4IG9A

Structure of nad-dependent protein deacetylase sirtuin-1 (open state, 2.64 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
269
structure length
268
Chain Sequence
MRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-1
publication title Structural and Functional Analysis of Human SIRT1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 85
structure length 268
sequence length 269
chains with identical sequence C, E, G
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4ig9A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4ig9A01
2PGNA 4F56A 1EFPA 4GG1A 4MPPA 3GLRA 4HD8A 1YC5A 1Z8NA 2Q28A 2A1UA 1PTJC 3ZGOA 4BVGA 4JU8A 5DGTA 4BV3A 4JU9A 2FRDC 2VK4A 1M2JA 1V5EA 1S7GA 1Q14A 4MQ5A 5FEMA 4UU7A 2JLAA 5EJ4A 1UPBA 4BN5A 4GPEA 2B4YA 5BWNA 4JSRA 3FLMA 3HWX1 1U2GC 1U28C 4BN4A 2FSVC 3IAEA 2VBIA 1OZHA 4J16C 1OZFA 1HZZC 4GM1A 5K3SA 2Q5LA 1XLTC 1SZCA 4UTRA 2OD2A 4RMJA 3GLSA 2QQGA 4L2IA 5MF6A 3U31A 2JI7A 2HJHA 5DEIA 3OE1A 2OD9A 1T9AA 1YI0A 2V3WA 1PNOA 5EJ9A 3HWWA 4RMIA 3FSJX 1O97D 5MFPA 3PKIA 1O96B 1YTLA 2EZ4A 1MCZA 1ICIA 4F4UA 2JI8A 2Q5JA 1T9DA 4BVHA 5MGNA 3F6EX 4L3OA 2UZ1A 4K9QA 1SZDA 4Y6QA 4BVEA 3CF4G 2JI6A 1Q17A 1M2HA 2EZ9A 2WVAA 4G1CA 4R8MA 1POXA 4UTZA 4V1CB 2WVGA 5K6RA 2PGOA 4ZP1A 2DJIA 5K2OA 4RJIA 4X3PA 4RMHA 1ZPDA 4KPUA 4UU8A 3GLUA 2IHVA 4UTVA 4HDAA 4I5IA 3D4BA 4Y6LA 1T9CA 4TWIA 4UTXA 2VBGA 4MPRA 5D7NA 2H4FA 1UPCA 3CLTD 2NYRA 4J1TC 5MFZA 2X7JA 1Q6ZA 1YC2A 1JSCA 4GP9A 2C31A 3D7KA 2Q27A 1PT9A 1V5GA 5EJ5A 4GM4A 4X3OA 1EFVA 5DGDA 4JUFA 3JR3A 2JLCA 3CLSD 3D81A 2Q29A 2BRUC 3K35A 4K9NA 1OVMA 2PANA 4KXQA 1Q1AA 3PKJA 4FZ3A 4JD5A 2H2IA 1N0HA 4FVTA 1OZGA 2EZTA 4FEEA 4FEGA 3PDHA 4TWJA 3EYAA 3JWPA 4UUAA 1DJLA 4C78A 2IHTA 1YHYA 4BUZA 2FN3A 2OD7A 4JT9A 1T9BA 2WVHA 4IG9A 3LQ1A 4KGDA 4BV2A 5K6TA 4GM0A 2H2FA 4RMGA 3CLRD 2H2HA 1PI3A 1Y9DA 2FR8C 2JI9A 2VK8A 4MZXA 5IMSA 1BFDA 2VJYA 2VBFA 5AHKA 3E9YA 4JUAA 1D4OA 3EA4A 2JIBA 4UTNA 1M2NA 1V5FA 4Q9DA 3U3DA 4V1CA 2EZ8A 4IAOA 4D5EA 4K9MA 1YHZA 4ZZIA 2Q5OA 5FYQA 4UUBA 4COKA 2A1TR 2Q5QA 2H2DA 2H4HA 5EJAA 5EJ8A 4K9KA 2NXWA 3IAFA 2AG1A 4JUBA 4QQ8A 3CLUD 1UPAA 1YI1A 4D5GA 4BVBA 5BWOA 1E3TA 4C7BA 2IHUA 4K9LA 4RJJA 1YNOA 1MA3A 1M2GA 1PYDA 4RJKA 5BWLA 4JUDX 4V1CI 3F6BX 2OORC 2QQFA 1J8FA 2EZUA 1S5PA 4MPJA 4IF6A 5EJ6A 3GLTA 4QELA 3FZNA 1NM5C 2H4JA 4JUCA 1POWA 2FWNA 1U31A 5EJ7A 2OO5C 4K9OA 1QPBA 1U2DC 2W93A 5EJMA 4O8ZA 1PNQA 1PVDA 3RIGA 2H59A 2VK1A 1PO7A 4JT8A 3ZGVA 3EY9A 3ZG6A 4K9PA 1YBHA 3RIYA 1M2KA 4QPZA 4BVFA 4Y6OA 2AG0A 2H2GA 2UZ1B
chains in the Genus database with same CATH superfamily
1JECA 3CYFA 1IBCA 1U2ZA 2P8SA 5BMVB 1EE1A 3B2EA 3LCRA 2VN8A 3U16A 2PV7A 4FLEA 4HS4A 3RFCA 3VOSA 1SOWA 3E3NA 1Y1RA 1CB0A 4HD8A 1FB5A 1GAEO 4TKMA 1E3LA 2FZWA 2WVJA 4GBED 2EJCA 3DUFA 3L02A 5FBKA 1IUKA 1OSNA 4DV4B 3HACA 4JBIA 2P9JA 2QTTA 4TXMA 2X4IA 2DQ4A 5LN1A 1IH8A 1CBUA 2C5HA 2NWQA 2WJ6A 2XUZA 2VI5A 2VCHA 3U5ZB 3NAQA 2ENUA 1SKAA 5HGJA 4EI8A 1JG1A 3AF1A 5KSPA 3IVXA 1CUUA 4KCGA 2Q0SA 3DNPA 5JW6A 2VFAA 3U7GA 5ES3A 3D8RA 3MHTA 2QM7A 2VPWA 1VL2A 5JXJA 4ENVA 4QL3A 2Z8ZA 2XUOA 3HL0A 1O4WA 1APBA 3SEAA 1KEPA 1S2DA 3KYBA 4E3ZA 3LA8A 2FRDC 2NSDA 1YZNA 1H2AS 1N2CA 2FKAA 3KWJA 3QKSA 2Q4BA 2IXDA 3WWZA 1MB4A 4H7JA 3TJRA 2GEVA 3SQLA 4PYKA 3C3DA 3EIWA 2W6ID 3KBOA 3EVDA 4GRIA 4WD3A 3IALA 1SQ0A 3RS3A 1L4GA 1URPA 2OTCA 4L9SA 3USZA 2RGNC 4CI9A 1C29B 6YASA 2XCQA 4PQFA 2R6AA 1Q15A 4UU7A 4JENA 4ZZ2A 1DAMA 4CNBA 4DB4A 4KVGA 4AG6A 2JB9A 5A7HA 1RCTE 1A9OA 1QHFA 1KTVA 3CVJA 3CUUA 5DNYB 4FE4A 2QTCA 1P73A 3K6SB 2GK4A 2MSEB 3PNYA 4H08A 1JDBC 1RABA 1TUBA 2WMYA 4Q00A 2FWJA 4WJKB 5G53C 3SS8A 2P5SA 3KS9A 2ZRPA 2O3TA 4DS3A 3ZE1B 5H1YA 1I7LA 1IZ7A 1MTZA 3Q0EA 2CD7A 2PUCA 2HDOA 4RHUA 1RWVA 1H4SA 3TPCA 3LGAA 4E11A 5TGDA 2CL0X 5LMCA 2IQ5A 4P3OA 5K3CA 2Q2WA 4E2ZA 2VSQA 1AA9A 3WTBA 2GZDA 1J8QA 4WRRA 2HMYB 1RZVA 1ZW1A 4QASA 4Y2VA 3IXMA 4X24A 3TXXA 2CLKB 3FKSA 3CVXA 4DMLA 3L2OB 3CZQA 1NN5A 1YDFA 4B3BA 1M1UA 3LKVA 1IWBB 3LUAA 3GNQA 4QU9A 2ZIFA 3DT8A 1FW6A 3E5MA 3QU9A 2GJSA 1RW4A 4RANA 4OA5A 1EAYA 2BHTA 3DT6A 1QVZA 3CLUC 4NBTA 4HBZA 16PKA 4MQEB 1IY1A 4KXXA 2IYXA 2ADOA 3BGVA 1J33A 3KHSA 3C3YA 5ECDA 1N25A 1X13A 3D6NB 2GZ2A 4TV8A 2VNKA 4I4TA 4IKOA 4MP8A 4RH1A 2OMKA 2C8JA 3VKUA 3SQXA 3GGCA 3IILA 3KSBC 4H4CA 2WSIA 1L3BA 2F48A 1MEJA 1XZ8A 2HJHA 2VYVD 3DMFA 4WCFB 4L8GA 1KJQA 4BKQA 2C2KA 5CVCA 1KZ6A 4WCDA 1NASA 2QTGA 2CLMB 3UXHA 4KSBA 4FB4A 2FW1A 3W3ZB 4B8ZA 1ZI9A 4CF4A 5EJ9A 4I81A 1RLMA 2JG3A 3HS3A 4YASA 1HYEA 4A1FA 1E9DA 3SR4A 2V8BA 3PKIA 4KX3A 5FI1B 2IHKA 2V98A 3EMDA 3HDGA 4RJ2A 2HFKA 4DPMA 1N34B 2HSGA 4G41A 4G2TA 1WM1A 3CR7A 3TDNA 1VLJA 3DHVA 1AX9A 2PMFA 1L6IA 4KQJA 5CPFA 3RVLA 4XYBA 4V0LA 4YAGA 4IOMA 4ALJA 3KQHA 2YS6A 3HO1A 1T4CB 1ZCJA 1HEUA 3EVZA 3UPDA 5KYWA 2AN4A 2N75A 3RU7A 5DSZA 2HIHA 3ODGA 1RIFA 3P9QA 3LCJA 1C3JA 2ZU6A 4BO3A 1A1VA 1F5SA 3P2OA 3CO5A 3H7AA 2D5BA 2LWIA 5GTDA 1N5KA 2H63A 3AMVA 3OTHA 3HXOA 1Z16A 4BUCA 1Q1EA 2IIVA 3BDIA 3C16C 4DR3B 3KKZA 3NGLA 1GGMA 4DCMA 4JI6B 4BVEA 3IBTA 4DIOA 1KSJA 1QYRA 5BSWA 5G02A 3GDOA 3LC1O 4IH1A 2AKEA 1KR2A 1QQTA 2FFJA 