1JW9B

Structure of the native moeb-moad protein complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
240
Chain Sequence
b'AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEVCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 82
structure length 240
sequence length 247
ec nomenclature ec 2.7.7.80: Molybdopterin-synthase adenylyltransferase.
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jw9B00
1GY8A 4NJMA 4BV8A 2GN4A 4EEXA 2JCXA 3P19A 1DIHA 1FDSA 2C0CA 3DOOA 4ID9A 5GZ3A 2JCYA 3PJGA 4PLHA 1ZEMA 2EJWA 2YQ5A 1U3TA 1GZ6A 3HUDA 4UEKA 2GR9A 4FQ8A 2IZZA 4EI2A 1EUZA 1SB8A 3TZQA 2Q2WA 1VJTA 2E49A 2EP5A 2NQ8A 3RIHA 3E9NA 4GKBA 4EGFA 2GF2A 2J5KA 2P9EA 4OJNA 4DLAA 1EFLA 3AU8A 4M55A 3ZNPA 2ZTMA 3Q9UA 3U5TA 2DPHA 5FF9A 5JDIA 4GQAA 4XCVA 1QV6A 7ADHA 4CR8A 2OP0A 3ADOA 1MFPA 1YO6A 4LVCA 3I9JA 4ZQGA 4AJNA 1H6AA 4D46A 4M8SA 2ZQYA 4CV1A 3NAQA 3BHJA 1VM6A 1GUFA 1M6HA 2NV6A 3DZKA 1B16A 1P44A 4GWGA 4MIEA 3GR6A 1YB5A 3H9GA 3D5QA 1XU7A 3U49A 2AQIA 4BGEA 4G2NA 3OIFA 4HFNA 2HJSA 3BMQA 1EMDA 3AI1A 4E13A 3AY7A 3CUKA 1DBVO 4RLHA 3KO8A 5F1OA 4EJMA 1UDCA 1EVZA 3SEFA 1XELA 4R01A 5DDIP 3OIDA 3KVOA 4K6FA 1QYDA 2OXIA 4XRGA 4YQYA 1I33A 2PGJA 3ZWXA 4DYVA 1T2CA 4D45A 3PWKA 2X1HA 1E6EA 1JKFA 2LDBA 3U4IA 1R0LA 2EW8A 2ZK7A 1U7HA 2AQKA 2WD7A 5A3JA 3FNFA 1PGNA 1HXHA 4U6QA 4E6PA 3H4VA 2F00A 4TVOA 2HKIA 5EJ2A 4CLOA 3AUTA 1DHTA 5T5QA 3HSKA 5I9LA 4J4TA 4JJIA 4BHTA 5IZCC 3QQPA 5KCZA 4B8ZA 2O7QA 5KTKA 3FPLA 2QZ9A 4YJFA 1CQJA 3PGJA 3ADPA 4TRRA 4B8WA 3OP4A 4X54A 4IS3A 2X5OA 4GMGA 4BNKA 5HBRA 1WDLA 3ORFA 5DOZA 2NVUA 3FN4A 1HRDA 1IHXA 1YH3A 3E1KA 5G0UA 1ISFA 3VKUA 3S8MA 1B3BA 2H6EA 3WTCA 2GN9A 2J3KA 1ENOA 4U6SA 1HEUA 4YT5A 4W7HA 2YV2A 1RYDA 4WNCA 4BQRA 1JKJA 1EDOA 3W6UA 1WPQA 1ORRA 4JK3A 2VRBA 1DIGA 3H3JA 4L8VA 4LRSB 4MVJE 1GZ4A 3VDRA 5JDCC 3P2OA 1H5QA 2D2IA 3F46A 2EIHA 4NJMB 2QX7A 1MLDA 4PG7A 5DN9A 2DBRA 4PCVA 1V8BA 3GHHA 1P77A 1MG0A 1PQPA 3DWFA 1PTJA 1TB4A 4RPKA 5G0SA 2BH9A 4RQTA 3NGXA 1NVMB 2AEFA 3WLFA 1DRVA 4XQCA 4YRDA 1MC4A 2VWQA 2BFMA 2R00A 4TMFA 4W7IA 3VZRA 3PYMA 3QP9A 2VZ0A 1HF3A 1HE5A 2Z5LA 2E6UX 1DC6A 3GK3A 4Q3CA 4J1QA 4NBUA 5C7IO 1A9YA 1IOLA 2EHDA 3TL3A 2EGHA 4R54A 1B14A 3ZWCA 2X6TA 4A10A 1I10A 2D8AA 3EY4A 3TRIA 1N8KA 2BHLA 4N5MA 3WQRA 3S2GA 3NJ4A 1NFFA 2CUKA 4ALIA 5LDGA 1N92A 4CM4A 4PG5A 4CM9D 1WAMA 3GAZA 3OETA 1ZSNA 1PWXA 2C2YA 4JLWA 2HDHA 2OBNA 3SJ7A 1OOEA 2GN6A 4GSKA 2NTNA 4CUJA 2IZ0A 3NDRA 3LYLA 3QWBA 1XDWA 1GQQA 1H2HA 1YOVB 3HZZA 4Y8VA 3ZHXA 1KVSA 2FSSA 5EIOA 1N9GA 3D1LA 2NNLD 5IXYA 1T4BA 1UZLA 1YS4A 2OL4A 4TQGA 3PIDA 4FFMA 2XAAA 1I3LA 3GQVA 4A26A 5HTOA 4N5LA 3MJCA 2WEKA 3GPDG 1NHGA 2I5PO 3PFFA 3Q1LA 2DU8A 5JE8A 4CLOB 4L4RA 2BD0A 1ENYA 1PJSA 4UUNA 5BSGA 1H93A 2VNAA 2VUSA 4XIYA 3WIDA 4AJHA 2O23A 4O0LA 3SLGA 4F45A 1UR5A 4NBTA 1QYWA 1ZMOA 1ZO8A 2YV1A 4YJFB 1ZIDA 2ZIZA 3R6DA 4D44A 3NT2A 3IKVA 4U0JA 5F5LA 1KEUA 4MPDA 5BNTA 1TEHA 3ZU5A 2JHFA 3F47A 3V2HA 3LSYA 3O26A 4IGEA 1PR9A 5CDYA 1JW9B 2AMFA 1Z73A 5DOVA 3DB2A 2I65A 1DSSG 1C1DB 3FF4A 2VT2A 4YEDA 1JTVA 3DZHA 4EUEA 4J9UE 3UFXA 5COAA 4CUZA 4GVLA 1QV7A 1GU7A 1LLUA 1BG6A 3L6OO 3N7UA 1M66A 4AJ2A 2F1KA 4AJJA 4BO9A 3PHGA 3JYPA 4B4VA 4Y6PA 4FB5A 4P4LA 5MGBA 3JQ9A 4PLFA 5A9TA 1I36A 1Q2XA 1YL6A 3I4CA 1LDYA 1TT5A 1Z7EA 1ZW1A 2HU2A 4AVYA 5DNAA 3I9OA 3L6EA 1QLHA 3ICCA 3QWHA 1NQAO 3PZBA 3ZHYA 1SOWA 1U9JA 4CMAA 4XYLA 1Y8RA 5L9AA 4MP3A 4NIMA 4BGVA 2O3UA 1J0XO 4WOJA 2WYVA 1HTBA 3ZU3A 4JROA 4YJGA 4LSMA 4BUCA 3AOGA 3GRPA 2EV9A 2VHZA 4OGWA 2DBZA 1AXGA 2I3AA 4URFA 1OZAA 3L07A 3KETA 1H6DA 3AY3A 1HSZA 4BNYA 4F6CA 4RF4A 2FR8A 4LGVA 1GYPA 4PVCA 4DIBA 2P2SA 2Q1WA 2QQ5A 3GY0A 3QE3A 3C3XA 2NUAA 3PTZA 2P5YA 3B70A 2PFGA 3Q0EA 2Q50A 2OFPA 3WG9A 1HDCA 3F5SA 3GGPA 5CFZA 1PS9A 3PRJA 1WWKA 1HE2A 5K0ZA 4ALKA 4ONEA 4HX5A 5IN5A 4HFRA 2OORA 4GX0A 1DFIA 2V7PA 2GNAA 5KVCA 4FOSA 2X9VA 3OA2A 2YQ4A 1J49A 4R41A 1DFHA 4PLPA 4WCFC 5EESA 3WQQA 3U3XA 5JCXA 1FMCA 3COSA 3HDQA 1E1KA 2JL1A 4DTIA 1IPFA 3PXXA 2WD8A 3RQSA 2X0RA 3UAGA 3WYEA 4NFHA 1NM5A 2JD1A 2CMDA 5BQFA 8ADHA 1GV1A 2A35A 1ENPA 3U62A 4IMRA 2GUGA 3OICA 2C5AA 4FFPA 2XOXA 4XYBA 5FWNA 4XYMA 4DL9A 1XWFA 3CZRA 1RM5A 3TL2A 5L51A 2AA3A 2Y99A 2JD2A 4RVUA 3K8ZA 5F1KA 2OZPA 3E03A 5CEJA 3F5QA 4MVJP 4QQRA 4Z0HO 4YACA 2QW8A 4FGWA 8LDHA 3JQDA 3DTTA 3UUWA 4A27A 2HMUA 3DBHA 1P1IA 4CMEA 3ROPA 5KWEA 3KHUA 1KBZA 4ZA2A 4WPGA 1L1FA 3CKYA 1LDGA 2VOEA 4R51A 4CMKA 2HMSA 1Q7GA 4AFNA 4ZQHA 2W2KA 3H9JA 3QWIA 4DWVA 1O9BA 1LRLA 1VL0A 1PJ3A 2HSDA 1P31A 2EP7A 3PGXA 2V6GA 1P33A 5U9CA 1ZUD1 1QLJA 3LK7A 2IEBA 5ENVA 1PS8A 4EZBA 4K26A 1YBMA 1IZ0A 1TT5B 1VRWA 3I9NA 3LDHA 5DP2A 2NVWA 4Q3DA 3CIFA 4Z0PA 3VTFA 2AW5A 1PZGA 5JMWA 4B7XA 5BSHA 3A1NA 4J3FA 1F8FA 3DFUA 3LQFA 4WLUA 1E5LA 5TX7A 3KB6A 2ZYGA 5ICMA 2EKLA 4W4TA 4BNNA 1RYEA 3HE3A 3NTOA 3GFBA 4OH1A 4L76A 3PQDA 3GN2A 3DEYX 5TGDA 2VTDA 4FPXA 1EVJA 4IGFA 4KTVE 3ZV3A 4YRAA 1R4MA 4W9NC 2X5KO 4DPKA 5BSFA 4W6ZA 3WICA 2WSBA 3C85A 4I9NA 3K2BA 4DQVA 5BNIA 3FD8A 3OJLA 4Z9YA 4BMSA 4DIFA 2G5CA 1XLTA 2NU6A 1UZNA 4MKZA 1PWZA 1OFGA 1WDMA 4BO3A 4D41A 3NDJA 4WLOA 1I3NA 1H9AA 1HL3A 