4BNDB

Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
253
structure length
253
Chain Sequence
b'AMKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKYDQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALEKAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLASQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYPVVQMGIETITVRDWKETAAILKAIIAMEEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-PHOSPHOGLUCOMUTASE
publication title High-Resolution Structure of an Atypical [Alpha]-Phosphoglucomutase Related to Eukaryotic Phosphomannomutases
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Isomerase
total genus 91
structure length 253
sequence length 253
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4bndB02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4bndB01
3EWIA 3BWVA 5AKGA 3W5AA 3UMBA 3SF0A 1Z88A 5AI9A 3KZXA 5ALDA 3UM9A 2HI0A 4UAUA 4Y2UA 4EX6A 5A3RA 2C4NA 2G0AA 3AR3A 1JUDA 4Y2QA 2NO4A 3SLRA 3QU4A 4C4SA 3FM9A 1RDFA 3PCTA 4KNVA 4E88A 2HOQA 3MC1A 4UW9A 5AI0A 3WKBA 4UATA 3DNPA 3NRJA 1ZD5A 3WGUA 2ZOSA 2OA0A 1ZJJA 5AM4A 4DFDA 1Z4PX 5AW5A 5AK5A 4FE3A 2AMYA 2HF7A 1CR6A 4G9BA 1O03A 1AQ6A 4EZEA 1X42A 1YV9A 2WF7A 5AVXA 5ALEA 3EF0A 4O8CA 2P9JA 4AS3A 3MN1A 4UU0A 1Q92A 3L8EA 4I9FA 2HSZA 2RARA 3WKCA 4EX7A 3E58A 4F71A 2FPUA 5AKZA 3HYCA 5AESA 4YH1A 1U2TA 4OHFA 4BYGA 2I7DA 3FPSA 4HGRA 4KX5A 1J8DA 1TJ4A 2YMLA 1Z4KA 2GO7A 2YMPA 2YMMA 1T9ZA 1SU4A 2YN4A 1QQ5A 3NASA 4YCMA 2G06A 4BBJA 4J03A 3ZW7A 4UM7A 1ZD2P 1LVHA 5ALOA 1WVIA 2HEGA 2JAUA 5AW0A 5AM3A 3UMCA 2CFRA 5AKEA 3KC2A 3GYGA 1ZRNA 1FEZA 2ZXEA 4Y2PA 1TA0A 1S2OA 4L6CA 1YNSA 4MUMA 3ZWDA 1L8OA 3B8EA 1RKVA 4GXTA 3WGVA 2YFYA 1S8OA 3R9KA 3QXGA 3OCXA 1N9KA 2QLTA 1TJ3A 5AKLA 3L8GA 5ALWA 4RETA 2ODAA 4UMVA 2DQSA 4UM5A 5AM1A 3ONNA 3L8FA 3U13A 4NAVA 2JARA 2HDOA 3RF6A 1XP5A 3ESRA 1QH9A 1U7OA 5AKHA 4C4RA 4YIKA 2I33A 2HX1A 4MWOA 4AS2A 4FFDA 3D6JA 3I28A 3ZVMA 5AK6A 4PNHA 5AW4A 3AR6A 2FPWA 3RFUA 4HAIA 3E8MA 1RLTA 2FI1A 3L0CA 5AW7A 4OFZA 3N07A 2Q5EA 3ZTYA 3KBBA 4BNDB 5AI5A 2FDRA 3ET4A 3F9RA 3ZU6A 2FPXA 4ZEXA 1TE2A 2I34A 1Y8AA 2C88A 1Z4QA 3DV9A 3IRUA 4HGNA 5AM5A 3QYPA 4HYTA 2RBKA 2ZBGA 1NRWA 2C9MA 4UMDA 4ZEVA 3AR9A 2B1QA 3K1ZA 2R8EA 3ZUPA 1VFPA 4UU1A 3ED5A 1O08A 5AKIA 3MMZA 1RMQA 3TLMA 3L1VA 3EF1A 4NFLA 4UASA 3NALA 5ALRA 3QU7A 2GHQA 2NO5A 3R09A 2GHTA 3SKXA 1KYTA 1QYIA 3AR4A 3ZX5A 4EEKA 5IT0A 5ALMA 5ALNA 4G63A 3PGLA 1CQZA 5AW9A 3L5KA 2EARA 3E84A 2EAUA 3OCVA 4YIHA 2FUCA 3OCWA 4ZEWA 5AICA 3ZX4A 2X4DA 4YCNA 3M1YA 3QX7A 2HHLA 2R8YA 2FUEA 5AVSA 4NV0A 5AKYA 2OYCA 1Z4NA 3L1UA 3QUQA 2I55A 1Z4IA 3WKDA 3WK4A 1NNLA 5AM0A 4CF3A 1Z4JA 2B8JA 1RPZA 1U7PA 2CFTA 5AIBA 2BDEA 1SWVA 2C8LA 4Y2XA 5AK3A 2ZG6A 5ALTA 1T5TA 2AH5A 3FGOA 1T5SA 5A3SA 3ZVLA 2O9JA 1PW5A 5AM2A 3U19A 1L7MA 3L0YA 1RMTA 2YY6A 4HGQA 1K1EA 4DWOA 2NYVA 4BEWA 2O2XA 3QUBA 2FEAA 3I6BA 3I1YA 4CF4A 2HF2A 1J97A 4XPZA 4B6JA 1WPGA 4NABA 1RKQA 1ZD4A 3ET5A 4FYPA 4XQ0A 3WK6A 3WKAA 5AVUA 2B82A 3CZ4A 4CE6A 2AGVA 4KX3A 1EK1A 4XOUA 5ALPA 3NANA 5ALJA 2JAOA 2WF8A 3OCYA 4I9GA 4Y2JA 2OBBA 3FPBA 5AI8A 4YGYA 4YCLA 5AI4A 1L8LA 1L6RA 3QLEA 2MSNA 1RQLA 3A1DA 1RQNA 4DW8A 2IOFK 3KDPA 5ALLA 3N1UA 3AR7A 3M9LA 3N28A 3L8HA 4BEVA 1EK2A 3SKYA 3OPXA 5IT4A 1LTQA 3PGVA 5AVVA 4OCZA 3IB6A 5ALSA 2C8KA 2YJ5A 3U7EB 2CN1A 3UMGA 3SMVA 2B1RA 2WHEA 3QU9A 2G07A 2GMWA 5ALFA 2G08A 4EENA 5AVYA 2W4MA 3U7FB 5AIAA 2WF6A 3AR2A 4Y2VA 3A1EA 2B0CA 1SWWA 4JB3A 2GFHA 4UAVA 2I6XA 4QJBA 1ZD3A 2VKQA 5AKXA 5ALKA 5AVQA 5ALZA 5ALUA 1NF2A 3WKEA 1TJ5A 1Z4OA 3L7YA 3NIWA 5AVWA 1QQ6A 2PQ0A 3NUQA 4L6AA 3AR5A 3EPRA 3J7TA 3OCUA 5FP0A 2ZBEA 3KOOA 5AK4A 4H1WA 4IG4A 4XE5A 1U02A 3B9RA 4BX0A 3N5KA 2WF9A 2YJ4A 5ALIA 4OD0A 5A3QA 2R8ZA 5ALXA 3U26A 1U2SA 2HO4A 3CNHA 5AVRA 4EELA 1Z4MA 4HGOA 3QU2A 1XPJA 2BY4A 3E81A 4L57A 5AKJA 2PKEA 3QNMA 3OCZA 2G09A 4J2TA 1Z5UA 4KNWA 1RRCA 5AW6A 1ZOLA 5IS2A 3NAMA 3A1CA 1RLOA 3W5CA 2YJ6A 4QQFA 4UARA 2I54A 2JAWA 3ZWKA 3WK5A 3U7GA 3DDHA 3QGMA 2QYHA 2RAVA 3QUTA 4CNQA 1VJRA 4F72A 2FPRA 2W11A 3ZTWA 1RC8A 3P96A 2G1AA 3MPOA 1RKUA 3VAYA 4Y2YA 2Q4TA 2PR7A 5AKKA 1L7OA 1F5SA 3R4CA 2HCFA 2Q4RA 1XVIA 2P69A 3PDWA 4UMFA 1L7PA 3QU5A 5AHXA 1VJ5A 2WF5A 4KN8A 4Y2TA 3IJ5A 5AVZA 1Z5GA 3FZQA 5AW3A 1YDFA 4DCCA 5JJBA 1ZS9A 3SD7A 2G80A 4BX2A 5AW8A 2R8XA 2RB5A 4BKMA 1RMYA 3B9BA 5AI6A 2P11A 5ALQA 4KYTA 1Q91A 2W43A 3WK7A 1L7NA 2WFAA 5AW1A 2AUTA 3W5BA 3A3YA 4GIBA 3WK8A 2B30A 3BA6A 1WR8A 4BNDA 1YJ5A 1N8NA 4Y3UA 3S6JA 2WM8A 2IYEA 1YS9A 3ZI4A 4RESA 1YMQA 1MH9A 2D2VA 2BDUA 3U7HB 5ALGA 5AW2A 4C4TA 3QUCA 3ESQA 3I76A 2JGAA 2YBDA 2ZBFA 4BX3A 3HLTA 2P27A 4JDPA 4AP9A 2FPSA 4HGPA 4NWIA 4UMEA 4Y2SA 4CF5A 1QQ7A 2IOFA 3SHQA 3WK9A 1Z4LA 2ZBDA 2YJ3A 1WZCA 2EATA 4IFTA 5ALYA 3ZVNA 5ALVA 2OM6A 3N8GA 5T41A 2CFSA 1ZRMA 3W5DA 2B8EA 1RLMA 3OTQA 3FVVA 3L0BA 5AVTA 2YMQA 4Y2RA 5E0OA 5ALHA 2MU1A 2IOHA 1IWOA 3AR8A 3DAOA 2IA5A 3KD3A
chains in the Genus database with same CATH superfamily