4DM4A 1VMEA 5BVGB 2NTNA 4EHAA 4LWZA 3KSMA 1H0KA 4M9QA 1MN6A 1QO0A 2XDQB 1SCAA 2Y71A 3B1FA 2AX4A 1KYIA 3QVJA 3HKBA 1RFGE 4HVAA 1Y7LA 2Q49A 3D3WB 3NYIA 5JU6A 4G23A 1POXA 2VDRB 1ODIA 2NGRA 3H87A 2CEKA 2VA9A 3BE5A 5GIOE 1ZINA 2WM8A 1ZAKA 5DCYA 2XZDA 3KZOA 1GTRA 5DIZA 4HFJA 1WSBA 3TB6A 2VZEA 3A6GA 2D4HA 3JTEA 4JLWA 3TSOA 5HIIA 3HVKA 3GIDA 4LIPD 1NKVA 1J6UA 1BG6A 2WWGA 3DP7A 3ELWA 2B4AA 2X8WA 3PEWA 2ZRDA 3UMGA 1XU7A 4N18A 1UT8A 2YIVX 4XXHA 4OQZA 2WOJA 1U0TA 1TAUA 4PGHA 5G2OA 2FR8A 1DQNA 4DUZB 3L8GA 4KPUA 3AEUA 2OZLB 4GXTA 3JZMA 1L7RA 1LVHA 3BORA 4ZVPA 3IPRA 3IDZA 4DRYA 1R88A 1TZ2A 5DE3A 3O1HB 3A04A 1QLWA 2PJDA 2AF3C 1Z33A 3QFFA 2AB0A 1IG0A 5DX8A 2WJAA 4NBUA 2HYDA 3KKOA 3NAMA 3R0IA 1QIHA 3RTAA 3DBOB 4N5DA 3D5TA 4BC1A 4YX9A 3SN6A 4UREA 1ENOA 1TCCA 3DG9A 3IMFA 4NS4A 4EENA 2X7XA 1A4UA 1PJTA 3JALA 1DWOA 3AM5A 5A9TA 3MWLA 3TQRA 1NZDA 1AQNA 4FINA 1VDMA 5DKFA 1I10A 4F6RB 3VYUB 4QUEA 4AUKA 2A8YA 4PGAA 3FHCB 1S2NA 2IF2A 2BBTA 4GC5A 3WHIA 1IY2A 1VYVA 4P7FA 4WWHA 1Y1TA 4U2CA 3MWEB 1CJSA 1MAHA 2ZT8A 1F2UB 1DTWA 1UBLS 1B14A 1AK2A 2GB4A 5FWYA 1MVOA 2AKAB 4JWTA 4AULA 1XYVA 2MT9A 2BYTA 3NFRA 2PX0A 3BMNA 3QU5A 2ZI5A 3ZDBA 2WIGA 3M9LA 1I3MA 1IEVA 4K3VA 3RS8A 4FSDA 4H2DA 3V2UA 3C6MA 4BU0A 3SKVA 1OILA 1TZJA 1BDMA 1P5ZB 1CEQA 1FNNA 1NG9A 2I1WA 3OFND 4KXVA 4L85A 4Q9AA 2BRUC 3J81k 1G64A 1MJ5A 3KAJA 5GY7A 1XD9A 3GFSA 3S8EA 5GJBA 4BAGA 3DWIA 4ZOAA 5CFQA 4F91B 1I1HA 2Q3FA 2V1UA 1BGXT 2E4XA 2Y0BA 3K0KA 4KXQA 1Q1AA 1SCDA 2AQHA 4OQLA 1SXPA 4UNSA 2XV1A 4INJA 1NE7A 1UT5A 1BH6A 2Z3WA 1P5JA 4IZIA 4GWGA 1ZM3A 5DZSA 4HMPA 2VPYA 1MOSA 3BJMA 1CJUC 4PHHA 2QMOA 2OV3A 3U3OA 4NLLA 4WJLA 4ZT4A 1FP4A 2TS1A 3G88A 2XMPA 3O8LA 2BFDA 3G0BA 4Y9TA 4YDSA 4FEGA 3A4MA 3F3MA 5J47A 3C1OA 4MKFA 1GRVA 1KU0A 2NYUA 4YECA 2C3PA 3IVGA 4E5UA 2O7NA 1T8SA 4P5EA 2VLIA 3CH7A 4YONB 1TA0A 1Q0HA 5TS3A 1DC6A 2EV9A 2NSHA 2QRGA 3LL4A 3DVLA 4FGZA 5DP1A 5DRYA 3O91A 5TMDA 1N2JA 4A0QA 3HEMA 121PA 3QYPA 1D2EA 5CCBA 4JT9A 3M9WA 5LL6P 3FCUB 4XVUA 1M7BA 4XWTA 4S1OA 4BLTA 3U7IA 1N3IA 3PHHA 3PBKA 4FNOA 2JAUA 3V4ZA 1NW9B 2QA5A 4A27A 5AUQA 2NPOA 5ILGA 1GZVA 3NKVA 4ID3A 5CT8A 3ZE7A 3ZOZA 4EHBA 3R40A 4KPYA 1NQWA 3PT9A 3U3XA 1YL6A 4KIGA 1NVDA 4XZ3A 721PA 2ILTA 2Z83A 5A5DA 3QYAA 4FFWA 3VNQA 1XVUA 2ODNA 4DDHA 3TLCA 3O31A 1C9YA 3KKNA 3ORHA 1NVVR 1XRQA 1B4DA 1N92A 2W90A 1QTIA 2CXUA 2QP3A 4X93A 5E1MA 4PX3A 3SZRA 2Z2YA 1ZSVA 4E31A 3ICQB 3L93A 4N7RA 3TYXA 5AO9A 1GADO 3C87A 3RBAA 4A92A 4NXNB 1NFFA 1WO8A 2GFHA 2I1VB 3IEXA 4B46A 3DLHA 4DRXA 5I5EA 5JDCC 5LOVF 2O8BB 3EISA 3DXYA 4EFDA 2NUBA 3DPIA 4TWAA 3C6BA 1KFJB 1FFBA 2HAEA 1QHSA 2VXCA 3BF8A 3PGVA 3W79A 5A02A 5LLTA 3QTLA 1UKCA 1EVZA 2PT9A 1M1YB 3H9EO 3KUCA 3QFSA 3UMJA 3I9KA 3CZRA 3GJ3A 2QTBA 1KYYA 3FJ1A 4XCXA 1Q95A 3EVNA 4MPTA 5AR1A 4RD4A 5CBPA 3E0QA 3BB3A 5IPFA 3SZMA 2YW2A 3L6BA 5AKYA 4TMWA 2Q46A 1A04A 2RK6A 5FLXA 2HBZA 2WFZA 4EM6A 3UT0A 3HDVA 1BVRA 2HRBA 3H13A 5EPUA 1DV1A 3M9XA 3AVPA 2DT8A 2A1TR 1UMKA 3HUUA 4EPYA 1UXHA 1W49A 3FCYA 1YE3A 4HY3A 4EF6A 4JT2A 4CKBA 4NBNA 4FUQA 3A1VA 2JS7A 5J5CA 1QIGA 3P0EA 3K96A 2YIDA 1I94B 3Q7IA 5KOJB 4AO8A 4CVNA 2ZZMA 1V1RB 4NECA 5C32A 5K0FA 1SB8A 5B4UA 2F3UA 2TSYB 4KZPA 2IUTA 3I8XA 3SYTA 2VT6A 5JZSA 4E5PA 1A9PA 4LNHA 1BO6A 4NBKA 1YB5A 3SC2B 2ZUDA 4PQGA 2WDZA 3WJ1A 3PEYA 3CEMA 2V7WA 2GKSA 3EWIA 1QVVA 3JQ6A 2AC4A 5EQDA 4EHKA 4Q66C 2C07A 4AS3A 4CGZA 3ILHA 2QRJA 4IWXA 3VR5H 5A4MS 1EFDN 2IFTA 1N5RA 1UPAA 2ZRHA 3OD1A 2WFLA 3EMBA 4HC4A 4IQFA 4PCUA 4EG8A 1YULA 3KZMA 1YS7A 3N76A 4DL9A 2ZQ5A 1DARA 2QTNA 3LNTA 2XE6A 2IELA 3LW7A 2I8LA 2WJPA 2JD1A 4M83A 1IN5A 5IASA 3WLMA 2B1JA 5H9WA 5KX5B 2P6UA 2IF0A 1SVUA 3SBXA 4TTAA 3U48A 4NOMA 3KJEA 4I50A 3KDAA 2X2OA 2QMYA 4DIMA 1RMTA 5KYXA 2PG3A 1PG0A 2VDUE 3IOYA 1BXRB 1DG3A 4WDRA 3IBGA 1FFAA 2M1ZA 1J1ZA 2FFAA 2W58A 3D2LA 2QORA 4H77A 4TT3A 4Y2JA 3HKCB 4ARUA 1XMQB 1QF6A 3UOGA 1W73A 2R11A 3CB2A 2VRWA 5HVNA 1NVUQ 3RK4A 2YWFA 2W2QA 1F7UA 1RAFA 4RHCA 3A2NA 4CQLA 5CDTA 4PRLA 2RHMA 3EIQA 3UFBA 1FS5A 2BSAA 2HSZA 1ISIA 1EK2A 2NVBA 3QEJA 1ZH2A 3BH7A 3VJRA 2CNBA 3UAWA 4U2GA 4NR0A 5K8VA 4WNAA 5E6UB 4CE6A 4IVQA 1C3VA 2GZMA 1QZZA 4XWKA 4HZUB 4I36A 1P4JA 3R7NA 3CX8A 1E1NA 4MS3A 2TRSB 1T8TA 2MINB 4IIHA 4ZTZB 1JFFB 1U31A 1A2KC 4YJHB 3DS8A 4UHDA 5CA0F 3FMGA 5CCDA 4OJTA 5DU2A 1JG7A 2VNSA 3D0QA 1QPBA 1Z0FA 2VJMA 2X8AA 2HWUA 1OOEA 1JTFA 3TZBA 3ADCA 3S2ZA 3H19A 3P5SA 3D1VA 3AI3A 3IUEA 5JROA 1PLJA 1UK8A 1KRWA 2J0SA 1FJHA 4RPHA 2W6PA 2P5YA 3U37A 3KHKA 3JZDA 1P9NA 1YONA 3NC4A 3O9MA 4JEHA 1NR7A 3AR8A 1GTMA 1N5IA 2VCEA 2GEJA 4BLPA 4HNAB 4KZKA 4QXMA 4XD7A 2QN1A 4PN7A 2R86A 2C9ZA 2RGYA 3MLBA 4DE5A 3VXKA 5J4LA 1GKLA 1T9HA 4CM4A 3ZDCA 4C7OB 4UTPA 3K30A 4UAUA 1ZUNA 1FFDA 4K6OA 2WB4A 5EUBA 2IYSA 4JEIA 1HA3A 1N1EA 3IBYA 4FQ5A 4MRAA 3UKDA 1P1HA 3RYCA 1MAVA 2AG0A 1XZIA 4FQ7A 3V4FA 1QLHA 3IDSA 3PUIA 3LG2A 4MMYB 2K2WA 4Q03A 1O3YA 1CEYA 2UYYA 4BV9A 4ARSA 2ODAA 1L5MA 3E0XA 3GUVA 3I37X 2DEUA 3FOBA 4IV0A 4PQRA 5EKXA 2G09A 4UNNA 1XWWA 4PFKA 3RAJA 3DAHA 3M4NA 2R6GA 1U11A 4HRXA 1KBOA 4O2LA 1W94A 3AVVA 2XYHA 3U4GA 4BZPA 4IDHA 4HPXB 4K86A 2WU0A 1VHWA 3T7SA 1G20E 1CUCA 