1JW9B

Structure of the native moeb-moad protein complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
247
structure length
240
Chain Sequence
AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 82
structure length 240
sequence length 247
ec nomenclature ec 2.7.7.80: Molybdopterin-synthase adenylyltransferase.
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jw9B00
4I5DA 2VYVA 3RBXA 4P8RA 2R6JA 4FGSA 3V1YA 4CQMD 3DO5A 3ZU4A 1LDNA 2HK7A 4OGWA 4BO7A 4NH4A 1K5HA 1K0UA 4XGKA 4DQUA 3BHJA 4CM4A 2E49A 4Z6KA 5I7EA 2Q2WA 1C1XB 3UF0A 3U4HA 4PFJA 3OSUA 4RORA 4XQGA 1KVUA 4HKTA 3E03A 3QWBA 3C3XA 1NXQA 5JDCA 4YJHA 2GNAA 1PJQA 2I66A 3JQ7A 4FJ1A 2ZKLA 2Y66A 4R3WA 1K6IA 4ZICA 5KJCA 3VH3A 2O4UX 5B37A 4A0SA 4R3NA 1HSZA 3C7AA 3IP3A 3OM9A 2B35A 4JN6B 4GQAA 3F5QA 3UCFA 4PLVA 2BGMA 3ASUA 3JQFC 1GDHA 4FJ2A 4UUPA 1EVIA 2EWMA 3PGJA 1NWHA 4GVLA 2GPTA 5HWSA 4B79A 4YJFB 1YOVB 1ENOA 3CEAA 3HDQA 3CZMA 2XF8A 3K6JA 4E6PA 4TZKA 3ZDFA 2BD0A 1GQQA 5G0VA 1U7TA 4PCVA 5GY7A 1JA9A 4YT4A 3KSUA 4D7AA 3NJ4A 3DL2A 3AWDA 4XJTA 5IXYA 3SEFA 3MWDB 2PY6A 3NDJA 4KUHA 3F4BA 3RUDA 1HDRA 2FR1A 4XKJA 1SNYA 2PWZA 4R5HA 3WXBA 3CZRA 4RJTA 2G5CA 1GUZA 3UCEA 5DCWA 1DIHA 2O3TA 3ICPA 4PG6A 4FR5A 3SX2A 2PGLA 1PR3A 4BMVA 3PJEA 1I10A 2J3IA 3HJAA 3QVWA 4GX1A 2WM3A 2XXJA 2LDBA 3PTZA 5G0SA 1I3KA 3H9EO 2E6UX 1M6WA 4BQRA 4Z0HO 3GHYA 4MP6A 4IY1A 5F1KA 3P5SA 4IZIA 4L4XA 2JD0A 4I9UA 4RCVA 3PHJA 4DQXA 4ZQGA 4EEXA 3GPDG 3JQAB 5AXAA 1KBZA 3WMWA 2DUWA 3ON5A 3AUTA 3BIOA 3KXDA 4J6FA 2WJPA 3MZ0A 2X9GA 1DC6A 6LDHA 4R1TA 4OHUA 2UYYA 4DPKA 5IDWA 5FFFA 1UP4A 2JAHA 3AI2A 1MGOA 4LMRA 4YEDA 4II2A 1F14A 4OL9A 1P3DA 1XYGA 3EHEA 3Q9UA 1R0LA 2Z5LA 1UZLA 3Q2KA 1JLLA 2R00C 1XKQA 3JD3A 1B8PA 3A4VA 3RC1A 1ZSVA 4MO2A 4BGUA 3QRWA 3U5TA 1B8UA 2Y68A 3K2EA 4ZVVA 4CLXA 4ZJUA 3IMFA 4Z9XA 4AJNA 4YA6A 2ZB8A 2DBQA 1BWSA 4BO3A 2JCVA 4ZN6A 1WZEA 4QFDA 3TOZA 4NJOA 4AJLA 1PQPA 2VUUA 4E30A 2P68A 4EJ6A 4XYEA 1OC2A 1KVRA 1HTBA 4BNWA 2NM0A 4OSOA 3E9NA 1Z73A 4FOSA 1I30A 1H6DA 2WWRA 1Y9EA 2G17A 5JY1A 1DAPA 3F6YA 4WCDA 4CM5A 1P33A 1ZMOA 3MOGA 3F5SA 3VPXA 1L1FA 1FDVA 4B3HA 3JD2A 4J90A 4A03A 3PYXA 4NDNE 1YRLA 2Y67A 4P4GA 3TL3A 3WSWA 4CLRA 1DPGA 1RKXA 4Q3AA 3RU7A 2JD1A 1JQBA 4Y6PA 1YGYA 2JKVA 1M66A 1YONA 1CRWG 4W7HA 1DJQA 3RKRA 1LSUA 2QYSA 4BNKA 2ZB3A 2IRWA 3D5TA 1OOEA 3PHGA 4CV0A 1VKNA 5IFLA 1EZ4A 2G1UA 3LT0A 4IIVA 4YB8A 5C7LO 5AVOA 1DBVO 1A71A 4GSLA 1DRUA 1PQWA 4GGPA 3DBLA 2NWQA 3Q3CA 4DBZA 2ZYAA 3WFIA 2RBEA 