1JW9B

Structure of the native moeb-moad protein complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
240
Chain Sequence
AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 82
structure length 240
sequence length 247
ec nomenclature ec 2.7.7.80: Molybdopterin-synthase adenylyltransferase.
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jw9B00
3Q2IA 2Y0EA 4HFJA 1NP3A 2G76A 3PYXA 3DMTC 1TEHA 1H6CA 3WFJA 3FWZA 3ANNA 1P44A 2GR9A 3BMNB 3LF1A 3WYBA 4EW6A 2HSDA 4CLOA 5JY6A 1PZGA 2OFPA 3HJAA 5HRUA 2W2KA 3GG2A 1CQIA 2HK8A 1I5RA 1RM4A 2OBNA 4E5PA 2BGLA 3PJGA 4JQCA 3KRTA 1GZ3A 5I7VA 3HG7A 2EGHA 4E13A 3TFOA 4Z9FA 2I3GA 1VI2A 2Q2VA 2X9VA 1LUAA 2BH9A 3O9ZA 3F1LA 3NYWA 5AOVA 4B7UA 1U3VA 3FI9A 4IY1A 4N7RA 2DPHA 1EEHA 2NTVA 1H6AA 1BXGA 1VC2A 4Q3AA 3DFZA 3O8QB 3WGIA 4NFSA 4KUEA 2DFVA 4RF3A 1UXGA 1YGYA 2Q46A 1KOLA 2UUOA 2VTDA 1E7SA 3ASUA 3GT0A 2NWQA 5BT9A 4N5LA 4CMHA 4L4XA 5KKAA 3RBVA 4BMSA 2VOJA 5EERA 2X22A 2VZ0A 4PLWA 2JCXA 1HTBA 1PEDA 4O6VA 5IDYA 4CUJA 3IP1A 1CRWG 3ZH2A 1YB1A 3KYCB 4B4VA 3BMNA 4WCDA 3OJ0A 5CP8A 1PL6A 4OGWA 1OC4A 7MDHA 2OXIA 2R00A 5B1YA 1LSUA 4O59O 3Q9NA 2A9FA 4OHUA 4MVJM 4XYBA 1NVMB 1J6UA 1BWSA 4U8GA 1EUCA 2D5CA 3PFWO 1Z73A 3EUWA 1E3SA 4NMHA 2X0JA 3OHSX 3KETA 3QE3A 1ZVMA 5IF3A 3GK3A 1HDYA 1UAYA 2QW8A 1UUFA 3FNHA 3GZNB 4BHTA 1JA9A 2V6FA 4R69A 1N8KA 3AJRA 3FWNA 5JAMA 3SXPA 3O8QA 5G4KB 4TRMA 5IDXA 1LSSA 3PI7A 4W6ZA 3E9NA 1ZNQO 3SBOA 1PR9A 3AOEC 2VT3A 1PGPA 1FDSA 2UYYA 3IDSA 4W9NC 1DOHA 1EZ4A 3TQHA 1P0FA 5ILOA 1WMBA 3N7UA 1EQUA 2ZB7A 5MDHA 3G79A 5TNXA 2RH4A 4R9RA 4MP8A 3JQAB 3RUDA 3RVDA 4PLCA 4TQGA 4MKXA 1HYGA 4PFJA 3RJ9A 3KYCA 3T7CA 3TRIA 3VDQA 2CFCA 4N18A 4DPLA 3IP3A 1X7DA 3CIFA 5CHEA 3IJRA 1ZO8A 4Z6KA 5IZCA 1SAYA 4I5DA 1NR7A 2VCYA 1JN0A 3ICPA 4RLHA 4OMUA 2CNBA 1QYWA 2IZ0A 3QVTA 4RQTA 4PLPA 5FWNA 2DBVO 4NI5A 1Z45A 3UVEA 5A06A 1EVJA 2Z95A 3WJ7A 1B8UA 1MUUA 1S7CA 2VUUA 1K6JA 3GZNA 1E5QA 1ZSYA 3GN2A 4YEDA 3TOXA 4R54A 2X23A 4ALLA 4BNIA 3DOCA 3AI1A 1R0LA 4NZ9A 1DC6A 2HJSA 5G4KA 3RD5A 4ND1A 2HAEA 3TWOA 4BNKA 1F8FA 2B5WA 1KC3A 4BKUA 1GQYA 4FFMA 4OQYA 2P5YA 2NU8A 3FBGA 1Y8QB 3L07A 4ITUA 4E6PA 2RHRA 3GDGA 4TKMA 4KMSA 1LDGA 1KS9A 2J5QA 1U9JA 1A9ZA 4MO2A 1VL0A 1R0KA 5A9TA 5KJ6A 3WGYA 2Q4EA 3WGZA 5CDSA 3DBLB 3GRPA 1EVZA 3JQAA 3H3JA 5IZ4A 4PVDA 1V3TA 5F5LA 4XQGA 2W2LA 3FCOA 4RVSA 4BO5A 1C14A 1T24A 1GDHA 4BNHA 1JAXA 4JGBA 3U4IA 4QFCA 3CKYA 3HDQA 1VJTA 2Y67A 4FFPA 2B69A 4W7IA 1WVGA 1OMOA 1KBZA 1DIBA 5IG2A 1A71A 5KIAA 2V6GA 4BO7A 1NQAO 4UAGA 4IDCA 3UOGA 2OO5A 6LDHA 3CEAA 2CF6A 1DFGA 4P4LA 1OOEA 2X86A 5IJZA 3H9UA 3I6IA 3R6DA 1FDUA 3OQ1A 1CQJA 4FOSA 5DT9A 3GLQA 4OSOA 2EF1A 3WBBA 4YRBA 5L40A 2P9CA 2UUPA 4KTVE 1E7WA 2FR0A 1Q7GA 3QWHA 4MVJA 3ZWCA 4QECA 4CLXA 3H2SA 2G82A 2FRDA 4PLGA 1GZ6A 1KY4A 4E5MA 3FNGA 2GPTA 1Y8QA 4XGNA 5EESA 3DZBA 2NU7A 4RPHA 1B26A 4K6CA 3COSA 5CPFA 2C07A 3DBLA 1VSUA 4XGKA 3RC9A 3JQAD 1C0PA 5KKCA 3GN1A 4QTZA 3S2IA 2GN8A 3H2ZA 6ADHA 4JJGA 4KOAA 3BAZA 4EJ6A 3NTOA 4GI2A 4NFHA 2VYVD 2Y1GA 4XYLA 4AJ1A 3GNQA 2Q45A 1YH3A 1ADFA 4TVBA 3AW9A 4ND3A 3SEFA 3L6EA 3WTBA 1NFRA 1HYEA 1Y8RB 3AOGA 1HWYA 4TVOA 3WJAA 1F0YA 3VZPA 1GQ2A 1BG6A 3KEOA 2HKIA 3VDRA 4DPMA 4ND5A 3IMFA 2DU8A 3HZZA 1LLDA 2FPPA 3UH1A 1LNQA 4WNCA 4Z0PA 5JO9A 4AJ2A 4CMGA 1A9YA 4MVJD 3RSHA 1HT0A 3GC6A 3V1TC 1VM6A 2CD9A 2OBYA 3M2PA 1R4NB 1W8DA 3L9XA 3KXDA 5JO0A 4S1VA 4ZRNA 2P68A 3V2UA 3DTYA 2VZ8A 3TZQA 4R1SA 4GMGA 2YW9A 1S6YA 3OJEA 5HM8A 4WLOA 4K6FA 4TSKA 1IZ0A 1HLPA 1M6HA 2LDXA 3TZCA 5IXYA 2AW5A 3WG9A 2WE7A 3BHMA 1NPDA 4XQ9A 1QV6A 4AJPA 4R41A 3BYZA 3QW2A 4E2YA 5JDCC 1B8PA 4BNLA 3Q1LA 5U4QA 4K9DA 5GZ3A 4YJGB 1Y8RA 2X5JO 3D4OA 2JHGA 2OHXA 2VWQA 4GQAA 4A03A 4UVHA 4XQCA 5TT1A 3UFXA 3KSZO 1PS9A 3HDYA 5L4LA 2AEFA 1MFZA 3GQVA 2FSVA 1KVSA 2FHSA 2PKRA 4ID9A 3WOHA 3GHYA 1T25A 2Y05A 2GZ3A 1TXGA 4A2CA 4GAEA 3GGGA 3GVCA 1R4NA 5TX7A 3PWKA 3BMOB 4CMCA 4R1NA 4MOWA 2AQIA 4D42A 2X0RA 3ZV6A 3ZWBA 3EC7A 1ENOA 4U6SA 1ZJYA 4ALIA 3PJDA 8LDHA 5AXCA 5ER9A 5DBGA 4CQMD 3WXBA 1DC4A 1GEGA 1NAIA 1V3UA 5L51A 2GO1A 2BFOA 2HMUA 4MP6A 3HDJA 4BO1A 2C7GA 3OF2A 1X1TA 2OORA 2VYNA 3V2HA 5ER6A 2TMDA 4CQLB 2R2GA 4YTEA 1JU9A 4YJGA 4MINA 4F45A 1LA2A 5GZ6A 4J2OA 3D64A 5LCXA 3BTOA 4IINA 2GASA 4QUKA 1NVTA 3GY0A 1WW8A 4CJXA 4BO4A 4XA8A 2XPCA 5ADHA 5A02A 2CVQA 4B3HA 3K73O 3EDMA 4J49A 4WLNA 3W8FA 4EGFA 3ZW8A 3WMWA 1HF3A 2NADA 2UDPA 4JROA 4OOFA 3C1TA 2PZMA 1I8TA 1DAPA 3BMOA 5J23A 3PTZA 3Q11A 4N54A 1B14A 2Q1UA 1H9BA 2JAHA 4E12A 2ZTMA 5GZ1A 3D5TA 5EL0A 3JD2A 3RUHA 4MVJP 2WYWA 2FN7A 4R16A 1XDWA 3TL3A 3FBTA 1DEHA 2WE8A 1QP8A 4WCFB 1M75A 5JE8A 2HO5A 2I65A 3U4CA 4J0EA 2NNLD 4PRLA 4DVJA 1DFHA 4R3NA 2Q1WA 3MWEB 4CQLA 1N9GB 3EGOA 4IMPA 4BNVA 2WEKA 2CMDA 2O50A 1F8GA 5AVOA 3ETGA 2I5PO 3WSWA 1UP7A 2VHVA 5JW6A 3DBRB 4LN1A 2I3AA 4UUPA 1PL7A 1LEHA 3PWZA 3QIVA 1CIVA 4A73A 1V6AA 1E6UA 3VH1A 2FPGA 1LDNA 2NTNA 3CINA 4BKPA 2IZ1A 5JAQA 1UZMA 4B4UA 3RUIA 1GAEO 2JL1A 1MG0A 1A7KA 2JJYA 2CDBA 2YZ7A 4CMBA 3PFFA 4FB5A 1EDZA 1LRKA 2VN8A 2VRCD 2ZKLA 4FOOA 1E6EA 4MIEA 1DIGA 3VPSA 2PTGA 5F1PA 3BHIA 1PJ2A 2I76A 4YT8A 5HS4A 