4BNDB

Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
253
structure length
253
Chain Sequence
AMKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKYDQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALEKAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLASQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYPVVQMGIETITVRDWKETAAILKAIIAMEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-PHOSPHOGLUCOMUTASE
publication title High-Resolution Structure of an Atypical [Alpha]-Phosphoglucomutase Related to Eukaryotic Phosphomannomutases
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Isomerase
total genus 91
structure length 253
sequence length 253
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4bndB02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4bndB01
3EPRA 3OCVA 5ALXA 3SKYA 5AVZA 3U7HB 2I55A 3WK7A 2W4MA 2B82A 3ESRA 5ALWA 2ZBDA 2BDEA 3A1DA 1SU4A 3KD3A 3GYGA 1WPGA 2FPRA 2R8EA 4IG4A 5AKZA 2B8EA 5ALJA 3UM9A 2HO4A 4RESA 1NRWA 1QQ6A 4J2TA 5AKYA 3W5DA 3MPOA 3A1EA 2P11A 5E0OA 3ZVLA 1L7NA 5ALIA 4GIBA 2I7DA 3L8HA 1YMQA 4XE5A 5AKGA 4Y2TA 3EF1A 5AKEA 5AK5A 3IRUA 4KYTA 2WF6A 3N8GA 1QQ7A 1J8DA 5AK3A 4MUMA 2AMYA 1LTQA 3U7GA 5AW6A 4NAVA 2JGAA 2I34A 4KX5A 5ALHA 4EZEA 5AICA 1T9ZA 3ED5A 5ALKA 5AW8A 2I33A 2B0CA 2B1RA 3AR2A 3W5BA 4FE3A 1ZD4A 1O03A 1ZD3A 2DQSA 1CR6A 3E8MA 2I6XA 1RC8A 2YY6A 4UU1A 1RRCA 1RKQA 2WFAA 3WK4A 2YBDA 5AKKA 4UMEA 1EK1A 2RBKA 4QQFA 1KYTA 3QXGA 4EEKA 4BX0A 2MSNA 2C4NA 3AR8A 4YCNA 2I54A 2O9JA 2QYHA 1U7OA 1F5SA 4Y2RA 3DAOA 3L8GA 3QUQA 1Y8AA 3OCZA 3EF0A 4KX3A 3QU2A 4OFZA 4EX7A 2ZXEA 5IT0A 1L8LA 2B8JA 3ZVNA 1EK2A 2G80A 4YCMA 4F71A 3WK9A 5ALLA 4UASA 2ZOSA 4FFDA 2WF8A 4DWOA 3KBBA 3AR9A 3SLRA 4EX6A 1VJRA 4Y2JA 1LVHA 5ALUA 1YS9A 3ET5A 3QUTA 3I76A 1U02A 5ALOA 2FPUA 2YJ6A 3I6BA 4Y2UA 5AKIA 2AH5A 1VJ5A 2B1QA 3P96A 3CZ4A 2FDRA 1TE2A 4UM5A 2JAUA 2WF7A 5AI0A 3FPBA 1AQ6A 3A3YA 2X4DA 2YJ3A 1RDFA 1Z4PX 2IOHA 5A3SA 1U2TA 1Z5UA 1ZD2P 3DDHA 4Y2PA 3N1UA 3HYCA 2RB5A 3E81A 1XPJA 3M1YA 1WVIA 3CNHA 1Z4KA 2NYVA 4DFDA 2C8KA 4J03A 1ZS9A 4C4RA 1WR8A 2R8XA 1X42A 2HF2A 5AW3A 2YMMA 1RLMA 3EWIA 2ZBGA 2GHQA 4XPZA 1Z4QA 4BX3A 4Y2QA 2C9MA 1VFPA 3DNPA 2PR7A 4OCZA 5ALSA 5ALDA 5ALQA 3NALA 3FPSA 1MH9A 1S8OA 1FEZA 1XP5A 2WM8A 3L1UA 4KN8A 5AI4A 5ALFA 2AUTA 3UMCA 2OBBA 5AM4A 5AM3A 2D2VA 3WKBA 5AVSA 4Y2XA 4Y2YA 3QU9A 3BWVA 1YV9A 3L0BA 5ALNA 3FM9A 1U2SA 1CQZA 3NASA 3ZUPA 3ZW7A 4BX2A 5AM1A 1RKVA 4BYGA 2EAUA 5AK6A 2FI1A 2JAOA 1RLTA 1L7PA 4ZEVA 3ESQA 5ALMA 2JAWA 3SD7A 4KNVA 3J7TA 5AIAA 3WGVA 3K1ZA 3ONNA 4HGNA 4UATA 3W5CA 1Z4OA 5AESA 2YMPA 2P9JA 5AKLA 3L0YA 1XVIA 3MMZA 4G9BA 2R8YA 5ALZA 1T5SA 5ALYA 3TLMA 4BEWA 2G06A 4L6AA 2YN4A 1YNSA 1Z4IA 1N9KA 4C4SA 3OTQA 4IFTA 5ALPA 3SF0A 1ZD5A 2CN1A 2FPWA 2GO7A 4EENA 3A1CA 3HLTA 3KZXA 5AKXA 3PDWA 4HGOA 3UMBA 1Z4JA 3KOOA 2HDOA 5AM0A 3ZTWA 1RQNA 3U26A 2ZBEA 4CF3A 1O08A 5AI9A 3N07A 4RETA 2GHTA 2PKEA 3WK6A 4Y3UA 4C4TA 2P27A 1NF2A 5AK4A 5AW9A 1Z4LA 1QYIA 2HEGA 3QU4A 2C88A 3L1VA 1YJ5A 4NV0A 2YMLA 4UW9A 1K1EA 5AHXA 3WK8A 3W5AA 4UMFA 4AS3A 1TJ3A 1RLOA 3U7EB 2YFYA 3QUBA 1WZCA 4HGPA 3WKAA 1SWVA 5AM5A 4JB3A 4AS2A 3MN1A 1NNLA 1J97A 4F72A 5FP0A 1YDFA 5ALTA 3E84A 4HYTA 1U7PA 3RFUA 4HGQA 4Y2VA 4ZEWA 5AW4A 4NABA 2YJ4A 2IA5A 2P69A 4Y2SA 4AP9A 3ZWDA 1Q91A 3WK5A 1TJ5A 5AW5A 2CFTA 3NIWA 1RPZA 1PW5A 3AR7A 2EATA 4GXTA 3VAYA 5AM2A 1Z5GA 5AI5A 4YIKA 2YJ5A 1L7MA 2JARA 2WHEA 1ZRNA 3ET4A 3KDPA 1RKUA 2CFSA 4O8CA 1Q92A 2EARA 3L7YA 2ODAA 5AW0A 3L8EA 4I9GA 1L6RA 3NRJA 1L7OA 4L57A 3SMVA 2IYEA 3QGMA 3L0CA 3NANA 3OCUA 3QUCA 4HAIA 3U7FB 3KC2A 3OCYA 3R9KA 4YCLA 2FUCA 1Z4NA 5AVTA 1ZOLA 2HF7A 2OA0A 4DW8A 3L5KA 3RF6A 5A3RA 3I1YA 3SHQA 3U13A 5JJBA 4H1WA 3UMGA 3ZVMA 3WKCA 2IOFK 2BY4A 2G0AA 4FYPA 5ALVA 3AR5A 2G1AA 3NUQA 3AR4A 1QH9A 1IWOA 2WF5A 3AR6A 3PCTA 1TJ4A 5A3QA 2OM6A 3SKXA 2GMWA 2Q5EA 3NAMA 4CE6A 1T5TA 2FEAA 2NO5A 3QNMA 4BEVA 1SWWA 1Z88A 2G08A 3M9LA 3FZQA 5IT4A 3N28A 4UARA 2GFHA 2G09A 4E88A 2FPXA 5AKJA 3B9RA 2W43A 3FVVA 4UMDA 4BBJA 2FUEA 3B8EA 3QX7A 1RQLA 2O2XA 4BKMA 4NFLA 3WKDA 5ALEA 5IS2A 3PGLA 3ZTYA 3OCWA 2ZBFA 4HGRA 3N5KA 4UAVA 3ZWKA 3ZI4A 5AIBA 3U19A 4MWOA 4QJBA 4UAUA 1TA0A 3OCXA 4CF5A 5ALRA 2R8ZA 3IJ5A 2RARA 2B30A 3S6JA 5AKHA 2HSZA 5AW2A 4CF4A 5AI8A 1N8NA 3F9RA 2YMQA 3DV9A 2ZG6A 3IB6A 4JDPA 2MU1A 5AVXA 3WKEA 4B6JA 3ZX4A 3D6JA 4PNHA 5AVWA 2BDUA 3OPXA 2FPSA 1RMTA 3R09A 2HI0A 4UM7A 3QU7A 5AVQA 2AGVA 1ZRMA 5AW1A 3QYPA 4DCCA 2G07A 3BA6A 3L8FA 4BNDB 5T41A 1RMQA 3E58A 3QLEA 5ALGA 3R4CA 4UU0A 2VKQA 2HOQA 2HHLA 3AR3A 4XOUA 2Q4TA 2OYCA 2NO4A 3PGVA 3MC1A 4XQ0A 2IOFA 4YIHA 4CNQA 1JUDA 5AVYA 1S2OA 1ZJJA 2PQ0A 4I9FA 3ZU6A 3QU5A 4UMVA 5AI6A 4EELA 2Q4RA 2QLTA 1L8OA 2C8LA 2W11A 5AW7A 5AVVA 2HX1A 3I28A 2WF9A 1RMYA 4ZEXA 3B9BA 5AVUA 1QQ5A 4L6CA 2CFRA 3WGUA 4BNDA 4YGYA 4OD0A 4NWIA 4G63A 4OHFA 5AVRA 3ZX5A 3FGOA 1Z4MA 2HCFA 2RAVA 4KNWA 4YH1A
chains in the Genus database with same CATH superfamily