1E2KA 3W5AA 4YDHB 1TUBB 1DC5A 1YS2X 1ZD8A 2BL4A 1M54A 1F0NA 2AI1A 1V7PC 2YHIB 4XDYA 5DCYA 3W6PA 2Q9CA 2YXBA 3NBUA 3TCXB 4IH1A 3VU3A 2PT6A 3A3OA 4OLJA 2RIPA 3WLLA 1VP9A 4R1MA 5DGHA 3H5WA 4I1UA 5F1YA 3QPWA 3G0CA 4QGHA 3ZE9A 2B78A 3ZY3A 5KSWB 4H1VA 2DPYA 3H3XA 5K3FA 3TIIA 2HU8A 3TZKA 3G9XA 4RORA 4UATA 5CCXA 3K1JA 3ZY2A 4LHVA 2DPLA 2BKXA 4UFPA 5KC9A 4WLUA 1R0ZA 1XEFA 1U7HA 5KDDA 4M1QA 2A9OA 1ZZGA 1UMBA 1ZPDA 1DEAA 2R48A 1GGVA 2YRWA 3AUSA 3P9YA 4IVPA 1OXBB 3KVYA 4NCXA 4Q9KA 4QXQA 4XEUA 5D3MA 2YNMD 3SCZA 2AMYA 2KLBA 1CDEA 3EA5A 3BD6A 1LWNA 1AQ6A 2AOTA 2HHHB 2PUEA 1FYXA 2OAP1 3MUEA 3IR5A 2VNKA 4KXWA 4PYRA 4UEJA 3UFBA 2PUBA 1XZGA 3R7BA 2Y68A 4TYPA 4YYZA 3DHNA 5K20A 4QOHA 4Y1FA 5EQFA 3E22A 1B8PA 1W4LA 4DJDC 2OAGA 3UCFA 4TX1A 2G9VA 1GL7A 4PZPA 5E7QA 1RP1A 4IUYA 3CLUD 2ZB2A 3MG9A 2RARA 1HBJA 3O4GA 4DHWA 4EY8A 1DAFA 1XD8A 1I3LA 4F60A 2Q46A 4YA6A 5D6OA 1P2SA 2VK1A 4G4GA 4Q7JB 4Q93A 4YH1A 5TE9A 2I3BA 4WFIA 3SZLA 2PANA 3B53X 3WNZA 5BWMA 4K9LA 4F4CA 1LBEA 2W2NA 3R5KA 4O25A 4X8MA 1USKA 4P7JA 1C1DA 4LF7B 4AP5A 2BZ0A 3GLHA 3UWDA 4EHKA 1ULSA 3B3AA 1KEWA 3COZA 3CZMA 2PSDA 3JYPA 1QOQB 2CJPA 4R81A 5HP4A 4KNYA 2R60A 2NTNA 1C7RA 1XJ5A 3G5UA 5AHRA 4Q00A 1G5IA 2F48A 3O75A 2H16A 4IDFA 4HNUA 3AEYA 4CKYA 5FBVB 1Q0UA 2FPGB 2UAGA 1L5VA 3PUWA 3QW4B 4V0OA 4Y0NA 5T67A 3WLMA 4YRBA 3QLTA 1AIPA 2H54A 2WI8A 5BN5B 5J59A 4DLZA 3V4SA 2P3LA 4HMOA 4LBVA 3U3RA 3A2KA 1DQPA 4TS9A 4QG7A 4YWHA 4J03A 2IUTA 2GLXA 4QL3A 1SQSA 3KJZA 2FH5B 3SC2A 2DLDA 1A72A 3A31A 3K4HA 4RLFA 1JMVA 3TJRA 4H6XA 3WMWA 4PZAA 1CULC 5BVGB 2XGJA 2RGEA 1E9FA 3N5CA 3ZDAA 1JU9A 3BB4A 2XUPA 2QBYB 4RTJA 1Y0BA 1M7HA 3R3HA 3T1OA 2BMEA 1TA0A 3SIRA 3BSFA 4MS4A 3N53A 4OJYA 4MLCA 2OV2A 3F2IA 4J6EA 3O8BA 1R9NA 2QTBA 4LXXA 4N3AA 1D6JA 4L76A 3SJZA 4W5JA 1LBSA 4NFYA 4N39A 1KK1A 1VB5A 1N2JA 5HE9A 5IK2D 2PX2A 4CTMA 1LK7A 2W8BB 1JKIA 1TJ3A 2ZUSA 2C9BA 3AFNA 2ZRCA 3L8GA 5C5CA 1RD4A 4UNSA 1L4UA 3LYAA 3DE2X 3W1VA 5C81A 2CCKA 3JY6A 1MVLA 3QOFA 2K2WA 1H94A 3QE4A 3F6PA 3RC8A 3RBAA 3NOXA 1T43A 2XQIA 3T4XA 2W6PA 3MD9A 2RKWA 1HDZA 1WD5A 3IQDB 1N92A 2GRJA 2VF5X 4MH0R 3TDMA 4A82A 3Q3CA 4BTVA 4E2XA 4FMCF 1XKTA 2ODWA 3S0JA 1IWPB 2YICA 1Z73A 2ODPA 3E0XA 4AS2A 3LGXA 1NLYA 1P1IA 4G01B 5CVCA 4C03A 1CRWG 1KI4A 3ZZMA 3LUBA 4G07A 3G0HA 4V2IA 3R7FA 3UGTA 1L9KA 3AUAA 4DCVA 3BRSA 1BS9A 2FI1A 1ZOOA 3V4LA 1GNSA 1I9CA 2P4SA 3B1FA 3JQEA 3BSWA 2P6PA 3EVEA 3I34X 1SXJB 3V1MA 4A8TA 4C4XA 4CV0A 1DCMA 5BWLA 2Q3LA 2EERA 1VJTA 1IC6A 4DQ0A 1HLFA 4IKEA 1A9PA 1OMOA 5EPEA 1FOEB 5LP6A 1P31A 3ET4A 4L72A 4N0PA 3A1TA 1E7QA 3N0RA 4AYWA 3E9DA 1QIKA 3ZU6A 1F14A 1SOVA 1UDCA 2ZPUA 3C6KA 1KPIA 4FOSA 4I50B 2D00A 3PKIA 4PBRA 1TE2A 1I7NA 1ZM2A 4FFBA 1OVGA 5DYNA 5E2IA 4KR2A 2IYRA 2BJWA 2RGYA 1AKYA 2Q5QA 2QN8A 2ZPTX 5CH5A 3UB4A 3U7IA 3V46A 4NSNA 2HL6A 7GPBA 3PPIA 2QORA 4FDVA 5DX1A 1WCWA 2FWBA 1PWYE 3FHTA 3R9XB 5IT5A 3F90A 3UV7A 2BUCA 1H0KA 4NYJR 5GV7A 4M1KA 4E1VA 2FK7A 4C3UA 1GADO 3AI1A 1RS0A 2VHCA 1RAGA 3IMFA 4RQTA 1SG0A 3ZUPA 3ZWQA 4Z51A 2HCRA 5E6SA 1RXVA 1U0GA 4B4UA 3FZEA 3CUSA 3D02A 1M8GA 1BXRA 2MYPA 4MEBA 4ZYLA 3LLUA 1R88A 5ITVA 4WZZA 3DE3X 4CEHB 3D4BA 5BR8B 2WJ4A 1WV0A 1DX4A 4B6SA 2YWEA 1J2UA 1PR1A 2Z8YM 4O2BA 3N6XA 3IDZA 1E5XA 4OFWA 3D5EA 5CFNA 5FKJA 4EFNA 1Z7GA 1GSOA 4OJNA 4MJ3A 4YT4A 4OX9Y 4BFZA 1D9XA 2WHPB 2OMEA 3G2JA 5ALNA 3TTXA 3WRWA 1A5TA 4A73A 5KHLB 1PNOA 2OV6A 1ZSNA 5T4HA 4EG7A 1Z3CA 3CUVA 3GJ3A 3HDVA 3I8XA 1J21A 2J0EA 2ZU6A 3QQ5A 4DV0B 1NMQA 2VDQB 5DYTA 1RM4A 1CY2A 1SIWA 1OXUA 2ZYDA 5JZBA 4OYHA 1AZTA 1ZGBA 5KJ1A 4TL8A 2O8CB 4EQ6A 4ZI2A 1OYWA 4CCYA 3O5AA 1QIMA 5KYXA 2D06A 4KG7A 1R4ZA 2QD3A 5H9WA 3FSJX 1U7TA 4F3CA 4KUGA 4TTSA 1P8AA 2NYUA 3A04A 1SO8A 3QUQA 1U0RA 1Z6TA 2X0DA 4WQMA 3M5WA 1FUUA 4UTZA 1MMFB 4EYSA 3X2EA 1Z4JA 4CF3A 4G0YA 4OQPA 2IZ5A 2R66A 1Z0ZA 2CZQA 3Q4GA 3DTVA 3HZRA 4CRWB 1Y34E 3K53A 4Z7JA 1PW5A 4QJIA 4AG6A 1QG2A 2A92A 1RMTA 3EW7A 1ZIDA 3B52X 2NSJA 5K8UA 3CJQA 2DHDA 1XMXA 4YP1A 2FQYA 3TLBA 1K88A 2Q2QA 3OY2A 2E4YA 5IAKA 3TZQA 4FEGA 4BEWA 1GDTA 2HQOA 2YZ2A 1K5GA 2Q8QA 4YO8A 1G8FA 3FVWA 1QONA 3I1YA 2F6RA 4FMBB 5F1PA 4AIIA 4CM4A 1A4UA 4YR9A 1J97A 5J9FA 3CKYA 4KQEA 5LC1A 4XVHA 1T8TA 3LCRA 4JLJA 1TKAA 3Q3EA 2P1RA 1OU4A 1XN4A 4MO9A 4BO8A 3AIOA 1EFHA 4G85A 1TK2A 3QKSA 5DE3A 1R3UA 1OTHA 4R3NA 3QFHA 3WKAA 2DFLA 3JQ9C 4Q34A 5LBUA 3TINA 2ZR9A 4I7EA 4EHDA 2AGVA 1PUIA 4BUJA 5CGZA 4CM3A 5KC8A 1U6JA 2ZJZA 5B7GA 1A4IA 3NANA 1QUEA 4XCXA 5JSQA 2A4KA 5JE8A 3SHVA 1VB3A 3OCYA 4BNVA 2JCGA 2IXDA 4ZVQA 3G8YA 2BR4A 1YE3A 3BL5A 4MJLA 4CTKA 3KHUA 4K6CA 4FT4A 1D0SA 2NO9A 4Q7LA 3B5IA 3I1FA 3VHLB 2IEAA 3IOEA 3PIIA 4FS8A 3TQIA 4FMDF 3I0MA 4BMCA 3PC3A 3VJLA 4OYYA 1J06A 2OCAA 3GG9A 3BT7A 3IAM6 1GAXA 2QZZA 1EUCB 1YRBA 3AW9A 5CVUA 3T7DA 2X2EA 3PCRB 3HVHA 5TXGA 4LXIA 1OZ0A 4TKUB 1PZMA 2OGZA 4N41A 4G0UA 4IIEA 3N1UA 5LQKA 3C4VA 5JJ5A 4TZ0A 1EBFA 5E1BA 3CZ5A 4G5GA 3CRMA 1MX3A 1GDDA 4M1MA 4ESOA 4P6VF 5ECDA 3BK7A 1CPYA 3GFSA 3I2FA 5KYGA 5U9CA 1JBQA 3IE2A 2XDWA 4YJ3B 5CLJA 4HYYA 2ZJ7A 1YBAA 3ZKWA 2YJ5A 1N36B 1VJCA 3RNOA 3Q1LA 2X9GA 4QODA 4RY8A 3SDBA 4H7KA 5L3SB 2C4TA 1AUVA 3WSWA 1Z68A 4EF5A 1VLJA 3G8AA 4U2KA 4UBMA 1A2QA 3R5XA 4QSHA 5CK5A 4OMCA 1RAHA 1WEHA 5G1PA 4MPPA 4OHWA 1WUHS 3C15C 3FYTA 3OZAA 1GWNA 2X9QA 2R4TA 2WHRA 1JIKA 3A1EA 3JYQA 3OLCX 3HB4X 1X9HA 4D8WA 2VAXA 4M38A 3LFTA 4QJBA 3EN0A 3W1WA 2AXQA 