1JW9B

Structure of the native moeb-moad protein complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
240
Chain Sequence
AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
total genus 82
structure length 240
sequence length 247
ec nomenclature ec 2.7.7.80: Molybdopterin-synthase adenylyltransferase.
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jw9B00
1Q2XA 3K6JA 1NQOA 1WZEA 4FB5A 2NQ8A 1WMBA 2W2KB 1NQAO 1E7RA 1EUCA 3E9QA 3PJFA 4QUKA 4UUNA 1SMKA 5KVQA 2Y0DA 1DFHA 2EHDA 3LC7O 4NDNE 4DQVA 1XQ1A 2O4CA 4XB1A 1HEUA 3IJPA 4BO6A 4AJ1A 3VH4A 4PN3A 2J3IA 4IJUA 2BHLA 1MFPA 4BMSA 5K9ZA 1I3MA 2DT5A 4IDFA 5EMHA 2LDBA 4I08A 1R0LA 4RGBA 1JKIA 4ZA2A 3KTDA 1R6DA 4GMGA 5F1KA 2E6UX 4J1SA 1H94A 4RL6A 3ZU3A 2HLPA 4RDIA 1CF2O 3D5TA 4DIFA 1MP0A 3DBHB 4AG3A 1ZH8A 3W4JA 2I67A 4YBZA 1T1RA 3HDQA 4Z0TA 4AVYA 2PZMA 5CDSA 1X0XA 1YVEI 5MGBA 3I4CA 5IJZA 5IN4A 2C5AA 2I65A 3OECA 1T2CA 2BFPA 3L0DA 3PHGA 4ZQBA 1S7CA 4ZVVA 1QV7A 4K6CA 3TRIA 2ZCUA 1LSOA 1I2BA 3BMNB 5EIOA 4ALKA 2W4QA 5TIIA 1KETA 3K5PA 3P5SA 3JD3A 3H2SA 1N9GA 4N5NA 4KUHA 4MVJD 1PEDA 2VZ0A 1GZ4A 3FTNA 3RUFA 1F06A 5L45A 1E3IA 2HJRA 1BDBA 3Q6IA 1HE4A 1RWBA 3PFFA 5TJ9A 1OAAA 4TZKA 1LDGA 4XJTA 1QYWA 3EAGA 2GN6A 2OOSA 4BO1A 1C0PA 2WD7A 3CEAA 3D1LA 1SBYA 3JQ8A 1HE2A 3QVSA 4LVUA 4RVUA 3ZHXA 1UDBA 4RZHA 2BMAA 2YQ5A 4ALIA 2E82A 3QHAA 3PHJA 1MG5A 3GC6A 1PJ4A 4YQZA 3ZV5A 4EJ6A 5FF9A 4OJNA 5I9LA 3GA0A 5TS3A 3RC9A 3DDNA 2Z5LA 3H5RA 2JCVA 1E6WA 1ADCA 4AJKA 4PLWA 3U09A 4HNGA 4GVXA 5G0SA 4AJ2A 4BKPA 1B2LA 2IZ0A 5A9RA 2PK3A 1AHIA 2RIRA 3SC4A 4E5MA 3GG9A 4DC1A 4JN6B 2LDXA 4BVAA 2JKVA 2YUTA 1DOHA 5KWEA 2HJSA 3HDYA 4JBGA 1YL5A 3JQEA 2PFGA 3GUCA 3GEDA 4AJPA 3HJAA 1GYRA 3RSHA 4QO7A 1NXQA 3RUAA 4RPJA 5L7WA 4FN4A 4CV0A 4W82A 3EDMA 2P9CA 5BNIA 1KERA 3BTUA 4WCFB 3L9WA 4PLGA 1RJWA 3RUCA 1EBUA 4A7PA 3RQSA 2V6GA 4BNGA 2V7PA 3GLQA 5H82A 3IIEA 2PZKA 3BMQA 3QWFA 2WWRA 3HSKA 4RLSA 1O9BA 2YFHA 2EKQA 4Z9FA 1WWKA 1X7HA 3F9IA 4IDGA 5IXYA 1PGOA 1B7GO 4IQ0A 1E3EA 1SB9A 3H8VA 3W8EA 1U3TA 3L4BA 3Q11A 4CM6A 1B15A 3WGGA 2QRJA 1CQJA 4KDEA 4PCVA 3MEQA 5DBIA 5A04A 2PGLA 4IUYA 5A02A 3WMXA 5ITWA 3I9OA 4XEHA 4FQ8A 1ZSYA 5ADHA 3AY3A 3PYMA 3QWHA 3F4BA 2ZYAA 5TT1A 2FWMX 1NASA 3SJUA 1H6AA 1DFIA 4CMJA 5DCWA 1O5IA 4FC6A 3GVCA 5IDYA 3D3WB 1E1MA 4UAGA 3RUIA 3E5RA 3JYOA 3L77A 3GK3A 3DOJA 4BNJA 4UVHA 4WNIA 1LX6A 3PQFA 3O03A 4J3FA 4J1TA 1ISJA 3F5QA 2BF7A 2QHXA 1H2HA 3EY4A 2VOEA 5JAMA 1W4ZA 3UOGA 2H63A 1P3DA 1ULSA 4D42A 4R1SA 2VYND 3JYLA 4BL5A 3I23A 2PD4A 4QSMA 4GVLA 1AXGA 4JXKA 2ZK7A 1KYQA 3DTTA 4XGIA 4L4XA 1WAMA 1DLIA 3VPGA 4BUCA 1PR3A 2NNLD 3ENKA 1ISHA 2CDBA 4FSHA 1LJ8A 5IAAA 3CH6A 1YKFA 2OBNA 1UXGA 4NQZA 4QXMA 4CLDA 2CZCA 4LSWA 3JQGA 2UYYA 2GO1A 2J5KA 3VKUA 3VPSA 4B8ZA 1E3WB 3WYCA 2YYYA 3KYCB 1P9LA 1DDOA 2BGMA 2HMVA 4EW6A 2DLDA 2AA3A 3AOEA 1U5CA 1V9LA 1KEVA 1DBVO 4GH5A 2I5PO 2G0TA 3ZV3A 1I8TA 2X5OA 4MINA 4R5HA 4E31A 1PIWA 1D8AA 3E6AA 1DJNA 3FCOA 2H6EA 3Q2IA 4MVJE 3VH2A 3EGOA 4FC7A 2XF8A 1QRRA 1NR1A 1M6HA 2OHXA 1PZHA 3B1FA 2W90A 2G17A 3HNPA 1FDUA 4DQUA 1IYZA 1PJCA 4YJHB 1M6WA 4UEJA 1L7EA 1UZLA 4MIEA 1PS8A 4DYVA 2AQIA 4PG7A 4RVFA 1T24A 3U62A 1ENOA 1DRVA 4BB6A 2NU6A 4RQTA 3VTZA 5C7OO 4BNZA 2HUNA 1I01A 2OZPA 3AM4A 5ILGA 2IDZA 1XKQA 1K6JA 3PGXA 2YHIA 2CDCA 4XDYA 3K8ZA 5HTOA 4HADA 4JX8A 1E1LA 2CVZA 3WLFA 3WGOA 1KVUA 3HHPA 4ZRMA 1BHSA 1LBEA 2OFPA 1LLUA 1DEHA 3MJTA 3TL3A 1I2ZA 4UVDA 4GGOA 1T1SA 1LRJA 3PRJA 1NPDA 1RM4A 3IKVA 1KEPA 2B37A 4B7UA 3HFGA 2ZYDA 3ZWWA 2P9EA 3OA2A 4Q3AA 1JAYA 4IZHA 3CMMA 1P31A 1RM3A 5EQDA 1W73A 3S2IA 5HS4A 4D7AA 3VOSA 2DBZA 4RV9A 4KTTE 4Y9DA 3JQ8B 4IDAA 4OHUA 3RVDA 4Y98A 1HLDA 1UP4A 4NU5A 1B8UA 1MX3A 2FSSA 4B3JA 4IZIA 2A92A 4OSPA 2X0NA 1Q7CA 3NDJA 4JROA 3MJSA 4ZN6A 1XA0A 3DONA 4KQXA 3LLSA 4RF4A 3IUSA 4YJDA 3ZNNA 2B5WA 1D1SA 1V8BA 2WD7B 3QP9A 3OF2A 4R41A 1HL3A 1ENYA 2AE1A 1NQ5A 1KBZA 4B4OA 2ZTVA 3D3WA 2FR1A 1F8GA 1HDYA 1E7QA 3ZHBA 1ZEMA 4R9RA 3H3FA 3TZHA 1AHHA 3FR8A 4KZPA 4PG8A 1LU9A 5ENVA 3ZV4A 4EEZA 1GCUA 1BDMA 3NT5A 4I5GA 3L4BC 3CZMA 2A94A 2Q2QA 4DXHA 4QTZA 4L9RA 2ZTMA 4TROA 5BR7A 3OBBA 4RZIA 4WCDA 4BV9A 1Z82A 3ZW9A 4QQRA 2DTEA 2VYVA 2FMUA 3GHYA 3ZU5A 4A5OA 1BTOA 4E5NA 4TQGA 3K2BA 4CM8A 1ULUA 3AM3A 4TVOA 1U1IA 3BA1A 1ZK1A 3QSGA 2AQHA 2JFGA 2P4HX 2IYPA 2W98A 2X0JA 4D0RA 4R5MA 1SCUA 2NQTA 3ZWMA 2GUGA 2HMUA 1B14A 3JYPA 4LN1A 5JDIA 2IZZA 1RYDA 1LLCA 4IDEA 1O89A 4E6PA 2Y99A 4LCJA 4BMVA 4DIBA 1WMAA 1P33A 2D1YA 2CY0A 2VCYA 1QP8A 4MVJF 3C3XA 2DVMA 1A9YA 4YQYA 4N7RA 4AJ4A 1OOEA 4TRJA 2RAFA 2P4QA 3EZYA 3F47A 1Y9AA 2R00C 1XQ6A 5C3MA 2I3GA 4GPD1 2XOXA 1N1GA 3GR6A 4EUHA 4HFNA 3GVPA 3DZHA 1BVUA 4YJGA 4CV3A 5CFZA 1VSUA 2VWQA 3DQPA 1UAGA 2VYVD 1HWYA 1E5LA 1LSUA 1A7AA 3UF0A 3A06A 4J7XA 5EL0A 4RO0A 4U6SA 5ITVA 4YAGA 2ZYGA 3SEFA 1B8VA 4P4GA 3WBBA 3UCFA 3M1LA 5G2OA 3GMSA 4J6FA 3GPDG 5BSHA 4R16A 1T2DA 1UDCA 4YXFA 3JQFC 1Z45A 2P5YA 5I7FA 4ZQEA 5HBRA 3U4DA 4BNIA 3KLMX 1MLDA 3AY6A 3TNLA 4XRRA 4A03A 2EEZA 1E6UA 5BSFA 8ADHA 2C2YA 4NBWA 3OA0A 5FEUA 4MVJM 4II2A 1ZK0A 2UUOA 1KC3A 3MJEA 3V1UA 3LLVA 2ZQZA 1J5PA 3ADOA 5H81A 3RC7A 4Q9NA 