5G0UA 3VZRA 2BMAA 2B5WA 1IPEA 2J3HA 4WCFB 8ADHA 3NTRA 4WNCA 3JQAD 5AOVA 5T67A 1TB4A 3PDUA 5EN4A 4CLEA 1GFSA 3PP8A 4HADA 4W82A 3JD4A 1T24A 1V35A 2QRJA 3HB5X 3C1AA 3LC7O 1DIBA 1Y5RA 5F1OA 1H93A 1G6KA 1HT0A 3GPIA 4RO0A 4CQMA 3GVHA 4HXYA 4B8ZA 3DHEA 3DOOA 3KSZO 3MOIA 4CLHA 1GL3A 1ZFNA 4FD3A 4MIOA 5AQ1A 1R16A 2HO5A 4EJ0A 1CYDA 3HWRA 4RPGA 4ALJA 4BNZA 2VQ3A 1SB9A 1NPTO 5G4KA 3DTYA 3HDJA 1B2LA 2YHIA 9LDBA 1PTJA 5H81A 1Z82A 1EEHA 3CUKA 4MVJH 1UXIA 3FBGA 3RFTA 4R9SA 2PKRA 3I83A 1W73A 4CPDA 4LSWA 4XR4A 5TT1A 1T2EA 5IAAA 1GR0A 3GZNB 4EEZA 4ZGWA 3I23A 2GYYA 1ISHA 3W4KA 2YV2A 3RFVA 1NFQA 4RVHA 1U2DA 1HZJA 3N74A 4CMKA 3GR6A 1NHGA 1JAYA 3IQDB 3ZW9A 2AQ8A 2VRCD 4H15A 3WYCA 1SEPA 3QVTA 2B37A 3GGOA 4IJUA 4J9UE 1ISFA 5TNXA 3NEPX 3V5NA 3DC2A 1I36A 3FR8A 3OJLA 5F5NA 3KOUA 2LDXA 2WD7A 2ZTMA 5A5EA 3PWKA 5AXCA 2FOIA 4ITUA 2R2GA 5TIIA 3BTUA 3VPFA 4BNJA 1NR7A 1GYPA 1U4SA 1NBOA 2Q50A 3QHAA 4W9NA 4XQCA 4OQYA 3GDFA 2OORA 1MC4A 3VVBA 2I67A 1PS9A 3Q9NA 3RC2A 2UDPA 2VWQA 3RUHA 4NBVA 3HFGA 2X9NA 4E4YA 4I5FA 1RYDA 4EBFA 1P44A 4BO1A 3E9QA 5ADHA 3RC7A 1BHSA 3PFFA 4RLSA 5HRUA 4RZIA 2BGLA 5CDSA 1H5QA 2CMDA 4FPXA 3ADOA 4ZQEA 4EW6A 1DRVA 3WMXA 2VHVA 1MC5A 2PD4A 3EGOA 3PK0A 1N1GA 3RASA 5TGDA 4FFPA 2AG8A 3T4EA 5A1TA 1GCOA 2GASA 3KETA 1B7GO 4CQLB 4YYZA 3QWAA 1SO8A 1HDGO 1MXFA 2AHRA 3IDSA 5FI5A 1EMDA 4CR8A 1NAHA 1QYWA 4Y98A 1CQJA 1BDMA 1DO8A 3PIIA 4Q3EA 4XQEA 2YZ7A 4CM4B 4D43A 4DTIA 3L4SO 1FMCA 1C1XA 3H5AA 2CNBA 2Q4EA 4D46A 4WJZA 4O0LA 2OXIA 1F17A 3U4IA 4YJHB 1ZK4A 3JQ7B 4FN4A 3HHPA 2P4HX 3ANMA 3EVNA 5JFOA 1PQUA 3NDRA 2C2XA 4FQ8A 3GEGA 2P5YA 1Y9AA 3LC2O 4TSKA 3ONEA 5MDHA 5JSFA 1QR6A 1U3TA 2EKLA 4CM7A 4D44A 1ULSA 2V65A 3ENKA 1VRWA 1NR1A 2NVUB 5CEFA 2X0IA 2YV3A 1YOVA 2B4RO 4UEOA 1E6WA 1SOVA 4JBIA 1ZJYA 3I1JA 3RROA 4IDEA 1ZK2A 2AEMA 4HNHA 3TZKA 2GZ2A 3VHRA 3U09A 4IPTA 2WYUA 3FRJA 3QIVA 2ZTUA 4MVJE 3GAZA 1HZZA 1I2CA 4HFNA 4R5MA 7ADHA 2IZ0A 3ROMA 5KVCA 1U5AA 3GEMA 4XDZA 1YB4A 1EBFA 4CM6A 2CDCA 3WICA 4GWGA 2JHGA 4DLLA 4UVHA 1CWUA 5EPOA 1Q7GA 1OMOA 4E5YA 3D1LA 4IDFA 2QQ5A 3DAPA 3JYPA 2Y1OA 4QO7A 4CL3A 3DBVO 3KRTA 3ZWMA 4CM8B 1QKIA 1LX6A 2BF7A 2IE0A 2BI7A 2JL1A 1N2SA 1RM4A 3JQBC 5DBGA 5AYVA 1EK6A 3ENNA 4OIMA 3WGHA 1PU2A 1CJCA 3U9LA 2DQ4A 1PJ3A 2NACA 5L9AA 2YDXA 3JTMA 3M1LA 4IDGA 4ND3A 4BKUA 1MG5A 1YJQA 1E7WA 4OXKA 4TWRA 5IZCA 3QA9A 3ITDA 3BMQB 3JQAA 3PWSA 2C07A 1NX6A 4FC6A 4CL8A 4YR9A 4M54A 2GERA 5L4LA 1UXKA 1WDLA 4RZHA 5CHEA 2Q2VA 1J4AA 2BKAA 5G0WA 2VZ0A 