9LA 1E94E 3KPYA 4TMZA 2PU5A 4TUYA 1B23P 4ZVSA 1VSUA 4D3FA 5LUBA 1LFAA 2QMYA 5AKXA 1M54A 4OU4A 3CW2A 1CUSA 1Q2XA 4U6SA 5JVDA 5GIPE 2FZGA 3VZSA 2XYGA 3LOUA 3V4OA 3OWXA 2JLAA 5B12A 2QAJA 1AZWA 4PSAA 1KPGA 3OA2A 3O90A 1OYYA 1SGWA 1YQTA 1P4RA 3JRXA 1FLAA 4V0KA 2WIFA 4FCWA 4EAQA 1XRNA 5E4TA 4LYFA 3LIIA 1CERA 3L6EA 1ZUNA 3D3JA 4Y2PA 1KZ7B 2AT1A 2Q0XA 1YRYE 4H6PA 3IE1A 4DKJA 4C6TB 4JEIA 3V1UA 4WMLA 4RTQA 4LF7B 1YFJA 1HA3A 1XRLA 2F3RA 3CLTC 1XZFA 4PC3A 3KSAC 4H1VA 1EVZA 3TR6A 4Z1OA 4UHDA 1N3LA 3E18A 1XJ0A 2O2JA 3I9V6 2ZSFA 3TIGA 1R16A 4O1IA 3AL0C 2ZJ1A 4RA9B 3PXXA 4X84A 5LCXA 2YWFA 1ZRSA 1JEJA 3FIJA 1N3YA 1DLJA 4UXHA 3G7SA 1E60A 3F9CA 2P9BA 3JQAA 2OMKA 3E03A 1BROA 2C1XA 1NBHA 3JYHA 3LG2A 4RVUA 5FBWB 1DOAA 3OPYA 3VNUA 1TPZA 3IQFA 4W1SA 4YECA 3OP4A 1Z82A 3UFBA 4E5NA 2PFSA 4ZK6A 1YD7A 3A1VA 1JTVA 4Q5IA 1WUKS 5KWEA 4O1MA 1P4GA 2PX0A 4AC9A 1QDUA 2RE8A 2JGJA 3PFGA 1M8GA 3LZDA 5AM0A 2E48A 4Q3AA 1PLKA 1HLFA 3NHYA 3NTVA 3C8UA 3I2FA 4PXYA 1UBNA 1KPIA 1PJCA 2B98A 2IA5A 1XJWA 2W2KB 1GZ5A 3AL2A 3IKVA 4NNPA 4GXTA 4RETA 2I3GA 5CYOA 1CW2B 2P2DA 4QQ8A 4Q7MB 5H83A 4F72A 1THGA 1ZMRA 1G21B 1Z0SA 4E11A 3ZS9A 1FUEA 1U0RA 2IGBA 2X5OA 5CURA 3VR3D 5T57A 3E9NA 3BCRA 4RQBA 1GZ7A 2A5DA 2J7KA 4DPLA 1Y5MA 2HPZA 1XMIA 3CX3A 3UXYA 3KKZA 4N9WA 4BKMA 3RBAA 3AV0B 4PGHA 3C6ZA 1L8AA 2LD4A 3T1NA 2FGJA 1YUBA 1TYBE 2IPLA 5CDFA 1SU4A 2QP4A 3LE8A 4B6EA 1RQ2A 3TLAA 3NWOA 1B00A 2VI5A 3IXLA 4XJVA 4LJ5A 2GF9A 3H1FA 4FXOA 3SQMA 4J0HA 1G2QA 3G5UA 1C0KA 4QNMA 5DNDA 2XXAA 2DERA 4UJ5A 1PQUA 4ZHQA 3VBEA 5JASA 3NOVA 2YXBA 2ZB2A 2R60A 2FSPA 5IJ9B 3K0FA 4GSLA 5EL0A 2MIIA 4RLFA 3OT4A 5E6RB 1QB8A 2I7XA 1JQDA 3IRVA 1JR2A 4I3FA 1ES9A 4UVDA 3USZA 3ZDBA 1FOEB 1A82A 3TR5A 2GVDC 3HMQA 1MOPA 1W4AA 2VYVD 1LW7A 3VPXA 2JBWA 3D3EA 3WA6A 1SVMA 2C5EA 3HGTA 4R31A 2CDBA 2A58A 3MCTA 1RHUA 2RG7A 3T3EA 2AWOA 2J0EA 4EPXA 3NXSA 1PJQA 1V8DA 1T0PA 4YCAA 4Z9BA 2OYCA 3QBVA 2FOIA 4C4YA 3AMVA 2OLKA 1OJ7A 4QGBA 3MCZA 4XWAA 4B6FA 1M7GA 3T7EA 4YXWD 2C92A 1DAFA 1RBYA 4RK7A 1H2XA 1E9FA 1P91A 1UKEA 4FNAA 4DQVA 1NRXA 1IFXA 1NN5A 1RR6A 2E1PA 2HHCA 4QVGA 1NVMB 3TNYA 4EF6A 2R86A 4R98A 5BY2A 3QWAA 3M6MD 1KFKB 2WJ4A 2C3UA 1L1EA 1V5WA 3QQ5A 1TM7E 4JI4B 2PT9A 1FYWA 1AKQA 3G17A 4J0QA 4I81A 1H2EA 4RVFA 1BOOA 4TTSA 3S5UA 1P7CA 4JSYA 3KOUA 4Q21A 5JNTA 5K0EA 1J22A 3ZDDA 1IQ0A 3PIDA 2H52A 4WCDA 1KZ6A 5C8YB 1GLVA 2GPYA 1I3LA 1OFUX 1T1JA 1EAMA 3CVWA 4CLXA 3DXZA 1JYEA 4FGKA 1XLTA 2I6SA 1I7SB 3N2IA 