4J0FA 4DA9A 3E48A 2B4RO 2QG4A 4G65A 3LT1A 1Y8QB 4L76A 4OL9A 3GUYA 4FD3A 2CMDA 3OFSA 1C0KA 5I9MA 5THQA 2RBEA 2NACA 3K92A 4PG5A 3EUWA 5A3VA 3WWZA 3S8MA 4AJLA 4BHTA 5IN5A 1ZBQA 1VJTA 4DPLA 4J9VA 2EF1A 1PX0A 4K28A 1G1AA 3DZJA 1O6ZA 2ZATA 3HZZA 1DRWA 3ITDA 4L8VA 5JDCC 4ZQHA 1T4BA 1YDEA 3U5TA 2XXJA 3S2EA 4Q3DA 3ORFA 1NP3A 1V3VA 4IDBA 1ADBA 4NBUA 4NJOA 4R51A 4NU6A 4P4LA 1KY5A 4NBTA 5DN9A 1KVQA 5I7SA 5FFFA 4Z3DA 1PQPA 1Q0HA 3UCEA 1NVTA 1PJTA 3INTA 2JD2A 3ENNA 4JJFA 4MP8A 4NHEA 1C1XA 3HDJA 4U6QA 5G0UA 3UICA 3VC7A 3IMFA 1P0CA 2Y1GA 1V35A 3AOEC 3PWZA 4CMGA 1GCOA 4ZU3A 3CE6A 3GFBA 3WYBA 3ITKA 4P38A 1HRDA 1A9ZA 1OMOA 4E0BA 5I7VA 1GPDG 5AXCA 1GFSA 4A2CA 3L4SO 3V1TC 4GL4A 3CIFA 3ETEA 4U7WA 1ADGA 1BSVA 4JNKA 3ZWOA 4E2ZA 3M2PA 2I76A 3LDHA 3W4IA 4YACA 2OMEA 4HUJA 4XR4A 4FJ1A 1HSZA 3MWEB 4DL9A 3JQ7B 1HKUA 3VVCA 4TMFA 2OL4A 2EV9A 1O8CA 3ROPA 1HYHA 2H9IA 2NVBA 1PQWA 4D44A 2X6TA 7MDHA 1VC2A 5B1YA 4DC0A 1N8KA 4YVFA 2YV1A 5B37A 1PS0A 3OEYA 4ALNA 4ZHSA 3OIDA 1IE3A 2VRCA 3HADA 4HFMA 2O50A 5LCXA 4CM9A 2CUKA 1P74A 5JY6A 3AWDA 2EIHA 1C3VA 2IZ1A 6ADHA 2QRLA 1XLTA 1R4NA 3JV7A 3FD8A 4CMIA 5HA5A 3KHUA 3QA9A 4EGFA 1M2WA 2UV8A 4KWIA 1ONNA 3MWDB 4GBJA 3UN1A 4GMFA 4B7XA 5DDIP 3S1LA 4D3SA 5T67A 3SJ7A 3H5NA 2Y1DA 1ISMA 1I32A 1J49A 4CM4B 1PJBA 3STHA 3DMTC 4D46A 2B4TO 3C7AA 4ONEA 1Y9EA 2BH9A 3TSCA 1DRUA 3F46A 4B3IA 1GUFA 1JDJA 1NFRA 2OBYA 3GPIA 5A4DA 3K73O 1E0DA 2RHCA 3RUEA 1Y8RA 3ON5A 3QVOA 3VPHA 3OEWA 2CVOA 4ND3A 3BTVA 4ND5A 5KVSA 2QYTA 3F3SA 1U4SA 1JKJA 3QQPA 2AHRA 4XDZA 4DBVO 5JCJD 4RORA 5ICSA 3KZVA 4TWRA 2CD9A 2PA3A 4J2HA 1E7SA 3ANLA 1Q0QA 1H0KA 3WFJA 4JQCA 4R1NA 2BD0A 4HNHA 4XQEA 4GWKA 3PDUA 1JA9A 2G82A 3RUDA 2EKPA 2I9PA 1Z7EA 5AXAA 1GQQA 1P1IA 1EFKA 2OO5A 4URFA 2J8ZA 4LISA 3MCVA 5CAEA 3WJAA 4XGNA 4B8WA 5ER9A 3VAZA 5I7EA 1J0XO 5I8WA 5B4VA 1LI4A 1GAEO 4ROSA 2AEFA 5L95A 1E1KA 5L4LA 3S2GA 4WLEA 1A71A 1YQGA 3UUWA 4XYEA 3FN4A 2Y0EA 3KEOA 3KYCA 3IOYA 1EDZA 2O23A 5FWNA 3WXBA 3ZWXA 4MKZA 1BXZA 3KSDO 3UAGA 4OKIA 4CM7A 5A05A 1VRWA 2GZ2A 5L7YA 2JAPA 4HXYA 1LSSA 4UVEA 1QKIA 2GLXA 3TDKA 1BWSA 4FS3A 4R69A 4WPGA 3F6YA 2FOIA 4RF5A 1LEHA 1XWFA 4B7CA 1CETA 2FZEA 3I83A 1IULA 3T4EA 2VNSA 1R4MA 1WNTA 3DWFA 2B36A 3LF2A 4BQRA 4DRYA 1IPFA 4F46A 1Y5MA 4Y6PA 2AMFA 4E5YA 5JCXA 4P22A 3DBHA 4KWHA 2JJYA 1PS9A 4P4NA 1HYEA 2VQ3A 4U8GA 4GI2A 2HMTA 4OQYA 4R54A 4XJSA 4WLFA 5TNXA 4N5LA 4PLTA 1XDWA 3DBLB 3UW3A 4J1NA 4CLRB 1EVZA 4JJGA 2HMSA 3C1TA 2Z1NA 1QLJA 1DXYA 3GEGA 1Y8RB 5JDIC 4DWVA 5JMWA 5A06A 3B1KA 4G5HA 5L9AA 3AU8A 4IINA 4J2OA 3OMLA 4FFOA 2BGKA 5F5LA 3Q9NA 4FIZA 5ENDA 2FN7A 3BMCB 4XGKA 5KTKA 3TFQA 2Y66A 3K96A 1ZNQO 4I8XA 1BGVA 3GAZA 5A9SB 1JU9A 1Y5RA 2BRUA 3LSYA 3O8QA 5T8KA 4E33A 3O8QB 3OH8A 2WM3A 3N7UA 3GEMA 4D3FA 1TT5A 4BNKA 2HCTA 1F14A 2X1HA 2JFHA 4GKVA 2PH5A 4ALMA 1FK8A 1KEUA 2P2SA 2TMGA 2OP1A 3SXPA 3FBGA 4J9UE 4LVCA 4NI5A 3FNFA 3LF1A 3ANMA 1LDMA 1NNUA 3U9LA 2Q3EA 3SLGA 1E3WA 1YB5A 4XQ9A 5JO9A 3QVWA 1WPQA 3H2ZA 4PRLA 3L6OO 3QWBA 4IQ8A 2IE0A 1U3UA 4IDDA 1L7DA 3PHHA 2AE2A 4MDHA 1WDKA 3RFVA 1NBOA 5CDYA 3MJVA 5G0WA 5CDGA 2X4GA 1EBFA 3H9JA 1UAYA 4R68A 1GR0A 2ZIZA 4PLFA 2YJZA 4Q3BA 3VKVA 4N18A 4J4TA 1C1DA 3G1UA 1DIRA 2RH4A 3EVNA 5AQ1A 4LGVA 3S2FA 3ZH2A 3HB5X 5JS6A 2ET6A 4CMBA 3ASVA 1LDYA 3VH3A 1H9AA 1ZVMA 5A1TA 4YAJA 5KJCA 1GUZA 1EVYA 2GRAA 3AI3A 2YY7A 1YBMA 2O7SA 2E4AA 3G49A 1JVBA 3JQDA 1E92A 4XQGA 2JAHA 3PTZA 3DTYA 1K0UA 2PKQP 2D0IA 3PP8A 4BB5A 2C82A 1SC6A 2J3KA 1OI7A 1HE3A 1ZMTA 4EI2A 4PLHA 2V6FA 4C7KA 4FDAA 1I3KA 3PXXA 3PYLA 3KO8A 3DXFA 4ZGWA 4G81A 3ZWPA 5JAZA 4HFRA 3G3EA 2JD0A 3GZNA 2YHUA 4R1TA 4DGSA 1YO6A 4DBZA 1D3AA 3U4IA 4YR9A 4F45A 1Y6JA 3GNTA 3LVFO 2PZJA 2Y68A 4YCAA 3ZN2A 1X7DA 3OSUA 1SOWA 1TXGA 3OJOA 1XG5A 3F5SA 1ZK4A 1PTJA 2GPTA 3UKOA 5IZ4A 3NYWA 1ISFA 1SEPA 1N7GA 4UUMA 2NM0A 1SEVA 2AG8A 5F1PA 3VHRA 3H5AA 3GOHA 3OHSX 4XCVA 3U49A 4BO5A 2DQ4A 5JNLA 1WXDA 3O4RA 4PG6A 4CLEA 3DOCA 2R6JA 3DZGA 3HN2A 1MB4A 1R0SA 4RVDA 4DPKA 2PGJA 1WW8A 3FI9A 4RVHA 2D5AA 4O0LA 2VUSA 3ZWAA 1CRWG 3GY0A 4Q3EA 4EEXA 5DBGA 4BQPA 4YT5A 4CV2A 1QYXA 3I9KA 3WNVA 3A1NA 3KYDB 2BFAA 1HDCA 2WTBA 1AGNA 1Z73A 3FNGA 4QT0A 1NFFA 4BO9A 1JAXA 1H6DA 3KXDA 3TN7A 5ICMA 3K31A 2H1SA 1OFGA 1YDWA 2NSDA 3ZNQA 2ZB4A 3BHIA 4WKGA 3DL2A 4WCFC 1EFLA 2A35A 2X58A 4YWJA 4E5PA 2ZTUA 5A5EA 4GSLA 4NG5A 3CKYA 2VWHA 3LT2A 1CWUA 1DIHA 3H9EO 4MIYA 3I9MA 5DP1A 5THKA 1PJLA 4S1VA 5TSDA 1GQYA 1IHXA 4MKXA 1I24A 4CR7A 1QYVA 1SAYA 4M1QA 4MJLA 4WEQA 4DMLA 3V2GA 3NUGA 4AJNA 3RWBA 3PWKA 5TF4A 2GASA 4GLOA 3P2YA 1ARZA 2NTVA 3FPLA 4BO4A 2VOJA 5CPBA 2Y67A 5BSEA 3BHJA 3JQAA 3CTMA 4NBRA 4DIOA 1K6XA 3DZBA 3L6DA 1MA0A 5F3RA 4BO8A 4IGEA 4CL8A 4CMHA 4E4YA 2I99A 2NTJA 1ZSVA 2FR8A 4MVJI 2EKLA 3FWNA 5T5QA 5KOIA 1EK5A 2GSDA 3CINA 4JK3A 1B8PA 1NPTO 1XU7A 4BNMA 2IXAA 4H15A 4I5FA 4Z9YA 1NWHA 2B35A 2HKIA 3PQDA 4NNJA 5IF3A 1DHTA 1V6AA 3DMTA 5IZCA 5KKAA 1QSGA 4I9UA 4NZ9A 4FOOA 2O2YA 4K26A 5DZSA 5KJEA 4HFJA 5DT9A 3VH1A 4RPGA 2HSDA 4R4JA 1EK6A 4NFSA 3D64A 1MG0A 3LK7A 2SCUA 4RPLA 1PJSA 1PGJA 1IL0A 3OJEA 4CQMB 4CQMD 4FFRA 1BVRA 4M86A 2YDXA 3NTQA 1EQ2A 1T25A 