1SO8A 3MTGA 1M75A 1K5HA 3TSCA 2X22A 4XDYA 5JW6A 3JD4A 4CM1A 1HDXA 3VZSA 1GQ2A 2PWZA 2EWMA 3DBVO 4YA6A 3JQAA 1NBOA 1QR6A 1ZCJA 2I6TA 1T1SA 1YGYA 1KEWA 1ZEJA 3U0BA 1IB6A 1ZVMA 3U4CA 2QRJA 4ZU3A 5T6BA 4INAA 4KWIA 1SOVA 2O3SA 3RFVA 3GVXA 5IZCA 2PK3A 4FR5A 3EZYA 5FEUA 2E82A 1GR0A 5COQA 3M6IA 4BKQA 2WE8A 3TZKA 2R00C 2W8ZA 3Q2KA 4KUGA 1NTOA 5C7OO 3A14A 4S1VA 1DJNA 1MXFA 3NDIA 4LISA 4MKRA 4ZJUA 4HFJA 4RO0A 4CODB 3I9MA 5B37A 1P1FA 4GLOA 3FPCA 4WLVA 4E5KA 5C5IA 4PG6A 1QP8A 3DHNA 1BXZA 2DC1A 2EKPA 2UV8A 3DR3A 5EL0A 4GSLA 3UGKA 4WNIA 5KJFA 5JDCA 3W8DA 1BSVA 4B4OA 2ZTLA 2W2LD 2PGLA 1E5QA 3CTMA 4PZEA 1EDZA 3WOHA 1Z45A 2RH8A 4XGIA 4NPCA 5CAEA 4AJPA 3PLRA 2PLAA 1XQ1A 3ZWPA 3KSZO 3ZU4A 4CMCA 3ULKA 1JWAB 4ND4A 4RGBA 1ARZA 3CMCO 3K30A 1G0OA 5TS3A 1NR7A 2D59A 4JBHA 1J6UA 2GYYA 1R4MB 4CPDA 1IHYA 1V3VA 2JFFA 3X2EA 2Y0EA 3KEQA 1P1RA 4WCDA 2IXBA 1QYCA 5L3ZA 4B3IA 3V2UA 4ZQBA 4LCJA 5IFLA 2DPGA 4BNTA 3AM3A 3BMCA 4DVJA 3WJ7A 2A9FA 5L95A 1NPYA 2OGUA 1C3VA 1X13A 1UDAA 4RORA 4B7UA 3GDGA 1NPTO 1TI7A 5FYDA 3FR7A 2C29D 3NTQA 3LVFO 3E9MA 1N2SA 1IULA 2J3HA 3DXFA 1EQ2A 3KLMX 4XB1A 3TJRA 2AQHA 1RM4A 1EK5A 5JFOA 4B4UA 2Z1MA 4J2OA 4L4SA 5JYDA 3BHIA 1CDOA 1Q7CA 2P9GA 2PD3A 3LU1A 4P22A 3JQAB 2D3TA 2CSUA 3U9LA 3F9IA 4IJKA 3BTVA 3JQ9C 3V5NA 1NQ5A 3AM5A 4YJDA 1KERA 1P1HA 4YB8A 2QRKA 3HB5X 4WEOA 1I2CA 1FXSA 1ZK0A 2IDZA 4HXYA 1MA0A 3RJ5A 4WGGA 2VCYA 1LC3A 4YJHA 5T64A 3NTRA 4YAIA 1ZNQO 4FFOA 3W8FA 4E2XA 1KVUA 1ISJA 5GY7A 2QG4A 1N7HA 4BOYA 4OOFA 1BDMA 1NYTA 1M6WA 2QRLA 1BVRA 1H94A 2EJVA 3K2EA 4F46A 3HQ4O 5G4KA 5JAQA 4CLRA 5JO0A 2VHXA 3GVCA 4DPMA 1EE9A 1YL5A 3K92A 1LSUA 3ENNA 3BXXA 4IXTA 4PIVA 1CERA 3ZNQA 2OOSA 4Z9FA 2Y1EA 4PGFA 5IDYA 4XGNA 4KDFA 5CPBA 3JD1A 1C14A 5GZ6A 4KP7A 3WNQA 5AXDA 1VPDA 1DOHA 3VPXA 4BKRA 1D4FA 4GI2A 3WIEA 5IDWA 3G79A 4GBJA 4JNKA 2JAPA 3RC2A 4CV3A 1QRRA 4MP6A 3OECA 4J4BA 3T7CA 2RAFA 2B5WA 4J16A 3WJAA 4B79A 2VYND 3N74A 4CQLA 4Y6RA 4JP2A 1PQWA 4BNGA 2PA3A 3ANNA 2PZKA 1PS0A 1VE9A 4UEOA 4E31A 4RVSA 4CMBA 3VC7A 3MJ4A 4BNJA 4PLZA 1SAYA 4TSKA 2HK7A 3DTYA 1Y8QA 3TNLA 1NFQA 5L4NA 3PP8A 4OQYA 4YPOA 4JGBA 2Y1CA 3ZZNA 4J1NA 1MUUA 3OH8A 3ZWAA 4ALJA 4UULA 1SMKA 4E32A 3RROA 4LCEA 4IIVA 3GG9A 4CQMD 3K96A 1MV8A 2O4CA 3F1KA 5A02A 1BGVA 2PD6A 3BMCB 1T2EA 1E1MA 5CDUA 1DC3A 1K6IA 3JQGA 1KY4A 4WE3A 5TRTA 4CM9A 4YRBA 1R0SA 3VOSA 1W0CA 2C7VA 1LTHR 1Y81A 4L73A 3ITKA 1X15A 2AE1A 2GZ3A 5H81A 1G6KA 1FJHA 3B1JA 4Q3EA 4BMNA 4BIIA 3L4BC 3OBBA 2RH4A 1VLLA 4RZHA 1P0FA 5JY6A 4LMRA 4BNLA 3CH6A 4WCFA 4E2ZA 4CMGA 2Q4EA 3W1VA 3DHEA 4P4NA 4WOKA 2ZB8A 4GL4A 5KVQA 1GTMA 3JV7A 3IP1A 2GPTA 2DVMA 5AXAA 3NKLA 3PVZA 1HYEA 3KSUA 1M76A 4QECA 4KQWA 4YJHB 1YQGA 2O2YA 1MP0A 4BL5A 5JC8A 2ZJ0A 3PHHA 4EW6A 1MXHA 3E5MA 3H5AA 4QTZA 5TT1A 1HZJA 2AG8A 2FPPA 2VOJA 2PZLA 2DLDA 5ILGA 1DXYA 2CVOA 4ND5A 3UKOA 4N18A 5JNLA 5G4KB 4CLRB 3RUEA 4Z3DA 2H1SA 3RBZA 4NBVA 3H2ZA 4OAQA 4W82A 1GADO 4PVDA 4RJTA 5DF1A 2WDZA 4II2A 1JLLA 1B26A 1N1EA 1DJQA 1P1KA 2C7GA 4DQXA 1B3RA 1F06A 2HUNA 4C7KA 3DC2A 2Q45A 3WMWA 1T1RA 1XYGA 3BMNB 2GLXA 4MVJI 3IMFA 4FW8A 2WYWA 3GVPA 4E5NA 4LSWA 1F0YA 4MVJF 1QG6A 1E1NA 3GVIA 4I5GA 1Y1PA 1YDWA 1B2LA 1KC3A 1S6YA 3ZWVA 5A04A 5CG1A 3OJFA 3HB4X 4XX0A 4I5EA 4R1SA 1Y5RA 3E82A 3VH1A 4KUHA 4A03A 2B0JA 3B6ZA 5B4VA 3JYNA 3GZNB 4W99A 4NDNE 2E37A 4OSPA 2B4RO 1E3WA 5HS6A 5TJHA 4LVUA 4TROA 1O0SA 5JC1A 1T4DA 3AUUA 3IUPA 4EJ0A 4NFSA 4LN1A 4NBRA 1GCOA 2CVQA 3RI3A 2YZ7A 1LLDA 3L4SO 4JJGA 2HJRA 1D1SA 2O3RA 5L45A 4W9NA 5EMHA 3LF1A 1UH5A 4DLLA 5CEEA 3WYBA 2DFVA 1XHLA 1A7KA 5C7LO 3AI2A 3ZW8A 1Z74A 2RIRA 3GZ4A 4AJ4A 3GNTA 2BMAA 3BMOA 3DONA 2ZB3A 5JYEA 4BO0A 1OI7A 2A4KA 3PI7A 4J7XA 4MP8A 5G2OA 4YAKA 4ROSA 3M1LA 5ITVA 2EXXA 4TRMA 4WCFB 3LC2O 3OM9A 3ETDA 4QSMA 4BV9A 2XXBA 1WW8A 1L7EA 1ZKMA 2C5EA 3SC6A 2ILTA 5DBFA 2D5AA 4E5PA 4NMHA 5T8KC 4WASA 3UICA 1HT0A 3MOGA 3A4VA 2Y68A 3MEQA 2Y1FA 2WTBA 2YHUA 1XQ6A 2CDCA 5KJEA 2Z1NA 1UUFA 3E8XA 2YDXA 4WLNA 4LK3A 4HNGA 3NJ8A 1EBUA 3PK0A 1P1JA 2Y1DA 4MIYA 2JAHA 3Q6IA 2NU7A 1IYZA 4BO2A 2O3QA 4IJWA 4NBWA 4XWYA 4BS9A 3TDKA 2Q1SA 3AU9A 1VSUA 3ZHBA 2PZMA 2UAGA 3EVTA 1GPDG 1HYGA 1I5RA 1O6ZA 1TXGA 1E7MA 5HS4A 1HE4A 4M89A 4AJ1A 1Y6JA 2BELA 4L74A 4PLYA 2C07A 4IDEA 1T2AA 3BMQB 3VVBA 2CY0A 1A9ZA 4D3SA 3AM4A 1IPEA 1YQDA 1NWHA 4QX6A 5ILOA 3UXYA 4IZHA 3RJ9A 2VRCD 3C1OA 1OC4A 3SC4A 3W4JA 4LMPA 3NX4A 1JVBA 2X4GA 4ALLA 1E3WB 3AJRA 1DAPA 3HJAA 3VH3A 2WD7B 3BTSA 1HDZA 3BA1A 4A7PA 4R16A 3VHRA 3RSHA 1Q7BA 4JN6B 4UVIA 2YJZA 4NFYA 4P8RA 2BF7A 1LDEA 3UHAA 2RCYA 3FWNA 4GX1A 1NFRA 1I2ZA 4FD3A 1UAYA 5H82A 3ASVA 3D64A 3N58A 4IXWA 1Z6ZA 3EDMA 1BW9A 2HK9A 5ES3A 4O6VA 4GGPA 1JKIA 3LT0A 2NVUB 2GSDA 3BMOB 4HUJA 7MDHA 1ONOA 1PGJA 3I6IA 2GGSA 1BXGA 3H6KA 1Z82A 2VZ8A 2UDPA 2I76A 4J9VA 3K9QO 1GYQA 2VQ3A 1VC2A 1X7HA 3D5TA 4AJIA 3STHA 4R9RA 1SNYA 2Y66A 4ZRNA 1A27A 1BHSA 2EERA 3QVWA 4FN4A 4IY1A 4DRYA 3KYDA 3RBXA 3ZHZA 4OIMA 4DBVO 4R1TA 1HE3A 3JQEA 2Q49A 4ILKA 3G49A 1Q0QA 2AHRA 3DQPA 2P5UA 2NACA 4PFJA 1VI2A 4Q3BA 4YT4A 4CL8A 4MVJD 3HWRA 5F3RA 3TFOA 3UH1A 3DO5A 1E77A 3LT4A 5AYVA 1J4AA 1ZK1A 2ZQZA 3C7DB 4K6CA 2D5CA 