4BNDB

Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
253
structure length
253
Chain Sequence
AMKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKYDQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALEKAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLASQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYPVVQMGIETITVRDWKETAAILKAIIAMEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords ALPHA-PHOSPHOGLUCOMUTASE
publication title High-Resolution Structure of an Atypical [Alpha]-Phosphoglucomutase Related to Eukaryotic Phosphomannomutases
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
total genus 91
structure length 253
sequence length 253
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4bndB02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4bndB01
4G9BA 2HEGA 3IJ5A 3ZWKA 1L7PA 5ALQA 2HOQA 1VFPA 1Z4IA 1ZD2P 4BKMA 2FUCA 2GHQA 1AQ6A 2CN1A 1RC8A 4RETA 3VAYA 2B30A 2PKEA 3R09A 4Y2YA 2WF6A 1RQLA 4AS3A 4QJBA 4KN8A 2QLTA 1Z4NA 1Z4QA 1QQ5A 2B8JA 3UMCA 3AR6A 3CNHA 5AK4A 4Y2JA 3WGVA 3MPOA 1NRWA 5AKIA 3WK9A 5AW5A 1U7PA 3QX7A 2OM6A 4GIBA 2G07A 5AVYA 2NO5A 3M1YA 2G0AA 3FZQA 5AM2A 3N1UA 5AW4A 3B9BA 3I76A 4Y2PA 5AI0A 4FFDA 3L0BA 3QYPA 3IB6A 2NYVA 3KC2A 4HGRA 3ZU6A 5FP0A 3OPXA 3W5CA 2MSNA 2YFYA 4BX2A 4UM5A 1ZD3A 3SF0A 5ALZA 3I28A 3NRJA 3TLMA 2AH5A 1T9ZA 4NABA 5E0OA 3PGLA 3OCXA 2DQSA 2C8KA 3HYCA 2JAUA 2R8EA 3QU4A 4Y2UA 4KNWA 4Y3UA 3R4CA 3WKAA 2IOFA 3K1ZA 3WKDA 1Z4JA 5AW9A 4C4RA 5IT0A 1U02A 3U7GA 1Z4LA 3W5AA 3OTQA 5AI9A 4CF4A 2O2XA 3SMVA 1QQ7A 4Y2RA 3PDWA 2JARA 1TE2A 2ZBEA 2WF9A 5AHXA 5A3QA 3R9KA 2ZBDA 3L1VA 2HHLA 2GFHA 3ZUPA 4C4TA 4F71A 3FPSA 1VJ5A 2R8YA 3E58A 4NFLA 2R8XA 3AR3A 5T41A 4Y2TA 5AK3A 3KDPA 4UMDA 5AW2A 2GHTA 4O8CA 1TJ5A 3L8GA 4AP9A 1Z5GA 5AVRA 1RMQA 2AMYA 4AS2A 4IFTA 1U2SA 3OCUA 4UMFA 2HDOA 3OCYA 1SWWA 2FPRA 3ZVNA 5AVXA 2G08A 3S6JA 5ALOA 4YGYA 2WF8A 1L7NA 1ZRNA 2HF2A 3J7TA 4Y2XA 3A3YA 5AKKA 2BDUA 2P9JA 2PQ0A 2IYEA 5ALJA 1J97A 4EX7A 2Q5EA 4E88A 3U19A 2YJ6A 4NV0A 1RLMA 1RMTA 2FDRA 3FGOA 3ZX4A 3UM9A 3ESQA 1EK1A 2FPSA 5AKXA 3OCVA 3WKCA 5AK5A 4BX0A 4UMEA 3ET5A 2P69A 4J03A 5ALWA 1S8OA 2RARA 3ZVMA 3U7EB 2ZG6A 1U7OA 4BEVA 3RF6A 1YDFA 4NWIA 5AM5A 4BX3A 4B6JA 1U2TA 2ODAA 3BA6A 1IWOA 3AR8A 5AKHA 4ZEXA 2JAOA 2YN4A 4BEWA 3NALA 1YNSA 2YMQA 4EX6A 3SKXA 2RB5A 2QYHA 5AKGA 1TA0A 1KYTA 2AGVA 2R8ZA 1Z4MA 5ALLA 5ALYA 2W4MA 1JUDA 2OYCA 3U13A 2P27A 4EZEA 2IOFK 2MU1A 3L5KA 3EPRA 4YH1A 4ZEVA 4UW9A 5A3RA 1WPGA 3N8GA 4UU1A 3ZWDA 4YIKA 2G80A 4L57A 3N28A 2HSZA 4GXTA 2Q4TA 5AESA 1WR8A 2ZBGA 4CNQA 3L0CA 5ALMA 1CQZA 5AKZA 3L8EA 1NNLA 1RMYA 3L0YA 5ALRA 5AVQA 4YCLA 3I1YA 1Z5UA 2YY6A 4QQFA 2B82A 2PR7A 2W11A 4XPZA 3SD7A 3UMGA 5AW0A 3F9RA 1S2OA 1EK2A 4XOUA 4EENA 3NAMA 2FPWA 3L8FA 2C4NA 2B0CA 5AI5A 2HF7A 1N9KA 3A1DA 1Z88A 3DAOA 1ZOLA 4OHFA 5AVUA 4JDPA 4JB3A 3PCTA 4UATA 4DCCA 3W5DA 3AR5A 2EATA 3M9LA 1WVIA 5AKEA 4F72A 2FUEA 1YMQA 1Z4PX 2GMWA 2I33A 4DWOA 2C8LA 3ONNA 5JJBA 3L7YA 3MC1A 2HI0A 5AKLA 2G1AA 1QQ6A 1T5TA 5ALGA 2FEAA 5AW6A 1WZCA 3QUBA 3WKEA 4UU0A 4HGPA 3DV9A 3QNMA 2OA0A 1LTQA 2FPUA 2P11A 1FEZA 3MN1A 4FE3A 2X4DA 3ZI4A 3WK7A 4CF5A 5ALPA 2RAVA 5AM1A 1J8DA 2RBKA 3E84A 4UARA 3UMBA 3IRUA 3QUQA 3U7FB 4L6AA 4CF3A 2B8EA 2CFSA 3BWVA 1RKVA 1CR6A 2WHEA 1ZRMA 5AKJA 1RLOA 2I54A 3DNPA 5AW3A 1L8OA 2YMLA 2YJ3A 4I9GA 5IS2A 4UMVA 3W5BA 2CFTA 3E8MA 5AW7A 5AIBA 1ZD5A 3U26A 3P96A 4J2TA 5ALVA 1QH9A 5AI4A 4UM7A 3QUCA 4OCZA 4YIHA 1Z4KA 3NIWA 1O08A 5ALKA 3RFUA 4Y2QA 2VKQA 2BY4A 3QU5A 5ALXA 4UAUA 3B8EA 4HGQA 3OCZA 1VJRA 3QU9A 4BBJA 2HX1A 3FM9A 1RKUA 1Y8AA 3DDHA 5AKYA 5AVTA 2HO4A 4G63A 1PW5A 1ZD4A 2D2VA 3ZVLA 5ALSA 3QGMA 2YBDA 4FYPA 4ZEWA 1RQNA 1O03A 4Y2SA 3AR4A 3WK4A 2W43A 5AW1A 5AM0A 3WK8A 4CE6A 5AVWA 3A1EA 2EAUA 3B9RA 3FVVA 4Y2VA 1YV9A 4YCNA 1Z4OA 1TJ3A 5AVVA 3L1UA 3N5KA 3FPBA 4DFDA 4UAVA 2AUTA 5ALTA 4HYTA 1L7OA 3NANA 4EELA 3L8HA 2NO4A 2YMMA 2IOHA 1F5SA 1SWVA 4BYGA 4C4SA 2I55A 2HCFA 2B1RA 1N8NA 1X42A 1ZJJA 2JGAA 2O9JA 5AICA 2BDEA 3OCWA 3GYGA 5AI8A 3I6BA 3U7HB 3SLRA 5AW8A 1XVIA 1RLTA 3ZW7A 4MUMA 5ALDA 4HGNA 2FPXA 1RPZA 2JAWA 5ALFA 2FI1A 2G09A 3KOOA 2B1QA 3EWIA 3ED5A 5A3SA 2CFRA 4KX5A 3A1CA 2I6XA 2YMPA 4IG4A 3E81A 5ALIA 2YJ5A 2I34A 5AK6A 1T5SA 4EEKA 2C9MA 4DW8A 1ZS9A 3ZTYA 1LVHA 2ZXEA 3D6JA 1XPJA 5AM4A 3QU2A 3SHQA 4NAVA 4OD0A 4H1WA 2WM8A 1SU4A 4BNDB 1TJ4A 3KBBA 3KD3A 5IT4A 1RRCA 3ZTWA 4OFZA 3N07A 1YS9A 1L7MA 1RDFA 4I9FA 4KNVA 5ALUA 2GO7A 3AR9A 5AVSA 3EF1A 2I7DA 2ZBFA 1NF2A 5AM3A 4KYTA 2YJ4A 3WGUA 3NUQA 3ZX5A 2IA5A 4PNHA 3PGVA 2Q4RA 2WFAA 3NASA 4XE5A 1MH9A 4HAIA 1L6RA 4RESA 3WKBA 5AVZA 3SKYA 4BNDA 1RKQA 2C88A 3QUTA 3ET4A 4KX3A 2G06A 5ALNA 3WK6A 4UASA 5AIAA 5ALHA 4MWOA 3QLEA 5AI6A 2WF7A 4L6CA 3WK5A 3EF0A 1L8LA 4YCMA 2EARA 4XQ0A 5ALEA 4HGOA 3HLTA 2OBBA 3AR2A 2WF5A 3KZXA 1QYIA 2ZOSA 3QXGA 1XP5A 3MMZA 1Q91A 3QU7A 3ESRA 3CZ4A 3AR7A 1K1EA 1Q92A 1YJ5A
chains in the Genus database with same CATH superfamily