1D4FA 2YW9A 3I9LA 4JJIA 3WQRA 1B16A 3IL2A 4ND1A 3BMCA 4W6ZA 4PGFA 4XYMA 2NU7A 1UR5A 2X9NA 2PH3A 3DFZA 4LRTB 1ISGA 4BMNA 5HM8A 4RPKA 3IJRA 3NT4A 1WP4A 4GX5A 4BNTA 2PKQO 1LDBA 3ZHYA 4YB8A 2IYOA 3FPCA 1DIBA 1R37A 2AW5A 2Q49A 5COBA 4BNHA 4HV4A 3IC5A 3LC1O 4Z6KA 5KJ6A 1YJ8A 2WMDA 3I6QA 1SNYA 5DCUA 5JXWA 1CQIA 1GY8A 1U2DA 2OP0A 4DREA 3ZV6A 3DC2A 4M8SA 2Q2WA 1UH5A 3FNEA 3B1JA 4KP7A 3RASA 4PLCA 3I52A 1YL7A 1BW9B 4NJMA 3TPCA 5BQFA 4M89A 3RUHA 1R66A 1G6KA 1RM5A 4TRRA 5IDWA 1JWAB 2OGUA 1BRMA 2RHRA 3UGKA 4XB2A 1HDZA 3W8DA 5JMPA 1GZ3A 4D43A 1JLLA 4GLLA 2HAEA 1Z74A 4QFDA 4O63O 2AEMA 4OH1A 1KOLA 3GGGA 3IS3A 1PU2A 5F1OA 3DZIA 3DHEA 2YHIB 2QZZA 1Q7BA 5COAA 3AY7A 4L4RA 4D45A 1H2BA 3SVTA 1ZJYA 2VN8A 4O1MA 5EESA 9LDBA 2FRDA 2Q46A 4K1LA 4U5QA 3GZNB 1NHWA 5AVOA 3S55A 7ADHA 3RU9A 3WGYA 5LDHA 3FF4A 3JD0A 3GVXA 1O94A 3JQAD 3JYQA 4TZTA 4BO0A 2NTNA 4IDCA 3NDRA 2E48A 1I2CA 4J4BA 5DOVA 1FXSA 2FY8A 3R1IA 1MC4A 4BNVA 3NGLA 1SZJG 2C54A 2D59A 4XYLA 5MDHA 3PWSA 4EYEA 1IUKA 1LC0A 3ZNOA 4BGUA 4FPXA 5GMOA 8LDHA 4BO3A 2VTDA 4XRGA 1EEHA 3PI7A 4A27A 1NWCA 4RLHA 1VL8A 2DC1A 3D4PA 3IP3A 4ALJA 2GDZA 1PJ2A 5G0TA 4E12A 4OAQA 3G17A 3AJRA 2W2LA 4YRBA 1TT7A 3WTCA 2WE7A 5BNFA 5JAQA 5CPFA 5ES3A 1DSSG 2O4UX 3LT0A 1YWGO 2A9FA 4BV8A 4ND2A 3RC1A 3EC7A 1TLTA 3AFNA 3GGPA 5A3JA 1HYGA 4M54A 3AUTA 3JQCA 3TZQA 5IDQA 4R9SA 5AYVA 1R0KA 4JP3A 2X5JO 1TB4A 2A4KA 4CMIB 4BKOA 4CLXA 2RH8A 2POQX 2WE8A 3W1VA 1V3TA 3KYDA 1B3RA 2OORA 3WQQA 3PFWO 4IM7A 1C14A 1IZ9A 4EJ0A 2IEDA 3N74A 1NR7A 5DOZA 4YRDA 4AICA 3C7CB 3FHLA 4DTIA 5L4NA 3KSZO 1UXIA 4RF3A 3OIGA 3A28A 3D4OA 1NAHA 4RPHA 3JD1A 1RYEA 5COQA 2VHZA 2DBVO 4YDRA 3BYZA 2JFFA 1YL6A 1X1TA 2C0CA 2J3HA 3PJGA 5CEFA 3GHHA 2VWPA 3VTFA 3DFUA 4OYRA 2Y93A 4XWYA 2GYYA 3O26A 1I3LA 1Q1NA 3MOGA 5G4KA 2O3TA 1PZEA 1BG6A 1VLLA 4J16A 3W6UA 1OBFO 3I5MA 1KVRA 1C0IA 1NAIA 1R16A 2BLLA 5JAIA 1MFZA 5TT0A 1K5HA 5EERA 2DM6A 4OXYA 2O48X 4YYZA 5U9CA 4JBIA 2WYUA 2JHGA 1GL3A 1PZFA 1LQUA 1RKXA 5U1PA 4NIMA 3D7LA 3ST7A 4GAEA 4JIGA 5KKCA 4BKRA 3RAJA 2BKAA 3F4LA 1B0AA 1GEEA 3P7MA 3Q0EA 5BNTA 2X0IA 4WLNA 4PLZA 4WE3A 3WJ7A 3PZRA 3WLEA 3IKTA 3DO5A 4CR8A 2JHFA 3N58A 4M87A 4KDFA 3WSVA 4EZBA 4UULA 3NJ4A 1A27A 1O95A 3BMOB 2WD8A 1YGYA 4KMSA 1Q0LA 3BMOA 4YAIA 5FI3A 3RKRA 3ZCXA 4J0EA 1RPNA 4R3WA 4GSKA 4EDFA 5FI5A 1N92A 3DBRA 1EQUA 1TVEA 1XSEA 3GMDA 1UUFA 3H7AA 1QG6A 3I3OA 4YPOA 4TKMA 3GNQA 5U4QA 4AJHA 3WS7A 5DCYA 2VZ8A 2FP4A 5L51A 2D3TA 1X1EA 3DZFA 4PLVA 2O3UA 3DBVO 2BGLA 3FBTA 3H65A 3AK4A 3TFOA 2OUIA 2EW8A 4YEDA 4L0QA 4YT8A 4WLOA 1IPEA 1LA2A 4ID9A 1UP7A 1ZK2A 1GADO 4J4HA 4OM8A 1U4OA 2FPGA 5T64A 1NTOA 1ZUD1 2IXBA 2GR9A 3DAGA 2EG9A 3QY9A 2VT2A 2Y1EA 5L40A 1ID1A 1DC5A 4OXKA 5L53A 5HRUA 1MC5A 2YFQA 1J6UA 2VRBA 4DVJA 1EDOA 4FFNA 1U9JA 1U8FO 1GPJA 3WIEA 4B3HA 3E8XA 3GVIA 3DZKA 3AFMA 1F17A 2EP7A 1IHYA 2VWGA 4KUEA 2B83A 2QX7A 5G4KB 1XU9A 2HK9A 3NGXA 5EN4A 4D41A 1T2FA 4FGWA 3GDGA 1HZZA 2WDZA 1V3UA 1X7GA 3BAZA 4DMMA 1YBVA 3UCXA 1LRKA 1P77A 4M49A 2H5LA 5JSFA 1P1KA 1W6UA 5JO0A 3VZQA 4BNUA 3UXYA 3TOXA 4OO3A 4D3DA 2HRZA 4GGPA 4RDHA 5GY7A 3KRTA 3EK2A 2R00A 3ULKA 5TQVA 1YS4A 3INGA 2AQKA 2Q45A 1KC1A 2EP5A 2Q1WA 4GX2A 4ND4A 4E2WA 1SB8A 4IJVA 5JY1A 2Q99A 3WGHA 4AFNA 1K6IA 5T6BA 4DQXA 4EJMA 1GV1A 4OGWA 4IXWA 1C1XB 4F6CA 4ESOA 1PJQA 1JQBA 3GN2A 4TSKA 3ZWCA 3MJCA 4BGEA 3KSUA 4ALLA 5TC4A 2DAPA 4YAEA 1LQTA 3TOZA 3NT2A 4UREA 3WX0A 1ZKMA 4PG4A 3OETA 2E37A 3G0OA 1I36A 4DLLA 2Q2VA 1JKFA 2X0RA 4JP2A 1J4AA 4BNLA 1ONOA 3QIVA 1DHRA 2QW8A 4CJXA 3BIOA 4I5EA 4J7CA 1SPXA 2O3RA 3JQ6A 1KIFA 1FF9A 1GUYA 3ZNPA 1YB4A 3AI1A 4C4OA 4Y6RA 1U7HA 2P91A 5GZ1A 3QLJA 1HT0A 2WYWA 1EE2A 1GD1O 1QYCA 2OXIA 2NLOA 1MXHA 1VJ0A 3PLNA 1DAPA 4ZRNA 1GV0A 1E77A 4B4VA 4B4WA 1M75A 4FCCA 3Q1LA 5EINA 4WNCA 4XQCA 1N9GB 1K89A 3CZRA 1O0SA 3RROA 1HF3A 1QR6A 1JN0A 3HG7A 3JQFA 1OC4A 4IMRA 4WOKA 4LMPA 4P8RA 2YV2A 3I9NA 1DJQA 4A0SA 2C7GA 1R4NB 3LC2O 1TI7A 2ZJ0A 3WMWA 2WEKA 2GGSA 4E32A 2WSBA 3D4NA 3RFTA 1ML3A 4JBHA 3E03A 4MVJH 3PHIA 1AXEA 1P1JA 1X0VA 3IP1A 3COSA 4G2NA 1JWBB 3ZW8A 4OOFA 1HDXA 4CR6A 3ONEA 4OMUA 2DUWA 3DB2A 1DLJA 1DC3A 1L1FA 3GN1A 3F1KA 4H3VA 3WNQA 3W6ZA 3GAFA 3I9JA 4AJIA 4CLRA 4A10A 1XYGA 1P1HA 3T7EA 1PL7A 3GQVA 3PIIA 2X9VA 4ZICA 1PWXA 5L4SA 3QW2A 2NVUB 1NVMB 3GNSA 4E2YA 3UH1A 1D7OA 2GNAA 2HK8A 4XR9A 3MJ4A 3WTBA 2VZ9A 4CM5A 4LSMA 4YT4A 4FGSA 1XELA 2DPGA 3ZZNA 2QZ9A 3QV1A 1BMDA 3ZU4A 4AL4A 5JCJA 3DAFA 2GZ3A 2Z1MA 4BO7A 4WUVA 2X8LA 5KJ1A 1QV6A 3B20A 1YXMA 3BTOA 4QFCA 3FTPA 3H9UA 4R1UA 4RJTA 3QWIA 1H93A 1P0FA 2DUUA 1W8DA 1YOVA 3GDOA 1YOVB 3EHEA 4GX1A 4BNNA 2EXXA 3K2EA 3DEYX 1FDTA 3KVOA 3R3JA 1A4IA 1NQTA 2G76A 5C7LO 4BOYA 1R12A 3NKLA 1LDNA 1PQUA 4IMPA 4CM1A 3H4VA 5G4LA 3GH3A 5GZ3A 3C8MA 5DNAA 1T4DA 3WICA 3CSDA 1SOVA 2HK7A 3NTOA 1K3TA 3BHMA 3JD4A 1NM5A 2D5CA 3KYBA 4Q3CA 4MPDA 1FDSA 4W4TA 3I6IA 2NU8A 3CXRA 1HE5A 2WJPA 1M76A 4UUOA 4HP8A 3SC6A 3L9XA 3WYEA 4JCOA 3MTJA 4CM9D 3GG2A 1B26A 2ZCVA 1GU7A 4WASA 3VPFA 2VRCD 3QWAA 3FNHA 4A73A 4B79A 4HKTA 2HU2A 1LSJA 4XZ3A 1BXGB 2I66A 2GERA 2C7VA 4NK5A 3ZGYA 4BGVA 1T2EA 3EYWA 3I4FA 4UVIA 1PWZA 1XGKA 3C1OA 