3R3JA 5EMHA 1JWBB 1NM5A 2QRLA 3HUDA 3IOYA 1HE3A 4Z0TA 1E77A 3JCZA 3VC7A 1VE9A 1DAOA 3WGHA 5A5FA 5B4VA 3ZWAA 4WCFA 3BZUA 5CFZA 4RVHA 3DL2A 4OAQA 2PNFA 2Q2WA 4TROA 1TB4A 3MCVA 4XZ3A 3JYOA 4RLSA 4DQVA 5G0UA 3FNEA 4CR8A 4HKTA 5F5NA 1N9GA 4BUCA 4I5EA 2O3JA 3DAFA 1I3NA 3HB4X 4PLVA 1VLLA 4IZHA 4BNYA 1YS4A 3DBRA 1T2AA 4HFNA 1SOWA 2ZTLA 3PZBA 1NX6A 3H9GA 3JD3A 1PJQA 4PG4A 1U8FO 2GN4A 1E7QA 1GPJA 3DOOA 5DNAA 4C7JA 2BF7A 3F9IA 4L8VA 1GYPA 1AHIA 2HRZA 3TDKA 1QKIA 2H1SA 1VRWA 1UAGA 1OFGA 2HMVA 4ESOA 1BXZA 3Q3CA 1QYXA 5BSEA 3SC6A 2X0IA 4IJWA 4B7XA 1UJMA 4WLVA 3G17A 2OMEA 4LW8A 1OC2A 4AVYA 1SCUA 3D4NA 4NNJA 4BO2A 1A27A 1SOVA 2D4AA 2EKPA 3PXXA 2ZATA 3QY9A 1ZW1A 4YRAA 1LC3A 5JYDA 2O2SA 3KO8A 3M1LA 4JX8A 4ONEA 4OYRA 1R0SA 5F1KA 5BNFA 2Y0DA 1PSDA 1PJSA 5JCJA 2PKQP 2X0NA 3PLNA 4OSPA 1E3IA 4LSMA 4YJHB 5JDIC 4IDDA 1C0IA 3DZIA 3TOZA 1NBOA 2GUGA 3N74A 1J49A 2GYYA 1ZFNA 4CM6A 4PG8A 3ROQA 1I01A 3TNLA 3JD4A 3K6JA 1FXSA 1ZMTA 5TT0A 1D1SA 3V8BA 2YFQA 1H6DA 2UV8A 3HQ4O 3STHA 3JYPA 3SX2A 4IQGA 3GGOA 2FY8A 1N1GA 2EGGA 1JTVA 4IXTA 4LMRA 4GGPA 4BNZA 1BVRA 3ZI0A 1KEWA 1QV7A 5JMPA 4DPKA 3VPHA 3CH6A 3MJEA 1GUFA 5ES3A 3DHNA 4E2ZA 3I4FA 3RKRA 2AQ8A 3HSKA 2IEDA 1YL7A 2OP0A 5G4LA 1TT5B 4DMMA 3G49A 3WMXA 1AXEA 1X7HA 5BNTA 4FQ8A 4HNHA 4AFNA 4DLBA 3NT5A 3RUAA 4YJHA 1I36A 1V35A 3L6DA 2VHYA 3WBFA 2VUSA 4Y67A 1YDEA 1ISJA 3U49A 2YV3A 4HV4A 4BNWA 4DIBA 3VH3A 4DBZA 1AUPA 2EW8A 5CPBA 1AHHA 3GEMA 2FPIA 4CV1A 1WP4A 4ND4A 5KJEA 3TL2A 2NU9A 3RU9A 1PU2A 3CPSA 3U3XA 1W0CA 3FNFA 1M76A 1RWBA 3P7MA 2H5LA 4PZCA 1U1IA 2AEJA 4PIVA 3GHHA 1I30A 2J3IA 4RVFA 5TS3A 2VWPA 1Y81A 1PZFA 2ZQYA 4BO8A 1NVGA 1SEPA 5A03A 2V65A 3WICA 5A4DA 1A7AA 1CYDA 4UUOA 4BGVA 1BSVA 3E9MA 3PHJA 3TZHA 1P33A 1TT5A 2NVUB 3LK7A 3QQPA 1SB8A 4PN3A 1FK8A 2GGSA 3H8VA 2CUKA 1LDEA 3F47A 1GYQA 3MWDB 2J6IA 4O0LA 1K2WA 3O03A 3Q2KA 2ZK7A 4RPJA 2DT5A 3WGTA 2YDYA 2EIHA 1YJQA 2RH8A 1R37A 2NVBA 4XB1A 4A10A 2PH3A 1Y1PA 1I3KA 3UGKA 3E48A 4JP2A 1ZK0A 1ZXBA 4FS3A 4IDAA 4EI2A 3WWZA 3I23A 3HE3A 4J91A 4QT0A 3K2EA 1PGOA 1Y9EA 4TWRA 1OBFO 1XKQA 2J3HA 4H7PA 4IQ0A 3V1YA 3BMQB 2F1KA 3QJ5A 3C7DB 5DN9A 3LYLA 5CG2A 3GRKA 3KM0A 4F6CA 3LT1A 1ZKMA 4E4YA 3HN7A 1O5IA 1RJWA 1GZ4A 1X0XA 4H3VA 4JBHA 2JCYA 1HSZA 1NFQA 2DBQA 3PQEA 1K3TA 1BMDA 4B4WA 2NVUA 2A94A 4BNFA 1IOLA 4HWKA 1PZHA 3WQQA 4DBVO 3K8ZA 3PVZA 4ROSA 3WIEA 1B7GO 1LRLA 2GD1O 3EK2A 1E3LA 4FFRA 4F3YA 4YVFA 2I66A 2R00C 4J43A 3GDOA 2Z1NA 3C7AA 3ZGYA 4K1LA 3FR7A 1MA0A 3GFGA 1NWCA 4GVLA 4R5MA 4XRRA 3ITKA 2BRUA 1DB3A 3MJSA 1JW9B 4D43A 3AFNA 3O4RA 1LQTA 4IPTA 1MXFA 3LVFO 2DKNA 1ZEMA 3F6YA 3I5MA 1G1AA 1KERA 2WYVA 3E8XA 1I24A 1PR3A 1UZLA 3BMQA 3K96A 4J0FA 5L95A 4P4NA 1LTHR 4D79A 4F6LA 1H5QA 1GQQA 5ENDA 3S8MA 1QYDA 4JP3A 1ZSVA 3E5MA 4YAJA 2BHLA 4FJ1A 2Q4BA 5DCUA 3WGQA 1IY8A 1HDCA 1XELA 4TRNA 5ICSA 4BNNA 3C1OA 3TJRA 3TZKA 4DIOA 2YY7A 1QG6A 3DOJA 4ZQGA 4GKBA 1K89A 4JN6B 2W90A 2FZEA 1U2GA 4LVCA 1PQWA 4CL3A 5KNLA 5BSFA 3MTGA 3KB6A 3NX4A 1D1TA 1HEUA 2PGJA 4NIMA 4E2XA 5IZCC 3WWYA 5JBIA 3WFIA 4U7WA 3W6ZA 1E7RA 5A3VA 3GVHA 4WNIA 3NV9A 1IL0A 4UVDA 2EKLA 4XJSA 2IXBA 3CSDA 1ZCJA 3ZWVA 2JD0A 2FP4A 3RWBA 3NAQA 4FW8A 4DXHA 4E2WA 2GERA 5KJFA 4WECA 1JKFA 1XCBA 2ILTA 2JKVA 4E30A 1A72A 2POQX 1DLIA 5EJ2A 3ONEA 4AJNA 3VKUA 2QHXA 2HU2A 2ZYAA 5I7SA 2OP1A 3GOHA 1E7MA 3RFVA 3E9QA 4FSHA 4L9RA 4BS9A 4NPCA 4YCAA 5JXWA 4MDHA 4UEKA 2P4QA 2HJRA 3GUCA 1LU9A 3K2BA 4RL6A 1WZEA 3PYMA 1O6ZA 4JK3A 1GD1O 1WWKA 1WDMA 4MKRA 1KC1A 1E5LA 3DZHA 5L9AA 3C85A 4W7HA 4BKRA 4Z9YA 4OO3A 1QORA 4KDFA 3B1FA 1LJ8A 4J7UA 4I5FA 1CWUA 3ENKA 1ZK3A 3MOGA 1ZJZA 3ZWXA 4BO9A 1IULA 3LF2A 1WPQA 2YYYA 4Y98A 2PY6A 2R6JA 5JS6A 3RC7A 2NACA 2EKQA 1ADBA 2AEMA 4D3DA 1D8AA 2Q1SA 4U0KA 4GWGA 5U9CA 2PH5A 1KY5A 3GPIA 3IJPA 4YAGA 4GX0A 4XWYA 4D44A 4CR6A 3S2FA 3BXXA 4BVAA 1O9BA 5TQVA 1F17A 4ZRMA 2PD3A 3GH3A 4LMPA 3IUPA 4RVUA 1H0KA 2A35A 3QP9A 1ONOA 4S3MA 3KOUA 1GU7A 1GV0A 4P22A 1MLDA 4Q3CA 5CEFA 4OXNA 2Q3EA 1EE9A 1PWZA 3JQFA 3MTJA 1ISMA 3I6QA 3H9EO 4NK4A 3OEWA 5F21A 2NQ8A 4DTIA 2EEZA 3S2EA 1CJCA 1YBMA 2Z5LA 3NKLA 4BB5A 2IZZA 4TKLA 3L6OO 5CG1A 2I67A 3GAFA 2GZ1A 3B1JA 2FSSA 1GYRA 1P77A 3LU1A 1XQ6A 2IYOA 4TMFA 3OJLA 4ZQFA 1JKJA 3WLEA 2QIOA 2J3JA 3P2OA 1KETA 3U4HA 4RVDA 1SO8A 3BTSA 4M49A 1ADGA 4D7AA 3DFUA 3JQBA 3HHPA 4Y8VA 3G1UA 4MVJE 4FGWA 4GLOA 2RIRA 3FD8A 4PZDA 2E49A 2PR2A 4IGFA 1GADO 2OZPA 4XJTA 2YUTA 3QLJA 3WR5A 2AG5A 4EZBA 1VKOA 4YAIA 3PDJA 2AE1A 1HZJA 5EN4A 1XEAA 4YBZA 4AICA 1LI4A 5DDIP 3GUYA 1IB6A 1E0DA 4M8SA 1DJQA 5L53A 2PV7A 1SNYA 1GUYA 2WJPA 4CMEA 4FR5A 1B15A 1ZK4A 1I33A 1QRRA 4YB8A 2W2LD 3PYLA 1PJ4A 3OECA 1ADCA 4GPD1 2O3UA 1YB4A 1KEPA 2O3SA 3ENNA 5KJ1A 4NR0A 3ADPA 4H15A 3UHAA 4MIOA 1ZK1A 3VVBA 3OH8A 1A5ZA 2I99A 1LDBA 2OUIA 4WGGA 3SJ7A 4RF2A 2PZJA 4M89A 1C0LA 3OIDA 2VNAA 1N7GA 2D2IA 5HTOA 4KWIA 2EXXA 2YJZA 4GMFA 1RYDA 4I9NA 1QR6A 5EIOA 5T5QA 5JAIA 2D1YA 2VHZA 1RM3A 4GKVA 1ZBQA 1SPXA 3X2EA 1HLDA 4DLAA 4IDGA 2ZTVA 3AI2A 3RQSA 1Q0LA 1TVEA 3EHEA 3HFSA 2B4TO 1TA4A 1GFSA 1M67A 4NFYA 5FEUA 1HETA 2Y66A 3GVIA 4RO0A 5L7WA 1YWGO 5IDWA 1AE1A 4KUHA 5DBFA 3Q0EA 2JCVA 3Q6IA 