5COAA 1EVEA 1OAOA 2I1QA 1RAAA 1N6KA 2FLKA 4OQYA 1R15A 2Y1WA 5AHOA 4PX5A 1CY4A 2JCYA 2VHXA 2E4VA 1YIAA 3IMKA 4U1RA 3UQYS 4XQ9A 3VJMA 3QE4A 2JLSA 3HJBA 1Y3DE 1MG5A 1IHXA 3JQ8B 4X90A 3U56A 3GT4A 1JZSA 1Y3BE 1X7YB 4AG3A 4EVSA 5I9NA 1KMMA 4QVIA 1GGVA 1AKMA 3QVTA 1XK6A 4KLNA 3N0TA 4ZQBA 3C15C 1LPNA 1PR3A 3ZBPA 1JWBB 1L5WA 2NTNA 3ZWCA 2QD3A 3ESBA 2C59A 1OH6A 4MYRA 2IYFA 1G59A 2DLDA 3GBVA 5LD2B 4I9GA 3HJUA 4Q1EA 2GM4A 2UZ3A 2X6TA 4AZ0B 1KBOA 2EKLA 2X1LA 5E6UA 3TIFA 3O9ZA 2WLSA 4EKDA 1XRQA 2O7SA 3K0AB 2DSTA 4XR4A 2QRKA 5KTNA 3P0IA 1E2DA 2JKYA 4HBGA 4A4DA 2IHJA 3T06B 1VCIA 4OGLA 4ARUA 2XBMA 2MSEB 1E9SA 2YY6A 4KQGA 2AQIA 3L04A 1T8YA 2D3WA 3DO6A 1NE7A 3QH4A 1E1CB 1JIIA 1UT5A 2JHGA 5IH3A 1FFGA 2HH9A 2UXDB 4DJTA 1R4NB 4J9UE 3EC1A 1SWWA 3AHFA 3FZYA 1J8FA 4BJ6A 4ZWNA 4YJHB 4JOSA 2YBDA 4G0YA 3IUQA 4XD2A 2PGLA 1OZAA 3F4LA 4PS1A 2FX2A 5G40A 1KDYA 4PZYA 2ZK7A 2FEOA 2JFXA 2ZRLA 3BIJA 4LJ8A 1P5FA 4XIIA 5LP1A 2QAGB 5ADHA 3O8BA 4OO3A 3QWBA 1UBUS 2BBWA 2X4LA 1E7QA 2WWYA 4IOMA 4Q9KA 5AOCA 4BNDB 3T7RA 4C43A 1N2EA 1KI3A 2BFFA 3MFYA 4BZPA 5KYYA 4DIEA 1I4WA 3CSUA 1JLLA 1Y0BA 3BIXA 3KLBA 2IU4A 2AFIB 2QE7A 1TMKA 2DTEA 3Q6IA 3S2FA 1KOJA 1YBVA 4MVJG 5DV9A 1RHMA 3RK1A 2WINI 4G1EB 2DFNA 1YVRA 3EC7A 1JDBC 4GP6A 5GQSA 4GZMA 4Z4QA 5G02A 3K8QA 1FJHA 1R1DA 2X4DA 1PHPA 3DKIA 4EI9A 3NEPX 5B7GA 3KBOA 1GAXA 5J4YA 4YRQA 2KE5A 3R7LA 4XYBA 1LTQA 1TYCA 3IAEA 3F3MA 3NJ4A 2Q1WA 3CBGA 3SX0A 3R41A 2AEFA 4G4SP 4TMYA 2AOVA 1NP7A 1WW8A 1M1YA 2VK4A 4X7PA 4AQDA 4J03A 1N5MA 2C9BA 2X8WA 3H2JA 3KT0A 4EZBA 2HWUA 2W6IA 4Q6WA 4JBWA 1XD2A 3GFVA 5JS6A 1CHDA 1Y89A 1IB0A 3CKKA 2Y8EA 3HVIA 4G85A 1U3FA 1IE3A 4D9MA 4E07A 1TVEA 4Z9AA 2OGZA 3ASVA 2RCNA 4YP0A 5JDCC 3T3GA 3NOXA 3VNQA 2JFVA 1H4QA 4Y0VA 3QUAA 2X2FA 4LYYA 2QG4A 5HBGA 3RSLA 2DBVO 4LF5B 1ZCJA 5D51S 2GHRA 2PZEA 1XC7A 4QUIA 5EE5B 1BQ3A 3AEKA 4DIOA 4YB8A 4DVJA 4ETIA 2VF4X 2G0TA 2BJWA 1WXQA 1Z2OX 1P61B 1PTKA 1SA0B 2PL9A 5DTJA 2ET6A 3LUJA 3OQHA 4I4NA 3T1HB 2WJHA 5TMDA 3F8TA 4QHSA 4YONB 4YCMA 1G20B 3O8OA 1FPQA 2XDWA 4K28A 3HO8A 4MKGA 3WVNA 5JW6A 2XCTB 2CL0X 4EKEA 2HT6A 4PGAA 2WTNA 1G42A 1RT9A 2YJGA 1N2IA 1J24A 2RK3A 3FH0A 4MUFA 4QYTA 4BNFA 4B43A 3DTVA 4ND6A 2V98A 3LL7A 1Z6XA 3MJFA 3V5NA 5CJJA 4GX2A 3KYDB 1G8SA 3QVXA 1QQAA 3EDYA 1VBMA 3FKSA 2PX4A 3DR5A 3L8YA 4XWTA 3V4LA 3BGVA 2FGKA 1L5SA 2R2AA 1OXSC 1D2CA 1QIHA 2BF4A 1D6MA 1VL8A 3RS3A 4MUJA 2AG0A 1Q91A 2QQ0A 3TFWA 1JPJA 9LDTA 3AEQA 3V8MA 4L78A 1SOMA 3DBLB 