4IG9A

Structure of nad-dependent protein deacetylase sirtuin-1 (open state, 2.64 a)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
269
structure length
268
Chain Sequence
MRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-1
publication title Structural and Functional Analysis of Human SIRT1.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 268
sequence length 269
chains with identical sequence C, E, G
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4ig9A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4ig9A01
2OD9A 4JUFA 1PNQA 1M2KA 2FSVC 4F4UA 1J8FA 4RJKA 2H2HA 3D4BA 4Q9DA 1V5EA 4BVGA 4MPJA 4L3OA 5K6TA 4RJIA 1V5GA 2JI8A 2VBGA 1Z8NA 4RMHA 1SZCA 3K35A 2H2FA 1T9BA 4UUAA 2Q5QA 4BVEA 1OZGA 4X3OA 4QQ8A 4BV2A 2UZ1B 2A1UA 1O97D 5BWNA 4ZZIA 2H2DA 4FZ3A 1PO7A 2JI7A 2QQGA 4BN5A 4K9KA 2OD2A 4UTRA 1HZZC 2PGOA 4BVBA 2H2IA 4K9NA 2Q5LA 5MFPA 4GM4A 2VK4A 2IHUA 2VK8A 3ZGVA 3GLSA 5MGNA 4FEEA 4O8ZA 2EZ4A 2C31A 2Q27A 4J1TC 2QQFA 3OE1A 4Y6OA 2H4JA 4JT8A 4L2IA 4UTXA 2X7JA 4GM1A 4TWIA 5MFZA 1S7GA 4MPRA 4BV3A 4MPPA 1POXA 1PNOA 1MCZA 2IHVA 5EJAA 5FEMA 1Q6ZA 4QELA 4RMGA 2EZUA 4BVFA 1YI1A 2FR8C 4K9MA 4KGDA 3F6BX 3FZNA 2A1TR 4C78A 4JUDX 4UU7A 1OVMA 4JD5A 5EJ9A 4TWJA 1SZDA 4GM0A 2H4FA 2JI9A 4D5EA 3U31A 4HDAA 4GP9A 5EJ5A 2EZTA 2JLAA 5BWOA 4UTNA 4FEGA 4JUAA 1YC5A 3IAFA 2H4HA 4X3PA 4G1CA 2PGNA 4QPZA 1U2DC 1S5PA 1XLTC 3RIGA 2Q5JA 2PANA 4GPEA 3D7KA 3EY9A 4V1CA 1JSCA 1Q14A 5EJ6A 4FVTA 1O96B 4BVHA 5MF6A 3D81A 5DGTA 1QPBA 2FWNA 1YTLA 2JI6A 1Q1AA 5IMSA 4JT9A 1M2JA 1YHYA 4C7BA 3U3DA 3JWPA 2JLCA 3PKJA 2OD7A 2H59A 1POWA 4Y6LA 1YHZA 4UTZA 3GLUA 4K9LA 2V3WA 2VBIA 2IHTA 2HJHA 4JU8A 5BWLA 2JIBA 1PVDA 2Q29A 3ZGOA 1M2GA 3HWX1 4V1CB 5EJ4A 4R8MA 4RJJA 2Q5OA 3GLTA 1NM5C 3CF4G 4IG9A 1YBHA 3CLUD 3EA4A 4BN4A 2WVAA 2NXWA 1T9AA 4MZXA 1EFPA 5EJ8A 1DJLA 4MQ5A 5K3SA 4KXQA 1UPAA 2OO5C 4Y6QA 2FRDC 4BUZA 5K6RA 4RMIA 3RIYA 1U31A 1BFDA 4KPUA 4COKA 2OORC 4JUCA 4J16C 4IAOA 3CLTD 2EZ9A 4JUBA 1M2NA 5K2OA 5EJMA 4K9PA 5D7NA 1OZFA 4IF6A 1ICIA 5DEIA 1U28C 3IAEA 2VJYA 4GG1A 4D5GA 1M2HA 4UUBA 1UPCA 2VBFA 1N0HA 1Y9DA 2DJIA 2W93A 3ZG6A 2H2GA 1PTJC 2AG1A 1UPBA 1PYDA 1YC2A 2B4YA 3EYAA 2EZ8A 1Q17A 1V5FA 1U2GC 3CLRD 1YI0A 2NYRA 4ZP1A 2FN3A 3HWWA 3F6EX 4JSRA 2WVGA 4K9OA 2BRUC 2VK1A 5DGDA 1ZPDA 2WVHA 2AG0A 1T9DA 4JU9A 3CLSD 1MA3A 5FYQA 4F56A 5AHKA 1PT9A 4I5IA 3FLMA 3GLRA 3JR3A 3LQ1A 1PI3A 4V1CI 4UU8A 4RMJA 4UTVA 3PDHA 5EJ7A 4K9QA 3FSJX 1EFVA 1T9CA 1D4OA 1OZHA 3E9YA 3PKIA 1YNOA 1E3TA 2UZ1A 4HD8A 2Q28A
chains in the Genus database with same CATH superfamily
3FUTA 4D42A 3IUSA 4GDMA 2IT1A 4A27A 1SUCA 3GEGA 2C7QA 1AKWA 4JEUA 5JDCA 5LQCA 4WLOA 2JGJA 5EJGA 3OQVA 1OBHA 5A3SA 3OTWA 5BY2A 3KB1A 4RQUA 4E5VA 1DMSA 3ZH9B 3I0MA 3WGYA 4RMNA 3QM1A 2ASVA 4JBGA 4N03A 4NESA 2FHSA 1QHIA 2R5NA 1EXMA 3IB6A 4Q47A 5JSYA 1BHSA 3F96A 2GOYA 1P5JA 3H4IA 1X7XA 4L3OA 4M46A 5HG0A 4E1BA 821PA 2WAOA 3P9CA 1UODA 3QKUA 5G1OA 1VYHA 2V7VA 3D6UA 3G9QA 3MS4A 5D87A 1VE1A 3VJLA 4QL3A 1U65A 4O4IB 3EGVA 2R97A 1HDEA 4JI0B 1F0PA 3PJFA 4GOJA 2Y1DA 1SB9A 4KQKA 2IV7A 4B2IA 2WMNB 1A88A 3VGJA 4ALIA 4MCHA 5FI0B 1XCOA 1U1IA 2PCJA 2QVLA 5ESRA 3MIZA 4BLUA 5MN4A 1AHIA 1X1CA 2ZBRA 3I0ZA 2W43A 3GGGA 4KXMA 3ND5A 5IT0A 3OD5A 4EPVA 1S1MA 3LX5A 1Z6GA 4RL6A 1L9KA 1RJFA 3FTQA 2AE2A 4GBJA 1FCJA 1DAHA 2DCUA 3A9UA 3IALA 3KPYA 2WNHA 4EKYA 2AFHA 4EW2A 3OHMA 2BD0A 3AL2A 3VNSA 4ZMRA 1UBNA 3B9PA 4U2FA 3M83A 4QQ8A 4EHNA 1OWPA 3AVOA 3BRSA 5JCJA 2H1SA 2O6HA 4KDRA 4B79A 5JO0A 5JY6A 1QZTA 1GRRA 2WLSA 2XKKA 4KRGA 1YKGA 2WUEA 1OA0A 2OO7A 2VYVA 2D1YA 3MT9A 2TMGA 4BO0A 5A04A 4L5BA 5D5PA 1AD2A 1K97A 1N5KA 4J7XA 3OIGA 1DV1A 4G8CA 3WZMA 2QLTA 2QD3A 4TVOA 5AVXA 1M8FA 1FDOA 3DE0X 3GNQA 4RSRA 4JX9A 2PVCA 2ZCJA 1GVHA 2FPOA 3H9QA 4N54A 4FIDA 5FA5A 4EKNB 4EEKA 4Q4AB 4WNIA 1PF7E 3A1VA 1HLDA 4KX5A 3WZLA 4CVNA 1W49A 2WJ6A 2JFUA 2Q5LA 2HD4A 4MLPA 1BJKA 3CB2A 3DMNA 5TX7A 2AUMA 1EZZA 2PUVA 5LBIA 3H2ZA 3ICVA 3ZZMA 1YQWA 3ANMA 3Q3EA 4MWGA 4BTEA 4D4GA 4EPRA 2H1LA 2BGUA 1E3EA 1OI2A 1T8SA 1D2MA 1Y6QA 3C6YA 1YIAA 1VCNA 1BHJA 3ZGVA 5HE8A 3UPUA 5G1PA 3QNMA 4EATA 3IBTA 3WGIA 1XZKA 2HHHB 4R7ZA 1Q15A 1IH8A 3L1HA 4EI9A 1PR9A 1OWOA 4J91A 3UHFA 3WG9A 3R40A 4XWOA 4O8ZA 4EHFA 1QJ4A 2D2EA 5D6NA 4URHA 1EJ6A 3NT4A 3TMAA 3WLOA 3ABZA 3BJZA 1NAIA 1DPFA 3BBPA 1RPJA 3VSAA 1NJSA 1YWGO 3ILSA 2O3QA 1E7SA 1FU8A 3KV3O 5CBPB 1DXQA 2ZRMA 4GWGA 3RS9A 3M1LA 3ZJTA 1PW7A 3W6ZA 1F7UA 2Q3CA 3MCUA 4XJXA 3LSTA 3PUKA 4HVAA 1Q0QA 4L2IA 3FLEA 2IY8A 4V2IA 4FYXA 1N7JA 5KPJA 1NUPA 2AFRA 2FCAA 1U2PA 5DP1A 4CF3A 1JSLA 3UENA 5LWHA 4DR1B 3ZLUA 3INRA 3ZQUA 2AJCA 3HU2A 1CSEE 1ZM9A 1M7GA 1RJ9B 1T43A 2VRCD 4EK9A 3LCVB 4D4HA 5IKEA 4PPQA 3BGWA 1NUHA 4D99A 5C31A 5C34B 3UMYA 5AK6A 2EL7A 2IHZA 4WUTA 3UJPA 2FPLA 4Z4IA 2GN1A 5ALUA 3TOSA 1PNVA 3UV6A 5TNXA 2GWHA 3VC2A 4DY4A 3FAKA 1G8PA 2CN1A 4M9XA 5F33A 3AZQA 3WL8A 3ZW8A 1QRSA 4RAQA 2MTBA 2FP3A 2W2KA 3FWPA 3IEIA 3UB4A 4AI6A 1QGZA 1ZXLA 2J0SA 2B5VA 1NTRA 3T99A 4Z0NA 1GITA 2F64A 2Q8QA 4NSNA 3TOXA 3WXMA 1U6KA 2BM9A 1N7GA 1XVUA 3LUKA 4IJKA 4UVEA 4E5SA 3ZDCA 2O8BA 3OU6A 3RJMA 2RKWA 3CUVA 