3BZUA 2EEZA 1Y9EA 1NNUA 1PJBA 1LSJA 1Q0HA 1I3KA 1T2DA 3AFMA 4UUMA 3D4OA 3O8QA 3M2TA 4KQXA 3UCEA 1AXEA 1TA4A 4BNVA 4D0SA 1SC6A 3R0IA 2FSVA 2EF1A 4HFMA 4CM4B 5CPFA 4K9DA 1DPGA 1CF2O 2Y93A 1XEAA 1YVEI 4PRLA 2W2LA 3PJDA 5A1TA 4GMFA 4GVXA 3WB9A 5TT0A 5JO9A 3D3WA 5CDTA 3R3SA 1N9GB 3Q3CA 1LRKA 3WGZA 3WGIA 4NG5A 2G1UA 3JQ6A 4P4GA 3OEYA 3GMSA 1C1XA 3H3FA 3AK4A 4QUKA 4CLEA 4MVJM 5KJ1A 1W73A 3FNGA 1LC0A 1I0ZA 1EVYA 5JPIA 1E3LA 1ZSYA 1H6BA 3QV1A 4HNHA 1ZSVA 2GERA 3ZV6A 5A9SA 3AY6A 3FBGA 2HCTA 1AUPA 4I8XA 3LF2A 5CDSA 1ZK2A 2GN8A 1CWUA 3LT1A 4MOWA 2JFHA 2B36A 2PZJA 3BIOA 1KC1A 2FWMX 1BW9B 2NSDA 1U5AA 3BAZA 2HK8A 2HO5A 4RLSA 1EZ4A 4YT2A 2WJPA 3RFTA 1AHIA 3GF4A 3JCZA 5L53A 1GPJA 1VSVA 4ALNA 5JAMA 1LNQA 1PZHA 1YQXA 1BXGB 1YBAA 4UUPA 1GFSA 4EYEA 4XD2A 1NQTA 5JBIA 3PJEA 1UXJA 3DAPA 4NU5A 3RUDA 2O4UX 1U2GA 4QT0A 5AVOA 4ND2A 4EITA 2O50A 2ZCUA 1R37A 2DM6A 3A28A 3KYDB 4IQ8A 4KTTE 4BGIA 2Q4BA 3L4BA 1EFKA 4ALMA 2H63A 4Y67A 4LW8A 1C0PA 4HV4A 2NWQA 4U5QA 2VWHA 1BWSA 3T7EA 3V1TC 4OKIA 1ADGA 1YXMA 4I9HA 4YAGA 3PEFA 4MINA 2NLOA 4WECA 3GGGA 1U3WA 1YB4A 4FDAA 3LC1O 2WYUA 1VL6A 1NWCA 3DZFA 3IC5A 3BTUA 4AICA 4B3JA 3WTBA 2IZ1A 3OJEA 1SEVA 1QSGA 2IE0A 4FOOA 4DLBA 3ONEA 4JBIA 3D3EA 4YAEA 3ROKA 4AJLA 1Y8RB 1P45A 3PHLA 1U8FO 1ZMTA 4U0KA 3DAFA 4XJTA 2WE7A 5TJ9A 4YJGB 1E6WA 3MCVA 1NQOA 5G4LA 2CDBA 1WMBA 3B20A 4TZKA 1YWGO 1E7YA 3QLJA 2NVBA 2NADA 4R5MA 3IP3A 3O8QB 2VNSA 4R9SA 2PH5A 2FHSA 3RFXA 1E3EA 4K1LA 1F12A 2FZEA 5DCYA 4DPLA 1BRMA 3JQCA 3O38A 3PHJA 5A3VA 1LU9A 3JD2A 3VVCA 1O5IA 1TVEA 2DBQA 2O2SA 4FC7A 4J2HA 3CEAA 4PZDA 3U09A 1SEPA 3DZJA 3AI3A 4HADA 3I1JA 5GMOA 4XDZA 2B5VA 4R3NA 2PY6A 2VYNA 3WGQA 2C59A 3JYOA 4R1NA 5EERA 2PV7A 4DMLA 4R5HA 5CDGA 2E4AA 4L4XA 5TSDA 2J8ZA 4G81A 1ZJYA 3INGA 1JAXA 1UAGA 1G1AA 4MVJH 5CP8A 5G0TA 4ESOA 5DT9A 3S55A 2W90A 4UAGA 5TF4A 2X23A 4DYDA 4EJ6A 1JQBA 1B15A 5A9SB 3TF5A 4BNFA 3WFIA 4CQMA 1O8CA 2YDYA 2R6JA 4GX5A 3DDNA 3CPSA 3RCBA 4TZTA 3ETEA 1OBFO 3MJTA 3WMXA 3VZPA 2ZJ1A 2Z95A 4CM8A 5ENDA 2YHIA 1K6XA 1T25A 5KIAA 1LA2A 4PLCA 5JXWA 2G0TA 1PJQA 2P91A 3DAGA 3L9WA 3ZWMA 2WWRA 3VZQA 4TWRA 4QXMA 2E48A 4BKPA 2X0JA 4HKTA 3RUHA 3WR5A 2DTXA 3DBHB 4Q3AA 5JSFA 2BFOA 3RAJA 4TRJA 4IDBA 5FFFA 3VPFA 2VHWA 2YW9A 1ZH8A 1LI4A 5IG2A 3GA0A 4II3A 1YKFA 2BRUA 2W2KB 3R1IA 4N5NA 3EHEA 5JS6A 3QIVA 3U4HA 2AQ8A 1GDHA 1LSOA 3ZNOA 1DC4A 1NAIA 3JSAA 5F21A 3WGGA 1HETA 3A9WA 1ZBQA 3GRKA 4AG3A 5T8KA 3GHYA 3K6JA 5F5NA 3VTZA 2CDAA 1ULSA 3V1UA 2TMGA 1FK8A 3ROMA 3GEGA 5LCXA 4DC0A 3QSGA 3ANLA 1KYQA 4IJUA 1GCUA 3OFSA 4XR4A 1D7OA 5CG2A 1IL0A 3D0OA 2Q2VA 4OHUA 3G1UA 3GEMA 1DB3A 2X5JO 3C24A 2GO1A 4EUHA 4J90A 3NT4A 1SBYA 5TNXA 3HFSA 3WSVA 2H5LA 3QHAA 1PIWA 4J0FA 1N7GA 4MIOA 2Q99A 4B7CA 2W98A 3A06A 4NHEA 3C8MA 4EDFA 5L7WA 2YUTA 3IUSA 1K0UA 1ZJZA 4OOEA 2YFHA 4AJOA 1EBFA 2G17A 1YDEA 3F4LA 4BO7A 4NH4A 2DTEA 3CSDA 4MJLA 2O7SA 3GEDA 1KS9A 3ZNNA 4IIUA 3UF0A 2DFDA 4KUEA 4YBZA 3GN1A 2D1YA 3HG7A 5EQDA 5HWSA 5I7EA 3ZWBA 3I9KA 2CNBA 5CHEA 3EW7A 1H9BA 3W6ZA 4O63O 5KKCA 1V35A 4NJOA 1X0VA 2Q2QA 5THKA 4NQZA 4IBOA 3ZWWA 2ZB4A 3JD3A 3TWOA 2DBVO 2QZZA 1XGKA 4FCCA 1B7GO 1WVGA 2ET6A 4RDIA 2C20A 3OQ1A 3GG2A 2HRBA 2YHIB 3O4RA 3WBBA 1VKOA 1YJQA 3IAHA 3PPIA 5DBGA 1E7WA 4OL9A 1YL7A 2TMDA 3M2PA 4F6LA 1LDMA 4M49A 4BKUA 4UUOA 3IL2A 1PGPA 3EGOA 1NASA 5IAAA 2VWGA 3FCOA 1KIFA 5JY1A 1QMGA 4H16A 1PJTA 3JQ7A 4CM6A 2BFPA 4ZQEA 5BSEA 1AHHA 4KDEA 4BNWA 1LJ8A 1N1GA 5C3MA 3OJ0A 2V6FA 1KETA 3I5MA 1ZZEA 2PD4A 2VT3A 3K5PA 5AOVA 3ST7A 4E2YA 4KMSA 4M54A 4R69A 1U7TA 2AEJA 2X7HA 3ZWNA 1BTOA 2CZCA 3IJRA 3CZMA 1JU9A 1PSDA 3QRWA 1JVSA 5ER6A 4RPJA 5B1YA 1HKUA 1XU9A 3VKVA 4GX2A 2W4QA 4AJKA 3HHPA 3SX2A 2HMVA 3QVOA 3RKRA 3KUXA 2DUWA 1YBVA 4RPHA 4UVHA 1I01A 1MGOA 3ZWYA 1Q1NA 4KZPA 5DULA 1U4OA 2C54A 1K89A 2GZ2A 3HFGA 1ADBA 3RD5A 4PLVA 4WEQA 4F3YA 3V8BA 5IDXA 2QIOA 4FJ1A 3HN2A 5I7FA 3ZV5A 1IE3A 1B8VA 4RF3A 5DCUA 3GUYA 1D1TA 3IQDB 3TOZA 3NRCA 2JJYA 4CMIA 2VUUA 3G17A 1KEVA 1UJMA 3GUCA 3QVSA 3EVNA 2NM0A 2VRCA 3P2YA 2BLLA 1K2WA 3L77A 4OM8A 3KLPX 3AOEC 3ON5A 3RKUA 5ADHA 1B8UA 3FNHA 4OYRA 1HDGO 1ADCA 4BGUA 3FBTA 3ETGA 1U3UA 2VTEA 3EYWA 4RQUA 3KOUA 3PFWO 2VZ9A 3CINA 1NVGA 4BKOA 4Z0TA 1GV0A 5L7YA 2Y67A 1EE2A 2VHYA 3FRJA 1V3TA 1EK6A 2YFQA 1J5PA 2UYYA 3NT5A 2ZKLA 1DLIA 3BYZA 5COBA 3SVTA 3GH3A 4DA9A 1U8XX 2YV3A 3NEPX 4M86A 3DMTC 2PNFA 5HRUA 4BNZA 3D4PA 4XEHA 1AN9A 1MB4A 2HMTA 1OC2A 4OKNA 4XRRA 5FI5A 5DCWA 1DLJA 1MX3A 4DIOA 1E3IA 4WLFA 1JDJA 1A4UA 3H65A 3VH2A 4BB5A 2Q1UA 3WGYA 3FI9A 6LDHA 3Q2IA 3JQ7B 3F4BA 1V6AA 2B4QA 3GNQA 4ZD6A 2HAEA 1Z75A 1E92A 2OBYA 1ONPA 1Q0LA 1WZEA 2OMEA 3GDOA 3IDSA 3EC7A 3IJPA 4XKJA 4ZQFA 3UCXA 1UXKA 1PZFA 3V1YA 1E3JA 1R66A 1AGNA 2BGLA 3GPIA 1M2WA 1LDNA 1KOLA 3S2FA 3SJUA 3IOYA 5IZ4A 1JN0A 4CQLB 4MVJA 2NQTA 1X14A 4PRKA 1CIVA 3ENKA 1QORA 1PL6A 2EGGA 5I8WA 5A5EA 2I67A 2GASA 1Y8QB 4R68A 1AE1A 4PLTA 5THQA 1RM0A 4E2WA 4YAJA 2PKQP 3E9QA 5TLSA 1WLYA 2XPCA 4JBGA 3ZWOA 1FDUA 1GL3A 3TZHA 4M1QA 4XQEA 4M87A 3WQSB 5LC1A 1PQUA 3S1LA 1A5ZA 2WMDA 5H83A 2Y05A 3E18A 1QYXA 3JQGB 3EAGA 1U5CA 4YWJA 1E7SA 1NHWA 5HM8A 1YOVA 1X1EA 4D7AA 1BXKA 