3EUAA 2EXXA 4ZGGA 2QENA 3GP3A 3F7OA 2P5TB 4JU8A 2PBRA 3FNGA 3HLKA 3MSCA 2OGWA 2UXCB 3RYIA 5TDHA 3DQZA 3E8XA 5BXQC 5DNCA 2DPXA 2HCJB 1T5DX 1AH2A 1XZAA 1F17A 3G3EA 3ON5A 4KG7A 3PJFA 4M9XA 1ZRNA 3LX6A 4DNXA 1YBVA 3I34X 1BS9A 1AB6A 1CJCA 3CGWA 3PZBA 3ZPXA 3MJHA 4NESA 3T9DA 2IH4A 1THTA 3MRTA 4M1SA 3SY8A 3J80A 2BMVA 1MO6A 3ILXA 3L7DA 1KJYA 4J0JA 2JDIA 2WOOA 2JLAA 3SR0A 1PEDA 1JLHA 2WLTA 4XUGB 4TKLA 5ARDA 5AW6A 4FJ0A 1ZD4A 1CKEA 2I76A 3MOSA 1AKMA 4AZ3A 1ZISA 3LHSA 5G3ZA 3WSWA 1CUJA 1D2AA 2HO5A 1A76A 2E18A 3R5SA 4KWHA 2OQIA 4B75A 3BERA 1GNQA 1NRXA 1YK1A 3N2EA 1K66A 2CVPA 2GZ1A 1HOTA 4DA9A 4K88A 3D3KA 2XXBA 4R2JA 5IHPA 4J4BA 3DMPA 1XTSA 4M3NA 5F33A 4RQUA 4D46A 1YQGA 2XWBF 2P69A 3CZ9A 3P9PA 4D1YA 3T1VA 1E96A 3LFHA 1WXGA 1IBRA 1ZH6A 4LISA 4Q3OA 1JT2A 1SHKA 3BXGA 1UXKA 3HCAA 3I5AA 1E9VA 1U8FO 3HI6A 2XRZA 5IUKC 3IKMB 4YMUA 4DA0A 1SBCA 4HGOA 1D07A 1M75A 5KREA 3DVQX 3HYCA 4LQDA 5GADl 3EGXA 1QH0A 1TZMA 3KRTA 3GG2A 3WDKA 4IIXA 2O1XA 2QRKA 4DA4A 2XNDD 3KTDA 2FMTA 3THYA 2H29A 4DYVA 1GEEA 4IDNA 4HJRA 3COSA 3PTLA 3JQ7B 1QHYA 2J4CA 4R5MA 3ZK8A 2OGZA 4HAYA 3Q8XB 5AKXA 4BBPA 4EUEA 3PQCA 1E5LA 3HJUA 4I4IA 2ID9A 4LI3X 2WUEA 4AVYA 4ZFNA 2PZAA 3H1AA 5BURA 1JHMA 5C5IA 1C5KA 2DLDA 1VLZA 4XEHA 2XE4A 3UZUA 3G6KA 3VPSA 3RLIA 4L9RA 3Q8WA 4LNUB 3RW9A 3KLOA 4L08A 5JG7A 1ECJA 2QLTA 5K51A 4YCNA 4G5YA 1SCIA 1TGYA 2H1CA 4R69A 4RXMA 4BO8A 2IPXA 4HV4A 1CY0A 4M0UA 3CKMA 5EWJB 4UHBA 4Q7LA 2OM2A 4PR3A 3CUEF 4CM7A 2X5NA 5TF4A 3I2YX 2WPDA 1JFSA 5GM2A 1M6YA 4MVJD 4WDQA 3TGWA 1KWGA 4JC8A 4CEHB 4L2IA 3NG1A 3MT0A 1NVFA 4HQLA 1N2BA 4PZYA 4X44A 4BLOA 1GKUB 3LZDA 1KZ7B 4NAHA 4RESA 1FDWA 2V3WA 5EE5B 4ACAA 4CKEB 1E2UA 4U7TB 1I0LA 3IUQA 4ND8B 3A4YA 4MA0A 1C30B 2LR0A 3QE4A 3NLLA 2HV9A 3ULKA 4F4HA 2C4WA 2AC2A 1X2EA 1SBIA 4AJ1A 4EZBA 2AOUA 3BXHA 5B7GA 2Q3DA 3LY8A 3IE1A 1UIRA 2FZCA 1CU1A 1T1JA 1YTLA 3RAEC 1EZ1A 2ZJZA 1U99A 1CR2A 1PTKA 1R6BX 1HRKA 5DGHA 3CONA 5SYNA 1NW8A 4R5HA 1HNNA 1O54A 1VLVA 4BEWA 3KR2A 2XD9A 4DLNA 2P90A 1ISMA 1L5KA 1H8HD 2CNWD 2IY8A 2PXAA 1EP2B 3Q9LA 3GN1A 3BUSA 2B1RA 5JAIA 4UC0A 3NM4A 5KQLA 4WXEA 3ZD9A 1RWBA 2COEA 2W2TA 2AEEA 2FLVA 3K2BA 3KQWA 2J0EA 1XMVA 5LD2B 5CFNA 4NV0A 2O7RA 3F6SA 1DTEA 4JB8A 3H8WA 3RK1A 2HBRA 2X2EA 4MR7A 3NOVA 3L77A 4CV1A 1ZNWA 1T26A 5JVDF 1R8XA 3SAJA 4LS3A 5IX8A 3GI1A 4M55A 1ZR2A 3ECSA 5KNDA 2ZRNA 3IPCA 3PUVA 3DZ8A 1KI8A 1SUFA 1BGWA 3C74A 3KYIB 3NBUA 4RJTA 2OQ2A 4B3CA 1W2GA 3EYWA 4YMTA 2AG5A 1TM4E 2J0UB 1E7SA 2GNOA 1TMOA 2O8NA 1QFSA 3PDCA 4G89A 4QULA 1YS6A 4Y2TA 3RC8A 4JITA 3OFVA 1JRLA 1V5IA 2PS3A 1JR3E 4D4KA 3ETCA 1UAYA 3A3PA 2P2ZA 5LP1A 1TTPB 2NZVG 1AGPA 3LF2A 4WTOA 3N3AC 4O2AA 1WUJS 1L7VC 1YRLA 3RGWS 1EWRA 4YROA 1FNMA 1LW7A 2HRDA 3HR7A 3C4QA 3IKLA 4UM9B 2UVQA 3H2KA 3WLOA 4CCSA 2H4WA 1XI2A 1QLJA 3Q7PA 4LZAA 3WKCA 1EINA 1Y9JA 1KJJA 4EFNA 4UVDA 4EBFA 5L8VA 2W2LA 4AKTA 1LLUA 3GUHA 2D1QA 1B42A 2FJPA 3DFMA 1R4ZA 1TNDA 3TLJA 3U60B 2HIGA 4P1ZA 4QOHA 4CHTA 2AS0A 3ETGA 2I4IA 1M0WA 4Z1MA 3OF3A 1E9EA 1NBMD 2G5GX 4HVLA 3KIPA 4IGEA 5K2MA 2BFNA 1WCWA 4K6CA 1PFGA 3HE3A 3O4HA 5KDOA 4MYHA 4M8KA 3UQZA 3CH6A 4ZREA 1CEEA 3C6QA 2I7DA 1NN3A 2IYLD 3QNUA 5HKOA 1GPWB 2HLDD 3PLNA 3W8DA 3ISVA 5HIMA 1XPRA 3UWSA 3L0YA 3ZCSA 1DQRA 1X9IA 5LXTB 1E3MA 3S8YA 5DYGA 3KCNA 3WBFA 1JQDA 3CXUA 1VYTA 2C3MA 2P0YA 3L8EA 4RVGA 1Y8ZA 3CFYA 2EU8A 5MDHA 4MV7A 2DETA 1SKBA 2AE2A 1TEXA 3NEPX 1YJ8A 3FE2A 3AVXA 2BJVA 3PDJA 3CC8A 5HRCA 4IFBA 1EVYA 4E5VA 1II9A 2OSBA 4W4TA 2BDUA 2VKQA 1ZK4A 2OCYC 3AZQA 1ODFA 4YREA 4AIIA 4AY6A 1F38A 1ZC3A 1YSCA 4GM4A 2H7YA 1BYUA 2J3IA 1AHPA 2PH7A 4UDXX 3DO5A 4JBWA 4PZLA 5ICMA 4QECA 3AR5A 2GMWA 1P6XA 1ZJ5A 1N4DA 2I80A 3DL0A 3P27A 1IAQA 1WLSA 3GYBA 3G9TA 3MBIA 4R9RA 3R5XA 1RZRD 1OXXK 2FMFA 4CG1A 1N8NA 4KXFB 3KAPA 3DL4A 2Z58A 2ZYGA 3PEVA 4GECA 1XMOB 2CHUA 2WJGA 2ZIWB 1E7QA 1EDBA 1UKVY 1YE8A 1LNQA 4FWIB 3JY6A 4ENUA 2FWMX 3ER8A 5HJEA 1VI2A 4G84A 3QE9Y 2H1SA 3WWOA 1R8YA 1OGIA 4ZQEA 4BMXA 1SCJA 2OAEA 2RHLA 3GEDA 4P0PB 1JQKA 3TD6A 1JALA 4PS1A 2ERYA 3OWXA 5DNEA 3FLBA 3LAWA 3LQ4A 2M1XA 5IDVA 4HDKB 5CT6A 3IP3A 4Q4JB 4D3DA 4WVFA 2H52A 3L92A 1ZHHA 1V39A 5SICE 1X94A 1Q50A 2OXFA 4IUDS 5TMEA 1P8JA 1E32A 2P0AA 5K9ZA 4TKZA 4GZ5A 4MB6A 3T6KA 2D3TA 3PB3A 3B6IA 5LOVB 4XIJA 1AOXA 2R8EA 4JLDA 2Q5CA 1UQTA 4MVCA 3ENWA 4NEGA 4XJXA 4N41A 1LBQA 1KOLA 3ZHQA 2QVCA 1Z4LA 4F1JA 4PC6A 3QIAA 2CFRA 2G6TA 2PGXA 2Y1DA 3CPJB 3D6VA 4KUEA 5C8DA 1RI4A 2F1JA 1L5HB 2IS4A 1THZA 3BDAA 1J24A 1XZFA 2HH9A 1BKYA 1LDNA 1N3YA 2QQ5A 4XQ0A 3TLGB 2AK2A 2IW3A 3CTPA 4V03A 2VHVA 1EGAA 1H5UA 2ZAIA 3LUBA 3E9MA 1KXJA 4XRGA 5BRJA 4QQNA 4GMXA 3GZTB 4C3UA 4ZODA 3ZDZB 1ZXXA 4GPZA 4C5AA 2VK8A 4JL6A 2C3UA 3WGNA 1DDIA 1QU3A 2EEPA 5JIBA 3DO8A 3GROA 3AWDA 3U0BA 1R37A 1CJBA 2ACKA 1S2LA 2BFFA 3P2MA 3EZGA 1UIMA 4GGPA 4YRKA 3WQRA 4D81A 2FZKA 4YTEA 4YT5A 3ABQB 4FR0A 3D3NA 2FMUA 3MB8A 4XSVA 3IP9A 2CWDA 1M9NA 1EQ2A 2ZIXA 4MQMA 4L1KA 3NEYA 1JMVA 2C77A 3BGWA 4G5HA 4FFBA 4RA6B 3TRIA 1V5FA 3F7MA 4DMUB 5LM3A 1R18A 4G1FA 2QD1A 4Q16A 4D5EA 2HHCA 3I42A 2GERA 2VJOA 2YQ5A 3H4TA 4GQIA 4K9MA 3LP8A 4CMIB 4LSZA 1HURA 2CL7X 3HWRA 5C8YA 1BHJA 2IODA 1T8UA 