1SEVA 2QX7A 4GX2A 2LDBA 4D3SA 4G65A 4M86A 5CDTA 3AY7A 1WDLA 1T2FA 3ON5A 4GWKA 4WASA 3BTUA 4BNMA 4BB6A 5H83A 3L0DA 3PLRA 4ZA2A 1FDTA 1YDWA 2G1UA 1ZMOA 3F5SA 3JYNA 4XKJA 3FRJA 5HBRA 3E18A 3DHEA 3GNSA 4YT5A 1VSVA 3SC4A 3WS7A 4E0BA 1ARZA 5AXDA 2E6UX 1CEQA 1ENYA 5JC1A 2A4KA 3ZWPA 1IPEA 4DQXA 1XYGA 1QSGA 5IN4A 1DLJA 4AJ4A 5JPIA 4IDFA 4M87A 4MVJG 3WLFA 1T4BA 3MJVA 4O5OA 2AG8A 2EP5A 3HDHA 4R01A 1BVUA 1Q0QA 1V8BA 3N58A 2QYTA 4NBWA 4RGBA 4CM3A 1B16A 1WMAA 4QSMA 1JQBA 1PJLA 4CMKA 2XF8A 1IE3A 3E03A 2BKAA 3EW7A 1EK6A 1D7OA 2HMTA 4L4SA 1WXDA 1ISGA 1QLHA 2Q2QA 3GVXA 5H81A 1BW9B 1QMGA 2DVMA 5BSHA 2G0TA 3FR8A 4YQYA 3K30A 3RASA 4CV3A 4IGEA 5DBIA 3S1LA 1KYQA 1N7HA 3ZNPA 5KCZA 3K9QO 1BDBA 3SJUA 3MZ0A 1E1KA 3F1KA 1T2DA 2V7PA 3WNVA 4NBTA 1H9AA 3GPDG 1YVEI 4N5NA 4RZHA 4J4TA 5AYVA 4Q3EA 2XXBA 3ZHXA 3BTVA 3PJEA 3P19A 4BNXA 1B8VA 1U4SA 1DRWA 3PHLA 4CM4B 1E1MA 3UKOA 4WCFC 3G0OA 1MX3A 4WKGA 1PJTA 1ZH8A 4CM1A 1P1FA 4BKOA 1WAMA 3PQDA 4CLEA 4W99A 4WPGA 2E48A 3H65A 3RC1A 3ANLA 4A5OA 2QQ5A 4PG6A 4RDIA 3RUEA 4J4BA 1YQDA 3UCXA 4ZD6A 2FZWA 4YDRA 2VYND 1NPTO 3WYCA 2VZ9A 3UXYA 2ZIZA 3K5PA 4PG7A 1BW9A 1TLTA 4RJTA 2DBZA 3WYEA 4B8WA 2C5EA 4E5NA 1NHGA 3JD0A 1U8XX 1ZUD1 3QVWA 1DXYA 5T64A 1HSOA 3PHIA 1BTOA 2ET6A 4GX1A 3DAPA 1OZAA 1YQXA 4XEHA 1WZIA 4KWHA 4LSWA 5FF9A 3ZU2A 1NYTA 4KDEA 1LSJA 3I1JA 1Y6JA 1JVSA 4QXMA 2QYSA 1KEUA 4Z9XA 3QRWA 1NQOA 3PK0A 4AL4A 1Q7BA 2QG4A 1GPDG 4CM5A 3KLPX 4F46A 3G3EA 2JD2A 4CM4A 3I9MA 1SBYA 4JXKA 2OL4A 1NXQA 3ROPA 1R15A 4UULA 5THQA 1JLLA 3ZN2A 5KTKA 2D8AA 1EFLA 1F14A 1IHYA 3ZWOA 3E5RA 4PLTA 4WUVA 2OOSA 1BRMA 2B37A 4KTTE 2W98A 3DDNA 2X8LA 1J0XO 4FFLA 3WQSB 3KSUA 3DHYA 9LDTA 2VOEA 3QV1A 4FJ0A 4U5QA 4W4TA 1Q0HA 1FDWA 2AA3A 5B4TA 3DZFA 4XYGA 2BELA 2EJVA 2EV9A 5TJHA 1UXKA 4R1TA 3KHUA 3LC1O 3INGA 3V1UA 1YKFA 4J1SA 2GLXA 2NLOA 2A92A 2BD0A 3PRJA 3WTCA 3LT2A 4EYEA 4G81A 3CMMA 1VJ0A 2VT2A 3D3EA 4LGVA 3T4EA 2EJWA 2AXQA 3RBZA 5G2OA 2C2YA 4ALKA 2I6TA 3DXFA 3TF5A 5F3RA 1IHXA 1QYVA 4IIVA 1UXHA 4JCOA 3QWBA 4GBJA 4BNTA 4EUHA 1NTOA 4CLDA 5G0TA 1U4OA 2NU6A 3I9KA 3AU8A 2RHCA 2HK9A 2Y1EA 4A0SA 3P2YA 2GSDA 4M55A 3QWIA 5A1TA 1CETA 3OQ6A 1P1JA 4A26A 4L76A 5CEJA 2GZ2A 2B83A 3DONA 4J90A 2SCUA 3KYBA 2IYPA 1DIRA 4OKNA 4ALJA 1HYHA 4OIMA 4EUEA 3QWAA 4CM9A 4ZHSA 2GN6A 4Q9NA 3OETA 4BGIA 2F00A 1J5PA 3W6UA 2WDZA 1D3AA 3ETDA 3H7AA 4BL5A 5L7TA 3VZQA 3PIIA 1SB9A 2YV1A 3JYQA 5MGBA 1P1IA 3V2GA 3L4BA 4BOYA 4ALMA 3UICA 3A14A 3VZSA 4G5HA 3T7EA 5L4SA 7ADHA 2PFGA 2W4QA 1HDZA 4BKQA 4E32A 2PGLA 1N1EA 4PVCA 1U5CA 3KVOA 3VVCA 4YRDA 4L0QA 2Q49A 3PHHA 4WEQA 3CMCO 3FPLA 3WX0A 5BNIA 1NQTA 3IS3A 4RZIA 1HRDA 3OP4A 1MXHA 5EINA 2PD4A 4ZQHA 2EP7A 4YAKA 5JCJD 4PLZA 3DBVO 5DF1A 2O2YA 5C7LO 5A04A 3LT0A 1PQUA 2WD7B 4OL9A 5IXSA 1ISIA 3G1TA 3HN2A 3QWFA 1ULSA 1BXKA 2VTEA 1XG5A 4HY3A 4JBIA 4ZJUA 4CM9D 3ZV3A 5KJCA 3AY3A 5TIIA 1YONA 1U3UA 3ASVA 4Q3DA 4RPKA 2EERA 4URFA 1ID1A 3ETEA 4NU5A 2AMFA 2JFGA 3CZRA 3UCEA 4EUFA 4CR7A 5C7IO 2FWMX 2IEBA 3OSUA 3AK4A 3INRA 4NG5A 4YJDA 3F5QA 4NBUA 3KBOA 4WJZA 4AJLA 3AUTA 3DTTA 3HB5X 2DTXA 1PS8A 5C3MA 5TSDA 1DDOA 4DREA 4YPOA 2C54A 4NQZA 2DTEA 2C59A 4WLUA 4BNGA 3ZHBA 4CL8A 4GX5A 3VHRA 5TLSA 5EPOA 3I4CA 3HNPA 3H6KA 3RC2A 3I52A 2O23A 4LISA 2FR8A 5T6BA 3UF0A 4XYEA 4ILKA 4IMRA 1P0CA 2WD7A 4Z3DA 1CF2O 2BGMA 1PJBA 1Z7BA 3MEQA 2IRWA 2X58A 1U7HA 4OXYA 3OMLA 4R5HA 5TC4A 4EDFA 1K6XA 1I2CA 1JWAB 4CUZA 1EDOA 4LK3A 4L74A 5COAA 3I9JA 4AJIA 2UAGA 3JSAA 4QEDA 3W4JA 2O3TA 2C0CA 3KZVA 1NPYA 1P31A 4IS3A 2VHXA 4D0SA 4KZPA 4BO0A 4NJOA 2Y1DA 5LDGA 4BV8A 2ZTUA 3VZRA 4I8XA 2EWMA 1BDMA 3DEYX 4OXKA 3AUUA 2BI7A 2ZCVA 1TT7A 3I9OA 2PK3A 4BO6A 2DFDA 1EQ2A 2O7SA 3ZDFA 1ZZEA 1O95A 3A28A 2VRBA 3GVPA 3RU7A 1Q7CA 3GMSA 1KVUA 4Q39A 1ISFA 1DC3A 1LLUA 2J5RA 2VHWA 3AFMA 5ENVA 1J4AA 1HL3A 2P9EA 5DOZA 4AJHA 1RM5A 2WM3A 5C5IA 1B2LA 3AY6A 3PDUA 1GV1A 1O8CA 2GNAA 3CE6A 4FC6A 1DHRA 1Q2XA 5G0VA 2HRBA 1W4ZA 5TJ9A 3LSYA 1DPGA 3JQ6A 1Y5MA 4FFOA 1FDVA 1K6IA 5BQFA 4D41A 4RORA 3IIEA 4DWVA 2PKQO 4FPXA 3ZCXA 3NEPX 3ZU3A 4IJKA 1LLCA 1UZNA 4L73A 1G6KA 1H6BA 3KUXA 4CMJA 3VH2A 2C20A 4UVEA 2BFMA 1NHWA 2WTBA 3C7CB 2H9IA 2NV6A 2H63A 4DYDA 4YXFA 5K9ZA 4EBFA 3KTDA 4CM8B 3A1NA 4UVGA 4XR9A 1V3VA 3WNQA 1XHLA 5G0WA 5JMWA 4P38A 4RDHA 1IUKA 1M2WA 4GSKA 1DO8A 1PQPA 1HDGO 4LVUA 4Y9DA 4CMIB 5T8KA 1RKXA 4QO8A 3F4LA 1HDXA 1PL8A 3F46A 1RM0A 2DTDA 2VUTA 5HS6A 3S55A 1X13A 3R0IA 4PLYA 4CM7A 3EVNA 3MJCA 4KUGA 3U9LA 3PIDA 1DFIA 2ZYGA 3OA2A 3H3FA 4MJLA 4LRTB 2X9GA 5JFOA 3NGXA 5DP2A 2AHRA 4J1NA 5K0ZA 1R66A 1F12A 2VWHA 1P1KA 4PZEA 4BMVA 3JQCA 4CV2A 1T1SA 1I32A 1LC0A 3JQDA 3VOSA 1GR0A 5TRTA 4BGEA 1X1EA 4BMNA 3DBHB 5A9SB 3OIGA 3GR6A 2Y68A 3ST7A 2D0IA 4Z0HO 2HLPA 4B3JA 3OBBA 4CM8A 3GDFA 4BGUA 4II2A 5B12A 1ONPA 1U28A 2Q50A 2X7HA 3A9WA 4LCJA 4E5YA 1T2EA 1VJ1A 3JQFC 3DMTA 3GZ4A 4J1TA 4WK6A 4AJJA 2B4QA 4EEXA 5CDGA 1U3WA 4CMIA 2HK7A 2Y1OA 4NH4A 2DUUA 3C3XA 1KEVA 4GVXA 2I9PA 3WIDA 1E92A 3AM5A 1P74A 4Q3BA 1DSSG 2NTJA 2CSUA 2YDXA 1GTMA 1LSOA 4RV9A 1U5AA 5JAZA 3VAZA 1EE2A 3M6IA 4XDYA 4YT4A 2ZYDA 1K5HA 5JYEA 4DIFA 5AXBA 2HQ1A 2YFHA 4LRSB 3W1VA 4E31A 