1VE9A 3ICCA 1U3VA 2PGDA 2Q4EA 2AXQA 5KVVA 4EITA 1YH3A 4XKJA 1EUZA 3VDQA 1YJQA 1ZIDA 2QIOA 1GEGA 3JQAB 2W8ZA 1K2WA 5KJFA 1GDHA 2C5EA 2ZTLA 3E9NA 3BXXA 5CDTA 4CPDA 3TF5A 4MVJG 1ORRA 3PLRA 4FW8A 3ROQA 4XA8A 3ZDFA 3HWRA 5B4TA 1A7KA 3B6ZA 5C5IA 6LDHA 4L74A 4H16A 4W7HA 1KY4A 3SX2A 1X14A 1DO8A 1U8XX 2P5UA 4J91A 3R6DA 3SLKA 2NVUA 3RFXA 4BKUA 3HN7A 3ONFA 4KQWA 4CM4A 4EUFA 2JD1A 1FDVA 4LK3A 2EERA 3AOGA 4PRKA 5KIAA 4PZDA 2C20A 1G0OA 3QJ5A 1EMDA 4WEOA 1VSVA 3L6EA 2O3SA 4RF2A 4WLVA 3PHLA 3NX4A 3INRA 4O59O 1F8FA 2HQ1A 1PGNA 3PEFA 2FZWA 3M1AA 4CQLA 5A9TA 2J5QA 1XEAA 2P9GA 3KETA 2HDHA 1PR9A 3BZUA 4R3NA 2ZB8A 4PIVA 5EQFA 3TWOA 1UZNA 2AG5A 1HXHA 4J1QA 1MUUA 1YB1A 1E5QA 1LRLA 4L75A 2AEJA 2HRBA 4HY3A 1JW9B 2YQ4A 3RKUA 4XD2A 4QX6A 4U0JA 3O9ZA 3D5QA 1DFGA 4Y8VA 3RCBA 4YJHA 1U2GA 3GZ4A 2BELA 3WGQA 3ZU2A 2UDPA 3KEQA 4J49A 3OQ6A 1TA4A 1IY8A 1XCBA 5ILOA 1WDLA 1VL0A 1GYPA 4HWKA 3H9QA 2V65A 2CF5A 2G1UA 4E3ZA 2JCYA 3H3JA 3JQ9A 4E30A 4J43A 4NJMB 3V5NA 4W9NC 4UUPA 1NYTA 2C07A 2BFOA 4MP6A 3JD2A 3B70A 1N2SA 2F00A 4BNXA 3JQBC 3RD5A 3M2TA 3OP4A 3UVEA 3W4KA 1PJ3A 2PR2A 3TJRA 4X54A 5KNLA 1I3NA 1ONPA 2B5VA 2JCXA 5A03A 5TLSA 1DB3A 2EJWA 4E5KA 4MOWA 3RBZA 2DBQA 4WCFA 2CDAA 3IAHA 3PJEA 2V6BA 2IRWA 5DP2A 4YTEA 4KTVE 3DR3A 3WQSB 5TJHA 2PTGA 1I33A 4IPTA 5TX7A 4D79A 1ZXLA 3WR5A 1HTBA 2Q1SA 2ZJ1A 3RJ9A 1FJHA 1GYQA 1EUDA 3AU9A 3P2OA 5B4UA 1E6EA 2Y0CA 5H83A 1IZ0A 3KV3O 3U4HA 1F12A 2CNBA 2D2IA 4DUPA 4ZJUA 1VKOA 4W9NA 2UAGA 4FFLA 4HBGA 5F5NA 5EPOA 4OSOA 3RBVA 2CF6A 3RC2A 4CMAA 1KEWA 2Q1TA 1LLDA 3RBXA 4CQLB 5CG2A 1JTVA 5IFLA 4CMEA 4C7JA 2VT3A 1I10A 5JPIA 4NH4A 3WIDA 1EE9A 2WYVA 3JYNA 3NDIA 1H9BA 2JL1A 1ZW1A 4NFYA 1CIVA 2X86A 4L4SA 1UDAA 3U3XA 2G5CA 4MO2A 1U3WA 1NX6A 3GVHA 1YBAA 4IJKA 3VZPA 4XYBA 3CPSA 1EVIA 3O38A 3DBLA 1PGPA 3T7CA 1XR3A 2PV7A 3GT0A 2DTXA 5BT9A 1LC3A 1E1NA 3A14A 3WGIA 3ROKA 4YAKA 4ZD6A 1GQ2A 3UFXA 3WWYA 2X22A 2P68A 5B12A 3A4VA 2W2KA 1DAOA 3AI2A 3E82A 4K9DA 1IOLA 4CUZA 4YRAA 4WECA 1QYDA 4HX5A 4WLUA 2Q50A 4WK6A 1KVSA 3JSAA 3JTMA 3RI3A 2RCYA 2YZ7A 1UXKA 1Q7GA 3NRCA 2NU9A 4KOAA 3JCZA 2FR0A 2HO5A 4B4UA 4I9NA 1W0CA 3QRWA 4YJFB 4L73A 1SO8A 4MVJP 5JLAA 3T4XA 4PZCA 4QECA 4F3YA 1EVJA 2Y05A 1P45A 2X5KO 2ZKLA 1AE1A 2PD6A 1U7TA 4F6LA 3RIHA 3W8FA 1CDOA 3DHNA 4JGBA 4Q3NA 4DYDA 2O3QA 9LDTA 3Q9UA 1Y7TA 4BNFA 4TRMA 1A5ZA 1KVTA 2VUUA 1ZJZA 3V8BA 3P19A 3X2EA 2R2GA 1VJ1A 3ZWNA 2YV3A 4E13A 1MV8A 3OQ1A 2GD1O 2O7QA 3OQBA 2QYSA 4OKNA 1T26A 1Z7BA 4O5OA 4DLBA 3WGZA 2CVQA 4NPCA 2IEBA 2XAAA 3LZ6A 3KM0A 3ONDA 5ER6A 4FJ0A 3QE3A 5I8ZA 1EZ4A 4CM3A 1ADFA 2EGHA 3E18A 4IJWA 4BNYA 5BSGA 3OJ0A 3TZKA 2GZ1A 3NJ8A 1Z75A 2UUPA 4ITUA 4PVDA 1YQXA 3ZI0A 2B69A 4RVSA 4IBOA 4M55A 3U0BA 4GQAA 3FR7A 3WB9A 3GDFA 1CERA 4BNWA 3A9WA 3GF4A 4XX0A 5JYDA 5JE8A 5T8KC 4CLHA 2E49A 1VKNA 1PSDA 4RVGA 2ILTA 4I1IA 5TGDA 2GN9A 2VHYA 3TZCA 2ZB7A 3I1JA 3ROMA 1PL8A 4YA6A 3V2HA 5L7TA 3H6KA 4OOEA 4BO2A 2ZQYA 4K6FA 3LT4A 4WOJA 4IGFA 4OXNA 3GFGA 4IS3A 2W2LD 4UEKA 3VDRA 4I9HA 1DC4A 4I5DA 3SBOA 4MIOA 5L3ZA 3E9MA 3ADPA 3TZ6A 1X13A 3H9GA 5CDUA 4D0SA 1MGOA 4Y6SA 2GN8A 4W99A 1HLPA 3U4CA 1U5AA 3QVXA 2VYNA 3E1KA 3KLPX 3EVTA 3AM5A 1DIGA 4PZEA 2CFCA 1E3JA 1S6YA 3IQDB 3HFSA 4PLPA 4LRSB 2FSVA 2PWZA 4J90A 3OICA 3WOHA 5I9NA 3PZBA 3HB4X 1TT5B 4FBGA 2I3AA 4NMHA 4PLYA 4WJZA 3CMCO 5C37A 1H6BA 2VTEA 2PZLA 3ETDA 1PL6A 1X15A 4IIUA 4CMCA 1CEQA 3RJ5A 3HE3A 4FFMA 4Z3KA 1N1EA 2BI7A 1BXKA 4N5MA 4CUJA 3PYXA 1UJMA 3X2FA 3PJDA 5DBFA 1Z6ZA 3PDJA 5CG1A 1QORA 4NR0A 4IXTA 2VHVA 2C29D 3EW7A 3PIDA 3TL2A 4ZQFA 3OIFA 2FPIA 3FRJA 4XYGA 3ZWYA 1Y81A 1AN9A 3WSWA 2EWMA 5JC8A 1VI2A 1E3LA 4JLWA 1M67A 4BIIA 1H5QA 5IXSA 5KCZA 3MZ0A 4PFJA 1ZO8A 5JW6A 5IZCC 4TKLA 1XIVA 2D8AA 3JQ7A 4IY1A 3R3SA 1GZ6A 1N7HA 3R0IA 2J5RA 1NHGA 4J7UA 1P44A 3ZWBA 4A26A 1P1RA 3KUXA 2GCGA 4BKQA 4UVGA 5GZ6A 4E2XA 1A72A 2ZB3A 4FR5A 3BMNA 2NADA 3LYLA 1V0JA 3CUKA 5HS6A 2I6TA 2GN4A 1QXSA 3Q3CA 4AJOA 5AXDA 4Q39A 1HDRA 1P1FA 1ZEJA 3OJFA 4U0KA 5DULA 4EBFA 3KB6A 4MP3A 4FFPA 3ETGA 1LDEA 3AUSA 3OJLA 5G0VA 5JDCA 1CYDA 3AUUA 5JC1A 3FWZA 2F1KA 1LTHR 4XIJA 1YQDA 4CQMA 1DIAA 1NPYA 4XIYA 1QMGA 3ICPA 1E3SA 1F0YA 3JQGB 4CMEC 4Z0PA 3LQFA 4IQGA 2Y1CA 2AQ8A 4MKRA 3WFIA 3NTRA 3PGJA 4GKBA 1ZFNA 2PD3A 1WZIA 5K6AC 1IB6A 1MXFA 1TEHA 1KS9A 3E5MA 2C2XA 4QEDA 2BFMA 1LNQA 5A5FA 4ZQGA 2BI8A 5JYEA 3FSRA 2DPHA 3IDSA 1H6CA 5IG2A 4NFHA 3GRKA 1QLHA 2VHXA 4H7PA 1PGQA 5TRTA 2TMDA 4E21A 3ZWVA 4ILKA 3OM9A 2J6IA 5CEJA 1Y8QA 4Z9XA 5HWSA 4II3A 4MVJA 3HDHA 3M6IA 3V2UA 4CM8B 5C7IO 4TRNA 4FOSA 3Q2KA 1NFQA 1XHLA 3ASUA 3EMKA 3RU7A 1RM0A 1BXGA 1OZAA 1I30A 2J3JA 3C85A 3L07A 3D0OA 4AJJA 4BGIA 5K6AA 1DC6A 5F21A 2X7HA 1N5DA 5FYDA 5K0ZA 1CJCA 3JQBA 2EW2A 1YE3A 3D3EA 4DLAA 3DBRB 1ENZA 3UHAA 1ZZEA 3NV9A 3NEPX 4R01A 4CUKA 3EZLA 1VM6A 2VHWA 3ABIA 3QVTA 1UXJA 2HMWA 3C7DB 3PVZA 1PZGA 2Y1OA 1ISIA 5LC1A 3K30A 1I5RA 3MTGA 3PK0A 4CLOA 2X23A 1YRLA 5IDXA 4GX0A 1ZXBA 5CHEA 1UP6A 5AXBA 4KUGA 1ZSNA 2X9GA 3WG9A 1B3BA 4YJGB 3ZHZA 4AJEA 4LCEA 2NVWA 2UVDA 1ZCJA 4PVCA 1E7YA 5AOVA 2FPPA 2PY6A 1VL6A 1R15A 2DTDA 3DHYA 1JVSA 2O3JA 2PNFA 3IUPA 1ZMOA 4Z0HO 3VZSA 