3RSHA 1DEHA 2IEDA 5DOZA 5DP1A 3ZWXA 4IQ0A 1XDWA 3D5QA 1HRDA 3EZLA 4DWVA 1E1KA 3OEYA 4GH5A 5ER9A 4AJ2A 3WGOA 3TOXA 3Q11A 3ZHXA 3VAZA 1BXZA 5DCYA 4E5NA 3LYLA 1X13A 4J1QA 4JGBA 1ZBQA 1JN0A 2NQTA 4OOFA 3SVTA 4IJWA 2JD2A 1HETA 4G81A 1RM0A 3JQBA 4NMHA 4WEOA 3I9JA 3QWIA 1R15A 4J7XA 4BO9A 3UGKA 1CIVA 1Z74A 1N7GA 5F1PA 1O8CA 1LLUA 1QG6A 4ID9A 4D41A 5BNFA 2E4AA 4FFLA 2FSSA 1VJ1A 3O8QB 1A4IA 4OAQA 2QG4A 3F47A 3DFZA 5JAQA 3VZPA 1ARZA 1JKIA 3P2YA 1E92A 4R1SA 3LLVA 1LC0A 2X58A 2VRCA 3T7CA 2FSVA 2VRBA 3PDJA 1Y8QB 4WCFC 3ROQA 1XR3A 4WE3A 3GGPA 3GVCA 2QW8A 3HADA 2JCYA 2FPPA 4A5OA 1OC4A 1I33A 3D4OA 1LA2A 2GO1A 3T7EA 4YQZA 4CMIA 4UVEA 5BSGA 3I4CA 4ALIA 3GN2A 3GVXA 1H9AA 3ZWOA 2FWMX 1MB4A 4OXYA 4CLRB 3PHLA 1OBFO 4HFRA 4ND4A 3RD5A 3F1LA 3PXXA 2EF1A 1GYQA 4JP2A 1EQ2A 2AQIA 4B7CA 2GGSA 3S8MA 1YO6A 5L4NA 2Q45A 2BFOA 3I6QA 3GNSA 4NZ9A 4NK4A 3SC6A 5FI3A 3SC4A 3HN7A 5IN4A 4YXFA 3DBLB 3DZBA 2VCYA 1LJ8A 4WEQA 2QX7A 3E8XA 3ONFA 3FTNA 2CVOA 1PZFA 1YXMA 2EKQA 5KOIA 4BKRA 5EMHA 3GVPA 2VUSA 1YBVA 4WCFA 5CP8A 3WGTA 2PKQO 1A9YA 5THQA 2NVWA 4MVJP 1MV8A 4CUKA 1KERA 4QQRA 4CODB 9LDTA 4AVYA 4FC7A 2FMUA 4PIVA 4B3IA 5T57A 1ZXBA 3IUPA 3VTZA 4I8XA 1WP4A 4BNTA 4CQMB 2OFPA 2Q4BA 4ALNA 4ZU3A 4JX8A 1T1RA 4R4JA 2O3UA 3AW9A 1KC1A 2JFGA 1Z45A 4JJFA 5JAIA 1YE3A 4KTVE 1DJNA 2Q1TA 3X2FA 1NHWA 1YDEA 3B1FA 1DLIA 3H9QA 1D7OA 3JV7A 4GGOA 3HQ4O 1GYRA 3UKOA 2X22A 2NNLD 3H4VA 4KDEA 4GLLA 4LRTB 5G4KB 1DLJA 1RPNA 3WB9A 4L76A 1R4MB 1IE3A 3H3FA 3GT0A 4BNYA 4DPLA 1ONPA 2YHIB 4RF4A 1EVZA 2BI8A 3SJ7A 5U9CA 1GZ4A 2HDHA 4JCOA 2GRAA 1E3EA 1U3VA 2O7SA 2XAAA 3PYLA 2O48X 3GZNA 3UW3A 3WQSB 4CMEA 4DLAA 5JCJD 1OZAA 2VYNA 2JJYA 5JAZA 4BNNA 1KVTA 3QJ5A 2WDZA 3TZ6A 3VTFA 4GL4A 4WOKA 2PK3A 3Q0EA 2NTJA 1DIGA 4IDCA 2HSDA 1NVTA 1PJTA 4G5HA 4PG8A 4ILKA 4CMGA 4Q3BA 4S1VA 4B4UA 2WD7B 4CMBA 1X7DA 2ZTVA 1LNQA 4NBTA 2RAFA 4QX6A 4WLEA 3GNTA 3CXRA 5JC1A 5DBIA 4JXKA 1IYZA 3PEFA 1ZUD1 4OOEA 5I9LA 3E48A 3OJOA 1A72A 1ORRA 3DAFA 4BV9A 1HE5A 3A28A 5EERA 1EVJA 2EP7A 3E9MA 2J3JA 5CDGA 1R0SA 3V1TC 1V6AA 3GDGA 4QSMA 3TSCA 3ZNOA 1PEDA 5K9ZA 4R41A 4YWJA 5A9TA 2Y1GA 4HWKA 5CPFA 4NU5A 3V2UA 5JDCC 2C82A 4L4RA 5JE8A 4R16A 1LDEA 1M67A 3F9IA 4WPGA 3WIDA 4ESOA 1AUPA 3SXPA 3FSRA 1UDCA 1GUYA 4MPDA 5U4QA 1PIWA 3WIEA 1GQ2A 4AJOA 4O59O 5G4LA 2HK9A 4L8VA 5ICSA 5A02A 1AHHA 3TDKA 4Y9DA 2HJSA 3VZSA 1U2GA 4R54A 1ID1A 1PGJA 3U0BA 4LGVA 3KUXA 4H7PA 4R1NA 3ZV6A 1E7SA 2OBYA 3O4RA 1F8FA 1HYGA 1V9LA 1Y7TA 3AY3A 4XYGA 1ML3A 5TF4A 