4OH1A 4K26A 1UDCA 3UCFA 1MC5A 2V6BA 4WLFA 3ZNNA 2FR1A 2XOXA 4PCVA 3DR3A 1B3RA 1MP0A 3L77A 3RIHA 3U5TA 4XQEA 2VQ3A 5I9LA 3IQDB 5B4UA 1Y5RA 3JQBC 4XD2A 5A3JA 3JYLA 1KIFA 2ZB8A 5T57A 3DBHA 5A9SA 3HWRA 4HX5A 4OM8A 4FCCA 5AXAA 1NWHA 3UAGA 4CODB 1P1RA 5FYDA 1L1FA 4TRJA 4BQPA 3F3SA 4AJEA 2ZB4A 3GF4A 2C2XA 3W8EA 2RBEA 3AUAA 4DA9A 4CMEC 1I3LA 1MGOA 4I9UA 1FF9A 1U3TA 1QYCA 4M54A 4QO7A 1ZSNA 1X14A 2GDZA 2O4UX 1EBFA 3AM4A 1DIAA 1EUZA 1C3VA 4CV0A 5I7EA 4J4HA 3L4SO 5DCWA 3I9LA 4DC1A 1HDOA 2YHIB 3WGGA 1L7DA 3OICA 3H5NA 1ULUA 3GEGA 2BFAA 3ONFA 3FF4A 2GN9A 3QVSA 4I9HA 4NHEA 2B36A 3KV3O 5JCXA 3E1KA 4L4RA 2B35A 3NJ8A 3GFBA 4BO3A 2WMDA 4ND2A 2AQHA 3IUSA 3KSDO 3LT4A 5CDYA 1DRVA 2HMSA 1IZ9A 3WGOA 2DQ4A 3AOEA 1JKIA 1SC6A 1GCUA 2X9NA 4UEOA 1E1NA 4W9NA 5CEEA 2VYVA 4ZU3A 4II3A 4Y6RA 1E3JA 3LDHA 4ZQEA 5FI5A 4FDAA 1DRUA 1L7EA 4DRYA 5BSGA 1PIWA 1YE3A 2EHDA 2WSBA 4INAA 3EYWA 1I10A 4DC0A 2HMWA 4IDBA 2J8ZA 4IS2A 5DP1A 2CVOA 1YL5A 4PRKA 1LRJA 3AWDA 3ZWMA 1UXJA 3EY4A 2YQ5A 4G2NA 4CMAA 1GL3A 3V5NA 3LQFA 2YHIA 1SMKA 1CDOA 1ONNA 1X0VA 4J7XA 1F06A 5HWSA 2Y1FA 3ITDA 4C4OA 5I9MA 4YACA 3VPFA 4NBRA 5DULA 1FJHA 3W8DA 3MJ4A 4WOJA 3TZ6A 4RPLA 2NVWA 5KVQA 1G0OA 2CF5A 4I08A 3MJTA 3QA9A 4DMLA 3FTNA 1XA0A 4XB2A 5C7OO 1EFKA 2NM0A 3FHLA 3PWSA 2DM6A 1R12A 1EMDA 3GNTA 3OIFA 4CQMB 2FMUA 2WYUA 4FC7A 4U6QA 2W8ZA 3EMKA 3R1IA 1XR3A 1Z6ZA 4I5GA 4QX6A 4WLEA 2O48X 4D3FA 1PGQA 1GCOA 1M6WA 2YQ4A 2E4AA 3JD1A 2JAPA 3EAGA 4HUJA 3VPGA 2G5CA 4MKZA 4R9SA 1Z74A 3QVXA 1AN9A 3DAGA 2X1HA 4PLHA 1P3DA 3HADA 4RQUA 2C5AA 3QVOA 1XU9A 4CLRB 3WB9A 5ITWA 2ZJ0A 2Y93A 3JQ8B 4NK5A 1T2CA 3I3OA 4JNKA 3ROKA 4WEOA 4LCEA 1QXSA 2BLLA 2P5UA 1AGNA 1EVIA 3ANMA 4CLHA 2G17A 3NUGA 2PD6A 1PJCA 4IZIA 5JLAA 1LDMA 2IE0A 3VH4A 3OQBA 1WLYA 4AJOA 4DYVA 1QLJA 1JDJA 4RF4A 2QRKA 4EJMA 5COQA 3GAZA 4CQMA 4GLLA 2XAAA 3H9JA 5CAEA 1VPDA 3ORFA 1UH5A 1V9LA 1YO6A 1GEEA 3M2TA 4XIJA 5HA5A 1KVQA 4TZTA 1NR1A 1XGKA 5TGDA 1O0SA 5IAAA 3KLMX 3U0BA 1T26A 4UREA 1ZK2A 3RKUA 3CXRA 4CUKA 3LZ6A 3ZV5A 4CLRA 3PGJA 2TMGA 1O89A 2Y99A 3JQ8A 2CVZA 4J6FA 1I2ZA 4YA6A 1O94A 4RVGA 1GY8A 4HNGA 2JFHA 4CPDA 2B0JA 1W6UA 1E1LA 3T4XA 2QRJA 1PJ3A 1IYZA 2GF2A 4IJUA 3AM3A 3RBXA 4YJFB 5ILGA 3JV7A 2C7VA 1NASA 4P8RA 2PWZA 5IFLA 3TFQA 4WOKA 1WDKA 1HZZA 1ZXLA 3RROA 4TZKA 3JQ7B 4UUMA 1DHTA 3RUFA 3HFGA 1PX0A 1DIHA 3NRCA 4IXWA 4HBGA 1Z75A 2DBRA 2O7QA 4J7CA 3PJFA 2ZCUA 4E21A 1XIVA 3AUSA 3K92A 3ZWNA 1A4IA 1HE2A 2C29D 4D46A 1RYEA 1HDRA 4OQZA 4MVJI 3DZGA 5DCYA 5I8ZA 1C1XB 1EVYA 5TF4A 1T4DA 3S2GA 3M1AA 3P5SA 2H6EA 3VTFA 5IN5A 1XQ1A 3RI3A 3JQ9C 3EVTA 5L45A 3UW3A 3OM9A 4J16A 4FFNA 1ZEJA 5JDCA 2CDCA 1T1RA 3DC2A 3LLVA 1VKNA 5C37A 5LDHA 1JVBA 3RAJA 1H94A 1ML3A 2X5OA 2VRCA 3QHAA 2JFFA 4B7CA 5K6AC 3BMCB 1K0UA 3INTA 1OAAA 4YJFA 2RAFA 1XLTA 5LC1A 5JC8A 3UUWA 1H2BA 5L4NA 5G0SA 2Z1MA 3VTZA 2ZQZA 3PGXA 3FSRA 1GUZA 1MB4A 3DMYA 3NGLA 4OOEA 3ABIA 3JQ7A 5FI3A 3K31A 1YXMA 3H5AA 1LBEA 3ZHYA 2O3RA 1P1HA 1YJ8A 3KYDB 4WE3A 4ALNA 4GGOA 1UR5A 4ZN6A 5KOIA 1ZIDA 4FIZA 3SLGA 2BMAA 3RUCA 1C0KA 1MG5A 3NDRA 4L75A 1C1XA 2DLDA 4HADA 3MOIA 3SLKA 3FN4A 3C1AA 4R51A 1B3BA 1W73A 1C1DB 2GCGA 3I9NA 5A5EA 2NQTA 5JSFA 2B5VA 2PZKA 5A9RA 1E6WA 4J9UE 4NBVA 3ONDA 4BIIA 3QSGA 3JQ9A 4MVJF 1PGNA 2YV2A 4JLWA 4MPDA 3U4DA 1R4MB 4ZICA 3BMCA 4IDEA 1JAYA 3B70A 3NDIA 4DGSA 4HFMA 4EJ0A 2RCYA 5EQFA 3D7LA 1BGVA 1KVRA 2EW2A 4W82A 3O26A 2CDAA 3DO5A 1N2SA 3OEYA 2Q1TA 1PZEA 3GMDA 5A05A 3VKVA 3C8MA 5JNLA 2XXJA 3OFSA 2Q99A 4XYMA 4Z3KA 5K6AA 3R3SA 4JIGA 4UEJA 5ITVA 3ZZNA 5AQ1A 4Y6SA 1XSEA 4YT2A 3ZU5A 1TI7A 3KYDA 3L4BC 4HFRA 4HXYA 4QQRA 1A4UA 2NSDA 5U1PA 5IDQA 5L3ZA 4M1QA 4IM7A 2X5KO 1I2BA 4B3IA 3GEDA 3B1KA 3PEFA 1R16A 4ZGWA 2O3QA 5BR7A 3RFXA 1VL8A 3LC2O 2D59A 3RJ5A 1SZJG 3Q9UA 4NDNE 4ZVVA 4RCVA 1UP4A 1C1DA 3ZNOA 2BFPA 3ROMA 1HE4A 4XGIA 1WNTA 3LLSA 1MFPA 3IC5A 4IBOA 4I1IA 3PHGA 2YHUA 3H4VA 1M66A 3JQGB 3BA1A 3AI3A 3ICCA 5F1OA 3WQRA 3F4BA 4FBGA 4IJVA 1R4MA 3VPXA 4A27A 1E7YA 4NJMB 4AJKA 4J3FA 5I7FA 1I3MA 2GRAA 5ICMA 4E3ZA 2FOIA 4NU6A 4KP7A 4QFDA 8ADHA 5CDUA 3W4IA 2IDZA 2PZLA 5L7YA 2NUAA 2PLAA 3D4PA 4HP8A 2PA3A 1U7TA 3GA0A 4FGSA 1LDYA 1YL6A 5FFFA 2E37A 1UXIA 4UVIA 1HXHA 3W4KA 3D1LA 2DC1A 1HE5A 4OKIA 4YWJA 3CZMA 4O63O 3C24A 4GSLA 4YYZA 4MIYA 4YAEA 4DL9A 4C7KA 1MC4A 4J1QA 4EITA 1H2HA 1YOVB 3IL2A 1NNUA 1LQUA 1EUDA 3ZWWA 2ZJ1A 4K28A 1B0AA 3ZU4A 3DWFA 3ADOA 1FMCA 2DPGA 3E82A 4E5KA 2J3KA 1Y7TA 3FTPA 3JTMA 2V6MA 2J5KA 3DB2A 4R68A 4FN4A 1DC5A 3GGPA 3PZRA 4P4GA 1LX6A 1X7GA 3NJ4A 3OJFA 4IUYA 4Q3NA 4KQXA 3TPCA 3JQGA 2ZB3A 2JHFA 4N5MA 1YRLA 2WD8A 3ZWYA 3EZYA 3NDJA 3BIOA 4JBGA 4MP3A 4NJMA 5COBA 4R1UA 3D5QA 1XU7A 2QZZA 5THKA 1Q1NA 4BV9A 1Y9AA 4PLFA 2DUWA 2Y1CA 3IKTA 1ISHA 1PS0A 3NTRA 4Y6PA 4RF5A 3OJOA 1NQ5A 5DOVA 1NFFA 5EQDA 4B79A 4BNJA 4XIYA 2X6TA 5B37A 3AU9A 3DZKA 3DQPA 2AQKA 3H9QA 5H82A 3D3WB 4X54A 1DBVO 3ZV4A 4B4OA 3DZJA 3TN7A 3PPIA 1ORRA 3IAHA 5GMOA 4XR4A 1RPNA 4J9VA 2BI8A 1BHSA 1YOVA 3CTMA 2P91A 1LXCA 3FPCA 1PTJA 2BGKA 5KVSA 3KEQA 1YBVA 3I83A 4YR9A 4KQWA 3X2FA 5KWEA 1HKUA 4TRRA 4MVJH 2IXAA 5JDIA 1MV8A 3ULKA 1G0NA 1VL6A 2AE2A 3B6ZA 1YBAA 