5I3ZA 1RE1A 2CHFA 4AJKA 2E2WA 4YT4A 4LE0A 5F3RA 1IEVA 1YRLA 3O1LA 4FMPA 1D03A 1O96A 3GN2A 4I5DA 4UU0A 1QDLB 1LU9A 1LNQA 2PY6A 2WHPA 3FHOA 1NBWB 1S3FA 1Z5WA 2BGJA 2H4XA 1V11A 2H6EA 3F9RA 2JFNA 1XAJA 4FS8A 8GPBA 3D1VA 1GQRA 4BYMA 3WXBA 1XAIA 2F3SA 1R9MA 2C99A 3DMTC 4RABA 4MYSA 3PVSA 5IBCA 2O1SA 4I46A 2GPNA 5CU7A 2A94A 3A1FA 1ESMA 1T5TA 3GHYA 4BMXA 2HPAA 1LBTA 5BSKA 3QLVA 4HDNA 1GV0A 5BPFA 1ZR2A 1F8YA 4YO8A 5E2IA 5BOVA 3DQQA 3D5QA 4MGIR 4KR7A 3JD0A 4QDJA 4HPJB 4ZK2A 3AMVA 3W78A 4HB4A 8MHTA 5INTA 1G3UA 4BO7A 3KOOA 5LOVB 2M6RA 2R6JA 1O9BA 1THTA 1U0FA 5ILGA 3M5CA 1QUFA 2WJHA 3A0UA 1JH9A 3FSGD 1WVIA 3ZZNA 4DLLA 1Y8AA 1CS0A 2ZS7A 1MP0A 1JHXA 1K2VN 4LAFA 1ZD8A 1BQ4A 1E2FA 1BO6A 1I2CA 1CEEA 2Q0HA 4C7KA 3AU9A 3KOWA 4HRVA 2L18A 4LKOA 3UK6A 5EESA 4YMGA 4YT2A 3DMRA 2P8JA 3DR3A 1QG0A 3T15A 1IBCA 1FNSA 2O0JA 3L7BA 3I5AA 4ESVA 3NONA 2OCPA 3OI7A 4L5YA 5ADWA 3SYTA 1KYYA 4JB2A 1MT0A 1OC4A 5MHTA 4OB8A 2X2OA 1R64A 1W1WA 1DL5A 3FWYA 2FPRA 3GZNB 4K9SA 4S12A 4A8JA 4KIUA 3PICA 3I6YA 1UC8A 1QHYA 2B2XA 4NE9A 1DKRA 3BJRA 4ITVA 4AL4A 5GV8A 1DCKA 1P2DA 5B58T 2ZBGA 4N0DA 1JJVA 4HDOB 1VHDA 1XMQB 1C30A 3R9IA 2ZE7A 4I6GA 1QFXA 1OLUB 3G1UA 2ZRLA 1KORA 4QYIA 4NQRA 3U3ZA 4ZT5A 3AHHA 3RVDA 3D6VA 5A3RA 1A69A 2XITA 5J2TF 2AFIE 3ED5A 4BRUA 4LWPA 5GOTA 2EWWA 1QDUA 1Q0ZA 2DT5A 2GPBA 2BGKA 2IZ7A 4P7KA 3SY8A 4U9UA 5KWIA 1GILA 3TQOA 2XRZA 4D8VA 1I7LA 4MEJA 2ERXA 1UIRA 4AECA 3WLEA 3C4QA 2IH5A 5AT1A 5LP6A 1BROA 1Z0IA 4RH1A 3LBIA 5HGJA 1A2OA 3IUMA 1L1EA 1VKZA 2V5VA 3E3AA 3S55A 1STOA 1I33A 1USWA 4Q7JB 1U8TA 2P4QA 1V2HE 3TW8B 4B17A 1C8LA 5A3QA 4FEYA 5I7RA 3B6KA 4HGOA 1RLMA 5DNAA 1HT3A 2AW5A 4BU0A 4GRDA 2IODA 4B4OA 1POWA 4GMDA 3ZY5A 2BT4A 2NM0A 1JWLA 1H93A 4MKRA 1ZVMA 2IVFA 1T36A 3Q7TA 5DBFA 4RBNA 2IDZA 1XXHE 1WG8A 1BJRE 3CH4B 3QU9A 5AKGA 5IAKA 1MDFA 5BNTA 2IDJA 4FWTA 5BP7A 1FFXA 5F78A 3MILA 2VQSA 1F4LA 2IHTA 2RK4A 4EUNA 4CDMA 2R751 1XQXA 3COWA 4F72A 4YVFA 2C3PA 3KAPA 2PBRA 4W7SA 1P9LA 3PFWO 3MWJA 4X7MA 2B7LA 1F0YA 4XOIA 5BW8A 4YRZA 2IBMA 5FBVB 4BNNA 3EWAA 2Z2YA 4L6IA 5GAJA 1P3JA 4YRPA 2QM8A 4DZRA 3LA6A 4LMRA 2O7NA 5LZ4A 1NBAA 4FHFA 2ZYHA 1PEAA 1ZQ1A 1U8EA 3UT5A 4BNZA 4DCGA 2QTBA 4QGFA 4XFKA 1UK6A 1DG3A 5C8YB 3SVTA 2VTVA 1ZJZA 2NQ2C 1H2AS 1N1GA 3IH5A 3L6OO 1U7TA 2GYVA 3BL6A 3AUFA 3N2IA 1LS6A 4R2JA 4TMTA 3W5HA 4DJ5X 4XZ3A 2IEYA 1IATA 1K4MA 1RQLA 2PMFA 3VO9A 5BMOA 4IDQA 4AC9A 1R8XA 1A5BB 4WNAB 1I01A 1PD0A 3O8QA 4G63A 5GM1A 4ZHQB 2WPDA 4IINA 1E3JA 4BMZA 3QU7A 1UPAA 5H70A 1TVKB 5K0GA 3QPVA 1GPKA 4V0NA 1Y1LA 5G02A 1XE3A 5K6RA 4D9JA 1H8ED 4M1OA 1K6EA 2DU8A 4D7AA 1QE5A 1VE6A 1OLSA 4MS1B 4I1UA 4WFJA 2BBTA 4H35A 2FKNA 4DDVA 1DUVG 2HQOA 3I0NA 1OMOA 4AP6A 5I47A 1AG9A 1G5QA 1V16A 3CLSC 2OM6A 1C4XA 1WQ3A 2ZUVA 3NGLA 5ARBA 2VLBA 3U60B 2LKDA 3HRHA 1BYUA 3O3OB 3OIDA 3CWCA 4KAXA 4BMDA 3OF5A 4JS0A 2PNFA 3ZD6A 3B13B 3VMMA 1QC5A 4BLTA 2VDWB 4BQIA 1MOSA 3HDHA 2C2MA 2PXXA 4G85A 4J16C 4K7JA 3H1BA 5H1YA 4D57A 5KNCD 4N3GA 2H0QA 4EKIA 1SBIA 3D8UA 3ITKA 5JFGA 3FFTA 1WVGA 3LLVA 2QN2A 3DOCA 1DNPA 4M38A 3WGZA 3ROKA 4BE4A 3WNQA 5LDGA 2JFYA 2WUVA 3VV3A 3ZK7A 2C2ZA 4UFNA 3GGSA 2QZ4A 4A82A 1A98A 4KHPB 1MB9A 1YRHA 2D4AA 1KI6A 4ND8B 1UXHA 5CYFA 1ZSYA 4LNHA 5ALPA 5A7HA 4LYFA 1WB6A 3GXOA 521PA 3QFFA 4PG4A 4IDBA 4EY3A 1Z4KA 3UM9A 2NUAA 1A8UA 3HKBA 1A82A 5AKZA 4WQMA 5EWJA 1YSCA 1XTBA 3P8ZA 1TAHA 3CZCA 2Z4SA 1MU0A 2BJVA 3TLAA 3GH3A 3HWRA 4MQEA 1NQOA 3W6NA 1RCTE 5BSRA 3IESA 1C3OB 1OAKA 1UEJA 1NYTA 2P75A 3OWHA 1O95A 4FPXA 3T94A 1KK1A 4CM8B 5C52B 4JXXA 4UTOA 3O3NB 5I9TA 3HXKA 1PJCA 4MHSA 3U17A 4BIIA 5JARA 5FQOA 4ZU3A 2DT8A 2GEVA 4R05A 1XLUA 1YJXA 3VPFA 1M7BA 2V8BA 1JDJA 3WNVA 3RBVA 3W2IA 2H85A 2Q8NA 5B2EA 1MOQA 3O75A 3QG1A 4GDFA 3VPSA 1IONA 2QP9X 5L7TA 1WXXA 2WKRA 2QX8A 4ZRNA 4HBZA 1BXKA 4I7EA 2GVNA 2EAUA 4JBLA 3VSCA 2E5FA 1GCIA 2R5WA 5TMDA 4YPVA 3WYFA 1U2RA 1NJ6A 3C8MA 1WZEA 3F2VA 4HAUA 4V2UA 4C03A 5KNDA 2CZQA 3W9BA 5P8WA 4RTLA 7AT1A 1NQTA 3OTOB 3CVYA 5BPHA 5I7UA 3QKRB 1GGJA 4WW0A 3FLBA 1SXHA 1CUZA 2XSZA 4UDOA 1P4SA 4DCPA 3RTEA 3DNMA 4U3JB 2WSBA 4YMWA 2UDPA 1U2SA 3TTUA 1G7RA 5F52A 4Z4CA 3QNUA 5LU8A 1GZDA 3MTQA 2QQ0A 2P9QA 3HNOA 1H5QA 2CHQA 2GBCA 1T0PA 3LDAA 4IIBA 1KEEB 2I6TA 5L3VA 2VG8A 3KYDB 3WIDA 1YJBA 3L6DA 4X95A 2J5XA 1W87A 3TBKA 4ZYTA 4RTSA 1G2QA 1GTMA 1FUYB 1HDYA 2ECOA 1EUYA 1GSIA 2JS7A 3C85A 3GBPA 4BO6A 1E9CA 1ZD9A 2QRVB 1PUXA 1SXIA 1N25A 3LLMA 4BFTA 4LZJA 3EFHA 4C4AA 5BYKA 2PN1A 4LZNA 3OECA 2PZAA 2JGNA 3DDOA 1QP7A 3QEAZ 1PHRA 3K15A 1JKFA 5DYTA 4EL0A 2FMUA 3R23A 5FNVA 4TRJA 3R7WB 2KBEA 4MPDA 1XEXB 1C7IA 1PZFA 3JALA 5LNK1 4BXOB 2UZ1A 1Q0PA 3N75A 3CPEA 3PSAA 3RFFA 3OBIA 2Q28A 4PZUA 4Y2SA 4PQGA 4RD3A 4JI6B 3SXUA 2X3YA 4ESHA 5B53A 1NQVA 4KO4S 5GWXA 2G5TA 4Y67A 3GR6A 4H1TA 2ZXEA 5TB5A 3ZN2A 1D1QA 1DTSA 1GYQA 2X4LA 3O2QB 5SYNA 3V1LA 1VQ1A 4YUXA 4ROSA 3R77A 1GDHA 4F4UA 1K5DA 3SIXA 1GV1A 2UZ0A 2WJGA 4I50A 2LPMA 2ZJ5A 1XKTA 1HZJA 3GJZA 4CRWB 1J42A 5JAIA 4DDWA 1C4OA 2FEOA 2HSWA 5BN5B 1E9SA 4PYQA 3FI0A 1P80A 4MUYA 4ETNA 3EIQA 4P81A 1V7QA 4Q4HB 5DRYA 3M3DA 3U4MA 4DGSA 1L7RA 3UAXA 2ZIAA 3AVVA 4A7PA 4Q19A 1SQ6A 1E9VA 2Z3ZA 