5KVCA 4QO8A 3HUDA 4GWGA 4O6VA 3F1LA 4CLOB 1YONA 1C1DB 1HETA 4RCVA 1NVGA 3NAQA 3G79A 1R4MB 5T57A 2DU8A 1HZJA 3PPIA 4Y67A 2B0JA 2EGGA 3GRPA 5J23A 3KOUA 4TVBA 1LUAA 2B4QA 1ZK3A 3G1TA 1GTMA 3PQEA 4UEOA 3MOIA 4NK4A 2Y1FA 1ENPA 5A9SA 2VUTA 1HDGO 2FHSA 4EUEA 4YT2A 4LW8A 1VPDA 2Z95A 1C0LA 4BS9A 3DOOA 1D1TA 1UZMA 2NUAA 5DF1A 5LDGA 4CV1A 2Q4BA 1U28A 2YDYA 3WDSA 2QQ5A 1FDWA 4W7IA 4OIMA 4OQZA 5CEEA 1Y1PA 3TQHA 2XPCA 4CMKA 3K9QO 4RQUA 2QRKA 1UXHA 2IODA 2D4AA 3BTSA 4IIVA 4CODB 2V6MA 3WGTA 2PLAA 2VNAA 2Q1UA 2DFVA 3HQ4O 2DFDA 2DKNA 2XXBA 5CP8A 1AUPA 2C59A 3GGOA 1LXCA 3KBOA 2PKRA 3LU1A 1WVGA 5JBIA 1E7WA 3BMQB 4IS2A 3VPXA 3C24A 4INAA 3V1YA 4DPMA 1E7MA 2EJVA 3C1AA 2CSUA 4LMRA 1FMCA 1G0NA 3JQ9C 1HDOA 1BW9A 5EJ2A 3AW9A 1T2AA 3VZRA 1I0ZA 4NBVA 4YJFA 1DPGA 1HSOA 2GF2A 4S3MA 2NV6A 1LLQA 3AUAA 4WGGA 5JFOA 4N54A 1M66A 2O2SA 4CL3A 3VVBA 3DAPA 1WLYA 2DBRA 3ANNA 2NWQA 3DMYA 1A4UA 1OC2A 3WBFA 1WDMA 4FJ2A
chains in the Genus database with same CATH superfamily
2DJIA 1OFTA 2KMLA 4A91A 4N76A 1H22A 2OG1A 1TZ2A 3DPUA 4FB5A 1DAMA 3M5DA 1AQJA 3FPGA 2GEJA 4OU4A 2D2EA 3RPEA 3C98A 1TKAA 3E9QA 3EFBA 3OLVA 4GPBA 2OO5C 4LGYA 4AY6A 5KTOA 5EZYF 4XB1A 2ZFUA 3UJBA 3BIWA 2PA0A 2BWJA 2ZWMA 1JAZA 2XI4A 4PN3A 3HXOA 4JQOA 4IJUA 5J2UA 3MBOA 1GKLA 3LY7A 5J2UB 2UYQA 4IDFA 2ERXA 5EMHA 1FRQA 1PD1A 1PUJA 2LDBA 2XIQA 3BAFA 4RFLA 4ITRC 2F3TA 5KX5F 5MFZA 4MKHA 1JKIA 1QE5A 3I73A 1X8XA 2RFLA 1T0UA 5F1KA 3S6JA 3ZU3A 2HLPA 2B8JA 3HL0A 1CR0A 4AG3A 2R48A 2WSSD 4ZXFA 2P9TA 2I67A 4OHCA 1W0JA 4YBZA 4Z0TA 3VV3A 4F2GA 2WMNB 5ESXA 1XD2A 3HZOA 2P75A 3NO4A 1VDZA 1YVEI 2HRDA 3LO8A 2CHGA 4P7FA 5EHQA 3RRNA 5IN4A 1KI4A 4BTLA 1V71A 4JI8B 2V7QD 1D9ZA 3NHWA 2OXRA 3PPYA 2FVXA 4ZVVA 2QRZA 2ZSDA 2ZCUA 5K0BA 2VLBA 1I2BA 1V6CA 2BEWA 2A67A 2O1SA 3BMNB 4X92A 1ZM3A 1RYYA 4ALKA 3ZCSA 2RHGB 4NCJA 2JJ2D 4IWNA 4PYLA 2VDWA 3TIFA 2VZ0A 4LXYA 5FBZA 1INLA 5AVXA 1F06A 1PKXA 2GPBA 4PTZA 3EXFB 2HJRA 4HZIA 3U3MA 2FXVA 3ZD9A 1NZDA 1P3Y1 4ZJZA 3O0DA 4KYTA 1JEOA 1LB1B 4G3XA 3AINA 1OWOA 1C1HA 1WZUA 1BHJA 1A7JA 2AOTA 3LO5A 1IUPA 4FGKA 3EAGA 4XJTA 4BRSA 1ESCA 4BEWA 3D1LA 3ZHXA 2JI4A 3O91A 4LVUA 4RHFA 4BQFA 1ADJA 3BX1A 4R6XA 5I7AA 1KEZA 1UDBA 3IKMB 4DMRA 1YQEA 2E82A 3PHJA 2JGIA 3CO0S 3SHQA 4EHLA 4UHEA 3ZJ5A 1Y80A 3AZOA 5FF9A 3G2PA 3PR2B 1TYDE 3KD3A 2Z5LA 3QYPA 3R5XA 2GHRA 2JCVA 5CNKA 5DLPA 1K7XB 1E58A 3MNFA 4GVXA 2ZSIA 3S1AB 5LSAA 5KOHA 3I01A 1B2LA 2ECFA 2OCIA 4JVMA 5KOHB 2Y1WA 2RIRA 2QRQA 3FB1A 3SC4A 1E6MA 4MQ5A 4CL2A 4WZBE 4J8PA 1W76A 2NSLA 1OBCA 2ZIXA 4O2LA 4RMNA 4LHWA 2YUTA 3QYFA 4JLAA 1GPLA 3OZWA 4MQ4A 4TYMA 5KWEA 3Q5DA 2HEIA 1SRRA 1VJGA 4FYYA 1YL5A 4JBGA 3JQEA 4M7OA 2IH4A 1T43A 4GQIA 3DNPA 4J1TC 5KNCA 4FOPA 3HJAA 4EF4A 1KYVA 3QYAA 1A0OA 2D6FA 4P58A 1GYRA 5FFMA 2E4VA 1P0QA 1XN4A 1AU9A 3CRRA 3PNLA 4NU0A 4O25A 4HBZA 2VJCA 3EDMA 4Q1CA 2RGNA 4QDXA 5A5DA 5BNIA 4ENUA 4WCFB 1WZNA 3CVOA 4D80A 2ZYHA 3OEED 5J9FA 1EA7A 2VDMB 2N1BA 1QM5A 1SVOA 2H7YA 2YIDA 3E27A 3FVWA 3NYRA 4YJKA 3RQSA 4BNGA 4DV0B 1NLYA 2FW1A 5H82A 2QWXA 4PHGA 3OCWA 3R8FA 2O07A 3GD5A 3BMQA 1G8AA 3U7JA 1G41A 4D9JA 1O9BA 3DV9A 3NB0A 2HFJA 4Y2HA 1K08A 5FR2A 4PR0A 3PRYA 1KFKB 3F9IA 2ORVA 3EIFA 4Q4AB 5ALOA 4CT4B 5ULLA 1DC7A 3IGFA 5F2EA 5B58T 1E3EA 2MYPA 2FRXA 3DFFA 3NAGA 1U7UA 3JRNA 1U3TA 2W6MA 4C6RA 3PC3A 4FM9A 3LWDA 3DQQA 3NTXA 1M2VB 2CMKA 4LY0A 1ITZA 4AD8A 2E2WA 4NMMA 4QKQA 1BS2A 3KT6A 4DIDA 3Q6MA 5AKJA 1UJBA 4DDVA 2ZI6A 1XAHA 3EEBA 3C41J 4KDEA 3V8PA 3B7GA 2FWNA 2H1RA 4KVZA 5DBIA 3U9SA 2A1TS 1KMMA 2ZRBA 1RHRA 3FJYA 3INYA 4IUYA 5AVVA 3O4IA 2Z4TA 3R5KA 4XEHA 4FQ8A 4Y0VA 1EXVA 5CFPA 1JWLA 1L6RA 3F4BA 4IHQA 1ZHHA 4HDMA 4ITVA 2IHZA 3QI7A 4KWTA 1CPYA 1DFIA 5SY4A 1KDRA 3SJUA 5DCWA 1O5IA 4FC6A 1U63A 1P7VA 5DK4A 2W6JA 3CY6A 3D3WB 4MQEA 2AOUA 2DH6A 5SZHB 2JB9A 2GPYA 4PC1A 3T94A 4BFSA 1U9ZA 3T06B 4LF9B 2AKYA 4IIFA 3R23A 1YS9A 1JPVA 4YGYA 4A8TA 4J1TA 1WKCA 1XPUA 2DHEA 5J63A 1H2HA 2VOEA 2JIQA 4GU5A 1ECCA 3L1UA 3EPHA 1ULHA 1GNQA 1RPZA 1KOFA 1P3DA 3GJ3A 1LKZA 4QJ4A 4YGXB 3UW1A 4N8DA 4AY3A 4EQ6B 5EHZA 5JROA 3JATB 1SCJA 1SU6A 4BL5A 5L8VA 2NT4A 5HCUA 2AJDA 3I23A 4E09A 2ZK7A 3G2LA 1YJ5A 1UQTA 1WAMA 3VPGA 1BD3A 3I2YX 3CO5A 2IOHA 2X8BA 4JJAA 5I01A 4RTOA 1ISHA 2XWSA 3HKBB 1G21A 1EE1A 2CXUA 2ZBDA 1YKFA 3CH6A 4P7GA 4QXMA 3UMCA 2ORIA 1UBSB 2Q3DA 2W4IA 1V7PC 3FHJA 1GGFA 4EPRA 2IUTA 3JPYA 2J5KA 2YXBA 3VPSA 1DKNA 2GX6A 4NBSA 2ZG6A 3DV0A 4RY8A 3HKDA 4IXNA 4UMVA 4ZRDA 4B6RA 3AR9A 1SBIA 1GGEA 3OF5A 4IGKA 2CXNA 4F04A 2XAUA 1J1IA 4ZOEA 5CGQB 3TVDA 4CZ2A 2NUTA 4IIJB 2NUTB 3MB8A 3ZE0B 2I3ZA 3FCOA 1N5RA 1OIXA 2G36A 2MSCB 3FPAA 3O93A 4ML3A 4MVJE 4OB7A 4P32A 4Y1GA 3HM9A 1SWWA 2CNWA 2XF8A 1QRRA 2OHXA 1ZVQA 3EH2A 4R7GA 2G77B 1GTG1 3AONB 1L7NA 3LUCA 3O47A 4DQUA 4FGUA 1IYZA 2QPOA 4YJHB 1WHTA 5IWAB 4NEHB 4UEJA 4RTPA 3VZCA 2AS0A 3PSAA 4MIEA 2KWIA 5DFAA 1JPUA 4GC9A 1M6VA 2H1CA 3JY6A 1QHYA 4DYVA 5L3QA 5BQXA 4RVFA 2ZT6A 5AHWA 2XUKA 3U62A 9ABPA 5KYYB 1IOZA 5IS2A 5AQEA 1MRNA 2NU6A 5JJCA 2NQ2C 4P83A 1TUIA 4UUBA 4O33A 5EZSA 1QCCA 2PKEA 5CT8A 1I01A 3O90A 2FSGA 4OJTA 5F35A 5ILGA 1ZN8A 4GDFA 1QOPB 3PGXA 3R5SA 2WB2A 