2P9ZA 4LGMA 4U63A 3TSWA 1PEAA 4MWTA 2FU5C 3OLZA 4PBSA 2IYQA 4CFSA 5KTOA 4PYIA 1IY9A 3R75A 3W4KA 4W5WA 3E3AA 2BI7A 2OBYA 2QVYX 4OFWA 2QI9F 1OI4A 4AJIA 1XUOA 1M72A 2FCAA 4YPVA 2JLVA 3GYGA 2QN7A 3Q5DA 3VU3A 3IHWA 4JLKA 3C7AA 1TUEA 2QR3A 4X8HA 5EPOA 4EIWA 3TR6A 1PNRA 4GR9A 1Q19A 3QKTA 4TSFD 3AUJB 3BTSA 3FF4A 4PINA 5ALSA 5BYJA 3S40A 2H08A 2GN4A 3I39X 2WKPA 1U04A 4DQDA 5EP1A 4U02A 3WOVA 5FV4A 2XNHA 1PFVA 3QF4A 4HBGA 1JI0A 4PRZA 4YA6A 2YHSA 5DP2A 4RY2A 4XGIA 4BFLA 1DJMA 1R8SA 3LC7O 3O4FA 2PFKA 2DTXA 4IZHA 5ADUS 1WXEA 5HDBB 5T5QA 1W8DA 4GR4A 4LDRA 4E1VA 1XZHA 4NE9A 3RGGA 2QN9A 4BFTA 4K87A 4I3HA 3A14A 4CCWA 2FPOA 2R1ZA 1P1IA 3AETA 1WV0A 4U7JA 4ACBA 4D5GA 1KYZA 3AVTA 4V3BA 1CC1S 3EXHC 4DV3B 2DTDA 5JS1A 4G8JA 4N47A 3ZV7A 1C0EA 1G8SA 1L4NA 1ZM4A 2P6NA 1E5VA 5EVJA 3T5GA 4MUAA 4RIEA 3IXLA 2G9RA 3TD9A 4HK4A 3ZWWA 2AT1A 2BMJA 4HNRA 1EHIA 5TS2A 1BJKA 1VYUA 1X19A 1D2RA 1F20A 1XX6A 2W6OA 3NXKA 4X60A 5T8KA 1Z4KA 4LHXA 4B6RA 3Q98A 4HR7A 1F2DA 1Z2CA 2O0MA 3BHNA 3IS3A 4QJBA 1V7PC 3LKBA 3A4NA 2QTFA 3LUPA 1EDEA 3G2OA 2XWPA 2GJ8A 3OX3A 5DTIA 2C3YA 4NP6A 4BIIA 2OORC 2Y1FA 3DH0A 2I1QA 3E18A 5CXSA 4BASA 5ITZA 4KDRA 3QLEA 5JANA 3KK0A 3TFQA 1U4OA 2Y2VA 3NANA 3G5UA 3A1NA 1AXEA 3S6JA 2QROA 1J49A 1F9AA 1TQ4A 3FMIA 4EY6A 3D31A 1U1DA 2C4VA 1HM5A 3PGKA 4HNTA 5E6SB 1GR1A 2WYOA 2C03A 3CSUA 2ONKA 1LNZA 3SR3A 1UFQA 1LGYA 4Q6WA 1G55A 3F6CA 3CF2A 5K3AA 1EE9A 1PD0A 3N3BC 4GNRA 3ITEA 5HCUA 1ZL0A 1W59A 4UM8B 3OE5A 2NSJA 3C7TA 3QPUA 1ODCA 2GT1A 2X8JA 3TQHA 5GGYA 1AZLA 1PQ4A 2H1HA 3I8OA 3JQQA 2BHSA 3VJKA 4W9MC 1YH3A 1LEHA 4LJKA 1MOQA 2PXXA 4MW9A 4EI9A 2B21A 1K06A 1M5TA 3KOXA 4AMBA 3I9NA 4IP0A 4RXTA 4WLFA 2NUTA 1W88B 5MN6A 1YAJA 2FW8A 4UFNA 4NULA 4ISBA 3SDSA 1DO2A 4D2IA 4BDSA 4DZTA 1GHTA 3SZUA 2X76A 4R84A 1KPGA 1SWVA 5CLHA 3JQRA 1RRPA 1CULC 2IGTA 3AONB 4DADA 1U7UA 1DC4A 3B85A 3WLFA 1G9XA 2D0PB 1BU8A 4D4GA 2P62A 3ZV4A 2XECA 2YQZA 2DFNA 3Q0TA 2H59A 1W44A 5EYPB 4EZEA 1Y9ZA 1NXVA 1SVIA 3UAXA 5FL7D 3V7FA 5LP6C 3R4CA 4URFA 1GOTA 2C3OA 3PLAE 1RAEA 3K1AB 1E1LA 3ZG6A 3THRA 1SM4A 3G8AA 1BRMA 3O8NA 4ALLA 5KOIA 1L0BA 5I4CA 2CHGA 4ZAWA 1RXSA 1ZRSA 1P31A 2YBEA 3LPNA 5JSKA 4EF5A 3RIYA 4M88A 4WKBA 1NW5A 4HUQA 3CVYA 1BE8A 3WB1A 2FTKE 1J06A 1G21E 5CXUA 2OOKA 1T3GA 1Y8RB 1FP7A 2ZJ8A 1MV5A 1Y8CA 4EGCB 4HI0E 3K6KA 3UEOA 2XQGA 3FJYA 5AK4A 4X91A 5C34B 4C3OB 4N0DA 5JFOA 1FPQA 2FSSA 5E9QA 3MF4A 3C39A 1HFKA 4POOA 2R8OA 3FJOA 1RCUA 3IVMA 4JLUA 4MJXA 4IZ6A 4B4VA 2NW6A 5BOVA 3QLVC 4YCCA 4U8HA 1L9XA 2HBYA 1GGEA 3KSDO 3L7MA 4W6ZA 2JFXA 3A9RA 1Z6TA 1XP8A 3AFNA 5TC4A 2PUJA 5TGZA 1ADJA 1G7CA 1WUYA 1ZZEA 3QFCA 5HQ3A 2H5IA 2HF2A 3RTGA 3FB4A 4AK9A 1BXGA 3BQ9A 1F8YA 4LZLA 3V46A 4JODA 2ABWA 3IIKA 4GNKA 4C2UA 2QJFA 3PNQA 3A3KA 1NYRA 4LSMA 5B1EA 3HGQA 1U3FA 3UGKA 4EQ6B 4TN1A 3TLZA 4EPRA 3S2GA 1L7AA 1UC8A 4BV3A 4MV0A 4LBWA 1XA0A 4UNPA 2IEDA 3I2JA 3RS7A 5AIBA 1MBZA 3SZGA 3GVIA 2YXEA 1XROA 3E53A 4IH9A 1M2JA 4HAUA 2V65A 4O4JF 4YDHB 2DR0A 4FZ5A 3QUAA 4FN4A 2ZW9A 4NARA 3OUUA 4JR2A 1IM2A 5C7YA 10MHA 3L5OA 3PQ4A 4MQ5A 5LUAA 3JATB 3EBPA 4NAVA 4ZRMA 5F12A 1Q7BA 2PEZA 2WC1A 1GYQA 3VO1A 2KMLA 4TTRA 4EG4A 1I3NA 1I6LA 1XF9A 2O50A 2P1RA 1V6SA 3L7NA 3VZBA 1L5WA 4YRSA 3A6LA 4DQXA 3HM9A 3T94A 4BWFB 2VJBA 1RJEA 1NI3A 3L5KA 4LQCA 3E4DA 4NMHA 5CCEA 4YLYA 4GPEA 3R3ZA 1Y1KE 3LX8A 1I14A 1DGQA 1I30A 1X7WB 3FLMA 1T9KA 1FTWA 4Z51A 4IUCS 1KIAA 1G16A 1MIOA 2A5LA 2VXOA 1ZUHA 5FOSA 1TMGE 1DC3A 1IXKA 1P2UA 3SYLA 1LF0A 1T1RA 1YGPA 3WJ7A 4GU5A 1FU7A 3QPAA 2DBZA 1O95A 4MDHA 4S1WA 3GK3A 1V3VA 3UB3A 3QTBA 2H5LA 4ME6A 4E12A 4KEAA 4P7GA 2BFWA 2C04A 4ZJYA 1C9DB 2YCBA 5IW8A 3NBAA 4LMAA 2R6CA 4MO2A 5E6RA 2GK6A 3L7KA 3MWEA 2LD4A 3MJSA 4L7QA 1ICEA 2CZCA 4V0RA 4DMGA 4FMPA 3MGBA 3T9CA 4QQRA 3DPSA 4D96A 3PGJA 3FPBA 3PS9A 3QMPA 4GKVA 4QDZA 4ZVKA 3CLHA 3PE6A 1GRCA 5KTTA 1BHQ1 2O8DA 4B6JA 3AIOA 2R00C 5AXCA 3VOBA 2X9QA 3P52A 4EKGA 1U7HA 3AM3A 1BNCA 1E79D 3TCXB 4TL9A 3WZMA 3ZHXA 4YRPA 1L5ZA 2ID4A 3FNIA 1V3TA 3FZGA 4PICA 4DANA 1N0IA 2NZUG 1P4SA 3A9SA 4BVJA 4US1R 2VAPA 3H97A 4FFDA 3UAOA 3VR3A 3G5AA 1CYDA 4OUKX 1KDYA 1DJPA 2BKUA 5JHHB 3ZVMA 4DCSA 2HZ7A 2DUWA 3TAXA 2QAJA 4F5YA 2IPAB 4Z0TA 4ZYWA 1A8QA 2VZ8A 1LS1A 1NRJB 2QY9A 3VR6H 4BMPB 2H1OA 3MT7A 2H7XA 3OTIA 3DLCA 4I1IA 2B78A 2AOTA 4XFDA 4GMKA 5I8WA 6NULA 1YZYA 1OXUA 3A2LA 1X1BA 4ZT7A 1TF7A 1NXPA 5JVDB 3DKRA 3QX3A 1IOWA 4K0RA 4FOTA 4HB4A 2BJHA 3VPFA 4WY2A 2ZK7A 4U7PB 4FYHA 5C3MA 1RXIA 2IEBA 1I3CA 3LYLA 4C07A 2VOJA 2I03A 1DRWA 2IU0A 1HNZB 5BN5B 3AF0A 2FLWA 2B98A 3FSGA 1JFRA 1ZK3A 4RHFA 4B6OA 3GJ0A 1T24A 1H0RA 1E1RD 4RD0A 5JD5A 1V26A 3JAMA 2C5GA 3R0XA 2ZUVA 1IPFA 1ATIA 3GDWA 5D51S 4B7AA 4LOIA 5KI6A 1M8GA 5EE0A 1ST3A 3EBLA 4F84A 2JI8A 5DRTA 4WOJA 3FGPA 2EQBA 3FXAA 3P9XA 2R5NA 3P2IA 5JJCA 3RUHA 1ZM2A 1GLGA 2HNAA 2JGKA 3LW8A 4ARCA 2HJSA 2HV8A 2YJ5A 3MWDB 4TTJA 1VPVA 1KY5A 3FN4A 1AGXA 2AZTA 3LDUA 2HUPA 5K3EA 3CSDA 1X92A 5CD9A 4KO3S 5FORA 1BXKA 2FRVA 1QGUA 5U4QA 1FP2A 4S35A 2J31A 1EEXB 2VPIA 4J3NA 4CG2A 1UM9B 4LXHA 3B60A 2QTHA 2AN9A 3QA3E 1K5DA 3DHEA 3DUWA 4F4IA 1MA0A 2XSZD 1X42A 4UTZA 3DMNA 3MLEA 3UFXA 5CBKA 5BUZA 3QBTA 