1D1SA 4XGIA 5L53A 2Y0EA 4FFRA 2QRLA 5A3JA 4YT8A 2AQHA 2VZ8A 2Q99A 1C14A 4PLHA 1LI4A 3AM5A 3S2EA 2WE7A 1D8AA 4Y6SA 3LT4A 1H2HA 1VI2A 4GAEA 4NI5A 1UH5A 3PZBA 5JMPA 4XRGA 3K92A 3L4BC 1CDOA 2Y1CA 3ZHZA 3FTPA 5I9MA 3JQGA 2X5JO 4UEJA 4WK6A 4MVJF 3OQ6A 1X7HA 2GD1O 3GVIA 1FDTA 2A92A 1PJSA 2GF2A 3WWYA 1O89A 4E31A 4PLFA 3JQ8A 4IUYA 5ITWA 2IXAA 2OO5A 4WKGA 4KQXA 1E3SA 1KEUA 1BDBA 1NFRA 2NVUA 3WGIA 3GC6A 1BMDA 4NJMA 2OBNA 2NUAA 5AXDA 2CDAA 1UZMA 4Z9YA 2H1SA 3RQSA 3AUSA 3OH8A 3BTSA 3TJRA 2I5PO 4R9RA 4CR6A 4OH1A 1NTOA 1EBUA 1DDOA 2O4CA 4BNIA 2WEKA 4OSPA 3NX4A 4D3DA 4IXTA 3BMCB 3G1UA 1HDCA 5DT9A 5ILGA 1C0LA 2H9IA 3L4BA 3BTOA 4CV2A 3Q1LA 2NU7A 3E5RA 1ZJZA 3ZV3A 3VDRA 1LEHA 1UP7A 2RHRA 2VZ9A 1Y5MA 4CM8A 4PVCA 2E37A 4FCCA 4FS3A 2DC1A 5JYEA 1YQDA 5HTOA 3KTDA 3K9QO 2WD8A 1JU9A 3FNGA 2PFGA 3W4IA 2DTXA 3ZWVA 1U1IA 2CVQA 2DT5A 3WLFA 5A04A 1EUDA 2X5OA 3ZU3A 3BMQA 4U8GA 4A2CA 3G0OA 3KSDO 3WNQA 4LRSB 4YAGA 4LCJA 1TI7A 1LXCA 5JW6A 4BV8A 1QSGA 1KY4A 1HE4A 2HCTA 1PGPA 5THKA 3LQFA 4RVGA 3K96A 3MTJA 2CF6A 1XCBA 3C7DB 3I9NA 4XQ9A 1IL0A 3NV9A 4YT5A 1U4OA 2AMFA 3HZZA 2A94A 3RFXA 1U28A 2ZB4A 3DQPA 3QVXA 4PZDA 1D3AA 4LK3A 3R1IA 3GLQA 4RVUA 3MJTA 1PJCA 4IS3A 4EUEA 2DBZA 3DMTA 3K2BA 1H9BA 1HF3A 3VPGA 2W4QA 4E2WA 2VUTA 1A9ZA 1PWZA 4PLPA 2C5AA 2X0RA 1KEWA 5DZSA 3RU9A 2PNFA 5TT0A 4DIBA 1HLPA 2BH9A 4GX2A 3DBHA 3ICCA 3KYDB 3ORFA 2FRDA 2Y0DA 4NK5A 4B4OA 5BNIA 2EXXA 2HRZA 2DM6A 4XB2A 3L9XA 2V7PA 4CV1A 1WNTA 3O8QA 5CDUA 1UZNA 1LC3A 2NSDA 4R1UA 2H5LA 3BHMA 4JBHA 3I9KA 1UXGA 4KWIA 4E13A 1Y8QA 1E7MA 1DFHA 4BKOA 2HLPA 1P1RA 3MEQA 3N58A 2O3JA 1NPDA 4CMIB 2W90A 5BQFA 4FIZA 1MUUA 1E3LA 3OIFA 5A05A 1B3BA 1YQXA 4Q3DA 3DBRA 1NFFA 1FDSA 4KUGA 3RIHA 4HP8A 3CMCO 3NTOA 2P5UA 4E5PA 4B7UA 4YQYA 1WMBA 3AY7A 3C1OA 1UAYA 4HX5A 2C7GA 1HDXA 2OHXA 4D3FA 2B69A 2GCGA 5KTKA 3IJPA 1Y81A 3FCOA 3NUGA 4WASA 3AU9A 4DQVA 4FOOA 4WNIA 4HBGA 3VH2A 4I5GA 1BG6A 5KKAA 3LK7A 3M2PA 1V3UA 4J1TA 3GF4A 1LSOA 2Y1DA 2VTDA 5ENDA 5L3ZA 3ETEA 3I5MA 5ICMA 1L7DA 5BSEA 4LW8A 5TSDA 3FPLA 3CE6A 3V1UA 5L40A 4BIIA 3S55A 3GA0A 1MFPA 2RCYA 5CDTA 1SB8A 1IOLA 3HE3A 1GV0A 1YKFA 2E48A 5K0ZA 1K2WA 1VSUA 5I8WA 3PQEA 2OZPA 4I5EA 2GUGA 5T8KA 5IJZA 4JP3A 4YAEA 2OMEA 3ZWNA 2HMSA 4R51A 2HKIA 2Q46A 2F1KA 1QORA 4BVAA 4W9NC 3U4DA 1VJ0A 1YS4A 2O7QA 4B4WA 3I9MA 4L9RA 4EITA 4U6QA 1GCUA 4TROA 1R4MA 1QP8A 3LLSA 2V6FA 4F6CA 1I01A 3H9UA 4EYEA 4E5MA 3FF4A 1O95A 3VOSA 2AQKA 1O9BA 3VH1A 3GGGA 2VWPA 1HXHA 1XHLA 4TQGA 5JYDA 2AE2A 