4YUYA 1G20B 4U7FA 1PK8A 1YE5A 1B8NA 1NVEA 1KK0A 3AFIA 2XUFA 3HUUA 1IOVA 2RI6A 4HADA 4O2AB 4B3GA 1E1LA 1GAWA 3WGOA 3ZCPA 1U80A 3TSYA 5KYGA 3ANXA 4IVRA 1QCYA 4TLBA 2FW0A 4K3VA 5FV4A 5EVCA 4MW7A 4DXAA 4DR6B 1JSRA 1BHSA 1IY2A 1G7TA 3AXSA 5DTJA 4B3CA 3O8CA 2OFPA 1VZ2A 1NUPA 2K5UA 4HVAA 1A97A 1J70A 2BBTA 3PRJA 1AJEA 3P97A 1D1QA 1EUCB 3ZTTA 2ZE8A 3FLBA 3NUZA 4Z1MA 1I7NA 1ZH4A 4I36A 2YTZA 3ELUA 4X6XA 3R7WA 5AKLA 2XB2A 3AQIA 3T7DA 4CDGA 3IBCA 5FO1A 2ZBVA 2J0EA 3H18A 4LY6A 3ND7A 4X7BA 4Q3AA 4HYEA 1NJ6A 1KOJA 2TECE 3S2IA 4HXFB 5HS4A 4D7AA 5JTTA 2QTFA 5EE0A 1T0BA 2O2GA 2GVZC 3CFYA 1LPPA 2OEPA 2PFKA 3KCQA 4Z2YA 5DPMA 4YN3A 1HEYA 3GJTA 3PIRA 3IEMA 1T8WA 5DK6A 3RS9A 1EZ1A 5DHUA 1B8UA 2FSSA 1CY4A 3SFTA 2GHQA 3BH6A 4BX0A 2X0NA 2I2WA 1ZESA 4ZC1A 5KOJA 3I6YA 3NDJA 3S2ZA 1TUGA 3HJCA 1JI3A 2JIRA 4JXJA 4NJEB 4X3OA 3NOOA 4LYHA 4ZN6A 5JXHA 3VOTA 3DONA 4UZEA 3UWSA 3DWGA 3IP8A 3EQ6A 4LNAA 1YMQA 3WKEA 1D1SA 1GTZA 1KYIA 1V8BA 2FZKA 2ZJ5A 5C4GB 3ZOKA 4KBYA 2VTVA 3E7FA 3OF2A 2IHBA 4R41A 1NRXA 1ENYA 1CUBA 1E5DA 2A9VA 2NT3A 2VYFA 5HILA 4O4LF 1YA6A 2E5LB 4X93A 4DSTA 1RTKA 3A7EA 4KXUA 4R9RA 3W6NA 4P08A 1ZL0A 3FR8A 2QX9A 3TLGA 2R68A 1WHTB 1D4AA 2A5DA 2IUEA 3DP7A 4BCBA 3DLBA 2GZHA 1GCUA 4M22A 1CFJA 4JLNA 2YWJA 3RVOA 2EL9A 3L4BC 3SC2B 3SSMA 2WYOA 3DAYA 5EE5B 3PX3A 1Z0ZA 2ZULA 4JH0A 1IHUA 1XRNA 4RZIA 2JJMA 3OJWA 1JFTA 4INJA 1Z82A 3MXOA 2WW8A 3ZW9A 2R1VB 3K0CC 1B76A 5IH3A 1P5JA 1F2TA 1Z6QA 4AO8A 4US0R 5AUQA 1JV2B 2P2CA 3T3HA 2GVDC 1XMVA 2FA9A 4FXPA 3VO2A 5JH7A 1GA6A 1BTOA 3WP0A 3NU1A 3QQ5A 3I2JA 3MCTA 1Y63A 2JCGA 3K2BA 4N1AA 4CM8A 2C42A 4XM1A 5EIAA 5EPUA 5FI1B 3BA1A 2W11A 3EARA 1Z7WA 1IWBB 2CXRA 3ESAA 5REQA 2WSYB 2KS6A 5KTTA 2E5FA 1I4EB 2H4WA 2W98A 2X0JA 5CB4A 2RC5A 1SCUA 2NQTA 5IJWA 2QQEA 3LP8A 1EDEA 3Q7SA 3AERB 4KIWA 4LN1A 1ZIXA 1KJJA 3B6MA 1EB9A 5JDIA 1U0RA 3WY9A 1O89A 4YAWA 1KHHA 1B41A 1QIDA 3G89A 4DIBA 3U1BA 1WMAA 2D1YA 2CY0A 2VCYA 3T5CA 4MVJF 2DVMA 5GV8A 5FLKA 4O4HF 1H2RS 1PTJC 1I14A 1Z39A 4WN9A 2H2DA 1OOEA 2I4LA 1UK7A 2RAFA 4TRJA 4KRXA 2COUA 3V7YA 1XQ6A 1E8DA 5K8JB 3DMFA 1TQ2A 1XZMA 1C3JA 3D3QA 2C3OA 2J6HA 2VPQA 3F74A 3GR6A 3DL0A 4IMIB 4IZOA 2QT1A 3MMSA 4CFZA 4G25A 4OFWA 4ARVA 3AGQA 2YKGA 4CV3A 5KYWA 2WHQA 3O3NB 2PG3A 3ZCQA 5KYUA 5EKXA 1YS7A 2VWQA 3DQPA 5EZYA 2YIMA 2JASA 2VYVD 1T2UA 4IHJA 1HWYA 4Z7QB 2O2DA 3LS2A 4W8OA 4WVLA 3V8MA 3K70C 1A7AA 1V5FA 1YB6A 3IH5A 2G9NA 1PR6A 2JVKA 3HFRA 3ICOA 2IUUA 3UF0A 2W6NA 3WKCA 3A06A 3LUDA 3QEOA 3OMXA 2AK3A 4U6SA 2E9SA 3R3XA 5EXXA 4C7VA 4KGZA 3SEFA 4P4GA 3PSHA 5ALVA 4D81A 5EP4A 1W5AA 2HB6A 4AROA 1AGRA 3GPDG 4KKXB 4R16A 3PQ2A 3M6VA 3Q7QA 1ZCFA 2PSJA 2HN9A 3RG8A 1Z45A 3A6PC 4YRTA 2P5YA 4GICA 4A2PA 1KP9A 1WJGA 5I7FA 5KYTA 1KI9A 3I2FA 4I50A 2W2NA 1S9DA 4XRRA 4A03A 1WSWA 4HHEA 5BSFA 2OD7A 3ACBA 2IEZA 2C2YA 2XBMA 4CF6A 2Z2IA 1ZK0A 3BDAA 1SXPA 1F8XA 1KC3A 3ZE2B 1OWPA 3O7MA 1Y7HA 2ZSJA 3R09A 5DMHA 1R9MA 4C2BA 5CHYA 4F6RB 5EYPA 3P9NA 2R6DA 4MV8A 4YJ2F 2B4RO 2GEKA 2QG4A 3PC4A 4MR9B 3TLMA 1Y8QB 3PQ7A 1XI2A 2OMKA 4OL9A 1DCFA 5THQA 1C0KA 2OKCA 3WWZA 1EUDB 1U04A 4PG5A 3EUWA 5A3VA 1T9GR 5LA6A 3S8MA 2Q5IA 4QG7A 3NXSA 4CKCA 3FYTA 4MV7A 1BNCA 1EM8B 2GLTA 4HLQB 4YK7A 4YRCA 4KR7A 4KKVA 1BH6A 1I3CA 2AUNA 1G66A 1VJTA 3F2VA 3B1XA 3NNNA 1PX0A 3ETHA 1G1AA 3ENWA 3RU2A 2AI1A 3FMPB 3CXUA 1YQ9A 3HZZA 4O08A 1K7EB 5CT9A 2JFNA 1MCZA 2ATIA 2CE7A 3BRSA 4L8VA 4BO0A 4QBTA 1T4BA 1I0IA 4O4JF 3S2EA 3QKIA 1NP3A 1V3VA 4IDBA 3A6ZA 5IEJA 1ADBA 4R51A 4LEIA 4NU6A 1BD4A 1T5OA 4JMPA 2FRVA 4Z3DA 1PJ8A 5EMLA 2BSXA 3U81A 1RRFA 2JD2A 3ENNA 4MR8B 1KZ9A 4BLSA 3FDJA 4U6QA 3T4PA 3VC7A 1YKGA 2XKAA 3CNEA 4B9AA 4EO4A 1DGQA 4EHHA 2OOKA 3ZX5A 4ME6A 1GCOA 4JMLA 2IHTA 3CE6A 1ZN9A 1E9VA 3L04A 5D8DA 4CIVA 5M3BA 1A9ZA 1OMOA 3G9XA 1GNTA 4KN5A 1OH6A 1IU9A 4O3FA 4R9VA 5DSTA 3KWMA 1IPHA 1HMYA 1NIPA 2EEPA 1PN3A 1GILA 1OASA 3AF3A 1ADGA 4KV9A 4U7WA 4Q9IA 3ZWOA 4V1CA 2CXQA 1CR2A 3V7UA 4BRZA 3O94A 1J97A 1NE7A 1ZNYA 3E2PA 4K2HA 3W4IA 3QU4A 4DTCA 4RD4A 1KZ7B 2CJPA 1RLUA 5E7JA 1G2OA 3JQ7B 1HKUA 2RI1A 3K09A 2WT9A 1VMEA 4L08A 4N47A 4TLEA 1C3LA 1JLLB 1HG0A 2YJGA 3G9ZA 3AILA 1XVTA 2NVBA 4IKEA 4LK2A 7MDHA 1WUHS 4V0SA 1MAAA 2G71A 2H5JA 3ZUGA 5A7HA 1IE3A 3C5EA 5C7YA 1MNQA 5H4HA 4PXAA 3EIUA 2O50A 4TL6A 3H5VA 4CM9A 1I1QB 2CUKA 1UBFA 2EIHA 5TVKA 1TIBA 5K0CA 1R4NA 1JJVA 1I9CA 1XTTA 3I1YA 5EJAA 3KHUA 3OX3A 2J08A 4EGFA 4KWIA 1X7YA 4ZREA 1ONNA 2K2WA 4IWYA 4MCJA 2ACWA 3ZYCA 2B4AA 5JMOA 2XH8A 2XA1A 5BN3B 4GXRA 1IATA 4FMDB 1ISMA 2JS7A 4Q05A 3SYMA 1J49A 1I32A 3HEAA 3SKXA 2FJUA 2VK8A 1T5HX 4CTMA 1Q5PA 4FBLA 4F06A 2B4TO 2R8YA 5HQ3A 1HNZB 3H13A 3TI7A 3TSCA 1SK9A 3V4OA 1VG8A 3G5AA 1M0TA 4DRXB 3WGMA 2ISQA 3VU3A 1FU4A 1RRVA 1XA3A 3AC0A 3GRVA 2RHCA 4U00A 5BT8A 2GPNA 4HTAA 1QFYA 3GGCA 2IF2A 3ON5A 1KMIY 1DKUA 1POWA 3OEWA 5FADA 1Z63A 2VJMB 4UNRA 2HT6A 1KO5A 1M34E 4ND5A 4O2BB 1JQLB 4XQ0A 3OEHA 2IY9A 3F3SA 1QCDA 1U4SA 2PKCA 2AHRA 2CFTA 2Q3FA 4XDZA 4EB0A 4RORA 5JCJD 3ER9A 1AKMA 3KZVA 1MO6A 4TWRA 2WJAA 1TVKB 2CD9A 2PA3A 4NNOA 4J2HA 3P0IA 5D51S 4G84A 5BQ5A 1FB5A 4JUIA 3WLRA 4JQCA 4LX0A 4LGMA 1QH8A 3TSAA 2BD0A 