1ZX1A 2BTQB 1JLRA 1I7PA 4JIGA 3SX2A 2PNJA 4KPYA 3T3PB 5ALZA 1C7JA 1XDZA 2CB0A 3MEQA 2ERCA 5B1DA 2UYQA 3NC0C 4BNMA 2CMKA 1SXJD 1Y7TA 3GJRA 3VBEA 1T3ZA 1TVCA 3A28A 4U7PB 5FUQA 3HNOA 4J0DA 5AVWA 3S8MA 3DV2A 3FLEA 3V8PA 3ZIUA 3PQ2A 3TXAA 3QVLA 4QPDA 1JLLA 1J0XO 3LHSA 3R40A 2IEZA 1WW8A 2Z5LA 1PQWA 1QV9A 3K30A 2QX6A 3KYJB 1YB1A 3DVAB 3HH8A 3BK2A 3K8QA 1P0CA 2F1HA 3DBVO 4L9RA 1P1CA 2VWPA 1X6VA 4I2VA 1UJCA 2HKIA 4I08A 4RGQA 1OASA 5D5QA 3P27A 4CUZA 4MAAA 2C57A 2FG5A 4QUAA 1U2SA 2I1WA 3IP1A 1V3QE 5JHHB 2AQIA 4GMFA 3N39C 4TQUS 2QK4A 4QGFA 3MWKA 5CAEA 2JKYA 3D3QA 1W0KA 1DOHA 3QU2A 1B0ZA 4C30A 1X0VA 3ZS8A 4LV6A 1H3FA 1D0IA 2V8OA 4FSHA 5CDTA 3WWYA 1H85A 1CVLA 2DJ5A 2PKEA 2GJ8A 2EIHA 1V43A 3BEDA 4LXTA 4MQUA 3RSHA 4EL0A 4FCVA 4TV9A 5BO5A 1ID1A 2LIPA 2Q2VA 4ZVUA 2YZNA 5I7RA 5KTKA 1VPTA 3HLYA 2LV8A 3NWEA 1W96A 1WY7A 4H17A 4YAUA 4QQFA 5JC1A 1KDRA 1KA9H 3O03A 4UARA 4WNIA 5IVDA 1N78A 3IULA 3L84A 1WIWA 1EFTA 3PIDA 4WD3A 1KEZA 1UCFA 3CCBA 4AF8A 4JR0A 1VJRA 1QRAA 1ZN8A 4J0KA 4JXXA 3UMYA 4X8HA 3G9TA 3THWB 4GC5A 4F9FA 5C8YF 1DJNA 1HLGA 1J70A 4B2YA 1U2GA 4HDOB 4JC5A 4ZZIA 2FWJA 1WXXA 4ANFA 3DEHA 1G4HA 2B3DA 3IAXA 4TKVB 1P6XA 4M7RA 1KO4A 4KO1S 1YU9A 4JQCA 2QR3A 5JJCA 4HADA 1UZNA 4Z0TA 4BAUA 1JJIA 1UC4B 5LJIA 3DHEA 4F12A 1KZYC 1F06A 5GJWC 4CFSA 5HKBA 4LDJA 1QFSA 3KQKA 4AJKA 4K6KA 5KYKA 4RY2A 2XYGA 1J5XA 1CP3A 3VZSA 2HMUA 2RIRA 3I0ZA 3RAPR 3RIYA 4PYJA 3R74A 2E3JA 2QMQA 1NMYA 1JHAA 4GU5A 2C2KA 4BY9E 1O94D 4NU5A 2JEYA 4GR4A 4HN4B 5LWQA 4MOWA 5EZ5A 1AMUA 3CLRC 5FNVF 3TRJA 3ZW9A 4Q16A 4DV2B 1E6LA 2IYAA 2VOJA 5CB4A 2ZM6B 3WK8A 5EZ6B 3S5UA 2HTEA 4GL2A 2OZEA 5EESA 2O2GA 3DAHA 4HNGA 2OENG 4U7JA 1SVUA 4M99A 4M8IA 2H85A 3UICA 2AFHE 1DBIA 2C94A 2ZJ1A 3B38A 3MWJA 3P2EA 3UV3A 3VYTB 2AKAB 3IBSA 4KKVA 4MYUA 1T0PA 4B80A 3VPAA 1RZUA 1GR1A 5HG0A 1HY3A 1X9IA 5B1SA 2JGJA 3DDSA 4QLOA 5ITZB 3P9RA 4WWHA 1NUAA 2WUVA 2CDCA 3JV7A 2Q8NA 3HLTA 3LS2A 4YDSA 4AP9A 3EC2A 4D0LB 2SCUA 2IPOA 3NC1C 4WCFB 3CVVA 2POCA 4Q12A 3E3LA 3THYB 1VBMA 4QYTA 4TYNA 5DHRA 4B85A 3LW7A 3T4UA 4MLDA 4JT8A 5ALYA 5LJLA 4KXYA 4N5DA 4UUQA 2QSZA 5I4BA 2IHTA 1PNVA 1DC3A 4Z8YA 4OA5A 1CVIA 3JWJA 3JATA 1GN9A 1RLMA 1ZICA 2QZJA 3QEOA 4X1IA 3SJAA 1XHFA 5U1PA 3M34A 1Y4UA 4BJHB 5BRAA 3DLHA 2Q5HA 4JX8A 3E2IA 2W6IA 1P1FA 1W87A 3PP8A 3E1GA 5GJVC 1GR0A 3DBHA 2O3UA 4L4XA 4KQKA 2E18A 1BWQA 4X85A 1KAGA 1E9EA 4GLFA 4II2A 5BORA 1I51A 4ABYA 5BWOA 2DPMA 3KB2A 1NJ8A 3MJRA 4ZQCB 4QYIA 1FDOA 2C2OA 3NBYC 4J75A 4JYMA 3OUUA 3LK6A 3DDUA 1Y4ZA 3A4LA 3O84A 5EUBA 3U3DA 3V8RA 3IJEB 4WXRA 2G17A 3OWHA 1AKUA 1CNFA 1Q1EA 2CF6A 1UJMA 4NDNE 2Z1MA 1GARA 3HADA 3VHXA 3H7IA 2LTAA 5AI0A 3MJCA 5EUMA 1JKXA 2XB2A 1KMMA 2VCYA 1UXIA 3HHPA 1MG0A 2CUNA 3NRJA 3V5NA 4BLQA 4ENTA 2G77B 3WRYA 1CZRA 1E96A 1L5HB 1DTEA 2GPJA 3G9ZA 1JFSA 4S1NA 2DBQA 2JFZA 3PFFA 1PSZA 5EJ5A 4DABA 5DLPA 2ZLBA 1JHDA 4Q4JA 4PC7A 2PZEA 1K4KA 3RKSA 1O3YA 1UINA 1EDDA 1VQ1A 2XX3A 2QZSA 3NHAA 4RZIA 1M83A 4HEJA 2ZJ8A 4IUCS 3R77A 4OMDA 1FC0A 4R8RA 5CJJA 4HX2A 5C31A 3ULKA 1EP2B 4OI2A 2M1ZA 1O95D 5FOUA 4MDYA 4BKUA 3E4CA 3W9YA 5IC5A 3V4FA 4ZOBA 2AWOA 4ZI3A 3TBFA 4DEXA 5HNKA 1DRJA 5IJ0B 1OH6A 1CF4A 5LKRA 1K08A 2AJ8A 4RQBA 2G88A 2O54A 2VLIA 3DXXA 4KXFB 5EIXA 2QV0A 3CLTD 3JQAB 1Y8RB 4XVUA 1U2DA 1XXLA 4F5DA 3AESB 3GRVA 1U0JA 2IYFA 5AJXA 3PX2A 2ISCA 1ECBA 5AJZA 4DQLA 2GCOB 3SZ3A 2FPUA 3JARB 4TKLA 2BGKA 3HKBB 3VNAA 3GG2A 3B1KA 4C21A 4C1BA 2IX3A 3CVUA 3INNA 3BJRA 4O6VA 4X94A 1GU1A 4TPKA 1HR0B 3M49A 3DL7A 1P0QA 1FCJA 1ZCAA 2BR3A 3QENA 2WAMA 3HN2A 3QVTA 4BCBA 1JEYA 4CXMA 2M98A 4EW6A 1Z4KA 3FTQA 3JAKA 4UQLA 2GO7A 4LW8A 2FXVA 2D5AA 2WJIA 4OTZA 4NZPA 4KODA 4ZCSA 4DNFA 5AOBA 5C5EA 2GOYA 1EWQA 1JSCA 3JCZA 1SU4A 1RCTE 2AYZA 1FNNA 3NT4A 1Y8QA 4C0QC 4L5IA 2XI4A 4RPHA 4P98A 1PKXA 4LY9A 2B37A 3NASA 3BF8A 4M3NA 3Q7EA 3SLKA 4ZD6A 3FMGA 4GM1A 2VQSA 2GKGA 3KYCB 2CD7A 4E4YA 1ADBA 4F5EA 1D9ZA 4XLLA 2H07A 2QAIA 2CDRA 2GT1A 3Q10A 4OATA 1GTMA 1OX4B 4IVRA 1X38A 1CEEA 1QGZA 2C2GA 3UMCA 4GSYA 3MQ2A 3IC5A 1N5IA 2VS1A 3KFVA 3MBIA 5NLLA 2VPZA 2HZBA 2KS6A 1E1QA 2BEJA 2ZXEA 3ESAA 2IWHA 2J5RA 1E99A 3UAYA 5KJ6A 4O4HB 5MN4A 3T3OA 1S2OA 3G1WA 1M0WA 3RASA 5ARDA 4DCOA 5FLXA 3PVZA 1GNRA 1NXXA 4N0MA 3ZHBA 1FNBA 3KZ1E 4NCKA 4K9OA 4I9UA 4TQAA 4ZVRA 1MX9A 2HLNA 3T3EA 4MS3A 1DQRA 3RSCA 4DADA 4Z1OA 5CT9A 1Y6GA 3OCXA 3O9MA 3RBZA 1YDWA 4HZUA 1C7IA 1AURA 4A10A 2OCBA 3SIXA 4EJFA 2QUJA 4X7BA 5GZ3A 1JDNA 5KWJA 1TU4A 4K26A 1I1QB 1U0HC 3L8FA 1COWA 4TMVA 1OTYA 1DRKA 4FZRA 4LPSA 1U11A 5EHXA 1OI4A 3IP6A 1JTVA 2G6TA 4H2DA 1WHSB 5DPMA 4BE4A 1XA0A 2W2KB 1L7EA 2W71A 4F9GA 1GPLA 3LJKA 3RVBA 2QPTA 3DMRA 3HSSA 4NE9A 4PO3X 1G6KA 3KCNA 3GEHA 4K7JA 1I7LA 1DAMA 1LLCA 1P77A 4EY7A 4Z4CA 4WJZA 4F91B 4HATA 1WMSA 4S1OA 3WISA 4M83A 3AR6A 1U90A 5E8JA 4L22A 3LSTA 2UUBB 3HP4A 3ZU4A 2P9YA 2PD3A 2YC2C 4I1OA 4KRYA 1G7CA 4KSBA 2HUPA 3ETJA 5B37A 4XIYA 1EB9A 3SYLA 4RXMA 4O4LF 2FZGA 1GPJA 3IMEA 1C9NA 4NBTA 4DBVO 1Z2DA 2IHJA 3DTNA 3FCYA 3QP9A 2XW6A 4HXEB 4UEOA 1YUNA 5E2BA 3IRVA 3QVGA 3TAHA 3U3KA 5L3SA 4DUZB 4Z5XA 2NUBA 4P3XA 1Y8ZA 2VYQA 5ECGC 1CUZA 2FDRA 3OEYA 3SXUA 5IF3A 3GPIA 3RT7A 2VT2A 3F7OA 4KAXA 4N3NA 3S4YA 