2IS1A 4UHCA 2PX8A 1HDXA 2W4MA 3ESRA 4EKDA 2P7IA 2WKSA 3K1JA 1N6NA 4BBPA 3KD3A 5K8JB 2LCIA 2PMFA 4Q66C 4D8VA 1VLLA 6AT1A 4FIZA 8MHTA 4RV9A 1Z7EA 1PFGA 3GLGE 4FX5A 2CK3A 1GUZA 1BS1A 4FJ2A 4EGJA 1IHYA 5BSMA 3ZQ6A 3GFQA 1KGDA 2LD4A 4GPIB 1X1AA 4B9EA 1TKAA 1GP2A 1KU6A 2F8LA 3A9RA 1MBZA 1PFUA 3OSZA 3R0XA 4U6NA 2ODEA 2ZEJA 4KMSA 3DO6A 1U80A 1ZOOA 4P2GA 1KH1A 5H5JA 4YJ3F 4ZO7A 3RSFA 4AYTA 2G36A 1XNJA 4ZC1A 2X22A 1R0BA 3ABZA 1WW8A 2IV7A 1EYZA 1XRMA 1VI5A 2ZYAA 1Y89A 4Z54A 2B8TA 3U44A 2WU8A 1U1CA 1QIGA 3OD1A 4B3FX 4HI0E 5COQA 1UBOS 4LVOA 3W5SA 1IE3A 1T9HA 5FEUA 1W87A 4PGFA 4DA4A 3AQIA 4OMFG 2V4ZA 5CH3A 5JASA 4WNAB 3BXPA 2VDOB 2QN3A 1GTSA 1L7BA 3ED5A 3OT1B 1B43A 1CZUA 3IE1A 1CFJA 3BAZA 5KAPA 2CXSA 1YDHA 1JDJA 3DXYA 1RAFA 4HKTA 4Z9FA 3ZZNA 1WQ3A 5BSVA 1R6TA 1Z36A 1NI4B 1P39A 1SB8A 2JI8A 3Q41A 4FE3A 4ZRNA 1MJ5A 4MOWA 2Y0CA 2LKCA 2WPDA 3ISVA 4LFCB 1V39A 1CS0A 1H9BA 1XLTA 5IAEA 3OURA 1JXQA 2NT4A 4HYYA 4WY5A 4UU1A 4M2LA 2PIAA 5EIOA 2XB8A 4PZYA 2IBSA 2WD7B 4BIMA 3KKMA 5FPHA 4NH0A 3RVMA 3QH4A 5TEWA 4J6EA 2J5XA 4MQ4A 5LPNA 2MSNA 5FAKA 4B4WA 4MWGA 3AR8A 4QBKA 3QVJA 4YJGA 1RPNA 3H19A 1REQB 4XSVA 1DL5A 1NVKA 1QKJA 4LC9A 4KLAA 4P08A 5CHYA 5DI9A 5DEIA 2H06A 4AN1A 4U3JB 3OMLA 3V33A 1YSCA 4MKXA 5JATA 1BCSB 4IJ6A 2HPAA 1AQYA 4JT8A 3PJDA 2IS4A 1IJBA 1E2DA 5ICFA 4ZHQA 3PC8A 1CB7A 2RBEA 2LNDA 3K0HA 1F0KA 4P5EA 4LZAA 3WIEA 4OK6A 2K2QB 1UBHS 3CRW1 4BN4A 1NUHA 3VZBA 4AL4A 5ARCA 6LDHA 2VDNB 2PZBA 2AEEA 4KHPB 1VL2A 3IRVA 2HR1A 4D0RA 1CZLA 1ISPA 3C4QA 1IHXA 5HFAA 3SDZA 2FK8A 2A2ZA 3K0KA 3KNZA 3OZDA 4W4TA 2EP7A 4A1OA 4DLPA 5KX5A 1X92A 2VTVA 1WY7A 2A5GA 2GK7A 3NONA 4H4CA 1FFEA 2XZOA 4MWTA 2QM0A 1CE8B 3HNRA 3S44A 3SQNA 1MB2A 1WMEA 2DF8A 4IGFA 1VJRA 2VP0A 4GQBA 1E3SA 3JAWB 5PGMA 3HMKA 1YS9A 5IJ0A 1YVUA 1VTKA 3A1SA 2AOWA 2SKEA 5A7GA 1LVGA 1GKKA 1SGWA 4IFEA 3VM6A 4C3UA 2YJ6A 1SURA 3KQTA 3CZRA 3QYFA 4JLVA 4EHFA 1ULUA 5L3QB 1T3HA 4CEHA 1KL7A 1VB5A 1M54A 4JMPA 4DPMA 4P8RA 5AKIA 4OLBA 3MMSA 4NYMQ 1D5CA 2NSHA 4HGYA 3ZDAA 1H1LB 1KYIA 1SNYA 3MRSA 5CM2Z 1KRXA 2YZNA 3RYCB 8ABPA 1Z47A 1BFKA 1MQ9A 1Z2CA 2A9QA 2GTHA 3H87A 3K0BA 4WFQA 5FNVB 1JZTA 5TPZD 4ENQA 5LVAA 2B36A 3EVZA 4Z7NB 3A4IA 3OP4A 1H6CA 1Z25A 2QX8A 4PG7A 1EK6A 1KARA 2QL9A 2W8BA 4CM9A 4D4LA 3TXXA 1BHSA 1YS1X 3IR7A 2AFHA 4DJDC 3T5DA 2RB5A 1K08A 3NRCA 4QA9A 3Q7EA 2WNIA 4MEAA 4CQMD 3C97A 4WV3A 4IWYA 2NYVA 1HV8A 1EZ1A 4I1OA 3C70A 4M3NA 4KQEA 5C80A 1JEAA 2ZRKA 1BZYA 4PPGA 5HS6A 2J33A 2FQQA 2FU5C 2ZVPX 3I6IA 3KXPA 3URKA 4EG6A 3G1UA 3IH5A 3JQBA 3TTWA 4EUKA 1RXCA 1FW6A 4K6OA 1YTUA 2WA2A 4FGSA 5JC1A 1Y4SA 2MTBA 3ZDQA 5JDIC 2YWHA 3EWIA 4JLPA 1HURA 1SCNE 1SZPA 4I1SA 2XEDA 1K5PA 3JQ8A 4Y2QA 3GLVA 3HGQA 1VFPA 3ZEIA 5ALDA 1T3SA 4G4SO 3AP1A 2NUPB 3L8MA 4G0WA 1WDLA 5TT0A 2I62A 3VR3A 4BZZA 2W90A 3RI3A 3UMRA 5KTSA 2BT4A 4QGFA 3WB9A 2CBXA 1Y8CA 2OP0A 5HIJA 1XPRA 2J4FA 4PZEA 4MPDA 3EQZA 1Y48E 1T4GA 2D0OB 2IOQA 5IM4A 4XASA 1PT6A 1QRAA 4E0BA 4ZYLA 4G2NA 1M6VA 5DTQA 4EJSA 1ZI8A 1UMCB 5D85A 3ND5A 4N7BA 2IPLA 4FNGA 1F1JA 4CF6A 4B43A 1MOPA 2RGAA 3T15A 4JVLA 5JECA 1CUGA 3S2UA 2CZQA 2PTHA 5J4LA 1U90A 2QN2A 3L46A 2NVUA 8ATCA 2Q0XA 3S1AA 2R85A 3TW0A 4DYVA 2OTCA 4IHKA 4NBLA 1XCBA 3GT4A 5ABPA 3GLFE 3WSVA 2PNFA 2BEVB 2Q7OE 1WP4A 5DFAA 1O8BA 4AKIA 1QK3A 4LHXA 1L5SA 2RHJA 5BPHA 2HIMA 5LMNB 4ER5A 3IIKA 2X8AA 5ALZA 1CUAA 5ALYA 3EOBI 3EZ2A 1OWMA 3U3OA 2RCYA 4R0NA 3R8XA 3VSCA 3D5QA 3H4VA 4Q4JA 2ZJ7A 1KDOA 2QRMA 4ZAZA 5KYXA 2YWGA 3T1YB 5DIZA 4JI2B 2YWEA 2ZJ0A 1E9AA 2OCKA 4XLTA 5A4IS 2HSGA 1ZSVA 4IDFA 2JI4A 4O6VA 4WT7A 3ZWOA 4EL0A 1RTTA 4X71A 4Z49A 1XMOB 2JBWA 4NV3A 2XGOA 1FPMA 2D0DA 2ZAIA 2PMDA 3RO7A 1R0YA 2ONYA 4TTSA 2M6RA 2HDOA 3CZQA 3AC0A 4JIGA 4KXYA 4Z5XA 3PICA 4XQCA 4ITUA 3M6MD 4ZYXA 3U26A 4CF3A 1F8YA 3DHEA 1U3TA 2VHWA 4MRNA 2GHTA 1MJGA 1IHPA 3ELDA 3R9XB 2PKEA 2VPQA 5DGHA 3GIWA 2EBWA 3R3XA 3OPYI 5DX8A 5EWJA 3TX6A 1XFDA 1ACJA 3D3WA 3OJWA 4GSYA 4O29A 2PKXA 3PRKE 3EVBA 4PSCA 4Q1FA 5K51A 5EYPB 2QNBA 2GASA 1L7VC 2WSYB 3WP1B 5HKBA 4WK2B 3L1VA 3MUOA 3L6OO 4HFRA 4CM4B 3OX1A 4TKUA 5JLAA 1FFSA 2QXUA 1CUHA 1GGMA 1I1OA 1V8PA 1WULS 2R751 3BORA 3KYCB 2UXDB 1PJ8A 3JVDA 3QY0A 1VKNA 4JC4A 3ASZA 4GWLA 2ZS7A 1KZ4A 3FAKA 4GI1A 2GBCA 4NULA 3TBHA 1LQTA 3U7EB 2FPLA 2O3TA 2QN1A 3MT8A 1DGQA 1J2RA 1SUEA 1DWPA 5AM5A 5KHLB 1DE0A 5EZ6B 1IB6A 4C21A 1G2IA 3GUZA 4EUEA 1E3LA 2C84A 1PWXA 2JH8A 3GLHA 3HYNA 3PHJA 3FUCA 4ISCA 3TLZA 3WYFA 3CJQA 4D4GA 2OK8A 3K8ZA 3JZDA 2QUIA 5CLIA 3IVGA 1AUPA 3GH3A 5FUYA 4FD3A 3QVMA 4R1LA 2P78A 3MXOA 4ZDKA 2C54A 5LA6B 5T3UA 1QRTA 2D74A 1K97A 5H81A 3EGOA 5K4AA 5KBYA 4TKLA 4QTTB 1V95A 1Y81A 3DZCA 1LBEA 2C2BA 3ANNA 2WSIA 3OIFA 4RHEA 4YS6A 2X0DA 4YAGA 1B76A 2XTMA 1Q0UA 1X0VA 4NJEA 2BGJA 3I5MA 5E38A 4GDFA 1EFRA 4NZYA 1X1CA 2JH3A 3C6KA 4J75A 2N46A 2XY4A 4JYPA 3ZDXB 2B0JA 4DMFA 2HBYA 4EO4A 1G8PA 2IYSA 4Q15A 3KDPA 2DT5A 4IFIA 3OZXA 2B4KA 3GLQA 2OXIA 1G59A 5DU2A 2H1LA 4JUIA 1SXJE 4UU7A 4RKYA 1Q1ZA 4YQYA 1DFGA 1WMBA 4ZIRB 5BSRA 3K6SA 2V9ZA 4RSMA 5BWLA 1QDUA 5DNAA 3I5YA 1X77A 4BE7B 5CH5A 3STYA 1AMNA 5ADWA 5EKTA 4II2A 3KR2A 3SEQA 1XMSA 1D0VA 2Z9BA 5EIBD 5BWMA 1RLUA 2DBQA 1G4HA 3HI4A 3LP8A 3BD6A 1QGOA 4GLOA 2OORC 1AB5A 4N0EA 4O4LF 3FR7A 3FD8A 3GLGA 3DH0A 1PJ2A 4FINA 1SCDA 4MGZR 3ZGXA 2FUCA 7AT1A 3LA8A 4B6QA 2ECPA 1Y7HA 2CXXA 5LWHA 1AKTA 3AF3A 1XYGA 5CLLA 5EQDA 4BLVA 1KQNA 3H13A 4LEIA 