1ESEA 4TWAA 3AEZA 2HSWA 1GSIA 1Y1LA 3B3QA 3JWGA 1XZNA 5FV4A 2XXAB 3OZBA 3TTSA 4WKCA 3T54A 3DEIA 1EINA 4NBSA 4NARA 2XIJA 3VHRA 2FWIA 2BELA 5IN4A 1BW9A 1NW9B 4RK0A 5T6BA 1AGNA 5ALLA 2C57A 2JJ2A 3NUQA 2PX8A 1X74A 2ZYUX 5EC8A 1X8JA 5FL7D 3SZMA 7ADHA 5B1EA 2KI5A 2A5LA 4MVJM 2HEIA 5TMBA 4CKEB 2I6XA 1ZK4A 2LBPA 3D6VA 1YA6A 3RWMB 3GEEA 5I8PA 2W2MA 1RP7A 1WUHS 2XCOA 3BXGA 3X1MA 3JQ7B 1PTJA 1WHSA 3ZW7A 2QBYB 3KPWA 2JAPA 4O2AA 2BFMA 1RHRA 2BR5A 4BN0A 2R44A 1W5TA 1Q0SA 1LPBB 4NMXB 1QO0D 3E23A 1XTZA 3TQQA 2KLHA 2Z5FA 4R6XA 4F86A 1XVLA 3I62A 2REBA 4FFPA 1QH9A 4KOAA 2OECA 1TRKA 5LLSA 2DR3A 3ROXA 4D8WA 3KOOA 2HPAA 4QL3A 1I6KA 3PHIA 5IBQA 2DETA 2XDAA 3VZDA 4MMYB 3WNDA 2AJBA 1M6EX 2GPTA 2J3DA 1B3BA 4R1SA 4RV9A 2I3BA 5FFFA 5BWCA 5ADVA 2PZ8A 4L4XA 3L1KA 4LNHA 4KQJA 3PRHA 1D1QA 2PS0A 2RKOA 3OFSA 5JPIA 4DIKA 4S1VA 1Y37A 1H93A 5P21A 1XEAA 2PD3A 3KL4A 2A9RA 4N39A 4O4JB 4DLLA 2YZ2A 1GSAA 3HUUA 3HXPA 3T4EA 1O9HA 1H2YA 1SXJD 1UK7A 2DJIA 2IYQA 5E3JA 4B09A 5BV8A 1MH9A 4U2EA 3HCBA 2H1CA 3PJEA 1PKXA 3ZKWA 3EX7C 5KZMB 4JUFA 4A5SA 1JG7A 3NFRA 5JOQA 4M7RA 4Q18A 1K1EA 2K5UA 1T4MA 3MTIA 2FVXA 4NONA 1I3CA 3MM4A 4KNWA 4MHSA 5FTMA 2M1ZA 4YAIA 1ISSA 1G9TA 2CZCA 3OQBA 1CF4A 3QE0A 4GYJA 4MJLA 4KSCA 3P0RA 4G3XA 5IVHA 4NVRA 2DCUA 1RYDA 1K7XB 1QANA 3KWFA 4F38A 2BHTA 1XP5A 2PGIA 3VU8A 1DV2A 1Y7TA 2GHIA 2N0SA 5I9MA 4B4DA 2WF7A 3DVSX 3E70C 1DJPA 1VE6A 3CH6A 3NEJA 4UEWA 4Y2UA 3WIEA 3ZU5A 2DP4E 1GVHA 5GZ6A 1F20A 1JHRA 4XM2A 1CK4A 1E77A 4V39A 3DP9A 2W2NA 2GK3A 3KYJB 3O93A 5TF0A 2C83A 2YS6A 3F9RA 4FYIA 4OMCA 3OEWA 4BX8A 3ZX5A 2Z3ZA 4HQOA 4HP8A 3QKWA 4RTNA 5U1PA 3HCAA 1UFRA 1MQ8B 3ADCA 3G3EA 3Q8LA 1XRJA 5ALEA 4UDYX 2JEOA 3KYIB 1AB6A 4CQMB 2EX0A 3DL0A 1I6WA 5AOVA 1MJ5A 3I04A 2Y71A 3PKJA 4TSRA 3RC2A 3STUA 1MXHA 2NU6B 4UCQA 5U4XA 4JU9A 2W2LA 1X0VA 3S55A 3GFQA 1ECGA 5CBKA 4YJKA 1CY0A 1XF9A 2LE0A 2OAGA 2X0NA 1Q20A 1ZL0A 3OLZA 1ZQ1A 2GNOA 3EGDB 2NOAA 2WWHA 2VDRB 1R7RA 2AJTA 3C70A 3FTDA 2ZI9A 3D5QA 4WGGA 5A7FA 1ZA2A 3OSZA 1KEZA 3LMKA 1EEHA 3P9IA 1CR0A 3PDCA 5B2FA 3AK4A 4QYIA 3PSAA 4O3FA 3PEWA 1JFSA 3VDMA 4L8GA 4R1PA 2XZOA 2Q6OA 5EA2A 1DAKA 2AF4C 9LDBA 1E32A 1NF8A 2RHJA 2HFJA 3ICQB 1U8FO 1XNGA 1YQGA 3FYSA 3MJDA 1W5SA 3ZK8A 3RS5A 2FHPA 3RWBA 1Q1EA 5COQA 2YJ5A 3Q3EA 2JHPA 3JD2A 3P0JA 1ZN7A 3DF9A 5DXFA 4YRRA 5A4DA 4MGHA 4YJ3F 4ZOBA 1PL6A 2GTPA 5D5HA 4GZ5A 1U6KA 4DGQA 5CW2A 1L3CA 2V8OA 3WE7A 3A7DA 3VR6H 4J1TA 4G86A 4OQXA 2E18A 1Q3KA 3AF1A 3IEUA 