3AF5A 1E8NA 3FBTA 3T7JA 4E13A 4X8OA 4WUTA 3IFSA 1E69A 1V7ZA 3QF4A 1VMAA 1EP3B 5DKFA 4B31A 1U0SY 3IRUA 2OO5A 1ZVQA 2WWRA 3QBJA 2DECA 2PGLA 4K9QA 4QGAA 2JD1A 2E6KA 1XTQA 3HCOA 4KMSA 5H9VA 3VHRA 3KBOA 5EC8A 5H3CA 4DAOA 5EJ4A 1DRUA 3I42A 4NTZA 4O63O 5REQA 3X2FA 1TC1A 2J9RA 4UHCA 1QZ3A 2EKPA 1OC4A 5ESWA 4NOKA 1T29A 3A4TA 1DCKA 3P52A 5AKIA 3PRYA 4ZT6A 4GR5A 3IAAA 1KSFX 1QAQA 1PZHA 2XRZA 4JP5A 4DA9A 1XTKA 2QT9A 4RS3A 2Y1KA 1M10A 1HETA 3H9EO 3OZUA 3CV3A 4M6WB 1VGQA 1DT3A 2AC7A 3W2HA 3PLAE 4TKZA 1WVMA 4LPKA 1DE0A 4ZT3A 3AR4A 1BROA 4D3YA 1MQSA 1JQLB 2PGAA 4NATA 3OIYA 4QICA 4WY8A 4ND7A 4ZQIA 3NVMB 5F78A 1T1EA 1LK0A 1GSIA 2HMWA 2WIKA 1GZ6A 3BMCB 2Q7DA 3ADCA 3K71B 3NNDA 4IXNA 4BP3A 4XWWA 5D51S 3VZRA 2H9YA 4TL6A 2UUAB 2ZAMA 4BO6A 3L7NA 1PSDA 4P08A 5K0LA 2QR5A 3FZNA 4L3VA 3GLFB 4I5IA 4U6NA 2ZKLA 3IEKA 4RFVA 4F4FA 2BCGY 1EGHA 2BEWB 3V42A 2X6TA 5A9SB 2CJYA 3M6XA 1LNQA 2X40A 1IU9A 4U7DA 3WKDA 5K1ZA 2FEMA 1C30B 4FCWA 1OWOA 4A8PA 2C95A 4JAVC 1WCIB 4O2RA 3EIUA 4M98A 4DLUA 2QG9A 3GJ4A 1WPXA 1KE2A 1V7CA 1LH0A 3HJAA 4RE6A 5GINE 2W2LA 2VRNA 2JW5A 3VPHA 2DT8A 1CQIA 3IMCA 1L5FA 3I32A 1G2PA 2ZJFA 3E5HA 3NWOA 1EWVA 3MWDA 4NYMQ 5SZHB 4B2IA 4MP3A 2VAMA 2FMKA 4B3XA 2Z5FA 2BFFB 1DUSA 4DPKA 2DH5A 3NDIA 2JGEA 3NBAA 2FEAA 3F7MA 4NZZA 1RXYA 4R5HA 3EA4A 1USVA 5DK4A 3B6KA 2NU6A 3UT6A 1Z0AA 1K5PA 3UO8B 1YDGA 2VUSA 3DGFC 3HCWA 4LF9B 3VR0A 4TRRA 1CJVC 1IEQA 1RKQA 5AJHA 1IYZA 1SA0B 1N2OA 4E07A 1KRXA 4DZRA 5DBFA 3S2SA 1ETHA 1PE0A 1EE1A 3WYFA 1QK3A 1JWLA 3UW3A 1ZO8A 3KL4A 4AZ0B 2EBFX 3OHPA 4G0MA 3Q5GA 1RBYA 2JH8A 3K0HA 1VL2A 4MB0A 2R00C 1XMJA 5ALPA 5FTMA 3TIVA 1FYWA 2I03A 2P2NA 1YJXA 1OGJA 2JAOA 2NSLA 3DBRB 1U9IC 1LZLA 3RHZA 2P6UA 2QIPA 2Q9UA 1UPCA 4LVCA 4NBUA 4I5FA 3FFXA 2VDOB 3JYOA 1XC7A 4MULA 5A6SB 4CI9A 4CQMB 2FMIA 2QRZA 3H2HA 1WBDA 4W1QA 2IVZA 3QYFA 1JB9A 3WLSA 3C5CA 4GI3A 3ZDXB 1E1YA 4WY5A 5BVHB 2HADA 2JJ1D 1EFPB 4EBFA 4LJLA 1HM5A 1RCFA 3I9V6 4RMIA 4P4LA 3VYSB 1T3TA 4YX9A 4YYEA 3DBLA 4CLXA 3HN6A 2GBLA 1CUXA 4IDBA 5EQJB 5LZ4A 2ZRKA 3HFSA 4IGKA 4LVUA 3T3NA 1QPBA 2WYWA 2X5OA 3E05A 5M5BA 3MCVA 4YRIA 2XBUA 3PRJA 3D2AA 3L01A 4P80A 1VPDA 4D9MA 3LY8A 2QAGA 4QM7A 2CN1A 1DIBA 2Z2IA 3NT5A 4IR7A 3IL2A 1J8VA 3T99A 5KO2A 2VJBA 4YMVA 2UXBB 1JRLA 3FFBA 3T5AA 2ECKA 2IEDA 4JUDX 1ISFA 4MWDA 2C2WA 1J07A 4GSLA 3WQQA 3AONB 4UD6A 3AR2A 2P9HA 1KI1A 2NXEA 3OG9A 3OWOA 1JIVA 1OT5A 1TU0A 2G28A 1FRFS 1RXEA 1KEUA 2GYWA 3BXEA 3H65A 1DTWB 4JB3A 5A06A 5BYAA 5IKEA 1G98A 1I4OA 3JVVA 1NKTA 4UBNA 1DV1A 2RK6A 3LIPA 3A10A 5ALKA 4F45A 3L02A 1W5BA 2P3OA 4OEHA 2RHGB 4OSPA 5GONA 3FOZA 1F17A 2PJUA 2B7BA 1JTFA 2DY1A 2ONYA 1MA3A 1Z4OA 2V4UA 3PC4A 4HJRA 5GVRA 1PVVA 5JCPA 4RTMA 1OGIA 1UBNA 4R1LA 4W1SA 3MB8A 2WSSA 4KPEC 1WDKA 2Q3JA 4YMUA 1KWGA 4BBAA 4WV3A 5AMXA 1P8JA 4HAXA 1T5HX 1SZPA 1QP8A 2YJ4A 1M34B 2VRCD 4LJ7A 1G7RA 4J0IA 4BB5A 1UOOA 4YJGA 1KMHA 1TA4A 1E6KA 4CUJA 1H23A 2FV8A 3HSYA 2QLJA 1D2CA 3PNBA 4HXGA 4UNQA 1ESZA 4D9JA 1KXZA 1N2BA 2H0AA 4JY7A 4A16A 4F97A 4OBWA 2OAEA 2ZSAA 2FFQA 3EY4A 1I4WA 3JQ7B 5GADl 1SCDA 4JODA 4WEQA 2A5FA 1Q7RA 1J2EA 4JU9A 4NHOA 1UODA 4FX5A 4D26A 1UOPA 2FJ0A 4S1PA 1R4NB 3AL2A 4PWZA 4UEQA 1OW3B 1FFWA 3DL2A 4RS4A 1G8HA 2W4QA 3BILA 2RD2A 3QGMA 4WBNF 2RAVA 2JJ8A 4J9UE 3ZTWA 3P96A 4L02A 1H6CA 1U8AA 1VDMA 3EQ2A 3RC7A 1K7SN 2YHUA 4INOA 4YRSA 5LCXA 3VAYA 4C76A 1JALA 2X8AA 4HT3B 3UANA 1QFZA 3ZQKA 2NGRA 4DCPA 2QM3A 4K5QA 3NRBA 3B3QA 1L7OA 1QVVA 3R4CA 1TB4A 1NNUA 3EDCA 2WJYA 3D8RA 5H3HA 4DC0A 1BCSA 5IBCA 2BMAA 1YJ8A 2F1OA 1TIBA 4DV4B 3M6FA 1JHXA 3WRYC 2D5BA 2WF5A 3IPXA 1R18A 4QYWA 3U80A 3KZCA 5CA1B 4MGKR 1CERA 4GMKA 4E09A 3IJ5A 4KQ1A 5FYQA 3M5DA 5F9HA 4C7OB 3OD5A 5A5EA 2ZRIA 2O57A 2HA4A 4S2UA 3RJ5A 2W83A 1FSGA 4BX2A 5KPDA 1EP1B 4EP1A 1RAIA 5F4ZA 2CLDX 3LY7A 4Y6PA 3I6YA 2J07A 1S8FA 2PWAA 1S1CA 1R2QA 2HLDA 1OAAA 2M1XA 3HJBA 4NJMB 4F96A 4CIAA 4CG1A 2PGIA 3NDBB 1WOMA 3WL8A 4QVIA 2XCSB 1H1LA 3BERA 2FFBA 2ZREA 2DWCA 4D4LA 2AZTA 2FR0A 2BM1A 2B30A 1MRNA 2XD4A 5JSUA 4WKNA 1YC2A 2LRHA 3DCYA 1MX5A 1A69A 2ATIA 4UJ5A 5FFMA 2CV1A 3N3AC 3VXKA 3S3TA 4LJKA 4MNTA 2PHZA 2IPAB 2XE8A 1PTJC 4UDYX 5KKNB 1YTUA 621PA 3T5DA 1UBHS 2C97A 3CVOA 4ZCQA 2LR0A 4IL5A 1SG6A 3EGVA 2GBIA 1E4EB 5P8WA 1WRBA 3ZBQA 3ZHOA 4DMRA 4MLZA 1XEXB 4IWYA 5KX5B 3NBKA 3A1FA 3HC7A 3W8NA 1M5UA 4X1YB 3V2UA 3FWZA 4AKHA 4N0DA 1VBNA 2OHOA 3RJTA 4DMMA 2PUVA 3IMGA 4LF6B 3WZ2A 1TAGA 2FW1A 3AP2A 4XWOA 2JVKA 5F4BA 4WUVA 3ZZ0A 3M70A 1N8KA 1X77A 3ZHYA 4CIVA 4ZYZA 3Q9LA 1LCIA 2FOIA 2IZOA 3OZCA 2KLHA 4Q1FA 5TV2A 5B6JA 1XZJA 1ZGAA 4MYCA 3RG2A 1GCAA 1L4MA 4UUPA 2NZUG 1ZUWA 3ODGA 5DFAA 4WZAA 3LPDA 1X7WA 2GEUA 4XPIA 1BE1A 4YK7A 1LBQA 4PX2A 1JYSA 4ZV7A 3AJDA 2OL4A 1Z2AA 1MQ9A 2JNWA 2V9ZA 5IJXA 3VFDA 3IV7A 4S3MA 4EITA 4UM9B 4Z49A 5MGNA 3MMXA 4WZBB 2Q3BA 4TXJA 2FUNB 5CB8A 1ADGA 4UPDA 3CF0A 2GD2A 2IA5A 4IIHA 3DOIA 4RM2A 5TGZA 3OIUA 4YAEA 3W05A 1ZMBA 3KD3A 5IAAA 4BPBA 2CDBA 4E0BA 2R47A 3TO5A 2OB2A 4E5UA 1HT2E 4JHXA 4RXUA 3MGAA 1I14A 1JLHA 1NYLA 3DL4A 1X39A 3GVXA 5A0VA 2JJ2D 3TSCA 1T5BA 1KVUA 4XGKA 3E3OA 2O2YA 4KIJA 3DHVA 4YASA 3OO1A 3WS7A 4Z4QA 1RWBA 3C3MA 1E7SA 2VNJA 2D2EA 1SCUB 3D6HA 4RYDA 5ENZA 5AJYA 