3DYIA 2GDJA 1BS1A 1IB0A 3D6FA 5CVCA 5D1NA 1KPGA 2QTLA 5GOZA 5JVDF 3N3AC 1P0MA 2I9PA 1Z7EA 2IL1A 3IAEA 3U4QA 2BFDA 2RKBA 4PGMA 4ZO7A 4K46A 1OT3A 4P53A 4Y2JA 1EFKA 3NH6A 4PZ9A 3HK2A 3O8LA 5DIZA 5JAHA 3P9PA 1Z4KA 4L5JA 2R47A 3RNLA 5JS2A 4JDPA 4X97A 1Y42X 2GI4A 2G9QA 3WJAA 3ELWA 1KTIA 1N9KA 1LI4A 2CHFA 4L6CA 3D6VA 3HYSA 2WTEA 1F3LA 1NJ1A 4ZDJA 3K1AA 3FHTA 4KREA 5L4LA 1EFPB 4DIMA 3S2GA 1HX7A 3HGQA 2A0XA 3AF4A 3OCZA 3T61A 1A71A 5JFGA 3ZLJA 1DEXA 3GRZA 4XYEA 3FN4A 3VI4B 2NU8B 4D97A 2D13A 4MKIA 3TB4A 3A4IA 4G5OA 2M6RA 1EDZA 1P7PA 2O23A 5IAJA 2ORED 1UINA 4G5GA 2OYSA 4N0PA 1BXZA 3UAGA 4NOKA 4OKIA 1T6NA 1YU9A 4IQ4A 2GZ2A 2QTGA 2ZJBA 4N5DA 1H85A 1EXDA 1XD8A 4CE6A 5LQUA 2RBKA 4HAVA 4MJXA 2GLXA 1BWSA 621PA 5GADl 5E6UB 3WYGA 4URUR 3KG2A 4Z9BA 4Q4HB 4RZSA 4HB3A 1H4TA 3QUAA 3KEMA 4GI3A 3UUFA 4YFYA 2FJ0A 2XRFA 5HBGA 4NH0A 4RV4A 2YUIA 1Y37A 2WUVA 3DWFA 1KQPA 3AF5A 4MA4A 2H57A 2Z3WA 1GZ5A 5J4KA 3IB3A 1IPFA 4YRQA 1BU8A 1E9FA 4WD3A 5AW4A 3BICA 3LX5A 4Z4FA 1CU1A 3DAOA 3ZGXA 4LYJA 5JCXA 2J5XA 3HJUA 4GOLD 1RQPA 1PG5A 2ZBQA 1NLZA 1SC3A 3FZGA 4HZUB 5HZKA 2JJYA 1QIGA 1NQUA 2Q27A 3MLEA 1JKMA 5K20A 1HYEA 3JVDA 3DXZA 4MSUA 3AX6A 4GI2A 4KAJA 2DOKA 4IR7A 3TIXB 3KBBA 1XJCA 5E9JA 4OPMA 4TTVA 4CI0B 3B2NA 5TNXA 3M9LA 3M9WA 3CA8A 4KXXA 3EGEA 2AR7A 1K9VF 3UW3A 4I55B 1XZNA 4ZOLF 5JXIA 3WBKA 3C4VA 4JDUA 3QOWA 3TD2A 1C5KA 4MQUA 5AW3A 3GEGA 2WFLA 1Y8RB 1OX5A 1Q83A 4DWVA 4C5AA 1T1JA 1XLUA 2H9AA 2XRMA 3B1KA 3DWEX 2IWHA 2N3ZA 3UK0A 4UMEA 3FNBA 5E2BA 4AUNA 5J4HA 3RH0A 5L9AA 1C9DB 4IINA 3FCEA 3VR3D 4WFQA 5LL6P 1XP5A 3CSSA 2CYCA 1QTQA 2NP6A 1X9GA 2YFKA 2FN7A 3EWAA 5ENDA 4DCJA 4F5ZA 3L7DA 5GIPE 1ZU5A 4RUKA 3TFQA 3K96A 2P6MA 1ZNQO 4JL8A 1BGVA 3A4NA 5GGYA 1JU9A 2A3RA 2GD6A 3D3JA 5K0GA 4G5XA 3O8QA 1HL7A 1V47A 1M1ZA 3VHLB 2OV1A 2XNJA 3O8QB 3OH8A 2WM3A 5CCXA 2OUKA 3N7UA 1K0FA 3OHPA 4GP9A 1E4EA 1TT5A 1DUSA 2D1QA 3E3LA 5HQJA 3FUTA 1BJKA 1QDEA 4MGEA 4CVNA 2ASEA 4Q1FA 3DKPA 1F14A 3QLUA 4HNQA 3BRWA 2PH5A 3IQIX 1RWWA 2OHHA 2TMGA 5JRDS 2VAMA 4RA6B 1BMFA 1FSGA 4J9UE 4LVCA 4NI5A 3NHZA 5C8VA 1LDMA 3U9LA 4DMKA 2J9FA 1SULA 1WRBA 1E3WA 1YB5A 3M4YA 4M2LA 3STVA 4ENVA 3QVWA 1SIBE 3T1NA 1U2QA 3HBAA 4PRLA 4IQ8A 3BHNA 2IE0A 4RV5A 3FVRA 2JFOA 4OVKA 4EA6A 3GT3A 1TD1A 1SQGA 3WK6A 3R0JA 3JR7A 1WDKA 2VRWA 4K9LA 2R86A 4MDHA 5HGJA 3UAOA 4ON9A 1EBFA 2HSJA 3H9JA 4X6UA 1RCUA 4A3SA 4R68A 2OD2A 4Q3BA 3DT8A 2DR2A 1SD1A 3VKHA 2C96A 2A9JA 2BY4A 3G1UA 3VSDA 5KNDA 4E6EA 3A1FA 1U28C 3JVVA 4HGNA 3EVNA 1WP9A 2XWQA 5JS6A 1HQYE 3ASVA 4P7BA 1RBZA 4PFKA 2ZUTA 5INTA 3M0EA 1GUZA 5AOAA 3H2HA 2HXSA 4XVUA 1AMUA 4WXHA 2GAJA 5J1SB 4WBNF 3JQDA 3LGXA 3CZ9A 4XQGA 1SXIA 2ZUWA 5B53A 1K0UA 2PKQP 5AHRA 1XZKA 1BDJA 2R8BA 4TPKA 3THOA 2C2GA 1VA5A 5E7IA 1G8SA 3EZFA 4EI2A 1VBMA 2IBSA 3KR1A 3MBKA 5B3JA 3PYLA 2JLQA 2AB0A 2ODWA 4XVCA 3CH5A 1ZRSA 3GZNA 2WMOB 4DGSA 2AXEA 1E9RA 3OI7A 4QUAA 4F45A 3A2KA 4TMKA 3F8TA 1Z4OA 8ATCA 1BO6A 1G21E 3VMFA 2NO5A 1UBUS 4XEUA 3F2IA 3UKOA 5IH7A 5IZ4A 1EFVB 2JGLA 4LJ8A 1FJ2A 1SEPA 2C7BA 2F1JA 1FUIA 1SOMA 3M5WA 4UUMA 3L01A 1SEVA 2SNIE 1AQLA 2Y76A 3FWPA 1DTWA 3OHSX 4MUHA 2QEQA 3AZQA 2HHAA 3QPUA 3CNBA 4S1OA 4I14A 5FEMA 3WYAA 3WZ2A 1AUXA 2QTRA 3GCDA 2R6JA 3BGVA 4C76A 2IEAA 2HXGA 5G3ZA 3TDNA 3VHXB 1JKJB 4RVDA 5DB4A 1L5NA 3U3OA 4DPKA 2ZRCA 3FI9A 4UUAA 4LQCA 4IFTA 4EDHA 1NJGA 1UBJS 4O0LA 5E3IA 5JHHB 1CRWG 1X8KA 1Y5NA 4B31A 2IIPA 1U81A 2I62A 3U7RA 3WXMA 3UXHA 3ANSA 3I9KA 3MILA 5ITSA 3VA7A 1DAGA 3FSGD 1J7JA 2YJ4A 3KZNA 2FE1A 2BFAA 2Y1KA 1RXWA 3MOSA 4NCKA 1L0BA 2ZJ2A 4JUFA 1CUXA 4W5HA 4FLEA 2HHCA 2X2PA 4KPEC 1GN9A 4QT0A 1NFFA 1ATIA 5DLQC 4B35A 4D8XA 1H6DA 3A9UA 5EFOA 1UKYA 3TN7A 2F59A 4MLCA 5IC6A 1PFQA 2NSDA 1OFGA 2QN8A 4X1KA 3PLAE 4M1TA 1Z6PA 1O4WA 1R8QA 2GTPA 4MHSA 4DUGD 5TQ0B 1PBTA 2WHEA 3NATA 4EX6A 4FE4A 3A37A 4E5PA 2X58A 1YVUA 2H52A 2ZVDA 3IE1A 1ZITA 3T5GA 2W83A 3DLHA 4NG5A 1KSJA 1S2MA 1F60A 4JSRA 1CWUA 4A1OA 4Q9DA 4U4AA 3P9QA 1F4LA 5THKA 3FAZA 4YXWD 2J07A 3F98A 3Q0IA 1D03A 2P3OA 3AR4A 4K6HA 5CU7A 4BUZA 4HH3C 3HJTA 1TCVA 4HX9A 4L02A 5M34A 2XYVA 2CZGA 4CEHA 4CTJA 1PJRA 2XVYA 2DH5A 1T91A 1ZWLA 3KZXA 4FLMA 4HEA1 1F0NA 4IV0A 5CX1A 3V2GA 4AJNA 4DNFA 2G06A 2GASA 1ARZA 1IY1A 1Z7YA 1OILA 2YV5A 1ORHA 1HT2E 3OTIA 5DJ5A 5BSEA 1O94D 3BHJA 4AQDA 2HNAA 1Q0RA 1Z25A 2OVFA 3L6DA 5F3RA 1KOGA 4IGEA 1XTIA 4BMPB 1N3BA 2I99A 2AZ4A 3QG5A 3QUCA 1Y7IA 1QQ7A 3MCZA 5KOIA 2X2OA 2HHJA 4LQLA 1CKEA 4RS3A 3DCNA 4Y2YA 1OYOA 1MVOA 3CKLA 4ED9A 2GEBA 5CDFE 3PEUA 3KU1A 2W5UA 4O1HA 3VPAA 1GZ7A 3PPVA 1BWRA 3DT9A 1XU7A 4I9GA 3M8KA 3GCGA 4PAGA 4WKNA 2B35A 2C78A 1MC1A 1T9CA 3K20A 4HQKA 4R81A 4JB3A 2NGRA 3G23A 4NNJA 2CLFB 2W6OA 4CNQA 5IBCA 5IF3A 1ZYUA 5K0LA 4B47A 5IZCA 3PQ3A 3N7AA 5LQKA 4NZ9A 4JI3B 4DILA 4FOOA 3I28A 5DZSA 2P9FA 4NHOA 4ODIA 1TVCA 3TNYA 5TEWA 2XA9A 1AMOA 2ZE7A 4EG6A 4YONB 5BXQC 5IJAA 3SY8A 3D64A 3M70A 3QXGA 4CQMB 4RPLA 3I6ZA 5FT9A 1K5DA 3L7MA 4WT7A 3IDAA 1T25A 3I9LA 1T8RA 3GRYA 3C6ZA 1L5VA 2G0NA 4GOJA 4JJIA 4ND1A 3BMCA 1T3TA 2JLAA 2H48A 3SGLA 5K8CA 1XXLA 2NU7A 2RJOA 2Q62A 2X9NA 2C0PA 2FUCA 2W8BA 3TINA 3V97A 2BR4A 2OCBA 3W5VA 1FFDA 