4E33A 1DJNA 3O38A 4A7PA 3IKVA 2D3TA 2P9GA 1AXGA 3L9WA 1ENPA 2EG9A 1OI7A 1UDAA 2DAPA 4R4JA 4DLLA 2VNSA 3BHJA 1N5DA 4H16A 1H93A 4PG5A 5GY7A 1NAHA 4XCVA 4JJFA 3PQFA 2Y0CA 5T67A 3WDSA 3ZW9A 1P9LA 1XWFA 1YB5A 2PGDA 3ZHZA 3SVTA 2B4RO 4RPGA 1E3WB 1ENZA 3GG9A 3B20A 3D3WA 1YQGA 3NT2A 2P4HX 2HUNA 4AG3A 2E82A 5I8WA 1I0ZA 1PWXA 3PP8A 4B8ZA 3D0OA 4D0RA 4XDZA 2VWGA 1D4FA 1LLQA 1U2DA 2JD1A 2O4CA 1Z7EA 4J2HA 1PGJA 1P45A 4R3WA 1V0JA 2CY0A 4XRGA 2C82A 5I9NA 5T8KC 5KVCA 2D5AA 1IPFA 2HDHA 3NTQA 4FD3A 4CLOB 2W2KB 3JQEA 1EBUA 1EK5A 3LC7O 1UP6A 3NT4A 3H5RA 4IQ8A 3TSCA 3RCBA 4EEZA 3A4VA 4DQUA 3U62A 3CUKA 4PGFA 2OGUA 2CZCA 9LDBA 4D45A 1E3EA 4YQZA 4FJ2A 4U0JA 4XX0A 4JJIA 2HCTA 4IIUA 4BNUA 3OA0A 3RFTA 4BQRA 2QZ9A 4GL4A 4O1MA 3WSVA 3ZNQA 1CERA 1R6DA 4OJNA 1Z82A 1BXGB 1KVTA 3E6AA 4UUNA 5JY1A 2UVDA 1E3WA 1X15A 3A06A 3EZLA 1N92A 2P2SA 2WWRA 4ZQBA 3UN1A 2IODA 3U09A 5KVVA 4GH5A 2X4GA 1UDBA 5DZSA 4DUPA
chains in the Genus database with same CATH superfamily
2H2AA 4EF4A 3JPWA 3Q2IA 5KQRA 1QZ3A 4HFJA 5J58A 2G76A 3LNTA 3CA8A 1TAUA 4QM7A 1H6CA 3SSOA 2GM9A 3B12A 3ANNA 4XAQA 1P44A 2GR9A 2Q07A 3LF1A 1LKZA 1ZH2A 3FPJA 3IVGA 1PZGA 2OFPA 3MGBA 5HRUA 2W2KA 4HI0E 4PX2A 3LUJA 3O4JA 4TTRA 1J5EB 4FHZA 4MWSA 2I4OA 2G08A 3IMKA 2BGLA 3QEMB 4G4GA 1Z38A 2Z30A 3KRTA 2Y9PB 1ADJA 2YN4A 3OPYB 4QUGA 3VZDA 2FWNA 4RH1A 5K8CA 5KDOA 4LPSA 2I3GA 3QPCA 4HXGA 2X9VA 3D0RA 1LUAA 3R7DA 1PW5A 3NYWA 5AOVA 5TQ0A 3E9RA 1XXHE 4IY1A 4A5SA 2JLYA 5K3FB 3MUEA 4HXEB 1UDXA 4Z3OA 1QUEA 1QHSA 1RFLA 2NTVA 1H6AA 1BXGA 1B4DA 4EJSA 2YV4A 4NFSA 2Q5JA 2EGUA 2MSLA 1DCTA 2WV7A 1Y3DE 2DFVA 3FH0A 4CDMA 4D2IA 3I0NA 1J2YA 1WUIS 2DHDA 2Q46A 2FKAA 2Y3IA 3GT0A 3WL8A 4CMHA 2NWQA 4TLEA 3COVA 1T0HB 5EIBC 4CGZA 2J0SA 3FE2A 1WUYA 2ZYHA 5KYNA 2VOJA 1TTPB 3FUTA 4B2YA 3C3WA 1A9RA 3QMPA 2VZ0A 4PLWA 1M1ZA 3D7SA 4XWGA 4NCAA 2EYUA 4O6VA 1PWEA 1HFJA 3ZLJA 1KDZA 2BUAA 1GZSA 4Y2RA 2HXSA 3Q5DA 3D8SA 3PEYA 2Q28A 3TW8B 4BC0A 2R00A 4I6JA 3Q9NA 1GARA 3GAMA 4Z4CA 1J8VA 1JA1A 4QUDA 1VJRA 4LFAB 3QEMA 4Q24A 4DUYB 2QE7D 3V4PB 2FFJA 2G36A 3OPYA 5EUBA 3OKFA 4M83A 4J0DA 2D5CA 1E3SA 2ZRGA 4ZO6A 1TW2A 4H3HB 3RHSA 2ZRFA 1KE2A 3IEPA 3TNYA 3TX2A 1YUMA 3LGXA 3USCS 2O8FB 1KNQA 3GK3A 4WSOA 2DLNA 3TIIA 3V8VA 4G1FA 3CLSC 2QRQA 3FNHA 3GZNB 5HIMA 1SVMA 3U61B 4PC6A 5K3FA 1SA0B 3RVMA 1NF2A 1ZOOA 5B7GA 3FWNA 2WZDA 5ALOA 3SXPA 5D2CA 3V97A 1T6BY 4Q18A 4YP6A 1PYOA 5A5GA 3SEAA 2BPOA 3E9NA 3AIMA 1RAEA 3JQPA 1M34E 2BR5A 2VT3A 3LVQE 4MB6A 1FDSA 4RWZA 5GQSA 4CDNA 1UC8A 3VSCA 3P26A 3IEVA 2E89A 1CY0A 2ONKA 1P0FA 2P6PA 4GR4A 4BX9A 5ILOA 4NXNB 2ZB7A 1OWNA 1WKBA 3GD7A 3AEQB 1K8XB 2VHTA 1O77A 5LWHA 5MDHA 4J3JA 5AVTA 3FUVA 5LBIA 1RRVA 4MKXA 1S5PA 1JAIA 3PA8A 4CGYA 3TW8A 4G5GA 3RWMB 1NUPA 1QDEA 3VDQA 4DPLA 3IP3A 3MWYW 3AP2A 3WL7A 5A1JA 1TJPB 1J21A 4UTXA 1QTRA 5F73A 2OENG 4RLHA 1NR7A 3UPUA 2L69A 1FUYB 3FOCA 4FLFA 5AM4A 2CNBA 1QYWA 3OOSA 3CVXA 1NIJA 5FWNA 2GBGA 4J0KA 1SUWA 4RSHA 2DBVO 4C01A 1Z29A 5CW2A 3UVEA 3I9FA 1I4TD 2VDLB 2WU1A 4LX8A 1ZQ1A 4K9OA 5NULA 3D2BA 2O8FA 1B8UA 3W5SA 1U0FA 1YQUA 3WI7A 1PO7A 1S7CA 1VMIA 2VUUA 1K6JA 2QY9A 1E5QA 1ZSYA 3GZNA 1I7DA 2IS6A 4R54A 1JIJA 1F2UB 5BYJA 1SA0A 2JGDB 4BNIA 3IDZA 3CV3A 2OWEA 3SOZA 3RD5A 4UQLA 1LF0A 2C3UA 1R5JA 2HAEA 3Q3EA 3SJAA 4BNKA 1F8FA 2B5WA 2OQRA 4GVPA 5EHNA 4RANA 3EC2A 4OQYA 4DCMA 3TECE 4M8NE 4GKJB 2QROA 2OFOA 4ITUA 1HGXA 2CVFA 4KIWA 4NE2A 1A9ZA 3ICOA 5FADA 3QLEA 3AEQA 5CDSA 3FHJA 4YS6A 3DBLB 2IW1A 1EVZA 1KYVA 2DSNA 3DHVA 4E46A 4K3UA 4NEQA 4YJ2F 2GBCA 2O0HA 1R18A 2XEXA 3G2QA 3GLVA 4WHMA 4YMIA 5EOVA 1D1PA 4C7MA 1G4AE 1YZTA 1KXZA 4BO5A 5FPTA 3PUKA 1TJNA 1PJ8A 4PQEA 4JGBA 2XNCA 3SHWA 1TMYA 2EFEB 3D0QA 1U0GA 5KEIA 5MN4A 1DIBA 4LBWA 5IG2A 3YASA 2XA1A 4NLLA 1MJNA 2A30A 2OD2A 2ODPA 5DNYB 4UAGA 1IATA 1E1RD 5IJZA 2X86A 3MMZA 1X7XB 1WZ2A 3TAUA 3OQ1A 3TLMA 4IV8A 3PG5A 2VEDA 1F2UA 4RFVA 1BFDA 2JGDA 2R4TA 5TGZA 4HWGA 2BH2A 3QWHA 3W5CA 4MVJA 1XZMA 3U4AA 1R0YA 1W48A 4MJ7A 3BWBA 3EPPA 3H2SA 3IULA 3LQ2A 4JOSA 4C78A 4IHKA 3EISA 3SDSA 3FNGA 2GPTA 1HE8B 2RGWA 1G16A 3DZBA 1ECCA 4B40A 6ABPA 4P4SB 4PHFA 3GLGA 2JJ1A 4RPHA 5M5BA 4K6CA 2WIGA 3MTAA 2VDQB 3DBLA 2DCUA 3ORQA 1VSUA 3OLYA 3S8YA 1XKXA 3ED1A 3EDOA 5AUQA 1C0PA 1RWOA 3D8NA 1V8ZA 5LYYA 3ZBTA 1UODA 1G6Q1 5JJLA 1IJFA 2FG5A 4JJGA 4KOAA 4QJ5A 4V0NA 4DYHA 1VCNA 4Z49A 4F4CA 2VYVD 1SUCA 1RCTE 2Y1GA 1Q0UA 2ZWPA 3FYUB 2RI0A 1JFVA 2O6HA 1QHXA 3MWLA 4BYGA 1OXKB 1O94C 4DG8A 3P71T 5K45A 1IBLB 1NFRA 3O8NA 5K8UA 4R7ZA 5FIUA 1F0YA 3C41J 1WY7A 4Y1EA 1X7XA 3KEOA 4KX5A 2Q7DA 2AFIE 2ZUEA 1CHNA 3QOYA 2QJRA 1A2KC 1ZYUA 1GSOA 2P3OA 1JE0A 3CUUA 1SWWA 3L4KA 2DPMA 3MYYA 3VI4B 5A7FA 1W47A 2IHBA 1JDSA 1LNQA 2HA0A 1VYHA 4PSUA 4CG1A 4AJ2A 4CMGA 1E2BA 1BZYA 3V1TC 3OIUA 4GZLA 2IHKA 3CKKA 4H2DA 2IY8A 3FHCB 5DGXA 2OBYA 3ICEA 1W8DA 1VZ3A 1II8B 1U2ZA 2P6UA 1E2UA 1W1IA 3AX6A 4FOTA 4UU1A 4ARVA 4S1VA 2P68A 5DX8A 1BMFD 3GYBA 3TZQA 1FQOA 1OV4A 4GMGA 2AKYA 2C5SA 2G3YA 2ZBUA 4P4SA 4P4TA 4LFCB 3T06B 4YUYA 5HM8A 5K8IA 2IKSA 5ISMA 4WLOA 4UTNA 2PPLA 1JFTA 2NYRA 4G0MA 5IXYA 2LDXA 3P2JA 2ZCJA 1XK7A 1YQTA 2QUHA 1YQ9A 4HGQA 2OYRA 