1NTOA 2JIBA 1OI2A 3UWMA 1KJJA 2OGTA 2V6MA 4HUQB 1T35A 3IXQA 5HKKD 5AM4A 1ZU5A 1I30A 4XB6B 3QOWA 4HXYA 4AF7A 1T13A 2A94A 1A5SB 3AHIA 5DHTA 3UJHA 3D8BA 4FYMA 2XAAA 3WICA 1V16B 4KI7A 4BZXA 2M6KA 1U3UA 3WYAA 2J31A 5BQFA 5DMHA 4RTRA 2DETA 1A9RA 2Y1XA 1JQJC 2C77A 3GEMA 4CMIB 2FFHA 2ECQA 1X1TA 1XVUA 3K0KA 3MWEA 4N0EA 3C8HA 3DDNA 1ACJA 2VATA 3OIDA 1P3JA 4WTOA 4B0PA 1ODCA 1JFRA 3DH0A 4RSRA 4Q3NA 3K9FC 4YQYA 3PD0A 1D4OA 1KDTA 5HUHA 3E58A 3NTXA 2CWDA 3JPWA 2AZDA 2FEXA 3I9LA 5JTUA 3S1AA 1KK2A 3JWPA 4PSCA 4W9NA 1M5RA 4WZ6A 3RRMA 4A8JA 2Q21A 3GMSA 3PGXA 4HGRA 1X1EA 4EJSA 4CR8A 1B7GO 1A4XA 3OZWA 2GF0A 3D3EA 3FAKA 1KVTA 3G8DA 3LC7O 2Z1NA 4LI0A 5IKOA 3WO1A 5HRAA 2YR0A 5JISA 4MI6A 4JC0A 3G5TA 2V4ZA 4PG7A 4Q5IA 4Y8VA 4OUKX 5L3RA 4O1HA 4OIFA 5HF9A 4P7FA 3PJFA 1P1BA 3VI4B 3VO8A 1FFCA 1VIAA 3CLKA 4B9AA 3ANLA 4MW1A 1N32B 1I32A 4RCYA 1BCRB 4MVCA 4BBJA 4R51A 5JMOA 1NNEA 1JKMA 3QPCA 1O89A 2H5IA 1T1IA 3K9QO 1KKUA 4MA0A 3DEZA 2C9ZA 4LRQA 4EO9A 4ABTA 1REQB 1N2CB 1NV9A 1L4LA 2FZVA 1U4OA 3EYWA 3E5NA 4UBJA 3N0VA 4HNRA 1CG6A 3E9EA 4YRFA 3IEVA 1NBHA 3MRVA 1RQRA 1ZI6A 1JF8A 4N3BA 1YNSA 3VJMA 4ZI7B 5DWQA 3OM1A 1A97A 4EPYA 2QTHA 2VYFA 2FLKA 3MIZA 2BFEB 5DOVA 2JLAA 1LI4A 5E1OA 4BFXA 5HZHA 1FNMA 3FWYA 5FUBA 4CYMA 3ND5A 2ZRBA 3MOGA 1R3DA 3M4XA 2GAFA 2J6IA 1H2YA 4HSEA 2DB3A 3FROA 1WX1A 1B73A 1C3JA 2PZJA 4L2IA 5BSMA 2PYZA 3S7TA 5BSFA 3RGGA 4CETA 1C5KA 1HQCA 2AMFA 1YONA 2JIOA 4J4BA 4G81A 1CDOA 4O0LA 4XB1A 5HE8A 3UF0A 2OCYC 3O8CA 1XP5A 2QZPA 3ISJA 3LKVA 3SY8A 4AKEA 1PRYA 5KTYA 5KWVA 1Q22A 3AQIA 1P74A 4MQ6A 5I51A 1E3TA 5K6AC 2AMLA 3GN2A 3VPDA 4QUBA 5BSRA 2XGOA 1YCDA 1F9AA 2PO5A 1EX1A 3H0EA 1VXOA 4GDFA 3CWZA 1XIVA 1B6GA 1K7EB 1U1CA 1XBTA 2FVXA 2UVDA 3J80A 5LA6A 4PHHA 3TMAA 2HU7A 2JGKA 4JFRA 4X60A 5JEDA 2WUFA 4DDWA 5GV8A 3T0IA 4NH4A 2Q5EA 3B60A 4R68A 1PUXA 1U8CB 1TTQB 4ZRNA 3GGPA 1EVLA 1HNZB 1JEAA 2PV7A 5I7HA 1PR5A 3HTXA 4DDTA 1EVKA 3WNBA 3ZY6A 2V1XA 3PHJA 2C20A 2PZBA 2J41A 1LPSA 1UPFA 5LP6F 1ZP6A 4Q3CA 4UTOA 3W5IA 3MAJA 4FOLA 4UTNA 3O3MB 4INPA 5DP1A 1JN0A 4ZCRA 1A1VA 1V5FA 4YMHA 3C1UA 3BWDD 4CLOB 1QXSA 3AW8A 3KYDA 3L8CA 4EGQA 2ODTX 1GDHA 5EGNA 3AINA 5I47A 2HJVA 4LFBB 4FINA 5HOEA 3U4CA 3FYSA 1H8EA 3A1VA 4CMEC 3TF5A 4BO2A 3L77A 4OHYA 5HIJA 4NMWA 4JUFA 4UM9D 2P2CA 2BMVA 3EG5A 2DUNA 3UENA 2JANA 1QLWA 1K8XB 4J1TC 3BXGA 1U2ZA 3K6JA 1JFFA 1MB2A 1D3AA 1OBCA 1T91A 1YR7A 1E61A 3TQHA 3L1VA 5JO0A 2QRJA 2HGSA 1PJSA 1T8YA 1JG6A 3H9JA 2HAEA 2C0QA 3HG7A 4EEXA 1OAOC 4HPJB 4EPVA 4U7GA 3VOSA 3DZIA 1WETA 4BV2A 1FX1A 1PGPA 1YZFA 2B2NA 2OYRA 2FW7A 2CNBA 2JIZD 1Y3HA 3PUIA 4MTLA 3B20A 3EXEB 7AT1A 2QAGC 4EJ2A 3SNKA 2D7DA 4UBLA 1NMSA 2JA1A 1H93A 4ZZ0A 1Y1PA 3I4CA 3LHDA 4IO1A 4TYYA 2W2OA 2EEZA 2ID8A 2J30A 2GLUA 5T8KC 5J4KA 4PLZA 1U3CA 8GPBA 4BFSA 1F4VA 4PV7A 1TVKB 3KDAA 3CVWA 4ZP1A 1YVUA 4YRZA 3FUWA 4KWCA 4YCNA 2BF4A 1FMTA 4AMVA 1T0BA 1BW9B 1WHTA 3M3PA 2OBMA 4RQUA 4UZEA 3E4DA 3PICA 3FSGD 2CLMB 1EFVA 5AKYA 3O3NB 3W8DA 3WB1A 5K09A 1F7VA 1OXXK 1E4VA 4HQNA 4C89A 4MPRA 4HDMA 4M7WA 4CPDA 1SHTX 1RI3A 5CEJA 4PYQA 1V4VA 1XG5A 2ST1A 4KR0A 5TARA 2OOKA 1E0SA 3B2EA 4EMBA 1CIPA 2MMGA 2HGZA 1UKEA 1ZWLA 3A25A 2RGGA 1FP6A 5ALTA 1PZXA 2XF2A 4PICA 5DSXA 2AJBA 4H4CA 4DLYA 1UAGA 2B1GA 3I92A 2P2GA 1Q16A 3M89A 1CFZA 1KFJB 1S7CA 3ZHVA 2RH5A 2G71A 1KJWA 3MWGA 1LWOA 3H1TA 5KMGA 2GESA 1SXHA 4GXNA 2QLFA 2YZGA 2FP3A 4I9NA 3T3MB 1ZIOA 1XZBA 3TXXA 2ZJ6A 4AQYB 3DWEX 3B9PA 1LDMA 3OUZA 5HFNA 2EKQA 1HEUA 1TF2A 3HDTA 3HYRA 1ZK4A 5FX2A 4JB0A 3T3DA 4DEYA 1PEYA 3LPNA 1DPGA 1Z5PA 3ROZA 1N6PA 1EPUA 1R74A 1ZD4A 3Q3VA 2C3UA 3GEIA 4CTJA 5BV7A 3OZ7A 1YQGA 3NJ8A 3P32A 2X76A 5T4FA 3DXZA 4AECA 1AKMA 2J7KA 1LBIA 2NTEA 5BWNA 2EG5A 1SBHA 3EZXA 5JNWA 1IVSA 3FOWA 5F77A 3NDJA 1CXZA 2QUZA 5ESRA 3IUSA 3Q85A 4NOLA 4D9FA 3IVCA 1HT3A 4DXDA 1N7HA 1O6FA 2RDMA 3V1UA 1FVXA 3OLZA 1TUBA 2IY8A 4B3BA 3EDOA 5KYYB 1XDGA 3Q1KA 1YR6A 2CMGA 2RHRA 3VKWA 3WAKA 1GTZA 1PGQA 3AI2A 2QROA 3CZCA 1BQ3A 2V7EA 3ORQA 3D0QA 2JGFA 3MBOA 1M7GA 1Y1SA 2BFPA 3A1UA 3OJLA 3UJNA 1WB4A 1Z06A 4A7PA 3AUTA 2REXB 1UMCB 3EC7A 1ONOA 2QYOA 3AR7A 3M9LA 4P4NA 4G1MB 3UT5B 4TROA 2RJNA 4P3NA 4QREA 5CD9A 1UEIA 1FSFA 1RRPA 1BH6A 2XH8A 3WVNA 2HR1A 4UVDA 1U81A 4D4MA 4ZU1X 3T38A 4PZ0A 3RJ9A 3JZDA 2HA6A 4MCIA 1F12A 2OORC 3A9SA 1XAGA 2JKZA 4AWBA 4MWEA 3X1WA 1G17A 2UUOA 4XYMA 4J3NA 1PJ2A 1UJ5A 3FVTA 4L5YA 4WGFA 3W7AA 2XWBF 2PUGA 3F6YA 1KBQA 1ZHHA 1XA4A 2Y92A 4MPDA 4TS3A 4YRAA 3ETEA 3PKJA 1C14A 1AH2A 1DKNA 1Q7TA 1WXDA 3HKCA 1PU2A 1SWWA 5B58C 1EE9A 4G0XA 2VJAA 5JH7F 1OYVA 4RK0A 4CKEB 5IULC 5K0GA 4NYIQ 3P9ZA 1NQXA 1G7TA 5D2CA 2VCEA 1U8TA 2C7VA 1Y3AA 1E6UA 3CX3A 3ZV6A 1IRIA 1BU5A 4FMDB 4IIXA 4MIOA 2PTGA 3QX8A 4PYOA 4TN5A 3L7YA 4W99A 3WQBA 2XDQA 3VKUA 3BH0A 3WGZA 4F93B 5AO9A 4ZARA 2ZBEA 3KETA 2IBSA 3NHBA 3GFGA 3S2EA 4AJHA 1OB2A 5CVTA 2CXSA 5KJFA 3GFTA 3A9VA 2AC4A 2DWQA 4UD2A 2BFMA 5A3QA 1A5AB 2DHQA 2FEKA 2JZNA 1AUQA 3SN6A 3L9WA 5JWHA 2J1LA 3JRNA 3NYIA 5JAQA 3NBFA 1XCPA 3RSZA 3MM4A 2HHCA 1BRMA 2JFOA 2P9CA 3OE4A 1SMKA 2VQDA 3ZCQA 2B3TA 1T1GA 4ZOAA 1UEJA 2WV7A 5BN5A 1JU3A 3IOMA 5KOHB 2WKSA 3E81A 3RAJA 2XZTA 1GPKA 2WR8A 3R5TA 5JYBA 5FFFA 4HH4A 4MRVA 