1OFTA 3AIIA 3BK2A 5BSMA 3KT0A 3H2GA 3ZCVA 1X70A 4DR5B 2GERA 3OJEA 3QBEA 1KSGA 5LYJA 3FTCA 3H5VA 4GE3A 4RMHA 1CZNA 4OXYA 1SZCA 3NALA 3K4PA 4UAUA 1Z5ZA 2VKQA 4X6YA 2YWCA 2BF4A 3NCTA 5T4FA 3OCWA 2OAP1 4TSFA 4BLPA 1VLLA 2V0NA 4NLLA 1CYEA 3BK1A 4NS4A 5CLJA 3E58A 3P1JA 3EH2A 3T3DA 1G98A 4UUAA 4TUYF 2PSSA 2WRZA 4O2RA 5FX2A 3EHEA 1I80A 2IEAA 3R7BA 4LRXA 4MARA 4AKEA 4JI2B 4IIFA 1JQ3A 1I94B 4D3XA 4CF5A 4KQEA 4DWOA 4OLBA 2QYHA 4XRRA 2O7RA 2DECA 4AZ3B 1G5HA 3AINA 1E79A 1XCLA 3OX1A 4R83A 3N7UA 3OOJA 2O8CA 2WP8J 1R9GA 4M9RA 1GTZA 2G25A 3EVEA 1XX6A 2AR7A 3RT1A 3UJ3X 1XZEA 4RFSA 5AW5A 2L19A 1VPDA 5ESWA 4PNZA 1Z0FA 2IP4A 2RC6A 4ZAXA 4FZ3A 1VJRA 2LTAA 3EIOA 3JCZA 2PA3A 4G8BA 1CFJA 4OQYA 5DYGA 1TM1E 2FJPA 3T1TA 2PXAA 4UDNA 3FVQA 3T9CA 4URUR 5L9AA 1KYWA 4BL5A 1E5TA 4BVBA 4UPEA 2VYVD 4RS3A 4DJEC 3G5AA 3HN2A 3CRNA 4K9NA 1H22A 3OE7A 1KETA 4BBZA 1N6IA 4ND3A 1MFZA 2Y0DA 4LFCB 2OLEA 3IPCA 4GM4A 1SUEA 2I2CA 1YDGA 4HX5A 4MNTA 4QBHA 1IY8A 5AKEA 4BMYA 4EA8A 4RCYA 4D0RA 3DB2A 3AR8A 4QDXA 5LZ9A 1H5NA 1Q3TA 4MRPA 5G4KA 3V42A 3EWSA 3HP4A 4B43A 4G2TA 4A3SA 1BSVA 5CT8A 3HYTA 3QOFA 1R5NA 1B42A 1HPLA 1C1HA 3I2JA 3B1JA 3WDLA 3PB3A 8ABPA 1JTEA 1E2LA 3CYFA 1YS7A 1JXQA 2GJ9A 2VOEA 5BSUA 1W88A 4AJ9A 4LF5B 1KQOA 3FDZB 4FC6A 1U2QA 1VXRA 4UZSA 3UO8B 3WOHA 4HV4A 1EGQA 1O3YA 5DOVA 5ED0A 4OJTA 3IQHX 3L4BA 2G9ZA 3DOFA 4R81A 1N5DA 1PKEA 3QZUA 4CKYA 4Q1CA 1C3EA 1S7GA 2WF9A 3SLRA 1WXIA 4IJMA 2ERCA 3D7SA 1JLKA 4B3XA 4K87A 3MAJA 2JANA 3K09A 4B6OA 2W6ZA 2GM4A 4ABYA 3C41J 3EEFA 1DCTA 4H18A 2J4DA 4A2CA 2ZYUX 3KLMX 3CX4A 3EOAI 1PFUA 1IBMB 1DKLA 3V1UA 4KTVE 2I3GA 2OL4A 2OR3A 3PFGA 2OWEA 2VRNA 1HM5A 2G4CA 3B36A 3CKYA 3LCUA 1FVOA 1GN9A 2IHVA 1F2TA 3OBBA 3P4YA 4HO1X 4QQNA 4E51A 2IUSA 3OFNA 3HK2A 3G02A 4L72A 3HUTA 4YR9A 5T67A 1ESEA 3ZXYA 4P82A 1Y9EA 1NOIA 1Q83A 5LQAA 1UWVA 4ZI7A 5EHQA 3FYUB 4OQZA 2AYZA 3UOGA 1NLZA 3P2EA 1YR8A 2A9QA 1VKHA 1LDEA 4F96A 2N9UA 3CUTA 4GC9A 3OIYA 2YVQA 2VZLA 1K92A 4AJ4A 1ZESA 2RHRA 2ZKLA 4K9MA 4XEUA 5ALIA 2AN4A 5YASA 1LH0A 1GQFA 4MROA 4OEHA 4D1YA 1ZUIA 5K3CA 1ZRNA 4HN4B 1NYLA 4FFBB 1QHFA 1J7KA 1XZLA 1CEQA 1PLJA 2EG9A 1R66A 3MLBA 4PIMA 4LSWA 4NCIA 3TBHA 1FVFA 2VRBA 5JS6A 3ZKWB 5HIJA 4G0WA 3DFMA 5FUVA 1NVTA 2FSIA 3KD2A 1F2UA 2WICA 3ML1A 3KLPX 3R6WA 4LCBA 4M1KA 3UTDA 2UUAB 1IHPA 4MUIA 1JHRA 5FOUA 1H2ZA 2ZSIA 3G0GA 3SHVA 3D4OA 3T0FA 2AZDA 2PKWA 3OZXA 5I5GA 3AZOA 5BNZA 5FORA 4O1IA 4B8YA 5ICCA 1FXUA 3Q12A 5IARA 4R7TA 1NNEA 2BTEA 4RZIA 4DNXA 1P3Y1 1DKPA 4B3FX 4GL2A 1T5SA 2J07A 3ZJ4A 2XAUA 4CLOB 2DFNA 1DS6A 2DQKA 4YJHB 5CXUA 2BGGA 2QYOA 1F2DA 1Z2CA 3WV5A 4IHJB 3RVKA 4ZPXA 1IZ0A 5K3OA 4NZ9A 2P9FA 2Q9BA 3WR5A 3MGAA 1BX1A 3QXSA 1OKKA 3P45A 4WXMA 2E5WA 3JW8A 3S68A 4DUGA 4RA9A 5JMOA 3KQOA 4NVRA 2WOOA 1KJJA 1XRNA 3H5IA 2ZUDA 4UC0A 3LSYA 3FMIA 1HNNA 4KP7A 4TXJA 4DLRA 3TXXA 3RODA 1C7ZA 3NM5A 2ZZMA 4MRAA 4LYHA 4YMVA 4DSTA 5TT0A 2PDAA 3ECCA 5GOZA 5IJ9B 3RQIA 4OHPA 1P4JA 4WMLA 1XXLA 5C7OO 2XT6A 3PHLA 4P7BA 1Z2DA 4D9GA 1HNWB 4L50A 1N6PA 4PCAA 2GPYA 4QUHA 1I1HA 2GXQA 5JWRA 4XM2A 4CTOA 1BDIA 1A7JA 2IZOA 1SHTX 3HJNA 3N2GB 1AUXA 2QUBA 3CB4A 2XIJA 3KIPA 1E3QA 4IJUA 5J59A 1FYVA 1HF3A 3IA2A 4KYTA 3CVJA 3TKYA 3V4FA 1QRUA 5GZ1A 1SUBA 2IEGA 2R7LA 1ECGA 1TM7E 4LJKA 5ELMA 1TVCA 5TE9A 5JBNA 3DL7A 9GPBA 1ZNYA 3DLAA 4L74A 4LXGA 4BBPA 2WM8A 1JSCA 4UPVA 2A8YA 4TMVA 4ZTUB 3AQIA 4WBNF 3U48A 1T0UA 4IJWA 1D7OA 5DHSA 2A57A 1TUBA 3MAGA 2GH1A 3KEFA 4AMYA 1SUFA 3T3NA 4LGCA 1MTZA 3UVEA 2B4AA 3S8EA 1DADA 5EMNA 3USES 4AFNA 2I3AA 3DH0A 1GZ7A 5CB8A 3RUPA 1JLSA 1DX6A 1QPBA 4FI3C 5EG5A 4CV3A 1A2KC 1G4UR 1QHNA 1H8HA 4H0NA 3ZCQA 3TJMA 3IBCA 4QYMA 1ORDA 5DSZA 5D01A 3TVTA 5JCPA 3VU3A 2ZBDA 3L82B 4XX1A 2JC3A 2NTYC 5LA6A 3NHFA 3X43A 3DW3X 3UJ6A 1A5TA 1UM9B 1PL8A 5LQNA 4ZQCB 5ANRB 3ER8A 2Q4TA 1G0NA 3HJBA 1OE0A 1EAYA 1W85B 2IELA 3PQ8A 2JGAA 2X41A 1B73A 4QUEA 4R41A 5IF9A 2Q1UA 1Z74A 4FR0A 4L6AA 1LPPA 4OHOA 4N6NA 2Z95A 2C5BA 2CFRA 4WGFA 5BRJA 3HZZA 4DLKA 1S9DA 2A86A 4DBZA 3G6WA 1P33A 2WE8A 2JIPA 2JLCA 1VJGA 1JG2A 1Y1SA 4M9SA 2NO1A 3BGSA 1G8MA 2AA3A 1FA9A 7REQA 5K01A 5CB6A 4Q0MA 3QSYA 1BWQA 3H84A 3OQHA 4W1SA 4Y30A 4PC3A 2OBMA 4Q7QA 4H4EA 2WF5A 2VJMA 3GGJA 3NIGB 3AR7A 3TZHA 3H17A 1KYIA 3F4BA 3JVDA 4GIBA 1TMYA 4BNGA 5IG2A 2XKAA 2R6HA 4A6PA 2HJHA 1CJUC 2G72A 5JD5A 3G2PA 3BA1A 3ZGYA 3NX4A 1EAMA 4FB5A 2PLFA 1TYBE 1UMDA 4O4LF 1RI3A 1Z13A 1QG2A 1YUNA 2I0FA 4HGYA 1YR7A 4G37A 1SPXA 5FLKA 2ZR9A 2V3CC 2B20A 1TYCA 5C32A 4DREA 3HP7A 2Q5OA 4F7WA 1XWIA 4E7PA 1U0OC 3GLTA 1YBFA 1K75A 1BE8A 3Q15C 1MIHA 1P2BA 1YHNA 2AI2A 1BDBA 3ENNA 4H17A 3H11A 3E7XA 2WJZB 5GINE 3K5WA 2GBIA 2CMGA 3LBYA 3TDMA 4UM9B 2NXWA 4AMUA 1V5IA 5CB4A 3ASVA 4Q1FA 1YE8A 3TFOA 2ZSFA 2P2DA 2Q6VA 3EVFA 3Q40A 1ZJJA 5L3SB 1NP6A 1TZ2A 3CMCO 2B61A 2D0PB 2UUPA 2OV6A 3F4LA 1FXWF 3GDHA 3EFEA 4IIXA 3ABOB 1EEXB 1ADBA 3CN7A 4G97A 4JB3A 4W7IA 3TNYA 3TOZA 1DFHA 3GFOA 2OBNA 3EYWA 2VHCA 3SYLA 3F71A 2JLQA 1C3JA 4WJKB 2QL7A 1NULA 2CE7A 3ZWKA 5H8WA 2IV2X 4I66A 1TEVA 2XADA 2QM7A 1N2OA 1MJGA 4PPFA 4CKBA 1L7EA 3PK0A 1QO0A 4RZXA 3IQEA 1NA5A 4HY3A 3GP3A 2ZJ4A 4ERXA 3MQ2A 3GLQA 2RGEA 1R8YA 2WFLB 