4I0WB 5CDFE 4WA7A 4CF3A 1WD5A 2LKDA 4D26A 2JHCA 5TY0A 5B4TA 1TYEB 1EM6A 3NGXA 3AZOA 4GEKA 2R96A 5JJLA 3TAUA 4HB2A 3RAGA 4M7RA 1AMUA 5C46F 2XA9A 3IMEA 5DNVA 3OZTA 4OB6A 4Z4HA 3DM9B 4J9VA 1UADA 1XCPA 3BXPA 3DDUA 4RVDA 2Z2IA 4ZO8A 2YMLA 2E2WA 3S7TA 3WLAA 1KZ4A 4M38A 1G21A 2ZKIA 4EGSA 2R48A 3NW9A 3BIFA 4WNYA 2W83A 5F73A 1THGA 3IUPA 5HIJA 4PNEA 2HJ9A 4GL4A 1GFWA 2JEZA 4HDSB 3NWOA 4BE7B 1F1BA 1RRKA 2RAVA 4KB5A 2O8CB 3X1WA 3UT5B 1YVEI 1A98A 3HJTA 3D4BA 3QJ5A 4KO8A 4NFLA 3FI9A 3QVTA 3SVLA 4RELA 1NMQA 3PXBA 4PC7A 3AF5A 1VE1A 1KKUA 1USKA 1O6BA 5CA1A 4EB8A 2JFZA 1BMTA 5HE9A 4MW0A 3RDPA 2Z95A 4BKUA 1NY5A 3N8NA 4A8HA 5BMOA 2QL6A 3A6KA 2QSUA 3I6BA 2A5YB 3MS2A 4HFMA 5EZQA 1Q83A 5ECWA 1CXZA 1GU1A 3DGEC 3CLTD 1KEKA 5FBZA 5FNVF 4U39A 1U9CA 1UDBA 4JN6B 1DAIA 5IWAB 1YOBA 1Z8FA 3TBHA 3KLPX 1I5OA 2WZBA 4PYRA 5ITVA 3COJA 1KJIA 5CMLA 5F21A 3EBOA 1TAHA 1Y0BA 3NJRA 4M0MA 2RG1A 2AF4C 3DBHB 3VH1A 1P60A 4DQLA 2PMEA 1I7DA 5BV1A 3OF5A 1RBYA 3H17A 3LUKA 4HQ0A 2FDRA 3IV7A 5LZ8A 2EARA 5DM4A 3BEDA 4FGJA 2D4AA 4EJ6A 1C3EA 2FV8A 5E4JA 3DL2A 1LX6A 3JYNA 2QD2A 2D06A 1MO4A 2PQ2A 2X58A 5DBFA 1WA5A 4HQFA 1L7QA 2ILVA 1WR8A 4C6RA 3KDPA 1L5NA 5JRDS 3UG6A 1MEEA 4BVLA 5JZ9A 1XVVA 3NTLA 2YZ7A 4I55A 4AX4A 1LZLA 1VDZA 5C4MA 1TKRA 4KLAA 2B2XA 2V03A 1XIVA 3DE5X 1EDDA 3GUZA 2J0VA 1QORA 1DJQA 2MSWA 2XTMA 3G2IA 4TWBA 1ZRMA 1YQ9A 3IEMA 3CQ9A 5KNBH 2VYQA 3BZUA 3F49S 2NV2B 4RZXA 3HN6A 1HMPA 3D8SA 3UYKA 1WKCA 3HN7A 1JVSA 2ISQA 3L1KA 1T5SA 4FEEA 4R9SA 1E6MA 3P9IA 4J1QA 4CM9D 4EG5A 2QRHA 2JGDB 1KMMA 1U6KA 4IHKA 2P78A 2H3HA 2XGOA 1V6AA 1NDUA 1YHYA 2W6IA 1IJEA 2PO5A 3SIXA 3VR1A 3SM9A 4BUZA 3ZE6A 1KOJA 1ULBA 3UH0A 1E7WA 2JJ1D 1M6VB 3ZGNA 5SY9A 5GGXA 4D4HA 1IL0A 4YUZA 4V2UA 1OFTA 1G2IA 3DWEX 2W6QA 1Y33E 3F98A 1VGVA 3JPYA 4MRRA 4OV6B 4FD2A 2J85A 4PF1A 4R3UC 5T4EA 2AD1A 4YRGA 3CLRD 3IYLW 4WI1A 1QHNA 3LYUA 2Y9PB 2H2HA 4JP8A 1FVHA 1QCZA 5EP2A 3AH8A 3OQOA 4PG4A 3I3OA 2A9VA 5F78A 1E3EA 2WWTA 5AW8A 3R9XB 1JLLA 1QTRA 3JQAB 3DTVB 1GUAA 4U2KA 4OEHA 3ZHSA 3WK7A 2GK7A 2VAXA 4G0WA 3N6XA 1NPTO 1WMAA 3H9BA 2VUIB 3TW4A 3HJAA 3GD7A 1MC1A 1P4HA 5EE9A 1TF2A 5DF1A 4DQVA 1LD3A 4AO6A 1C4WA 2DQSA 3PHCA 1DQZA 2FJ0A 2BD0A 3JAWA 3L6UA 3GLQA 3H9UA 4REOA 3W6ZA 1KEEB 1FZTA 1U2DA 2QDXA 2VDJA 1M2NA 3LBYA 4HQRA 4WN9A 5BSGA 5HFJA 4QHTA 3VR6D 5DCWA 1JUDA 1T0IA 1GT6A 1S7CA 1UWCA 2PVPA 3FWHA 1GRRA 1P18A 5FULA 2PUGA 1OBCA 1BS1A 2A1TS 3O3OB 2GA9A 2XOEA 1X1TA 4PWZA 2HWYA 3O93A 4WN3A 5E2BA 3KJXA 1NW3A 1F8FA 4PLFA 3C7CB 1ZBQA 2A3RA 3O73A 4LJSA 2HKIA 2BGNA 4MR9B 4YRIA 1NF8A 1YGYA 3V4SA 3EODA 4H7KA 521PA 5LQUA 2UU9B 1GPJA 4XWAA 3GP8A 4TM7A 2YRWA 3F6YA 1ZGGA 3O92A 5I8ZA 3HRIA 3ZR4B 5EJ8A 2DBVO 1DKMA 1XNGA 3KT0A 1H2WA 2JL1A 2PUWA 1FYEA 1QDLB 2Q4OA 2VYVA 1EVKA 1CY4A 3NDIA 4KLRA 3BL5A 2M6SA 3FZYA 2KHZA 4O63O 4EEKA 4RAOA 4S24A 2ZS8A 3JAKB 4OGWA 1F06A 3D6AA 1Y6RA 3OPNA 2PT6A 1YU9A 2AW3A 1EJ6A 2QTVA 3E3LA 4QQ8A 2H1LA 3EGDA 3VHXA 2Z5LA 1QH1B 3C3XA 3VFDA 3NBQA 1L7PA 3AVQA 5I9BA 3UJ6A 4H3KB 4PZCA 1SCUB 5G40A 1AN0A 3OQ6A 4QTZA 4X7MA 3EIEA 5KPDA 1J8YF 5TGTA 4JYZA 1NN1A 2CDRA 1Z73A 2OWDA 2YMQA 1E5QA 3FDJA 3C5WP 3G7UA 4JXJA 4J3JA 1YVRA 2FMXA 1E3TA 3H8SA 2HU2A 4QDKA 3RKRA 1LK0A 3RS0A 1EIWA 1D4ZA 1OW3B 5CNMA 1YF3A 2BGMA 3FYTA 2CF5A 4OBBA 4RKEA 3KM0A 2R7LA 1CUAA 3H5RA 4RIFA 2EBHX 4U3JA 4FDLA 5AVOA 2GBLC 2GJAA 1QJ4A 5CTAA 3HXKA 1BA2A 1H9AA 3F5QA 3SG0A 4QRDA 1GSOA 3V9PA 1OI7A 4B83A 1L5FA 4YUYA 2I2AA 2Q99A 2XBUA 3L8HA 4YJ2B 1BU5A 1TQ6A 1NUPA 4FW9A 4IX9A 2Z9BA 4KQMA 5GV7A 4ZQGA 1EUDB 4MS1B 3F4LA 4IDOA 5CK5A 2F4VB 2RDMA 2PV0A 3R76A 3EULA 2J6HA 2IZ6A 4IYJA 1D0VA 1SOAA 1JQJC 3RYHA 3MWYW 3T1OA 5BXYA 1CUXA 5IF9A 4DC9A 5BV0A 3PD0A 4BMOB 5LBIA 3WK9A 1GUYA 2WSSD 1TKBA 5J4VA 1NPYA 4W9NC 5LQAA 1J20A 1CWUA 2VWGA 1KHHA 3I09A 5LNK6 4EY7A 1F8XA 5CVJA 4CFYA 3MJCA 3N74A 1XTTA 2BBSA 3DKPA 3JYLA 2OO5C 2BSXA 4M37A 1XCJA 4YRDA 3H5OA 1Q6YA 1E9SA 3EC2A 4DMMA 1J2RA 4MKXA 1I6KA 5L45A 1E2FA 1FTGA 1QE0A 4MKZA 4YRZA 2GZHA 2W93A 4ZEXA 1ZDMA 2PWZA 7MDHA 3MCAA 1UMCA 3QOXA 1S2GA 1Z38A 1Z36A 3B1VA 4ZAVA 5TSDA 4KTTE 3RAPR 2VSNA 4ITVA 4TZ6A 2V3VA 2RD2A 5CVTA 1A72A 3ACBA 3PEUA 2JKZA 2QD3A 2J41A 1LPAB 3DC2A 3PHLA 1PR9A 3RANA 3W2HA 4JYBA 3ZLJA 4B84A 1N32B 2H0RA 2ZUTA 3NBZC 1OD6A 1JH8A 5A9SB 1V5WA 4RIHA 1Y1QA 4FZVA 3CMCO 1K08A 1C4OA 4JT8A 4INPA 1AF7A 2R6R1 3DOHA 4X00A 4DCTA 5EP3A 8MHTA 2F43B 1U0JA 2QPLA 4J7UA 4G86A 3ZCVA 3OU7A 4CCAA 5JXGA 1GUDA 1KDOA 3H05A 2HWXA 5J63A 5JLJA 3MN1A 5AESA 1V4BA 2CMGA 4DCJA 1G291 1R0ZA 3M83A 4KQXA 1U0HC 3G79A 3CUYA 4F21A 1SVMA 4D99A 4BVFA 2YVQA 2HCFA 1JU4A 5JWOA 4UHEA 1EJ2A 4EL5A 4BFUA 5EZSA 4O4JB 2DR2A 1D1TA 3RB8A 2FSIA 3Q15C 3FHJA 2HY7A 3ZS9A 4NQZA 1EK1A 2W6ZA 4ESVA 2P2DA 3E3MA 4R01A 3TZCA 1KMIY 3AO0B 4LNAA 2WIJA 1QP0A 2Q3HA 5F98A 3K0SA 4PAGA 2WQ6A 1WXXA 1JV2B 1ULTA 1XKQA 3II6X 4P6VF 2GD1O 1PG5A 4UKDA 5AM5A 2R7AA 5G3YA 4EH1A 5HZKA 5EINA 1I13A 2Q5IA 2K7ZA 4KWEA 5TQ2B 4NZOA 4HDOB 4RLFA 4R0MA 1ODJA 4F96A 3ZZ0A 1Q1NA 3OFNA 1GU0A 4ZI7A 4RTQA 4FGUA 3Q9UA 4XJTA 1MB2A 5DLQC 5AKLA 1K9VF 3V7YA 5JSYA 5TXGA 4C6TB 4IFEA 3BSWA 4WAUA 4MXDA 3S29A 5DGTA 3HV2A 3SYMA 1W36C 2H16A 