5JYDA 2QLBA 4JHLA 3OFJA 1J7KA 3MGCA 1QHSA 4FC6A 2VP4A 5HW0A 1G1AA 3EPKA 2B36A 4KAJA 4PAWA 4RXTA 2QBYA 3U6BA 4YFVA 1T34A 4YTEA 2XMQA 2V7VA 4M49A 1H4TA 4NMLA 1E1KA 3E6AA 1LX6A 3EXG1 4AP6A 4B1FA 2J85A 2CD9A 2I66A 4M0PA 3EX7C 4QFMA 4I66A 3FGZA 3ZXSA 1LDGA 1I8TA 3IILA 4Y2YA 5E3HA 1QZTA 5LDGA 3NW9A 4E32A 2W8BA 5EKDA 2ERYA 1NVEA 1QIHA 1VKHA 4EAQA 1KO1A 1H0RA 5BNIA 4HDKB 3TUZC 1I0IA 2DWUA 1L7PA 3P0IA 4PWYA 1QKJA 3GARA 2C2XA 3WOHA 1LBHA 3KHKA 4H9GA 3RYTC 4A2WA 2RE8A 4TMFA 1CKEA 2W6NA 1SULA 1X15A 1M1XB 1K06A 1KERA 2FN4A 1Z5WA 2UUPA 3FZQA 3M5CA 2IPNA 4FFOA 4GYJA 4M4SA 4R8VA 5DNDA 5A05A 3RANA 3WB9A 3RUAA 4FGWA 2DG2A 3RBXA 4BQRA 1TIKA 1XELA 3AXSA 221PA 1Q0ZA 1YR9A 3H8VA 5K2OA 1RPNA 2ATCA 4RHEA 5G0SA 1E8DA 2N42A 5K01A 1QTRA 1WB9A 1N57A 1ORRA 1NURA 1P4SA 3D8UA 4GHWA 5ALQA 1X3LA 4KDFA 3JQ6A 1JR4A 4B79A 5AD1A 4JC8A 2JLXA 3PEYA 5HDQA 1R27A 4FN5A 2CT8A 4HWGA 1GNLA 4LMPA 1SXJA 2ZS8A 1FFYA 1P7CA 3QBDA 1V6AA 3WL3A 2SICE 3BA6A 2V3VA 3UXMA 1HTBA 4N0QA 5H16A 2IVFA 3JRXA 1DOAA 1CHNA 1C9EA 1PEDA 2OM2A 4HVCA 5CB4F 3PRHA 1KKMA 5C8YB 2E4VA 1M8JA 4CLRB 1CU1A 1O5IA 3TD6A 3OZDA 1X80B 2Q3FA 2DX7A 5FPHA 3MGBA 4I50A 3TQQA 2XB8A 3F5DA 1YK0A 4H7EA 4ZEOA 3RS5A 3HXQA 3DOCA 5EZYF 5I3ZA 1G64A 4AG3A 4G67A 1K75A 3AF4A 5TQ0B 1KFEB 1N6OA 3RTBA 2P27A 1BVUA 2BFCB 3DKIA 3R9XA 5JS1A 4CLHA 3E23A 3H9QA 2O5EA 3MSXA 4H6VA 1Z4LA 1AN9A 1J0EA 1O1YA 1K8YB 3F1KA 4JWTA 3SBOA 1PIWA 4B17A 3IQEA 3Q2OA 4IDHA 4QTYA 3ZDDA 2VRWA 4LEIA 4V0SA 1HE8B 1L1FA 1CZHA 1M6HA 1MKYA 3MMPA 5FNVB 4YRRA 3NONA 4CEHA 1SUFA 2I29A 1JJFA 1IY1A 3I39X 3W5DA 3DEJA 2HLPA 1QH8B 3HCBA 3KUKA 2JZCA 3F74A 1O96B 1TFRA 2FHSA 4M8SA 4Q24A 5D5PA 3JQBA 3WIDA 4B2PA 5KNLA 4Z7NB 4LGYA 1GAWA 1XTSA 3QMVA 1PBTA 1G2QA 1T1SA 4IQ8A 4MK4A 4B6RA 2JI9A 3SJUA 2WHPA 2ZB8A 2H6EA 3C4QA 2FWNA 4ZT2A 5FOWA 4CFZA 1IUOA 2AJLI 1PDOA 2YINC 4L28A 5KDLA 5EMKA 4XWKA 4EA7A 2HIHA 4QOJA 3ZEIA 2D4HA 3BDAA 3BDIA 3G79A 3ND6A 1JV2B 1VXRA 4TSFD 1Z7BA 4F4JA 3MRSA 4EGFA 2O8CA 2BHLA 1CUVA 1GTVA 1UKAA 3MJFA 1TYBE 4L8GA 1HE4A 2OV4A 3VO1A 1XGKA 1BX3A 1X7ZA 1QGED 3JQFA 5KNDD 3ND7A 1ZC4A 2NO4A 2PMDA 4C0LA 4KNVA 4PLFA 3VPFA 1JSXA 4JXZA 3QVVA 1QF6A 4A15A 3THSA 4JJEA 2YNMC 1CY8A 6GPBA 1UJ4A 1K4MA 3NM4A 1O94A 4B3HA 2IYYA 5JALA 5KYWB 4NK4A 1ZITA 3DE4X 4OGFA 4E5KA 1XCOA 2ZCUA 2VHQA 3OF5A 2BBOA 4I6GA 4RVCA 2OA0A 4IEEA 3KELA 1W4AA 2I7XA 3CNBA 4E2ZA 4MR7B 1WBBA 2XYQA 4JV5B 3BBPA 3HL0A 3STXA 1T0IA 1S3GA 1S9DA 1TCUA 1X2EA 2WVJA 4FDUA 3BXOA 4UUNA 3FUXA 4INAA 3I0NA 2H9IA 5CVVA 4RPLA 3G6WA 3BXZA 2DHCA 3CLUC 3MTGA 2CLOB 3FXAA 4MUJA 3SC3A 4ZT4A 2QTWB 2J0QA 1AVTA 2F2TA 4FD3A 3D3JA 4N6GA 1RWQA 4Z3DA 4OGGA 3IQXA 3A26A 3P5BA 1X7YB 2Q5LA 3JSAA 4Y1RB 4ZZ3A 1U8YA 1JR3D 2YWCA 3ER9A 3FOFC 3CVYA 1Z47A 2CXPA 1U0LA 1W8DA 4I9FA 4ZAWA 1Z8NA 3RARA 2EKDA 1RI2A 2PRIA 4MITA 2FE1A 3WKCA 4BZQA 4HPXB 3HBFA 1UKYA 4R0NA 5IYZF 3QKWA 4PYIA 4QAQA 3S8EA 2BM0A 1ZGJA 3AYZB 1C9MA 1GT6A 1NMEA 4I6JA 5EE0A 1ZRSA 3RFVA 1K86A 5CA1F 4P8RA 4U9HS 1I4EB 2RHLA 3GXOA 4KX5A 1UIMA 4P38A 4RHYA 1TPZA 2J4CA 2EZUA 2J7PA 2H7XA 5ELMA 5HEKA 3WLIA 1RR6A 3MXTA 4Q1DA 2JIQA 4CLDA 4OF4A 4FGSA 5ES4B 4RTPA 2XUZA 4IDQA 4P5DA 3PHGA 2AR7A 2XUFA 2COKA 3HXTA 3CH4B 3QQPA 4KPUA 4M88A 4BLUA 3JRWA 4X6UA 3RKUA 3P19A 1CC1S 4YHBA 1N6RA 4CNBA 5DGTA 3SIPA 3RS3A 4JI5B 3VVBA 4NK5A 3ZWXA 2NQ8A 2IW3A 1HG0A 4GYKA 1LW7A 1ULZA 1EUCA 1HYBA 3RSOA 3RVLA 3ZXUB 3PYXA 1AKQA 4TKUA 5T57A 2IWRA 2GZRA 4IKPA 1GPH1 1UMKA 2W2QA 2SKCA 3R4VA 5LNK6 3U1BA 2BGGA 1C0EA 1BSVA 1CZNA 1CZKA 3B2NA 1XE3A 5EIWA 5KNDH 3K6RA 2WZCA 3I2HA 1U6KA 1HYEA 4YJ3A 3GYGA 1N5LA 4PC6A 3K0BA 2Y66A 4J91A 4WFKA 3JVDA 1RCUA 4KQ6A 3HUFA 5H0IA 1E5DA 3M2PA 2I2DA 1V95A 4X90A 5CT4A 2G9RA 4DQKA 4L85A 1RE1A 1SIBE 1U0NA 1DUIA 3L7AA 1ZAKA 4CL3A 5K45A 4G09A 3LBAA 3KQTA 4AO6A 2P35A 4AL4A 2D13A 4DG9A 1B1AA 3JD4A 4M9ZA 3ONWA 3NLLA 4DTIA 5KOJB 3G9QA 4FC7A 3PGKA 5BN3A 1TECE 3QTBA 4RFSB 1MC4A 2BTQA 4FLFA 1Y33E 3K92A 1AO3A 3EZ2A 2JCXA 5KTSA 1LLQA 3H8JA 1HX7A 2WWTA 2JARA 2PXCA 3RF6A 1QHHA 3W34A 5A7HA 1RIFA 3N2KB 3IT3A 2H92A 3R8FA 1JS1X 2IBTA 5G1NA 3UG7A 2QL6A 1UK7A 3ZCVA 2BKAA 3E3AA 1FBTA 3CWCA 4FHGA 4HLDA 4B75A 5FOQA 2ZKIA 3DVAA 3PZRA 3EPHA 1R8SA 1BGVA 2OAQ1 5KS2A 3KPJA 3EPLA 4R1OA 1B26A 1V48A 4LOKA 4ZV9A 3UK0A 1INLA 2ZB4A 4F4DA 3LLMA 4OV6B 2C4HA 4GKVA 4KDCA 4UHKA 4L8LA 3ICQB 1X8XA 4UM8B 2DKFA 3V3KA 1YGYA 4GPZA 4FYVA 4MPJA 3WLFA 4O59O 5F5LA 1FUKA 4TLDA 2FZ4A 1GPDG 3ROXA 3SE0A 1GGKA 4XLTA 1A2KC 1A3CA 3MGKA 4PXAA 1XU9A 4FDMA 1K7CA 3FPAA 2D5CA 1J90A 5JSZB 1Z4QA 1QV6A 1VP3A 3OEWA 1TA9A 4J0FA 4TTRA 5GVSA 1E2QA 1TD9A 3F3MA 2XB9A 3UWPA 2V03A 3HJGA 4G5YA 1SOMA 4RAOA 3SXPA 2ZIEA 4DJAA 3AERB 3RTGA 2QHXA 3IAS6 1RIIA 4H15A 1SUEA 3AUXA 4NJEB 4OU4A 3WYBA 2A1TS 2DVMA 4M37A 2EFJA 1Z6GA 4F2WA 3IAUA 4LNHA 2ECOA 3GA5A 4FYXA 1XXHE 3CW9A 5KOIA 2PK3A 3BGIA 2YVKA 1M6WA 2ZIFA 4CMCA 2WFMA 1UBJS 2H52A 4CEIB 2FLVA 3OZGA 3TLGB 4ITVA 1RMQA 4CKWB 4TKVA 1G59A 6ADHA 4LXQA 1MD9A 2ONKA 3VSEA 2BKVA 4I4TB 4LSZA 1ELOA 2VDUE 1WQ1R 3QU7A 4O4LB 8ATCA 4RZUA 4TV8B 5JNLA 1CVRA 2Y9MB 3OICA 1S2IA 3I52A 2YW2A 3RC2A 4A23A 5HCNA 5JD3A 5IDWA 5KSPA 3L9XA 3GT0A 3E8SA 4EG8A 2GETA 1H5UA 4JYBA 1WD7A 2KMLA 