3BB1A 2H0RA 4I0WB 3ELDA 4G1UC 3WWYA 5LP6A 1TFRA 2XGMA 4BRSA 3ONFA 1GNVA 3I37X 4N03A 2OD9A 3K73O 2Y0DA 4OMUA 1L6IA 3L7IA 1E5QA 4R9VA 4RYLA 5MHTA 3LI2A 2FFRA 4RVHA 1RRMA 3UV6A 1RPNA 4MKZA 1TQDA 1XQXA 5BP7A 1HYHA 4UUNA 4C0QC 1U02A 2JZOA 3AERB 1YS9A 4LDPA 4X97A 4NZ9A 4C29A 4BEBA 4WBNF 5JS8A 2ZZKA 4YP7A 4HLQB 5G2OA 1N75A 3T9BA 5FPPA 5DSTA 5DH9A 4WKPA 3UMMA 1RZRD 1FFHA 3KJEA 3MWFA 1SVUA 1Z7EA 1N2JA 3P27A 4KK4A 4W5TA 2WYUA 5DHSA 3B53X 5FAXA 3FY4A 1LC0A 3NKFA 3QI2A 2OFPA 3FBGA 2QLLA 1SCNE 5K45A 2X6RA 4ER6A 4Z3OA 3ZDFA 4DDTA 4UTVA 1K7FB 1PDWA 2BUAA 5FOWA 3N5KA 3QXSA 1KYQA 4YN3A 4DHEA 2H1OA 1MA3A 5JE8A 2HI0A 2IDMA 4MEJA 5AJYA 4IXMA 2VJDA 3HWX1 5DO9A 4UM7A 3RVMA 4EEZA 1PR5A 1PV1A 4HFRA 4TMFA 3A1TA 2EWVA 2R8RA 1HMPA 2XQVA 1X7WA 4OATA 2ZVJA 4Y9DA 5EHQA 1RWKA 4YRPA 4KR3A 3I1FA 1JI3A 1U7ZA 2WR8A 2IRWA 5LBUA 1C81A 5BV7A 2NAPA 1ZG3A 4JD5A 2AB0A 3AVXA 1U3UA 3W79A 1BO6A 4TRNA 5HJ2A 2AX3A 1XFDA 3VNRA 2XQJA 1UZUA 3A31A 3ZGLA 3E9YA 3L8GA 1NJ5A 2XSZA 4BP1A 4RY2A 4ENQA 4KX3A 1LRKA 1FFXB 4FFBB 1YZFA 3UHPA 1F2VA 4F5ZA 4YDRA 2FFAA 3KKLA 3ANYB 1XDUA 1W6UA 3HXKA 3I1YA 3EW9A 1KDPA 1NLYA 1E5DA 1WB4A 1JDZA 2NU9B 4AURA 4DMRA 3EUEA 1JB9A 1K08A 3OKAA 4DZZA 2AG6A 2XMDA 3U0VA 1SCUA 4BKRA 1FSFA 2AQHA 2IUFA 2JNWA 2JW5A 3RC1A 2ZS7A 4MEAA 4L28A 3RVOA 4BJ5A 1VG8A 1ESZA 2AEMA 4WJKB 5JRDS 2V4UA 2A1UB 3QE2A 4IEIA 3TPFA 1ZQ9A 4BTVA 3A6ZA 4ZEMA 4KRXA 3EWAA 3UN1A 4YR7A 5JAHA 3IS3A 4EHLA 3H6HA 3K70B 3PHJA 1YIDA 3TX6A 4K05A 3FMFA 5A0VA 3FUXA 5IDXA 3RJTA 4XD7A 2VDWA 4KXNA 4OM7A 4DGSA 2FPKA 5KYKA 1GQQA 3UH1A 4LY0A 4PPYA 2ZRPA 2B3DA 1AX9A 3EFOA 1TU3A 3NASA 4UEJA 3VMFA 1V6CA 1M2WA 3DTNA 4OSPA 9MHTA 1QC5A 1F2TB 4CTJA 3HU1A 4GL4A 4GVLA 3L6OO 4ZKDA 4MRVA 5C1BA 2PRSA 1IHDA 4JXZA 3PE4A 5TC4A 2JLWA 4TS9A 4PYLA 2UXBB 3C5VA 1P8AA 1VI2A 3BA1A 3EDRA 5AT1A 1MJGM 4RF2A 4EG8A 1HTTA 3VYUB 5DI3A 5ERXA 2AFRA 4LXTA 1CJKC 4DSTA 5BYBA 4B2IA 1E0JA 4ZJYA 2TS1A 4B6QA 3H11A 3K0KA 3EF3A 4BLQA 4EPYA 5DEIA 5FL3A 3GLFE 2Y6VA 1UBEA 4UHJA 4PG7A 4NICA 1E3QA 3QNMA 4E1VA 1RQLA 5DHPA 3SNHA 4EGAA 2C2YA 4IZHA 1Q2UA 4W4TA 3D9QX 5K3SA 3QE3A 3AIOA 4B8YA 4BFYA 2ZYVX 5KMGA 2R3SA 3DPSA 2RKWA 4YK7A 1PJSA 4AG6A 2I7TA 4EL0A 2Q3DA 1XVVA 3R3WA 4YAOA 3SXUB 2ZVQX 5EI5A 1A9PA 5KNBA 1JG2A 3CB4A 1GKUB 1SHUX 3G6WA 4KI7A 4LZPA 3R7NA 3LECA 4AP9A 4BO1A 1B0AA 5MN5A 3GH1A 1FFYA 2CFTA 1RYZA 4U63A 1G3MA 4LDZA 4F85A 2KMLA 1XTRA 1KF0A 1KSFX 2C94A 3U7QA 2P41A 1SZDA 4FFWA 2JIZD 3C87A 2BL4A 5EE1A 5FNVB 