5JAUA 3P5BA 1ZGJA 5E9AA 3T54A 2AQKA 4JLPA 3ADKA 4NENB 1AT1A 1T2EA 1ITZA 1GPBA 3F97A 3R3UA 1SGWA 3TQCA 2CFIA 5ULLA 1ZK2A 5F51A 3UQYS 4RZ3A 2FVYA 1KAHA 2YY5A 1TOAA 4LTNA 4PG6A 1ELOA 2FXVA 1WCV1 1ORHA 2B69A 2IOHA 3ML1A 4A6DA 2ONYA 2XVAA 4K9SA 3SNHA 1LBIA 4LDPA 1WMEA 1LJLA 1NJ8A 2W4MA 3CV3A 2RGWA 3K6JA 4NE2A 1U0GA 5AQEA 1E92A 3KZVA 1M2VB 2Z5GA 4WESB 4R2MA 4AB1A 3UW1A 5U9CA 5D3MA 2O8VA 1O03A 4LYDA 3ANNA 4J7CA 1Q12A 1YB4A 2HSEA 4OH1A 4MI6A 3IKVA 5DISB 3JQ8A 1YDEA 4W8OA 4PW0A 4MDEA 3IA7A 3X1ZA 2JW5A 1WCIB 2EHJA 1SVLA 5HUJA 3ROKA 2AN1A 3AJ8A 1Y5RA 2ZE8A 3IO5A 5HUHA 4WUTA 2XCIA 2J0QA 3CF6R 4QKQA 2GTHA 3AB3A 5FOVA 1X8JA 3SEFA 3ELBA 3PFKA 4MI9A 4HQKA 3OE4A 1FC0A 3AEXA 1X3SA 3HWX1 1U2GC 2BN4A 3M7IA 4F8YA 1EEHA 3L1VA 2XKBA 1VYHA 1WWKA 1HDXA 1ZZGA 1LLCA 4BNVA 2WA2A 4RHTA 4UEQA 1OBFO 2IXEA 3MMXA 4LRSB 2RSLA 4P81A 1ZHFA 1EFCA 3K5PA 3LLCA 4J16C 1Y4DE 3ZOKA 3RREA 2SCUA 3AYXB 2WYVA 2ANBA 3KEOA 3BMOA 5EGSA 3X2SA 1S6YA 4RTJA 1T0JB 4DR5B 2FMHA 3SF8A 3OP4A 4BWYA 3WOHA 1JEYA 3KT8A 3PXGA 5FA8A 3S70A 4B0PA 1QBKC 4IJ5A 4M53A 3UAYA 1ONOA 2GLUA 4MAAA 1W87A 3BJZA 4HUTA 1BTOA 2PBZA 3CUWA 4DZRA 1PBNA 5CCXA 5TQJA 1TRHA 2JCSA 1XDSA 4HNGA 3ZE8A 2VVTA 3NC0C 4RGVA 3BXZA 4UEJA 3ROQA 5C8VA 3W1WA 2Y1CA 3HI4A 3HZRA 3NO4A 1W25A 2ODWA 4RMJA 4PONA 3G8BA 3KKMA 4RD1A 3Q40A 4IDBA 4O02B 3RD5A 5EXDA 2ZTUA 4IPTA 2Z98A 5BQ5A 3AG6A 3QLTA 2GRAA 4E46A 4F3KA 1OVGA 1WQ1R 3QBDA 3DF9A 3TVDA 4IVPA 3U7QB 1A0OA 1U7ZA 4PTZA 4H6XA 1U28A 2PX8A 3TAHA 4IDCA 3DYIA 5G4KB 3OEHD 1Y5MA 1H0SA 3EG9A 5H59A 5T6MA 4WKNA 3N6RA 2HIAA 3FWNA 1JSRA 4G0MA 1UL1X 2E4UA 5TARA 3QPBA 3DE4X 3H83A 1X1AA 4LBVA 3VX4A 1LI4A 5TJ9A 4QOFA 2O5RA 3ROPA 4CR7A 3QU4A 2VOEA 4PHCA 3ZKAA 3ZLUA 4YQFA 3GJTA 3D8NA 2OO7A 1UBEA 1KKMA 1Q0RA 2ZYWX 3C7KA 1GZ3A 3FUTA 3W8FA 2BM1A 3G0HA 3EXEB 4BNZA 4ADSG 3THWA 4MWOA 3JQBA 2Y4OA 4R16A 4ZAYA 2J4FA 4Z5XA 2X0FA 2ZRMA 3U7HB 1P75A 1VSQA 1N8KA 1FDIA 3ZKWB 3PFBA 2UXBB 1DJNA 1U4NA 1DHTA 3EPKA 1RM4A 4U0KA 1EUYA 4PN3A 5IAOA 1P0QA 3WJAA 5BN3A 4NICA 5EWJA 4IY1A 4Z54A 3RRZA 3DVAB 4EHHA 3KQLA 3T8YA 4H7PA 3MW8A 4H7EA 3Q87B 3I45A 4XWYA 2DWUA 3PNOA 5BMVA 4JHLA 5IFLA 1TVKB 3KXPA 2JPDA 3U3RA 3HB0A 2G82A 3VO8A 3JD4A 4JP2A 1ZJ6A 4KYVA 2X5OA 1W29A 3HY4A 1JPUA 2Q2VA 4HQOA 3TNFA 1HLGA 5B58T 1UBHS 2VRCD 3I52A 1Z0ZA 1SIWA 2AI2A 4W5HA 5CX4A 3CWZA 3RU9A 3A7EA 3OQ1A 3BS4A 4R8MA 2GF0A 2QL9A 1PU2A 5I4IA 1RHUA 1XRSB 3OQNA 3B1XA 1E4OA 2Q6VA 4B17A 2PMWB 3LKZA 5TPZD 5IZCA 3KT3A 4U7FA 2B4KA 2VSXA 4M60A 5FR2A 1NTRA 3HXTA 4OD0A 5FNVB 4FZRA 1X7XA 4MR8B 4NK4A 1JDVA 4IH4A 3VISA 3K94A 2IWRA 4S1TA 3AOGA 2CHFA 3F7TA 3RKSA 2AYZA 3CKLA 4DWOA 4WVLA 4BQQA 2O5EA 1T0BA 4M8NE 5JLAA 4BV8A 1OF1A 4ZJUA 3OMWA 1X74A 3UKOA 4Y3UA 1JKFA 5FWXB 1OAOC 2GTIA 5JTUA 1NNI1 4L5BA 1MNQA 3PDWA 1MC4A 3QVGB 4H18A 4UUPA 3U4QA 4QWMA 3ICCA 4UU8A 1SQFA 2AL7A 2HEGA 3WR5A 3DZHA 1M83A 2EF1A 2WFMA 3HHEA 5EQFA 3WYFA 2PD6A 1NSYA 4Z49A 4OIMA 5ALFA 2J6CA 4XIIA 2M2IA 2RKWA 2YV2A 1KYTA 2G80A 4NH4A 3K6SA 4LY0A 2C96A 5B2EA 4Q4HB 4DPKA 4P9NA 1BKDR 4R6WA 4Y2UA 4QXPA 1EFUA 2ZBEA 4A6XA 4XVCA 1ESZA 2WTXA 1NI4B 4JLNA 4KYUA 5HF9A 2VBGA 4ZGBA 5C7IO 3DTVD 2R8RA 4LBZA 4CUJA 2ZR7A 1KVRA 5ITSA 4XGRA 2RI6A 1I1NA 3OFSA 5I7SA 2PGAA 2NNWB 1IZ9A 1ISPA 3ABRB 4G4IA 3VDXA 5JSFA 2BEJA 1ABEA 1C2YA 4B5LA 2AOXA 3EX7C 3QX7A 1ZH8A 1L4HA 2C31A 4NG5A 4N7JA 1HDIA 2VH2A 2RGDA 4H9GA 4A91A 4IG4A 5C5EA 1B93A 2FW0A 1IVNA 2R6HA 5KKAA 2PMDA 2LIVA 4QTUB 4BEJA 2V7EA 4IR7A 4Q1FA 2V3CC 3SYRA 1ML4A 1QNFA 3VHRA 5BY2A 3ZC3A 4Y6RA 5GZ1A 4HDNB 4RYDA 3ORSA 2IS1A 3EZ6A 4XSHA 3SE0A 1Y6ZA 2PPVA 5AOBA 1VJ5A 3GFFA 4CMEA 5AVTA 3TE7A 4BOYA 2R7NA 3A8TA 2Z2ZA 2ZWVA 5KJ1A 3AESB 3V3TA 5LMNB 3VNRA 1NBME 1UP7A 4EY4A 4MQEA 4DQ0A 2IS6A 4GZLA 6ABPA 1N3LA 4UEKA 3STXA 2OP0A 2JFUA 1KO1A 4DILA 1NJ1A 4ARVA 2CD9A 1Q1GA 2HU5A 1R50A 1BXZA 3VPBA 2P68A 1JJBA 1MFPA 1SG9A 1T0UA 3VH2A 4YUAA 4FGLA 3VKHA 2PL9A 1C80A 1HL3A 3PXXA 5J59A 4RV4A 3UT6A 2Q50A 1K5HA 1P9LA 1D1SA 2H2IA 2EX1A 3MFYA 1I6WA 3QK7A 1HR0B 2R6FA 3CE9A 4PIVA 4Z3DA 4BQEA 4ZCRA 3OE7D 1XJ5A 2Z30A 4IRXA 2D7JA 4WCFA 5LB2A 3RWOA 4Y2SA 3WMXA 4B3IA 4HPWA 1IDN1 5COBA 1GCUA 4IKPA 2A5DA 4KXUA 2ZIUB 1XZJA 5E7JA 3F9RA 3K9GA 3W06A 1M1YE 2ZJ1A 2Q5EA 2NQ8A 4RVSA 4BGVA 2A78A 2CT8A 3T9AA 1JFTA 1DXOA 3U7RA 4E2FA 1FCJA 1BOOA 1DOHA 1VCMA 2W48A 2FN3A 1RI3A 2DZDA 3P71T 4YWJA 1HNWB 1EZ4A 1C8KA 1NR5A 3WO0A 1M33A 3R3WA 4JQZA 2Y1OA 4QXOA 2ZSJA 3OBBA 1P80A 2EC5A 1KF0A 5B36A 1T4CA 4B76A 4EJSB 2CYCA 3M1YA 3AI7A 1R15A 5SV2A 4HTAA 4GRAA 1NONA 4CXMA 2JEOA 3OETA 2GJKA 2JJYA 5C80A 3Q2OA 3CW8X 2FR8C 3O3MB 1CLUA 1YDMA 2QR5A 2X0IA 3K0FB 3AP1A 4X97A 3WYCA 1ZGCA 1OFVA 3F67A 4IQ4A 4EA9A 3HVRA 2IOFK 2C9DA 5HOQA 1VMIA 1WNTA 2C2MA 2ETXA 5DX0A 1PZMA 2JKYA 3TQQA 3WDMA 4Q82A 5E7MA 5J4HA 2PUHA 3O2SB 1G19A 4IUBS 5UKDA 3V9AA 1DWQA 1WPQA 1WL8A 3DMGA 3TTSA 4OGLA 4UPVA 3HRKA 3QFHA 4W7HA 4D6YA 3ZU3A 4XYEA 5CB6A 1E6WA 1NU6A 1KS2A 5A2QA 3SI7A 3R9KA 4OHMA 4RLHA 2V54A 1OXKB 1EI9A 1I2DA 2IYEA 2J3HA 4QPJC 2XDQA 2Y4NA 2XNDA 3ZZMA 5C7LO 4GKAA 2HRRA 1IK4A 3CZAA 3D3WA 1JMYA 2ZDQA 3O9ZA 4GYJA 2RB4A 4I1VA 4IO1A 1RKXA 2WFAA 4R7ZA 4B3HA 1H9BA 3W0LB 1RWXA 