1Z4NA 3DNFA 5IM4F 2EEPA 1XQ1A 2O07A 3NEAA 4OKIA 5JASA 1QH1B 1QLWA 3AF0A 5AKKA 2C84A 1AE1A 4B74A 5CFPA 5CFOA 3AUTA 1ZKDA 3LE8A 4DCMA 3ZDDA 1MV5A 2MWMA 3TLYA 1C0LA 3B60A 4JUCA 2P90A 1ZXBA 1REQB 2IZ0A 4I9HA 2GAAA 3O26A 4H6WA 4L16A 5J4VA 1JDSA 5PGMA 5CA0A 1JV2B 4LRTB 4EELA 3PNQA 1NSFA 5K0EA 4YLGA 3TEFA 3TQTA 3LFTA 3UJNA 4MGHA 3QKSB 3DHWC 4RD1A 5EJMA 1TK9A 5SZJA 2HQRA 1P5RA 3Q7SA 2CC2A 1HDGO 2BFDB 2O0MA 2XBUA 2ZIFA 3GCZA 3HCRA 3PDIB 1W5SA 3I5MA 4QVKA 3NDRA 4DDTA 4IF6A 2C2WA 5LYYA 4Q9JA 3CY6A 5ICFA 5CDTA 3A1WA 1FLNA 2VJYA 1AHPA 3CLUC 3VO2A 3CNBA 1AT1A 3DBRA 3DOHA 4TQAA 3PWZA 1T0IA 4LPSA 2BHRA 3T5GA 2ADMA 3MJVA 1G6OA 3K5HA 2QN6A 4E4TA 2HRCA 2X8WA 2IBSA 1YKFA 4Y0AA 4R5HA 3PEUA 4M6WA 3TLXA 1L5HB 4FUTA 3U0BA 2P2GA 3GQVA 4C04A 1QHSA 4DPKA 2YW2A 1EJBA 4Y8VA 2AMVA 3GJRA 4RPGA 3UB3A 1Z7YA 3KXDA 1EUCB 4EUFA 3WDKA 1CUWA 2AG1A 1XO1A 3O2NA 1YDEA 1MXHA 1YCHA 2A2ZA 2J6HA 4AP9A 2GJ8A 1G5IA 3IAUA 4DRXB 1Z8DA 2O7QA 4DMKA 2Q4RA 3AF1A 4RZ2A 5HE9A 4OGGA 4EABA 3ILHA 2GS9A 1U9ZA 3KALA 4LYYA 4TMYA 5K3AA 4BNHA 1J1IA 3EWNA 3QBDA 4EJSB 2G3YA 3V4OA 4OUDA 5EY5B 4A26A 3DJYA 3R3XA 5THQA 2ZYAA 5HZKA 1AKMA 4JBWA 3ZBPA 3ISJA 2NZXA 1CRLA 4N4AA 3SK0A 5ITSA 1NQXA 2RIPA 1SUWA 2JZNA 3NEPX 4FDVA 3LOQA 5CNIA 4FNAA 2FN3A 1YVRA 3EJ6A 4XWYA 1KE1A 3K5PA 3DZKA 2QOEA 1ECCA 1B14A 4TS3A 3DTTA 3KO8A 2P91A 3O03A 4EZIA 3GLHB 2XUIA 5JMWA 3M70A 3QQPA 2F43A 2BH9A 4DB4A 3RS4A 3QX7A 4QOFA 4G3XA 2VK1A 5JNVA 2ODQA 2BSXA 4XASA 2PE5A 1Y8RB 1XD9A 3F8TA 4MUAA 3P9YA 3P0JA 2XWQA 1GL9B 4H1VA 4W5NA 1DGQA 1IB6A 4F3RA 2R7NA 4DR3B 2CJWB 2X7HA 3H13A 3KQWA 1WXEA 4LF7B 3S70A 3NV9A 3ZNOA 4AMGA 3K2BA 1MA3A 3RUDA 4O08A 1VRCA 2Z3WA 1WX1A 3DWEX 4G8DA 5REQB 2WD7B 3CUSA 2RGAA 4WASA 2OYRA 4F6LA 2O2XA 3J81A 1S8NA 1ZRSA 2HHAA 3F5SA 4B48A 3N6RA 5JRZA 3GLRA 1QH8B 2XSZD 3Q6IA 5KNDD 1LQTA 3KSRA 4G81A 1GGKA 3C7AA 5FAXA 1PI3A 5EMHA 5KCZA 2L69A 4GPAA 2B1JA 1ISPA 2PK3A 5LQDA 3RRJA 1O97C 3ISVA 3CLHA 1U7UA 1PR0A 3ZR4B 4BP3A 2QR5A 4HLUC 3N6XA 5CJPA 3OX3A 4N76A 3OZFA 2HMSA 4PAOA 4ZCMA 4EPYA 2KPOA 1TEXA 3CM0A 2Q7XA 5LB2A 2QZPA 1H4TA 2ZJZA 4M0UA 5JJBA 2J67A 5JAUA 3R0VA 2P6PA 3OQ6A 4LWOA 3RU2A 4OJMX 3HXQA 2HCJB 3H5AA 3GGDA 3TEMA 2OBLA 3B8HA 4J3JA 3VYRB 4C07A 2D1FA 1TPZA 5EHGA 5TV2A 4URZR 3GG2A 1AY0A 1OBOA 3P4UA 3O8DA 3D8BA 3TG2A 3FYUC 5TQ0A 4ZOLB 3AM5A 1QTRA 1M74A 3ZWVA 1LDYA 1L4GA 1XNGA 4QVIA 1EM6A 4DM3A 3PUJA 1RAEA 3H1FA 2RGGA 5TC4A 1RI1A 2H2HA 3RC2A 3VX3A 4EHBA 5HVNA 3FTFA 3F4KA 2H29A 1V5EA 5EIXA 5GY7A 3FHLA 4BAGA 2ORVA 2UYGA 1UEIA 1I24A 3G9ZA 4UVDA 5ALNA 2XUGA 3HCDA 4DLSA 5ALMA 1TA0A 4KRFA 1KKLA 1O08A 3IQDB 2XZOA 1B0AA 1GNRA 2IYOA 3D7RA 1D9XA 4FFRA 4HDSA 1LPBB 1UBLS 4HWOA 4ZCIA 4U7DA 2QXTA 2UKDA 2AFIA 1JJFA 4NV3A 4PGAA 3IB3A 4RK6A 2IKSA 4MVWA 1IEXA 4HB3A 3TQCA 3UJBA 2XWBF 4NBWA 3N87A 5A4KA 4LJ8A 4N0EA 1N7HA 4PO8A 3V3KA 4YAGA 3G1TA 4CL3A 2QLNA 2TYSB 3N58A 4L07A 4YRDA 5CDFE 4RVUA 3LIPA 1Z35A 4Q4JA 4RF4A 4UNNA 3OEED 1SXGA 3PDUA 2G9UA 4S2UA 3WP1B 3ZLBA 4BC0A 3BRWA 5C51B 3SVLA 3DLCA 4G4JA 3MCTA 2P2YA 3C8UA 4KWHA 3BWDD 3L7DA 2ANBA 2EJWA 2BFMA 1X1AA 4GSYA 1C3LA 2QTRA 3JAWA 4IF4A 1X3SA 1EFVB 2CUNA 2MOKA 3QE4A 3Q3IA 4HXFB 2RHTA 4Y2GA 2ADFA 2OUIA 1ZK0A 2YUIA 4I5GA 2DUJA 4UE3S 5GIPE 3A4NA 1A3CA 1SIWA 3EF0A 4Y0VA 4YJFB 1KRXA 3NPMA 4CLXA 2NSYA 4BV2A 2NU8A 1HXHA 1W6RA 1Y1RA 4GMFA 1XXHA 4BO2A 4L8YA 3V97A 1DJOA 1FSSA 2QMQA 4ZEMA 1NX6A 1J8QA 5CT6A 1MQAA 1R6DA 1U90A 4NOMA 4ZO8A 3BXOA 4WESA 3RV4A 1WE2A 1GNQA 1YB7A 2EV9A 3WYBA 4L8WB 1T0HB 1Z0JA 5A4MS 3PYLA 4R68A 2Y68A 1O87A 5C1BA 3AEQA 1YZTA 3CSSA 3N59A 4CYMA 2DPMA 4F8YA 3G2NA 1BXRA 1BGVA 1XQ6A 1KYTA 5BNFA 3S2SA 2WYWA 1VP3A 4OMFG 2E37A 3TD2A 5E3JA 2WSMA 2CMKA 3W6OA 2QE7A 4LZAA 4UHBA 3SP1A 1UZNA 3D3KA 3DD5A 1JEAA 2X0DA 3RS3A 4F86A 2HA4A 2WKQA 5DW3A 3T7AA 2QM3A 3OKFA 5TMPA 1PWZA 4IWNA 3LK7A 3KS9A 2CWWA 5G41A 1E7WA 4IP0A 4HNRA 1UBMS 3WSWA 4QVGA 5T6BA 1SBTA 2ILTA 5ARCA 2EQAA 4KTTE 4BMPB 3UJDA 1E59A 4KBFA 3ZS9A 5L51A 3N8DA 4YAKA 4BKPA 5BUSA 2ZWAA 1T8YA 2YYSA 3RRNA 3OE1A 2ZW9A 4BP8A 1SG9A 4LGMA 4D6PA 3CTMA 4DG8A 4CTKA 4MJ7A 3JWGA 1NVVQ 1XQYA 3AUKA 4GEGA 5E0KB 1US8A 1WV1A 3ZW9A 3IMFA 1XA0A 1U8UA 2RHDA 2AK2A 4OP1A 4F2PA 3HO1A 4AKHA 2LWIA 4OHFA 3X1KA 4J0KA 3K9LA 1NSTA 4BO3A 1IOVA 3RRMA 1EBBA 1N0UA 3B20A 4DT1B 2B83A 2ZQ5A 4DL9A 4X94A 4FOLA 3VU1A 2YIMA 2Q9AA 4LSZA 1UOQA 1X7ZB 2V7QD 1F4VA 2VXBA 4YXWA 3STXA 4CEJB 1DC7A 3SHQA 1W96A 3GAFA 4ALJA 1AM4D 1MIOA 3QMPA 5I8ZA 4F6RB 1PG0A 5H4GA 3WO0A 1XRSB 4N8EA 2IUFA 1ZL0A 3AYXB 3FPHA 3V2HA 1NXTA 1DHTA 1B0ZA 3N2LA 3VO8A 3FOBA 3E5HA 3GFBA 4BN0A 3ELUA 3L3BA 2MSKA 4JH0A 4HXGA 1C7RA 1HZZA 3H8SA 1AGRA 1YR1A 2HW8A 1SG6A 1EQAA 5K0FA 4WI1A 3PP8A 2YCLA 4PY2A 4Y9SA 4J1SA 3TN7A 3C3WA 3IILA 1BG6A 5KMGA 4XKJA 1M73E 3DWIA 4PLGA 1PT8A 4YRAA 4AUNA 2X2EA 2GETA 2ZI7A 4R31A 1A9XB 2OAQ1 3H16A 1UJCA 3D54D 1DVRA 5KS2A 4PX3A 5JBQA 1LS1A 4NMHA 1FL9A 1P5HA 1UP4A 4BX9A 5ALGA 1RAIA 2VYFA 4CN9A 3EW7A 2QT9A 3DE1X 3EQ9A 1NXWA 2E3JA 2ZIZA 4H15A 1TZCA 4JL5A 4WXEA 2I3DA 1T2NA 1HDOA 4JQSA 4GOMD 4KE9A 4L15A 2JBAB 3SKYA 3SMQA 1VJ0A 2HK7A 2R86A 3LVRE 3WB1A 4ZI3A 1YZFA 1ELOA 1HFWA 3ITNA 4GZ3A 4CMBA 