1RM5A 1MXHA 5ILOA 4RF3A 1HE3A 3STHA 3RJ9A 1HDYA 1I8TA 1XLTA 1PX0A 3PI7A 1AGNA 3KYBA 2X1HA 1LRLA 1GU7A 1FDUA 1BXKA 4RVSA 1TLTA 1DHRA 2V6BA 5COBA 2B4QA 1UXHA 1ZK0A 3IKVA 1EK5A 4NFSA 1GQYA 5TLSA 2VNSA 1PJ4A 3PWZA 4DBVO 3LDHA 4KMSA 1EQUA 2CZCA 5EL0A 2NU8A 4AL4A 4TRJA 1KVQA 4BNVA 4BL5A 3R0IA 3Q2IA 4IDAA 1A4UA 3FN4A 2GDZA 3ASVA 4CMCA 2X5KO 3DZKA 5A4DA 4FFMA 1SPXA 4D79A 3V8BA 4AJKA 4CLOA 1T1SA 1K89A 3S1LA 2W98A 5LDHA 1B8VA 4P38A 1HE2A 3DAGA 4CM3A 2X23A 3I4FA 1GPJA 1AXGA 2GR9A 1E5QA 4A73A 2OUIA 5JS6A 3D4PA 4MOWA 3I9OA 1P0FA 3GRKA 5L4SA 1P0CA 3ANNA 3TN7A 1HKUA 5JBIA 1ZKMA 2NTNA 1X0VA 3WYEA 1EUZA 3P2OA 2HMTA 4TKLA 5IDQA 1XSEA 5TX7A 4MVJD 3AFNA 4W6ZA 2FR0A 2CF5A 5EINA 3L9WA 1LSSA 2BELA 1E3IA 4Y67A 3TQHA 1P1FA 4E2ZA 3H2ZA 1WW8A 3QE3A 1C0KA 4YAJA 1SEVA 4NBRA 1PGNA 2C54A 3MJCA 4EI2A 3K5PA 3OA2A 1XEAA 3JQGB 4RV9A 3D64A 5TQVA 4XA8A 1TVEA 1F0YA 3VZQA 4BO5A 2ZYDA 3WJ7A 5C5IA 4E21A 3JQ8B 4GVXA 2QYTA 1C0IA 1I2BA 4TRNA 4N7RA 3RKUA 3ST7A 2YDYA 1KC3A 4IBOA 4GX0A 4MDHA 1VC2A 1TT5B 4FFNA 2GLXA 4NJMB 5IZCC 5B4UA 4RLHA 1PL8A 4AFNA 3GN1A 4FW8A 2BLLA 4IZHA 2EEZA 2GN9A 3KBOA 3F4LA 3C1TA 1LQUA 2GZ3A 1N1EA 2ZIZA 1ZMTA 1ENPA 1PJLA 2WSBA 1E0DA 1OAAA 4J0FA 4PG7A 4DIFA 4MIEA 4R01A 2I76A 5F3RA 1BGVA 1IHXA 2UUPA 1PZEA 1R12A 2H63A 1U5CA 4G65A 5C7OO 4OYRA 3KLPX 4GLOA 3DHNA 1S6YA 2YV1A 3ZNNA 3VVCA 4AJEA 1BSVA 5EQDA 3EUWA 3BMCA 5FF9A 1ENYA 1QLHA 4KDFA 4BMSA 4RDHA 3L0DA 2PD3A 3ZWWA 4FJ0A 4BGEA 1HL3A 4L75A 5JDIC 1XGKA 4RVFA 1MA0A 2VWGA 3IIEA 3JD0A 3M6IA 1H2BA 2XPCA 4O1MA 1ZEJA 3RAJA 1I5RA 2I3GA 3G49A 3WS7A 4J7UA 1F12A 1ZW1A 5COAA 2WYVA 5BNTA 4IIUA 4NBUA 4RL6A 1S7CA 3I9LA 2GN6A 3VDQA 5GZ1A 4H16A 3KYCA 4OQZA 4EGFA 1Q0HA 2ZCVA 4MP3A 2B4TO 1ZCJA 1E1NA 4JJIA 3ZWYA 4YACA 4IQ8A 1TEHA 4UUOA 3O9ZA 1DB3A 1NQ5A 1YH3A 2Q3EA 3DFUA 2V6MA 1GV1A 5COQA 4KZPA 1WLYA 1Q1NA 3OBBA 4LN1A 2X0NA 2YQ4A 4RF5A 1TA4A 1DC4A 5KJFA 1X14A 4XZ3A 3G17A 3Q6IA 2FZWA 3U62A 3IC5A 4J4BA 3DTTA 3EY4A 3QQPA 5BR7A 5J23A 3CSDA 4FB5A 2X8LA 4DMLA 1B14A 2PR2A 4MKZA 5JDIA 1X0XA 2NU9A 1PZHA 1VJTA 4E0BA 4ZQHA 1Z7BA 4MIYA 4M49A 4FFOA 5JPIA 3T4XA 4GWKA 2HU2A 1FXSA 3BTVA 5BT9A 3DBHB 3KYDA 3ANLA 2VYVD 3C85A 3GZ4A 2X6TA 1UAGA 1XG5A 1DRWA 1E3WB 3HDYA 3DZHA 3IUSA 4NPCA 2VOEA 2JCXA 2PZJA 4NG5A 1LSJA 1JTVA 4DL9A 5JY6A 4E2XA 2OP1A 3D3WB 4G2NA 1VL8A 4C7KA 4KWHA 4N5LA 4PLWA 4WECA 4LMPA 4XIJA 1VKOA 1UJMA 3ZI0A 2Y05A 3JYNA 4UUMA 2WMDA 1YB1A 1CQIA 2PZKA 4J3FA 2CVZA 4JLWA 4K26A 1Q2XA 1QV6A 2NQ8A 4GPD1 3BA1A 5A5FA 1O0SA 