2C57A 4FEEA 1XO1A 5EZSA 4CV2A 2OQIA 3H3JA 1HF3A 2UUAB 2IQIA 1F3OA 1A9OA 1QYXA 3K0AA 3TPCA 2X5JO 3EAFA 1VCNA 3U81A 821PA 1D6MA 2BKXA 1ZR4A 4H3VA 4IIJF 2QY9A 3KOZA 4ZOLB 4C0AC 3N2EA 1RYZA 1MXHA 4Q02A 4QE3A 3ANTA 4JL5A 5TPWA 5CJ2A 1I2MA 3DVAA 2GJAA 4GNKA 1J5XA 4BLSA 3ZCRA 3K35A 2JLCA 3NXSA 3VNRA 4TMWA 3WL5A 4UOZA 1NYRA 4ZEOA 8AT1A 1O1YA 1AE1A 2OM6A 4E3ZA 6PFKA 2XKAA 1DMSA 3JPYA 5CD9A 2V6JA 3T3OA 1WXDA 1G1MA 2PWYA 3FCCA 2PZFA 4JP8A 4S24A 4JYCA 2CMKA 4V0ME 3LYUA 5D1NA 2OB1A 4D9EA 2BLLA 1HE3A 1Z88A 3CF0A 5JADA 2G08A 1HPLA 3PBKA 4TL8A 3CG0A 1EX9A 5C31A 3UWSA 1VRWA 4GBMA 1K5GA 1Y6ZA 3GGGA 1LPPA 1RYEA 1Z16A 1SN7A 1B0UA 3Q1LA 1BDHA 2ZETA 2Q21A 1RI1A 3MOSA 5AHOA 4NY1A 4CR8A 4FE7A 2FUEA 4LHZA 3RQIA 1Q57A 5F73A 5FQNA 3I5XA 4LBYA 3V8VA 4GKKB 1D2MA 2CL7X 2GILA 1R0XA 5IBPA 4RVOA 4YPVA 5D86A 1OLSB 1FOEB 4CN8A 4XB1A 1OA1A 3DZBA 1AB6A 1V4VA 3W5UA 4C6RA 2ZJ1A 3SLGA 4HPXB 3UFXB 3M4NA 4GMHA 4MWOA 4QTZA 4TWZA 3EVAA 1L4EA 1TA0A 4E2FA 4EB8A 5ICCA 3FYTA 3LBYA 2ZWVA 4A10A 4BP9A 3D02A 3L77A 4HXEB 4IV0A 4YJ3A 3ZIDA 1YTLA 1FP1D 1NTRA 1VIMA 3FGPA 3IJ5A 4WESA 5DYTA 4YB8A 1PNVA 1S1MA 2CLFB 4J7CA 5AKHA 1N78A 1XZCA 1AD2A 1HE8B 2R47A 3W4IA 3V8RA 4JOCA 2IYUA 1KNQA 4F21A 5IWCA 2ON6A 1Z2OX 1PFQA 4IM7A 1C14A 3PIDA 4IIGA 4S1TA 1ZHOA 3WKEA 4PN3A 3QX8A 4JSTA 5KDDA 1ENOA 2JLAA 2XCOA 3B3GA 2FN3A 2OHJA 2ZUFA 1T1IA 3KBOA 3IVRA 2QM8A 4K0KB 2ZI3A 3RIHA 1Z56C 3ZBUA 3KTFA 4OHPA 4B6SA 2H1VA 2TMKA 2VNSA 1ZRMA 2VP6A 2WI8A 4YXWD 2GXAA 4Z4IA 4DCCA 4Z3OA 4R69A 3VX4A 4KXXA 1UBRS 2ERYA 3V1YA 3LFUA 3FFWA 1RVDA 5EWLA 4B9AA 3MQ2A 4X6UA 2OZPA 1T2CA 5IF3A 2VBCA 1GZ3A 5A4KA 2G1UA 5BR7A 1JHPA 1EWVA 3EDRA 4HVCA 4B85A 1FYWA 1L4HA 2J3LA 1BROA 2D7JA 3AY7A 4DDWA 4B4OA 1EFKA 1RHJA 3Q85A 2C1EA 4I9UA 1FS4A 4PG4A 3MF4A 3NTVA 1EB9A 1W4RA 3X1XA 1NR1A 3PHIA 4A26A 5JI3E 5GMOA 1HKHA 3NOOA 4LF4B 3WGGA 5CXSA 4GMGA 1TKBA 4BO9A 1ZK2A 1KJQA 4PSVA 3KZVA 1L8OA 1E9CA 1LUAA 2D7DA 4RAOA 5CDTA 3I05A 3DMYA 1GTL1 3DWIA 4IVNA 4DUGA 1Y42X 4RL4A 3I2YX 1SKQA 3DE3X 1UH5A 4E6PA 2OBNA 4KBYA 4LI3X 5BV2P 2HEIA 1EBFA 4CIAA 1I4WA 5G0VA 4XM2A 4M0KA 3LUBA 3BE8A 2W98A 5B4TA 2MMCA 2CFRA 2IXFA 3ZS9A 3IEVA 1KPIA 2G63A 4OXXA 5CT8A 2BP7A 2QX6A 5JQGF 1P81A 1SQ0A 3ZCVA 1FFWA 2ECOA 4LZPA 4WFJA 5KCMA 2WHXA 4YPFA 3ADPA 2GFQA 1WUIS 1E3IA 1GAXA 4YMIA 2KM1A 3O4IA 3RR2A 3T7SA 2BGNA 5CLQA 4NZ9A 1BQEA 4YUVA 4OHWA 1J22A 3CR7A 3VZQA 1NG9A 3HWRA 4FDUA 3T3IA 2Q1UA 3B8HA 2WM3A 2ZJ3A 4ERXA 4WINA 2HK8A 1OH8A 1I7DA 4FZVA 1PDVA 521PA 2R5NA 3G7UA 1IPHA 1ST2A 3HFRA 3FHCB 1DHRA 3DEAA 4N6OA 1S02A 4TZTA 5AKYA 3MPOA 2CXPA 2JRLA 3IODA 4CBVA 3LUGA 2VCHA 2CUNA 1WEKA 2GF2A 3L2OB 1SY7A 3VZCA 2OHFA 3EASA 4X8HA 3PA8A 1M2OB 2QVXX 4DCUA 3ZE2B 2UVPB 3PFBA 1N3LA 4D41A 4FWTA 5ES4B 1ZAKA 2X1HA 1N0WA 3AP3A 2QPOA 3JALB 1A9ZA 2AL7A 4MGKR 5EHQA 4MRSA 1TQHA 5SICE 2DOKA 2PX3A 2WWTA 3W8NA 2C9DA 4EY3A 1M8PA 4M1EA 2Q4OA 4Y1RA 2Y9MB 3GJRA 2UDPA 3FFBA 1YQGA 4PEVA 3KHUA 1LGYA 2PL3A 2YNMA 3EMVA 3FNQA 3N8GA 4BP1A 1AKWA 3GLFA 1D2RA 2EWWA 3LWNA 4AZVA 5E7IA 3LHIA 1LTQA 1RYDA 1COWD 2E9SA 4RKEA 2J32A 1P19A 3IDAA 1GAEO 2AA3A 1M0WA 2JGAA 3UJ7A 5BRJA 1IZYA 2FFAA 4MYCA 1SC9A 2F90A 4K26A 3NCTA 2PRSA 3HHPA 4O59O 3M82A 1SMKA 2BGMA 4BMYA 4F5EA 4R0MA 1U81A 4YX9A 1AMUA 3JD4A 3U0BA 3IOMA 3MJCA 3WRYA 4BGIA 1GTJ1 4MRAA 3LPAA 4TGLA 3OCCA 2RB4A 4WW0A 4YLGA 1M66A 4E94A 4ZU3A 1YWGO 3DF7A 1D1QA 1O03A 1WHSB 2PH7A 1Z8NA 1GQYA 5CTJA 1F2UA 4HQFA 3WGMA 1C8KA 4KN6A 3TKYA 4ZICA 2QRVB 3FDFA 2VAPA 1Z2AA 2H0AA 4QGHA 5D1HA 1L4NA 5TQJA 4DR5B 2E55A 3CRQA 1EK1A 1E4EB 1NXQA 2NU8B 1OWPA 3U3DA 4X7PA 1J07A 3FDZA 1MORA 1G5TA 1J21A 1NRJB 2FW7A 1L5OA 4GFDA 3HXPA 1UQUA 4WRRA 4BS9A 5CR9A 4KQHA 2F3QA 2ZS8A 5DK6A 4WXMA 1E61A 1V2HE 5CA0B 3QZUA 2DWQA 1IEVA 2PNJA 1SKBA 1RBZA 5I5EA 1SCBA 2XCRB 1Z35A 3K53A 4WCFB 4GM0A 1KFKB 2HN9A 1ZBQA 2WAXA 3OQBA 4F06A 5A1TA 5CXQA 4RDCA 2VK2A 1J8VA 2A1TR 1VOTA 3GF4A 4FILA 4D5GA 4IZHA 3OZRA 1CUUA 1L5QA 4JIMA 3HUDA 3S2FA 3OZTA 1F2TB 2A88A 4Q21A 2V7XA 2ISSD 5ALLA 4RQUA 2W6QA 2NZUG 1ITZA 3O8LA 5HM8A 1IN1A 3GV0A 2FOIA 4NMMA 3KBBA 2I65A 4N49A 3HCAA 3KQQA 3EZNA 1XDUA 1AHNA 3G6WA 5LXTB 3QLVA 3THXA 4LV8B 3O47A 1BCRA 4JKYA 1E7WA 1AQUA 2DETA 2HO5A 1H8HD 1BQ4A 3LPLA 5EUBA 5K2OA 2PH1A 1I3NA 2FSUA 3U7QA 4BC0A 3FNHA 3AEXA 1Y7LA 4BNVA 3A05A 2A94A 3GRFA 4OYRA 3TPZA 1Z6TA 3B1WA 1ZWKA 4GLBA 4V3CA 4F1KA 1PL7A 3H5VA 2DRIA 5KYNA 2ZZNA 3N8DA 1Z0KA 5F51A 1SB9A 3DWFA 4UC0A 4NMHA 5DM2A 4C43A 2Y1LA 3TE7A 2RGNC 1U0HC 1G98A 1QIDA 5LLDA 1KKLA 3Q15C 2B1QA 3V6MA 3O21A 1H8EA 4Z9XA 3HBJA 1A8IA 1SXJA 1I9GA 3BIWA 4Q82A 2EFCB 2GM4A 2Z43A 4G4IA 5AI0A 4EI8A 1YJXA 1K3FA 3TQSA 1XPUA 3ZCPA 4AMGA 4AB1A 4H0FA 1XNGA 1ZD2P 1C1XA 1LK7A 3IUJA 1LSSA 4QOIA 5D5PA 3CPSA 3ZYCA 2RHOA 1N2SA 2WG1A 4BECA 2QP9X 4YQEA 1WMSA 2C7GA 2H4XA 3V1LA 5IXYA 3ZHOA 1Z63A 1E79D 2EP8A 3IP1A 4KZKA 4OBBA 4OOEA 1NF8A 4W9NC 1YOBA 4ZV9A 3SC2A 2PUBA 3RE1A 1H0RA 4RKFA 2IZ7A 1C7QA 3INNA 3PVZA 1MDFA 4R0VA 1USGA 4Y6RA 4F5WA 3E3NA 5K0LA 1E99A 1LJUA 1BE1A 1U2DC 2F3PA 1LPSA 2Z8YM 3KKLA 3RTEA 5HM6A 3H9UA 4AO6A 2V9PA 4DSZA 1AZTA 2PH3A 3T52A 4DG5A 5DN6D 1UDRA 3GLSA 5HYVA 3KJHA 4AY4A 4D9FA 3GLUA 2AC7A 3GNLA 4D8TA 4HVLA 1RBMA 