1O94C 2RAFA 2PMBA 1H5NA 3CIOA 2V7BA 5I9BA 3GLIB 2HUNA 5TS3A 5FI1B 1W0KA 1A27A 5HCNA 4YJDA 4BMSA 5HIJA 2CHGA 1F8GA 3BYZA 4PNZA 2A6PA 3DKRA 2M6SA 5IMBA 1JYSA 3RANA 5IKEA 2CMFA 2QOEA 4EGJA 1TKRA 1Y6FA 3EAFA 4WBNB 1EBUA 1U9JA 4PLZA 4ILEA 4PX3A 1AURA 1OIWA 2DQSA 3NG1A 2I78A 1J90A 3NQ41 1IN8A 1U2EA 3QP9A 4TTJA 5CLFA 5LDDC 4TUYB 3ZTTA 3MGCA 2WSBA 1AKUA 1CS0B 1U1GA 2SECE 2VFAA 4KI0A 2WYVA 2OXIA 4MUMA 4G9EA 1M83A 2XXBA 3JQAB 4RV4A 4KVGA 4DM3A 1GFZA 5LWQA 2OCKA 1V39A 1IHUA 4JP8A 3E3AA 2Z30A 4EGSA 4IIBA 3MGKA 3RGWS 1VTKA 5IH7A 2OCLA 1NLUA 1ILWA 4O4LA 2Q7DA 2O3UA 4FN4A 1W5FA 3B1XA 4JLWA 4OH1A 2ATCA 3R5TA 3LBIA 4KYIB 3ZV3A 1L4MA 4JJEA 1LK5A 2PMDA 5HOEA 5CNIA 4UTPA 5J9FA 1X7GA 4QU0A 5KTYA 5A9TA 4ALMA 3C85A 4KXWA 1JH8A 1WG8A 4Q1CA 4TXHA 3EXHC 3K6SB 5DM1A 3AR9A 3ONWA 1U5BB 1VPEA 2PX3A 4URYR 2NTYC 2ZSIA 5IUJC 3MUFA 1T8WA 2ONYA 3UJAA 3PJRA 1EG7A 1FMJA 1N6LA 4PO1A 2H63A 2YX1A 2BMWA 1N7JA 1N7IA 1PS0A 3RUDA 4D6XA 3NYIA 3O73A 4MQLA 3W9SA 3U3XA 1L4EA 2BR4A 1AQ6A 2RK6A 3N2ZB 3AF0A 4JJKA 1DX4A 4GGOA 2E85A 4MQ5A 3C6QA 3MT0A 2W4QA 2WSMA 3RODA 4XCXA 3UFXA 4DB2A 3PFWO 1LW6E 3T52A 4R16A 3FJOA 4TS4A 4GBMA 5ILGA 1RBQA 3TXYA 2OOSA 4U9IS 4CFYA 1XTBA 1EUYA 2B7CA 1P7WA 4B75A 1RAIA 4BRUA 4DRXB 3A9UA 4OXKA 3P0EA 2DH6A 1S96A 4M99A 1QDLB 3KKKA 3SI7A 1TYDE 1JKFA 4YRSA 2HNAA 4II7A 3NB0A 1Q0PA 4PBSA 4C7OB 2R84A 1KYXA 4N1AA 3HYLA 2FJ0A 5KNLA 1U9IC 4YGXB 2OHFA 2VNIA 4F6RA 2AH5A 3JYLA 3DGEC 1ADJA 2XYRA 1TYEB 1ABFA 5AW5A 1X70A 3NBFA 2X8JB 1PN3A 3FDFA 3LP8A 4K03A 5FBLB 5EWJA 4ARAA 3GZNB 4M37A 4LI3X 4I1IA 5NLLA 1MTZA 3D4IA 3K20A 1Z3CA 3DC2A 3EHEA 1K0UA 2UZIR 4US0R 3OO0A 3K7EA 5TJ9A 4H1HA 2ZIGA 3LK7A 3MJEA 4RFSB 4Q9AA 5KNCH 3DT8A 1BDBA 1N77A 3LBAA 4TYWA 3BE6A 2XYVA 3SKYA 1JEEA 3CEMA 5AP9A 4A2QA 4EAAA 5BYAA 2HRQA 3WHKA 1GYPA 4RIHA 5LA6F 1U63A 3E6AA 2SKDA 1GNPA 3MNFA 4MS4B 5GY7A 5HKBA 1VMIA 3CXUA 3SIRA 1EDEA 2EFCB 2V1XA 1A7JA 3LLCA 1W4RA 3VPSA 4BP9A 5IDVA 2V0GA 3FHOA 2YRXA 3DC7A 4K6FA 5A02A 1XXHE 3EK2A 4MWOA 1NC1A 2PIAA 1V1RB 2OZKA 2XNDD 3SXPA 1QUFA 4DLNA 3IUPA 4AZTA 3BN3A 2VNKA 3QNUA 2ODPA 1QVRA 4ANFA 5IBCA 2VG8A 4DLYA 4X7MA 4I5EA 5T5QA 1D6SA 1M67A 1R8QA 4JYAB 5EFOA 2OXRA 1TYZA 1BU8A 2GWRA 2CHFA 4XASA 5JPCA 3PQ8A 3VI4B 5AVVA 1JE0A 3FMPB 1CTQA 3NTQA 2YFQA 3DEYX 3RHFA 2JKVA 3O4GA 5BWOA 2I5PO 1EFVA 1SBNE 3THXA 1U8CB 2WUEA 3GP5A 1NRIA 2V59A 3M1YA 3X1JA 1Z28A 4P5DA 3LT1A 1T5LA 3CN7A 1NW6A 3SX4A 1UXGA 3C7DB 1PVOA 1KGDA 2FPRA 4N7RA 3SJAA 5I7UA 