2WIGA 1ORIA 5JCOA 4UUMA 1D2RA 2A3RA 4P3YA 4LA4A 5AP9A 5HF8A 4JXKA 4H59A 1XHFA 3V5NA 3WBFA 3RHTA 2JLAA 4CHGA 1Y8ZA 1E2IA 2D62A 1FX0B 3T1OA 4YUZA 1PS8A 2LUOA 3MLAA 3ZLVA 3BL8A 4BUJA 1KU0A 4JBXA 5DXFA 1GAWA 5F7XA 3G2JA 3OOSA 4D9EA 3KUUA 4UMEA 2JZCA 1K3FA 1JQKA 2G1AA 4N0QA 4PXSA 3JQPA 4CQLB 5JQGB 2Q1TA 3JAMA 3RVSA 1YONA 4KIFA 1BS9A 2G5CA 1DWUA 2HT6A 4B3GA 1FDUA 2HEGA 2X9QA 1LVGA 1Z6YA 5EQJB 4MA0A 5EJEA 1VLJA 3O21A 1U2DC 4MS4B 2O0HA 2M6SA 2X4GA 4GXNA 4DUGD 2V9CA 1C0EA 1FDVA 3NZEA 4YAUA 3DLHA 4N41A 4L27A 5KVSA 3I9V6 3S2ZA 3UC9A 121PA 2IF2A 1JT2A 1QGAA 1LRJA 2VUTA 1ORHA 1E3WA 3BCRA 5D3MB 1SC9A 5IKMA 2IUTA 2ZIXA 1C14A 3BJIC 4AZTA 3P5SA 3M89A 2MJLA 5C5IA 2UZ4A 1Q1GA 1UADA 2EGHA 2FW7A 4XWTA 2CT8A 3Q2KA 1XCPA 1EI9A 2FY8A 3GDWA 2INGX 3AFIA 4KQCA 1EK1A 4YRKA 2P1RA 2OENG 3NYIA 3EDQA 3A9RA 3EIFA 1HNXB 3LUHA 3HN6A 3H97A 4OX9Y 4JVSB 3KKKA 2COKA 1BA3A 1OX4B 3V1KA 2G1KA 5AVVA 3JQFA 3NWJA 2PKCA 3U2QA 1GEEA 1K06A 1L5YA 4BEWA 1DEAA 4EJSC 1K6IA 3FTPA 1TEZA 3AHCA 3OQIA 2XXAB 1YZQA 1MW9X 1QANA 2IHKA 4JA0A 4WACA 2JI6A 5DGHA 5JD3A 1CR2A 1JB9A 1I1QB 3W34A 6ABPA 2AK3A 3KSMA 4RIHA 4AY2A 2OZLB 3L8YA 1KMCA 4E2YA 3MMPA 2Y1FA 1VMIA 1XDSA 2VO1A 3PEFA 5J58A 5EAIA 4JCCA 4A0FA 1KC1A 2YJNA 4C7BA 5CA1F 5JNLA 1ZI6A 3LUBA 3ETEA 2EIHA 2D5IA 5E7JA 4KXYA 1E63A 4C4PA 5C46F 4G24A 4J3NA 3R6TA 4BEBA 4N5IX 3AETB 2O3SA 2UYYA 4UTZA 1YZVA 2VYQA 3SS9X 2A0XA 3GLUA 2BE7A 5G3ZA 2QW0X 1PWEA 2FPKA 2VNAA 2AKAB 3IR7A 4IMRA 4J7CA 3S81A 1Q7BA 1UJBA 3SE0A 1EDEA 1JPNA 4M1WA 5GONF 4AY6A 2DWUA 4E46A 1D3AA 2VAXA 1ODIA 1R2QA 3GNLA 4BASA 5TT1A 5KOJB 1HNZB 1Y5NA 1HE8B 5EPOA 1GOTA 5CB0A 3M1YA 1XLTA 4XEHA 3FYDA 3HR4A 1IOLA 1NXSA 1X6VA 1U02A 1WY5A 4Q9NA 4AJEA 4E5YA 3K32A 3VDMA 2AZMA 4QREA 4R8MA 2J3MA 2D5LA 2QVXX 2HAEA 3GEBA 4UXJA 3BCUA 4P98A 2G6TA 5ER6A 1L3IA 1NPTO 1UBFA 2LNDA 3H5TA 3WRXA 2YJTD 1TQDA 2OHOA 3RTAA 3RWMB 3BWBA 2WJAA 4JR0A 2JHAA 5BQ3A 4W8OA 4ACBA 3EA4A 2WA2A 4D6YA 1U2TA 4ISCA 4E2ZA 1F8XA 3OZCA 4UE6A 1V39A 4CDNA 1PEDA 4MZXA 4XWGA 3NO4A 4HRAA 5JE8A 2P1DA 2VATA 3BXGA 3CH5A 4NABA 2O2DA 4ZVUA 5IEBA 2HV9A 1E6WA 1NMXA 1NURA 5H9WA 1FTYA 2XIQA 4C0JA 2F3RA 5D5QA 1DINA 4QODA 2QLLA 4LXHA 4HYEA 1P6XA 2B78A 3PI7A 3AFOA 3DMGA 1AMOA 4Z2AA 1Y34E 2Z30A 3PYMA 4W9MC 4NR0A 2FQXA 2JAPA 4DXHA 3FTDA 3OU2A 4BPBA 5TF4A 4KQ6A 3DC7A 4HAVA 1D2HA 3A3NA 1BH6A 4ZOQI 1G20E 1QWOA 5EI5A 1GL6A 2PX8A 2CLFB 2C2OA 2FVXA 3TZCA 2PQMA 1N2CE 1ECBA 1B26A 1U7WA 2JJ1A 1G20B 3RYIB 4C43A 4WFQA 2E4WA 3KHTA 1BMDA 3VOSA 2BCJQ 1EA7A 1X0VA 2G9RA 2JGKA 3FGPA 1A7UA 4REOA 1BZYA 4PPYA 1RKBA 2JPDA 4B1FA 5H7XA 5T8KA 2EZ9A 5JNRA 4UAVA 1YQXA 1Z5NA 2XI4A 4TRMA 4XB2A 5DK6A 2CWDA 5ICSA 4KR0A 3H1AA 4U0JA 2XXBA 3FKJA 4AUKA 3V46A 2RD2A 1HKUA 3B6JA 2O52A 4FGLA 5AW3A 1M3SA 5IVIA 3WB9A 1OZFA 1ZSVA 4P8RA 5EZYB 1O94A 4N5NA 3ERCA 5DEIA 1N1EA 1CLEA 1PL6A 3QF4B 2XF8A 2WT8A 3RJ5A 5JU6A 1MA0A 3VVCA 4F71A 3CQ9A 4D5GA 2V58A 3ZDZB 5G0TA 3L01A 4JQZA 5SZKB 2OB2A 3TTXA 1WEKA 3TLEA 3HLYA 5EVCA 3A7EA 3MTIA 4G0XA 3FFAA 5TQ2B 3FRJA 3EPHA 3IRUA 4HEHA 5EKSA 2Z2IA 3HJRA 1J1UA 1JR6A 4CIAA 5EQDA 2A67A 2WU1A 1H6BA 4EO9A 1QRTA 1J0BA 1M2VB 1VJ1A 2H2GA 2Q07A 2NUTB 2IH2A 2XA9A 4J9UE 3IMKA 3PCTA 3DP7A 5I9IA 3AESA 3CC8A 2QXYA 3MBOA 3UCFA 4N65A 5DTMA 1NUSA 2ZB2A 4XJVA 4KEAA 1F6BA 1KZ7B 1WNTA 3A04A 3LFUA 5DEOA 4QYXA 3V8NA 1YU6A 4YAIA 5FUMA 1WZNA 1Q17A 1JR3D 4U00A 4OHXA 3LYAA 4F45A 2AHOA 4WCVA 1YF3A 5JJKA 2OHJA 2XTNA 2QRZA 3B6ZA 3EGCA 5FPYA 5B2FA 1U1DA 5J1TB 3JASB 1NXQA 3T5DA 2RARA 3ZZTA 1CNMA 1U1CA 4AF6A 3JQAA 3P4XA 4F2HA 3DTNA 4JI7B 3JYOA 5JXHA 3KKLA 2XA1A 5EC8A 4O1MA 2YNMA 5BW6B 4CM3A 2XT0A 3B53X 5I7AA 4GNKA 2VLIA 1QMPA 2WIBA 1GPWB 3OEHA 2DF8A 3QI2A 2EKBA 4DV5B 4IS3A 1GT6A 1Y3BE 5UKDA 1QOQB 3SJUA 1UP6A 3Q5EA 4ZOBA 5TS2A 3WKAA 3DKRA 4AKIA 1TDJA 5TGTA 3KR9A 1ECJA 4MR9B 4G1UC 4RXMA 3H4TA 1E61A 2YFYA 4PYLA 4H3KB 2HWWA 1ZH2A 2P0AA 1UBKS 2G6BA 3BMXA 2Z57A 4PGHA 4ZREA 3VOAA 4MYDA 2E0IA 3MMZA 1J06A 1Z6PA 5CXXA 3P94A 3CZRA 1Z0UA 3M4YA 2HFKA 1JQBA 1II8B 2QPOA 4EG3A 1JFSA 1GAXA 1EFUA 2H3HA 3LUDA 1QNLA 3R5HA 4H4CA 5TGZA 3O0TA 4ZO4A 3ROPA 1BE6A 2RB4A 3LIIA 2CKDA 1HE1C 4EHLA 4H1WA 4QAJA 3L4SO 4V1CI 3AC0A 3ZNPA 4PN3A 2NZJA 1G8AA 1EHCA 4HX9A 3GPLA 5CJJA 2A4MA 2JCGA 3V4RA 3D31A 3ZWYA 3M4XA 3RVRA 4G5SA 4KX3A 2SKDA 3FGOA 4OAOA 1E3DA 2OHHA 1F0NA 3NDBB 2ZDGA 2HM7A 4N5DA 4B33A 5KU1A 2B6HA 4ZAFA 2FWMX 2F90A 3GRFA 2RMKA 3FCYA 1GAQA 1XQWA 2V9PA 2PZEA 3GJ8A 2PKQP 3GJ4A 4Z7OB 4NH4A 3TTWA 2J3HA 2UUOA 2R8RA 5CLGA 2AZXA 1QFJA 1WMEA 4LTMA 3E7FA 2CLSA 3GEEA 4CIVA 1K7FB 1L7VC 1XVIA 4FHGA 4LZOA 3M6VA 1XZDA 4AURA 1FQJA 4HTFA 3I4LA 1J0AA 2WM2A 2X86A 3N70A 3U39A 1NMYA 3VU0A 4P80A 4XB6B 3Q0TA 4PZ0A 3TUZC 2GLTA 1B00A 3JQBC 1OV6A 3KXLA 4FN4A 4JUFA 5EKTA 4B9EA 1VLHA 4BFUA 5LYJF 3PJRA 1HDIA 5E6RA 5AUQA 1L5NA 1PDWA 1WUKS 3BMQB 3L1IA 3LLCA 4N48A 3N2KB 4W5WA 3MPUA 3F74A 3BIJA 2I4RA 3O5AA 4H6PA 4NBTA 2WWTA 3SNKA 4JYAB 3WLIA 2REQB 4ARVA 1DKMA 4G5YA 3WIUA 1G0OA 1T10A 1ZOSA 4KSYA 2AJBA 5JYEA 2P3OA 4Q3NA 3ZE8A 1JVSA 1Q1BA 1DLJA 3TE7A 2ZAMA 5BUQA 1GL3A 2G8LA 3PQFA 4C4SA 5K6TA 3WQHA 1NMEA 2HMTA 4RJIA 4BX0A 1LDMA 4M0PA 4V0SA 4YY3B 3F67A 