4ZFNA 1PK9A 3UK0A 1IJKA 4EYOA 5I9IA 4BJHB 2XCLA 2Q3DA 1NVMB 4F4IA 3K05A 3G9UA 3JD0A 3L1UA 3LLVA 2H4YA 4MUHA 2JBAB 1SOMA 1T0JB 2DLDA 2FMUA 5IH3A 1DAGA 1YKFA 1SD2A 2FWRA 2GD2A 1KQOA 2X7XA 1G8KA 4UU8A 5LJIA 1II8A 5ALNA 3EIEA 4P84A 1CQZA 1JIUA 1O5OA 2ODBA 3ZWYA 1W59A 4N7MA 3FSJX 1XUOA 2CNNA 2PKRA 1Q1AA 4XIIA 3TVTA 4BX2A 4WUTA 2O7VA 4PZCA 4V0MA 4TZ6A 2ATEA 1YH3A 1SG0A 3VPCA 2HPHA 3QA9A 4RA9B 4LY6A 5HKKA 5JNWA 4IPTA 5LZ9A 1E3QA 4KNVA 1H5UA 3SVLA 1HDGO 4DTCA 3COSA 5DBFA 4HEA1 2FWMX 3QEKA 1PP4A 3PR1A 4KR2A 3OTWA 1KYVA 3AHJA 2XD9A 4HX2A 3UY4A 4XIYA 4BX8A 2C2YA 2CCJA 3NV9A 4G5FA 4O2LA 4Q4AB 4EGSA 1X7WA 4O4LA 1QHGA 3JW8A 4ROTA 1TRHA 1ZK0A 3KPVA 3T3NA 2D13A 5GONB 1Y3DE 4NU5A 4W1SA 1ZGHA 2ZJ6A 4DIKA 2H5JA 2C2HA 3O90A 1M5RA 1EJ0A 3GMDA 3C1OA 2CDBA 2NIPA 3LP5A 3RYIA 1XX6A 4M36A 3H1GA 3WXMA 3RVSA 1MA3A 2HF9A 1QHNA 4BGVA 1W75A 3V42A 1E2PA 4WPGA 4AFNA 4RW0A 4DC1A 3FNGA 1HYEA 4A8JB 4IUDS 4IIJA 3HLTA 3BDAA 4U5XA 1MN6A 5IPFA 5KREA 1D1TA 4RKWA 3GN1A 3RREA 3IMGA 6REQB 1WNFA 1E1RA 2C5LA 1H5NA 3LC1O 4AK9A 5LDHA 1ECFA 1PR5A 3QLUC 3N5CA 1P2UA 1IQPA 3HCDA 1Z34A 3E0XA 3ZDFA 4LZJA 4CKWA 3HXTA 4FCCA 4HJXA 2O23A 3FFAA 4RPCA 4RJJA 5K4GA 5MN6A 5AK0A 3JZFA 3DXFA 4WUVA 1FP6A 5FAXA 5C5IA 1EB8A 5IC6A 2MYTA 4TTRA 3MM4A 3QU4A 2C88A 4QEKA 3TIXB 1DDOA 1NR7A 1TUBA 2IV2X 1MAWA 1ULAA 2X8JA 4OB6A 2OGWA 4UEQA 5HDQA 1GD1O 1IYZA 2K2WA 4CUZA 4N0MA 1PFKA 4UMFA 2PG3A 2W6PA 3K31A 5EE9A 1N2CB 4W5TA 3BFJA 5E6UB 3UXEA 4H7JA 4Z99A 2YFYA 3F3SA 3ND6A 2BD0A 3FJYA 4CMKA 4F4DA 1WXQA 5B1SA 3IAXA 2P8JA 3MN1A 4KREA 4KR9A 5EHIA 1QOZA 1C8BA 5C7OO 2ADOA 1EFDN 4C0HA 4HNUA 3OF5A 3ABQB 2WZBA 5FP0A 2GZ3A 2WJ3A 2VXYA 4PX2A 1ISJA 4Z8YA 1YDFA 3CUUA 4DUPA 4G36A 3GAAA 3PNPA 1JNXX 1O3YA 5FI5A 4JR2A 5DHQA 1U6IA 4Q24A 2VHQA 3WR5A 5HJ5A 1QZXA 3KAJA 4PSAA 2IYVA 4IXTA 2YJ4A 3H4TA 2NPFA 3K72B 2IZZA 3HGMA 4AP9A 3ABOB 2J7KA 3BK2A 4MYHA 5DLDA 2CMHA 1V71A 2DLNA 1Y5IA 2N47A 4R3WA 1X7XA 3O2NA 4OHZA 4EA7A 2FLVA 5LLTA 1KI9A 4LQ4A 4PANA 5MN5A 2BFAA 2R7MA 4X60A 3BCRA 2A9PA 2J0VA 2PMKA 3GZTB 1QHHB 5SYMA 4UEWA 3ET4A 3IIMA 3R23A 1G8GA 4Q0MA 5J43A 3MJRA 4KE8A 1PZNA 4HTFB 4MS1B 3TE6A 2EARA 3DE7X 1KMHB 2R00A 1JQ5A 3QWFA 1Y8RB 1R0LA 4PBTA 4OP1A 2F8SA 5J2UA 3AESB 1QUFA 3V8EA 1QK5A 3C1UA 2EZ8A 4RY2A 5IAJA 4C6HA 5L51A 1PR3A 4PQRA 3QGMA 1I2DA 1TZKA 2AB0A 1LWOA 2XYHA 3ISJA 5FBLB 4AAYA 5CBPA 1E3WB 4YDQA 2IELA 2RHLA 1IZ0A 5TJHA 1O9GA 2WIAA 2F17A 3NTRA 3SZRA 1EINA 3FI0A 1HT1E 4GLJA 4CEIB 4RD3A 4DW8A 3NPAA 5DLEA 3WV4A 1ZGJA 1DKRA 2ZI9A 2IWRA 1SBCA 1T5DX 4DE5A 2CEKA 1G5FA 2PZGA 2Q3BA 2ZJ4A 4KJZA 4Z2YA 2BFDA 1FVFA 3FKSA 4G0XA 1SC3A 1DBSA 4UUBA 2D7CA 5BOVA 1CPYA 1QUEA 1KAMA 2O2IA 2BJWA 2ST1A 1F8GA 2QLJA 2ZJ5A 2VJCA 5A0FA 3ICCA 5JANA 4BQEA 1ZGBA 2HM7A 2RAUA 4NNJA 3L8YA 5FTKA 5CU7A 3UJAA 4JEHA 4WXRA 3PIIA 4MTLA 3SKXA 5JQGA 1IVYA 2PWBA 3KOMA 2AVDA 4L73A 5CX4A 4EYQA 2EJCA 2FRDC 2V59A 3K4HA 3RHZA 3CT6A 4XB2A 4C6TB 4DQVA 1KQ3A 3OX2A 3VHRA 5JVDA 1S6YA 3CWZA 3ESAA 4D81A 3MUNA 4WEQA 3VR0A 3ONWA 4TMTA 1M8JA 5JD6A 1ZL0A 4ZYVA 4EFDA 2R6HA 4RZXA 3L82B 3KHSA 4RVDA 3IPLA 4R9UC 4GG1A 4PO8A 1A9TA 2HQOA 1OMOA 5B55A 2Y27A 5DTMA 2DE0X 4QGBA 5EXXA 2PL5A 1N1GA 4NCNA 1Y6QA 1CZHA 1X80B 1F3LA 4A5SA 4BX9A 4K5QA 3M5PA 4TLBA 3RB8A 4FYJA 3UUWA 4JQYA 4R5HA 1KTVA 3T7EA 2R1VA 3ZDDA 4TWRA 2MSWA 3SIPA 4URVR 3ZBPA 1UQRA 3UGQA 1HL3A 5LZ2A 1C1DA 2ANBA 1TLFA 1WDWB 1RWPA 2REQB 4EP1A 1AURA 5K20A 1U0FA 3ETCA 2FDCA 1TMKA 3TRDA 5BYAA 2WMOB 1T1GA 5H3CA 3TINA 1U3VA 2BHRA 1KJ9A 2QR3A 3HACA 4B6GA 2H3HA 1OC4A 2VT2A 4JLUA 4B79A 3IFSA 4HSGA 2AKYA 4MVJH 1DB3A 3I01M 3G0CA 4UNQA 3ZX4A 3CJRA 3RRJA 4PIPA 3QHPA 3O8BA 4TL7A 5AVKA 3TKAA 2JLSA 1OB5A 3ICEA 4RJLA 1BDBA 3AVVA 1FFXA 1RT9A 4I4CA 1A95A 1YB6A 3VZPA 3UYLA 3CX4A 3PE3A 4WJKB 4ARSA 3NM6B 1PR1A 4GBGA 3OZIA 4KIFA 4RTJA 3IEIA 3S68A 4A0SA 1YZQA 3F74A 1WB6A 4X62B 2F67A 3FN4A 5I7HA 3AWIA 2JI6A 1QVVA 5BWOA 3QEBZ 1N33B 1LS6A 4P6VF 3A6PC 3HBAA 2H2AA 3L41A 4G65A 1M2WA 4P92A 4KXUA 4MRPA 3LUCA 3KXKA 1TEXA 3ROTA 1MHPA 1UMBA 3FCOA 2EIHA 1VCHA 3L0ZA 3MAAC 4OAQA 4REOA 1P29A 4ZC8A 4CNQA 2RGRA 2J4DA 4X1OA 1S4QA 3CY6A 1V7PC 2Q9AA 1EAYA 2PGJA 2QGFA 3AEKA 5DYWA 3PLRA 4D9HA 7ADHA 5D01A 1EM8B 4IDEA 1RI3A 4UE3S 5KJ1A 1VLJA 3PLAE 3E53A 1X19A 1MENA 2NOAA 3Q7RA 4GU5A 4NAHA 4Z6KA 4YHHB 1QU3A 1AKMA 1RACA 4QXMA 1IBKB 2IHNA 3GIDA 3KYIB 5BSUA 3O4FA 1T8WA 3MW8A 4PC2A 2G83A 4AIRA 2HT1A 3GEIA 5HMMA 1OB2A 3DEHA 1T6ZA 1TFUA 2O8DB 1XZDA 4DR1B 4RPLA 4F96A 2ONKA 1MHTA 3HLYA 2XAUA 4U7HA 2WKWA 3O9VA 4A2PA 4BL5A 5L3RA 3TLGA 4C1NA 1P1HA 4A0RA 4ZCTA 1G8MA 4ZV7A 2ZUTA 1V1RA 1UDWA 4IBOA 2OBYA 5LBIA 1KU0A 4TTJA 3OCVA 1G4UR 1FMCA 3U7HB 2I22A 2ODWA 2B82A 2CNDA 4DG9A 4ML3A 5IK2D 5TMPA 4LC0A 1HX7A 2ZBDA 2VWQA 5KSWB 2ZW9A 4IIVA 2W2NA 2XQJA 4CM6A 3CUSA 2FYTA 4PS0A 4XCQA 5BUQA 4D42A 3P5SA 5ALJA 1TYDE 2BRUA 4H0CA 4ID3A 5GVRA 5KI6A 4R51A 4AJLA 3BC1A 1PDOA 4X7RA 2Q4DA 5KU7A 2XOKD 3U4QB 3AW8A 1HXHA 2F00A 4UTNA 4DLBA 3BMCA 4QD3A 2G1PA 4DMMA 5DO9A 1QB8A 3V4SA 4YP7A 3VKFA 1V8ZA 4ZOLF 1LSOA 4TLCA 1EVQA 4HSEA 4RD2A 2GXQA 2UYCA 4B48A 1KMQA 4JJKA 4CQLB 3HV0A 3IL2A 2F3UA 2I7VA 4QGAA 1BYIA 1Q14A 2ZWOA 3H4MA 3NZEA 3CVXA 2JG3A 1RWWA 4M7RA 