1RM5A 3T4XA 5SZKB 1UXIA 2HL6A 5FLYA 3RUFA 2ZCJA 3NBXX 3O5AA 2BR5A 4OJKA 3VKGA 1G1MA 2JAPA 1P0CA 4C2BA 2QRMA 1QIFA 4CM8B 4F8JA 5DCUA 1C0IA 1CQWA 3JQ9A 3OD5A 2XKKA 4RWEA 1TQDA 3CWQA 1A8IA 1AZWA 5FOXA 1GAWA 2DUNA 1RQPA 3MRVA 4MVJA 1T5LA 2OZLA 2RGXA 3O1LA 4KE9A 4ERXA 5E2AA 4PAQA 4C03A 1KARA 5G1PA 4OK6A 3TL6A 1N7HA 1K6XA 2P91A 5DYYA 1JNXX 3M81A 3ZWXA 3WFIA 3FUUA 2KS6A 4OO3A 1YR3A 3OF2A 3CLUD 2RJOA 3K16A 3BXEA 3GAMA 2DCUA 3GGDA 4MKHA 5TMPA 5FHQA 1SBNE 1YRHA 4LMPA 1VLQA 2E6KA 4ESOA 1TVCA 3GVXA 5FWDA 4F6RA 1RWKA 1Q57A 2PFSA 3TL3A 3D0OA 1Z6YA 1A8UA 2FA9A 2GK3A 2L17A 4N6NA 1DMRA 1SCNE 3CM0A 4JXKA 4N9QA 1H8HA 2CNWA 3L4BA 1GNTA 2BM9A 2RFLA 1HETA 1F2UA 1YUBA 1U1CA 2O2JA 3K0HA 3OCJA 4M1OA 4G0YA 1QMPA 1W4LA 5J4KA 5JXWA 2YJ3A 3V3KA 1RXEA 1EP9A 4F7WA 2CFOA 3NEAA 1BMDA 3L06A 3CPHA 1COWD 1IOVA 1CUGA 4LAFA 4AM8A 3PPWA 4KE8A 4C4AA 2QQFA 3K1JA 4U6NA 1P0PA 2C5BA 4OHRA 3B6KA 3LBFA 4TTPA 1RQLA 3A1TA 2X3YA 4UUOA 4G25A 4LA4A 1G0NA 3KTAA 1XK6A 4QELA 3WMRA 2H5EA 4HXEB 4KFTA 4B82A 4V0SA 5LJIA 2WMNB 1QR6A 4J29A 3K05A 1CUBA 2CUKA 3TCNA 4RK0A 1RKUA 4UVGA 1U1GA 4AMYA 2ACEA 1JKMA 1G66A 5IEBA 1U3DA 2TYSB 3ANMA 1D7OA 2IP2A 4QGFA 4GIBA 1JTEA 3UHPA 2V6FA 2Z2KA 4L8LA 4MUNA 4UOEA 3IHLA 3HDHA 3UJDA 2F62A 2Z9CA 4NOKA 4A23A 5I9NA 5M29A 3UKJA 5F23A 3GRKA 4O2RA 3MMNA 5HQTA 3RC1A 2OGTA 4A2QA 4LYYA 4HO1X 1TUIA 3LT4A 3AUFA 2JGNA 3BKWA 3AEQB 3ZDQA 5I7EA 3AVUA 1L3CA 1PLLA 3M6FA 3R3YA 2G8NA 4KR2A 2C1ZA 2BIFA 1VPEA 3RSZA 4B32A 1CQZA 1K7YA 1OQAA 2Y0PA 3F96A 3E27A 1KYXA 2X8LA 3SLKA 4D41A 3I9JA 1W4BA 3KZXA 4R2LA 2AJ8A 1OXTA 2HU8A 3IPLA 2EX0A 2BFDB 4LZJA 2IDZA 3HJGA 4US2R 2JAWA 5JBIA 4RWZA 3RSHA 1QQ7A 2Q1SA 2JGMA 2ZTMA 1ND5A 3ZD8A 1NBMA 3OTGA 2A84A 1S0UA 1ZVQA 3FSRA 4R41A 1CY8A 4BPRA 1KBZA 4CT5A 4B6PA 2WG1A 3M89A 1FBNA 1XAHA 1XYYA 1YV9A 4KRYA 2BZGA 2XT0A 3C0KA 2CZGA 1M1ZA 3Q6IA 4R4JA 1CJTC 3T7JA 3VO2A 3VVMA 2HLDA 5E0KB 1RNLA 4ZANA 1K2VN 4Q12A 5J2UF 3PSAA 4Y67A 1MHPA 5H70A 1O0SA 1VMAA 1HH4A 2BGKA 1P7PA 1PWEA 2R87A 2ZBQA 4WH0A 4DV1B 1XLTA 1JWBB 4WGGA 2E5FA 3L9WA 5ALJA 5FT9A 5K3DA 3OU6A 5D87A 2GSWA 5BO5A 3OZAA 3RR2A 2O8BA 2UZ1B 2VTEA 1O97C 2OCPA 1QV7A 1PNTA 3IV6A 5F35A 4BGUA 3RJZA 1LJUA 1JG2A 5FUQA 3RT7A 1BVHA 3K0BA 6PFKA 4DCNA 1XALA 2IUYA 2PWYA 4ZO9A 4A4DA 3MC1A 1M1YA 3OX4A 4FN5A 5JPIA 4OAQA 4RY9A 1WBDA 1LFAA 1M3SA 3GJYA 2G9VA 4DV6B 3S55A 5DHSA 2WI8A 4G4SP 5HXAA 2WF9A 4S0ZA 4MA5A 2OLKA 1WUKS 5U4XA 2L18A 3NT5A 4AD8A 1RZRA 2XT9A 4TTSA 1PTJC 4RL6A 2R79A 1O2DA 3GXOA 1UMDB 4X71A 4X8MA 4XM2A 3P97A 3ZYZA 1KVTA 3OPVA 1T1IA 2ENWA 4OKSA 1FDSA 1NJ6A 2KE5A 2NM0A 3L6DA 3OG9A 5I01A 1FLAA 1Z8DA 2HIMA 1WTCA 4R81A 3OC6A 5HJ7A 1FJGB 3FF1A 4HAIA 1OJLA 1XRRA 3A36A 3RHSA 4BCCA 4MI3A 4RH0A 4TROA 4ASUD 5KOJA 1DCMA 1JF8A 1V1RA 1ZJJA 2V4MA 5IHXA 1JZQA 2RHJA 4EELA 3KALA 1GILA 1PT5A 5IP5A 3T41A 4BKMA 2CV2A 1QS0B 1PL0A 3PHBE 2G5CA 2AV6A 4N5LA 4OXNA 4UNQA 5AK0A 3W2IA 1ZH0A 4RFVA 4YAJA 4AJJA 1XNJA 1Q14A 1DDGA 2QQ0A 4N4AA 3SC2A 5C81A 1M1NB 3FGOA 1A7AA 4QYTA 3M5PA 3ANLA 3BXFA 4JX8A 1OH8A 3IELA 2PKYX 3P2KA 4M1MA 3TIFA 1UZMA 5JMPA 5F4BA 3GH1A 3OZUA 5ADHA 4KE6A 4YRAA 2C58A 3O4RA 4LW8A 4RH3A 3KQKA 3TDMA 5I7AA 4CI0B 5DULA 5JNSA 1IPHA 2AZ4A 1EDOA 9LDBA 1QZ3A 4R1LA 3IE0A 1TJNA 1XAIA 2B4YA 3BZWA 4KJXA 3ZX5A 4TV9F 1ORVA 4LTDA 1JU3A 3GAZA 4QTYA 5KX5A 2BP7B 4OHOA 3TK1A 3AR2A 4QJ5A 3H5AA 5M5BA 5L3RA 1TM1E 4AJ2A 4OQQA 5GZ6A 3UO8B 3ZTWA 2E5WA 1OYYA 1ZG3A 2G7MC 1XNQB 1U1EA 1UJMA 1DBRA 1QXSA 2FSVC 1LNSA 3CNOA 3HKCA 1H5QA 1V7CA 1Q1ZA 3AUAA 2P0EA 4Z9FA 2ADFA 1TVEA 5DLYA 4CMAA 5TNXA 5IBCA 3PJRA 3TOCA 4ZV7A 2HLPA 1WBBA 3FY4A 1YVPA 3JCZA 4EAQA 3TLXA 3ITNA 3PNMA 5LKRA 3IUSA 3ZV3A 4EPXA 3DDNA 4YUXA 1C2TA 1ZX1A 1MW8X 1K8QA 2KI5A 1J1IA 1EGVB 5ALKA 5HBRA 2W6JD 4GPTA 1PK8A 1KQ3A 4G24A 3LZ6A 3M1IA 4GI3A 2BMEA 4I9GA 2OC9A 2XGGA 3HA5A 5E6UA 4DC0A 1ZNYA 2XQJA 5HWSA 4OJNA 4M76B 3RSSA 4HZUA 3AK4A 1LLFA 3WLLA 4G3XA 5IUNC 4EYSA 1T1GA 2MINA 3OIWA 3QH4A 1DWPA 4QNNA 1JFFA 4YP0A 2PGDA 4KAJA 5BW5A 2IEIA 4P86A 3D4NA 4J76A 4YJHA 3NWPA 4ZQCB 1UR5A 1GD1O 1USIA 4Q4LA 3TKAA 3VOTA 3KSAC 2FWAA 3U31A 2QNIA 4HWPA 4I5EA 1RACA 3OHMA 4LFBB 2OL4A 3I23A 2QMEA 5GJWC 3S81A 4I8XA 2ZPUA 2H7CA 1DKRA 3R6LA 3HU1A 3D5QA 2QM8A 3H6GA 4TSFA 4BMVA 1B8NA 3AFOA 1LPBB 4QXRA 2JNWA 1QG2A 3CLSC 4GPD1 3V42A 5IT5A 2DBRA 3O8RA 1IWPB 1D03A 1NW7A 2VAMA 2ZAMA 2ZRKA 3R5TA 4HNAA 4HXYA 3VTAA 3RRXA 1VSUA 2BM8A 4Q05A 4CKCB 2GVDC 2YBDA 3AR4A 3V6LA 1YU6A 4BNTA 3HCCA 3O8CA 4FS8A 3C1UA 4YFYA 3T15A 4OXQA 3ESYA 5DHTA 1JR2A 2P3QA 3UWMA 4C7OA 2FW9A 1CRPA 1XEFA 1NVWQ 2JGRA 2L69A 1YQTA 1PVVA 3EOAI 4EMBA 1HLDA 3OOSA 3WWEA 2DR3A 3FPEA 4Q4DA 3WL4A 1B6TA 2IP1A 1MF7A 1FUUA 1MT0A 1U3CA 3G2MA 5AKJA 2RC5A 5J2TF 3R1IA 1A7JA 2P6PA 1H6CA 3PHGA 1P72A 1HV8A 4V0KA 2I78A 4CL0A 2ID8A 4LPSA 4PCVA 1I4WA 1T5OA 3LFTA 3MNFA 3MOGA 3D4IA 2Q62A 4R1MA 2OHIA 2QZJA 4CDMA 3FDZB 3V4OA 3JWEA 2VUHB 2P3SA 3EEBA 4FEAA 4CLDA 1BDIA 2MDTA 1Q17A 4MKGA 4RQBA 1TTTA 1AGYA 1R5OA 4FCCA 4S1VA 2F6RA 4TVKA 3DGFC 4LRWA 1U2TA 4BE9A 1KAEA 3ANTA 1S2MA 2ZREA 7YASA 1SULA 2EFYA 2ZDGA 2QZ4A 4OJMX 5I9TA 3ZI0A 2XW6A 3S1AB 5L53A 4B4OA 5K0JA 5EEHA 3MBKA 1ZSYA 