3U7FB 3L1UA 5H16A 2RKOA 3M49A 3GARA 5FYDA 1FSZA 4AYXA 3QX9A 2YCBA 3CZQA 2W2OA 4US1R 4C87A 2VBGA 3K8QA 1YRBA 4IDEA 1GZHB 1Y6RA 3E4CA 2OPBA 2D54A 5COQA 2JIZD 4KREA 4FSHA 3GT0A 3DBLB 2FPGB 3FM9A 2GVDC 3L8ZA 5AM4A 3D8NA 2C57A 4K46A 4U6NA 2NG1A 4NP6A 5B12A 4C2TA 4W1QA 3ESBA 2X23A 4AW9A 1FW6A 1X0XA 5EHZA 1PJ2A 3AHJA 3H7AA 4B7UA 1WLSA 1H9BA 3BF7A 3CSDA 3NWBA 1ORVA 1CQIA 1F0KA 2ISCA 3HU3A 3K8YA 5IF3A 4RU1A 2A6PA 4G4GA 3TQIA 3IQIX 5C4MA 2FZVA 4CGZA 5KNDH 4KWTA 2P77A 2X6QA 4KV9A 4DMLA 2PX6A 2WTNA 4LGYA 1O57A 3M2TA 1AUPA 1P9RA 4LV8B 1GPNA 2RAPA 2PQ6A 2B94A 2QTLA 4E12A 3AUYA 3MGCA 1UJ6A 4O2BF 4W8GA 5DYYA 2X2PA 4ZVMA 3M6WA 4ILEA 1WM1A 2DWQA 2Z0MA 4MQLA 2WPNA 3AIKA 3EXHB 5DCWA 3RYCA 4JGGA 4CM5A 4MS3A 2Y1KA 3JR7A 3RANA 1RP1A 4M0EA 2JEYA 2JI7A 2ZWVA 3LW7A 2BOVA 3ZHUA 3RK0A 2Q6KA 5A05A 1JVNA 1BC5A 1IIBA 2X58A 4X5OA 4E3WA 3D5TA 1UJ5A 4PQEA 4RGBA 1ABBA 1ZCAA 1WOYA 2QRQA 4YXFA 3LNTA 5HX7A 2WQ7A 2PV7A 3Q6MA 3GLGB 2I71A 1PNRA 5TPZA 2FN9A 1TMOA 3H2JA 3B5JA 3FIUA 3WRYA 3WTCA 4J2HA 1GXSB 4FQ7A 4WVLA 5HTKA 1KVRA 3JQ9A 2HF9A 4GXTA 3VHXA 4ECAA 2VA8A 2XYQA 3AJ8A 3OPQA 3WIOA 2V7GA 2O23A 4R1NA 4CIYA 4YRFA 1T1GA 1Z15A 2H65A 5K0SA 3T0IA 3DEHA 1TKBA 3BSYA 4EJ6A 5K0LA 1TYEB 2BI8A 3ZDEA 3L07A 3L7NA 1VYTA 2HIMA 4AZ0B 1Z26A 4RZUA 1ZX1A 2M2IA 3I37X 4HNGA 4O29A 3MOSA 1Z2EA 4Y2YA 3W8NA 2BISA 2QQFA 3W6PA 5LMCA 1GZ4A 1NBME 4M0FA 4OXQA 2BZSA 2DR3A 3W6UA 4WZBE 1KBOA 1L5LA 3PI6A 4XGNA 4DR7B 2WM3A 4IQFA 1VCOA 4MVCA 5KYUB 2BIFA 4E21A 5MFZA 2O3RA 1L7QA 1MLDA 4WZBB 2XQVA 1G2IA 2Q5IA 1AUOA 3NVKI 1H4QA 1QIDA 1Z9BA 3M5DA 4HH4A 3N76A 1VTKA 3THXB 4E09A 4HLNA 1QQ7A 3VR0A 3ZQKA 2J6BA 1I5OA 2CFOA 1NIJA 1P7WA 2VSOA 2B3TA 3G3EA 2BTOA 4EMSA 3LAWA 5ALHA 1VPVA 2UXCB 1RZVA 3PYXA 1OLOA 3KR2A 4WE3A 2BFBB 5L45A 4KVAA 1WPQA 3V4PB 3AF6A 2CLEB 2FSFA 4NS1A 1U1EA 1L4HA 5FWYB 1BGXT 1GUZA 1W0KD 4EX6A 1CIVA 1QQ5A 1ECFA 1WULS 1RCUA 2GILA 5EJIA 2QUKA 2O8EA 1FMLA 1KSHA 1XZAA 2VNSA 3O2SB 4G5HA 4V0OA 2A5YB 2E1PA 4UBLA 4Q9KA 2FSSA 5C0OE 3UGKA 1NU6A 1F1BA 4O4HF 1B1AA 3CW2A 3ONEA 4EEXA 3I30X 1U3DA 4YPFA 3L93A 4C7VA 1KH1A 5B6JA 3QVVA 1V47A 1T9GR 1CXZA 3D59A 4GGPA 1K6JA 4H7FA 3WJ7A 5LQUA 1N77A 3U4QB 2ECPA 4KXXA 3WAJA 1SXJE 1NLUA 5AM0A 4X41A 5CHYA 2DCMA 3HDYA 1MR3F 4OFXA 1R8JA 4P4SB 4TL7A 3WHIA 2FMFA 1Y82A 4BE9A 3WK8A 3TLGA 4HH0A 3WGUA 1XQVA 3RNOA 1TEHA 4A92A 2RGXA 3EX7C 4MGKR 4IHAA 2NV0A 5HIMA 1ZINA 2FH5B 1LF5A 1SZDA 2ZTVA 1P0MA 4HFRA 4LOHA 4LCJA 5DBIA 3TTSA 4EP1A 5JZVA 2AUNA 3M6UA 3L6RA 4WFKA 4L5AA 5JOQA 4K28A 1JRLA 3UK0A 3WDSA 421PA 1ZVKA 3AEYA 4B80A 4TWAA 4DN6A 1QP0A 3GFPA 4IH9A 2UU9B 4YWJA 2WHQA 2YXPX 4MP8A 4RETA 4U5XA 4NARA 3IOBA 2C3UA 1LBSA 1P6QA 2GK7A 1QRRA 2IYXA 2QJRA 3PPXA 4W4TA 4Y1GA 3ZGNA 4UD6A 3L7KA 3MJHA 1QLHA 4KO2S 3V8VA 4RVFA 5G2OA 1PVOA 4Y9DA 3THWB 2I4TA 4HNAB 2GA8A 1SBCA 3NHZA 3W9YA 4XIIA 5K8IA 3I6QA 2M98A 3KJQA 1ISSA 4E14A 3FPGA 5C18A 2VAMA 3F46A 2BFAA 5K3SA 1QGUB 1R27A 1LJLA 3OZRA 4N8DA 3D3NA 4R84A 2AFVA 4Y1RA 4E4YA 5DLPA 1RI2A 3FBGA 4RWEA 4Z4HA 4X66B 1Q2XA 3ZIAA 3V2GA 2AOUB 3ZKAA 4ZN6A 2Q1WA 4KAFA 5LXTF 2NUPB 4TL8A 4EPXA 4HEA6 4R6WA 3LGAA 4IFBA 3ZJVA 3RD5A 2ZWOA 4BIMA 3QRWA 3HBAA 4RA6A 4DE5A 2I3BA 4QOIA 4RV5A 1RTKA 2PZ8A 3AEKA 2QLJA 1BH2A 3R8FA 4DLUA 2O2IA 5TARA 2FR8A 3K2EA 2N46A 1ZGJA 4ZVTA 3PZRA 1S4MA 3RFVA 3GYGA 5I5EA 1MRSA 2CMHA 3H6HA 1ZYUA 3MFYA 3WYAA 3CNNA 2ZKIA 2AOTA 3ZUGA 4AN0A 2N0SA 4UXHA 1KO1A 1L4FA 2HH9A 4RC9A 1OFIA 1XDUA 3DFUA 4RHXA 1QG6A 4YCLA 1UT5A 4MMXB 4Z3OA 2D13A 2A0FA 4CMGA 3RCBA 1A72A 1CZHA 1WWKA 4UM7A 3BRCA 1WKCA 5IULC 1WCXA 3B51X 1Y6ZA 4UM8B 4O4IF 3S1AA 1QYDA 3U37A 1WP4A 3T5CA 3QMVA 2A5JA 2OKGA 5JV5A 2XWPA 2YXEA 1JIKA 2R1TB 2VXYA 5A7GA 4R6XA 2R7AA 3QTLA 1E5XA 1NR1A 2WJPA 2OK7A 2YJ4A 4JLJA 5CM9C 5FA6A 4UEOA 3RBZA 1YDWA 1WXHA 2VPXA 2PH5A 3IX7A 1K9VF 3QUTA 3D64A 4UHCA 3OZDA 5BVGA 3H1GA 1WXDA 2ODAA 3HDJA 3ITDA 2JHGA 1XEAA 4V24A 5CX1B 5AK0A 4F5EA 5JAZA 4TXMA 1XD2A 2ERYA 2G0AA 4QTZA 4FFMA 2OD7A 5AHOA 3RS0A 1MB3A 2H4YA 1OLXB 2REBA 2B1RA 4D8TA 1A8SA 3I9OA 4L5IA 2GA9A 4N40A 1W7AA 2TSYB 1MEOA 1LLQA 1JA1A 2B1QA 2NU9B 2F4NA 2P2ZA 2YY6A 2NX2A 4EVIA 1XZ8A 2AQKA 3NHJA 1K98A 4YACA 1L1QA 4ZV9A 3I4CA 1JLHA 2R2AA 2J30A 4PHGA 1UL1X 4OBEA 5ECGC 4DM7A 4DQKA 4PIVA 4EY5A 1HH4A 3UFXB 4UBIA 4WOCA 5CCDA 3VC1A 5FTWA 4QWMA 5B1SA 5HZHA 2PS9A 2ZCUA 1RJGA 3I8XA 4WLUA 3A25A 2I6SA 4P4LA 5E6SB 2QTGA 1JKXA 3GVHA 5CDFA 1JEYA 3GRRA 3D6AA 4MDFA 4H1HA 3GPCA 4HEQA 2NSDA 4TRRA 2ABWA 2FW9A 1YQQA 4HB0A 3WYEA 4XB1A 2YRFA 1AURA 5COAA 4PYKA 4TV8A 3CLUD 3GMIA 2X5NA 2O3UA 1I10A 4I1VA 2PRJA 4HXYA 4WCFA 1JVBA 1XMIA 2XMBA 4OYYA 2J6IA 4BE7B 1EFPA 2CL7X 1FNDA 4MI1A 2H2AA 3NHPA 4RPHA 5K99A 3FYHA 5LUAA 2PWPA 4JLAA 3CEJA 1NSYA 3OIUA 4OI4A 4RSHA 1F9EA 3I9MA 1R0BA 5C7LO 3VAAA 1VG8A 3TG8A 3HH8A 3RROA 3LDHA 4TM7A 3LWBA 1GPAA 1R4MA 1VI6A 3EZNA 3GA0A 2OO5C 4R69A 1GZUA 4ZT7A 5BMVB 2FRDC 3BHJA 3DFKA 2NZ8A 3ULKA 4YRIA 1H4SA 1H5UA 1WXQA 2QTTA 3NBYC 3V8PA 3QJYA 2PL3A 1DJQA 4OL0A 4ESOA 3U7GA 1YD7A 2M6KA 1E0KA 3X44A 4WINA 4ESEA 5BOSA 2VJQA 2VUHB 5IJXA 4W5RA 1OXKB 1Y8CA 2DBYA 1PP4A 2PWZA 3U7HB 3OHPA 3BFPA 3QHPA 1W48A 4DPMA 5EIOA 4BEVA 