2XF2A 3A9UA 3F4KA 4P4TA 1RM4A 3RBAA 3JYPA 3EF1A 4OQZA 1OVMA 2EBFX 4RPHA 5E6RA 3UKJA 3FSGA 5KVQA 3U4MA 2CCKA 4KN9S 4FLFA 1G20B 4B32A 5L6LB 4EPTA 1OX4A 3H6GA 1P75A 4MUMA 3UJCA 2BFEB 4XOIA 2HCTA 2P9ZA 5CAEB 1MTZA 1VMIA 1XEWY 2EZ9A 2G8NA 5KINB 3GEDA 1ZH0A 2YASA 3MCWA 5BYBA 3W1VA 1W8IA 2OAGA 1DQPA 1AKVA 2QR5A 1Z3IX 4JLOA 2AOXA 1CQWA 2JEZA 4KEAA 3TZEA 2JFQA 4BE9A 3VTFA 1JMVA 4EHAA 5KYYB 2B1RA 2VUTA 4D6PA 1SVNA 3R3HA 2O8CA 4MJXA 3KB2A 5AJWA 2EHJA 2M2IA 3I0MA 3PXBA 3ISTA 1T3TA 5KVCA 3EA0A 2ZRIA 1G16A 3QELA 2V45A 4JCCA 4UMEA 3A9VA 5K2MA 4A91A 2ZP1A 3OVMA 4AJKA 2P6RA 2PIDA 1ID8A 2FP4B 3RSOA 3ZNPA 3KV3O 1A77A 3QXGA 4EEKA 1CUSA 5JJIA 5HRAA 3DZKA 2JB9A 3BJZA 3JARB 4FFPA 5G3YA 3RCBA 1E4VA 2O9JA 5BWCA 4Z0PA 1ONPA 1GA6A 1JSRA 4CKBA 3HYSA 1D4OA 2WT4A 1KJNA 2KJQA 4R68A 1FLAA 5TGTA 3MTIA 3JYNA 4LNAA 4P86A 1XXHE 5M34A 3F90A 1AKEA 1ZZGA 2JCVA 3L4EA 5E4TA 4V24A 1E0JA 5F35A 1WZIA 5TLSA 3NT4A 3LDHA 2Z8YA 2H2FA 1X1TA 3BEOA 1VE1A 4OHCA 3Q3IA 3WLJA 2AX4A 2WMNB 5JAOA 4NBSA 5E9AA 4NCBA 4LMPA 4JC8A 4MGEA 4NJMA 1QDLB 1KSHA 2H9YA 4DWOA 4E3WA 3DL2A 3WZ2A 2FSGA 3AR9A 1X2BA 4I9NA 5LMZA 2GCIA 2NO6A 1BQ3A 3C39A 2EGGA 3C8UA 3EULA 3ZJVA 4EX6A 4D57A 4M6WB 3ACDA 3BYZA 2PYIA 3E8SA 3T7DA 3TBKA 4EI2A 2XDAA 3EFEA 1KI2A 1MT3A 1Z0FA 3SR4A 3UA4A 2FPMA 3W34A 1U02A 3B3JA 2PR2A 2PUDA 4L75A 4KVAA 1JU9A 2G9RA 3L8ZA 1A2KC 1JSZA 3OQNA 1IY9A 1OVGA 1R6BX 1PQ4A 2O20A 2XTJA 3G23A 4IICA 5FL7A 1XAHA 3OHSX 5TV2A 3ZCSA 4HB3A 4JT4A 3BQNB 1A2QA 4C4PA 5KOYA 1VECA 4U3JA 3FTEA 1DCMA 3TH5A 3WGQA 2JGMA 2FMIA 2P77A 2B6HA 1BCSA 1ULTA 1C9MA 1V26A 2G9UA 3HA3A 3GBSA 4OQMA 1ULHA 5HIIA 3SG0A 4ZT5A 1GFSA 2Q2VA 1CDEA 3BGDA 2DC1A 5JAQA 3SZLA 3SYTA 5FF9A 3S7ZA 1GTVA 1JQDA 2P2NA 1AQ6A 1PO7A 2R8RA 3K5IA 5JHGB 1ZCFA 3P0FA 2QRHA 4CIWA 1Z5UA 1QXSA 2IEAA 4R8KA 5DHRA 1NUSA 1XOIA 2FPIB 2ZJ8A 3N1UA 1OGJA 4D9MA 2HSDA 4TMFA 3M1YA 3VOSA 4HUJA 1T24A 3KUUA 1Y1QA 1IXSB 3BB3A 4N0QA 2IXAA 1Q15A 4WKGA 3U31A 5ED4A 5AHRA 4B2YA 4OI2A 2ORYA 4C4RA 5HGXA 1M6HA 3UCFA 2A5DA 5DIFA 5IXJA 4KB5A 2BGIA 3OEED 3AJRA 3U3MA 2BONA 2NSDA 1FS5A 2FR8A 3PITA 4QU0A 3UOGA 2J3KA 1TZMA 1L8XA 4G4SP 4XPZA 4P83A 3CUKA 1Z4QA 2QRPA 4C29A 1TT5B 1CRZA 3K70C 5BNWA 4RLQA 4NV1A 5CXXA 1VZ3A 1YE3A 1K5HA 4X1YB 2J5RA 2YUIA 5AM4A 5COBA 3UC5A 4O3FA 3WKBA 4YT4A 3L0PA 3WA6A 1AUVA 3U4DA 1TM1E 3M4JA 3WFZA 3L02A 2P41A 2ZAOA 5T4FA 1T0BA 4W8HA 4ALNA 1KEEB 4HFNA 5K0NA 2P90A 1Y5RA 1VA4A 1SIWA 3FX2A 3QE4A 4M1OA 1OFTA 1YBFA 3P4YA 3JSXA 4QFMA 4L74A 5DMXA 3RG8A 5KTMA 4ZEVA 5FTMA 3O4VA 1BFDA 4UXJA 1K0FA 3WRXA 1T4MA 4L0DA 5I7RA 2DEUA 4LYFA 4MO2A 2H2IA 3WOHA 4FN5A 2NU6B 5B3JC 1XTTA 1M0TA 3AEQA 4XKJA 5L3VA 1T5LA 3V6LA 4MZXA 3SR3A 3UAOA 4ND8A 1ADGA 5B7PA 1NQTA 2YMPA 2HMSA 1QVRA 2DUMA 3QJGA 3TRJA 3ZE0B 2RH9B 1NJ1A 3QFTA 2OO3A 2O2DA 3H6KA 4RJIA 1IBSA 3MWDB 4FDAA 1UBCA 3MHPA 2ZKLA 3M6LA 5AWFC 1O95A 4PAQA 2IKSA 5EIEA 3G9XA 1WUYA 3K70D 1DHTA 1PD1A 2NUPA 2GN6A 1OTYA 2J3IA 1KGSA 5IAKA 1QX3A 5JDCC 1W0CA 4PYOA 4F6RB 3QY9A 5A02A 2FTKE 1N7GA 2AJBA 1QP4A 1DXHA 2Q0QA 3IKVA 3ESDA 1ZVJA 3HQ4O 3NYQA 4LYEA 4IQFA 2ROQA 5EIFA 2B3DA 4F4JA 3H4IA 5IHPA 1IVNA 1IM5A 3GJ8A 3OTQA 2R2AA 1MKYA 1WLSA 2ZXFA 4QBFA 2AZ4A 3OZ7A 3NYRA 4ZT6A 4A0HA 1TOAA 1T5HX 2QP3A 3KJFA 3Q4GA 4WBNB 5BN3A 4URXR 5ITZB 3N8NA 1YZ3A 4D3SA 4HGOA 2ZU0C 1HWYA 3L6UA 4DQ0A 1UMCA 1ENZA 4DQXA 3UXMA 1TQ4A 3AU9A 2QN8A 1SHZA 1VSBA 3LI2A 4IIDA 1E20A 1QOQB 3N07A 1YZUA 3CN9A 4OH7A 2FMXA 3OLVA 3WY9A 1GXSB 3WB2A 1XTJA 3OQIB 4J2HA 1XZPA 4B6RA 1UKBA 1AUQA 1DCKA 3D2CA 2ZB2A 3Q8XB 4F46A 1ADBA 1Q1NA 2LWIA 4BFTA 2QZ4A 1XA4A 5LQCA 1N25A 2HEGA 4C2TA 3ER9A 4Q9LA 1S4MA 3RDPA 1UMDB 2I2CA 4YR9A 1I8TA 4ODIA 5CXUA 2QSJA 4Q01A 3PUIA 3NVKI 4R05A 2HKIA 3AMVA 4G89A 3KUDA 1SPXA 3W8FA 3CRVA 4AKGA 5HIMA 2AR9A 3GP8A 4QEDA 4P82A 5AJTA 3VR5A 3QPVA 3FYUC 5HS4A 4FWIB 1JG6A 4E31A 2A0UA 3PJGA 1EWQA 1Y3HA 1E5XA 2O5RA 2W9XA 1DEXA 2ZSKA 2ZRPA 3EG9B 3D8UA 2ORIA 4R40A 4AS2A 3T4UA 1PK8A 4M1WA 2HJVA 2ISQA 3HFSA 5CNIA 3QSGA 1GITA 4FMDB 2Z6QA 4J7XA 3P9IA 3LJKA 1YZLA 4HD8A 5TARA 1ZKMA 1SIOA 1ZJYA 1JI3A 1QCDA 4KIJA 2AXNA 4EI7A 3PPIA 3RF7A 4C4AA 1JFSA 2BSQA 3IJEB 4D99A 1SUBA 3W9BA 5L3SA 3KOYA 4X0EA 3C0KA 5KWEA 4TQAA 4BO7A 4F86A 2JJMA 1NXSA 4XUCA 3LX5A 4L1KA 2VAVA 3B5IA 3D4LA 2OHGA 4J0EA 3AJDA 1U2PA 4TQUS 5CGQB 3IC5A 1L5HA 5HOQA 3EMDA 1DC4A 2CYAA 3P71T 4M0PA 1VLQA 2H52A 2ZSUA 3OG9A 1Q16A 5SZKB 2ODAA 2WYHA 5IYZB 2IUFA 3ZHSA 2PXAA 4HWSA 5K3DA 3FTFA 3I8OA 3OE5A 4KV9A 2NUTA 3H0EA 4IHJF 1YVDA 1FZTA 3F46A 4L57A 1JHMA 4LSZA 2WDZA 3W6NA 4EUSA 2Y1WA 1FFCA 1W5TA 3IR6A 1VGQA 1YOVA 4OMDA 5JARA 3RS5A 3MFYA 1R4NB 3IPYA 3U39A 2J08A 3NYIA 3WRVA 3LCUA 1SZDA 1MH1A 1O94A 4HDNA 4IKOA 4TYYA 3A3OA 5JSZA 4P0QB 4EMTA 1ZY2A 3ANYB 4J2OA 4L07A 1NOJA 1LSJA 2OA0A 2PUWA 5IZ4A 1H94A 5K1ZA 1GGEA 4LXYA 1YR1A 3DZGA 3A32A 3NVAA 2WJYA 2Q62A 3GG2A 4HG2A 4JFRA 1EH5A 4LHSA 5FBKA 4E09A 4WADA 3GJ5A 4J07A 2IOFK 4XVQA 5HCNA 3TOSA 4X64B 4ADSG 1DJMA 3H2BA 4G26A 4UVIA 1ICEA 2E4WA 1I2BA 4ZVNA 1HEUA 2FNAA 5E7QA 1XHEA 5G53C 4LGVA 3DE6X 4URUR 3W2TA 5TGZA 5A5VA 3HCCA 4GXQA 4ZOEA 5KNBA 5I7OA 3E3LA 2I5PO 3G0HA 1B2LA 1LKZA 3AR6A 3O95A 2IU0A 1N36B 4OI4A 4W7HA 4WZAE 4BCDA 