4XJSA 4CMIB 5ER9A 3ASUA 1RWBA 1VJ1A 4YYZA 1ISIA 4DUPA 1E1LA 2JD0A 3ZH2A 1DC5A 4L9RA 3ZV4A 1CYDA 4A5OA 2UUOA 5C37A 3ZN2A 3KRTA 5G0WA 5CEFA 3C7CB 4FS3A 3TFQA 4DMMA 4FJ0A 1I2BA 4RPGA 3QY9A 1RM3A 4BB6A 3DHYA 4RL6A 1ADFA 2OO5A 4YTEA 1U1IA 4WUVA 5ITWA 1R6DA 4OXKA 4Q39A 5A03A 5TQVA 4OXNA 2FN7A 3WYCA 3RBVA 1B8PA 2I3GA 1GZ3A 3JQBC 2YYYA 3JQFC 1C1DA 3EZLA 1DFGA 3MWDB 4RV9A 2DAPA 3QWFA 5KNLA 3WGTA 1FDWA 5EN4A 4YDRA 3RUCA 1PJ2A 4D3FA 4RF5A 1LRJA 4GWKA 4PG4A 1T26A 3H8VA 4E21A 1Y9AA 1WZIA 2FOIA 3H9EO 1HDYA 4ND1A 2JCVA 1EEHA 4EBFA 1HLDA 2ZB7A 4BQPA 1Y5MA 4N54A 3NV9A 4GH5A 1WNTA 1LLCA 3K73O 5EPOA 1W4ZA 3PYXA 1DHRA 5F1PA 3GMDA 2JFGA 4CM3A 1X0XA 5I7SA 1XSEA 2B37A 2IYPA 2LDXA 2XF8A 2RBEA 4FIZA 4HP8A 3PZRA 1K3TA 4RVFA 4DQUA 3TZCA 4FSHA 3KYCA 1R15A 1A72A 3C1AA 3OEWA 4BO1A 4CMJA 2VYVD 2VUTA 3RVDA 4NK5A 2J3IA 2RHRA 3H2SA 4UVEA 1IZ9A 4CR7A 3PLNA 3GLQA 3UCFA 4D79A 4O59O 1ZK4A 1YB1A 4RZIA 1UDBA 3PQFA 1RKXA 4O5OA 4PLGA 1I32A 2AXQA 3I4FA 4U8GA 3MJSA 3RU7A 1O95A 5JCJD 4BO4A 2Y0CA 1A71A 1CQIA 1ZFNA 2HLPA 5U4QA 2AG5A 1M67A 4FJ2A 2NTJA 3I9LA 4E33A 4ZVVA 4AL4A 5J23A 1LXCA 5A9RA 1XR3A 3MJEA 4BNXA 2V6MA 3LLSA 3OMLA 1F17A 5I9MA 3RASA 4CJXA 1QXSA 2G76A 4RPLA 2IXAA 3UN1A 1E7RA 4RVDA 4BO8A 4IJVA 2EW2A 1JA9A 4K28A 1HLPA 1W6UA 4DC1A 1P74A 3ZDFA 1RJWA 4JCOA 1KVRA 4IINA 2DTDA 4H15A 2FPGA 3WBFA 4NNJA 4YCAA 4JQCA 3DFZA 2P68A 3INTA 4IQ0A 3QJ5A 1Z7BA 4J7UA 4BNIA 1R0KA 1WP4A 2ZCVA 1V9LA 3Q11A 1UP6A 3RUIA 1K6JA 4CLDA 2DKNA 1LBEA 3B1KA 4RCVA 4Z6KA 3KYBA 1C0IA 2BFAA 3X2FA 5KVVA 1PU2A 1U4SA 4QO7A 2V6BA 2NU9A 3HDYA 9LDBA 4YR9A 1GUYA 3MZ0A 5KOIA 4DREA 1H6CA 2ZYDA 3G0OA 2FZWA 2CF5A 4ND3A 4E5YA 2C2XA 3WNVA 1LLQA 5L7TA 1KEPA 1U3VA 1UXHA 4J1TA 3VDQA 4CMHA 2BI7A 1S7CA 2ZTVA 3C7AA 2SCUA 2JHGA 1R12A 4C4OA 4NI5A 3H9QA 1UXGA 3ZU2A 3JYQA 1IUKA 3JQ8A 4XA8A 1YE3A 4J4HA 2VHVA 1SZJG 5IF3A 3W8EA 1BVUA 1PEDA 2AEMA 4PN3A 1HSOA 3AWDA 4IQGA 2JKVA 2D0IA 5K6AC 4N7RA 1GQYA 5L4SA 5U1PA 3S2EA 5L4LA 1E0DA 3DBRA 3RU9A 4BO6A 5BT9A 4Z3KA 1R4NA 1U2DA 4JX8A 1ISGA 3HNPA 1TT7A 1E3SA 4WKGA 2CD9A 4UVDA 1F14A 4FFLA 1KVTA 3TN7A 2WM3A 1L7DA 3QW2A 4RVHA 2EKQA 4IS2A 3SXPA 3PIIA 1DEHA 3DMYA 3KYCB 1YONA 2I99A 1D8AA 1H2BA 2PKRA 3C1TA 3ZI0A 1PGQA 3V2GA 4OSOA 3PWZA 4BNMA 1O89A 5A05A 1LDBA 3RC9A 4UEJA 2ZYAA 1DDOA 3H5NA 1UP4A 3RUAA 2QHXA 1XKQA 4UVGA 2BGMA 5JLAA 3WGHA 3E5RA 2P4HX 4MO2A 5A4DA 3OIGA 1HDOA 3OHSX 2PR2A 4FC6A 5KKAA 1GEGA 3WS7A 1NP3A 2X86A 4XQ9A 1ONNA 4G65A 3GDFA 4YXFA 2FP4A 1A4IA 2G82A 5KJ6A 5GZ1A 4BO5A 2DQ4A 3WWYA 3F6YA 4E3ZA 3F1LA 5EQFA 3FTNA 1E7QA 2GRAA 3PDJA 3B1FA 1X7DA 4I5FA 3BTOA 4GLLA 1C0LA 3G1TA 1O94A 4XQGA 2GZ1A 1NPDA 1Y7TA 4I08A 4D0RA 1X1TA 2X0NA 4IDFA 1SCUA 3QVXA 3AOEA 4J6FA 1QYVA 3ANMA 4YVFA 3GT0A 3GOHA 4Y6SA 3HN7A 2J6IA 4J49A 2DT5A 3OJOA 1ZK3A 1V0JA 4LRTB 3AFNA 4QFCA 1RPNA 3CMMA 3GC6A 2FR0A 1MG5A 2V65A 1F8GA 1LUAA 3QVTA 3P7MA 1VL8A 4I1IA 2X58A 4OO3A 3DMTA 5JDIC 4XGKA 4JIGA 3M1AA 4ITUA 3UOGA 5KJCA 5T67A 3E48A 4EUFA 1ISMA 4DBZA 3JTMA 4Z9XA 1UXIA 5JAZA 3RWBA 3JQ8B 1BDBA 2PTGA 3HADA 2IYOA 3VAZA 3FSRA 4MKXA 3ONDA 1IY8A 1DIRA 4GKVA 2Q46A 4ZN6A 4IZIA 4J1SA 1VJ0A 3RC7A 3DBRB 5TC4A 4GGOA 2Q3EA 3KM0A 1R4NB 4U7WA 2UVDA 1KY5A 4PLWA 5BNFA 3UW3A 4TKMA 1MFZA 3KZVA 3PDUA 3H5RA 4J7CA 4GAEA 3RUFA 1FDTA 4R1UA 3LC7O 3D3WB 1ENZA 1KVQA 4YQZA 3IKTA 5I8ZA 2CF6A 4YT8A 4ZHSA 2VWPA 1C1XB 3VH4A 3WSWA 1X7GA 3H9UA 4OXYA 2CVZA 4XYGA 3DBLA 3ITDA 1CEQA 3ZCXA 4WLEA 1I3MA 4XR9A 1P9LA 3HDJA 2VN8A 4CM5A 3ABIA 2XXJA 2OUIA 3MWEB 3PWSA 3EUWA 2P4QA 2FY8A 3RC1A 4CUKA 2HMWA 5MDHA 4A0SA 4CM7A 2IEDA 3AW9A 3LLVA 4IDAA 1SB9A 3W4KA 2DUUA 5I7VA 1CJCA 5I9NA 2A94A 3WLEA 3AUAA 5A5FA 3R3JA 4CR6A 3TPCA 1LX6A 4O1MA 2ZATA 1GD1O 1DIAA 4FFNA 3T4EA 3FHLA 3MOIA 1GEEA 3T4XA 4JXKA 1UZMA 3SBOA 2P9CA 5DZSA 4BNUA 3ICPA 3ZW9A 1I30A 1JAYA 1V3UA 3W4IA 3FR8A 1LQUA 1WDKA 4CV2A 1PL8A 5JMPA 1VKNA 4CLXA 4IPTA 2OHXA 1EQUA 1ZXLA 1ISHA 4EEZA 4FGSA 4IDCA 4E4YA 1OMOA 2RHCA 2BKAA 2HQ1A 3JQBA 3ROQA 2J5QA 3JQFA 1JWBB 1ULUA 2O3JA 1WMAA 2NTVA 4ZGWA 4HY3A 3ONFA 1GAEO 2Y1GA 3PHIA 1NXQA 2ZTUA 3JD0A 4H7PA 3UVEA 5TIIA 5K9ZA 3P5SA 4NZ9A 5IJZA 3WX0A 5BR7A 4NR0A 3D4NA 3FWZA 4L0QA 4BMVA 3CE6A 2I66A 4R3WA 3OF2A 3OSUA 4J91A 3K31A 1PJLA 4TKLA 1CRWG 3U4DA 1DO8A 2OP1A 5T57A 5AXCA 3LT2A 3KSDO 4AJEA 4ZRMA 1A7AA 4WJZA 1W8DA 1CETA 3DBLB 1NR1A 2EG9A 2GDZA 3Q9NA 3GVHA 4KOAA 1FDVA 4FFRA 2O48X 4A73A 1YJ8A 4XIJA 1R16A 2BI8A 3OQBA 1DAOA 3AUSA 4UREA 1TLTA 3TZ6A 3DZGA 1DIBA 2A92A 1T24A 4CQMB 4IMPA 2FR1A 3VPHA 3GNSA 2J3JA 4FBGA 1E6UA 2C82A 4QEDA 5IN4A 3JYLA 2GCGA 4D43A 1EUDA 4NK4A 3I23A 4TRNA 1DRUA 2I9PA 2D4AA 4B4WA 4KWHA 4CM8B 3KTDA 4I9UA 4BNHA 2UUPA 3PJFA 5HA5A 3KV3O 3NUGA 4D42A 3E6AA 5EINA 4CLHA 1PZEA 1P0CA 3O03A 1P3DA 4H3VA 9LDTA 5G0VA 3EK2A 3LZ6A 1I24A 1ML3A 4GPD1 1GYRA 4HWKA 4Q3NA 2X9NA 4E0BA 3DL2A 2QYTA 3NYWA 1XIVA 1ID1A 4QO8A 5DP1A 1LEHA 4ZICA 5B4UA 3OQ6A 3DZBA 2CFCA 1I8TA 3GAFA 1FF9A 3WFJA 4D3DA 3DZIA 3KBOA 1UP7A 5KVSA 1HZZA 2GD1O 5FI3A 2Q1TA 3OA0A 3IS3A 4DXHA 3I3OA 2B35A 4Y98A 2FPIA 2Y0DA 1GUZA 3SLKA 4IM7A 5IDQA 4DGSA 3TQHA 3VPGA 5L40A 4CV0A 2J5RA 4R4JA 1D3AA 5A06A 3FNEA 4XB2A 3KXDA 