1QZ3A 5IULC 3Q9LA 2PXXA 3IESA 4RX1A 3CVXA 2H5JA 1M75A 2AI2A 4Z4FA 3CNHA 1SUEA 1YCGA 4H77A 2UYCA 2IYAA 1L4YA 2H1IA 2UDPA 1N34B 2PWAA 4MQEB 4WESA 3H65A 2NV6A 1IHYA 2C2HA 4ZT4A 1ICIA 1Y4SA 1RWMA 2XCLA 3RS2A 5DN6A 1X1DA 4TS1A 5CH3A 5JCJD 3SJUA 4X3PA 1K3UB 1HFWA 3HZOA 4QATA 4CN9A 4LG1A 4OK6A 1O5OA 2IFTA 2X0KA 2OZLB 2HIGA 3OPXA 3U39A 2WJJA 1H9AA 4LSWA 1X1AA 1JSLA 4PN3A 4JUIA 1P2GA 1ECFA 4BHTA 1RI2A 2X3FA 4IJ5A 4MVJF 1EA7A 4BNLA 3QKIA 3ZLUA 4FZ5A 5AICA 4KR6A 2X76A 3BRCA 2AG5A 1TB4A 4Y67A 4XVQA 4RLQA 4M49A 3ICWA 1TU4A 4I8XA 3H9JA 1NAHA 2ZTUA 4XB2A 3VC2A 2H8GA 1VP9A 1HQDA 1M76A 4H7IA 3EZYA 5DK6A 1EVJA 3OQ1A 1SBYA 2XT6A 4LJ4A 1CRZA 4WN9A 5BNZA 3UAXA 3SJBA 1JHZA 2IYWA 3N5CA 2OBYA 3FPJA 1HY3A 1LLCA 4QEKA 1W4ZA 3BHMA 1ZD4A 3QY0A 1US8B 1R8SA 4I9HA 5C31A 1OH5A 4XJXA 4PO9A 2VL7A 2EQ5A 3WLTA 2XSZD 4ZFNA 2ROQA 4I55A 1Y9DA 3HUEA 3WSTA 4DUYB 4P5EA 4RABA 2JFNA 1PR1A 2HNKA 3ESAA 2VJOA 1E1CA 2CWWA 2NV2B 4GLOA 2JI8A 4IILA 4JA0A 1SM4A 1NXXA 2GK7A 2D5AA 2OM6A 4GOOD 4GMGA 4NCNA 3GCZA 4WSOA 4XSHA 3H2BA 4ZDIA 1EK6A 1TT7A 4F92B 3TVYA 1SBIA 3ASUA 4L75A 3KHTA 4MB0A 4P4LA 4YRLA 5BMVA 1M8JA 2YWXA 4FKZA 3PXUA 3SGLA 1GEEA 2XOKD 3EVAA 5CVCA 4F4IA 4YUWA 2QJRA 4G5RA 1DDIA 1NSFA 3PDHA 1YFKA 1SIWA 2CJPA 2Z8ZA 2CJYA 5CITA 1V26A 4BMDA 3PVCA 4PX9A 1K75A 1YKSA 2J33A 4X8OA 2FB9A 1M1ZA 1P31A 1XXHB 2Q3FA 3IQWA 4FBGA 4Y3UA 3GA0A 1TGYA 3PXGA 1I32A 3RFTA 4D7AA 5HKLA 1P39A 1XZQA 4QGFA 4PBRA 4CE6A 1ODTC 1LZLA 1I2ZA 3EDQA 1LQ2A 1SIBE 1T9GR 1TZBA 4EH1A 4CIWA 1A3CA 3PE3A 5TVGA 3TRFA 4HVTA 1OV4A 3NP9A 3A70A 3GAMA 5DWDA 1YQQA 2RONA 1QB7A 1X7XA 5BQPA 2FSSA 4IHJF 3WQRA 2Z6QA 4PYJA 1AY0A 3EH2A 3IL2A 1CUVA 3SC6A 1HXHA 1DPFA 4D0GA 1R00A 4U9UA 4RK1A 5JZSA 5FYQA 1UPTA 3G13A 3BSSA 3JQRA 5JTTA 1LBSA 4IF6A 4BY9E 3OZSA 3ZQUA 4Y9TA 3QXCA 4IUYA 3AHHA 1TCCA 2C99A 2C77A 1QTQA 3OAAD 1ONPA 4K87A 2BOVA 2GVZC 1K3TA 3MZ0A 4I4CA 1BA3A 3E9DA 4U6NA 1EZZA 2HLPA 3WYBA 2G67A 4OCZA 2YV5A 3L8DA 2TECE 3I42A 2PLNA 2F67A 4LWQA 3ZZNA 1NPYA 1SZJG 4L8WB 3HA2A 3QF4B 4V38A 1GA4A 5BW6B 3HCFA 2XH8A 2AXEA 5L8VA 1AQNA 4NE2A 3VNVA 3UOAB 5GM2A 1K92A 2K4MA 3OA0A 3OH8A 5CVJA 1P75A 1YMUA 5AJWA 4DC9A 4EG7A 5TQ0B 4FX2A 3QU7A 4OYLA 2CV1A 4GKKB 1VDMA 5CVTA 1R50A 5ICGA 2J5QA 1U04A 1FFDA 2PH7A 4MLCA 4R1QA 3V1YA 4AY5A 1A2OA 1E4YA 1R27A 1Y4DE 2O2DA 1Z8DA 2Y9MB 1FXSA 2C3PA 1RQNA 4YJHA 3R6LA 4W9NA 1XZEA 1DLIA 1PSDA 1BQ4A 2CLFB 2EIHA 3KZ1E 1CUWA 4RJJA 3T94A 4AWXA 3H84A 4D9KA 4QGSA 2O7RA 5M04A 