4HCJA 3C4VA 2XEXA 4IJWA 3KEQA 3JQAB 1QV7A 2ZSBA 3EJ6A 1L0BA 5AUQA 2VR1A 4M0UA 4JLJA 1MX3A 1NW5A 2Z30A 4BLUA 5AOBA 1RHQA 5JS6A 4YQFA 3WLIA 2BGTA 4TXMA 4X6XA 4QKQA 1T9CA 1YHZA 5CLFA 3M9LA 2C3UA 3BTSA 4UHHA 1Z5WA 2B7LA 3IBTA 1DIAA 5T5QA 1FNCA 2GUWA 4KO1S 1XHFA 2JFYA 4RZHA 5KPJA 1ZJWA 2C04A 1AKNA 4UARA 2ZSAA 4FHCA 3I5UA 4G0VA 3AX6A 1GQ2A 3OAAA 2A78A 4OQYA 2P9CA 4U8GA 4CLEA 3CX7A 3ESYA 3LL4A 4MRMB 3SIWA 4BKMA 1RJEA 2KBEA 3KQOA 4UUNA 3L7OA 4Q7LA 3D6MA 2ZCJA 3ETGA 1USIA 1ZW6A 3EEYA 4ZOLA 1C7EA 3IO5A 4BZXA 4HP8A 3C8MA 3CH7A 2WIBA 3AEUB 2GAIA 3TVYA 3C98A 3DOJA 4QJBA 1N3BA 2G6BA 2V6MA 4KWEA 5GAJA 4GPTA 4YJDA 4GOND 3ZDEA 3SM3A 5FKJA 4AO7A 4BGUA 1JHRA 2LKDA 2O0KA 3M0EA 5D3KA 3D0OA 3AIOA 5ALRA 3UUEA 4E2XA 1VYUA 2GKSA 3V2IA 4RMGA 3EJWA 4NOMA 3IQEA 1Q7GA 1U8YA 4P3NA 4LF5B 3HEAA 4DUYB 1S7CA 3D7LA 3CT4A 1RJGA 1Z45A 2QRUA 3VR1A 1NVXQ 5FFMA 1CP3A 1M74A 5A9SA 3AUTA 1R2QA 1X3LA 4E7OA 1QTQA 1I7QB 4HLQB 3G5TA 4KMRA 3UBMA 2YYZA 4PCLA 2G5CA 2AXPA 3KEFA 1OIXA 2BDUA 3QBTA 2C4MA 4Y2HA 4C5AA 3W6ZA 1ZM4A 3GOQA 1NONA 1WG8A 5AXBA 3I9V1 5IMBA 5BMVB 2I0FA 3MBKA 2FSVC 2P40A 5FADA 1IFXA 3GH1A 3EVNA 4CQNA 1OLSA 3GRAA 3MB5A 1K63A 2Z4TA 4G6ZA 1UIMA 1YZYA 3ER8A 2W8ZA 1DBQA 2AR7A 3PXDA 2Z2IA 3E5MA 4M8SA 5ALGA 1THTA 3B51X 4YAKA 4MDFA 4P54A 1W88B 2IGTA 3OH8A 5EE5B 2QZSA 2X41A 4DRZA 1AG9A 1RCUA 2M1ZA 3G79A 2KBFA 1BE8A 5TGDA 1C3JA 1XQXA 1Y98A 3D5EA 3V1NA 3AF4A 2FGKA 4HY3A 5THKA 4Z1OA 1CG6A 3IVCA 2GXUA 5FOUA 2JHAA 4MIYA 1KR5A 3ICWA 4IX1A 1KE2A 3H1EA 4BNUA 4BVKA 1PFWA 1JQAA 3EC1A 3PHGA 4FEAA 4MK4A 3ZHVA 3PNMA 4A3SA 5JYEA 5KSOA 1YIOA 1Y8QA 1NWHA 2D5AA 2VJMA 2XWBF 4M0EA 1QCYA 3KOWA 4EELA 5JU6A 4TMZA 2FKAA 5GJWC 3HZHA 2OY0A 3DAGA 1E0SA 1XMVA 5KEIA 3I9OA 1IVSA 1Z22A 2P65A 3DLIA 2PBFA 2RGGA 5JW6A 2A67A 2WWRA 3Q1KA 4FIDA 1EQUA 5C32A 1ZNWA 4LNUA 4QIHA 1W93A 4MJ3A 4ZDIA 2VHXA 3NIBA 4L8FA 4EAAA 3CMMA 2WKQA 2XWSA 1OFUA 4NWIA 1R0KA 2CE7A 2QYSA 4TSFA 2BMJA 1J97A 1Y6RA 1XIVA 3R5FA 1E7QA 5EE0A 1P0MA 5IC4A 4YP0A 2ETVA 3KK0A 2RONA 1MIOB 3MWJA 4Y6PA 1BVHA 2DPMA 1IOZA 4DCMA 1Q22A 1I0ZA 4MW2A 1FS6A 4NBKA 5FCDA 3HDYA 1OWNA 3M1AA 2VJDA 1TLLA 3RVKA 4BLPA 2OG1A 2LIPA 1P61B 2VXCA 5EQTA 3WL4A 5FA8A 1EEHA 3L7MA 3MLAA 1D6SA 4RESA 1FTYA 3AU8A 1XVUA 2OZKA 2WBLC 1B8NA 1NL3A 1YGPA 3QWBA 4QPZA 4UBNA 3JX9A 4LV5B 2KYRA 1LDBA 2QRNA 3O4JA 1S2MA 1O7JA 5EQFA 4DCSA 4EEZA 3FBTA 3IQZA 3OOSA 3PQEA 2QJFA 4PW0A 4R3UC 4DVGA 5IVHA 4L2IB 2GPAA 1J2TA 4G8CA 1FU7A 5ICEA 4PZZA 5BUZA 5F3WB 4BKUA 1HE2A 1KBOA 2DY0A 4LJ9A 5JWOA 4M7OA 2BMAA 3TTSA 1EJBA 1M10A 4IH4A 3T61A 1A96A 4F9EA 2QTGA 4D3YA 2V54A 4RF2A 1WHTB 4JP2A 4LF9B 2P4HX 2Y77A 4WIAA 1DPFA 2QTFA 3DT8A 2AKAB 4HXGA 3S8MA 1NKSA 3MWFA 4OKIA 4S3MA 3TIIA 2V6GA 1MO2A 1LC3A 1V5IA 4GZ6A 3UG7A 3WYCA 2PS3A 5G41A 1SVMA 2XDQA 3BB4A 3JVIA 4OYYA 4K1XA 3KJEA 3L43A 3JTEA 5C8YB 2EW8A 4IDHA 3P0JA 2X2OA 1W73A 1K8YB 5ALKA 1ZH4A 2A5FA 3HU1A 4NBWA 1CHNA 4NOJA 4O1HA 4TVSA 2F43B 1A4XA 2IPOA 3UANA 3SX4A 4QGGA 3RS8A 1QJCA 3SSMA 4M55A 1ZD3A 3ZLJA 3HUEA 3X1WA 5FUVA 4DR6B 1M2OA 1V9CA 3AHCA 4IEIA 1O9BA 1GJRA 1QIEA 4N3BA 1CNFA 4QICA 2RGBA 2AX3A 1Q6ZA 1QLHA 3FRIA 4RIEA 1N2JA 5AHWA 3WC4A 2V03A 2X23A 1IBMB 3EXHC 3ZD9A 5LOVF 2GEBA 2NGRA 1D9XA 1TVEA 3GBPA 2BLNA 3E5RA 3NR2A 3QE2A 2I54A 1GKYA 1UM9B 4V39A 4EEXA 4ZI7F 2BZ0A 1YCFA 5IFLA 5KZMB 4X91A 4XUEA 5A5DA 2C9BA 1DAHA 1SCQA 1ZINA 2GSDA 3GZNB 3NHSA 4CLOB 4BXOB 1YC5A 1UCFA 1W85B 2FN9A 4JZKA 4EG3A 5IT0A 1P1BA 2H18A 1HK7A 5H1YA 1JG2A 4IIEA 4V0SA 3MRXA 2CHUA 3WAJA 2IHTA 3C41J 2JLXA 4NH4A 2QI9C 1JIJA 1JSCA 3AT1A 1SXPA 3T3MB 3FZEA 4LF7B 4B7CA 4E15A 1Z06A 5KJ6A 3IS3A 3GT3A 3RSQA 2PL1A 4TVBA 3X1KA 4AZSA 2G5PA 1YACA 3JQ7B 4KRGA 2FW0A 5COAA 4ZO8A 1UBNA 3W1EA 1OGIA 4NK4A 1RWXA 3IKJA 2GBGA 3SYNA 4PYIA 3GK3A 4RZ2A 1OSNA 1CUFA 1E4EA 1KH3A 2O1SA 2HTEA 3EDMA 4RVFA 2NU8A 5ICMA 4DY4A 1O97D 3ET5A 2IZ0A 2I7XA 4YAWA 4YO7A 1S9DA 3W77A 3ZS8A 5BO5A 4V03A 4CMEC 621PA 2FFRA 4ER7A 5I01A 5L4SA 1X8KA 4Y2UA 4XD7A 5KIAA 1NBIA 3OUTA 4LYJA 3O8CA 1EFVB 4JA2A 1WJGA 4WCFA 1E0DA 1IXYA 4E6EA 3F6RA 4JUBA 5AJHA 1VJ5A 4HX5A 3KOXA 2NYUA 4R7ZA 2UZ1B 5DGCA 5HVNA 4BFUA 3A9CA 1UANA 1SA0A 2JAUA 3ROFA 4FYKA 1E1CA 5KKCA 1I0LA 3W8DA 5HKOA 3R3SA 1JG7A 4OQXA 4Q3DA 3LGXA 1Y82A 2J9RA 2WP0A 1XPJA 3K9BA 3ZLTA 4CDNA 1B3RA 2Q6VA 4GW3A 3IGFA 4F3CA 2L18A 1TGYA 1ZS9A 1IG0A 2B1JA 1ONOA 4PFKA 5FI1B 5BWNA 4ZVTA 3VYSB 5KTTA 1N1EA 3LKDA 2BHLA 4CM8B 4MP3A 3RK0A 1CV2A 5J4YA 2ZR7A 1HT3A 2XODA 1ZD8A 4Y1GA 3RRFA 3IIIA 4MQFA 1PAUA 1PQYA 3ZU3A 1NM5C 2E4XA 2YWCA 1OILA 5LZ7A 3TLAA 4QDOA 2PR7A 2RKBA 2NP7A 1M34B 1BSVA 2H4ZA 3L8DA 4WSOA 4X45A 3PB3A 4DV5B 5DNVA 3NDJA 2AUTA 1LZKA 4ESHA 3GLIE 5AM3A 1E9FA 1DFHA 3LYHA 2Q6KA 1ISIA 1WCWA 2W6ZA 1C4KA 3DEFA 3DQZA 3CQ9A 3GU3A 2ZE7A 2PS0A 1Q20A 3BWVA 3CPJB 4OHXA 4PG6A 4YONB 4B74A 1NFRA 2CNLA 3AG6A 2VQSA 4ZVSA 5HCIA 3UW3A 2JAPA 3EZGA 4N5LA 5T8KC 3NP7A 5ICSA 1JLLB 4IX9A 1WF6A 3ANSA 4Z9YA 1PT9A 1PJ3A 2ZSJA 1IUNA 4PRKA 4AF8A 4YRNA 3U6BA 1V8BA 3ITDA 3JQGA 4TSRA 3ZV7A 4BLQA 4D44A 4K8OA 4TS9A 3R0VA 4GX2A 4IHJA 1WU8A 1K6JA 2RKWA 3KXIA 3P0HA 3KQWA 4J43A 3PLNA 3QVKA 3TRHA 2I1VB 4JI0B 1CFZA 3PFCA 1JU4A 3CN7A 2R48A 4YMHA 3ENNA 2GBLA 1TX4B 