5LDHA 3CXRA 3INRA 1MC5A 2PH3A 4RVGA 3HDHA 2X0IA 3S2IA 3PQEA 4NU6A 4PG8A 2FMUA 2B4TO 3F3SA 3BMNA 1NVTA 3WWZA 4XZ3A 1BMDA 1NAHA 3IIEA 5IXSA 3DOJA 4JP3A 3I52A 3WDSA 4E12A 4HBGA 1HYHA 5K6AA 3D7LA 2IODA 5JAIA 2PKQO 4MVJG 3G3EA 3GFGA 5B12A 1XA0A 2PGDA 2H9IA 6ADHA 5ICSA 4P38A 2AE2A 1LQTA 1C0KA 2B69A 4IDGA 1HWYA 1B0AA 2O3TA 4OMUA 1SPXA 3GZNA 4I5DA 1QKIA 1U28A 4E5MA 4J43A 2FRDA 2VYVA 2BGKA 4MDHA 3H7AA 3L6DA 4PZCA 3JQAD 1DRWA 4OQZA 1XCBA 3DOCA 4IUYA 5AXBA 2HRZA 2POQX 1ZXBA 1T2FA 2Y1OA 4S3MA 5JCJA 3MJVA 1EUCA 4XYEA 4J0EA 1XG5A 2IRWA 3KEOA 1EVIA 4C7JA 2X9GA 1G0NA 3L9XA 2YY7A 4A2CA 4RDHA 2R2GA 3WXBA 2X8LA 3VPSA 1N5DA 1OAAA 3NGLA 3QA9A 1PX0A 4G5HA 4E30A 1YRLA 4CMEC 1PL7A 3TOXA 3BHMA 3MTJA 3L0DA 4L75A 1H0KA 4BVAA 1PR3A 1HDRA 4JJFA 4TVBA 4CL3A 4IDDA 2QYSA 1NX6A 1PJCA 1LSSA 3GGOA 3WGOA 1WXDA 3FTPA 3ZGYA 4QFDA 4B3HA 4Q9NA 2NU8A 4WK6A 3PYLA 3QWAA 5DBIA 2B83A 4RF2A 5B4TA 1PJ4A 4Y9DA 3EMKA 3I83A 1PGOA 3I6QA 3O9ZA 5AQ1A
chains in the Genus database with same CATH superfamily
1GY8A 1RKUA 4EG5A 4C6SA 2FF5A 3FA2A 4EUNA 1JG2A 2CLHB 4KXNA 2HTEA 2QRMA 2JCYA 5CNIA 2H1WA 1ZM4A 2ZB2A 3T5AA 1A2QA 2GR9A 5JUWA 1EUZA 4ETMA 2SNIE 1SIUA 4AZ0B 2V9CA 1ULHA 5E1BA 1NE2A 3E9NA 4GKBA 4OJNA 2C61A 5LZ7A 2NN3C 4GYKA 3AERB 4DLAA 2NO0A 4KR6A 1JGTA 1MQAA 4OKSA 4JMLA 2QV0A 3CR3C 2NUPB 4PZ0A 3WE7A 2XQGA 4ZEMA 1NJ5A 4RY8A 3T3HA 3DVLA 5AO9A 2QNRA 3KNZA 4B6FA 4U1RA 4F21A 4EELA 2R1TB 3LCVB 3M6WA 5CDFA 3FUXA 4DHWA 1H6AA 3I32A 3X43A 1W5SA 4OA5A 1J25A 2DCMA 4JOSA 2XADA 5K4GA 3KWFA 1GUFA 1MABA 4HWTA 3L1IA 3A9VA 5THXA 2GZSA 1B16A 2QMHA 3NLLA 5I7RA 1F7UA 5ABPA 4MIEA 1ZNZA 3D5QA 3KCQA 3LUAA 4QD3A 3GEBA 1SC9A 4HFNA 4IQ4A 4OHMA 1D6NA 1OXMA 2X2PA 3BMQA 3EF3A 2D5LA 2WJZB 2X8AA 1FE8A 4O33A 3P71T 3AY7A 4BZXA 1DBVO 3HZRA 1YS1X 3KO8A 1UDCA 2DQSA 1EVZA 4KQHA 3OY7A 4KN6A 1U0SY 1NUQA 1NXTA 2R8RA 1E1RD 2RH5A 1N0UA 4JVOA 3LGAA 5LIPA 1DZ3A 4I55B 3ZWXA 4PBTA 2UVPB 1VB3A 4D45A 3PWKA 4HLUC 1R9NA 4KE8A 4D56A 3ICWA 1R0LA 2V59A 1H4VB 2O1SA 3FSJX 2GCNA 2YY6A 5AHKA 2AQKA 2WD7A 4R2WA 3G2HA 3FNFA 2P41A 5JQGF 2QL9A 4K9KA 4XUEA 1MO4A 4CLOA 1XCMA 4CCYB 3AUTA 2PBLA 1DHTA 2IY8A 1E2HA 5I9LA 4J4TA 3F5FA 3BG5A 2CHUA 2FCAA 1XA3A 4FCWA 3SC2B 3UV6A 4B45A 4EUSA 2C2KA 1W96A 2C84A 3DCJA 3EGDB 3SBDA 4V39A 1JXMA 2FLVA 2X6QA 3PVCA 4TRRA 4B8WA 3ETJA 2Y6UA 4IS3A 1DEAA 5BVHB 3S0JA 3HO1A 3HKEB 1JR3A 1YUMA 1HRDA 1YH3A 3G89A 4V2IA 5G0UA 1T36A 1JS1X 2PEZA 2R8EA 4JWKA 5GOTA 2O54A 1P2TA 4XGQA 4IYJA 4W7HA 2YV2A 3A4LA 2OILA 1RYDA 4YP6A 1CUBA 2M6KA 1EDOA 4YASA 3EIQA 3W6UA 3ZD7A 4L28A 2NU8B 1VKZA 5TB5A 4NECA 2AOXA 5M34A 1M0WA 4JK3A 3ESRA 1DIGA 4DRZA 1W9HA 3WMWA 4YHBA 3ZCQA 2BL4A 1TM7E 3VR3A 4NE7A 2XTJA 3FPEA 2D2IA 3FLEA 4LQDA 1DEKA 1WCIA 4EI7A 2BMJA 4PCVA 4JC8A 4UU7A 2AFIA 1V8BA 1OH5A 4BVBA 1KAQA 3WC4A 3FUTA 2ONJA 2PBRA 2PS9A 4P35A 1PQPA 2V1XA 2FX3A 3KZCA 5G0SA 1JDBC 2FN8A 1TQ6A 4PC1A 1IOWA 2BH9A 3DDWA 5ALIA 2PZEA 5ALSA 4CNQA 1KMMA 1N3IA 2MTBA 4LV6A 4LHWA 2X4DA 4AMYA 1DRVA 2N9UA 6Q21A 3QEBZ 1MC4A 3TH5A 5BR4A 5HIKA 4W7IA 4Q0MA 5I7UA 4RD3A 2CXUA 3NM4A 4L7QA 1ADYA 2Z5LA 3GK3A 4EWLA 3LRXA 1FFAA 3UB3A 3M83A 5C1IA 3G5MA 1GGMA 4FKMA 1A9YA 1IOLA 4ARUA 5C7IO 2BLNA 2EGHA 1B14A 4R54A 1XRNA 3RS0A 3WQRA 4N5MA 2BGRA 1U2ZA 3S2GA 1ONSA 5A0FA 5CA0A 2CUKA 3UXMA 1Q95A 3H4MA 3NO4A 1KAEA 4U7PB 2FDCA 1N92A 1MABB 1N0HA 4GI3A 4A0HA 1ZIXA 4PG5A 1AM4D 1KSHA 1K4YA 2R11A 2YWRA 1PWXA 4ZFNA 1RKVA 1SD1A 1W35A 2IEIA 3VC1A 2IV2X 1VKJA 4CUJA 2CJPA 3DP9A 1Y6ZA 2IZ0A 3D6UA 3LYLA 1YOVB 1GQQA 2FEAA 3CUEF 3HJCA 3HZZA 3LX4A 4P2GA 5HE8A 1VZ3A 4EKDA 4QBHA 5JSQA 4KAFA 5JXJA 1TM4E 1Y7HA 1U90A 2QD1A 5EIOA 4C4SA 4EKGA 2R60A 1T4BA 2DGDA 4LXTA 4BU1A 1U3DA 4GC9A 1NQWA 1L7NA 2WIDA 3W0LB 1E2DA 4N65A 1ODCA 3OZVA 1OFUA 3EWSA 5FD8A 2QD3A 1Q0UA 1D2CA 1OWMA 4D44A 2DU8A 2MSWA 1D4AA 5G1OA 4CLOB 2WJYA 4JLOA 1ENYA 1PJSA 1EVKA 1NW8A 4EG8A 4UXIA 1N5OX 1M5UA 4AJHA 1OLXB 3JYHA 3T3MB 2JAQA 3SLGA 1QYWA 3ACDA 1HZZC 3WRWA 1DJPA 3NT2A 3HXPA 1L7QA 2G06A 4JB0A 3R40A 3H7IA 1KEUA 2ONCA 5BUCA 4UHBA 1I6WA 4H0FA 1HG0A 2JHFA 2QW1A 2QZJA 3F47A 3V2HA 1T36B 4F12A 1K2VN 2QLFA 5TDHA 2WICA 1Z8FA 1CQZA 2ZYHA 3P0FA 3TJMA 3QNUA 2I65A 1F0KA 2E2WA 2ATIA 3DYVA 1DSSG 2YL2A 4OHWA 1D2HA 1T3HA 2YW2A 2H7VA 3BH0A 3FF4A 4QRHA 2RARA 1JTVA 5FNVB 4CIAA 5K99A 2F1IA 3QEMA 1QBGA 5HDBB 7YASA 3UFXA 2WF8A 5G53C 1WB9A 1U31A 1QPBA 1XAHA 1MJ5A 2N3ZA 3LX8A 1FVXA 1G5RA 1Q1BA 1BG6A 2P69A 2AGVA 4GVLA 4KXUA 1U1FA 3U7HB 2N46A 4IIDA 4AJ2A 4ER7A 2FZVA 4K2AA 1WCIB 4AJJA 4KBGA 3RSLA 4QREA 3ZU6A 1K7XB 4RTMA 4FWTA 1PNQA 1N36B 1FTYA 1AU9A 3EXHB 3IHLA 4I8IA 1UANA 4Y6PA 1F9AA 2Q3DA 2R1UA 2WSSA 4PLFA 3TB4A 5A9TA 1YRBA 4YCJA 3PICA 4ZT3A 3K5IA 3KFXA 1COZA 1TK9A 4GL2A 3DR5A 1ZW1A 3PC2A 4GICA 4AVYA 3T3DA 5LYYA 4M4SA 2IUUA 2BHRA 1UJBA 5FH9A 1ACLA 2P0EA 4FEAA 1Q3HA 1QLHA 3PZBA 3QPAA 3VHQA 1FSZA 1U9JA 4I1OA 3WBJA 4CMAA 1ZJJA 2P79A 4C20A 3VVLA 1KYTA 2E5WA 3L84A 1HTBA 1R7RA 3LX5A 4IWNA 4JROA 5ELMA 3EG5A 3GRPA 4KLZA 1IBSA 2CD7A 3WLHA 4C5BA 1GGJA 2HY7A 4L72A 3CH4B 3Q41A 4IIXA 2WNSA 3EODA 4P58A 2QQEA 4URFA 1ZVVA 5F98A 2C4VA 2LP4Y 3VKWA 3GA7A 1HSZA 3HCFA 1XK6A 