4LE1A 1KEEB 3VH4A 2H9AA 5AW9A 3DHYA 3KOMA 4LV8B 4KQJA 2ZSKA 3QJYA 3W2EA 2Q4OA 1KSGA 1I6LA 2PPLA 3JZIA 3SHTA 1G3IA 1P2FA 4ILKA 4YFYA 1GL6A 2JLVA 4GAEA 4LNUB 4ZEWA 2GTIA 3OF2A 4XW2A 2I3ZA 3TD9A 3ZX4A 4BV9A 1WCYA 3QUAA 2QLMA 4QLBA 1AV6A 2IYQA 4DIKA 1ZIXA 2DT5A 2ANCA 5FBHA 4Q9JA 1EG2A 3FB1A 5DBOA 2B8NA 2DWPA 2FX2A 4TLAA 3RG8A 5K3OA 1Z4NA 2E7ZA 3ZU5A 5CLHA 1M2OB 5M29A 3IR6A 1IN6A 3PSHA 5FJIA 2B21A 4OK6A 3BRCA 4J0CA 2ZI5A 2HWUA 2Z9BA 4GBMA 1U7PA 5L40A 3B1YA 5KYNA 2GX6A 3DCNA 3SHFA 2A9VA 4AVYA 2WJ6A 1ZN7A 5IJ9B 1VZ2A 5ITZA 3PITA 5C4GB 4LDZA 1KE1A 4DBLC 1T5SA 4IZHA 4WK0B 1L7MA 1H5NA 3MT9A 4IX1A 4L5BA 1KIFA 2XT0A 3LT2A 3EDYA 4UE6A 4B40A 4WCFA 4GPD1 1EWYA 1IM8A 3U4IA 4ZWNA 3THYA 1WE2A 4YUAA 1Q50A 1ND5A 2J9ZB 3PXBA 2G9UA 2RGBA 1VOTA 2H1WA 3RREA 4DNPA 3K9LA 4EY6A 3NH9A 1E8MA 4C22A 1TZMA 4M60A 3SQWA 1RPAA 1E32A 4WXYB 2OCLA 4HDNB 3CH7A 3HDGA 3S2IA 5JFTA 5L6LB 5KWIA 3AEZA 1F4LA 5JRDS 3TQTA 1VG1A 3PZBA 4BDTA 2MMCA 2JKVA 1H2BA 1YMUA 3NTVA 3C5VA 4K9PA 1JQ3A 4TMZA 3KAQA 3MZ0A 4ZFNA 5J4YA 1Y5IA 2AQHA 1IBSA 5EKUA 2VPPA 3HSKA 4Y6QA 1Z35A 3BQNB 2N1BA 1SZCA 2CVZA 3OLXA 1S8NA 3NGMA 4JXKA 4LYFA 4H0NA 3TH5A 3M5PA 4BNTA 1Q7BA 1D04A 5CEFA 5LSAA 2GEVA 1XTVA 3SQXA 4O4JB 3ENQA 3I2JA 2CDNA 2O2DA 3CM0A 3N2EA 4S12A 1PV2A 2BPOA 2DFTA 3CJRA 3LOQA 4KVZA 4DB4A 3NHMA 1EAYA 3KZMA 3MCTA 4DQUA 1DJMA 1JHMA 2NNWB 5ARCA 5T6BA 2YZKA 4NI5A 4KR6A 1UZUA 4MGHA 4EYQA 4JKIA 3ZC3A 2QDKA 5JDCA 4LF8B 1RU3A 5HMLA 3SFZA 3SEFA 1L5HA 2R0QC 2CYBA 2O2JA 1A8PA 1W47A 2A5LA 3BZBA 4QEDA 5T5QA 3TECE 4QDOA 4AC9A 2RCNA 3LCUA 5ALSA 3T6KA 2NYAA 4E46A 1YR2A 2O0JA 4RSMA 2W9XA 3FPGA 3OA2A 1Y1TA 4BMSA 4CTOA 4KREA 1HDCA 2NO6A 3GJ8A 3L7OA 5DM60 2CSUA 5AVYA 4MKGA 1CTQA 5AIAA 3SAJA 3FW1A 4Q9DA 4G0OA 1ZQ9A 4HKTA 5J5AA 3UJ6A 4HRVA 5IJ0A 3AKDA 3A3KA 5JSYA 5TX7A 2YDYA 3U9SA 1C4KA 1OY1A 5TJHA 1YH3A 3JQAA 1GG5A 1GZUA 1QC5B 1Y8RA 2DUWA 2PL9A 3BHMA 1SPBS 1USUA 3K2IA 3QVWA 3AESA 4IIFA 3MYRA 2DY0A 5LYYA 4N47A 2V1UA 2GCOA 4RDCA 5CT6A 3JARA 3HKBA 1S1MA 1ZC3A 2PEZA 5CJPA 3QKRB 3W79A 4PBSA 2WIJA 1RQPA 3OQ1A 5GONF 4KE7A 4CN9A 5E7JA 4OREX 2ATXA 1N1DA 4ZKDA 1T2CA 3VTAA 1KH3A 1OXTA 4BMPB 2P4QA 1XKLA 4RSHA 2VTVA 2HMAA 4HLCA 5SICE 4OD0A 5T3UA 4V1CB 3VDMA 3FTCA 5CX1B 2DTDA 1NW3A 5JSHA 1G4UR 3WRXC 2ZIWB 2SKDA 4ENPA 2W0SA 1F2UB 4MW7A 4RPCA 2OQIA 2NTYC 3EPJA 2JGDB 3MOIA 3PNOA 2C9YA 1O6GA 2CF5A 3FPEA 3SMQA 3VYUB 4Y0VA 2RAFA 3RS0A 3KYCA 5L4NA 5ITWA 3BCUA 3ZWPA 2NQTA 1GEGA 2FHPA 2PLWA 1MZVA 3HEMA 2MWMA 4P4SB 2QT1A 2Q62A 3EA0A 2VRBA 3JQBC 5SZKB 4AMZA 2R5NA 4RHFA 1OX4A 5G1OA 2YWRA 4DUGD 1O7JA 2AN9A 2Z8ZA 4B3GA 4XUGB 4B6FA 1G20E 1WZ2A 5IAEA 3U7GA 3DDHA 4O4HA 5FOXA 5EE3A 1MQ8B 2A1IA 2FRVA 2Z8XA 2BFWA 3PD1A 3TRFA 2JJ1A 3H8SA 4RU1A 3OKCA 4XVQA 3K0SA 1EXWA 5JNUA 1H6AA 3L8MA 1T5LA 1LSOA 2OCKA 5F3WB 4I6EA 1UFQA 1XF1A 2M6SA 3DMTA 5FBRB 2EQAA 5C8DA 2VG8A 4ZVOA 1PL8A 5FL7D 2H1CA 3OBBA 1Z8FA 4PAGA 2VEOA 2Q41A 2FFRA 3JWHA 2FR8A 3OM9A 4P3PA 3ZLBA 4BFYA 1F5SA 1P7WA 1QANA 2HCFA 5LZ9A 2PXXA 3FRIA 4L6IA 3PDWA 1I2ZA 2G9QA 2CMFA 5IARA 1CIVA 1MB0A 1RRGA 1UDAA 1XKXA 2IDZA 1F8XA 2Y67A 5EP2A 4D44A 5EJ9A 5LQUA 4XX0A 3V32A 4X97A 3ZNOA 2K7FA 4F2GA 2W2KA 4MAFA 3STVA 1Q1ZA 4BMZA 1SN7A 5A04A 3MLBA 3F1LA 1YDFA 3W2FA 3SFTA 4O3MA 3B5EA 1RHKA 2F1IA 3DULA 2P41A 3RV4A 1ECGA 1D03A 16PKA 2Y6VA 3QVJA 4HH1A 5EUQB 1UAYA 4BNHA 1NVVQ 4XUEA 2JLBA 3E7WA 1EM8B 4D43A 2UXCB 4UTRA 3GUCA 2WPNA 3N6VA 1T8UA 1N5RA 1EGAA 3K5HA 1K92A 3GRRA 1DQNA 4E4RA 2EGUA 3N7AA 3Q98A 5AXAA 5L9AA 3KCQA 1ONSA 1SKQA 2V65A 4KE9A 4UCFA 2AEJA 1HO3A 4RNDB 5K6RA 1GXSA 3R76A 4U1RA 4AKIA 3BCRA 4J1QA 3BULA 4N7RA 2ZTUA 4OXNA 3A3PA 2Y4OA 5DCWA 2BH2A 1VA4A 2WM8A 3LUDA 1JBKA 5EJFA 5I48A 4EW2A 1LPAB 1YBHA 2O0HA 3DO5A 2J0VA 4QWWA 2EBHX 1XJCA 2GYUA 1O8BA 4OHRA 5F35A 3BD7A 4ECEA 2I1QA 2Y05A 1Q14A 1RWNA 2FZCA 2O20A 1O97D 3ZGYA 3AIMA 4MDFA 2J6HA 3QXHA 2QU7A 1SCJA 2XT6A 1CUBA 2CGEA 4Y1EA 3UOWA 3VNBA 3DQQA 5A4AA 4S05A 4QPZA 4FLMA 3JSXA 5T4BA 2PV0A 3KEMA 3L7KA 4QU0A 2ODNA 1QQ7A 4HH3C 3LLCA 3CU5A 4XB2A 2HBRA 5LMCA 2OPHA 1RAAA 4YUZA 1OT3A 1GPMA 2LVBA 2PH7A 3KOUA 2ZQYA 1NZJA 1WZCA 2ZEJA 4UUOA 3GGGA 3N2IA 1D8AA 3WHIA 3LGSA 3HB0A 3PI7A 3QWAA 3I6ZA 3C1TA 1E3MA 1BOOA 1LS6A 3GFQA 4OM7A 3O21A 4PONA 4QFBA 4DIMA 2QMZA 4M6WA 2AW3A 3STHA 2H18A 2G1KA 2WE8A 4IPTA 4RH0A 3X1KA 2CEKA 4ACBA 3BTSA 3TBKA 4Y2RA 2ZYRA 3BMCA 2MU1A 4US1R 2NPIA 4B3RB 3AR8A 2VBGA 4YP9A 4O1IA 5EOVA 2BSAA 1VKZA 2XOEA 3KWLA 4R7TA 4UPVA 3RVNA 3VKFA 4P81A 3AJ8A 1XRRA 3E9NA 5C35A 3F5MA 3N0TA 3ABRB 3T7KA 4HAYA 2PT7A 4XAQA 1XZ8A 2QVLA 1NJ2A 3RVQA 1XMQB 5ALDA 2ONJA 1G8AA 1JXOA 1RYDA 1SHKA 2YYAA 2VYCA 2X23A 3QVUA 2G0AA 4AO8A 3PR3A 4RVSA 3SLRA 1A7AA 4NKRA 1RZRD 2BEWA 3PHLA 4J4HA 1YSCA 1E63A 3LO8A 4YRCA 5JT1A 2A9PA 2BFOA 4UW9A 3RT9A 1XZLA 1EFUA 1XALA 3QE3A 3DNPA 5HF6A 1K6EA 7REQB 1C30A 1FTYA 4BNLA 2IUEA 3ICEA 3WG9A 3C3WA 1WCIA 3THXB 1JQBA 3Q6IA 2P0EA 3QA3E 1RI1A 1O95C 2X6QA 3ZLVA 4C2BA 5CG2A 1YA6A 3DFUA 3TVYA 4L4RA 5DM2A 2A7XA 1FDVA 1KC1A 5FL3A 1OZGA 3V7NA 4ZVTA 2LP4Y 1XSEA 2ZI7A 2WYUA 3BOSA 3MBKA 4BVKA 3MS4A 4C4AA 1U2EA 1V1MB 2JS7A 4D6PA 5FWXB 4K6HA 3WJ7A 8AT1A 3IP8A 5GM1A 1L4BA 1JH9A 2I4MA 5FLYA 2J5BA 3FD8A 