1YIDA 1YQWA 1W2WB 3JS5A 4FZ5A 2OD7A 2P2CA 5AKLA 3WGYA 4QLBA 4HNTA 5J58A 2AC2A 3ESBA 3DZ8A 3H2IA 2G77B 2UUBB 1MQAA 3ZZ1A 4LKOA 2BMVA 1UFVA 1OFIA 1GDHA 2I6FA 2YV2A 1C8LA 1ELOA 1O89A 2KLHA 3ABSB 3RU7A 1VMEA 2ZJOA 3TLMA 1BRTA 4D96A 4D02A 1Y6JA 3LV8A 5K01A 3P9NA 2CXHA 1XRPA 1P9RA 1SXHA 5GV8A 4F4FA 1UBGA 1BMFA 2QP4A 4TOIA 2BKVA 2CW5A 1DG1G 2YN4A 3RNOA 4QOGA 1KAEA 3M6WA 4OY3A 2ZRQA 2WVHA 5BR8B 4Y6SA 3SF0A 4CG3A 1VHLA 1TPZA 5LNK6 2PM8A 3DP7A 1KAHA 3PQFA 3WGNA 5DNYB 4NOKA 3AH8A 1XJ0A 1NN5A 1WBBA 5LL6P 3DBRB 3IX7A 5PNTA 4FGKA 4MINA 1DV1A 4JGBA 5E8RA 2J3QA 2ODTX 2X14A 1G8YA 2JGDB 3BWEA 3AYXB 3FFXA 3QPCA 3R0QA 1XVTA 4JFAA 1G42A 1LNQA 3NEAA 3MWKA 4UQPA 3WNZA 5ELLA 2NZ2A 1QORA 5CW2A 4C2BA 1NZDA 1IEXA 1U5BB 2PAAA 4LYYA 3TW4A 1FUEA 2QMOA 3G0GA 1X3SA 4MVCA 1MAAA 1FLDA 1OKKD 4FEGA 4PYLA 4MQUA 3EGXA 4DYDA 5KQMA 1HFWA 2C77A 2BZSA 1UMKA 2ATCA 2JEYA 3GUHA 1DKQA 4FFWA 5DSZA 1M6NA 2CB9A 2R4UA 4WGGA 2R44A 4Q9JA 3ZQUA 4B6EA 2NG1A 2OHOA 3K2IA 3WK8A 3VU9A 1VKZA 4MR7B 1VBKA 1Q74A 1AN9A 1G8AA 2O2HA 3LPCA 4WLUA 2OENG 4WFKA 3GAFA 2GNOA 1WZCA 1LTKA 2AVNA 4Z8XA 3K15A 3LQKA 4A8JA 4LOLA 2BKUA 2JD2A 1H93A 4R6WA 3C6MA 3CX8A 3C7CB 1ZMXA 4H4DA 2ZJBA 5A5GA 3RD5A 1HMPA 4CGYA 2WQ7A 4MZDA 3DPUA 1JDTA 1SBYA 3IP6A 2BE7A 1OXMA 2ZI7A 4HTAA 3IUSA 1DT3A 4L22A 2QBYA 2SBTA 4KIGA 4PR0A 2GLTA 5JSYA 2E4ZA 2I4LA 1FA9A 4XFJA 1EX1A 1KZYC 3OPNA 4P0PB 3OQVA 2E4VA 2FQWA 4LXTA 2EERA 1X39A 4NABA 4IYJA 2H11A 4UHJA 4WLOA 4Y2SA 1P1FA 4MRRA 4UJ5A 5A5EA 2Z1NA 1CWUA 3K6RA 2VTDA 5EFOA 1IL0A 1XZQA 1YMVA 3A7EA 3QK7A 4M7WA 2GJ4A 4FCVA 1JKFA 5CVEA 1M67A 2IYRA 3QUSA 3GROA 1LCIA 4IO1A 2J3EA 4TXLA 1N3IA 1SC6A 1TD9A 1VIYA 4G4GA 3OJOA 5AXDA 1ADCA 2JFWA 1F38A 4AP5A 2VLIA 3L04A 5L3ZA 2PT6A 2PMCA 2GEJA 4KLRA 3D4NA 3RG2A 3UGTA 4HAVA 1FP4B 4A16A 5DBHX 3LBIA 1NPYA 4V0LA 1JQJC 1EFLA 1L6RA 3A6ZA 4GR4A 4UCFA 5DNDA 3ZH2A 4DS3A 2HUPA 5DBOA 2R7AA 3LF1A 5FR2A 2PH5A 2W6JD 3HVHA 3PJFA 3VNUA 2DFVA 3ZV5A 4EBBA 2P0EA 4EPVA 1PZXA 1L5WA 1XZNA 4IRMA 3OCUA 1MA0A 5GZ1A 4DKJA 4DCTA 2I78A 4I2VA 1WV0A 2VZLA 4UNSA 2ZVJA 3JYOA 3VV2A 4DT1A 2CK3D 4TROA 4JBNA 1QAMA 4HQ6A 4POAA 1EESA 4MAAA 3VR6A 3H5NA 3RVBA 3UAVA 5EIHA 1UT6A 1XLTC 1SHTX 2V7GA 1I3CA 2EYQA 3MERA 1E2NA 2YWFA 5DW0A 1I3KA 4ZAYA 1SUIA 2AMVA 3TLCA 4A2QA 1U98A 3IMCA 4LJRA 1P4RA 3PDCA 1H66A 5E6SB 4DDKA 3LXRA 4R5MA 5CB4B 1KMHA 4M22A 1MG5A 4BNGA 1IEQA 3A1FA 2WKRA 1JDUA 3H5TA 4CU2A 2WWVD 5EERA 4KXLA 4HEA6 3COPA 4BCCA 5L8VA 3NV7A 1KYZA 5K3SA 5HNKA 1VG9B 3IBCA 5FORA 4LK2A 5KSYA 1E64A 4CE6A 1JV2B 3MIIA 1ZC4A 3MRTA 4LJ6A 2QRLA 4PHTA 4ZQIA 4KAFA 3T5GA 3FZQA 4MQ6A 2VP9A 1GR0A 3PC8C 4DIFA 3ON5A 3AVXA 4CEIA 4HMQA 2ZUBA 5CK5A 5BV8A 4TV8B 1B0PA 3IAEA 1HLPA 2AJCA 3RV4A 3RAJA 3G7SA 5HWSA 1ZK1A 4R31A 1DTWB 1UF9A 2A58A 4QHTA 4JBWA 2BR4A 4N18A 3U40A 3R7DA 3D3EA 3CIOA 3G17A 5ECGC 3UV3A 5KQLA 1OAKA 1BHQ1 1SVUA 1B3BA 1GYPA 2UUPA 1TM4E 4NEQA 4WBSA 3ZCTA 2L69A 1ADFA 2H59A 1IB0A 1MEJA 3ZI0A 1U65A 3DO5A 5DULA 4HQKA 3RFCA 4ZGWA 1FQOA 1GPLA 1SR8A 3N0WA 3QFSA 1KO7A 3KWLA 4LXIA 1JLRA 4FNAA 4H3HB 4R2LA 4R8SA 1NUUA 3KSRA 2AQKA 3REQB 4E2YA 4B6OA 5CDYA 2IXTA 1R8YA 1IHUA 3KQSA 1EXWA 3O4HA 3GFOA 3BCUA 1EQ2A 2VC2B 4M9UA 4OXRA 3PCXA 4RBNA 3F9RA 3HP1A 1GT91 4OXIA 5ENVA 4LIPD 4K9NA 2HJ9A 4F38A 4RS3A 2QE7D 2GJ9A 3U5ZB 1G64A 4L6IA 4G0NA 5F3RA 3VJLA 4OATA 3TSOA 4DPKA 1UC5B 1FJHA 2YVQA 5EP1A 1DEOA 4JH0A 4HXYA 4QZVA 2Y68A 3AUKA 3N7UA 1KZ6A 4BV8A 1EIZA 2VUSA 4XM1A 3OZAA 4B8WA 4ZYTA 2O7RA 1JILA 2WWYA 2I03A 2O05A 5DCUA 3HCPA 1V25A 1ZVKA 1CU1A 3O74A 3Q98A 2DB3A 3S70A 1SU7A 1WQ1R 2OFXA 2BEKA 4TT8A 2OG2A 3JQBC 4US2R 3RSZA 4M1TA 1EI9A 2HBZA 5JNLA 1RM5A 3MGGA 2W2MA 3ZZMA 3EISA 3HBMA 1LRKA 2A3NA 4RTLA 4KQIA 4R8MA 3PGVA 2XMRA 3SQMA 3NBXX 5LOVA 3C7TA 1YRYE 1P5RA 4P31A 4XPIB 3KEMA 1JHZA 2Q1SA 3CS3A 4ZAXA 1E77A 3HDGA 3PQ5A 2CLSA 3MS4A 5FHRA 1VJCA 3C3DA 3CF4G 5HJEA 3LUPA 1RQGA 4B3HA 2ZI4A 4OUDB 1K6XA 3G13A 1A04A 4LX0A 5FJIA 1E5VA 3SS9X 1KMNA 4KU4A 3UJ6A 4ZI7A 4UEKA 1GFIA 1XRRA 5LCXA 2QLTA 4DYHA 1LFDB 4EUNA 3EVDA 4B3JA 2OHIA 5J1TB 3L7DA 1AXRA 4EKYA 2HX1A 4J8PA 2EFYA 1TJPB 1K7FB 4H7EA 1P4GA 2ESRA 3QNWA 4FYXA 2Q5IA 5IYZF 4EJSC 2WYWA 3TTVA 2ZB4A 4CNBA 1KK3A 2HLDA 1UBMS 2R60A 4UTXA 4GPAA 1BW9B 3LM8A 4LWZA 1TVMA 4AMBA 4PG8A 2CNWA 1U94A 3HVJA 3TM5A 4IXNA 3S0JA 1HOTA 4OP2A 1G41A 3KD2A 3N2YA 4MS3B 4G56A 1WW2A 2G7ZA 1CETA 1TMOA 3DLPX 2Y0DA 4KACA 4KYVA 1NYTA 3EZ7A 3PC2A 1P0PA 4CMJA 2VRCA 4MMYB 5ILQA 3G0DA 3U1BA 3WICA 3KZNA 5B3KA 2B9EA 2IITA 4M8IA 4D82A 3GLIA 1A9PA 2FF5A 2FSPA 2ID8A 1DUSA 2NNLD 2P3OA 3INTA 5DNWA 3N39C 3EEIA 4R2WA 3STHA 2C5EA 4BFWA 4EDFA 2VQEB 2DWCA 3NCHA 1BXRB 2V7EA 2NW6A 3Q7SA 4D74A 4HDKB 4J2TA 2MYNA 3DE4X 1G6Q1 2B7CA 5ES3A 5K8TA 3ZXIA 2B69A 2VOEA 1RJWA 2Q0SA 4EA6A 9ATCA 4GOXA 5T3YA 1U0LA 5KOHA 2R7KA 4WY2A 3BJIC 3PD7A 4CZ2A 2I2WA 3HC7A 1KC1A 3WVNA 1RQPA 4JODA 2XB4A 1IN5A 4RSHA 1PR6A 2NTEA 3IMKA 1GNRA 1Z5VA 3DMFA 3G9ZA 1A98A 3UZUA 2C7OA 4N41A 5GJBA 3GBVA 3KOUA 3FTCA 4Y2TA 5AKGA 4E88A 4EYGA 3FB1A 4Q3OA 4P7JA 3RHTA 2ERXA 3SXJA 1ZUWA 4K3UA 3SWWA 3A1VA 4W7IA 4WXYB 1NOKA 2Z2ZA 3DDNA 1CERA 3TR6A 2PKYX 2R1TB 1WKVA 1TTPB 3ZZTA 4C4OA 3RUIA 2VO1A 4RHFA 3DFUA 1M8GA 4L95C 