2J6CA 1Q7CA 1DHTA 1DU4A 1UMBB 2BGJA 2CFCA 3EMVA 4RZUA 1GUAA 3UA4A 2GNAA 3NLLA 2QN9A 1WCV1 4Z3KA 3IP9A 2VS1A 4M0UA 5FWYA 4Q3LA 3G9QA 1PJLA 5JDCC 5FPKA 4GI2A 5K0EA 3OZBA 3RANA 1MA3A 4GGMX 3L07A 4DLWA 5JI2E 2Z2ZA 1GGMA 1N75A 1ZD2P 1E3SA 2C04A 2CZCA 4D43A 2P78A 2FUCA 1MKYA 1EWRA 1UXGA 2GHQA 3LWDA 4BZXA 3P97A 3KR2A 5NULA 2R8OA 3GRRA 4KVAA 1YFJA 2BUCA 1RC8A 3VAYA 4X1KB 5IU6A 2IPAB 4ZMBA 3IIKA 2WILA 3C4JA 3CRMA 4G8CA 4HQFA 5K4AA 3ZCSA 4CL3A 5BMVB 1N2CE 5G0WA 2GZSA 1X86B 2OY0A 4KN8A 1R0WA 4LBWA 2KBEA 5KTRA 4KEAA 3HNPA 2HRRA 3GBVA 4DCJA 2OESA 3MYRA 4LF5B 1L2TA 2YICA 4LGYA 4F4JA 3U1BA 1J8MF 2I6QA 1J0DA 1NXWA 3SC3A 1OZAA 3TKLA 2IJGX 2YVUA 5F73A 1BYUA 4H59A 2XYVA 2EERA 3T61A 5HJ7A 2X7JA 3W8RA 5HUQA 1WG8A 3MMPA 4HB2A 5JD4A 2AMFA 4IIXA 4MQEA 4IDCA 4FMPA 3JQ8A 2G9QA 4HS4A 2NU6A 3MTIA 4JJKA 3TINA 2V6IA 1X3SA 4ESHA 1U7HA 2XE6A 4DC9A 1YDEA 3C16C 4EB6A 3RIYA 2IHJA 3J81A 3H2IA 2JLYA 1A9XA 4WZBE 1H94A 2NTYC 4JLWA 4XIFA 1U6KA 5K3EA 4B2LA 1OPXA 2G88A 1ABFA 4OLHA 4BZQA 2IUEA 2WI8A 3P9IA 1KJNA 1XMSA 2DG2A 3CRZA 1WMEA 3WGIA 4J7CA 1JPJA 2OE2A 2AH5A 3CLUD 2HIMA 2YWXA 4ZDWA 4B3MB 3T3HA 5HS6A 1IZ7A 3UGKA 2TECE 2XYHA 3Q3CA 4KPFC 4PINA 2IZ0A 1L9XA 2ERYA 4QEZA 3CUWA 5C46F 4AJKA 5L51A 2ZPAA 1Y1PA 2YW2A 1KIMA 3P2JA 3WFZA 3DDCA 1GYPA 1OA1A 1X15A 3F5QA 2GXUA 1YCHA 2RIRA 3IP7A 4NQZA 2H1SA 4LA4A 1A71A 3BF7A 2R1UA 1K9SA 1Z56C 3AJRA 1JT9A 1ZIXA 3C74A 3X2SA 1WP4A 3ZKWA 1LBEA 1SUIA 2CXPA 1BHSA 4XR4A 3WQSB 3K0FB 1V96A 2AUNA 2GCPA 3HB9A 1NV9A 2WT9A 3IAM6 3K1TA 3H5TA 4QPCA 3PC8A 5DLPA 4BQPA 4HWGA 2XE4A 3V2IA 2WIBA 4R2XA 1QO0A 4IXWA 4OVKA 2P9HA 3C8ZA 1E77A 4CPDA 3CZAA 4LJKA 5GAJA 10MHA 4KWEA 1OBFO 3L1VA 4KLNA 1VKJA 4PRLA 5D1HA 1JG3A 1BMFA 2JJ8A 4U9HS 4ZOEA 2HA4A 2B9VA 3NVAA 1KMQA 4YFVA 5JMPA 2O48X 3DFMA 2BTEA 4GSYA 3WRWA 4PWZA 2CYBA 4Y2TA 1EE9A 1F20A 3A1VA 1DBSA 3DHEA 2EFCB 4HBGA 5AW2A 5BWNA 1KEKA 3ISJA 1FU8A 3ELUA 4E1BA 1Z5GA 3KKMA 4M1KA 1MEEA 2MWMA 1EXWA 2A8YA 2RHHA 3L49A 4IO0A 2HLHA 1HYQA 1V1MA 1A5SB 1YDGA 4MMYB 1WX1A 1BQ4A 5ER6A 1D1PA 1H2AS 2HV9A 3C6BA 4FYVA 3N70A 4PLTA 4AKGA 5DYYA 3S55A 3NHKA 5IFLA 2XYPA 3G3EA 3E53A 3BCRA 1RAEA 2PD6A 4PM4A 1CR4A 2ROQA 3KETA 5EIEA 4WOBA 1C3OB 3EK2A 1ISSA 1YS2X 3WHLA 5H0IA 2VZ0A 1BX3A 5IDXA 1JI3A 1QS0B 1S02A 5TT0A 3V55A 4AICA 1JR3D 3G9UA 2YDXA 1ISHA 2R62A 1R0XA 3G2IA 2DPLA 3V1TC 5B6PA 3RS7A 4CCAA 1Z0JA 3L79A 1T5BA 2DT8A 4G9GA 2WTNA 5KDDA 3OZDA 1P2VA 4MUYA 1X1TA 2IYYA 2ZR0A 1A2QA 2D1FA 2FDRA 4GMHA 3K2QA 2P9TA 4YCBA 5E7MA 3LLUA 1LS1A 2KS6A 4F6RB 4IQ0A 3AOGA 3HL4A 2EKPA 3ZK9A 2V7TA 3ZJVA 4UAJA 2ILVA 2AIRA 5I7OA 4GH5A 4CEHA 1XZQA 4PPYA 4N82A 4ZAWA 2NACA 3BMNA 5LLTA 1GAXA 5BW6B 3GLHB 1HQCA 5FUVA 4Q1DA 4DNOA 3CZCA 4PCUA 5JSYA 4EPVA 4BEVA 4C04A 4DBLC 1YDFA 3EA5A 3M1AA 1J2YA 1O89A 1QLHA 2XE7A 3JCZA 1I30A 1XVUA 2X3YA 3KBOA 3NM4A 4G1CA 4M1TA 2VTDA 5C8XA 2JH3A 4F12A 4IIHA 1YJXA 3OIDA 2W70A 1FFYA 3ZV5A 1DOHA 2Q6LA 5TQ2A 5DTRA 3K32A 5H7XA 3SLKA 5TIIA 1BCSB 2DBZA 3LWBA 3TIIA 2ZIXB 2WWVD 2QM3A 3K0AB 3CCCA 2ZJ7A 4JLMA 3BDAA 1YJ8A 2V3WA 2VNJA 4G1EB 3MTGA 1C7IA 2UYQA 2NSJA 3BFPA 1VMAA 1JR3E 1R10A 2BELA 3ROZA 3OM9A 3U7QB 2IW1A 3ZHBA 2BAGA 4FGUA 4I1YA 4TS1A 2ZI5A 2V6MA 5BP7A 1PNTA 2CVPA 1RPAA 2OZKA 4ZU1X 1OR8A 1QDUA 4JLDA 3RUEA 4ZEVA 1T9KA 2WUFA 1US8A 2ZBRA 4XYMA 3DEAA 5BQOA 5AHKA 4I55F 5KJCA 3I2GA 4MUEA 4YIKA 2HA2A 2O2YA 3PFHA 4X5OA 5D2CA 4GOXA 5DX0A 4ILEA 4P86A 2ZRBA 3H6GA 2FR0A 2PUWA 1QLJA 2ZB7A 3C85A 1EINA 2WTEA 1FFBA 1WTCA 2QTCA 4FCVA 4Q1FA 4H7EA 3PNVA 1MNQA 1SIUA 3L0YA 3KAKA 1QH8A 4AZVA 2PUVA 4LJYA 1ADGA 4U3JA 4YXWA 1G19A 1QRUA 2WYOA 1N0UA 2HPZA 4DJ5X 5IWAB 4YRIA 2O2SA 2I2WA 5JHHB 1SEVA 5KWVA 2B82A 2H29A 2PR7A 4TYWA 1JLRA 4HUQA 1EK2A 1FF9A 2BGMA 1AE1A 1X7XA 4D4IA 4F5ZA 2ZDHA 2ZIFA 4L8YA 3CVYA 2UDPA 4DXDA 2WUWE 2VSQA 2ZSEA 4BQSA 5HUHA 2Q2NA 2O5VA 2PA3A 3AO0B 4IHJA 4K9MA 2R2GA 5AHRA 3LF1A 4QRIA 5JZ9A 1PSWA 1MC4A 4BNMA 2UXDB 1PWHA 5IDYA 2H0AA 2XE8A 4Y6SA 1FXUA 1W88B 3MWDA 4PG5A 2HK8A 4BQIA 4FCTA 3L7YA 4WKCA 3P2OA 4NARA 1EZZA 1V3VA 2OGUA 1RPJA 5AKLA 3I05A 1N32B 4URHA 2K2WA 1D1QA 1XQ6A 1K7FB 5ICFA 3WLTA 3O4IA 5SZHB 4KQIA 3P27A 1WUJS 2GTIA 4R84A 3ZEAA 3RJTA 4FW8A 2ZSBA 3OIUA 1K68A 1PT6A 5EG5A 3SR4A 4OAPA 4X1YB 5A1TA 4C7KA 3OMLA 2ID4A 2IPLA 2VUIB 4AVYA 3TPFA 2Q7DA 2ANCA 2Z2KA 2ZUSA 1ZCAA 2X5JO 2GJSA 3TLKA 3HTXA 2NTEA 1ONSA 4QDTA 2ECKA 3RRFA 3GLQA 1CKEA 2P40A 1ZISA 3OJOA 5DTMA 3DWGA 1WXQA 3OC6A 4HAXA 3IRUA 3DO5A 2QK4A 4LSZA 3NFYA 4ND2A 5CG1A 2HMSA 2WMOB 3K94A 4X7PA 3W6OA 5BRAA 2FMKA 1T1JA 3K9QO 5JCZA 5JAHA 3K53A 5LM3A 5F2OA 2OLEA 2AJTA 1G0NA 1AGXA 2WKPA 3TCKA 3LC2O 1HH4A 2SECE 1XWFA 9ATCA 5JD5A 1TQ4A 4KMMA 3GEHA 2ZQYA 4J7UA 1JHRA 2CUTA 3RREA 3JZFA 3URKA 2WSBA 3LUBA 4D3SA 1GNSA 3W5BA 3AHIA 3A4YA 3U26A 5I4CA 1CUSA 1XEXA 2OB1A 4KH0A 1T6XA 4GEKA 5DYWA 2ZRNA 2MIIA 4FHGA 3KXKA 3PSAA 3N2KA 5COAA 1C9DB 5CFQA 4WERA 1EFPB 1Z4KA 2R8RA 4MYSA 1V1RA 1OLXA 5TQ0A 3ZWXA 4BCDA 1SOVA 4E32A 4EO7A 1E8NA 4WESB 3BULA 1KDYA 1Q50A 4GF5A 2I9PA 4FHDA 3I2JA 3PUWA 3CLTD 3H1PA 4COOA 1FDWA 3EEBA 4GQBA 3CF4A 5H80A 4ZKDA 3RYTC 4CFYA 4HNAA 3EPHA 3FNBA 3HCWA 1QV6A 3RTAA 1VJCA 4KK4A 1ZMTA 3PUHA 5CURA 4U4AA 1B0ZA 1FYXA 1EUDB 5A5DA 2A14A 1CJMA 2C0QA 2VK4A 3GLIA 4UHKA 2A7XA 4YP6A 3L41A 3DUWA 3DT6A 2AQ8A 3QLTA 4EW1A 4QYTA 4EABA 4DBVO 1YCGA 4Y7CA 1DEOA 3LYAA 3NT5A 2YASA 5C31A 1NOIA 1V5EA 2EVWX 3DVLA 1YBVA 2PZAA 