1N9GA 1UDWA 4UXIA 1ZUHA 5H59A 3UT6A 4BQFA 1JEEA 4EQZA 5J43A 4E3ZA 2YXDA 2JLWA 2B21A 3DVLA 1EFAA 2VF2A 1D0VA 3ABIA 3FCOA 2PLRA 4OH1A 2VIIA 4PYOA 4CR8A 4MIEA 1FYWA 5IABA 1QVRA 2IP2A 3RKUA 3JZIA 1KJZA 2QX9A 3CXUA 5HILA 2CXUA 3TOCA 3E9MA 5J3JA 3EGOA 3Q88A 2KX7A 2Q8PA 2FEAA 2H2WA 1E0JA 7ABPA 4K9PA 4NAHA 4UHEA 1ENPA 1N4DA 1LX7A 1QIMA 2E21A 3EG9A 4LXYA 2JVIA 5KCMA 3TWOA 3ZBTA 4B87A 3C8DA 4JBIA 2WOJA 2NO9A 3IQXA 1F12A 5EIEA 2HDHA 1DE0A 4JK3A 1JFFA 2HXGA 2YXBA 4V39A 1TZBA 2B35A 3OP1A 4F92B 3L06A 5JW6A 2D5AA 1H05A 3VYWA 1JDBB 5CG1A 2VAVA 1P7ZA 1A8QA 1VOTA 1JXMA 1WHTB 2DHCA 3IV6A 3A6DA 1DKUA 4KH1A 4TTSA 2HZBA 4K81B 3JU3A 4Z8YA 1AB5A 2YH2A 3UHPA 3V4VB 3WMRA 2RGBA 9MHTA 1TM3E 4EVQA 4F3NA 3TGLA 1RSZA 3IHTA 4POOA 3TFWA 4XW2A 2F6RA 3L0OA 3HQ4O 3G49A 2XNKA 5ALTA 1Z39A 3NC0C 3TTTA 1H1LA 1PSWA 4BO4A 1AZSC 4KH0A 4YBZA 3EXHC 2E4YA 1LDGA 3AY3A 3KYCB 3LO8A 2D2VA 3GVXA 4KU4A 4R3NA 2CL0X 4TLBA 1NLYA 1RNLA 3AK4A 1D2NA 4V3BA 3SF8B 1BOFA 1U7ZA 2RGDA 3E7DA 3G68A 3KSDO 2NYRA 4NHOA 5DM1A 1XNHA 5DNWA 1B8NA 4IEIA 3I9KA 2Y0EA 1RKQA 2EFJA 1PJAA 3OPMA 2XKJE 2FE1A 2FF5A 2RDMA 4MUKA 2QBYA 5LJIA 1ARZA 2ETVA 3IBGA 2CD7A 2GEUA 2V74B 3CRZA 4GMGA 4CW7A 3G8BA 3SPXA 3RF6A 2XNDA 3SX0A 4X8HA 5CG2A 3SXPA 1FTNA 5E2AA 1NR5A 2PZMA 1ISJA 1PCXA 3GP5A 5DM4A 4PTZA 2AD5A 2AX4A 3CBQA 3HYCA 3LUPA 3WYCA 1CJSA 5LOVF 3A11A 3ZBUA 1J5XA 2NTNA 2WVHA 3ZTTA 2C82A 1H2EA 3HB7A 5F3DA 3V8RA 1U8AA 3C6XA 3GYBA 1XGKA 3R4VA 1QNFA 4MITA 4MRMA 4TMXA 4UQPA 2OHVA 1H3EA 2REOA 4PZEA 1IHOA 2CVFA 2CXTA 1CDOA 2V6FA 4I5IA 1CUEA 1OYOA 1UXGA 2BR3A 2DSNA 2PD6A 2QVZX 4BNYA 2PT5A 1ODJA 1UPUA 2UVPB 3OCYA 4IVPA 4BVKA 1FPMA 1NATA 3BXPA 2F1HA 1E1RD 4G0NA 4MKHA 1VIMA 1JH8A 2JJ2A 3RYFB 1LC3A 2XTAA 4NCKA 4R0NA 3I23A 3Q5DA 4RMJA 1YZGA 1EH5A 2PL9A 2WI8A 3K6SB 4WBSA 3ZHCA 2FUG1 2IYTA 4XYGA 3P96A 4WD3A 3DAHA 5ECYA 1NJFA 2V5AA 1NDUA 1T8PA 3IVXA 1QKKA 3R5TA 1J6UA 1SUSA 1RLIA 1V1MB 4HUQA 1CPYA 4L4UA 2Z6QA 2HADA 1VCIA 5KC8A 4F4FA 2BZGA 3COSA 4EH1A 5HUHA 2QI9F 4Q12A 2A0KA 3VH2A 4NENB 3ENVA 3NHRA 4CN8A 2IY7A 2MR5A 2QT1A 3AX6A 1LCIA 1K8YB 1RYBA 2J08A 3DBVO 4MW2A 2X9VA 3TK1A 2I6FA 4PC1A 2QMYA 2OHFA 1JECA 1LI4A 5K1ZA 4ZZ1A 1Q84A 1VKJA 1X8XA 4IRMA 2WTBA 3HN7A 2ZPAA 5IHPA 4BGUA 1TT5A 1LD3A 1TQ2A 4FLEA 5AICA 5FJIA 4EMTA 1FUUA 4JKYA 4AS3A 5AXCA 4OFZA 3N86A 5K8JB 3RS8A 3BT7A 4Q9DA 1Q12A 1R6BX 5HKOA 1VL5A 4EG7A 2KS6A 4ZYXA 3HJAA 1NI5A 3ET5A 5HKAA 4HJRA 1HO3A 2XQGA 1F3LA 1T4BA 1YR3A 2IW1A 4DRYA 3Q85A 2VP4A 3ZGLA 3PXGA 2Q5FA 3HV2A 4NJMA 1DO2A 3OEYA 3RUFA 4BLQA 3F7NA 3HM2A 4PWYA 5AHXA 3QG5A 3ZDXB 2A7QA 3TECE 4OLFA 1UC4B 1MEEA 3VHQA 2QK4A 3NBFA 5DSTA 2FDRA 4JLKA 1A50B 4RACA 4U0KA 1K3TA 3F1KA 4BLWA 3HKCA 1FMTA 4LOLA 1RC8A 1VDZA 1EXWA 3K0SA 1NVKA 4GMHA 2AJLI 5EE5B 2BF7A 1OX6A 5A4DA 3AB8A 3W7AA 3BTUA 4HNSA 4MR8B 1MB0A 1SOMA 2RSLA 4HR7A 1YZ3A 3R5FA 2QQ5A 1VPTA 2HLNA 1JXAA 1G8SA 1UQTA 4WKNA 4DQLA 5KTNA 5DYWA 2WIKA 1OSNA 2PRSA 4KWCA 2IZ6A 4W8HA 2QN7A 3WLHA 1JKJA 2EP7A 3IJ5A 5C8YF 2RGUA 3EPLA 2O2GA 1WB9A 5CLFA 2IIQA 4WJZA 3FF4A 2ZGVA 2M9MA 2YDXA 5F5LA 1JAYA 4CM4A 2GD0A 2F62A 2GCOA 3KOZA 3GJYA 3NW9A 5CCBA 2QRJA 3P2IA 2H1FA 2TS1A 2Y3IA 5BWNA 2W11A 3H83A 3IT2A 4ZZIA 2DGDA 4J75A 9ABPA 1SXQA 1XTTA 1BXGB 1YJCA 2Z4TA 1GT91 3L7OA 5JH7B 1K68A 1Q50A 5G40A 1DCMA 2ATXA 3VR5D 1I14A 1C9NA 4P58A 3HVKA 4PFSA 1XZQA 1TT7A 3QU5A 4EJMA 1WDKA 1SB8A 2JGDB 1D4ZA 5AHRA 4L9RA 2H2IA 1DO8A 3R75A 2ZSKA 2D3TA 1M5UA 2Q2QA 3K0CA 2BFEB 3HUUA 3PRKE 3S4YA 1Q3KA 4V02A 2F48A 4HQRA 1AQUA 3EXFA 2I4MA 1XR3A 3EVDA 4JKOA 3VZBA 2QROA 4CIDA 1JA9A 1W2GA 5CYGA 5U1PA 3TM5A 3EBOA 5T41A 3O8CA 3GGCA 4LF6B 1XALA 3DPUA 2J3QA 3ZVLA 4HDQB 5E8JA 3VPBA 5BYAA 3T7CA 2BM1A 3E23A 2IS2A 4EG5A 4PINA 4JI1B 5KYVA 2KMLA 1VM6A 2C31A 2H31A 2VJCA 3RSSA 2WHYA 2RC5A 5ISMA 2ODEA 1UWKA 3D8SA 1QPZA 1HLGA 2L42A 4FS3A 4KN8A 1OGJA 2PUGA 3DKVA 2W2MA 2Q41A 1NBOA 4JC4A 4L0QA 5DASA 3G8DA 1C81A 1P7PA 2AIRA 3BIXA 1N8KA 3NG1A 5IASA 4IDNA 5CLLA 1FRZA 2LCFA 2I8LA 3SHTA 4EAAA 4R9UC 1YRQA 4YJ3A 1E1QD 3QEMA 4P33A 1AV6A 3HZRA 4UREA 4KK3A 3ZW7A 4BBAA 3CGWA 3KZVA 5K8UA 3ADDA 2EVWX 2HREA 1JU4A 4C4OA 3OC0A 1N2CA 3VKGA 1I5EA 5DM2A 4PWZA 4ETWA 5D86A 3O91A 1I13A 4PSVA 3FOZA 1SRQA 2IW3A 2R44A 1HR0B 1DAPA 2A1UB 2YJ5A 2CXPA 2NSHA 4DSZA 3G6KA 4OFWA 5KKAA 2O05A 1K7EB 4IOMA 2XDQA 3SC4A 1TUEA 2G4LA 3AYZB 3PXDA 3ODGA 1A9ZA 5FEMA 3T8YA 4GPBA 3OQNA 4JODA 5AUPB 1G6KA 2BMVA 3VISA 3FD8A 1UEXC 5JLAA 4RMGA 4JGIA 5K3BA 5LM3A 2I7VA 4BTVA 4TXNA 3TPFA 2XZDA 3H7IA 4QEDA 1OJ7A 5HNKA 3GP8A 1Z38A 1C9YA 1DQNA 1XU9A 4NFLA 1IVNA 2AXNA 1Q91A 4E5UA 4DLXA 1H2BA 4HMPA 4UDXX 2DPLA 1EINA 2EBFX 4D4MA 2GZ1A 5AKLA 4B4VA 5HIIA 1D1SA 1UOEA 3B5EA 4QG7A 4BX8A 5EUCA 1C8KA 1Z68A 3MNFA 4F4IA 5K6AC 3AGPA 2R1ZA 3GRKA 1WRBA 3M6FA 3NWOA 1A2BA 2OQVA 4DV2B 1K7YA 3DB1A 3ESZA 1EM8A 2EFEB 2EKZA 5JZMA 2CLHB 2OCYC 1L2TA 2V6IA 3EC1A 4WK2B 1GO2A 1ZUNB 2VAWA 1G7CA 2EJUA 3N8NA 4JL6A 4KDFA 2CK3A 4UEJA 2XMPA 3C3XA 5HQJA 2VXOA 3ZY3A 2HA6A 1YFLA 2Q1XA 2ZRIA 3ZOZA 4N1AA 2K4MA 3NGXA 2Q3EA 2WA1A 2YZ2A 1UBSB 4QU8A 3U4GA 3TPCA 4BDSA 4CCYA 2J0UB 4XSHA 3ZCPA 1HLPA 5JAPA 2B4TO 4G0UA 3I9JA 4JBYA 2PUCA 4DY6A 