5CT4A 5SZJA 4UZEA 3PNPA 4QUBA 2D7CA 1NPDA 3FYUA 5J3JA 2HWXA 3KTOA 5TV2A 3PL5A 3BYZA 2BFEB 3OX4A 4XM0A 5JDCC 1QP7A 2R66A 3IKLA 4TV8F 3S7TA 2YFYA 3K3PA 2WWHA 4YJGB 3QFTA 1XA4A 2X5JO 4BCDA 4D9FA 2DGDA 2B1RA 2JHGA 3K05A 2VWQA 2FEMA 1KYIA 1E9SA 4ZFNA 4BCBA 4ARIA 1NT4A 4GP7A 4PBTA 3MIZA 4UVHA 4XQCA 3K9FC 1YQWA 4RQAA 1PYDA 2X0DA 1Q2UA 3L43A 3LBNA 3PC2A 2O54A 2AG0A 5EGNA 4DNPA 4ZAYA 1XLTC 3EIQA 3GFOA 3CONA 1ZH0A 3CNHA 3W6PA 1VGRA 3TNFA 3NKFA 1PK7A 3WOHA 1CS0B 1UINA 2V7GA 3EIEA 4GAEA 3GVCA 3CPEA 1KQPA 2P6OA 4IH9A 4L9WA 4LHSA 1II8A 4DDUA 5BW6B 1YBHA 4CMCA 5CVVA 1JDTA 5CJJA 1U0TA 4LG1A 1ZI8A 5KVAA 3U13A 4UM7A 3TTTA 3ZWBA 3BIJA 3SQWA 4J94A 2JEYA 4DIKA 1KOGA 4P3PA 1UKYA 2ZRJA 3PJDA 5DHTA 1U0NA 2KX7A 5DBGA 1DC4A 1GEGA 1RI3A 1V3UA 2J85A 2GO1A 2M98A 4MV1A 5BWLA 3A4LA 3UA3A 2PSSA 4LJYA 3OF2A 3TLZA 4BAZA 3DDZX 2IQ5A 1H0SA 4CQLB 1KJZA 1O5TA 2BFEA 4NYJR 4TYPA 5IJ0B 4YJGA 4F45A 1U1EA 2HF9A 4NF2A 5GZ6A 4IEIA 4PHHA 4J2OA 1M0SA 4IINA 2GASA 2CBGA 4GOXA 4LIPD 3H05A 2C7QA 4V2UA 4X63A 2GHRA 1DO2A 1T3GA 2QD4A 4RZSA 3V3TA 3ZCQA 2D13A 5ADHA 1KI3A 3K73O 3EDMA 4Y1RB 2MYPA 3W8FA 4OB6A 2Z2KA 4PWZA 3WMWA 1HK7A 3VKWA 2QTVB 3W5DA 2BUBA 1CS0A 4EW1A 3DJYA 3IQZA 1SIOA 1E9RA 1VIDA 3CZ4A 3KU4A 5I9BA 4ECAA 3J7TA 5ILQA 5DHSA 2V7QA 3PTZA 1LNSA 2NO7A 2JFQA 1OHHA 3PUIA 4JITA 3VJMA 2R7MA 4GC9A 3LP8A 4X8OA 3D5TA 3A9TA 1N33B 1OW3B 3CNLA 4GE3A 1PK9A 1XDWA 5JPDA 1MB2A 3FBTA 1QP8A 3IILA 1M75A 1M2KA 3L0OA 5DBEX 3D6JA 3NIGB 3HL4A 3TGWA 3TMKA 1NX9A 2I65A 4PNHA 5ALRA 3GCXA 3U4CA 5LSAA 1DEKA 2CUNA 3RSZA 1JLSA 2Q1WA 5CW1A 1W1WA 3PPWA 4CQLA 3CLHA 2XHZA 3B3QA 2WEKA 1Y8CA 2E7ZA 4F0JA 3VJKA 5EJ5A 1Z4IA 2O50A 5IJ0A 5AVOA 3DMFA 3ETGA 4G4SO 2PCLA 1Z13A 2VHVA 5JW6A 1FE8A 3DBRB 1U0EA 2M32A 3ABQB 4H1VA 5T7BA 1LEHA 1LBSA 1O9HA 1YTLA 3PWZA 4G8JA 3EF3A 4YWHA 3ISTA 3T1NA 3E7FA 1K9VF 4LZAA 3TH5A 2YJ6A 4C20A 5KWEA 1N3YA 4OAOA 4RY9A 4YO7A 2JIZD 4Y1RA 5CXSA 3CINA 2QZSA 1T1GA 1BFKA 1LTKA 4QSHA 2QTVA 4B4UA 4AU1A 4R9UC 4F2DA 1ZICA 2JJYA 4CTNA 3EVCA 1W2HA 1BKYA 4FOOA 5EIWA 3P9NA 2B2XA 2YRXA 4MIEA 2JLWA 3VPSA 1XEWX 2NSLA 4YT8A 4ZEVA 1PJ2A 4RKYA 2SKCA 3SR0A 3D2CA 2ZZNA 3JSXA 1NM5A 2FJUA 1YOBA 1RHMA 1L4BA 1Y1LA 2VTKA 4BDTA 7GPBA 5M7EA 2D5IA 3AKZA 3RTAA 4KFCA 1VE9A 3OTGA 1DAOA 2DH5A 3DH0A 3W7VA 4B6SA 1DGQA 4HSGA 4QOGA 3ZXIA 5MN5A 3R5KA 1V4BA 1AKUA 1TNDA 3Q3JB 2IU3A 5A9SA 4RVHA 1TIPA 2WUDA 4OAQA 1QHNA 1TB4A 3MCVA 1N2BA 3JYOA 4GYJA 4QJ4A 5JSKA 4CR8A 4HKTA 3D8RA 3FDIA 5JYCA 4I5EA 3TDNA 4NQRA 2VH5R 2AZXA 2OWDA 1RC1A 3OOJA 4IGKA 1W96A 3ZTYA 4IZHA 3T3NA 3DBRA 3EIHA 4KO4S 1Z35A 1DEXA 3ZTWA 1SOWA 1RVDA 3WV4A 4QNMA 2FZ5A 3KHTA 3JD3A 1PJQA 1WTAA 1U8FO 2FPLA 1ZN7A 1QTNA 4LXYA 2ZP1A 1E7QA 3VR4H 5DNAA 2GF9A 2XGMA 1P1CA 3CISA 4PAMA 2BF7A 3VR2A 3CRVA 1V8PA 1TQ6A 3FDXA 2HRZA 1AHIA 4FOLA 4HO1X 3UO8B 3G5TA 3AKCA 4I1SA 1UAGA 1OTXA 1OFGA 4PNEA 3OKPA 1R6TA 1BXZA 3LO8A 4N12A 1B0ZA 2LTAA 3SC6A 4DCGA 2X0IA 1M1NB 2EX4A 1P0MA 2GBIA 4N6NA 5E7MA 3TYXA 4MQFB 1WXXA 1J8YF 1R0CA 1SH7A 2XYGA 5AM2A 4AVYA 4NNJA 1OI2A 1SOVA 1LVGA 2QLLA 5ALYA 2D4AA 3ZGVA 2ZWMA 3KC2A 2H1LA 2GDJA 3LPNA 3RSCA 3R09A 3B8EA 1LWNA 4K9RA 5HG0A 1PTJC 4FWBA 3QY9A 5AK3A 3RJZA 4A8JB 3MFYA 2O2SA 4JX8A 4ZCMA 1AMUA 5F1KA 1J2JA 1R0SA 5BWNA 4N03A 1PSDA 1IZ7A 3B13B 1HUQA 2YN2A 2X0NA 1XZPA 1LB1B 1CRQA 1R8SA 1ECBA 1E3IA 3H5TA 3LGAA 4LSMA 4PE5B 4A6EA 1O0BA 3DVAB 3SQXA 1C0IA 2DERA 1P7CA 4NZPA 4PSKA 4OH7A 3F6RA 2GYYA 2I62A 3B2NA 1KZ9A 5DW0A 4QDZA 3IDQA 3EDRA 1MX1A 1THZA 2FPIB 2YFQA 2UV8A 3JYPA 3KDAA 3UXHA 5JXJA 4C88A 4FN5A 1N1GA 3V7FA 4DANA 4DIDA 3JZDA 1GA1A 4FNAA 5SY6A 2GHTA 3C6KA 4OBXA 3KZMA 3ZI0A 4RK5A 5IBRA 5LLDA 4DPKA 3ZE1B 3SM3A 3UKDA 1M1NA 2CMHA 3NU1A 3CH6A 4RNDB 4MQFA 1GUFA 2RHMA 3FGPA 3EXHB 4E2ZA 2NZ2A 1LVUA 1WW3A 1YL7A 3RS8A 1I4LD 2R6DA 4R2HA 4DJEC 3G49A 1WKVA 4FCVA 3HXPA 5F52A 3G82C 4A8JA 3HRIA 5AM5A 2P79A 1YIDA 4AF6A 4AFNA 5BNTA 3BCHA 3TUJC 2PQ0A 5JSUA 3DT6A 2E4YA 2LBPA 3KWJA 2FDXA 4YJ2B 3RUAA 4ZZIA 5CVTA 3DVAA 1V35A 4EHKA 2C1EA 1JHXA 4PTZA 1UAAA 1G21B 3U49A 4E5DA 2PXCA 1WZCA 1G20B 4DIBA 4EGSA 3VH3A 3N0XA 4CG3A 1NW3A 2ZUTA 2FPIA 3RU3A 4LDQA 4CV1A 5AFSA 2OG2A 1CUVA 1M0WA 3DE3X 3DE7X 3LUPA 4ND4A 1QRSA 3IQFA 2TECE 3RU9A 3CPSA 3LLMA 1AGRA 3NBUA 3PUYA 4X95A 3U3XA 2AJLI 1W0CA 2YN0A 3O3NB 1XQYA 1UDRA 4B5LA 2PA0A 4HS9A 1E2FA 1V6SA 1TFRA 4DCCA 4PIVA 3GHHA 5ITZB 3LRPA 2C3MA 2J3IA 3MSXA 2Z2XA 4JFAA 4JFRA 4RVFA 3P9ZA 3U9SA 4BO8A 1NVGA 5B3LA 1FCJA 1IBRA 2JRCA 1XP5A 2YNMD 2QN1A 3EXHA 1A7AA 1XBTA 1MO4A 4FFBB 4G0NA 3O21A 2IYLD 4HAUA 4KN9S 4M1EA 4ZV7A 1BSVA 3KJFA 3DCNA 3PHJA 3TZHA 3NHRA 3ZDCA 3PVCA 2Q5EA 1UWKA 3AV3A 1HE1C 2MMCA 1FK8A 1IC6A 2GGSA 2JFBA 3CW9A 3H8VA 3F47A 1GYQA 2CLOB 4Z8YA 3PQCA 5DV9A 5JG7A 2M6RA 2A5YB 3PXUA 4DLVA 3Q2KA 2ZK7A 1XDSA 4RPJA 2DT5A 4LOLA 2EG5A 1XHEA 2PUJA 1ECGA 2QNIA 3GJ4A 3N7TA 5IUKC 4YJ2A 2GILA 2H5EA 1R37A 3ACDA 3K9BA 3IR5A 2XEDA 5IWAB 2YYZA 3HP7A 3PE6A 1G21A 2A9VA 2VLIA 2XMCA 4P83A 1C9MA 3RVPA 3SHOA 2O5EA 1G20A 3CVWA 2HLDA 2RIPA 4EI2A 2IYXA 3RVRA 3WWZA 4F7DA 1TDJA 3K20A 4ASUD 3PRYA 4B34A 5LNK6 1L9KA 1N5IA 1PGOA 2DECA 1OE0A 4NX2A 4LKOA 1N2OA 