2X7HA 1QX3A 3VZSA 2NZVG 8OHMA 4JB2A 3RJMA 1P5RA 1EJ6A 1GDDA 1VIAA 3V7UA 4Q3CA 1D04A 3WL4A 4Y2VA 3TFWA 1YVRA 1GGJA 3W7BA 3ZWAA 4BQQA 4ZI2A 1ENYA 5CK4A 5ICSA 2J3EA 4AAYA 4TYQA 2QI9F 3E9ZA 3VC1A 1AMOA 4OJYA 4L5YA 2Y0PA 2IYUA 1ESMA 3G85A 5EQFA 4KDEA 4LJ4A 4FMCB 4F8YA 4ZTUB 3T4EA 2QBYA 5DHSA 3VVCA 4A8JA 1OFUA 1QP8A 1VRWA 4DCOA 4BNHA 3G79A 5I4IA 4LPSA 3WA7A 4BKPA 4D98A 2V4MA 1XD9A 3R3VA 1DC4A 1YBAA 2CWDA 2R7NA 3NTUA 4GKBA 4TGLA 1UDAA 1AGPA 4JD5A 1Z0SA 1IMOA 4GFDA 1FZTA 1XEFA 2X5NA 1J8YF 2B98A 3EGDB 3G9XA 1GU7A 1LQ2A 2A92A 2Y05A 3ZQ4A 3TFQA 4XYGA 3G88A 3DJFA 4BLWA 2OKGA 1GP2A 2RI6A 4CBVA 4R71A 1R5JA 1UOEA 2Z6AA 2VATA 3F5FA 3O9ZA 4HGNA 5LMUB 3F73A 4ZQGA 5ALFA 1QAOA 3DZJA 4ROSA 2FI1A 1Y6ZA 3HSYA 1VRCA 3ED5A 3RTCA 1CUFA 3CR3C 1IJFA 1IVYA 1MW9X 2Z09A 1HO3A 1EG2A 1UMCA 1X8JA 1K63A 1VL1A 4S1NA 7MHTA 1Z73A 1H1TA 4PSCA 2IHUA 4FEEA 4RH0A 5EI5A 13PKA 1OAOA 1P4RA 3F4KA 4L8VA 3C4QA 4UUNA 5F4BA 3UKOA 4F97A 1LVHA 2ZRJA 2BP7A 2QU8A 4QUAA 3FMIA 1TM3E 1NQAO 3KQLA 3I9LA 3UAZA 2HMTA 3RJ5A 1I1OA 1CUJA 3PJEA 1MQSA 1JIIA 4FGSA 1U9ZA 5K4HA 1GZ5A 1MB4A 2QE7A 1IPFA 2QRGA 3HKDA 4TM8A 5BNWA 3KD3A 3DCNA 4FR0A 4IIJF 3V42A 5CLHA 4R8KA 2QG6A 4NIMA 1SC9A 1L7MA 1SBCA 4C0JA 4LI3X 1YR8A 4CKCA 1JE0A 3RE1A 3HBAA 2VDQB 3OFVA 1QG4A 3LCVB 5DYIA 3RVSA 4C6TA 4MTLA 4I1OA 1QHFA 5F35A 1E5QA 2Q2OA 5AVJA 4CQLB 2WVAA 3MUOA 1BDIA 1CETA 1QGAA 3WMEA 4KYTA 5E1BA 2O8EA 1D03A 4B4UA 4KSCA 3PGVA 2O52A 4MPTA 1QX4A 1NJ6A 1UKAA 1X0XA 5CVDA 1U28C 1WCIB 3MWLA 1GKLA 3PKZA 1UZMA 4BNDA 1DAMA 3TQFA 5FOTA 1HMYA 2PZBA 1SY7A 3PHJA 1UUFA 1HG0A 3ET4A 4HAYA 4BTEA 2X3FA 3HGQA 4I5GA 4LXYA 5DN9A 1P7YA 4F2HA 1WW3A 3GRCA 3ZN2A 4EEXA 1GN8A 5I7RA 1JL3A 1KC1A 4ZTZB 4XUDA 2CV1A 3FOCA 4HO1X 2BFCB 5EE9A 2VDUE 2PRZA 4L4XA 3T6KA 1KERA 3NWOA 2J3IA 4L6CA 5CITA 1FYWA 2VAXA 2W6ID 1ADYA 4RNCA 2CSXA 3WK5A 4EJ0A 1U2DA 2JI8A 1A2OA 3KV3O 2XVYA 1DRWA 2L0XA 2PZLA 4K5QA 4WI1A 2C82A 4Z86A 1Z2PX 2IF2A 4HGOA 1WXXA 1TZKA 3C0KA 3U7JA 3AVQA 2WF5A 3H0EA 4W7HA 1DAOA 2ORWA 5F9MA 4HX9A 2OHFA 1JHVA 4WFKA 5JG7A 4RXMA 1V43A 2ZUDA 4US1R 4YPFA 4FBMA 3GA0A 1IC6A 2C54A 5DIFA 3KKEA 3CLVA 1RI5A 1B2LA 3KVYA 1K0FA 1LSOA 1P6UA 3UPDA 1NVAA 5LB2A 1TB4A 2AFHA 2QX9A 3DMPA 3LJKA 1XXHE 2GAAA 2W4IA 3AESB 3IJ5A 3NR2A 3P9CA 4P32A 4EJ6A 1L7XA 4YP9A 1W4BA 3RYCB 3VR5D 3WWCA 1L4GA 4G8DA 3NEPX 1W47A 5HE8A 3L7DA 4B74A 4OHZA 3ZQUA 2OVFA 4J16A 1LDYA 4X3PA 4F96A 1TQDA 4L74A 2NUAB 3ZWQA 1ZUIA 3E4DA 3G23A 4EKNB 5JSQA 3EZXA 3P0FA 2ZSFA 1YZNA 3C6MA 3I58A 4NH0A 3WL8A 2IT1A 2WV7A 1B8VA 2H57A 2QLTA 2X86A 4KWHA 3H8JA 2O8NA 3RRMA 3HJRA 4BECA 4JEMA 2WZDA 1RE0A 1PSDA 4DMGA 2XW6A 2VRBA 3MAGA 5HGJA 3HXMA 1ORIA 2P91A 4WY5A 2WTAA 4ZU6X 4UFNA 4C0AC 1BHJA 4ND5A 4NYJR 1TKRA 1RWXA 1M5RA 3TW4A 4V0QA 1SHTX 4XQCA 4B17A 4DIUA 1XDBA 2OWDA 2DAPA 4CI9A 3SBEA 3DMYA 3K96A 4IJWA 4YI5A 3ER6A 3R3XA 5F52A 4W1PA 2FSUA 3AF2A 2PL5A 3OO1A 3C3PA 4UEJA 2WD7B 1ACMA 2A9JA 1Q1ZA 1RKXA 5TS3A 1N3YA 3NRBA 5FNVF 4O2BB 5IC5A 4FNOA 4WXPA 3QYPA 4Z0HO 3KC2A 4KO3S 1A4IA 2J5RA 2YFYA 1TT5B 3ZBUA 3V8EA 1N2GA 1IEXA 4LGMA 3ZXXA 3H42B 3B8HA 2QAJA 3ADOA 4OXIA 3UUGA 1SVSA 4AZSA 4F46A 4RTQA 1GIAA 4LGCA 1CHNA 3AF4A 2YBEA 1T9ZA 1TEHA 3HO1A 2CXUA 3A4MA 3NFRA 4ALLA 4WUTA 3TE6A 3E35A 3JASA 2B7CA 3TVTA 4RENA 1FSGA 2UUOA 3LKZA 4HJXA 3VO8A 3FYUB 4NK4A 4RTKA 3DMGA 1SZJG 4Z9AA 1S7CA 2NQTA 3OZAA 2Y6UA 2D0OB 3DVAB 4O4LB 5IVDA 3MJ4A 3HHPA 1TK9A 4FFRA 3RAFC 2P6NA 4FDAA 4HZGA 5HX7A 1O94C 4NBWA 3FLAA 4UXIA 4NBLA 1VXOA 1P0MA 3MMSA 3ST7A 3D1JA 4R51A 5KJFA 1NUQA 5DH9A 2DF8A 2C29D 2BGLA 3OLQA 1BXRA 2CGEA 3CSSA 3IQFA 1I2ZA 1XVTA 1YQEA 3PQDA 5JO9A 4UD6A 1RC1A 1TIPA 2ZBEA 4MR8A 1KI8A 4ENWA 1T9BA 5LU9A 3LGXA 2GRUA 5BW5A 1QRSA 1M5UA 2M6KA 2ZWIA 4MGHA 2AOWA 5JMOA 4F3CA 1UCFA 4TZ6A 4N40A 2NVWA 3UXHA 4CM6A 2R4QA 3KQSA 2LTAA 1O0CA 1VSTA 4J1TC 5T41A 2PUJA 5EHZA 3KDPA 3LQYA 4MRMB 5I48A 2CB9A 2PE5A 3PL1A 1N6LA 3CX7A 2R4TA 3N6RA 4UKDA 5K8JB 3ZDQA 4B5KA 5HA5A 3W7AA 3L18A 3U37A 5AVRA 1M7GA 1VLJA 3DO8A 3DTTA 3I42A 3MRXA 3WNDA 4YRBA 2JLXA 1TO6A 4GKAA 3V8PA 4Q02A 5EJFA 2HDOA 3ZDRA 2I4NA 2FPRA 3F98A 4Z9XA 4R2IA 3GUVA 3H9CA 1UBGA 1P39A 3V48A 2XYGA 3NV7A 1OI4A 1RYNA 4AMYA 2LWIA 4IQ4A 5HQTA 3BXEA 2IYOA 4ZI7A 3DYVA 3R7SA 1LCIA 1FLNA 1BE8A 3DBOB 4MV4A 2DVMA 1KOFA 4BLOA 1T1GA 1CJCA 3I8OA 3D8RA 3TM5A 1U3CA 4RD0A 5IJXA 1VJGA 1F0YA 1TUGA 1ZCFA 3WDSA 1EK0A 3TUZC 3DWFA 1GXSA 4DLTA 1KEEA 3OX1A 3S3TA 1FPMA 1L3IA 4CIAA 2OV3A 3QKRA 2GN1A 2E5LB 2LUOA 4NV0A 3FLEA 3WXBA 4BATA 2Z9CA 1Z2DA 1L4BA 1YD7A 2O7NA 1PQ4A 1YK0A 3K3PA 2XAUA 4ENRA 2Q07A 3UQZA 2CLDX 2BCJQ 2O3TA 4U2KA 2EF0A 3I0NA 4NRDA 4AW9A 3TLYA 4C1BA 4HFJA 1JDNA 3JPWA 4JU9A 4OH1A 3QK7A 2Q4BA 2B2NA 2DT5A 2VO1A 4G01B 5GY7A 3L82B 2JIOA 1KARA 1RJ9B 7YASA 3RK0A 1AKYA 3L46A 1SNYA 3OSZA 1DDIA 2R6JA 4WCFB 3VTKA 1KYXA 1BYIA 4Q1AA 3RFTA 5LZ9A 1LDGA 3DLCA 4UTNA 3EEFA 3V00A 4MWTA 3WGYA 1WPQA 3B36A 4CTKA 2FFJA 3OE7A 4IQ8A 3VAZA 1A72A 1KBQA 4C22A 1E1NA 2R7LA 4LRSB 4RM3A 4B2IA 2FSSA 2QRZA 1QHYA 3IKLA 2WNSA 4H7JA 4MS1B 4F21A 4LZOA 3PHCA 3IB3A 2ZJ1A 3TJZA 4EX6A 3SEFA 3FJOA 5G1NA 4LQLA 2WV9A 3DC7A 2D0DA 3OQHA 1ND5A 2JVIA 3LZCA 2R79A 2CF5A 4MGIR 2ORVA 5D5PA 4IQGA 3AC0A 3AY0A 