3O2JA 4C01A 3EVFA 2EARA 3WHIA 4BMNA 2QI9C 2CL7X 3G7NA 3IJRA 4UASA 1XJQA 4GX5A 1OLXA 1BOFA 4BNTA 3ZHYA 3UWOA 2CHUA 1P8AA 4YRRA 5DYTA 3RRMA 1R37A 1V1JA 2Q49A 3UJDA 4BNHA 5D3MA 4HV4A 1N0WA 1OXBB 1CR4A 4G0UA 5HKAA 3HM2A 1YJ8A 1IWPB 1SNYA 3T8YA 1CQIA 3K9BA 3BE8A 3DC2A 3TSZA 2Q2WA 1J22A 1UH5A 1W25A 5A6SB 3HLKA 3IMCA 4KP7A 3TLEA 1LBTA 1UC9A 1MJNA 5HCIA 1OZ0A 2A88A 3U80A 1YL7A 4ZAYA 3TPCA 4GPTA 3IX7A 4GNRA 1WB9A 1NVAA 2VDNB 2A4MA 1I7SB 1RQNA 1OKKD 1G6KA 1TFUA 1HQDA 1RM5A 5EAIA 3VKGA 1TTTA 1DEOA 3G8CA 4QTXA 4P33A 4QEKA 3VISA 4GM0A 3SOPA 4KN6A 4JHLA 4NYMQ 1PEAA 3GPLA 9GPBA 4OI4A 2QAIA 4EPTA 4EUKA 2ZRMA 1WPXA 3KOMA 1GZ3A 4PC6A 1M2OA 4WZBA 1ADYA 1H0HA 3G5UA 4X00A 1M2OB 1VKHA 1II9A 2HAEA 2QI9F 3NBYC 4O63O 3V8EA 2V7EA 5DGHA 4ENRA 5I8WA 1EJ0A 5EMKA 3VXKA 1B74A 3A4YA 4KPGA 1DS6A 1GIAA 4BPBA 4JYZA 3T9FA 1TYZA 1YJBA 3DHEA 4CIAA 3ESZA 3GRCA 3LQKA 1GKIA 1QOQB 4L4RA 3H1AA 5F12A 2Z09A 1ZJYA 1CUUA 1XYVA 4QD3A 2Q46A 3EQ8A 4U5QA 1KR2A 3CE9A 2WAYA 4Q24A 4XIIA 5LDHA 1H2WA 3WGYA 2C9DA 3FM9A 3GVXA 1ECJA 5K6RA 1AM4D 3H8JA 1FXSA 3L8MA 4W1QA 3R1IA 1MC4A 2O2JA 2XDQB 4NG4A 2E4YA 4E1AA 3NDBB 1UZAA 4TYPA 2FN3A 3LBAA 3V34A 4XYLA 3KQLA 4BU1A 1P19A 4QXQA 4II7A 3W06A 4EYEA 3IMGA 1IUKA 1QMPA 1R00A 1TQHA 1WUTA 5AUNB 4EJ2A 5GMOA 3THYA 1WCWA 3I2KA 1J0CA 1OYWA 2VTDA 1NW3A 5DTEA 1UBKS 3U48A 3B6JA 1OLSB 3ISJA 2V54A 2DC1A 5EXEA 2IZOA 1BCSA 1PJ2A 4A0RA 1ZL2A 5CAEA 1BCSB 1H8HA 2Q4RA 3IRVA 1IBSA 4YRBA 4BTVA 2Y92A 1PWYE 2H51A 2WSLA 4PXYA 3NRBA 5LB2A 5JCOC 3EEFA 3LT0A 3MXTA 4RM2A 2ZVPX 1ZNWA 4RXTA 4BV8A 3RC1A 1NUAA 1WUJS 5EEHA 4HO1X 5A3JA 4LJAA 2GK6A 4TV8B 2V58A 4FB4A 5JD5A 3VJRA 2BHTA 4JP3A 4YJ3A 4BKOA 4UHKA 2I22A 2HA4A 2PT9A 1QVWA 2GCOA 3MJDA 1U6JA 3OMWA 2WE8A 4WFKA 4CETA 4JT4A 5TGZA 1UOEA 3KYDA 1XQ9A 2N47A 2I54A 1C14A 1J2JA 4EJ0A 1KARA 2XNHA 4B34A 5HJ7A 5KDDA 3CVJA 4X7RA 4RTLA 2WTAA 4TS4A 1O03A 1M0EA 4L4YA 3J81A 3KSZO 1UXIA 5CVDA 4YRMA 5JS7A 2AWOA 2I80A 3A28A 4KWEA 1NAHA 2V6JA 2WINI 4QGAA 3LX4A 4QDTA 4FKMA 1Y82A 2W9XA 3JD1A 1RYEA 5K8LA 5JUWA 2VHZA 4YDRA 2ODBA 2MYTA 1SKYB 5JXGA 1XTVA 4KLCA 1AV6A 4HAOA 4QELA 1RZRD 2HA0A 2J3HA 2REOA 2WVGA 3GHHA 3V8VA 1VIVA 4JJ4A 4HL6A 1RNLA 3P9YA 3DFUA 5E9AA 4R1MA 4HN9A 3CLTD 2YXPX 2J3QA 3SZLA 2RG7A 2OXCA 3KQYA 4TTJA 5G4KA 3W04A 1F2TB 2O3TA 2O8EA 1QC5A 1BG6A 1QBKC 1VLLA 4M83A 5ALXA 4EMSA 3UUGA 3I5MA 2COKA 2IYRA 1C0IA 3NKVA 1R16A 3GLGB 5C7LO 3SSAA 2XQIA 1KEEA 1K5HA 3JPWA 1O54A 1KKMA 2DP4E 4DQLA 2DM6A 2IHYA 1N6OA 1QQBA 2O0LA 2WYUA 3QBDA 2OZLB 5C51B 4EB3A 3P1JA 4KDRA 5U1PA 3IVRA 4RJKA 4D4GA 1U1DA 2W7TA 2VTKA 4NIMA 4DT1A 4O3MA 4XWOA 2C7QA 4BKRA 5HZMA 2O7NA 2Q7XA 3P7MA 1GEEA 1HV8A 3X3HA 4PGGA 3ZDQA 5IWCA 3IE0A 4R2XA 4HDNA 2F9LA 4QQ8A 4TKUB 4H1UA 4WE3A 1GKKA 1F1JA 3AFGA 3PZRA 3WJ7A 3DO5A 1RKVA 4H7HA 1XVIA 3N58A 3QMWA 2WUFA 5AMXA 4EZBA 1SQ0A 1QO7A 1A27A 3EMVA 4EW3A 3GEHA 1Q0LA 3UPUA 4B3RB 3EOZA 3ET4A 4J03A 4LGCA 4WBNA 3ZCXA 1FRNA 2R7AA 4R3WA 2F17A 3D6JA 4JJEA 2NXWA 1PYOA 4OQXA 4EDFA 1N92A 2QLNA 4NJEA 5JQGF 2FFAA 4YPOA 3T3DA 3R40A 1FSSA 2A84A 3O2NA 2DSNA 3REFA 2I0FA 1MEJA 1UFVA 1KIMA 3E3MA 4DA6A 2PAAA 4G86A 2D3TA 3CWZA 4B43A 3DZFA 1JXOA 2XY4A 4PLVA 3DBVO 1VCOA 2UXCB 2AVDA 3L6RA 3TUZC 3Q8MA 1XROA 4RENA 5EWLB 3EXEB 3SMVA 4IH1A 2YOGA 1ZK2A 2CLEB 1GADO 5AK3A 5FBQB 1U4OA 2FPGA 4H4EA 5T64A 3V4SA 3A2NA 1QFMA 4MUFA 1WY7A 2GR9A 4JI1B 3Q3HA 3HXKA 2Y1EA 5JNWA 1Z0JA 3IVCA 4E5UA 1Q11A 2VF8A 2YS7A 3V33A 5L40A 4OK3A 2YFQA 4ATNA 4DVJA 5FUYA 4G8CA 1KJ9A 1EDOA 4DCMA 5JXJA 1EX1A 4PYNA 4DHWA 2IQIA 4IGIA 1E62A 4B3HA 2R60A 4JB0A 4F3RA 3E4DA 1EFVA 3DZKA 3GVIA 1MBZA 1R0ZA 3DMDA 4K8RB 4MWEA 3G2IA 1G5RA 3ZDZB 2VWGA 2CKDA 2DFNA 2FNAA 3QELB 2B83A 2QX7A 4KUEA 1LVUA 2P30A 2QXUA 4TV9B 5G4KB 1TCBA 3NGXA 1C4OA 5HKBA 4FHEA 4OX9B 1HZZA 2CLDX 3BAZA 4DMMA 2I78A 5AD1A 4M1ZA 4C2TA 5ALHA 2P9ZA 3T34A 4BIMA 4D3YA 5JH7B 1JHVA 4QUGA 4OKSA 4M49A 3LCVB 4TWZA 5JSFA 1P1KA 2JIOA 1TUBA 3KSMA 4NYIQ 2CK3D 5HDQA 4HUQB 3VZQA 3TNFA 3FFXA 4X6YA 1AKEA 2XSZA 3MF4A 3THXA 3GBSA 3HGTA 1PD0A 5CJJA 1SHKA 3MPOA 5GY7A 3EGCA 5CLLA 5ECWA 3Q9SA 3A58B 1M8JA 3KD2A 3ZG6A 5B5SA 4JLUA 2IXEA 2RHMA 3AFHA 4ND4A 4RSRA 4HOYA 2HTEA 4OATA 5JY1A 2Q99A 1Z29A 3NHMA 4QU9A 2JH9A 3KS9A 4YUZA 3C7KA 3DL7A 3TAXA 1GV1A 4OGWA 1BKSB 2EHJA 1WUYA 3QKSA 5CMLA 4ESOA 1L8QA 3HUTA 2BGUA 4JP8A 4ZI2A 3ZWCA 4BGEA 4KRFA 1N1MA 2QVGA 4RK7A 1WMDA 1E2BA 4YAEA 2D2XA 3TOZA 2X9QA 2QNIA 2ZPUA 3NT2A 4DCPA 4EL0A 3LKDA 4W5JA 2Z6AA 3UAYA 4QPPA 3V1LA 2E37A 5DYNA 1I36A 1YZKA 4DLLA 3A3YA 2NXEA 4DDKA 4ZYUA 4RJLA 2AC4A 5EIHA 5BVHA 4NXNB 4YCCA 4E15A 5BPHA 1DCKA 2C4NA 3C4QA 1II8A 3FOBA 1Q7RA 3LY5A 3QG1A 2FPUA 1YDGA 4I5EA 2JHCA 1XKTA 3I04M 1SPXA 2O3RA 1G7SA 4KH0A 4MUGA 4X8MA 1GUYA 221PA 3LJKA 1Z4PX 2FMFA 4P7JA 3CF4A 1O6FA 1R5OA 4ZVKA 3RIGA 1U7HA 2QX4A 5GZ1A 2V7UA 3QLJA 3ZWDA 1NUHA 4P4SB 5C1BA 2HHHB 1A2BA 1EE2A 1GD1O 4LOJA 2OXIA 2OPBA 1MXHA 3R76A 1KMNA 1VDMA 2XZTA 1GV0A 3CSUA 1DWUA 2QTVA 3JALB 5BV0A 2QTVB 4FCCA 4LQ4A 2EFEB 1RKUA 2KHZA 2Z8XA 3CZRA 3OC0A 1O0SA 3QVKA 4WNCA 1HF3A 1KL7A 1W0KA 2QT0A 3JQFA 4LECA 3USES 1OC4A 4XAQA 4YPVA 5CDFA 2PUAA 1RRMA 4LMPA <