1Z63A 1IQRA 1EUYA 4H7PA 4C0WA 1JMKC 2ZUSA 2B1JA 1F7VA 2BL4A 3U5ZB 3LYLA 1UBUS 4EJSC 3NAZA 3O94A 4EX6A 3LT1A 1H8EA 4E4YA 4NU0A 3CYFA 3M6XA 1JAHA 4GPIB 4R7GA 3WLSA 5ITZA 4OMDA 1DBQA 1TCBA 4BWYA 4DR5B 2H1HA 3WNZA 2VO1A 2JCYA 2QTFA 1NFQA 4FFBA 5FWYB 1AVTA 1IY2A 2DBQA 3V4RA 1BMDA 4ML3A 4HB2A 4GHWA 2A94A 4GMXA 3SYLA 3G0DA 2M6SA 3E35A 2DT8A 3W79A 1XRMA 1JQ3A 3WQQA 3P9RA 1SQFA 1RXEA 2W0SA 1B7GO 3C43A 1H69A 4FFRA 4YVFA 1WEKA 1S3GA 2GNOA 2R8EA 5ALQA 2R00C 2REOA 2I80A 3GDOA 2Z1NA 5EWLB 3RM3A 2POCA 4BQEA 1SK9A 1X70A 3OUUA 3UWSA 3UT0A 3ITKA 1GPWB 1YVPA 1MKYA 1VKHA 3VR6D 2GEBA 1JW9B 1XX6A 4G5QA 3DOEA 4K8RB 5ECGC 2BAGA 2P35A 4DGSA 4LE2A 4PTLA 4S1PA 4TV8B 3G8DA 5DYGA 1ZEMA 3F6YA 2W42A 4MRMB 3OWXA 3PDHA 5DASA 2WYVA 2ZS8A 2VSFA 3OFJA 1ABFA 5BW4A 2GTPA 4J0FA 4XWAA 2Z2ZA 3LI2A 3ZCVA 5L95A 1LW6E 4FMPA 1OAKA 1PD1A 3IIIA 1LTHR 3G7NA 3M4ZA 2F3QA 2J9GA 1T2UA 4LI3X 2VF7A 1UK7A 1Z4OA 1GQQA 2AN4A 1OZHA 1JIIA 1FYFA 1TU0A 1CZHA 3DAYA 4PV7A 4M8IA 4UU8A 7REQB 5FWYA 1UC5B 1XLWA 2BHLA 2V58A 4FJ1A 3CX4A 2BMVA 4A2QA 3DD5A 3TJRA 1QHFA 2VDMB 3EOAI 4M4SA 4DIOA 1GM5A 1FSPA 4CHGA 3DP7A 3QF4B 1PTKA 3UMJA 4Q02A 4BKMA 2O2GA 3BK2A 3C8DA 3PXGA 1U2GA 4CL3A 1JB1A 3NAMA 4WXHA 3R7NA 2O7RA 3E0QA 3UAZA 1Z0IA 3KB6A 5EWLA 3RT1A 4DSAA 3LTEA 2PFKA 3MGCA 4KDCA 4KXYA 4MLPA 1G8FA 4MTLA 3TNJA 3EXAA 3WWYA 1UKCA 5JBIA 4MDFA 2P2LA 2C95A 4OSEA 4U7WA 1IAQA 5DFAA 2ZI9A 3F9RA 3HXOA 4YXWD 1NW9B 2VJQA 1IOWA 4DLUA 2AK3A 4DARA 1AKMA 2OO7A 4XWOA 4XJSA 3UMBA 2B7BA 4TV8A 2HHJA 3OOHA 4EBBA 5KHOC 1W88B 3W8NA 1IN1A 2LV8A 4MRMA 5EVJA 4EO4A 1FLVA 3ZJVA 4WECA 4AT1A 1BXRB 1V4VA 1JALA 5IT0A 4ZP1A 1EVKA 1PJRA 1XCBA 1G17A 2X4IA 3E9DA 3JWIA 3KALA 3QVMA 2WWYA 5LOVB 1ICEA 5IT5A 3IUJA 4RHTA 1VL2A 4PBRA 3ONEA 4AJNA 3VKUA 4DA6A 2ZYAA 5I7SA 2OCKA 3AONB 3JVVA 5DZSA 7REQA 1DQYA 3KLNA 1KGDA 4JXZA 2PJDA 1E7MA 1U9YA 1N5LA 3CY6A 4BS9A 5A3SA 1EIZA 4WBXC 4JQYA 6GPBA 1WABA 2P4QA 3I4LA 4CL0A 1L7VC 1LU9A 1QE0A 1Z0DA 3MCTA 4U7DA 4GIBA 3QF4A 1IM8A 1W5TA 1B76A 1OI3A 1WZEA 4JK3A 1WWKA 1JSLA 2MYTA 1SVLA 2FEXA 3OQIB 1KC1A 2FEOA 2L2QA 3EQ7A 2W6IA 4XTRA 5DTEA 4W7HA 4BKRA 1P5JA 2JAOA 3L8MA 4Z9YA 4DV1B 1W5SA 2EFHB 1PVOA 3B1FA 4UCWA 3TW0A 4I5FA 4IEEA 2ECQA 4D57A 4PNZA 1I94B 1ZK3A 1DXHA 1VYTA 3MRSA 3NIWA 4ZHQF 3JTEA 4AZ3B 2W71A 2YWXA 3KUUA 2PX4A 2PV0A 1WPQA 3LF2A 1RZVA 2PAFA 4N0MA 5EHZA 5K5EA 1W88A 4MR7B 5BYBA 2QMOA 4EW3A 5A0VA 3BFXA 2JGJA 4IGAA 4Q3LA 3B5EA 4OFZA 1BXRA 3V8QA 1YFJA 3V00A 1Z4KA 3CXUA 1J42A 1JJIA 1GL6A 1E0KA 1VBFA 4L85A 3VR3D 3WOVA 2AEMA 5LOVA 3ACCA 1RQNA 1BHO1 2ACVA 3IEIA 5FBLB 5H59A 4MYTA 4C06A 4BIMA 1ORVA 4PGMA 5I9IA 1R64A 2XI4A 2YJ4A 1ZNYA 3BSWA 1BH6A 2WQ7A 2PJUA 4X20B 3VU1A 1RZRD 3S2FA 3DWGA 5LFAA 4UTZA 2ZYVX 3OCUA 2OLJA 1ZH6A 2R7LA 4TM7A 3CUWA 1EGMB 2Q6IA 2PD3A 2VK2A 4C0LA 2RAVA 4LMPA 3AVOA 3EYAA 3IUPA 3N7AA 1CTQA 1DAHA 1EDDA 1Z6GA 3I01A 3OQIA 5AH0A 5GONF 4MYSA 3U7JA 1NXVA 4S3MA 4HUTA 1LK5A 3F7OA 3SIPA 4BMZA 5CXQA 1DKRA 4PWYA 4PYOA 2IDMA 2IVZA 2B8JA 4Y2YA 1C7JA 5IXJA 3BD7A 1PWZA 3E8MA 3JQFA 3KHSA 3QLUA 4AMGA 3ZYZA 4CWAA 2X0KA 4DZZA 4FQ5A 3SR4A 2CB9A 3H9EO 1K66A 1SUIA 3OEWA 3DB1A 1G3QA 2NQ8A 1Z8DA 4NK4A 3RVJA 2MHCA 4AZ3A 1CB0A 5K01A 5CTJA 5GOZA 1W0KD 5FLEX 1YBMA 2ZBRA 3JYHA 3X1ZA 4D4IA 3W1WA 3TOCA 4MR7A 2FLWA 4RXMA 2V5VA 4X7MA 4BB5A 1T0JB 3HK2A 1HT1E 1BQ3A 3IAUA 1SVSA 2P40A 4TKLA 4YC7A 3D4IA 4I4LA 5CG1A 4ZVMA 4MUBA 1GTG1 4XGQA 2K5UA 1GYRA 1C5KA 1P77A 1XQ6A 5LUBA 3CVYA 1G2PA 3NVAA 3SKYA 1AS3A 4DW8A 3PXAA 1JXQA 1X42A 3MCUA 3P2OA 2JLUA 1KETA 1YJBA 3FYCA 4XUDA 1P19A 3OIWA 1PG2A 3U4HA 2ZSAA 3CNBA 3KSBC 4M49A 4X20A 3JQBA 4Y8VA 3FZEA 3G1UA 2QI9F 5HOEA 2QX8A 4CCSA 3C98A 3SI7A 5IKPA 2DYKA 5KTTA 4MHTA 3FD8A 4XJTA 5F9MA 1K5DA 2E49A 2PR2A 1XTRA 5JAMA 3U60B 3EFEA 4N4AA 4D0NA 1Q50A 5DMHA 1OFUA 4BU1A 3RF6A 5EN4A 4F97A 2W2MA 4DCVA 3FYUC 1IVYA 1LGYA 2GA9A 3LKZA 2NV2B 1IB6A 4FILA 1ZNZA 4I3GA 3JVIA 1F20A 1GUYA 2WJPA 4CMEA 3SLRA 2JCGA 4FR5A 1B15A 1I33A 1QRRA 1YCDA 2J07A 3I8SA 3MQ4A 4XDGA 5LKRA 2QPAA 1JR6A 3PYLA 2SBTA 2GAIA 4GPD1 2O3UA 5KJ1A 2VHJA 4NR0A 2WWIA 1RZUA 4XFJA 3REOA 1ZUIA 4IYJA 4MPRA 3UYLA 3W0LB 4Q1AA 1LDBA 1WZUA 2AJ8A 1ESMA 4KLAA 1GSIA 4GR9A 2ZRNA 2WUGA 4M89A 4RF2A 5D5PA 3KYJB 3OIDA 3UT6A 3TTSA 1V7QA 2D2IA 4C07A 3E9YA 1AJEA 4M9UA 4NENB 2WKPA 3QE4A 2B8EA 2IU0A 1ZPDA 2FN8A 4QBFA 2FI1A 2I2DA 2WRZA 4K2AA 2D1YA 3NH6A 3U39A 4P7JA 3D6UA 4GRIA 3A9UA 3CGWA 3HBJA 2BBTA 1IBCA 1ZBQA 1SPXA 1Y4DE 3QFRA 2G07A 4GKVA 4OHVA 3B6KA 1D2MA 4P32A 5LDDC 5FHQA 3TLAA 1F6BA 3CUTA 2B8NA 5BYKA 2BGUA 5HEKA 3HJHA 2QP3A 4WXRA 4V39A 1BEEA 3NASA 5IX8A 1TVEA 1WVMA 3EHEA 2V3CC 1TA4A 1YC5A 2O1EA 5EXXA 4DJJA 3RYCB 4NFYA 2BOVA 2OTCA 4QDJA 2Y66A 3UG6A 2W6NA 1EWKA 3PNQA 5L7WA 2FPOA 3ZOZA 2WWVD 2DUJA 4KUHA 1UMBB 4W9RA 2A1TR 3CM0A 4J29A 3E27A 1AS2A 4RZQA 2JCVA 3Q6IA 3RKSA 1SEVA 4JI8B 1B43A 1ESZA 3GLSA 3L0SA 4GX2A 1J1UA 1CZLA 3Q9SA 3Q8XB 5KOHB 4C04A 4JT9A 3TZBA 5KZMB 2VPWA 1WDLA 4X93A 1K2VN 3ZDZB 3ON5A 1Q0ZA 4GWKA 5D5HA 2V7UA 2E85A 4UM5A 4WASA 3PC4A 4NENA 5CT9A 3TLKA 4YP5A 2I4NA 2OHIA 5H83A 5HP4A 1ZX1A 3L0DA 4TTSA 2FSFA 1VE3A 5HBRA 1FDTA 4XKJA 2WUWE 1ZMOA 