4KLAA 3C7TA 5LZ5A 1L5ZA 3KT8A 4MW2A 1NQVA 2BI4A 3I09A 2P27A 1RRPA 4W7SA 2QM7A 3O3NB 3QVOA 1OBVA 3DQPA 2ZWOA 3GEIA 2H6EA 2XMQA 3HWSA 3LCRA 1O6BA 3NIBA 3OLZA 5CM8B 3VR6H 5KKNB 1J22A 2IPMA 3IELA 4QRHA 2X8WA 4UU1A 2COEA 4EBFA 1ZGJA 5B37A 3ONEA 1M8PA 1DXQA 2BHRA 1NULA 4DRZA 1U7ZA 1S96A 1WR8A 2ZSUA 3AZPA 3KT3A 1JFRA 1ZI9A 3JAMA 1WXDA 3QTBA 3SJCA 3AP1A 3IS3A 1OH5A 2FQYA 2WZCA 1OGJA 4AJOA 2ABWA 5BWLA 4YDHB 3T7KA 4KNYA 3PXXA 4P3YA 4EGAA 5HJ2A 1H4TA 2R9VA 4BMCA 5E9WA 4JVMA 5A5GA 2QD1A 1CQIB 3WY9A 1U2QA 4MVJA 5EEGA 3F7NA 1YQTA 2WU8A 1ZX1A 2WHXA 1YE3A 3E82A 4UHHA 3GL9A 3IDFA 3HO8A 4U7GA 4YAEA 1RRVA 1F4PA 4G5SA 3F9RA 2ISQA 1X80A 3BRCA 4WEOA 3LV8A 3IVMA 3O73A 3NAMA 8ADHA 1F1JA 1FE8A 1SU6A 3GN2A 4ITUA 5JO0A 3A7DA 4ZVPA 5TQVA 1KBOA 1ZOLA 2HWUA 2I6GA 2WBLC 1R18A 2Y71A 3KT0A 4JDPA 3PCTA 3U7RA 1E2HA 4A91A 1PS9A 2BGUA 1QVZA 4RGBA 5T5QA 3USCS 1LPPA 3DBHA 1BCRB 2ZSDA 3IUSA 2OB2A 3DL4A 1HK7A 1QH1A 3B89A 3G8DA 3NOQA 4OMCA 4WK2B 4GPTA 1VPTA 2WFMA 3HN7A 5EE0A 3BC1A 4QE3A 5JRDS 3K20A 4H6VA 4C7OB 5LWQA 5BQPA 5J2TA 5K0ZA 3L5OA 1G5QA 5HQ3B 3T4PA 3C15C 4QFMA 1AKUA 1QQ6A 1ZVMA 2H52A 2GASA 2FPPA 3ZKAA 2E3JA 2QLFA 5AJYA 3NNDA 3TUIC 5J58A 3C3CA 4QTTB 1RHRA 4EO4A 3WJAA 2JA1A 2OV8A 3A37A 3RASA 3GJQA 4HP8A 1ECCA 1VDMA 4XB1A 2CMKA 2GF0A 1XP8A 2BE9A 2EDCA 1ZUWA 3KKKA 1TTHA 1Z16A 4D0SA 5JVDF 2FDXA 2YHAA 5FWXA 3UUEA 1GPLA 4CEIA 4V1CB 1JQ3A 2J08A 4PNZA 4GMXA 5KSWB 3HCCA 4YAKA 1T3LA 1YE8A 5LN1A 4LMBA 1BXKA 3CKMA 2W6PA 4CDRA 4CLRA 3AJDA 2E4WA 5ESXA 4NCBA 1GZHB 4RMIA 3TMYA 1FYFA 1VPDA 3OETA 3ZCVA 1R9NA 3R5HA 1E89A 5HM6A 4YV2A 2O6LA 4ZN6A 4K2HA 2QMEA 4EQ6A 5F77A 3AERA 3BWMA 4BP1A 5DK6A 4ARBA 1GRRA 3EGVA 3VM6A 1C4OA 3BAZA 1A5BB 1I4WA 2HA0A 1OFUX 3HXTA 1W0JD 3PFKA 3FHJA 2CNOA 2DTDA 2ZE5A 1FTYA 2OGWA 3NH6A 4MXDA 2JASA 2X6RA 4J0KA 1YWGO 5GWXA 1FXSA 3DPIA 5B53A 2TS1A 5AIBA 2TSYB 1JPNA 3SN6A 1FX0A 4AU1A 4RFLA 1X7YB 1Z3CA 4ZPXA 1JU4A 1M2HA 2OQ2A 1T34A 2E1RA 4MKFA 4YALA 1H2BA 4F60A 3TG2A 4Z9FA 4DG8A 4Z4EA 4RFSA 3PNSA 4FKZA 3BPSA 2CFIA 1UK9A 1FNMA 1OXXK 3OEWA 1D09A 3A10A 4H6WA 2YXLA 4BN0A 4OX9B 1C9MA 1AF7A 4HWRA 2H0QA 2NYAA 4WLFA 1RJDA 3U3KA 2WE8A 4BKRA 1I0LA 2ADMA 5FL7A 4E5DA 5LOVA 1R15A 3A4LA 3AIIA 3FROA 1Y8AA 4YQFA 4AKEA 3QW4B 3N3BC 1ZM3A 5EA2A 1W4ZA 4EOGA 1MEJA 1YR7A 5AJUA 1JEYB 1FFWA 1X19A 1WBJB 1YTLA 2FRXA 3WSWA 5DHFA 4F38A 2P2CA 1MU0A 5G4LA 1SCUB 1Z2EA 3AFMA 1GVNB 3BFXA 3O90A 3AM1A 4O6VA 4P36A 5FPHA 4M99A 2HK7A 4A16A 4HLUC 4KO2S 4YONB 2FX5A 3IE2A 1GCOA 2PMDA 1NVWQ 4KI0A 4OA8A 4A0RA 1KAGA 2BFWA 3WB0A 1YFKA 3E7DA 4YNBA 2L69A 1QP7A 3OQIA 1XAHA 1SMKA 4J3FA 2I3DA 2GAIA 2RC5A 4F04A 4URYR 3THSA 1VYHA 4MZXA 1NXVA 3M6FA 3HMQA 4JLJA 5EKXA 4ZCPA 1Y4ZA 3CSUA 4AJ4A 1J0XO 1WMSA 1QHIA 1N6KA 1OYYA 3GZ4A 4PSAA 4W9RA 2NPFA 5KKCA 4JT4A 3VSEA 1B00A 1HDXA 3H9UA 1G5HA 1N5IA 4BYGA 2F17A 3DLTA 3EXFB 5JCJD 2JJ1D 4FUTA 1CUCA 4Q0MA 4QXRA 4B7ZA 2PWBA 3OKFA 4KGDA 3KWLA 2WZQA 4EI2A 1MF7A 1WSBA 5COBA 4KGXA 1SC1A 4YLEA 2W98A 1T3TA 3O7WA 5D5QA 3LFUA 4EJMA 2NU7A 1YA4A 4IDEA 4I1RA 4X1KA 4C5AA 3FSGD 3M6VA 4RLFA 4R7GA 1BD4A 3E05A 1TC2A 3ORQA 1E6CA 1GG5A 1Y4UA 2HQ1A 3S1SA 3KCNA 5JAPA 1FVHA 2ST1A 3LO5A 2R5WA 2FWMX 2P8SA 3A4NA 4KLCA 5DXAA 2YJZA 1ZGHA 3TS1A 3DBRA 4FOPA 3LUKA 2W6JA 4KKVA 4AG3A 2RGYA 1TVKA 1URPA 2G9RA 1AKEA 4JDUA 4WKBA 4YQZA 4BFVA 6YASA 1D9XA 2P9CA 5EKDA 4YCJA 4GRIA 2VDMB 5T8KA 1MV8A 1HZZC 2V0NA 1NVVQ 5IJ0A 4Z0TA 1Z5NA 1J5PA 3JTEA 3TCXB 1BRMA 5L95A 1GG2A 2R1ZA 3LHIA 1DO0A 3GIWA 3RRYA 1AH2A 2AOTB 1NUTA 1F0PA 3R3YA 3T5AA 4F6CA 1W1WA 3DR5A 5CM9C 3NRCA 2BFBB 4Y30A 4GYJA 5JAUA 3TZHA 1J2JA 1TJ4A 3EQ8A 3U4QB 3BMOB 4YA6A 2RK3A 1PL0A 2WR8A 4ZI5A 4XVUA 1SVUA 5T7BA 3PNYA 2JKZA 5LZ8A 4DR6B 2GA9A 1EWYA 1EDOA 2XBUA 3CN9A 3VJLA 2WJVA 1C50A 2AEMA 5TGZA 1W94A 2VPZA 4D4KA 1T9CA 5A2GA 2G4VA 4TLAA 4J7AA 1Y9ZA 2D0IA 3Q8XB 4HCJA 3D8HA 4MQBA 4TN5A 4G0OA 3JX9A 1Z47A 1YU9A 3PC3A 3AWIA 1LA2A 4LVUA 4J90A 4MV0A 4NDZA 1DWUA 4UCXA 2XIQA 2F43B 2VAVA 3OZGA 4QFCA 1U6IA 3H65A 1G6Q1 3DZDA 4DUGD 5JAOA 2I7CA 1AC5A 2V7QA 3NI2A 2FMXA 1J7JA 4Q93A 3UJAA 3W90A 4NS1A 4DWVA 5K0FA 2QLBA 3K0FA 2F55A 2G06A 2HCRA 2ZRFA 3WK6A 1FFDA 2XZPA 3RVNA 1Z6TA 2N1BA 2ICAA 2X5KO 4WKNA 1XZFA 1LC3A 5CFMA 2FWRA 4ZHQB 2AZ4A 2JAQA 2YRFA 1VKNA 3I37X 4NBRA 4P80A 3NKLA 4PO8A 3T94A 3TIGA 1EWVA 2FR1A 1WLYA 4CCYB 3FTEA 1R5BA 2YINC 3P0JA 3PNMA 4KAJA 3ADCA 4YGXB 2HCBA 2ZUBA 3WLMA 2YJTD 1KVUA 2F3TA 3K4PA 4DGQA 1FX1A 3ASYA 1PWYE 3TLGB 2YTZA 4BFYA 5KNLA 2C2HA 3NT4A 4D8UA 4QAJA 5DNWA 1EP9A 1JT2A 1ZA2A 2F3PA 2LW7A 2ODQA 3MJFA 3LDAA 4TM7A 4Q05A 5FUYA 3A6HA 2FZGA 3NVMB 4LZJA 1DCKA 1P9NA 3E1GA 4JB8A 3V2UA 1XPUA 5H4GA 2JKYA 3EZFA 4Z7JA 1VE7A 1XRJA 1E7WA 1ZOIA 1IHXA 4FX2A 3RIEA 1FJGB 2FB9A 4NKRA 3SX0A 3D5TA 1R50A 4GSLA 3W1EA 4WBNA 5EIHA 3VH2A 1EZ4A 2VJDA 2HOQA 1Z8NA 2R2AA 1UBUS 1TT7A 4X54A 1KMHB 1W30A 3A6KA 3H99A 3UN1A 2UVDA 3LPCA 5EXEA 3F4LA 1YB7A 4TKVB 2WG1A 1VIDA 4RETA 2WWFA 5AWFC 4P0QB 1XD8A 2MYTA 1ZAYA 3VGJA 4ZOLA 1NX6A 1DXYA 4WXRA 3CCFA 4GVXA 4M6WA 4AS3A 2ZPUA 2AE1A 1S8NA 4QJBA 3TTWA 2HHCA 4QIHA 2JIZA 2YQ4A 4NCAA 3VYVA 4HPWA 1PZFA 1XELA 5CDFE 1Y3IA 3O8BA 1QDLB 3UMCA 5CLFA 4O5OA 3CF2A 2QTTA 1VM6A 3RI3A 