5IVHA 1R3UA 4DMUB 2FR8A 4DZTA 5CA0B 3JPWA 4CT0A 5AW6A 2P2SA 1T8TA 1X8KA 2OYSA 2QQ5A 3T8YA 2O05A 2ISCA 2C2MA 2K2QB 4DMHA 3KJZA 4Q48A 4P34A 3IJEB 3OT5A 3QGMA 4L02A 4MV1A 1CQIB 1RQ2A 2CKMA 1DQPA 5AK3A 3WG9A 1JHVA 1V5GA 3B82A 3GGPA 5CFZA 1V41E 1GA4A 3PRJA 4CKZA 4X20B 3SC3A 1XALA 3OZGA 4ONEA 1G8MA 3V6MA 2PA0A 2ZWVA 4HFRA 2Z0MA 3RYFA 2XBLA 2GNAA 3K16A 2XNKA 3Q4GA 4FOSA 4E6EA 4Q03A 2X9VA 4X7PA 5IJAA 4BATA 5C4MA 4H59A 1QVAA 4BWVA 1J49A 4D9NA 2P75A 4PLPA 4HN4B 4WCFC 5JCXA 2PJRA 1ESEA 1KAMA 2J7PA 2A5LA 1GN9A 4MNTA 2X14A 4N0DA 1NM5A 2JD1A 3CLTD 1HT3A 3H6GA 3CKLA 4NFHA 5AOCA 1UBMS 3RV3A 1ENPA 2PH7A 3U62A 2EZ4A 3RU3A 1BYUA 5F5XA 1BA2A 5DBHX 1B43A 1XTVA 5EPEA 1TAUA 1CT9A 2ATXA 4MQ6A 2YN4A 1K86A 4TS1A 4JJAA 3M82A 3MCTA 3MQ4A 1OT3A 3JZAA 4DL9A 4ZQCB 5AI4A 4MGHA 3TLXA 2BZSA 5IBQA 2PT6A 3AG5A 3IVMA 3TL2A 2AA3A 4NBLA 5DI9A 5AW8A 5KQMA 5L51A 3O3CA 5FAXA 2OZPA 4EKNB 3U6BA 4MIKA 5CEJA 1KYVA 2QI9F 1ATIA 4UHDA 5KTNA 3N53A 1D1PA 3WB2A 2QW8A 5K0NA 1BKDR 4R40A 2VDOB 2WKWA 5K3FA 4G85A 3ZXXA 5FTJA 5LZ4A 3F7MA 2YX1A 3QEMB 1FFYA 4WBSA 2SCUB 1F2UA 3KHUA 3UFXB 1ABEA 4WPGA 4Z1MA 3H16A 3AVXA 1LDGA 2BGUA 2O57A 4EAAA 1L7VC 1QOZA 5FXMA 4AS1A 2W2KA 3H9JA 2BM1A 3HB7A 1JIJA 2MDTA 1S9DA 3QWIA 2YVAA 5FBHA 3H8SA 1ZGJA 1PJ3A 3A3YA 1P31A 521PA 1C7RA 4MA5A 3PGXA 4Q9IA 1PT5A 5BUZA 3K9LA 1GFIA 1BD4A 1PS8A 1SVOA 1Y9JA 3PRHA 4IUCS 2F3UA 4RQAA 1IZ0A 1NUAA 1OX5A 4CEIA 1E1CB 1GLNA 1N2BA 1VRWA 3I9NA 2ECQA 3LDHA 3N39C 3Q7PA 4IFEA 4JOBA 3T5MA 4DLPA 2V5AA 1XEFA 4ERXA 2XWBF 4J3JA 5ALRA 2AW5A 4B2LA 1FDRA 1PZGA 1P1CA 2IIQA 2R6GA 2R84A 3JR3A 1WBBA 1HT2E 2YZKA 1C9MA 2AJBA 4N5DA 2HL6A 3T3PB 3G0IA 2RDMA 3MWJA 3DFUA 3OU6A 3JSXA 1ZGHA 4MWTA 1JG6A 1XK7A 5DK4A 5TX7A 2FWRA 3KB6A 4BX2A 2Z5FA 4YCDA 3DKKA 3LVBA 2GXAA 2OSBA 2HUPA 2GAJA 2ZEJA 1F7VA 2WAXA 1ECFA 3GFBA 3K1YA 4KK4A 3QUQA 4L76A 4Q1BA 3DV2A 2CWDA 2H54A 3W1EA 2VTDA 4FPXA 1EVJA 4IGFA 3V4PB 4YRAA 2IHNA 4W9NC 3FFXA 3IP9A 3RSSA 3IHKA 2R79A 1VA4A 1CY8A 1QO9A 3M6LA 2IC5A 5HUJA 4BPBA 1QDUA 2Q4TA 3K0EA 3KVNA 3OJLA 4RMHA 2DRIA 4B2PA 4BMSA 4DIFA 2Q5JA 3QE2A 1UF9A 4E09A 4EYQA 1J06A 2OBLA 4BRWA 3UPDA 1XLTA 3UMMA 1E2BA 5SICE 1UZNA 4TKUB 1V2HE 4EVSA 1YRWA 1KYZA 1OFGA 1FQWA 4BO3A 4D41A 3S5JA 3V9AA 3I5UA 1L5MA 2WHXA 3TKLA 4XEUA 3K0KA 1Z4IA 3WHKA 4HWGA 4BXOA 4ZIRB 1CRZA 2VIIA 2QY9A 4WK0B 1M75A 4OB8A 1UPAA 4JSTA 1Y5NA 3OPVA 3V1NA 4HB0A 4XDYA 2J08A 5LP6B 5JW6A 1YJBA 4CM1A 3MJDA 4WSOA 1OAOA 2P67A 3I45A 3VZSA 3W3ZB 3HUTA 2PWZA 4KQ2A 1Q17A 3GLGE 3JQAA 3P9RA 1FZTA 1ZCJA 3H5TA 4MGKR 1U0FA 1PHPA 1YGYA 2QUZA 3U0BA 1E5DA 3I2JA 3M7IA 1O4WA 4LYHA 2ZTHA 4LJ5A 4Z3OA 4N3BA 3EQ6A 2ZRGA 1PTJC 2J32A 3OX3A 4KAAA 4KWIA 4WOPA 1SOVA 4GI1A 2GEFA 2GEKA 2QLBA 4JB8A 3EXAA 3LOPA 3ND6A 5KTSA 2CJFA 5IZCA 2M9MA 5D84A 1CZOA 4XVUA 3O92A 1JQJC 2I1QA 3M6IA 4D96A 5IJ0A 4BKQA 3AB8A 1PFUA 3D6VA 2R00C 1NYLA 3WIBA 2FEKA 5K3FB 4EHIA 4YV7A 3D8RA 3A14A 1JVNA 5KSZA 1XZNA 1Y6RA 1V6CA 2H1FA 5JJBA 3M5CA 1F2UB 4LISA 1ABBA 1AKWA 4A0QA 1J24A 4Z2AA 4HFJA 4IO0A 4G1BA 5DX0A 4RQBA 1OX4A 5T3YA 1T0JB 2JLYA 1H1TA 2AS0A 3FPFA 5LMNB 2XRYA 3EFHA 3SJZA 5KHLB 4BN5A 1RNLA 1T2NA 1CYEA 1OJLA 5HQTA 4YO7A 1UDWA 3ELBA 5DNVA 5EL0A 3WAKA 4GSLA 4MYSA 2M6SA 2ZR8A 3T7IA 4CEIB 1YRQA 3H4IA 1BJTA 3VAAA 3W8DA 3C97A 5BV0A 2CDNA 4FFVA 4M1MA 4NP6A 2A0WA 3LHKA 3RVJA 2RGAA 5DNYB 2PGLA 3RREA 1QHEA 1Z45A 4DVGA 5CAEA 2FPWA 1YCDA 1ZU4A 4NPCA 4EFLA 2PLAA 4R0NA 2GPNA 1CU1A 1LTQA 3OY2A 3ZWPA 3I9V6 1CE8A 3A9SA 4DNPA 4OQLA 3DE2X 2ZJ8A 3ROTA 3CVYA 2PKCA 2ZBVA 3QU7A 1ARZA 5KNBA 3V42A 1XX6A 1E0SA 1UEJA 2GPJA 3TIIA 4ARCA 1IXZA 1EP9A 2DWUA 1LW6E 1SVKA 2YJ5A 1YK0A 3O8BA 3LG2A 4KL8S 4TV8F 3MAGA 1JJAA 2DPMA 1XLUA 2I34A 1CY2A 3IXLA 5B3JA 4ZQBA 2V4UA 3VKGA 2KLHA 1UK9A 4O2AB 2H57A 4YI5A 5L95A 4ZO7A 1C3VA 4RORA 1M7GA 1NUHA 3SNKA 4PX9A 1AJEA 3AXTA 3O1HB 4WZAE 1NPTO 2OD7A 2DFLA 5FYDA 1CHNA 2AKAB 5EIBD 1SBQA 1TVKA 3I4LA 3ENVA 2J87A 3E9MA 3AHGA 1UPUA 1KGSA 1EQ2A 2W70A 4D8YA 2FP3A 2ODTX 5HKKD 2FW6A 4PRZA 3R7FA 4AX8A 1EK5A 1MB2A 1VMIA 3UH0A 2QROA 4B4UA 1DKPA 1RZRA 4EI8A 2IHZA 4NEHB 1WSAA 4L5AA 1W9MA 2Y2VA 3V7FA 2EFDB 3A37A 1PBNA 2HA2A 4D92A 3VSEA 3AKDA 1MW9X 1Q7CA 1GNTA 2AX3A 3CG4A 4HQ0A 3ITNA 1AQLA 1CR2A 3JQAB 4P22A 4Z8XA 1V1MA 1ZD9A 3WNBA 4M9UA 1XAIA 3U9LA 4NH0A 3PC7A 5DRTA 3TX6A 3F9IA 3LGXA 2DLNA 2GEVA 3PQ3A 2IU6A 4LX0A 4YJDA 2W8BA 3QYPA 2JIMA 5BMVF 4FW9A 1MDFA 3T35A 1FXSA 1SHTX 2NO4A 3DL0A 4HXYA 2C31A 2PUVA 3PFGA 1JL3A 2CMFA 4K7JA 1KMIY 5FHRA 1JIXA 4Y9TA 3RJ5A 1CEYA 1NLYA 2VCYA 5IJ0B 1RBMA 5GIPE 1RLOA 1SUWA 5JNVA 1Z3CA 4BQNA 5HKBA 4JUAA 2C2WA 2QJTA 4HNTA 1Z38A 4HGRA 1ISJA 1HLGA 2JIBA 3I6YA 5GY7A 4DYVA 2RB5A 4L5YA 4HEJA 2QLNA 3EPHA 3II6X 2C00A 2QGNA 4NARA 1NYTA 4RNCA 4E5DA 1Z4JA 1H94A 1D4OA 4JI3B 4F46A 4GPZA 5G4KA 4EBBA 5JO0A 1H2ZA 3A70A 4UZFA 2QAJA 4ZOBA 1NMQA 4CWAA 4FSXA 1LSUA 2ID7A 4JJ8A 2OOSA 3LP5A 4Z9FA 4LRYA 5IYZF 5IM4A 1MAWA 4N5IX 2Q3CA 5CPBA 1E64A 1U2PA 3JD1A 2HM7A 4KP7A 4Y0VA 1L4HA 4FNOA 4O5AA 2YXNA 4DLZA 4FFMA 3MC1A 4GI2A 5IDWA 3HL4A 4JNKA 1CLUA 2BM0A 4LZAA 1GDTA 5AVSA 3MGCA 3RC2A 3RFCA 4CV3A 4FR2A 1EXMA 1XQWA 4MP6A 4CQLA 4I6GA 4KIUA 4MW4A 