3W8DA 1NM5A 3W6ZA 1GUFA 5B12A 2OGUA 2C59A 3S2FA 3WGGA 1XIVA 3WR5A 3DBRB 3PQFA 4UVDA 3VC7A 4IMPA 4ND5A 3NAQA 3ONDA 4B8WA 3VPSA 3ETDA 4TZTA 3ROKA 4J9VA 4PRKA 1LU9A 4EZBA 4E32A 4YVFA 3GRPA 5L51A 3NRCA 1V8BA 1ADFA 4XD2A 3OFSA 1B26A 4QEDA 5KNLA 1VPDA 3EDMA 1DHTA 2XXBA 3GFBA 4BO4A 4TKMA 5HS4A 4BNFA 1JVSA 1MG0A 1DSSG 2QIOA 2A35A 3AJRA 4CM9D 3UN1A 1UR5A 3AK4A 1PSDA 3JSAA 1P1IA 2DTEA 3PHIA 3UICA 2HK8A 5KIAA 2P9GA 3TZCA 3OECA 4YAIA 4CMEC 1X15A 1ZVMA 2VHZA 2Q49A 2DPHA 3WLEA 4E5KA 2CUKA 3KHUA 4AJHA 4PVDA 3C24A 2GN8A 2P2SA 4F45A 1MX3A 3MJEA 3FWNA 3F46A 2AW5A 5DN9A 2CFCA 2ZB7A 2IODA 4NU6A 4MVJA 4UAGA 3AOEA 2NVBA 1DFGA 1SCUA 2PH3A 2HQ1A 3P19A 3WQQA 1XU7A 4NNJA 1C3VA 4TRMA 2BRUA 2B0JA 4AJIA 4BS9A 4M86A 5JAMA 2DBVO 3OIGA 3WFJA 4X54A 3QV1A 1VSVA 4W4TA 4BMNA 5KJ1A 2NTVA 1BVUA 2P9CA 5JMWA 2W2KA 1NWCA 6ADHA 2CSUA 3K31A 4J0EA 3W6UA 2Q1UA 3JQCA 4IDBA 1R0KA 3WGZA 4O5OA 4KTTE 4YCAA 4PG4A 2TMDA 3ZNPA 4JIGA 1KY5A 1E7YA 1X1TA 1YDWA 2G0TA 3OA0A 3H5RA 1UUFA 5HM8A 1AE1A 2P91A 3F3SA 3KVOA 1DFIA 5JLAA 3IS3A 4J4HA 1BTOA 4MINA 2ZQYA 5L7YA 5G2OA 3FNEA 3ZH2A 1I24A 3B1JA 4INAA 1E1MA 3ZWAA 4RDIA 4A26A 5L7WA 2VT3A 1YL6A 3OQBA 4U0JA 4UVIA 3BZUA 2BHLA 2EP5A 2YYYA 4BKPA 4CJXA 1HLDA 1O6ZA 1P77A 3DZJA 3PYMA 1E5LA 3H8VA 2BGKA 4J43A 2A4KA 1J49A 1NNUA 3OICA 1ZZEA 4IM7A 4K9DA 4RPLA 5CAEA 1NPYA 3ZU5A 5KVVA 3IAHA 1U7HA 1GEGA 3NGLA 3SLGA 1ONNA 1QMGA 2D0IA 2EV9A 3AUAA 3WBFA 4PN3A 2GN4A 4FBGA 4CLOB 1BW9A 1PS0A 3GEDA 1DC3A 3GUYA 4QTZA 3TPCA 4Z0PA 2Y1EA 4RGBA 1NASA 4RQUA 1LLDA 4J1SA 4RPHA 4L0QA 4E3ZA 1OI7A 4RPKA 2VWHA 4IGFA 2IXBA 4OXNA 3RUIA 1U8XX 3UCXA 2JAPA 3MJSA 4KUEA 4Z0TA 1ZEMA 1V3VA 5GZ6A 3ADPA 4AJ4A 2VNAA 5K6AA 1ZK1A 3BMNA 2J5QA 5B4VA 1M6HA 1IHYA 3PZRA 2H6EA 4BGVA 3IKTA 1DXYA 1ADCA 1E6EA 4E12A 1I3MA 1B0AA 2HMVA 4J1NA 1XU9A 2EHDA 2D59A 1PGOA 2Z1NA 3TL2A 3KB6A 5DP2A 3WTCA 1NQAO 3DDNA 3GHHA 1ADGA 4XWYA 4U5QA 3DEYX 1IB6A 3AOGA 4J7CA 4NR0A 5CG1A 1R6DA 2VHYA 2BFMA 1H6AA 4QXMA 3E18A 2J8ZA 1RJWA 2AXQA 2DPGA 2YFQA 2GSDA 5HS6A 2HMWA 3RUFA 5KJEA 3L07A 3EC7A 2IYPA 3TZQA 1NYTA 4D45A 2RH8A 4KP7A 1G1AA 1KVSA 1YWGO 2A9FA 4WUVA 3VKUA 2X4GA 4PLCA 3CINA 3H3JA 3H65A 2SCUA 3WOHA 1TT5A 1JDJA 3RC9A 3S2IA 3U4CA 1GEEA 3ZW8A 4BB6A 3KV3O 1LRJA 3H2SA 2FY8A 1A7AA 4ALMA 1MLDA 3LZ6A 1BVRA 1EVYA 4U0KA 4YTEA 3PLNA 3HNPA 1W4ZA 4J16A 4BHTA 1Y1PA 3HUDA 2DU8A 1T2DA 1K6XA 2ZATA 2X86A 4L73A 1C1DB 4IINA 1U9JA 1ZXLA 2FPGA 3MCVA 4M55A 4RVDA 4A10A 3O38A 4GSKA 1N9GA 4PLGA 2HAEA 2YHUA 1U8FO 3CPSA 