5HWSA 4WXYB 5GMOA 3WGVA 4KXXA 4FYIA 5J59A 1G8SA 2IIBA 2R6R1 2OM6A 4Q9IA 3SBXA 4MH0R 1ZBQA 1ZIPA 1A27A 5AM2A 5IUNC 3ABIA 4UDYX 3WB9A 2QRVB 3I76A 4IHJF 1RYEA 1NRXA 1DL5A 3BX1A 2H63A 5GOTA 1BXZA 3KB6A 3M4ZA 2G83A 4DRYA 1OTHA 1P77A 2IRWA 2DH5A 4KJXA 3QBDA 2VH2A 3GU3A 1N2CB 3FPJA 4GW3A 3KVRA 4NLLA 2PUHA 3CE9A 5IDVA 1RWVA 3HGMA 3QI7A 3D8UA 2AYXA 1LSSA 3HCDA 4EGCB 4MK4A 4KDFA 5F7ZA 5LIRA 1Q1EA 2R44A 2V7XA 3DE6X 1A7JA 3TLMA 3RG2A 4L0MA 1HPLA 4U2EA 4M49A 4ZCRA 3SQNA 4P4SB 2PO7A 3T7CA 5ESRA 1Z33A 3I6QA 4WECA 5HKLA 2W9XA 1VLMA 5LYJB 3MFQA 1XYVA 2QAGC 3NTOA 1JQDA 3UGTA 3I30X 4Z7QB 2RHLA 1OC4A 4UEWA 3Q5EA 4M54A 4X3CA 1MQ8B 3VPFA 1MC5A 3HJTA 3A9WA 4RTJA 2PMCA 4S1WA 3DL0A 2ZATA 3WKAA 4WZBB 1WJGA 5ESDA 1SZPA 2RH4A 4YWHA 2C42A 2WFLA 5CCXA 1FVFA 4RKQA 1ZITA 2CMFA 4F85A 3TQQA 2D59A 5BVHB 1OJLA 3U7GA 3HY6A 5LQUA 3KVOA 4YJ3B 1SPBS 3UKJA 4C4YA 2VQEB 1UT5A 1L5KA 1RZRD 3S29A 2BYTA 3CTPA 3ESZA 4ZYXA 1B3RA 3WGMA 4EDFA 4YUAA 4S04A 3D3KA 3NU1A 4L16A 3V6LA 1PGJA 6ADHA 3ZNOA 3VPCA 4CQMD 2SHKA 2KYRA 2O1EA 2WD9A 1QONA 1VJ5A 1K8ZB 3O31A 1JQBA 3WRVA 1Z6PA 3ESYA 1AUXA 3K09C 4LYFA 4NHEA 2CXHA 1CUBA 4AN0A 1JQJC 1P1BA 2MYNA 4CTMA 4ARUA 3O4RA 1SO8A 2CDNA 5KVAA 4R5HA 4YJDA 4QLBA 3D4OA 5K9ZA 1FS4A 1ULHA 1OD6A 4RSHA 1NP6A 4MIYA 4ZI3A 1YUBA 4CLOB 3RIHA 3GJ5A 2P35A 4A1OA 1DAFA 2H9IA 2X2PA 1L7AA 5F98A 4WNCA 3M7IA 3FHCB 3N6VA 5TR9A 3V1NA 4HDQB 3R3JA 2ZAOA 1DTSA 4KFTA 3BIXA 3EZNA 3KJEA 2PBRA 4M8SA 3MCTA 5CFOA 5JBIA 4QVIA 1W88A 3KX2A 3U39A 1ML3A 2V8OA 2BONA 1F0NA 1WABA 1WRBA 3LYHA 3DEFA 5HR5A 5IJ9B 3Q3GE 4FWTA 3F0TA 2IEBA 2XCLA 4FS8A 1JG1A 3A25A 4GLJA 4R7TA 4G26A 2PCLA 3UBMA 4GKKB 2YUTA 1Z0IA 4BMOB 4XX0B 1WU8A 2R6ZA 4WK0B 2PRYA 4RDHA 3I1IA 4RULA 4QUJA 3ZHSA 1V71A 4E3WA 4UNPA 2BZ1A 2DWUA 4EX7A 1H2RS 3FLBA 4XQEA 1ST2A 1AHIA 1VRVA 3KZKA 4HWOA 4BEBA 1ECGA 4RPCA 4X1YA 5FHRA 3W7VA 4EVSA 1B6RA 2H7XA 2HHJA 1IY1A 3LYLA 1NJ8A 1DKNA 2GPJA 3H83A 2LDXA 3T54A 3LHFA 2AYZA 1U1EA 2JIQA 4P3XA 5LBIA 5IVHA 2FPOA 2OCYC 1OWPA 3WLEA 1YC2A 3D43A 1LI7A 2FQQA 3KJXA 3LGAA 1ZVQA 4IMRA 1E3WA 2J9ZB 3B3JA 1KQNA 4BNIA 4QOFA 3H2GA 3WC4A 4BO3A 2BCEA 3U48A 4GPZA 4I6JA 2B0JA 5KZMB 2FZWA 1L8XA 1N36B 1NURA 1DP4A 1SBYA 4B6FA 4N7JA 1LSJA 3R5XA 4BX3A 3RUDA 4YACA 2XHEA 2L82A 1L1EA 4A8PA 1M2GA 1QO7A 1STOA 2H85A 2C7VA 1JSXA 5KQMA 3OLXA 1G2PA 1YS1X 3TH5A 1MX9A 4CNBA 1QRTA 3TN7A 1PJ3A 2AB0A 2BGIA 4XRRA 4RK5A 4PICA 2AXPA 2D3WA 1G16A 2PR2A 4P4TA 3W9BA 1TGYA 4WESA 3E9CA 1M7HA 5EP4A 2JG3A 3EAGA 3F7OA 1HEIA 4FI3F 4CUKA 5AOAA 1GAWA 1WULS 5SYMA 4BQFA 1Z4MA 1I10A 3ZE8A 5INTA 1ODLA 1V47A 1V1JA 3F74A 4X62B 1NVMB 1J90A 1E98A 2OPBA 3QKSA 3TG8A 2D2EA 1HX7A 5JWRA 5L7WA 4EZEA 4BXOA 2CJWB 5T4BA 3PJFA 1VI5A 4AD8A 1OAAA 5EQDA 3VNVA 3UV7A 1XQXA 3THOA 1NY6A 3O1LA 5EZSA 1Z0FA 2I1LA 1VGVA 3LXMA 4TN1A 5KWSA 1QFYA 1OB2A 3ICWA 1QAMA 1A2KC 1WZNA 3VR2D 4BPRA 1IUOA 5A4KA 3C1AA 4H0FA 3PG5A 5H1YA 1R9JA 2BM1A 3QMMA 4IICA 3G8CA 3T3MB 4D99A 1NTOA 2HGSA 4WACA 4C4ZA 3CB2A 4Z5XA 2IH4A 1LQUA 1HWYA 2HW8A 2K4MA 3IVRA 1YS4A 5DYGA 4N49A 4KU4A 4I3HA 5ICGA 2IU3A 1PJBA 4AYXA 1A8SA 1ZN7A 3L0SA 3EFOA 2ZITA 4WZ6A 3CURA 2GYWA 1KO7A 3CHYA 1P31A 2FJUA 1ZK3A 4JQYA 1LRKA 4I5FA 5HF9A 1E2MA 2I71A 3KUDA 4O4JF 5LDGA 2R6FA 1E1YA 2QEQA 2Z6UA 1HSZA 3H2JA 2HDHA 3NXSA 4P58A 3ZK7A 5BR7A 4FR2A 1Z6YA 1E66A 5TX7A 3A11A 5DW3A 2O2JA 5FTMA 5JZMA 3SYTA 1KDTA 3NIFB 3N8KA 4HDNB 1Y4DE 2F3QA 2IHZA 3CJRA 3Q8KA 2KPOA 2XWJI 7AT1A 1JHDA 2Y1FA 1ZK0A 3CNEA 4D9EA 2BM0A 4QD3A 5H9WA 2XQIA 2GMWA 1XDGA 4RTNA 1U1CA 1Y5RA 2NUPB 3PXAA 4S24A 5H8WA 5TARA 1HLGA 2HI0A 1CZOA 1UAGA 1W25A 2OD9A 2D3TA 2G1AA 1LW7A 4QECA 3K8YA 3PEFA 1U2EA 4DV6B 1DEAA 3UWKA 1G20E 3Q7IA 4CR6A 5JWOA 1I1NA 4WPGA 5EWMB 2EOAA 3DV9A 2CYCA 3OX2A 1WDWB 2D0PB 1BS9A 5CHYA 1LTQA 1R6BX 1OT5A 1V11B 4YPOA 1OGIA 3AFIA 4QA9A 4JI6B 2XCRB 3BEDA 1YHNA 4XXHA 2Y92A 2C3PA 2PS9A 3CUYA 4DCNA 1Y3BE 2YDYA 4ND6A 2JANA 2O4UX 1XSEA 1OWMA 5BURA 1RXVA 3P9KA 3FCSB 4RBNA 2FP4B 2RH9B 2P30A 5MFPA 2E55A 4FOOA 2ACWA 4UARA 2J3HA 1GFSA 4JY7A 3PRJA 3TX2A 4L6AA 4OJTA 4PGFA 3P1JA 4IF6A 3LRTA 5A0VA 2DEUA 1DMSA 1MRNA 2QTFA 3EWAA 1WU7A 1QCCA 2A0XA 2VF2A 4RMNA 3RYIB 1E1CB 3THYB 1FZQA 1JF8A 2COKA 2E49A 2XDYA 3A9VA 3R75A 2P0AA 1EBFA 1KKLA 2Q3FA 1I7LA 1R0RE 1RQPA 5DGXA 4GPBA 2XCSB 1L5LA 5CVJA 1U81A 1ZNZA 5DOVA 1GKUB 5DYTA 2VYNA 3UJ6A 2Q5IA 1OZ0A 2RHGB 5ALKA 3AJEA 3EDOA 4IOLA 1WCIA 4JJ7A 3UB4A 4E0BA 3GPBA 1HTWA 3BMXA 4TTTS 4LRTB 2ZYHA 3LP5A 1TU0A 3SZOA 1YZVA 1E2KA 1HORA 3I83A 5JTTA 2G7ZA 2VPYA 3BFVA 3WJ2A 2AQKA 4AZ0B 2VWGA 2QQ5A 2DR0A 5ABPA 2JGFA 1PNOA 2CBZA 4LDPA 3HFRA 1V9CA 3H17A 3V8RA 4LYYA 4ZYVA 3V5NA 4G0ZA 3A1TA 4XYBA 2I65A 3HYRA 1CP2A 3U16A 3GF4A 1W7AA 1E1MA 3G9ZA 1SKQA 2VVTA 2YWRA 3WK4A 4EG7A 4YHHB 4Q6WA 3GBSA 3R0VA 4CE6A 1W19A 2YHUA 4LHYA 2EAUA 3CB4A 5KAMA 1E61A 4RC9A 3S5UA 3WX0A 3FVVA 3TNYA 3FNIA 2AOUB 1T9AA 3F5MA 1XI2A 2F1RA 1Z4OA 2X42A 3IILA 4BO2A 3ERCA 2QDXA 1G6OA 3SR3A 5E9AA 1VTKA 1SJ9A 4M86A 4NXNB 3GXBA 1IYZA 2Q3JA 2O19A 2NNLD 2FOIA 4LC9A 3JVIA 1QHGA 3V33A 5D86A 1WE2A 3HFGA 1XNJA 1J1ZA 2B4RO 3CX3A 2NO4A 1I2AA 3QW2A 2Z83A 2YMMA 1K4MA 2IOHA 3IOEA 4LS3A 5DN6A 3KOYA 3QHPA 2C0CA 4MB0A 5LR6A 1P6QA 1V6SA 