3JARA 1CE8B 4UBNA 4JP2A 1PQWA 2HBRA 2MYPA 2JARA 1CUDA 1RXYA 2PA3A 1GFWA 3ANNA 2PZKA 5A62A 4FE3A 1W5EA 4CMBA 1W36D 4OLBA 1JHUA 3J81k 5EAIA 3HP4A 4PLZA 4KNYA 4KH0A 1M74A 2PBZA 4G0XA 4EB8A 4WBNA 4ID3A 5JXGA 3AV0B 4KXLA 4GLJA 4OQYA 5JHHB 3SEZA 4JGBA 4OHYA 2K7ZA 3CH7A 3DWIA 5EG5A 4NOJA 1MUUA 2JLCA 2ZJBA 5IVIA 3ZWAA 4B09A 1L5NA 2JJMA 1EIWA 2Q2OA 4AS3A 2JGRA 2O06A 4CQMD 5A02A 1BGVA 3PGKA 4PAWA 5DKFA 1NVVQ 2FXIA 1E1MA 1F3OA 1WF6A 1RWQA 2MINA 1O8BA 3JQGA 1EP3B 4WE3A 4CM9A 4F06A 3BFJA 4DMKA 1W0CA 4N3AA 4YAUA 2C7VA 1KI4A 3WGUA 3UAXA 1TVKB 3L6BA 4IHJB 1Y81A 1RZ3A 2CL7X 5ALEA 4L73A 4N3GA 3ITKA 4Q00A 1N6NA 1PYGA 1RC1A 2GLTA 1FJHA 3B1JA 3KHTA 1Z5VA 3E7PA 4CHTA 3OZXA 2EBWA 5HIMA 2EFHB 4E4RA 2CXOA 2BGWA 2ZIEA 1WPGA 4KIWA 4D9CA 4M76B 2BFEB 1RWNA 1MEEA 1QUEA 1IXKA 1EK1A 2RH4A 2XTNA 2ZT8A 3F0TA 3OBBA 1ZD2P 1V1MB 3R4CA 2FH5B 4FHGA 4MQFA 5AKYA 4BNLA 1VHDA 2HU5A 3FFTA 4E2ZA 1IBRA 2V96A 4FOLA 1PKXA 5IASA 3HXOA 1IZ8A 2G5GX 3LLCA 2NXCA 2W8BB 2EX0A 1QIHA 2H2AA 1NSFA 1GTMA 2H0AA 5HKLA 3IP1A 1ZWKA 2NPIA 3KZKA 1XTPA 2V9PA 2FF7A 5AXAA 2HJGA 2JLQA 3HLKA 2HOQA 3PVZA 2OWEA 2ZRKA 3IAUA 1M76A 4QECA 3ESDA 4KQWA 2PX3A 1PEYA 1YQGA 1S2GA 1U9IC 4TWZA 3SLRA 3V4FA 1RAGA 3ZHQA 4TLMB 4B6RA 2AG8A 2PUTA 4JAVC 4E51A 5K8TA 4WT7A 1TVCA 4FIDA 4G97A 1D2MA 1FPMA 1TECE 4QU9A 1RFGE 3UKOA 4ZMBA 1X8JA 4YMWA 3KJNA 1L4MA 2C8VA 5G4KB 5DM0A 3T41A 1KAOA 2I8CA 3FB4A 3RBZA 4O4HF 3NORA 4OAQA 1GADO 2BGNA 1LD3A 3N05A 4HDRB 4BLSA 1VG9B 1JLLA 1SOAA 2GI4A 3EUEA 3BRWA 4MVXA 3WRVA 1DJQA 5A3QA 1RWMA 1KK3A 5IWCA 1ZCBA 3M4ZA 1X94A 1ZVKA 3DC2A 1X38A 2UYGA 5C4IA 1W44A 3W9UA 2PQ6A 2HJWA 4HR7A 2HLDD 3BMNB 3W2IA 1NQUA 3A0RB 3Q3GE 3I58A 5DXJA 4QBTA 1VOTA 2WYWA 3GVPA 2KJQA 3BGWA 3HKDB 1L8LA 4MVJF 2J7KA 2QVGA 2DQYA 4MYDA 4J0QA 4BQEA 2A0KA 4JGGA 2ILVA 4I5GA 5EXEA 1Y1PA 3QU2A 1S6YA 2RGYA 2HYIC 3ELUA 5BWNA 1OIVA 3TR0A 5ECYA 4R1SA 2Z4TA 1YCHA 4GT1A 3WZLA 2B0JA 1N7JA 1WZCA 2J3QA 4A91A 4WBNB 5B4VA 3ENWA 3U7RA 2R3SA 5KC8A 4G0YA 1E3WA 3ZJUA 3E7FA 5TJHA 2QN8A 4LVUA 3AXSA 1W581 3NWPA 4ILEA 4K9OA 4W1RA 3VUFA 7AT1A 5K0FA 3HRIA 2AN9A 2KPOA 3REOA 1DTWA 4JSRA 4F96A 4NFSA 1MVLA 3P32A 2K6GA 2ZBPA 2I1WA 2CVQA 3FLAA 1LLDA 1PUIA 3KXKA 1V16B 2MINB 4JJGA 3MVEA 1EUCB 3LF1A 3EDCA 4DLLA 4C2TA 4MLDA 3AF4A 1TYZA 1Z22A 4KXQA 3T5TA 1A7KA 4OTZA 2X41A 4ZVLA 4N9WA 1UIMA 3NVAA 4KQEA 2BWJA 3VU3A 2VNKA 4ARZA 5C37A 1OYVA 4G09A 2NPOA 4XWKA 2FPOA 3CVVA 5GADl 3R5KA 5JD5A 3NASA 4G4IA 3GNTA 2BMAA 3BMOA 5FTMA 1SD5A 5F12A 4IIGA 4BO0A 1OI7A 2HA5A 1EM8B 1NRJB 1V11B 2LD4A 1II9A 2IP2A 4HWSA 4MQFB 3NWEA 1NQVA 2EXXA 4TRMA 5K0TA 1AF7A 2FQYA 5AR1A 3C4VA 5JFTA 5F7OA 1RAFA 1TYEB 2BN4A 4IF4A 4QSMA 1FYFA 4BV9A 1WW8A 1HDIA 1FP6A 1ZKMA 3RFFA 1JJBA 2C5EA 3GLHA 2BC9A 1W4AA 4LXIA 2I33A 3DE7X 2ILTA 5P21A 3QX3A 1ODSA 1P7WA 5DBFA 4NMHA 3QLVA 4HDCA 3I1FA 3UICA 3JTEA 1I80A 2V98A 4G9BA 2QN6A 2IOFK 3E53A 3ROGA 1SUSA 2ZSIA 3AB7A 1Y3FE 2YHUA 1PG0A 4RENA 3ESYA 2GZHA 3QI2A 4UEWA 5IEJA 4R2MA 3AW8A 5EJ5A 2AK3A 5IXJA 1JHRA 1J2YA 1U5BA 2W9XA 4GP6A 1E79D 1NXPA 1X74A 2IIPA 1JQEA 3G0BA 2IY7A 2E87A 2LIPA 3BK1A 3OZUA 2P4UA 4BO2A 3KJIA 1SUEA 3P9SA 1Z2PX 1HFJA 3M3PA 4MYCA 3DMNA 4YMTA 4YMLA 4C3ZA 3C6KA 3F6EX 4G2TA 3AU9A 1VSUA 3NNNA 1VL1A 5FHQA 1UBEA 4TQAA 5FUQA 5FULA 1FTQA 3GLTA 3S27A 2EZTA 3L01A 5HS4A 3IHTA 4AJ1A 1N2IA 4Q1AA 3F3KA 3CO5A 2C07A 3K8QA 4HYQA 1DT5A 4HAVA 1N8SA 6REQA 3QTTA 4P36A 4EHLA 4OGFA 3IB6A 2ZULA 3HO8A 5ALZA 5BP7A 2FSPA 3G2PA 4ZAYA 1J2TA 1A9ZA 1SULA 2UVQA 3WIUA 1IPEA 1I0IA 1XXHA 2L2QA 3MF4A 1KYXA 3C1OA 3PC8C 1OC4A 3SC4A 3LYUA 4ENWA 2B4YA 4LMPA 4J03A 1JVBA 4OMCA 4ALLA 1E3WB 4G0MA 4YLYA 1U6IA 4JI6B 3TK1A 3GCGA 2KBFA 1HDZA 1SCAA 3BA1A 2YR0A 2I1LA 4R16A 2HHJA 3CBGA 3GA5A 1ZH6A 4JFRA 3O94A 2JIDA 4X63A 2HADA 4FONA 1TEZA 1EJ6A 2YJZA 1KY3A 1P9OA 4DV0B 1NG9A 1LDEA 1YTLA 4I9FA 4MW6A 1NFRA 1I2ZA 1PKEA 3ZGVA 1CQJB 4YN3A 2YC2C 3ASVA 1QRSA 1RTTA 1P0MA 4GDMA 3RS5A 4O6VA 4IV8A 2JH8A 4KI7A 3RTDA 3JALA 3RYHB 2XOKD 4ZTZB 1ABFA 4HDMB 2NVUB 1Y3BE 3BMOB 5BYKA 1PR2A 4HUJA 4RZ2A 4GMDA 5K3OA 1W59A 3DEIA 2FOLA 3I6IA 2GGSA 3H6KA 1MQ9A 2GSWA 2BUCA 2E7ZA 2UDPA 3W7VA 5LLDA 3K9QO 4M98A 4Q4LA 1GYQA 4EKEA 3VYTB 1JKJB 2QQ0A 1R0WA 4QGHA 3N2KA 3FG9A 4MRPA 4R81A 4AJIA 4CW7A 2FFJA 4R9RA 2VK8A 3X2SA 3N2IA 4DRYA 1QGED 1UPTA 2BEJA 5A4KA 2P3OA 1T9ZA 2F3QA 3ZHZA 2WG0A 2V7VA 4Z4EA 3ZWQA 2IQIA 5GVSA 3VI4B 3S8YA 3OZRA 221PA 2O2ZA 3IVXA 4PXSA 5KHAA 3AR8A 2QRUA 2QM8A 3GJZA 3R7LA 1HRKA 1Q0QA 2BSXA 4MQ4A 4JLBA 1FJGB 2NACA 2GFHA 2B8WA 1YMQA 1IAVA 1K7FB 4Q3BA 3E7DA 3LVQE 3MSCA 4RJJA 5CB4A 5CYGA 4AKIA 4MVJD 1E3DA 5F3RA 2CNDA 2IZ6A 2I7TA 2RKOA 3DO5A 5TPZD 3M1IA 5LR6A 5AYVA 2AI1A 2HFKA 1J4AA 4ZOCA 4RGQA 4IJMA 2VBCA 3KTAA 1H1LB 4G4GA 2WP0A 1F3LA 3PEUA 1XCPA 4IYRA 1Y9EA 4G67A 5JSKA 1ECBA 5F3DA 2R1ZA 3AJEA 3AF3A 4HQ6A 4ZVTA 3E7WA 3NFRA 4N6NA 4D0SA 1TA4A 1OLOA 4TM7A 2C2GA 3G7NA 3RW9A 3HPRA 4B35A 1THMA 2CMGA 4OHFA 1DPGA 2D2EA 2FFHA 3HEMA 5IAJA 5KYTA 3PNKA 5CGQB 4PRLA 1ESCA 3LUGA 1XTUA 2D1FA 2W2LA 3PJDA 4BMPB 3CJQA 6REQB 4QTYA 1IZ7A 1T3TA 3TS1A 2DBYA 2VPXA 2HCBA 4GMXA 5TT0A 3WB9A 4FK8A 1HTTA 3SKXA 4CIXA 1P7CA 5KQLA 