4UAGA 5C81A 4AJJA 4PS1A 5KKNB 5B4VA 3BKWA 2YZNA 5E3IA 3TSWA 1L7AA 1UXJA 4R1TA 4TLAA 1GP2A 4ILKA 3TZLA 1H9CA 3LWZA 3G9XA 3OG9A 5ADVA 5CIWA 2R85A 2GCPA 2P1ZA 4OK6A 1WPGA 2XBLA 3BD6A 3P26A 5AVSA 1YC5A 4D0SA 3J7AC 1R9JA 3IKMB 2XRYA 3GT3A 4KQHA 1NVAA 1HFKA 5JATA 3HKDB 3L6CA 3RSQA 1U80A 3FA2A 4L9WA 2X77A 2PGNA 3IVCA 1E3LA 3VAYA 1OILA 4QNMA 4WLEA 4RVHA 1XDZA 3FNRA 3STUA 1F17A 5BW4A 3EGEA 5KYNA 5EXPA 1QMGA 3RSGA 3MCZA 4Z9YA 1Y81A 1JU9A 2I22A 4QTXA 4DYDA 3QVOA 3S8YA 1B41A 1PK8A 4YJGB 2GLXA 5LMZA 5B3JC 2WDPA 5B7PA 3PUIA 1B0PA 1HE4A 3DBHB 5FBRB 3K92A 3IQFA 4YALA 2EARA 4JIMA 4NNJA 3VM6A 1TYDE 1ZVJA 3N8GA 2OYCA 3JQGA 1NG9A 5AUNB 3AFGA 4OHUA 5KTPA 1OH8A 1HYEA 2J3IA 4E5NA 3ZOKA 1XZIA 4V1CA 2C3YA 2PO5A 1Y6GA 1MPXA 1C7QA 1JDBC 5EIHA 4PCVA 3TZKA 1E7MA 1RYNA 1ITZA 4QPJC 2XB9A 1B8PA 4GKVA 2R25B 3EPPA 5E7MA 5DFAA 5BV0A 5JAOA 1RLTA 5MF6A 5HQ3A 3UMMA 2YV1A 2W90A 1YOBA 3I9FA 2VP0A 4A1FA 3JATB 5HRCA 2E55A 3VDRA 1KYZA 3DFIA 4XVRA 3ROGA 2QD1A 3HCOA 3GCXA 5H9VA 5HK8A 3GBVA 2PAFA 2HU8A 2JLVA 1Q7RA 5AKJA 5E6UA 1BMFD 3KDSE 1TXGA 6CHYA 2XGOA 2QHXA 2L0XA 1JR2A 3O9ZA 5A02A 5BSGA 1YTLA 3THYB 1LTHR 3REQA 2B8TA 4WOBA 1F6DA 1KAHA 2B3DA 1RXSA 3IPAA 4M9UA 4P7GA 4NE2A 3S2YA 1G8HA 3UT0A 5AJXA 1DAOA 2HQ1A 4NAUA 4W9NC 1N92A 3HYNA 5EIWA 4BOYA 3JSXA 1TF7A 1LBIA 1LDBA 1PHPA 2JJ8A 2CD9A 4NQZA 3TAHA 4RJTA 5A0TA 2K7ZA 4EENA 2YY5A 3I5UA 1RU3A 4HH1A 1K0FA 3JQ7A 5ALVA 2R00C 4CKCA 3PTAA 4GI2A 1ZCJA 2YVUA 3IE1A 3CLVA 3LRXA 3HY6A 4HDMA 4TV9B 5SY4A 2NAFA 1XZGA 1L6RA 3OIVA 2ZTMA 2ECFA 4GW3A 4TPKA 4B3IA 4DIUA 4DM4A 1FMJA 3QP9A 1JL3A 4GE0A 2OP0A 1W35A 5FBLB 1XJQA 2NU7A 2DWOA 2ZVJA 4O2AA 3VPGA 1UBHS 3T9EA 2P68A 2GBGA 1JEQB 1KDTA 2AG8A 1E0SA 2KI5A 2R1VB 4GI1A 4HPWA 1U04A 3G8AA 4JA2A 4K9DA 3SX4A 1J8MF 4DJJA 4HFJA 3OZTA 4I6EA 4GKBA 4ZZ0A 2Q1SA 1Z33A 2X0KA 3HWX1 4BECA 3BICA 2A9JA 3V7WA 1TOAA 3AUAA 2E87A 3VR6A 4OQEA 4NBRA 2YIVX 3IQGX 1CFZA 4RKWA 5FUYA 3TCKA 2XB6A 2JCBA 3PPWA 4JEHA 1TGYA 3SXJA 3COZA 1A4XA 4YASA 4LS3A 3P9RA 5DMXA 4F3TA 3X1WA 2NO6A 1YVUA 1RIFA 2XGJA 1ISHA 7ADHA 1AJEA 4D4IA 1FZTA 1BCSB 4TS4A 1YBVA 2VSNA 2BHSA 3INTA 1DJLA 2I2DA 4REMA 3NLLA 5JXGA 2YWXA 1A95A 2PRZA 1DJPA 1Z07A 2C7VA 1R0SA 3QKTA 5LC1A 2C7GA 2PMEA 4A5OA 1YFJA 4DA4A 3GO4A 3AERA 2AV6A 1OXXK 3D6MA 1BCRA 4RMIA 3RIYA 5CFLA 5F23A 1HETA 4U8GA 1QTQA 1G8JA 3QLTA 1NVXQ 3IL2A 2F3PA 1I9GA 1Q0SA 1M8KA 4LSGA 3V6MA 4N7BA 1TJ4A 1N0IA 4EBFA 4J2OA 3VHRA 2FSHA 2ONJA 2YINC 2XQKA 3ZE0B 2WE7A 4F6CA 1FC0A 3WFZA 3UWOA 3W1EA 4GQBA 5LBUA 4DQVA 3KP1A 2DC1A 4MW9A 3ZE7A 1ONBA 1JIJA 2G1UA 1JFRA 3MHTA 4KO1S 2P5UA 3QWIA 5IXSA 2HMWA 4IKEA 3OT1B 2X8JA 4JYBA 3BZWA 1B8OA 4LXUA 3NETA 2FJ0A 1MBZA 1LV7A 3VU8A 4BRSA 2P11A 3C5WP 2RAFA 4GOOD 4YA6A 1DV2A 4G0VA 4GR5A 4RDXA 3C3DA 4H16A 3PQ5A 3QVGB 4ZWNA 2ZJAA 4QDKA 3DL4A 1H85A 2A84A 2CW5A 2GYYA 4WGGA 3KSAC 3NBQA 1TIPA 2Z1MA 1NBMA 1WTCA 3C7CB 3S2IA 1HT2E 2X22A 1PR1A 2OSBA 2X0IA 4FJ1A 4U2GA 2BGRA 2FAXA 3BA6A 3KZOA 3LZDA 2ZUFA 4UUBA 3SR0A 1RYMA 1EUQA 4YV0A 2ZTLA 2A5GA 3H2YA 3PA6A 4ZGBA 5C1DA 3DZFA 3BGOS 2NXCA 1I4OA 2D74A 3R0QA 5CR9A 2AJDA 3FDJA 2VDVE 4P4UA 3DM9B 2J3EA 1Z56C 3IUYA 4ZALA 3Q6NA 1PYDA 4TTQA 3DTVB 1UT6A 2XMGA 1G21B 4YCNA 2I4LA 2V7UA 2HUNA 3GLIB 3S44A 2AI3A 4JQOA 2EZ8A 2I2FA 3STWA 1RXYA 1M1NB 5FI1B 3LL4A 3K4QA 3NDIA 1AZTA 3VTAA 5KINB 1M6NA 1PT5A 3G8YA 4I55A 4RVDA 4O02B 4E11A 1JWAB 3BH6A 3V33A 6ADHA 3DEKA 3CIOA 5A5VA 3I6BA 4K1LA 3D6JA 3AUXA 4YCSA 1TM5E 2BEUB 3K0FA 2PWBA 4Q1DA 5GTDA 4C76A 2O59A 1RYDA 4UBMA 1G19A 4KXLA 1ZK1A 4K9OA 3TH5A 3KSBC 4R2MA 4IIJB 5FBQB 4PG5A 1W36B 4X1KB 4F5ZA 1I9CA 2WUWE 2ZSBA 3P7MA 4IHJF 2AKYA 1SY7A 3K3PA 5AXDA 5TPWB 5CDUA 2RAUA 1SXJA 3NTLA 1EUDB 1TAUA 1Z0DA 2ENWA 1M34E 2YIJA 5C8ZA 5MN6A 2QW1A 5G53C 4JIGA 3FVWA 3CT4A 5ALJA 3SMVA 4C01A 1VL6A 1VE9A 3D3WA 1ULTA 3JPWA 4Q7MB 4YMHA 4YGXB 1R6VA 2KW5A 3BXXA 3RADC 1Z06A 1SOAA 3DONA 4Q7EA 1C9MA 3HRKA 2H52A 3CZ4A 4EUHA 2DULA 3EFOA 1AVTA 3ZBQA 2ZYDA 3IIJA 3U26A 3JPYA 2YV3A 4JWTA 3QE9Y 1KI4A 1F48A 4LX0A 4B7XA 4ZARA 3HB9A 2XOKA 2XZPA 1GA4A 3FYCA 4FGKA 1P0IA 3URKA 3QITA 4CEHA 2PS0A 4BLVA 4JFRA 1C2YA 3SFVA 4C21A 2SCUA 3HMQA 4QJBA 5BV2P 3PEYA 1XJCA 4D98A 5KYXA 5EJ7A 1F2VA 5EMMA 1EP3B 2VDJA 1RXVA 1UMKA 2RJOA 2VH1A 1YNSA 1NZDA 4KDCA 3WADA 1PTJA 1A7AA 1FF9A 3PGLA 1FX1A 4YI3A 2JJ2D 5FUBA 5F2NA 2D7DA 1WPXA 3AWDA 3N2EA 1MGOA 1RE0A 2YVAA 5EXEA 5TR9A 4DUPA 2GHRA 2V7BA 4M8SA 4EO7A 4C6HA 1NJ5A 3SI7A 1O9HA 2CDBA 3L0PA 2AN3A 3LTEA 3HG7A 3NKFA 4QBKA 2NT3A 2LCQA 4GO1A 4Z6KA 2QSUA 3NT2A 3TL3A 2OCDA 1DXHA 1T6NA 2VDOB 4GLLA 4UEQA 1NZJA 4UPDA 3LZ6A 1K9SA 3I6MA 4IDPA 1ZA1A 4FSDA 4RJKA 1OR8A 3LECA 3LQKA 5A9SA 1BEZA 2C54A 2VUIB 4RW0A 4ZQFA 2J8ZA 1BDJA 3K1ZA 3QVLA 3BMNB 1AQ6A 1K8QA 3HACA 3STYA 1WDWB 2I1LA 1KAGA 4EYGA 1NKSA 4AX8A 1PJTA 3PITA 1N2BA 4PXAA 4MRSA 5AI5A 4KFUA 2IYYA 4RH3A 2AYYA 2F17A 1JW9B 4YFYA 5HRAA 1LJUA 1NG1A 4B2LA 4OVKA 5AVQA 5K7SA 2YHIA 1JLLB 1FSGA 3LP6A 2F3QA 4ZCRA 1COWA 2DUUA 2IEBA 1OI3A 4S1NA 2CJXA 5L40A 3EDCA 1O0SA 1T6ZA 2E82A 5JAMA 3DLIA 3DO8A 4KN9S 1OH7A 3GUHA 1C3VA 4G0PA 3HE3A 5AVRA 4PVDA 3WIVA 1R6XA 2PTHA 2EWVA 5KJ1A 2BBWA 1JHDA 1XC7A 2P67A <