3GNTA 2LE0A 3KFVA 1KMCA 5U4XA 4M0DA 2XHZA 3RS8A 4CTNA 3SLRA 5GQSA 4D0GA 2X76A 4JAVC 1RRCA 3U4CA 1L7VC 5JLJA 1ZHOA 2X5XA 2C94A 4CKXA 3L1HA 4BKUA 4AN4A 1KFCB 1XDDA 3KSRA 4OI1A 4IH9A 4KBYA 1QIKA 4DSTA 4ESEA 4AX4A 1ZMBA 3MK31 3EWIA 3E3AA 1GNLA 1ONOA 3DAGA 3DKVA 4JR2A 2Y2VA 4LYDA 3C5HA 3KZNA 2FZVA 4P4UA 4XDHA 2X77A 3EGCA 4DN6A 3B1XA 2I2AA 4IG4A 5LLDA 1L1FA 2RE8A 5JSZA 3E3MA 2BTOA 2XNJA 2I76A 2Z3VA 1Q83A 4WVFA 3IQHX 2PLRA 1G7CA 4LJ9A 4OI4A 1AHPA 1QUFA 2R96A 4LECA 4E2YA 3DA8A 1WUIS 4GVPA 5J2UB 1DKOA 1H8HA 1RJFA 2P5YA 5FLXA 1CJBA 4IDDA 1H69A 3SHFA 3ZVRA 3R5TA 4HS9A 4R8SA 2D2XA 2R1TB 2RSLA 2ZUCA 4RAOA 4EY6A 3A32A 3F6YA 1NNSA 2PZKA 3GJ4A 2NP6A 4QUIA 1TT5A 1F8FA 2C2YA 2EKDA 3ZCQA 4RJKA 4KACA 5EKSA 4YRNA 4NZZA 3CRQA 3JY6A 3ESAA 4PNEA 3ER9A 1NYLA 2AJBA 2FF7A 2C5HA 3ZIDA 1YTUA 1QPZA 1UFQA 3VNSA 3T3OA 5JQGB 4CMAA 2N42A 4N18A 2Y1GA 2VF8A 1SUCA 4UUBA 2KLHA 3UQYS 1EA5A 2AL7A 5K0BA 1DELA 3ZD6A 3GYBA 3OH8A 3JQ9C 1NF2A 1ZSYA 3D54D 1KI4A 3MMNA 4H35A 4YP5A 1EX7A 1ECFA 2AN9A 4MA0A 5E1MA 5TQJA 3DVAA 2YS7A 3Q0TA 2VHTA 7ABPA 5A6SB 1UKYA 1U4SA 4GBED 1RP7A 2YQZA 3OSUA 4R5MA 3ZLTA 4DY4A 4Z4IA 1XHLA 3GP3A 1RKQA 2C88A 1QUEA 3TBFA 1DOZA 1IJEA 4UQLA 2Q1WA 5ALNA 2JIBA 5DFAA 2GEFA 2FW0A 4JC5A 4P7FA 4J49A 4AF6A 2AX3A 1E8DA 2HA7A 2IYLD 3RUAA 3L7BA 3TRHA 4M1SA 4GZ6A 2CE2X 4KP7A 5FULA 4EJSC 5EHIA 5AI6A 3I64A 4FFVA 1U9IC 3JAKB 4QJIA 5K3OA 4KODA 2LP4Y 3IHKA 3VKVA 1EWTA 5CB4A 1NN0A 3B70A 1BDMA 4MMZB 3BYZA 5A04A 4JLSA 1GEEA 1I13A 4TVOA 4XQ0A 4ZP1A 5DJ5A 1QOZA 4IHAA 2O8BA 1QO0D 4JYMA 2HGZA 4ZARA 1GGVA 4KPGA 4TSFA 4G0UA 1MPTA 3KEQA 4OIFA 1BMQA 4TMZA 2XMBA 1BMFD 2ENWA 3UFBA 4JOQA 2O3QA 1TEXA 2WWRA 1N6RA 2I4OA 2W2OA 3FUXA 4Q66C 1V9SA 5KJEA 3UYKA 4RH1A 1D0SA 2XWPA 4HGYA 3S27A 1ZJYA 3K0BA 4XDGA 1IZYA 5DWQA 4HEA6 1GM5A 4NL4H 2E5FA 4XWYA 4I8IA 3F46A 1H4VB 3DLIA 1COZA 5BWOA 1KY5A 5HPYB 2IYRA 4ARIA 4KYVA 3NMUF 4OV6B 1XLTA 4EB0A 4X92A 1ZR2A 4B81A 3LK6A 4JWKA 2V0CA 1Z83A 1R6VA 4F45A 3FOBA 1PR6A 1TMYA 3D64A 3MTDA 2KI5A 3TNLA 3V9AA 2BI7A 1FLDA 4DJEC 3WV5A 3DGEC 2JIDA 3GUYA 3V8MA 1EHCA 1JV2B 5CB0A 4IDFA 2ZJ0A 2A0FA 3FZEA 4JSTA 5DM2A 5K3SA 3A6GA 4KQFA 3GROA 1KZHA 1VE3A 4EG8A 1U0BB 1DGQA 1XZGA 2UUPA 5K6AA 2H5LA 2FSVC 1YRQA 4RJJA 3MINA 1OBCA 1Z7YA 5KWJA 3C87A 1W73A 1PUXA 4JZYA 1C0EA 1CY8A 2JRCA 3QHAA 1OY1A 4JC0A 2Z56A 2H4HA 4NENB 1A8IA 2G07A 2RONA 4EKYA 4FX5A 2XR1A 5E3JA 2C4MA 1FQWA 1EGMB 1ZNWA 4JJFA 2CDAA 1JZSA 3B9BA 3TSYA 2X14A 3WYEA 1J9EA 2Y1EA 1DFHA 2L19A 1XL1A 5FOQA 2PX3A 2NP7A 3X2FA 4WCFA 4P08A 4HPXB 4CQNA 5HBGA 5D51S 1AQNA 1UXHA 2P6PA 2ZEJA 2IH2A 3O8RA 3OPXA 3PT9A 2IXTA 2JHGA 1RHQA 1VJ1A 5J2TF 4MRAA 1GYRA 1JKIA 1GSHA 3LXXA 3VYRB 3LM8A 3OMXA 3W2GA 2YW9A 4BE9A 5B7NA 5LZ2A 3GGOA 2HR1A 3AOEA 3IUNA 3KXPA 1E5TA 1K08A 1XNGA 4J2OA 3WHPA 4BMSA 4MS1A 5TB5A 1CEXA 4PHGA 3T7TA 1NZFA 3EXEA 3MJTA 2IOYA 5FLKA 4Q12A 5CR9A 3JVDA 1O6FA 1EHYA 3EN0A 3G7SA 4FEGA 2L18A 2XWSA 3EWNA 3GVIA 3LWNA 2GRAA 4KR3A 1NI4A 2XTMA 3CRNA 3T9BA 2IY9A 1CS0B 1PFYA 2P0EA 1HF3A 3A3OA 2RJ3A 1E6UA 4UHCA 3R4CA 4QKQA 5LP6C 3LKDA 2IV7A 3O8LA 4QWMA 4R7ZA 2RHMA 3SHTA 4BP8A 3ZVKA 4TTSA 1YF3A 4LCBA 1P4HA 4IJMA 1CQXA 3PC8C 4ZYUA 1UBRS 4R2WA 2Z6VA 4FFOA 1L5QA 2CMDA 1NRIA 3MS2A 4CMJA 4P8RA 1T5IA 4OU4A 3ZH2A 2A9RA 4V38A 4OHPA 2WF9A 3HXLA 5CT9A 1HR0B 5AHXA 1FS5A 3NUZA 1HFJA 4DQKA 4RTOA 3R9KA 3H2SA 3M1IA 4G2NA 5HZGA 3K92A 4O2LA 1T29A 3Q9LA 1NT4A 5D7BA 5JIBA 2FWNA 4JJIA 2KLBA 2OCGA 3FR7A 3JQFA 3KDAA 5IYZF 2VTKA 2H2DA 2BSAA 3RV3A 2C3YA 2XT6A 5KYYB 3MCZA 3GRZA 3RD5A 3BGWA 1M6WA 1FU4A 2Q8NA 1VE6A 4MUXA 3RVQA 3ZDBA 4JI0B 4YXWD 5IG2A 3VH3A 2NZYA 3I5UA 5IEJA 2YFQA 4HZUB 5IN5A 3OCYA 1BTOA 1T3ZA 3AVPA 3LQ4A 1JFFA 1BCRA 1U0FA 1ODTC 2OD7A 2QMHA 4HLCA 3R40A 1IZZA 1G0OA 2VJNA 4PLWA 2BZSA 4IVRA 5HZMA 1DWOA 2SKCA 3MGCA 1PJRA 1H0SA 3PQ2A 4ZT2A 2O8FB 4RTLA 1N9GB 1PYDA 1QORA 5CYFA 3H0CA 1ZRNA 4R1LA 5TF4A 1P7VA 4PHFA 1X7WB 4BWYA 4Y2XA 4DNQA 1JIQA 4ADSG 2IYEA 2XVZA 3CUUA 1MIOB 4JIGA 5T3YA 1PI3A 2PBFA 4S1TA 3VU8A 4HRAA 2XI4A 3H3XA 4ZVSA 1E9EA 2ZYIA 3NGXA 5TRTA 3AV0B 4FHFA 2EZUA 2VPWA 2YJ6A 3IMGA 4O33A 4JLPA 2ZU0C 4KN9S 4GBGA 3C7KA 4HF7A 2A0YA 5K8UA 5TGTA 2RHCA 2A9KA 2WHPB 1NNI1 3T7SA 1FSZA 4TZ0A 1V6AA 4L8LA 1M2VB 3GDFA 1QZZA 2RK4A 4U02A 5CGZA 4CYMA 721PA 3CW8X 2OTCA 3NC1C 1XK7A 3PICA 4J6FA 3GGCA 1AF4A 1SG9A 2GPWA 2JZOA 2OC4A 2REXB 4TS4A 4GM0A 3BMQB 1DADA 2GZHA 2YWHA 3I5XA 3MFYA 4QDXA 1MORA 3NTXA 2HEIA 2XIJA 2GM5A 3NBYC 4R2MA 4CTJA 4H3VA 3MAAC 4MHTA 3RYFA 3B5JA 1OV4A 3CINA 3NWBA 4NDNE 3CVWA 2CXQA 2VN8A 4TMKA 1HFEL 5FPQA 5C37A 1H6AA 1KTIA 2OO3A 3IV6A 1SQSA 1TKAA 4XSVA 3GB9A 1XEWY 3BMCB 4S1OA 4A0GA 4F4UA 1OC2A 4LRWA 1KI6A 1TU4A 1DBIA 3KE9A 4NYMQ 5AKHA 3TLAA 1QCZA 3HY3A 3AF5A 1T2VA 4UHDA 4NU0A 3RSCA 5EJ2A 5F3WB 1BNCA 3LT4A 4NOMA 3R3UA 1UOOA 2PKRA 3EXHA 3SF8B 5BR1A 4H77A 4EAAA 1VI6A 3RVMA 1N5JA 3U3ZA 4LDNA 5KYVA 1XRSB 2I1VB 5ALLA 5AYVA 3QE2A 4NCJA 4DLSA 1O0BA 2V9ZA 3GG9A 4EPYA 2GXAA 4V0LA 1EEHA 3HSSA 3TLZA 4YH1A 4C7XA 1WW2A 3FVRA 2JAXA 1DKQA 1X8LA 3IT3A 4E5UA 1JEYA 1M1NA 2ATCA 4LX0A 1MLDA 1TW2A 3ABRB 2GWRA 1ODJA 2WYVA 1FP4B 3AY3A 4HB0A 4PZAA 4COKA 5AT1A 3ZHZA 2VQDA 1VIVA 3LQFA 5B4TA 3REOA 2PGJA 