4CF5A 2JJQA 1KZ1A 2GM5A 3QSGA 2QLFA 1Z2OX 1MQ9A 1PR3A 3IEIA 2P9QA 4J1NA 4WL0A 4LE2A 4M7WA 2GEUA 5KJ6A 1EB8A 2VUTA 2XMDA 5JS2A 2MU1A 3FPHA 3W5HA 1FF9A 3B1KA 2IITA 2W71A 3QUSA 5T4HA 4E94A 4ZOQI 2JFGA 4WEOA 1GKKA 3JSAA 5C5DA 1E1MA 1W2HA 3MA0A 3R6TA 4KOAA 3W3AH 1MPXA 3RYIB 3AR7A 1QRSA 3TSAA 3AZPA 3IAXA 4KOEC 1PR4A 1VOTA 3GFTA 4MITA 4A7PA 3SP1A 1Z2DA 3RVPA 1YZKA 2KPOA 3AQ4A 5KHLB 4I9FA 2G1PA 1RXYA 2PLWA 3EMKA 3BCHA 3I1YA 4MV8A 3C3EA 4DIFA 4INAA 3CG4A 4LZOA 4YALA 5KQMA 2NOAA 2VO1A 3A26A 1T4DA 3MG9A 3L7IA 1GTVA 2XQIA 4QEZA 4WNCA 2GM4A 2D1RA 3NOOA 2C2HA 4GI2A 4L5IA 4RF2A 2NIPA 4I4CA 5FL7A 4HRVA 4WECA 5EMHA 3OZ7A 3PVSA 4F06A 4AZ3B 5LQDA 3BMQB 3EWAA 3GDFA 3SC4A 1Q6ZA 4PZ0A 1ZYUA 1Y89A 1XU9A 2IX9A 1Z6GA 2BONA 3CTMA 3GV0A 4WBXC 3WFJA 1VPTA 2HSDA 1YD7A 3DFZA 1DX4A 4G36A 3ZDDA 3CR3C 5IS2A 3N5KA 2O23A 3K5IA 1Y82A 3BD6A 1MENA 3PYMA 4KUHA 2P35A 4MJLA 2FPKA 5GP1A 1JLMA 2XMBA 4LOKA 5B6PA 4BNDB 3UM9A 1FDVA 4BB9A 2N47A 4F38A 3GBVA 4LE1A 1MRNA 4LYFA 1O4VA 1TXGA 3L7AA 1EH5A 4LNUA 2XQKA 2B7LA 3BBPA 1PDVA 5JCZA 1SUPA 3LIIA 1H85A 1O57A 4GYWA 3FFWA 1S2IA 3GHHA 4JQOA 1JHXA 4O08A 3ZY4A 1E2EA 1SUAA 3VU8A 3K70C 1CUDA 4XUCA 3NV7A 2EFEB 1F51E 1DKUA 1XDUA 2CVFA 2FYTA 3I28A 3Q7SA 4JX9A 1UBOS 2W2VA 3ZQJA 9MHTA 4YP1A 2RB5A 1VHJA 4MLCA 2R1VB 2N46A 4QM6A 3CNHA 3M5DA 1R0BA 4BJ6A 4CEHA 1B3BA 1OZAA 1Y8QB 2BZ1A 2Q8NA 4XVHA 1ZONA 4E2XA 4FVTA 2C2OA 2QT0A 1EWYA 3EXHB 3T1QA 4QVIA 1FS4A 4FHDA 2MSNA 1D7AA 5ITWA 3S2IA 1JDJA 4CKEA 2O3RA 1RZ3A 3NUQA 3NP9A 3D59A 4MWGA 1C30A 1AHNA 4NNPA 2E4WA 1TADA 4YIKA 4ZPJA 1RMYA 5E3HA 1YCGA 2VK2A 1Z62A 2O0LA 1I4TD 4JLJA 3K2IA 1JIXA 2EL7A 4QD3A 3I2HA 3RUAA 3TEMA 4AW9A 1DRJA 1PW5A 3ONNA 5CT5A 2B1QA 2G72A 1GZSA 4FKMA 3WLPA 5IJ0B 1DAGA 2NU8B 4XX1A 2WVHA 3HKDB 1Y4AE 3IQWA 1U02A 5I9LA 3IEKA 1MP0A 1J07A 4LJ7A 4KR6A 3L7CA 1Y42X 4GDMA 1RQRA 3KEQA 1P0FA 4KH0A 2JGJA 3L4SO 1DIBA 1U8ZA 1A97A 3NDRA 4XDGA 2CKMA 1BW9B 4OBXA 3A1FA 3THSA 4EFLA 3K1TA 4YV7A 1E2NA 3IAM6 3N1UA 1O5TA 4AO7A 4NFYA 3PHIA 1QNLA 4PSAA 4FSXA 1NATA 1K27A 3G85A 4IGFA 1J09A 1V47A 4MRVA 1B1CA 4EA7A 1H3EA 1FMFA 4A03A 1PJ4A 3DZBA 2WWFA 2PUAA 4ZEOA 4B0OA 4OLJA 1XRLA 3G5MA 1D6NA 1HQCA 1UZNA 1M2WA 4HPJB 3UGTA 5BT8A 2RH9B 4PXAA 2WIDA 1GVHA 2D3WA 3QYJA 1E3DA 1V95A 2IL1A 1E7RA 2J0UA 3NJ4A 4Q1EA 3RJ9A 5BT9A 3H9CA 4JNCA 3K4HA 1XL1A 1AKTA 5AJYA 5IKXA 1YR9A 5HMMA 4A3SA 4ER5A 1ADFA 2OB2A 2YNMC 4IEIA 3ZBUA 1IIRA 4AZ0B 3IUJA 1NWCA 3LK7A 1W76A 3HZHA 1MIHA 2Q9AA 5ICCA 1KMCA 3LPAA 1EX9A 1WBJB 4GYKA 2Q7OE 4H1UA 5CEJA 1HRDA 1USGA 4U2EA 1E79A 2C61A 3X0DA 3UUGA 2L42A 2ZIAA 4ZRDA 3IAM1 4ZK2A 2G83A 2C5SA 2XGSA 1M8JA 3H2ZA 3N53A 1W85B 1Z26A 4RHEA 3TTWA 5F2KA 1HYGA 4YPOA 3B3QA 5D2CA 3TRHA 2YDYA 2QLMA 3NNSA 1OYWA 1BN6A 1ZXBA 3M82A 4ZVTA 4QIHA 3B7WA 4L5YA 4URUR 1AN9A 3COWA 2O2IA 3PRYA 4HTFB 4HGPA 4M99A 3PGA1 1MUUA 4D9NA 3GGOA 4LHEA 1E2LA 3A6EA 3L46A 3PC7A 2VHTA 4L0MA 4ZZ0A 3W9BA 4W99A 5I7FA 3ZGXA 3ZXXA 1WP4A 4UASA 1WIWA 4L5JA 4UBJA 4H3SA 5MN5A 5MHTA 2ZWIA 4URVR 5EGNA 5COQA 3V8RA 3ZJ4A 4QOGA 1YI8A 3PC3A 3UOWA 3W1EA 1EUZA 3NHWA 3LHKA 3ANSA 1Z0IA 5LFAA 2X9LA 1JKJB 5LXTA 4EKEA 1NUHA 2VZLA 5D1NA 1QFMA 4NOJA 2QP4A 3HO6A 3OM0A 2PRYA 3VI4B 2O2XA 4NZZA 4LDQA 4B3DA 1E1RA 1EPUA 1ZUWA 4XYMA 4CIVA 3VVCA 1UBJS 1GG2A 4KQ6A 2HA3A 3Q10A 1BX0A 3CLVA 2R8ZA 1RM3A 2ZRGA 2FFQA 4RJJA 2B2NA 2Y66A 3ELYA 4TMVA 5BQOA 3ZVRA 2G71A 5BWBA 3OJXA 2F67A 1G3QA 4KNVA 4OJQA 2BHLA 2ZJ4A 3IQIX 5ILOA 2IVZA 1L7MA 2VTKA 2FMKA 1XOIA 1T34A 4Y2QA 4CMCA 2CCJA 5IN4A 4JJZA 4KAXA 1I7NA 4NABA 1EG2A 3C5HA 2ZXUA 1ND6A 3GLHB 2ORIA 1XZPA 1QUFA 3B1JA 3ZEAA 1RVDA 2J9XB 3M2TA 1GLNA 3KHUA 2O48X 3E2PA 4M1WA 3VNAA 3O1IC 4OK5A 2B1IA 3PUXA 5REQB 3WQHA 1Z7YA 3ENQA 2IYNA 3FVWA 3ZWDA 2OCIA 3ZWVA 3ZHBA 4RETA 5DHAA 4L4UA 2X0DA 3FAZA 3FZNA 3O8BA 4M7OA 5AM0A 3WDSA 3GNTA 3S1SA 1XRNA 5T7BA 3U4AA 3AUKA 3W3AD 1N33B 2CKDA 2QXTA 2XSZA 3MJRA 1KHTA 4LWQA 3ROZA 2EWVA 5KKCA 8ABPA 4GLFA 1RP7A 4J1SA 4NVRA 1P9RA 4IS2A 5HW0A 1YHNA 4CCYB 4X66B 4HWOA 1E6KA 5J2UB 4Q3EA 3GXBA 4HDKA 1TL7C 4Q4JA 1ZOPA 5IANA 4TX1A 4ZAFA 2DE0X 4CJXA 3QHQA 1BSVA 4P53A 4KWIA 3PICA 2ZSBA 3I6QA 1E98A 1OGYA 4Z86A 3OM9A 2O3SA 3KWLA 5LZ7A 1UM8A 2J46A 5LOVA 5HM8A 1ZJZA 3EEOA 4U5XA 2JCGA 4WKOA 2XUDA 5DGIA 2ZM5A 3E8SA 4MIYA 3QSYA 4IDEA 2K7FA 1OWPA 1XVLA 1P29A 1DL5A 2OYSA 2X9NA 4E07A 4PC2A 2NZWA 1GGFA 3OOJA 4LKRA 4OY3A 3NI2A 4P33A 2FG6C 2VZ9A 1L5HA 2C2WA 3IDQA 2ACWA 1E3SA 2OE2A 4ZO7A 3ILSA 1SXIA 3TLGA 2B4QA 4JSTA 4RQTA 4D9EA 5E3IA 2AD5A 5F1YA 1C7RA 2PQ0A 1L5LA 4B3TB 2H8KA 2JHFA 3R6WA 4CMKA 4UBNA 1B0UA 2UYQA 3E48A 4K6FA 2YC2C 3VPCA 1O08A 2ZAOA 1QAOA 3QY9A 4BECA 1WHSB 4MO9A 2HO4A 2WKWA 3H7IA 4MV1A 1FRQA 1I2CA 2QAGB 1QR2A 3O7MA 4UXIA 1K8ZB 5C1DA 2DB3A 2WQ7A 2Q7XA 4BGEA 1BX3A 4BB6A 3JRWA 5J43A 1FUYB 4HLUA 4QSMA 3V4LA 5I7RA 1L1FA 1ZAYA 2XD4A 1T13A 3QU2A 2AIRA 3HNPA 2V8OA 3KKLA 5LSAA 1G5FA 1Z56C 3ENNA 2ZI7A 4DJDC 3U61B 1E0KA 2B83A 3GOQA 4WHMA 5SZHB 1EFPA 4AYXA 5JO0A 1XSEA 2P6MA 3DHNA 3A1SA 4RA6A 1GTZA 3A0UA 3IVAA 4Q4CA 2DHCA 5DHPA 1IB6A 1KJ9A 4TLDA 2JIDA 4CMIA 4E2YA 1Z4MA 1FFSA 2JD2A 3GCDA 5EE1A 3JARB 4BKRA 5T8KC 2HHJA 3F71A 3QM1A 4U9IS 2IQIA<