3OC6A 5CDTA 4KO3S 3PUXA 4MO9A 4Z86A 4NG5A 1U99A 1USWA 1RD4A 1W5FA 1W85B 5JZVA 1I94B 1PDOA 3GMSA 2RK6A 3ZDBA 1JZQA 4CLEA 3WL8A 3LQ1A 2KM1A 4MVJM 3C4QA 1KE1A 3EIHA 1W73A 2R7LA 3O84A 2PBFA 4WA7A 2IHKA 2JFOA 1T4GA 1VTKA 1LC0A 4ZI7F 3QFRA 4UU8A 3IUQA 1EVYA 1GTJ1 3SZRA 3OWHA 4OYHA 1N78A 1UMDB 1VCHA 2YZ2A 3EA4A 1E1QD 4LDJA 1AGYA 3WNDA 4URVR 5EIWA 2AI2A 2HCTA 1VJ5A 3GIWA 3KKMA 3LF2A 1XA4A 5CDSA 2ZYWX 1DINA 4ZCQA 1VHWA 3ORQA 2PZJA 1C4WA 2NSDA 3ILHA 3GW8A 5D86A 1KHHA 1X8XA 4DDKA 2BYTA 3LKVA 1RQPA 5FUXA 3PXAA 3UMYA 2A58A 4LY9A 3WMGA 4MB0A 5IKXA 2EF0A 1ESMA 2WIKA 1J22A 1GFSA 1SD2A 5H8WA 721PA 3L92A 5JBIA 1VYTA 3DAPA 4PGHA 1W4CA 1U2GA 5CIWA 1Y6QA 1UCFA 2O50A 4LXUA 5I9BA 4MS3A 1TKBA 2QQFA 4GO1A 4QC2A 3TG8A 1USUA 5A7FA 2OAGA 4PQYA 3L8DA 3L4BA 3VGJA 3FYSA 1UWCA 3A2KA 2O8CA 4U5QA 1GKKA 1T5HX 1KRHA 1LFAA 1PO7A 3CNLA 2ZWIA 3MINB 1QH9A 2QVYX 1RWOA 2Y4NA 3HH8A 3L3BA 4I9HA 2ZVDA 4MMYB 3AGPA 3PEFA 1WMFA 4O02B 4R2IA 1TIPA 1D5WA 1KI6A 5A6SA 3HDGA 4JGIA 1BD3A 2QXYA 5PNTA 4F7DA 1THTA 1XJ5A 4DLBA 3QVLA 4GZ3A 3W5IA 3TPFA 1QAOA 1OFTA 2C9ZA 4OUKX 1M34E 2IY9A 3PNVA 1SU8A 1P45A 2A88A 4U0KA 1TPYA 2Z04A 2XUKA 3L41A 4FD2A 4CIYA 3JPYA 1XNJA 3DAFA 3HRKA 2AYYA 3ZZMA 3DVSX 3RSOA 4BE4A 5BRJA 4KQ9A 3U16A 2OKCA 2DEUA 2WPNA 5G4LA 1KR5A 3QVGB 3H19A 3REQA 1WVIA 1WMBA 5BSTA 1EZZA 1SKBA 3MPOA 2NADA 4IOMA 1XDGA 2P6OA 1WS6A 4D1YA 1KU6A 5C7YA 1JI0A 2NSLA 2OCBA 1BCSA 2QDXA 3W34A 3HVJA 5D3MA 4ER0A 3K0BA 4R9SA 4ZZIA 2PH5A 3HY6A 2FHSA 5JVDA 1Y5IA 1PUJA 1E4VA 2CCGA 3DS8A 4JVLA 1BRMA 1N0IA 3GUUA 3PHJA 5DCYA 4ZAVA 5A3VA 2NUAB 1LU9A 1TOAA 4Z7QB 1O5IA 2QENA 4WZBA 4AWBA 4ZODA 2PGIA 3K2IA 3U09A 1NBEA 3AI3A 3AHCA 2PLWA 3I1JA 4HADA 4Y0NA 2VHJA 4NY1A 4R3NA 3IUJA 4M8LA 4Y9UA 2VYNA 1ZOLA 1W2GA 4PAGA 2C59A 5CDGA 2PV7A 1PP4A 4R5HA 3NB0A 1OFVA 2IZ7A 5EHIA 4DMLA 3VNBA 2XGMA 3U40A 5ECDA 5JFGA 4DKJA 1ZUNA 3LOUA 5FLXA 2GM3A 2NAPA 5F7XA 2ZRMA 2ZUDA 2AJTA 1F6DA 2WJ3A 1ZUWA 4MVJH 1AOXA 3H86A 4OUDA 4W63A 4YCSA 3P0HA 4Z8YA 5LBUA 4UAGA 4GM0A 4WXHA 5C34B 5TF4A 4OLHA 1E2EA 1FXWF 1AX9A 3KJXA 4FHCA 5DVZA 3LDAA 4MV7A 3M3DA 3UG6A 4EJ6A 2YJTD 4F60A 1B15A 4NS4A 4ED9A 4BNFA 1O8CA 4LWPA 1G291 3O3NB 5AMXA 3AGQA 4GX5A 2X0FA 3L46A 4MRRA 4NNOA 4TLEA 2B34A 3CPSA 3TCXB 3C4JA 3CZCA 3IALA 2WV9A 1E8DA 4DJFC 2WJWA 1ECPA 2C5FA 1OBFO 4HDAA 3VZPA 5CLGA 5ENDA 3OX1A 4LUCA 4PLCA 5AJZA 4Q18A 4EF6A 1IZZA 4RESA 5JXWA 1DKLA 4DNQA 2EAUA 4P7KA 4X94A 4TWRA 1N2ZA 2GS9A 2WUDA 3DDZX 4QXMA 2BAGA 5B7QA 4BKPA 4M8KA 2NZVG 4HKTA 3NRBA 4WI1A 2DTXA 3T15A 3DBHB 3IAS6 3WO1A 4TS4A 1X3SA 3UY4A 2BFOA 1UWKA 1Z6TA 4AM8A 3NEAA 3SYLA 2IEYA 4BAZA 2ZE6A 5LJIA 1ZM2A 2O8CB 3GA0A 4M7OA 3EVDA 1ZP6A 3TQIA 1YKFA 1LPPA 5FA8A 1U6JA 3QIVA 1JF8A 2ZUUA 2ZBDA 3OWXA 4MCAA 4RCYA 3U4HA 4KVGA 1FC0A 5JAPA 1JDSA 3EVFA 5A6SB 5JZMA 4AZ3A 1UC5B 3F3YA 5HM6A 3RHTA 3UKJA 2P2YA 1NXVA 3DYIA 2Z8XA 5K20A 3GRKA 1A8QA 5T8KA 1JIIA 3K6JA 2VYFA 1ULSA 2JFZA 3HVHA 3IEIA 1LBHA 3GRAA 3GEGA 4MLPA 1YHYA 2ZUVA 2JGNA 3OAAD 3L49A 3QSGA 4RABA 4XQ0A 3SZGA 4C07A 4XR4A 1XZLA 5G02A 5I48A 2G6TA 3REQB 3A10A 2ZETA 5CG2A 2H2IA 2N42A 3TOVA 2A9QA 3PR3A 1L8XA 2WA2A 2X5JO 2GO1A 4KV7A 3NC0C 1BCSB 1QX4A 2C98A 2C4MA 2QD4A 4OAOA 5D3MB 1HT1E 3RS3A 3ZI7A 5KSYA 4XFDA 1JXQA 4HAWA 2H5LA 3JQPA 3VDMA 4J0FA 2GBPA 2W6IA 3LXRA 5CYOA 3N59A 4ZZ3A 3NW9A 4NV0A 1KJ9A 2GHTA 2GYUA 4WZBB 3TQSA 4MVYA 1QVWA 4AUNA 3C8MA 4EDFA 1PVOA 2YUTA 2DMRA 1CLEA 4NFLA 4YP7A 2M98A 2JFXA 3QVUA 4UAUA 1YDEA 5EUMA 2OM2A 5JMTA 1YTUA 1A7JA 5I3ZA 4UNSA 2ZVJA 2UYQA 5IJXA 5LXTA 2O7SA 1OBHA 4IIUA 3S7ZA 4LFAB 4GOJA 1GGKA 1RRGA 1PR1A 1T4CA 3GN1A 1ZUNB 4M9ZA 3WO0A 5HCUA 1DEOA 5HWSA 3PSAA 8ABPA 5LNK1 4K46A 1V5IA 4OUDB 5AK0A 5AESA 4FILA 1TYCA 3W6ZA 2EATA 3HYCA 3QPWA 5JARA 4F38A 4U7DA 3FTEA 1T9HA 2ZSAA 3B13B 3BXOA 3JWGA 2Q2QA 3Q88A 5THKA 2P2LA 1KAGA 1Q14A 1CR1A 1ZC3A 4Q4CA 4PPYA 5ESXA 1NDUA 2X5NA 1WY7A 2JVIA 2ZB4A 3JD3A 5CURA 2NOAA 3SJAA 3ZWWA 2CNNA 3LWZA 1J99A 5IKEA 1NATA 5CDFE 1XGKA 1ZUIA 4ZYVA 4X85A 4GDFA 5DB4A 1ILEA 4QUEA 2XCLA 3BS4A 3E9RA 1F2DA 1I4EB 3VZDA 4Q9DA 3BWVA 3EWIA 1EJ0A 5KOHA 1XAJA 4IGAA 5IUJC 1SCDA 5K2OA 3KT0A 4X64B 4RGVA 3UHJA 1VKHA 3RPEA 5ADWA 4FLEA 1VE5A 3WKBA 5L3SA 1YL7A 2CCJA 4BEVA 4U2BA 4FYXA 1GR1A 5LD2B 4H1WA 1LDMA 2W58A 3O5AA 4M49A 3PPVA 2O8EA 4UUOA 3G7UA 4FFBB 4ZOLA 3EGOA 2HQSA 2A1TR 4S1WA 3JQRA 1H8HD 2G63A 1Z5UA 1VIYA 4GOKA 3RF6A 3JQ7A 3U39A 1Q74A 2FSVC 2DETA 3KPWA 3JASA 1RU3A 4IWYA 4IP0A 1JHPA 2Z09A 4BNWA 4BDSA 3B2NA 4AZ3B 5HOEA 3G8YA 2Y92A 2ZAYA 1UFVA 1KETA 4I1VA 4MPTA 2TRSB 2ES4A 5FPTA 1QG2A 4GBMA 2F1RA 1KDPA 3N2EA 4QU5A 4E2YA 2PX2A 4ZAXA 1U7TA 2AF3C 2X7HA 1BTOA 1CY4A 5DSXA 3SHFA 5BWBA 4Q4JA 2UU9B 4CTJA 1PSDA 1Z3IX 2VSOA 5LOVB 4BMYA 1XNGA 1HE8B 4YWHA 4F9GA 1AK2A 1ZOSA 3D7RA 3OJXA 1EDBA 3SX2A 4I6JA 3HR7A 4M1WA 2Q3BA 4RSMA 1SHLA 5MN5A 5TEWA 1KARA 5HW0A 3LNCA 2R751 4AZSA 1I01A 1MGOA 1XMJA 2PS1A 4IIEA 4LXGA 4ZVNA 3PQ4A 3F7OA 1K89A 1YRAA 1P9WA 2GZ2A 4FTWA 4ERNA 2Z58A 3AHHA 3PFIA 3OE7D 4YRCA 3UFBA 1ADBA 3B3FA 4N1AA 4PLVA 4UARA 1RW4A 3W5SA 4E7PA 3RADC 1ZH2A 1L5WA 3EAQA 1VJCA 4FJ1A 4N8SA 4JLDA 5K8VA 1NE7A 1IE3A 5KI6A 1RSZA 4ZVQA 5ICCA