1XYVA 2DBVO 5LWQA 5IJZA 2J45A 3DQPA 2R65A 4G5GA 1DC8A 1PVVA 2HCJB 2QVGA 4K6MA 3V9PA 2E85A 1JA1A 3OBIA 4O2RA 1QC5A 2O07A 4II3A 2GERA 3BXGA 4LECA 1XKXA 5IUNC 4YYEA 2CUKA 3GDWA 4OH1A 1WD7A 4JJ6A 5A4MS 4Y0NA 4NARA 2GEKA 2O7QA 1B0AA 3WIVA 3EBLA 5EEHA 4UNIA 3DFKA 2XDWA 2CFOA 3D0RA 5JS2A 5FLYA 4YT5A 4IHAA 4RACA 3G8BA 2GWHA 3LT0A 4N47A 3VH2A 4J4BA 3H5WA 4AY2A 4L9WA 4I19A 2GESA 2RGEA 2HJWA 4XA8A 3W2FA 3K92A 2JFGA 2REXB 4CDRA 1H4SA 5ENZA 1LH0A 1NMZA 3I6ZA 4A15A 4RNDB 3THWB 2QDXA 3OM8A 3HUUA 2W2XA 2YINC 5I8ZA 3V8PA 3VMFA 4EHNA 1LV8A 2XZDA 1CY7A 5FNZA 1IWPB 4AWAA 4BOYA 4YC7A 3BG5A 3F5DA 1PWZA 3N75A 2BFEA 2IGBA 5CAEA 4RDIA 4WAUA 3PQ6A 3DFZA 3I2HA 3H2ZA 5CP8A 2BH2A 3HVUA 4B7XA 3UENA 2Z5VA 5IJXA 2NO1A 5FYQA 1BD3A 1P1RA 3JVVA 4RY9A 2Q3EA 5IP5A 3PDJA 1OFHA 1OBFO 3GXBA 1NN1A 3AXTA 5DRYA 5TVGA 3TZ6A 5EOVA 1ZUIA 1B8PA 3JQCA 2PX0A 1C2YA 2E0IA 2XRFA 4Q1BA 1CY0A 4DRXA 1F20A 4CCAA 3FPFA 1RW4A 3ZWMA 4QT4A 3JSAA 1I2AA 2COUA 2VP5A 3B89A 4N5HX 5T57A 1JYFA 1R8SA 1H2HA 2C07A 4BEJA 3BZWA 1ODCA 5F2KA 4MVJI 2Y1XA 3CE6A 3QNUA 4RENA 2GZSA 4NQZA 5HF5A 3U5TA 2HQSA 3RROA 1F6WA 3GQVA 3V7NA 3VR2D 4DCGA 3K0FB 4URWR 3O2JA 3ZK7A 4KQ6A 3I4CA 4I66A 2CE2X 2JFFA 4HAXA 1NP6A 1GAWA 4AKTA 3IPCA 4CIDA 2JGRA 1CUVA 2XB9A 5LQAA 3SYKA 1QMGA 1YD7A 5DI3B 1CQPA 2Y0PA 3E18A 1ULSA 3QRWA 3BRQA 4YRJA 5HK8A 1SZCA 4EHHA 4F8YA 4FYWA 3DWEX 3LD9A 4ZZIA 4CDMA 5TS3A 3CSDA 1JIKA 1Q7CA 5FWDA 4J3NA 3I72A 2IHYA 4D3XA 4LE1A 3TGLA 1KI8A 2ZQ5A 2Q5JA 3L49A 2GAOA 4ARBA 3LQ1A 5EPOA 1VL5A 2IX9A 3B48A 3BWBA 1K75A 4QSMA 3OX3A 2Y8EA 1IDOA 2UYOA 5IH7A 2E21A 3Q8LA 5JNVA 4KWTA 4OKNA 4HAUA 3F96A 2PZEA 3ITNA 4IH1A 4UDYX 1HORA 4OIFA 1XNRB 4R16A 3KYDA 3CLHA 1U0BB 1VE5A 5K0TA 3PQDA 4NR0A 1CJKC 2NZVG 3BSYA 5EP2A 4ZAGA 3QBVA 5ESRA 2P4UA 3BIJA 3C5VA 3EIXA 4P32A 4TYPA 4MIOA 4TKVB 3PSAA 5CVJA 2YR0A 1W0KA 3BZBA 2FKNA 3M2PA 3NDBB 1ATZA 221PA 1OWLA 5G1NA 4UTVA 3HA7A 2XRZA 3FPCA 1HGXA 2ZXUA 4POOA 1R88A 1SQ6A 3C5CA 4C0QC 5F23A 1NAIA 2AK3A 2VK8A 5EXTA 2HXGA 4KPUB 2ZYTX 1TGVA 1XZLA 3M8KA 1GCGA 1WUJS 3KPUA 3KSAC 1Q50A 2D2VA 3JRWA 3SCZA 4AG3A 4HEQA 4CM1A 1XRQA 5ULLA 3D59A 4WE3A 4ZVOA 1PGNA 3TR0A 3ZDZB 3Q2OA 3ZY4A 2EKBA 1LW6E 1LK5A 3Q0IA 2P67A 1ESCA 2MHCA 2GN9A 2ATIA 3GRVA 3WGHA 2OSVA 3FOEC 2J9YB 1HNWB 5JTTA 5IKOA 1I13A 1SO8A 1E5LA 2BGWA 2ZWAA 3REFA 4DA6A 3USES 2ZAGA 4EARA 1TM3E 5A5FA 4F6LA 4G24A 2GZRA 3P97A 2HY7A 2PFKA 3R5SA 4U39A 2P30A 2JAWA 5CGZA 4D8WA 4Q6BA 1Y7TA 3PHCA 3G5AA 3KFVA 3SJAA 3DOHA 4CMCA 5B1HA 2OAEA 3IP5A 1MC5A 3SMQA 4ER3A 2O8BB 3E4DA 2IHZA 2XCUA 2NV2B 4JJAA 2GYWA 2KHZA 5EMHA 2XUQA 3DOUA 3SSAA 4M9SA 4ZOBA 4IZOA 4AJ9A 1WXIA 2Q2OA 4EI9A 5HSGA 4LXHA 3BRSA 4IWXA 3ZWQA 1SHKA 3VR5H 1ZNQO 3SJBA 1BD4A 3V4VB 3WHLA 7GPBA 4MULA 1N9GB 1Z83A 2CD9A 4M83A 3CNOA 2V8OA 3NNNA 3ZHZA 2IK8A 4HDSB 3D6AA 2Z04A 4GPD1 2PLFA 4MIKA 5MFPA 4IEFB 1TAHA 3PXXA 2JJQA 2ZB3A 3JY6A 1B1AA 2EWMA 3GEGA 2QVBA 5IBQA 1H4TA 1NXOA 1RWOA 3U56A 2QN7A 2VWPA 1QRUA 1M2KA 2PGDA 4EW1A 1Q2XA 1KEEA 3MCUA 3A1CA 4IW3B 4RL6A 4FFSA 4CKYA 2IEYA 1DCFA 4P5DA 1E0KA 1XYYA 5I7FA 4R2IA 1ZJ6A 5HDBB 2I3DA 2R5WA 1NX6A 2XW6A 3NM5A 3ZTWA 7REQA 5D6OA 5LD2C 1MTOA 4G1FA 1O08A 2OE2A 3UKOA 1V5GA 4RETA 4D3DA 4EA9A 4CKCA 2NYAA 2Y93A 1SUFA 4G5XA 4MW7A 3NORA 3FYSA 4L9RA 5DJ5A 3RS0A 1Y4ZA 3LAWA 2AN5A 3FZNA 4PHHA 2FPOA 3AETA 4I4TF 3A3NA 5DX0A 4HUTA 3MAJA 4RHYA 4CETA 5K9ZA 4YMUA 1GARA 3FBGA 3CH4B 2PX6A 3N59A 5DCLA 2F7SA 3FCEA 4BO4A 3HNPA 4REQB 4WZ6A 1GPAA 1Q12A 2IRWA 1II0A 3HHEA 3NC0C 3WNBA 1K7YA 1GN8A 4ZXPA 3U7RA 3B52X 5HTOA 3LY8A 3W05A 1Q0SA 3RU3A 3IVAA 1YZVA 3L0DA 2HDNB 2RHCA 1U1DA 4BPRA 3NBAA 1JT9A 3KRTA 3ZXSA 1YS6A 1G66A 3DS8A 3G68A 1UBUS 1CF2O 3C87A 4MLPA 4BTEA 4DB4A 1SU8A 1AS3A 4MCIA 4MPTA 1WUKS 4YP5A 2P2DA 3QFFA 2NZYA 2VKTA 1SELA 3C1TA 3QA3E 1C3OA 4MR9B 3M83A 1YCDA 3TS1A 3E84A 4ZO4A 1V1MB 5AMXA 5JUWA 3QPUA 2PT7A 1GXSA 4LPKA 3OQIA 3RFUA 3FJ1A 1WKBA 3OE1A 3TEMA 1M2GA 5KNDA 1J5EB 4ZEMA 4K3VA 3UC9A 5KNBH 2G6TA 2SECE 3F6EX 4DA8A 1L4FA 2QTWB 5BMOA 1CBUA 4FYYA 1RPZA 1KETA 4O3MA 5KJFA 2NZJA 4MSUA 2EATA 1NVUQ 4GXTA 1UMDA 2OBXA 1TQ2A 3MCZA 2EX0A 2O2YA 3NEJA 2ZIZA 3NFRA 5KMGB 3BDVA 5AI5A 5IVDA 4HVAA 1RC0A 4US0R 2OZEA 5G2OA 4M0DA 2REBA 1EUCB 2YJ5A 1N6RA 1SVIA 2WHPB 4D4IA 5JAHA 5KVAA 3S28A 4MHTA 1A8HA 1O77A 5D7NA 3DCIA 1JEYB 4YALA 1VPTA 3PEEA 2YNMC 1NKVA 1N7IA 1N75A 4HYQA 4PZLA 3EG9A 1UBLS 3I6QA 3BJMA 2FQXA 3OUUA 1KK2A 3T7JA 4R2JA 2C58A 3FROA 1KOFA 3AEZA 1H9AA 1DIOB 1GQSA 1UAYA 4P7GA 5IAAA 1VL6A 2OCBA 2ZT6A 5FWXB 1N5JA 1T3LA 4AKEA 3UK1A 1HE1C 2BN4A 4P3XA 4IV5A 3MMXA 4YCLA 4A8TA 2NO0A 5FBQB 5D3QA 7MDHA 3C43A 1OBCA 1WL8A 2PMWB 4L51A 3RF6A 3LDAA 3TB4A 3FCYA 3WRYC 3CE9A 4FR2A 5SZHB 3SZOA 4O5AA 5MGBA 1ZXLA 4F3KA 1KI6B 1SBHA 1D2GA 2JCBA 2ODQA 4NG4A 5FOXA 5GOZA 4LJAA 5EHNA 1TYAE 3UXYA 5JROA 2QQ5A 3E5NA 1U6KA 4KP7A 3B3FA 2PUJA 4N5IX 3LC7O 4G1UC 4QJ5A 1QFXA 1HH4A 2WLTA 3AR4A 4G0PA 2NU7A 1QH9A 4D3FA 3O26A 3Q7PA 4D9NA 8OHMA 2FZKA 4PLFA 2VDUE 3UWPA 4B4UA 2PYZA 5IYZA 3K16A 2J9FB 3DW3X 3HKBB 3CXRA 5B30A 4DM4A 3Q3JB 1FDSA 1XF9A 1JFLA 2GBPA 3T1QA 1XZ8A 4ZTZB 2OCIA 3SXUB 4CVNA 4DZTA 3HU5A 4HDAA 3AM4A 1U3FA 2LDBA 3A6HA 4LAFA 2L17A 1R4NA 1ZH6A 1DC3A