4IRUB 4F2WA 3BL6A 3L7JA 2Y1WA 4LC1A 4MW1A 3IPXA 3WB1A 1JEOA 1ZP6A 1U7PA 4WXMA 3L4EA 3WYAA 4KNVA 3X1KA 2XSZD 3E9EA 3F6EX 1MJGM 2OCGA 5DTIA 5AVVA 4UTVA 5NLLA 3BXGA 4B71A 5HMMA 3VO8A 2ZBGA 4IDFA 1EFUA 3W9BA 5J4YA 3IE2A 3QMWA 2RGAA 1NN5A 2ZWIA 3AIOA 1JJ7A 3O2NA 4H1UA 5LZ7A 2AG8A 1DZ3A 4BVHA 2JLVA 3CRW1 4H6VA 2LCQA 3R9WA 5GJBA 3I5YA 1CUFA 1ZOPA 3ITNA 1KO1A 2YY6A 2PSEA 1WMDA 2NUPB 5I4KA 2BDUA 4MAAA 4NBWA 3PNYA 1UMBA 4UNNA 4RESA 3UWOA 3OD1A 3BGSA 4F3RA 1R0BA 3IEMA 2BGWA 2WF5A 2P9YA 3TGLA 4UQPA 2XF8A 2XQIA 3FBWA 5K3EA 3HUEA 1WXDA 3GEIA 4GOND 3GVXA 4OPMA 5KOHA 1QMGA 1G7CA 1RFGE 4JOCA 2GZSA 4D9JA 2IPLA 1IWPB 4EG0A 3NHPA 2Z6UA 2Z4SA 1YQEA 3S1LA 4MV9A 4EP1A 1TJ5A 5KCZA 1USGA 5H1YA 1D6MA 3KPJA 4RC9A 8GPBA 4DJTA 4GP9A 5C8DA 4NBTA 3GPDG 3OE4A 2RB4A 4FZ3A 4J4TA 1YZYA 2XXBA 4Q9HA 1FYWA 3RS3A 3BTVA 2YVKA 1NV8A 5A7GA 1QYRA 2O5RA 1IDOA 1NM5C 4TXMA 4F56A 3PJEA 4KQFA 1ZNXA 1TZMA 1DRWA 3W1EA 4HG2A 1E1MA 4ZVNA 3LNCA 1EM6A 1TX4B 2A1UB 1U8EA 2FZLA 2YVUA 3V3KA 3VU3A 1PJTA 2FW7A 1I2DA 1Y34E 2FZVA 3QZUA 2Q21A 4P93A 3EHDA 2N9UA 4RZ3A 3TRDA 4YGYA 5KNDA 2WIBA 4EHBA 4YN3A 1TZ2A 3TB6A 5BMOA 1MOZA 4CXMA 3O74A 3PQDA 1X1QA 4B6GA 3PX3A 3VC3A 1PZMA 4F7WA 2Q3DA 1M1YB 3IVRA 2R60A 5K3CA 4A5OA 3ZJUA 2NUPA 2YYAA 3PXDA 1YRHA 1W0JD 4AZSA 1ZQ9A 1U02A 2AG1A 4PZYA 4ZD6A 4XVCA 2VYND 3N8DA 2BCGY 5B6PA 1YCHA 2C9DA 4UNSA 2W2QA 2VZ9A 4FR0A 4KX3A 4L8FA 3R5TA 3ES9A 2XT9A 1TLTA 3PGKA 3VI3B 4ZK2A 2DBZA 3HB0A 1TUEA 1KSFX 2C5EA 1QC5B 1U8XX 5DN6A 3IO3A 4ZZ0A 4S05A 3KKPA 1HSOA 3V48A 1DAFA 4B3TB 3EBPA 1BTOA 5BURA 3R9IA 1DU4A 1OZAA 1CK4A 1YQXA 1WZIA 2V4UA 4MMXB 4NCJA 1FBNA 4NE9A 3N05A 2CFSA 4V38A 4BFLA 2RDMA 4IWNA 4MGZR 3UV6A 2H5IA 4DEVA 3KQQA 1HV8A 2QX9A 3QRWA 4KR7A 2EBHX 2WUFA 1TRHA 2BKLA 2E0IA 1Q7BA 2E4VA 1D2GA 1EFRD 1GPDG 2QRHA 4CM5A 1VKZA 4JGIA 5EKUA 4B3GA 2I8LA 4IR7A 2PKEA 1SBYA 2BJWA 4IYRA 3ROPA 2A1UA 5DX1A 1EFPB 1J1ZA 5I5GA 2C0QA 1L8QA 5BPHA 1TFUA 1V7PC 4LYGA 3ZZ0A 1EFTA 4C21A 1X8XA 5A0FA 3K8OE 4PLTA 1APBA 1F48A 2GKSA 3V2IA 2OOSA 1XDBA 1NW7A 4QASA 1FP2A 3FYDA 2PL3A 3AHIA 2LRHA 2W98A 4OFWA 1OV6A 4RGVA 5IKOA 3DDNA 4FZVA 4P3KA 3NORA 3MLAA 3K15A 3DHYA 1WXEA 1KKUA 1N57A 1SBZA 4QPPA 3E7PA 5B53A 2VOEA 3QV1A 1WV1A 4FJ0A 4MUGA 3LV8A 4BJHB 3SN6A 4W4TA 5EKSA 1QC5A 2AA3A 3OFND 2IXEA 3OLVA 1EXDA 2UUBB 4C0KA 4EW6A 1NRJB 4C0QC 4C6RA 3L7BA 4FYMA 1WXIA 3LC1O 2ZZKA 2OD7A 1GAJA 3D3NA 4O2BF 3V1UA 1XZNA 2FMFA 3ABZA 4KBFA 4P33A 1KJYA 3FPAA 3INNA 4J1SA 3R41A 2VCHA 3ZCTA 3LCVB 5E7QA 4KXNA 4DG5A 3WTCA 1XTVA 4EYEA 4G81A 3CMMA 2K87A 5HHTA 1FRVA 4MA5A 3T4EA 1EFPA 3JWJA 1KSJA 3SC3A 2C2YA 2G1AA 1KA9H 2CGEA 2I6TA 2MOKA 4PX3A 4A8JC 3ENZA 4ALKA 3QFHA 1IHXA 4H7HA 1QYVA 1FIUA 4EHNA 4BNDB 3QWBA 4X5OA 2IP1A 4QVGA 3TXYA 2WA1A 1JS1X 2Z9BA 1NTOA 1QHIA 5AR1A 4EUHA 1QP0A 5G0TA 3T1VA 2QK4A 1WY5A 2IFTA 3AU8A 2HBRA 3I9KA 1T0IA 2VP0A 4M0DA 5EMJA 2XUZA 4YRSA 4KO1S 4AMUA 2XGOA 3QWIA 5A1TA 2VJYA 4PM4A 1P1JA 2N0SA 4ZDJA 2QG6A 1VZ2A 4JOBA 4NRDA 3HY3A 4YP7A 4B35A 4ZOLF 5FNZA 2ZXFA 3CWQA 2ACKA 4ZHQB 1G8HA 2XCRB 4J90A 1YDHA 5KTSA 1SCNE 4ZU6X 3ZLTA 3KYBA 4ZCIA 2NNWB 2GCPA 4PZPA 4ACBA 4OKNA 2I2XB 4ALJA 2C4TA 3I0MA 4I2NA 4CM9A 4ZHSA 4Y3UA 2GN6A 3B38A 4Q9NA 2HM7A 4Q7LA 5ALDA 2ZBDA 1UFRA 2LE0A 1J5PA 1Y3IA 2R5NA 3E2MA 1H3EA 4L28A 4IV0A 1FJXA 4RJKA 2RH5A 3H7AA 3LLCA 4BL5A 3EXHC 2NV0A 3VZQA 1Y9ZA 2AEEA 5LNK1 4CF5A 5LZ4A 3CVJA 3FHTA 2QVXX 3BIXA 3AH8A 3T5MA 2BM9A 3DBIA 3THXB 2JPDA 4AG5A 4RMGA 3ILVA 4OGGA 3ELBA 2A3RA 2P30A 1PN3A 1ACLA 4JB2A 3UICA 2MWMA 1NJ1A 3VZSA 1QFYA 1U8UA 4G5HA 2K4MA 5CXXA 4BNDA 1N2EA 1BX1A 4R2LA 1C3JA 3KZOA 4PVCA 3LX6A 4M9RA 4TWIA 1PNVA 2TMKA 2W6QA 5GONB 4L0QA 3ETJA 1GSAA 3VSEA 4D9HA 2WKWA 1ZR2A 4DR7B 1NQTA 1YMVA 3LQKA 1HRDA 5B1SA 3OP4A 1MXHA 5EINA 1SCJA 2ZROA 3KCNA 4H27A 3L5KA 2WTNA 2VAWA 5JCJD 2BI4A 3HR7A 4PLZA 1D6JA 1J99A 3PDIB 3BHNA 1T4MA 1ECJA 4K9KA 2HSGA 4NMXB 4ZHQA 4LAFA 4KH0A 4WI1A 4F12A 2WD7B 2XY4A 1NSTA 2ONJA 3DE6X 1DKQA 4A82A 1ISIA 3HN2A 4M1YA 3CX8A 2BE7A 1CY6A 1B6GA 3NONA 2VTEA 4GI7A 1X80B 3E70C 4H31A 2MIIA 2VP2A 4G84A 5IJ9B 2E5WA 3BL8A 4C0HA 2GF0A 1U1FA 1EHIA 1UWLA 1XNJA 2VDJA 4TL7A 3MBKA 2ZVDA 3VGJA 3VVMA 3G89A 4RPKA 2HGSA 3BEDA 2W6JD 4IX1A 3THXA 3CZRA 1I6WA 2HIGA 1Z5NA 1PT6A 4S1OA 1REQB 2WW8A 2O07A 1A96A 4NG5A 4NBUA 4FU0A 1E66A 2I7TA 3DTTA 4B44A 3QG1A 4JI7B 3HB5X 4JVSB 4JQSA 1P2TA 1J70A 1E18A 1NVUQ 2AKAB 1G64A 1X2EA 1XN4A 2DTXA 3FCYA 1NW5A 4JT2A 5GONA 5C3MA 4YPOA 1DAKA 1MC8A 4HDKB 1HM5A 1SHLA 2FFQA 2PWYA 2WHEA 4WKBA 4BV3A 3SQDA 2NXEA 1MNAA 1V95A 2CL7X 3OX2A 4UE3S 5ERGB 3GLTA 2K6GA 3I09A 2YX1A 2CK3D 3H6KA 3HNPA 3RC2A 1U7ZA 1LK0A 2OV4A 3PDIA 4LISA 2FR8A 3Q3GE 4W5HA 2WY2D 4O5AA 5AW4A 2RK6A 4KK3A 3KQYA 2WD7A 2ATCA 4Z3DA 1ND6A 4KVGA 1U90A 3WK6A 5TC4A 1P62B 1X80A 2ID4A 3VDMA 3ZCRA 4E3WA 1RE0A 2XB6A 1AQUA 4LC0A 4A36A 5H8WA 5IJ9A 1QYIA 3B7PA 3FMIA 4EHIA 4RYLA 1OX5A 4O1IA 1TLLA 4JT8A 2BY4A 3ZQUA 1JMYA 2A5LA 2UAGA 3JSAA 1ZNWA 4AJIA 4MS3B 2C0CA 3KZVA 3NW9A 2O6LA 4MI6A 1TK9A 3AHJA 4IS3A 1YU6A 5DNDA 4KZPA 4BP3A 1BJRE 4D0SA 2Z6QA 4FEEA 3H75A 2ZTUA 3VZRA 2ZAMA 1REQA 1BDMA 4OXKA 5E8JA 2ZAGA 1U2GC 3AUUA