5B3LA 4KYUA 2PWYA 3RSGA 1IUNA 3JD0A 4KIGA 4WBXC 3ZXUB 3ZHUA 1NNLA 3NDBB 4HQ6A 4QEDA 4YUXA 2CDBA 4FD3A 4UPDA 2GR9A 5CA1F 3COPA 2AC4A 4JCCA 2ZRHA 3ECSA 1PJ2A 1KDRA 4DV5B 1P1RA 4DAOA 2QTVB 1MO6A 4QO8A 5JD6A 2XA9A 4YIHA 4UBJA 1BU5A 2LR0A 1KSFX 3V1MA 2NAFA 1CEQA 1Q7TA 1ZD9A 4HNSA 4BFWA 3ORRA 4M83A 5EXTA 4B0OA 4ZZ1A 3Q8MA 2ZP1A 5B6IA 1R6TA 3QFRA 2RG7A 2CBGA 1QFZA 2FFBA 1KA9H 1QQTA 1T13A 1MFPA 2VNHA 2XEXA 3I2YX 2GA8A 5AKEA 2IHYA 4QOEA 4UHJA 4B47A 4ZAYA 1RLIA 2EFDB 2DY0A 3H5LA 1FCJA 5C1BA 1L1QA 2QE6A 2ZI7A 2WKSA 5E95A 3B2NA 3JW8A 2ZLBA 3M0EA 2W8BB 4BBPA 4MGZR 4CKBB 3EZ2A 5A4FS 4BEJA 1SOWA 5ALGA 4II7A 2A1TR 1XALA 2FFAA 3N2NA 1JAHA 2QLNA 1WZCA 2MSWA 5EGSA 2V59A 4WDQA 4WADA 3TMAA 3TD9A 3PYMA 2A86A 3NEAA 3E5MA 1PL7A 3MN1A 4QC2A 3GLIE 5LVAA 3JWHA 3DV0B 1ABEA 2CSUA 3WK7A 3H0KA 4L28A 3L0ZA 3L4SO 4ILKA 4ZGWA 3SXJA 1B74A 2E87A 2AOTA 3EEYA 5F1PA 2IIVA 5TC4A 1XCGB 1FDOA 3D2AA 3S7TA 4C0SA 1NC1A 3BWCA 1GFWA 2RHTA 1L4HA 4I1UA 4C4XA 3MA0A 3U7FB 2JGRA 3FMOB 1GDTA 5C18A 3U4QA 3H9QA 3GZTB 3X1KA 3ADDA 5LP1A 5J23A 5CNJA 3RAPR 4MUFA 1OBHA 3OD5A 3BJIC 4OH7A 2PRKA 1ANKA 2X13A 4Z9BA 1SKMA 1YKFA 3UHAA 2YXDA 3VKFA 2YJ3A 1P6XA 2QE7D 3EMDA 5DHAA 4DSOA 1J0AA 3M6LA 1LKZA 4RY8A 1Y48E 1W52X 5AW7A 4PLFA 4B8WA 4DARA 4Q4AA 3Q7PA 5AI4A 3OQPA 1X7GA 2JFOA 3O95A 2DJ5A 5CX1A 1H66A 1OV6A 4ABYA 3THXA 1OBOA 4PHHA 2Z43A 4B32A 5CLJA 4Q82A 4EFKA 4J4HA 1LLUA 3W3ZB 4H4CA 4UAUA 2CJFA 2ZXUA 4OLAA 3DCIA 5DGHA 4N5MA 2I67A 3QYJA 1QHXA 3HP7A 5DWVA 1R0SA 2IWRA 4HNTA 2PEZA 3AVYA 1CUUA 4TVSA 3VDQA 4NU5A 4YJFB 1SGWA 4C05A 4EGSA 4BB9A 4ZHQA 1P91A 3KLPX 1GPWB 3JYPA 3SZGA 4GYWA 4UCWA 1H2XA 3GARA 1KXJA 3RC2A 2DXIA 5JXWA 3PQ6A 5DM0A 4DTIA 3O5AA 3UJCA 4DMLA 1NASA 3ITDA 4LOIA 3U4MA 1CLEA 1Y8CA 4U7DA 4OQNA 3FYDA 5BYBA 4D3XA 5HIJA 4BU0A 4ZEWA 3T52A 3MRSA 2GWHA 3QA9A 4N39A 1VKRA 3FPFA 1HEYA 4KXMA 5EQJB 4MQ5A 1EBBA 1CNEA 4WSOA 3I72A 3LHKA 4TTVA 1IM8A 1Z18A 3CR7A 3IBCA 5KCZA 3FVWA 3WNCA 5EJMA 5EVJA 2W6ZA 2FX2A 1JDPA 3ACDA 2V3VA 4K28A 2VL7A 2WINI 2GKGA 3CW2A 3DNMA 4TT8A 4A8JC 3RSOA 1LZLA 3NANA 3I4FA 4B7AA 1XKQA 3WAKA 1Z74A 5CBPB 3PE3A 3C41J 5CW1A 1A2BA 4MVJH 4W9NA 5HMLA 1KGDA 4CIVA 5FKJA 4FFSA 1F5SA 2WM9B 3AEQB 1TX4B 3MWJA 5ITSA 5CFLA 3E23A 3AT1A 2I6TA 5G41A 2BTQA 1N8NA 3PX3A 4Q3BA 5FQOA 1J21A 3P9SA 4OREX 1NA5A 1VCMA 3EDQA 3GYGA 4QUKA 1BMDA 4TKVA 2XNKA 1EXDA 4M1WA 3UOGA 4J8PA 2YKGA 5DXFA 3OZEA 4TPKA 3MOIA 4I55B 3SICE 4NFSA 1ZNYA 4ML3A 4NTZA 5ALDA 3MT0A 3W5JA 1CZRA 1KZ7B 1TA9A 3WLJA 1IJBA 3A36A 2XXAB 2Q0QA 2AD1A 2GCOB 4O2AA 2ZWVA 3TIFA 1L4FA 3R44A 4IDNA 2Y1KA 4RVCA 1CBUA 4PPNA 1IIBA 1PKEA 1GU0A 2E4XA 5A3SA 3RIMA 4E03A 2QUKA 4LJ5A 1RXIA 4MUIA 4F6LA 4UOZA 3QVXA 4YV7A 4HX2A 1RRKA 1ZMXA 3AHJA 3BE8A 4RYDA 2YMPA 3FFAA 4BO1A 1OAOC 4CKEA 3LK7A 3L1KA 2P4EA 1I7NA 1XMPA 2QLLA 1P45A 4IIFA 1SFRA 3IR6A 1CJTC 5CDUA 3VC7A 3I9JA 1NIPA 3HBLA 1IXRC 4QU5A 5EE5B 4C4OA 3AEXA 3UWDA 1ELOA 3D2BA 2VK8A 1ZH2A 2IODA 4P4NA 1XPJA 5LKRA 4DUYB 5GJVC 3S2YA 2RGUA 3OPYB 1O9BA 2B61A 5D3MA 1OFGA 3D6TB 1N2CA 3DVSX 2YCLA 4KE8A 3V97A 1RZ3A 1IRXA 1Y3HA 1KAEA 3EBOA 3HR7A 4HXFB 4MYCA 3UHOA 4BLRA 2FEOA 1HT2E 2NOAA 1GUZA 4L4SA 2JFPA 1AT1A 2QLJA 2X40A 1GPBA 4W1SA 3HKCA 3FB1A 3PQCA 2QB5A 3FKSA 4PQYA 3SNHA 5BSGA 5F7XA 3EQ2A 3L7MA 2G77B 4L27A 1RDFA 2ZJ2A 2NUTB 1Z7GA 5KUTA 2AFHE 1IHPA 1JTFA 6GPBA 1J8FA 3OQJA 4ZDJA 3SVZA 4DLKA 3USES 1E9VA 4DMHA 3L43A 3IRVA 2BBSA 1HOTA 3VTAA 4LF6B 3NUGA 3RCBA 1H2WA 5EXXA 1O2DA 3B5IA 5THKA 3V8BA 2F64A 1RWBA 4I50B 3NX4A 5FRDA 2VDWB 3BWYA 4B8ZA 1NM5C 3VPBA 1HL7A 3OE1A 4PRYA 1WS6A 4X93A 3WQQA 5ETJA 1K6XA 1YGYA 4JYZA 5MN4A 5FBWB 3WFIA 4B6RA 2BM8A 4EGJA 1FUEA 2G1UA 1NV8A 1TPYA 2F1IA 2VPPA 1W44A 3OWHA 1XLVA 1YHZA 5AOBA 3ASUA 5I9BA 4D3YA 1PS0A 2WF7A 4M37A 2HQOA 4RGVA 5AK0A 1TC1A 5FWAA 5CLLA 4QDKA 4WCVA 3DHWC 5FHQA 3RC3A 4KOAA 4Q47A 2XGSA 3JZDA 1BVRA 3R5JA 3T7IA 2ZUTA 3VPDA 4E21A 1V8PA 2O07A 2QX4A 2ECPA 2ZIUB 5IC6A 1F06A 3IC5A 3IO3A 3KJZA 1PKXA 3P2YA 1LX6A 2QN2A 1D2RA 2NTNA 4MKGA 1J06A 4MRSA 4ZEOA 3W3AH 3B1VA 1PNVA 3B3QA 3ZQJA 5JD3A 3UWOA 2AI2A 3RHZA 4JX8A 3K4QA 5CNIA 5LD2B 4KZKA 3QPUA 2QJFA 2QZSA 4UBLA 4PX5A 1PO7A 3AR7A 4Q39A 1SBZA 1S0UA 2QNIA 4JYCA 4PLVA 4CL0A 3CF0A 3T12A 3A3KA 2C8VA 3E7WA 4QHTA 1PT8A 4M22A 3SZRA 1B1CA 4B2YA 1HDRA 1QR2A 4JEUA 3RBAA 4RUKA 5JCOA 3AFNA 3DAFA 1DARA 4KPUA 2HDWA 4IL5A 4XJSA 1ZGCA 2VYVA 4G4IA 1DG9A 1X1RA 2UU9B 1HRDA 3BBPA 5IJ9A 4UBNA 3AIMA 3HM2A 1MDFA 1B42A 1JALA 3G2PA 3L6DA 3MOSA 2VT7A 4YRGA 1CUHA 1B76A 5JXIA 3H5WA 2X6TA 4XX0A 3GMDA 3TE7A 1FP1D 2Y9PB 1DKUA 2DFPA 2OC9A 3IULA 5ITZB 8ATCA 1L4EA 2JLRA 2XUQA 3C3WA 3OOSA 4WJZA 1HL3A 2MSLA 2JZCA 5JLAA 4V0SA 2E4VA 4YMSA 5BNFA 4DC1A 3LLCA 3T34A 1OE0A 1T0PA 4NPHA 1DT3A 1DAIA 2IXEA 6PFKA 3PIDA 3MPOA 4AROA 2G28A 1B0UA 3IAS6 2WRZA 4GLFA 1S6YA 1MEOA 3M5CA 2EG9A 3M1YA 1U2RA 1RWMA 2RIPA 1CDDA 2VCEA 3KQMA 3ILXA 2V9PA 3LC7O 3M4YA 2HCJB 3PC4A 4JKYA 3RW9A 4KRGA 3DDNA 3NHFA 4G0NA 3PFGA 4HNQA 4MRNA 2QAGB 3GPIA 3G68A 2ZAYA 3NS7A 3I04M 3UK0A 4A73A 3OZWA 4BV9A 4GI7A 2C3OA 3WOVA 3SIRA 4CV1A 1PYGA 1FFHA 3ENKA 3A4TA 2EJWA 3OT1A 4G97A 1HKUA 4O1MA 3H1FA 4RF4A 2NLOA 2ZE6A 4Q4LA 4YRMA 1LSUA 2OUIA 4D8WA 5E4JA 1Q0ZA 