4US2R 1XZCA 1C3XA 1M2WA 1G8YA 1Y6JA 4YUYA 5I7VA 1A1SA 2JHAA 3FJ1A 5DYGA 1ISMA 3O8OB 3DMNA 3L7MA 1RYFA 1WULS 4XCVA 4DWVA 1SA0A 1Q92A 2J8ZA 2Y0BA 4MMXB 1ADFA 3WNQA 7MHTA 1PEAA 1ZY2A 1BN7A 1M66A 1WM1A 3O26A 2JIDA 3LPCA 1KYQA 3SSOA 5HKAA 5KCMA 2R96A 1QP7A 1GYRA 4AZ0A 2CE7A 1DX9A 4FW8A 5CYGA 4ND3A 5IHPA 1CYEA 4BYGA 1U63A 1J49A 1R0SA 3A05A 3AWIA 1P2BA 2Z5GA 3AZOA 3BYZA 1ZVJA 3DBRA 4QDZA 1SUPA 2FPIB 1TKBA 1W73A 3PFNA 4FNAA 2AA3A 2FSUA 4MWSA 4B5KA 5A6SA 4RAQA 4CQMA 3Q8LA 4PFKA 1NBMD 1M33A 1ZLYA 2AKEA 1JAHA 2B0JA 2Q0SA 2KM1A 5CH3A 3VSAA 3Q3GE 2OCDA 2PU5A 1H1TA 2VP6A 4EPWA 1W5SA 4M22A 1ZD1A 1AA6A 1ENZA 2DPGA 2R6AA 4L4SA 4RV4A 2AW5A 1RFLA 1TM7E 3M6WA 2BP7B 3MS2A 1A71A 3PR2B 4WRRA 3R9IA 5TC4A 2XJ4A 4EB3A 1GQ2A 1E6WA 4XM1A 3RFTA 4OG2A 5B7QA 5BV1A 1A04A 1VIDA 1Y82A 4R54A 4G24A 5C7OO 2NXCA 4MLPA 2NADA 1I80A 4XM0A 2QG6A 5HIKA 1EFCA 1UQUA 4ZI5A 4MUGA 3VJKA 4AT1A 4JVLA 2CYAA 2WBLC 4EHHA 2PRYA 2JJ2A 3EJWA 4Y9TA 1QQAA 1S6YA 2YQ4A 1U28C 3IURA 4GGPA 4EHIA 1L8OA 1T2VA 1GNVA 3B8EA 3RH0A 2R1VB 3BJZA 4UAJA 1BKYA 2WU3A 4R9SA 4BQNA 3PWTA 4G5RA 1Z0DA 4Q9AA 4JI0B 1NIJA 2C04A 3LV8A 5ULLA 4IDCA 2C99A 1ZGGA 4GKAA 4URZR 2QLTA 2OLKA 4F46A 4GR9A 5BYKA 2IV7A 4EAAA 3IVGA 1YO6A 2AT1A 3ZJ5A 5JAIA 5HKKA 3L0DA 3IQGX 1US8B 4NNOA 2WOJA 3GDWA 3OJWA 4QUIA 3VTFA 3AEQB 4YVFA 4D98A 2FAXA 1GTL1 3ESRA 5AKHA 1IRXA 3RS8A 4K46A 2WD9A 4C6TB 3TFOA 5HK8A 3RVJA 1NAHA 4EOGA 2DXIA 1XEWY 1ZH0A 3CRW1 1JDSA 4O3FA 4TS4A 2DERA 1RM3A 3M6UA 2HLHA 2N47A 1UWVA 3D1LA 3WL7A 2PFKA 4F3RA 1OJLA 4PNHA 4EECA 3RAFC 4ZICA 1M34A 4LTDA 2WJZB 5LFAA 2V0CA 4XYEA 1OAKA 7ABPA 2I9KA 5IVPA 3SC2B 3ILXA 1L5OA 4HZGA 4KWTA 5JNVA 4DR2B 4IGEA 5FB3A 4F04A 1RHRA 4W1RA 1BMQA 4I5DA 1N6LA 2FJUA 4PYNA 4BNDB 1YZLA 5FR1A 4R8SA 3I53A 4NMXB 3JQ7A 1NUSA 4FLEA 4O2AF 4PVCA 4U7FA 4CU2A 4C6HA 4DA4A 1NM5A 1GCGA 2V7QA 4W6ZA 5F12A 2FOLA 4DDVA 4OXKA 2YIMA 4RA6B 4X0EA 5CT5A 3G2LA 2OFXA 2YYSA 5KTTA 3RIMA 1ZHOA 3C45A 5F73A 3OPMA 2K5UA 1BGXT 2JRCA 1Y89A 2GZAA 1NVKA 2XCLA 3PQ6A 3X1XA 1WSWA 1XHLA 3M0EA 4HRYA 2TMKA 2RJ3A 4XIIA 5TIIA 3AVWA 2GN9A 3CEMA 1BWPA 1YCFA 3LCMA 4AY3A 1ORTA 1NN3A 4GXQA 4BB9A 3MJEA 1PLJA 4G8CA 1H8HD 5HGJA 4RTKA 3BFVA 2Y1LA 4M76B 5H82A 1XAHA 2BIFA 4WMLA 1KYZA 1LDBA 2BN4A 2FP4B 4XTCS 3MMZA 3W78A 4CW7A 1Z18A 1LLUA 3HEAA 4F7DA 2QUAA 3BXFA 5G3YA 2YOGA 1O0CA 3E7PA 3SLGA 2JGIA 1VKJA 2PX6A 2VHYA 4Q15A 4ZJUA 1ZR2A 1XQ9A 4GD3Q 4WZBE 5CA1A 5EXXA 4HDSB 4M1WA 2PT9A 2V8BA 1LKZA 2WE7A 4HWOA 3ZE6A 4KXMA 1ES9A 1KETA 3QVXA 4PPFA 3MA0A 2ZI3A 4M0LA 2DC1A 4YLEA 5IT0A 4C0AC 1R0BA 3HDHA 2HDHA 3AHJA 4F06A 3E48A 3SYRA 5E1MA 1QTQA 2VXOA 1N4AA 3AVUA 3ZK7A 3PGLA 1JEEA 3B8HA 2YZ7A 1JPNA 4YRMA 4YNBA 4UE3S 2CW5A 4B3DA 2QAJA 2AR9A 4QU5A 3WBFA 1DC7A 4RHUA 1OXVA 4UNIA 3UMSA 4NJMA 1D2MA 4E51A 1MV5A 4IF6A 3KSRA 1EEXB 1II8A 5E4JA 3B7PA 3GLUA 3GZTB 2O8EA 2XADA 3FG9A 5H3LA 2FTKE 3QFSA 2KPOA 5TQ2B 2JAQA 2Q45A 2CLLB 3WNCA 3EIEA 2TRSB 1V9CA 1U0OC 5FUXA 3N9IA 2C84A 2J9FA 4DPLA 1VYHA 1NNLA 4I55B 2KWIA 1ZJ5A 1IB0A 2D3WA 2NO1A 2YVLA 2ZTHA 4V0RA 5AIBA 1RC1A 3N8KA 3HL4A 3GGSA 5E6SB 3EG9B 4Z54A 4YAOA 2QPLA 4N9WA 3FI0A 5LOVA 2GHIA 1FPMA 2H63A 3HCDA 3OZFA 1XEXA 3L4BC 5KX5A 3NUGA 4HZIA 2BV3A 4L9WA 2X8LA 3NHWA 1KK0A 2IZZA 4NYJQ 4X1YA 3I2YX 2Z5VA 4EKEA 2PYIA 4DV5B 1ACMA 1WDTA 1H4QA 2VKTA 1ZXXA 2J0SA 3EDQA 1ABFA 3ZZTA 4AG5A 1NDUA 1NSFA 3ZLTA 1DKMA 1MJNA 1ZMOA 3CT6A 4CODB 4XQGA 3I6BA 2GKSA 3CMMA 4DC1A 2RC5A 3BWMA 2RK3A 3U44B 5GPBA 1IY0A 3CX7A 4G1CA 2QE6A 4KBGA 1B4DA 4Y9UA 2IKSA 3T1VA 4RTQA 2DKNA 5EAIA 1ECPA 4PZYA 5IN4A 2C1ZA 2HQRA 3NUZA 2JFUA 2VBFA 1WEKA 4GE0A 4TTTS 3MVEA 4XQ0A 2AJTA 3TCKA 3LT0A 2AFVA 4PANA 2H4YA 2R6ZA 3IEUA 4CM8B 4ZHQA 1RRVA 2VDLB 2XNHA 1Z0JA 3F7NA 3U4QB 4E1BA 4OXXA 4WZBA 4K03A 5AUNB 3CCCA 1O0BA 1KQ3A 2VF8A 2WP0A 1MDBA 4LHWA 3KNZA 5CNMA 3PEFA 2Q5FA 4IDDA 5AI8A 1EHCA 1SB8A 3RQIA 2QMYA 4YCLA 2EXXA 4XYLA 1K3FA 2BMDA 3O0DA 3ZDBA 2VSOA 1HE1C 4LY3A 4JUAA 1KMCA 4ZOLA 2FR8C 4HAZA 4R40A 5BNWA 3HPQA 4HTFB 3FLMA 3CG0A 3KJHA 2JIZA 2V59A 1N2CE 3C16C 3P45A 5LBIA 4JL8A 1RI4A 2QTTA 2XNJA 3O91A 4JENA 3KDPA 1XNRB 5A0TA 2IL1A 5DTMA 3LL4A 1VCHA 2W2XA 3C3DA 3BZWA 4BGDA 1T9AA 3DHWC 1Q2UA 1N5OX 4BEVA 1LGYA 4II7A 4U3JB 5DJ5A 1N0VC 3ROTA 4HUQA 2F55A 4A0RA 3OPXA 2OHVA 1XV5A 3LZCA 2Q3HA 4RHXA 3VC1A 3ZZ1A 2AYYA 2O1WA 2Q0HA 3SMVA 1JL3A 3HV2A 4EL5A 1V16A 1VLVA 2YWXA 3QU9A 1XCBA 3FSGA 1GGFA 1OH5A 3UXHA 5ALFA 1DL5A 5CR9A 4FT2A 4TWJA 2W4MA 3LXRA 5CGQB 2CJWB 1Y9AA 1XI2A 1QHYA 4HQ0A 1GVNB 2D5LA 5GY7A 3V6LA 4BX8A 1JU4A 2GN2A 3LC0A 4CMIA 4ISBA 1QB8A 2H7CA 2Q1YA 3HY6A 1CEXA 4N7MA 2HREA 1TO6A 4LZZA 1ENOA 2ZJBA 8MHTA 3PQ7A 4X54A 5A3VA 1HE3A 1J0DA 1THTA 4RF4A 1IVNA 5ALUA 3DLTA 1Z8HA 3ACDA 2OHJA 1RWWA 1TJ5A 1M74A 2DBRA 4LZNA 2N75A 1VYTA 1XP8A 3CNOA 1EINA 3PT5A 1QS0A 5BXYA 4PPYA 1S89A 4P4UA 1DAGA 4L6AA 3ZGZA 1ULHA 1R0XA 3QPAA 4BP1A 1NF9A 3NIBA 3KOOA 5FADA 3HY3A 4BVAA 5DWVA 2VA8A 3RVPA 1TJYA 4IJ6A 1PZFA 4BZZA 1E3QA 1B3RA 1KAHA 4EPRA 3B9RA 1ONBA 4NAUA 4E7PA 2WMDA 3DZKA 4Z1MD 1GRVA 3Q3IA 3D6NB 1OWPA 1UJ2A 3L49A 2NAFA 4URHA 3IDSA 1HNNA 2O48X 3CMCO 2BLNA 1AX9A 4JNCA 1Z4MA 5K4HA 4YI5A 4DZZA 4FWBA 5CFOA 3WFJA 4K40A 1PGNA 1T3HA 2JH3A 3LUAA