1A5BB 3WK9A 1FTSA 3EJ6A 4F5DA 1WETA 2BT4A 4X91A 4UASA 3EGXB 3ETEA 4QIHA 3EQ6A 1XWFA 3ROTA 1QC5B 3NDIA 3SOZA 3QUBA 4TWBA 4UZEA 1N36B 3CLHA 1YDFA 3PQ3A 1IOZA 2BFFB 3OBBA 3LQ2A 4W99A 4EUFA 4IKOA 1FTGA 4W1PA 2ZJAA 2PX6A 1NVDA 3UJ6A 2DY1A 3RYCB 2H4HA 1VIVA 2I55A 5FR1A 5TEWA 4ETNA 3DNFA 3F5MA 4JKYA 1GZDA 2OAQ1 2P78A 3R7SA 1S6YA 3QIVA 2BDEA 3GFFA 4PXSA 2SNIE 2B6HA 2EG5A 1ZLXA 4GR5A 4IJQA 1V35A 2O8DA 1CR4A 3K9BA 4OLHA 4H7JA 4NKRA 1U3DA 4PLGA 1HT3A 1NA5A 2F3UA 3Q7TA 3SFZA 4A1OA 1QCZA 3B1VA 3CZ4A 2OD2A 2ZG6A 3BD6A 3CUSA 3L41A 3GMDA 4QUBA 3TTYA 4FMCB 4KYVA 4WESB 1BMQA 3HRKA 3GT7A 5BUCA 1WY7A 1P45A 4B3JA 5A9SB 3ONEA 4PRZA 1SKAA 4IIJB 5LC1A 3SK0A 3B1KA 1BH2A 1P74A 4GUDA 3A7EA 1DIOB 2HK6A 4CXMA 1MIOA 1XCLA 4D4JA 5KIAA 2QMQA 4FDTA 5JEEA 1VI6A 3Q7EA 2HMWA 1X1BA 2Q07A 4WXPA 4Z53A 3FYDA 1T91A 4Q9JA 2C9ZA 3C48A 2OV1A 3FKJA 4MYSA 3ZE8A 3ZNNA 3EY9A 3RK4A 1G21E 4DLTA 3OTOB 1G0OA 4P1ZA 4D3XA 1EYZA 3R3SA 2HD4A 1TADA 3QHQA 4K40A 5CDFE 4Q7JB 2VK1A 3D6HA 3MPUA 3ODGA 5FORA 3T35A 2ZR0A 3BMNB 3LUFA 3EVZA 3O4JA 1O54A 2V8BA 4QTTB 1LRJA 2N3ZA 2NU6A 2VUSA 4XW2A 5FLXA 4MAFA 1LDYA 2GBLA 2YMQA 3LO5A 4LXUA 3Q8KA 4YYEA 2VTBB 3B13B 5DLYA 5DOVA 3MUNA 3A26A 3BWBA 3SEQA 3FCCA 1XLTC 3HWSA 2GAJA 1GPMA 2ONKA 5EE3A 5ANRB 2VSNA 1JIKA 2POQX 4JP2A 5A3JA 5FBHA 1I2DA 2PZKA 4MHTA 3ENVA 4JC0A 3VR5H 4DV3B 1T8SA 5G1PA 1E3SA 1BKDR 1PFKA 3T61A 3RTAA 3ZYCA 2QVCA 1XAJA 1BN6A 1UODA 2EWWA 1F8UA 3KTFA 3LXRA 4RY8A 2M6KA 2VJBA 1YJCA 3QU9A 4PLHA 4PIVA 3SD7A 3ROEA 1RRCA 3H05A 1NGSA 4NBWA 3RD5A 1J4AA 2IKQA 1P9NA 2IH2A 4GOXA 5LYJF 2XV1A 1FFEA 1GWNA 1EX1A 3U3MA 2E49A 1RYEA 3HBFA 3ID6C 3L2OB 4FWTA 1KXJA 5JXHA 3DG9A 2M1XA 1HFJA 2ZRKA 2ZKIA 5AVKA 5HW0A 5L6MB 3QG5A 1K8YB 3K16A 4WJLA 1XZJA 4FDVA 1K4MA 2PD4A 1JHOA 3K0SA 2ZIUB 1ZC4A 4KR0A 2VHCA 4JP5A 2Y4OA 1CJUC 1CYDA 3E27A 5IC4A 4D26A 4D81A 4CKEA 2ZAOA 2OUIA 3HEMA 3CUWA 5T8KA 4EP1A 3ZQJA 2F8SA 4X64B 2VZEA 5B6PA 1I24A 4B4WA 1MBZA 2CD7A 2NZUG 1JHUA 2QRMA 4QQFA 1EWYA 3EGOA 3RYIB 5JRJA 2Q1YA 4PLPA 1GGKA 1XE3A 2X9VA 1H8EA 3E61A 4CG2A 4R8MA 4ZDJA 2BV3A 2IITA 4H6XA 2XD9A 3MLAA 5AK5A 4LE1A 4RORA 3URMA 4EB3A 3IMGA 2MOKA 1FNDA 1T35A 3CX6A 2HRZA 3OFKA 1T36B 2AX4A 4MVJD 5CFMA 1NKVA 2PRKA 3FDZA 4JT2A 5FNZA 1W25A 2ATIA 2VAPA 4RYDA 5SV2A 1TF2A 4C4OA 4YP5A 4YRFA 5KTMA 2VNHA 2QTLA 4LRSB 4PSKA 4UVEA 3KL2A 3QUTA 3QYFA 4FMDF 3TZCA 2BZGA 5BXQC 2XE8A 2EOAA 1CD5A 1TLLA 2GLUA 4PYKA 2NPIA 5KCMA 4G9BA 2RB5A 4L76A 5K20A 2WM9B 3ZCPA 1XMPA 