1JKFA 4BNXA 5KJ6A 1L7EA 3DMTC 1QXSA 1LTHR 1V3TA 1IPFA 4XB1A 1O5IA 1Q0LA 3BAZA 1PZGA 1IY8A 4YT2A 5B1YA 1LBEA 4MKRA 5IG2A 4DRYA 4CM9A 1WPQA 1B15A 4C7JA 4B4VA 3L77A 4HY3A 3OP4A 3QW2A 4I9NA 4PRLA 3KYCB 3W8FA 4PLYA 4NFHA 1P1KA 4U7WA 1PJ2A 5ES3A 3GQVA 4XYBA 3H5NA 3WBBA 3WJAA 3L6OO 2V6GA 3O26A 1ADBA 3MJ4A 4DREA 4CR7A 5TJ9A 2PA3A 1C0PA 3QWFA 3QVOA 4TVBA 3JQ6A 5T64A 3JQEA 3JQFA 1X7GA 1JWBB 1R4NB 2TMGA 3H6KA 4E2YA 4JROA 1W8DA 2AA3A 3B6ZA 3E82A 1I3NA 1ZIDA 2DBRA 1SZJG 3DZFA 3I6IA 5EJ2A 5DCUA 4ALLA 2PZMA 4IJKA 4LVUA 4MJLA 1BXGB 1Y6JA 3K30A 1IULA 4PG5A 4BB5A 1UXJA 4LVCA 4OM8A 5C7IO 2D4AA 4Z9FA 2VHXA 7MDHA 1GPDG 3PHHA 3FD8A 1MP0A 4FGWA 3HG7A 3L6EA 2HRBA 4YJGA 5CEEA 3D4NA 1Q7BA 5EESA 2RH4A 1XWFA 1E3WA 1AXEA 1N8KA 1P1JA 2B83A 5JCJA 2JFFA 1TXGA 4UUNA 4BNGA 2EJVA 3D3WA 1RM3A 1B16A 1G0OA 1R66A 1P9LA 4KQWA 2VTEA 4QUKA 4L74A 1T4DA 2EG9A 2ZK7A 1VM6A 1N5DA 3AFMA 2O50A 3ZWBA 3V2HA 2O3QA 3OMLA 3HN2A 4URFA 3ZGYA 4B3JA 4TVOA 3UXYA 4WLUA 1XQ6A 3ULKA 4HV4A 1KEPA 2BFAA 2PD6A 4GX5A 4OKNA 4CMHA 4BNMA 1HYHA 1H94A 1GZ3A 3GG2A 5KVQA 1J5PA 2D8AA 3QVSA 4II3A 4DXHA 4K1LA 1N92A 1T2CA 4DLBA 4Z3KA 4FSHA 3K8ZA 1V0JA 4D0RA 3IP1A 1ISMA 3INTA 5EQFA 4JNKA 4MVJG 4GKVA 3HDHA 5T8KC 1ZK3A 2C20A 1ZH8A 5DULA 2W2LD 3AI3A 3E5MA 5KCZA 4XEHA 1NQOA 1VLLA 1WDKA 1DC5A 3WGQA 2HMUA 1QLJA 3BMOA 4LSMA 1GZ6A 3W4JA 2R00A 1E77A 3OHSX 1EE2A 5GMOA 3JYOA 1NAIA 4IXWA 4PLZA 1LLQA 5JO0A 3BYZA 2NLOA 4NHEA 3EW7A 5A9SB 1CF2O 1DOHA 5TS3A 2I65A 3UH1A 1ENZA 4AJPA 1CERA 4UVGA 4W7IA 3LVFO 3RUAA 4PLTA 3NJ8A 1JAXA 3GUCA 3PVZA 1SC6A 5C3MA 4N54A 4ZRMA 3NDIA 3U3XA 1VL0A 3TF5A 3I52A 1EDOA 1Z7EA 4BUCA 5JXWA 2DUUA 5L95A 3RCBA 4ZA2A 1KIFA 4HFMA 1GY8A 2PKQP 3R3JA 3W8EA 3LF1A 2FZEA 3VKVA 4ROSA 4F3YA 5I9NA 4XYMA 2EKPA 2DLDA 3RBVA 1Y8RB 2C0CA 3UVEA 4DC1A 2EGHA 5I7VA 1KS9A 3DZGA 1I2ZA 4WLVA 1JVBA 1WMAA 2X9VA 3EZYA 1QYVA 1LUAA 2J5RA 2DTDA 5KKCA 3WWZA 2W2KB 2AE1A 3HFSA 1LQTA 3G79A 2PTGA 1U3WA 2UVDA 4MKXA 3UHAA 1IUKA 1ISJA 5A06A 2NADA 3KM0A 4TRRA 1I32A 3ETGA 2EERA 5G0TA 1M76A 1CEQA 2IZ1A 3PQDA 3ZV4A 4H3VA 3GY0A 3WNVA 3DWFA 4I9HA 4ND2A 4BKQA 2WE8A 3CH6A 4P4NA 3IJRA 1ZSNA 2PZLA 3COSA 3INGA 5TRTA 2D3TA 2G82A 5DF1A 2I6TA 3OJEA 3JQDA 3E6AA 5JNLA 2E82A 5FWNA 4DIOA 1YVEI 4IS2A 3TFQA 3RWBA 3B70A 4MVJI 1HDZA 2ILTA 1AN9A 3JYQA 4JBGA 5BSFA 1J6UA 1XQ1A 2P9EA 2J3KA 2C5EA 2GZ1A 1LDBA 3DONA 2DAPA 3A14A 2B5VA 4Q9NA 4N5NA 5ITVA 1OFGA 4P22A 1GD1O 3PJFA 3CMMA 3GDOA 4IGEA 5A9RA 3DOCA 3FI9A 4RF2A 4DPMA 1KOLA 3WGYA 1BW9B 