1R4MB 1SQGA 1E60A 5IULC 3N74A 2QSZA 4FS3A 1N1MA 3NT2A 4LQCA 4N0MA 2E7ZA 1E6WA 3MJHA 2VXOA 2Q5HA 1TECE 4JC8A 3OE7D 1J70A 1J5XA 3DTNA 3SEQA 2J09A 4DQLA 1FC0A 2CZGA 3PDIB 4KTTE 4YMIA 4EB8A 1TQ2A 1VHTA 3AQIA 4PFKA 1YBFA 4TTPA 3ZHOA 3WLNA 3SX2A 4DABA 5M29A 2FG7C 3LY7A 2XQKA 2IOFA 2O7SA 2ZTVA 4RQBA 4JOBA 1TCVA 4U2BA 5EE3A 4QNNA 4BQOA 1HSOA 2DPGA 4Z7OB 1YJBA 2DKFA 4AY6A 1EXMA 1NBMA 4WDRA 2FEMA 1P1FA 1T2AA 3SMVA 2ZT7A 2OLKA 3NBZC 2V6FA 4RSGA 1RI2A 1ZESA 2XXJA 3BUSA 1A8QA 1P2BA 3DD5A 4JKOA 4JLAA 1Z75A 4JXXA 1DNPA 4I5EA 2JFXA 1F6BA 4MKHA 5A3QA 3CNBA 3Q40A 2PS0A 5D6NA 1GT6A 2ZBDA 1RVDA 3OOWA 4JELA 3Q15C 4C4TA 1D5CA 1E3JA 2C1EA 4D42A 4H3HB 6REQB 5K51A 3H11B 1K7YA 4LXIA 1EVIA 4RK7A 4ZXPA 3CLSD 4Q7MB 1A3CA 1T2CA 2BPOA 3FTPA 3QH4A 3K9LA 4LI0A 4MO2A 1XNRB 3Q87B 5HCIA 4OM8A 4TSKA 3A6FA 1OT3A 2V4ZA 3ZC3A 1GL7A 2WVGA 3LAWA 1ONBA 1PJ4A 3KDSE 2BEVA 4IFTA 4K6FA 1U7WA 4KG7A 4PGMA 3RWOA 4B3HA 4KL8S 5ES3A 4MVJD 4DWWA 2XMRA 3GFBA 1EJ2A 2ASVA 4HDNA 1FNBA 2P6UA 1IXKA 4INJA 2JGEA 1G64A 5IHXA 4FWIB 1L8QA 3CPJB 1RW4A 3AM3A 3E03A 4MIKA 1NN5A 4QICA 1ZNXA 4Z4HA 2J3DA 2D1RA 3UF0A 2GN6A 3K9NA 2W6OA 4G5GA 3TQTA 5F7OA 4LTMA 2VJYA 3BA1A 5AKKA 2H48A 2WUGA 3FN4A 1F2DA 1WBDA 2DR2A 4OAOA 4R1OA 3FWNA 1RACA 2O1XA 4YMUA 1X9HA 5EWMA 1WSWA 2J48A 1UM9B 4CMIB 5C7LO 2O2GA 4GX5A 4P38A 5LC1A 3U19A 3AY7A 3GVXA 4IWNA 4N76A 5C1DA 3K5PA 1P2TA 1KYZA 1A5AB 3FGOA 2PS3A 2VAPA 1SUSA 4TL7A 5CT6A 2X0FA 3RU7A 4B3IA 4CMGA 1JEEA 4G09A 4ZDKA 1XZEA 1SAYA 5F5NA 1T2UA 2GKOA 2V45A 3N2YA 5DT9A 5JJKA 1T8PA 1P7PA 1V5WA 2ZS9A 3L01A 4BX0A 3LWZA 1JYEA 5JXGA 2A5DA 4KXYA 1A4XA 3H9EO 5DCUA 1CJKC 3D2CA 3JQAB 3PHBE 4GI5A 4PQEA 4QELA 4Q48A 1YNOA 3LECA 1KC3A 3BWBA 5FBHA 5K20A 2OXFA 2QUAA 1LJ8A 3KLNA 3QVMA 4WOCA 3WIUA 4MVJE 5JS1A 4NDAA 2JFGA 4NEQA 2IXGA 2BMFA 1ADCA 1M2WA 1TZBA 2ZCUA 4GXRA 1E1CA 3THYA 1LQTA 3IA2A 1NZJA 1QWSA 1T1EA 5KPJA 3IEMA 1ZZGA 3V8VA 3KHTA 5DNUA 3IAXA 3DHVA 1BC5A 2OG1A 2NU9A 1NL3A 3F97A 3KL2A 2HF9A 4NX2A 2CVHA 4XLZA 2CLIB 5K8LA 3GRFA 4MI1A 3D6MA 4M7OA 3DW3X 1GHTA 3MELA 4JL5A 4V0OA 4PQGA 3VBCA 3QPWA 7GPBA 1C4WA 2AGVA 3PPXA 2AXEA 1Y82A 3Q10A 4FFBB 5KOHA 3I61A 1K92A 2EX4A 3WG9A 4DXAA 3UOAB 3GLSA 3ZY4A 2PXHA 1W4LA 1WHSA 1RCFA 3N0WA 4LRYA 1H0KA 3SKVA 1W4CA 1V3UA 4NJEA 2Y1LA 6LDHA 3FBGA 4O1HA 5A3RA 1KYVA 2TRSB 3T9DA 1G3QA 1HQYE 1ZU4A 2PZGA 2A1UA 4RTMA 3HE3A 2CT8A 1M0EA 4OQXA 1XLUA 5G2OA 4ZIRB 4Q16A 3VSDA 3CLSC 1HE8B 2ZYWX 3OM1A 5IVPA 5CCBA 3FXAA 4Y67A 3AUJB 4JKIA 5AVKA 2ILTA 1CJUC 5FL7D 5KU1A 2JCBA 1PEKE 3K9BA 4P92A 1GJRA 4YJGB 1E20A 4C20A 1LRJA 1THMA 4TXNA 4S35A 4YJHB 2DUJA 5FBZA 3VVBA 3ROKA 2I7TA 4DYVA 1FDTA 1XDSA 4MGEA 4M8KA 1WBBA 3ITKA 4CVNA 1EIWA 1PFVA 4ARCA 4NOLA 5F23A 4GBMA 4KQ6A 4LY3A 1IAQA 4IINA 2F8TA 1Z5WA 1S2OA 5GV7A 1RTTA 1VYVA 2R84A 4H1TA 2RCNA 1D6NA 4G9EA 4IIVA 2BF7A 1P5ZB 1DC5A 1W36D 3DVQX 4UATA 3AM4A 1DIAA 3DOUA 3D6NB 4DCCA 2A1IA 4KYIB 4U7TB 3AR5A 3T7JA 5IBPA 1OZHA 1F8XA 4HEJA 4E7PA 1AX9A 1MB0A 4XB6B 2P9EA 4BZWA 2C7RA 4BFSA 1EQAA 1VYTA 1NOKA 1QKJA 3TO5A 1K7XB 2YVLA 3WYBA 2P4HX 2OZEA 4PIMA 3FGPA 1NZDA 5IBRA 1BRTA 5I7SA 2HA5A 1OF1A 3SJBA 2BVNA 1VL6A 4CM5A 3UOWA 2Z8YA 5LA6F 3VNUA 1MQ9A 3OQ6A 5D6OA 1AZLA 5JS2A 4YV0A 2FEAA 2X0JA 1IXZA 4X24A 3TIVA 2IQIA 2Y1OA 3E6AA 4F2DA 2UYHA 2TMYA 5C4GB 3I9OA 1QVVA 3HC7A 2VHWA 2JFFA 5B7PA 2OHVA 5EY5B 4CM8B 1MG0A 1GPJA 4POAA 5TMPA 3SYKA 4LNUB 4DCVA 2JJQA 1P4JA 2IUUA 1A9YA 3WTCA 1BAPA 2X5OA 3OUUA 3TQIA 1EE1A 4EPXA 5J2UA 2F4VB 2W6JD 3S8MA 4C5BA 3KZVA 4K26A 1OFIA 3VC2A 1VL5A 5KTPA 3QI2A 2AF4C 3OESA 1GRNA 3RF7A 2F90A 3AETA 4QOHA 4WFQA 1U8EA 3C6KA 4ZCLA 4E1AA 1JQEA 5BQ5A 1Y3DE 5D3ZA 1N2EA 4DWJA 2O2DA 1CR6A 4YJ2B 3IVGA 1JXMA 4RE6A 4UJ3A 5EYPA 3LIPA 1VLHA 1RLOA 4GE3A 1XQYA 4BP9A 2FFQA 1I5OA 1N2HA 1W87A 2XOEA 2VP6A 3IALA 3WYAA 3AHFA 2HUPA 2Z4TA 3DQZA 3SS8A 3A1NA 1B8PA 1T4CB 2IEGA 3IT0A 2JAHA 2IC5A 4D3DA 4EZIA 1QH9A 1I0ZA 2A67A 2HY7A 2ISSD 2BHNA 1DCMA 2Z2YA 2NV2B 1C9NA 1Y5IA 3LNTA 4MUGA 1NX9A 4XPIA 3Q8WA 5BWBA 2VSNA 1GZ6A 1SULA 2MMGA 3OJLA 4GM4A 1U0SY 3EDRA 3O2JA 2CD7A 2WM2A 3KFXA 4I7EA 4JBHA 3AL2A 2WABA 2JFNA 4G1UC 1JTEA 4JJZA 5J4HA 2PZ8A 3CE6A 2QG9A 2I3ZA 1Z8DA 3PCRB 4DV2B 1UJMA 4RSRA 2IH5A 3LPNA 2HXGA 3DMRA 4G23A 1IAVA 2PH3A 4HTFB 2DC1A 4QBTA 1GPDG 2J5XA 4JK3A 5EIWA 5G0TA 1Q3TA 3JARB 5J63A 2AVDA 3OVMA 2A88A 1JDUA 3H04A 3OZSA 3OU6A 3FM9A 2UVPA 2V7QD 3CX8A 3DE0X 3Q7QA 4NBSA 4N5DA 1H2FA 3HEMA 3DDHA 3L04A 3PGXA 2HO4A 1PW5A 3A27A 3H1TA 4OQLA 2MSDB 2X8LA 2GYUA 4D9JA 3JQ7B 4S1VA 3F49S 4KGZA 3RT9A 4FYPA 1KO8A 4TKUB 2QRUA 1V25A 4DA9A 5AUOB 4M8IA 3WDLA 3AR4A 4E09A 2PQ6A 3DQQA 4B2PA 3GUCA 2ZS7A 5DSTA 1W36C 3GCXA 2RK6A 5BSVA 5IZCA 4XH9B 3QFSA 4UNQA 4KO1S 4M9ZA 1XMVA 2ZFUA 2I6SA 3RS2A 1Z0UA 5KQGA 1KYIA 1Q3KA 1YIAA 4ER7A 4MV1A 1UK7A 1JJAA 4NBUA 3OT4A 5B6JA 3RQSA 4Q1EA 4YECA 2OILA 4WXEA 2ZJ5A 3ZR4B 2R87A 3B6KA 3UG7A 4CL8A 3R9IA 5KMGA 3GAAA 3HS3A 1LD3A 2HCFA 3VHRA 4OXRA 1MRZA 2ZANA 4NSNA 1RLUA 2A9VA 3RWMB 3THXB 1VECA 1Y9DA 3ZV7A 4CM3A 1V0JA 1RIFA 1VL8A 3VZBA 2N47A 4DBZA 1N8KA 4E5PA 2ZSIA 1C1XA 2CEAA 4U8GA 4MYHA 3BSFA 5G53C 1U5BB 3THWA 3ZHXA 1IEWA 3UBTA 3NWPA 3DC2A 2HMAA 1CVIA 1G5FA 3JQRA 5BSEA 3FCOA 1GY8A