3KDSE 3NIBA 4PM4A 4CPDA 1DP4A 2B2CA 2E4XA 3DYIA 3N0VA 2DWPA 1YQ9A 2JIMA 3OJLA 4U0KA 3W5SA 4CV0A 3R9WA 1TVMA 3AL3A 3SCZA 4GRDA 5D3MB 4PC7A 2CMDA 1KRXA 4PFQA 2O8BB 4BYMA 4HNSA 4WY8A 5PGMA 3LRPA 2R65A 4QBGB 1JA1A 5JXWA 4QOEA 2DY0A 3ACCA 1E3TA 1UWCA 1G8GA 4L3WA 4O59O 2AKAB 5JH7B 1KSJA 4HB3A 4KVFA 2DYKA 4YP1A 3GY0A 3DLHA 3L93A 4IH9A 2DC1A 5LQNA 2EGUA 1CZOA 4RDHA 1J33A 4PW0A 3QVMA 1OX5A 1C7FA 2W6ID 4TYQA 3WIDA 2WU0A 3NBQA 2FPIB 1YZVA 3GUHA 1NJ8A 1G3QA 5AM4A 4RO0A 4JJIA 2F1IA 3BAZA 3IHLA 3WLSA 4X8LA 1GCUA 2JGMA 3NKVA 1SXGA 4CDGA 3FSRA 2G1JA 5TPWA 1SBCA 1YQEA 3CE6A 3OE1A 1PEKE 1UP7A 3L79A 2QL9A 4E31A 2FE1A 3FRHA 3AETB 5ALGA 4Q1VA 1ZIDA 2NO0A 5IP5A 4D4KA 1FX0A 2C3MA 2UZ0A 3KQYA 4KDEA 1AUXA 1V4NA 3RBZA 3TQHA 4NNJA 5AVUA 4JVOA 1QYIA 1TIBA 4OX9Y 4IDGA 1IZ7A 3PC8C 1T2NA 4D98A 3OJ0A 4TPKA 4PO8A 3FDXA 4NCKA 3RKSA 3C3WA 3ZLBA 4EFLA 1JALA 1PK8A 2NZYA 2ZE8A 1QTRA 4C0BA 1FFBA 4HXGA 1OTYA 1PAUA 1R74A 2ZBRA 3EPRA 3REQA 5HCIA 4A0GA 2A1TS 1J39A 2PMFA 2E2WA 4G5SA 3RFVA 4GRIA 5DTMA 4N3AA 1E0DA 2IEZA 3E5NA 5DPMA 1OI2A 4ERXA 1JG3A 3S1SA 1JFFA 4Y0NA 2AEEA 5IF3A 3SFTA 2B99A 4U7WA 2JCVA 4DSOA 2FA9A 4QDXA 4IHJA 1TA9A 4AJ4A 3DD5A 3G0IA 5A3QA 3J80A 1S3SA 2CMGA 2IZOA 2X40A 5FTKA 2I71A 3UZUA 4DOMA 3I8SA 5KTRA 1MAAA 1SO8A 4HDKB 4QC2A 3L7DA 1IJFA 3OY2A 2P2CA 3AESA 3OZXA 3I61A 1QGDA 1NI5A 3FMOB 1MAUA 1VZ3A 5IT0A 4E15A 4LYDA 2QX6A 3NTOA 4R8RA 1BCSB 1XZKA 3IT0A 1PBTA 4GECA 3UMVA 4U6QA 2QLBA 1F2UB 2BEVA 1ZOLA 2PN1A 3RSZA 1MAHA 4OUDA 1EZ4A 2YQ4A 1VQ1A 4OXXA 3VR4H 3H97A 3U7RA 2WZBA 4INAA 5CR9A 3WLRA 2NVUB 1X7HA 2OXCA 5DTRA 3WB0A 3Q10A 2BH2A 4M0KA 1AT1A 5JSKA 2GFQA 4OKIA 1EIZA 4C7MA 4DV4B 3HFSA 1EFRA 2Q4EA 1NUQA 4WH0A 1TUIA 2X1VA 3RIYA 4IDFA 1E2PA 1ZWLA 2HRRA 1NTRA 1Z15A 4GOMD 4ILKA 4P0TA 2SHKA 4ND5A 3TUJC 4ZV9A 4ZYLA 2RHCA 1TTTA 2L19A 3A2NA 1NV9A 4U7HA 3FWZA 1V5GA 4Z3KA 2O0LA 1F2DA 2VYVA 3X43A 1GRCA 1URPA 3K8ZA 3MB5A 1A8UA 4OM8A 1RCUA 1QDEA 1Z6ZA 1EB8A 2MMGA 2HBZA 1PR9A 3OZDA 4I7EA 3W7VA 4MVCA 1DTWB 2NNWB 4HLDA 4ZAFA 3AEUB 1OB2A 3D64A 1J2JA 2RGCA 4WVLA 5B37A 2Q7XA 3E2MA 1CRWG 2D4HA 4YWJA 5E8RA 1N1DA 2RGNA 5CB0A 1OH7A 1FZTA 3C3DA 5JVDF 3S1AB 1QNLA 2DAPA 1LI5A 2XE6A 1DXHA 2PL1A 1N0UA 3GJSA 2QP3A 4NOKA 4X45A 3MB8A 4F2WA 3M6IA 2H1HA 3FUWA 1NQTA 4HDNA 4ESEA 2ZIXB 3LGXA 5C4IA 5MFPA 4I9UA 1H0KA 3EEIA 1A9XB 1LWOA 4R0NA 3A4VA 5LWHA 4IM7A 3SHOA 4B3TB 1SG6A 4PAGA 1D1PA 4K6MA 3EVNA 2C20A 1Y5LA 2I22A 4KIFA 3URKA 2HOQA 1C1HA 4P54A 3B5IA 2C5GA