3TZHA 2Q1SA 4JK3A 3SLKA 2ZJ0A 3QSGA 4NIMA 3AI1A 1D4FA 1H6CA 3F1KA 3OJ0A 4OMUA 4QO8A 3SBOA 4BNUA 3TNLA 5L7TA 5JCXA 3DZIA 3ZWPA 4J91A 1HYEA 3BMNB 4A7PA 2YY7A 3R6DA 3ZCXA 1QRRA 3E1KA 1H6BA 5HA5A 4J49A 2O2YA 4DYVA 4XX0A 4XYLA 4N5MA 2Y99A 2JFHA 1PS8A 1E6UA 3PGXA 2DFVA 4QFCA 1T2FA 2OL4A 3LT1A 1Q0QA 2IZZA 5T6BA 5ENVA 1SOWA 3FBTA 3GH3A 1FJHA 3A1NA 4M8SA 1E7RA 1WXDA 1AHIA 2BFPA 5IDYA 1YBAA 2FPIA 2ZJ1A 1DAOA 1SMKA 2I3AA 2PH5A 4WGGA 3VH4A 5A3VA 4HFJA 1QYCA 4BO8A 5CEJA 4BO2A 4D0SA 4UEKA 4C4OA 1JKJA 3WG9A 4RPJA 3ZU2A 2DVMA 4IJVA 4KOAA 4NQZA 4PGFA 3BXXA 3PFWO 5DBFA 1UDBA 4YJDA 3LC1O 1K3TA 2EW2A 1QYXA 3GG9A 3NT5A 4BNLA 3DXFA 1UP6A 2Q1WA 2F00A 5ER6A 5TC4A 3G1TA 1JW9B 2EJWA 3NT4A 1DIRA 3QLJA 3B20A 1XELA 3GFGA 2Y93A 3R3SA 3ZHBA 1KEVA 4K6FA 2PGDA 4R69A 3RBZA 4B7XA 3M1AA 1SBYA 1DIAA 3CTMA 1X1EA 1C1DA 4YJFA 1GAEO 4OKIA 4Z3DA 5IXSA 2W2LA 2Y1FA 2VYND 1E1LA 1N9GB 4AJJA 3RUEA 5LCXA 5GZ3A 1LDYA 3ABIA 5CFZA 4IDDA 3AM4A 2CY0A 2I9PA 3PJDA 4UULA 4BNHA 1WDMA 4DC0A 4EJMA 4F46A 2VOJA 3OETA 4ZQBA 3U49A 2FHSA 1IZ0A 2W8ZA 4PZEA 1CETA 1N7HA 4M1QA 2EW8A 3ZZNA 1KYQA 3QY9A 3ITKA 1QV7A 4Q3NA 3GAFA 1LDGA 4NFYA 2CDBA 1IZ9A 1E7QA 2RHCA 3RJ5A 4J2OA 5FEUA 2I99A 4A27A 1B3RA 3K73O 3OQ1A 1WWKA 3ZV5A 4EDFA 1PJBA 2C2YA 1HDOA 1F06A 1NP3A 2Z1MA 2HJRA 1P31A 1EFLA 3RVDA 1R4NA 3WDSA 1YQGA 1P1HA 1VL6A 4XR9A 3C7CB 4BQPA 4TMFA 5H83A 3EK2A 4I1IA 1RWBA 5U1PA 4AJ1A 3JQ9C 4CLDA 1BXGA 5JO9A 1LLCA 4XGNA 1NVGA 1HEUA 2PV7A 1PL6A 4IMRA 3WTBA 8LDHA 1H0KA 5L45A 4DMMA 1EFKA 5C37A 1T26A 5EIOA 1P74A 4DGSA 3I3OA 1VE9A 2QZZA 3PPIA 3DMYA 4YJGB 5JC8A 3A06A 3LT2A 1PL7A 3C8MA 4XIYA 5LDGA 1T25A 4OJNA 3OEWA 1LDMA 4LISA 2FR8A 2ZYGA 3V2GA 3OIDA 4J2HA 1M2WA 1ISIA 4CUJA 4HUJA 2NV6A 3N7UA 1A5ZA 2IEBA 5IZ4A 2VN8A 5HBRA 4WOJA 5FYDA 3JCZA 4FDAA 5DDIP 4CV3A 1T2AA 3AUUA 3INRA 1ZSYA 4XDYA 3DOJA 1W0CA 1YL7A 1PR9A 2CD9A 3W1VA 3H9JA 3UUWA 3FHLA 3JQ9A 1EDZA 3LSYA 4WLFA 1W6UA 2D2IA 4MP8A 4YPOA 3A9WA 3HSKA 1YJ8A 3AOEC 3GNQA 1Z75A 3WSVA 4S3MA 2ZTLA 4GMFA 2D5AA 5I7FA 3FNFA 3GMSA 2J5KA 2POQX 4DA9A 4R68A 4DYDA 3EAGA 3BMOB 3ZNQA 2NU6A 3VPHA 3B1KA 4ZRNA 4EUHA 2YQ5A 4F6LA 4WLNA 2Q2QA 5CG2A 3PIDA 4E33A 3SJUA 3IL2A 3EYWA 4I08A 1J0XO 1EUCA 1GADO 5A9SA 4YBZA 4D3SA 3FR7A 4ND1A 3D3EA 1YBMA 3KO8A 3O03A 1UDAA 1I0ZA 4CUZA 5MGBA 2EIHA 4JJGA 2IDZA 1WZIA 3KEOA 1G0NA 3AU8A 3NTQA 1WVGA 2HUNA 2YJZA 2Z95A 3L6DA 2QZ9A 1FDWA 3FWZA 1ISGA 2UV8A 4YRAA 2YW9A 1YB5A 1ONOA 2ZQZA 3LF2A 3WX0A 3TFOA 5IF3A 1FK8A 2ET6A 1SAYA 2PGJA 4K28A 4PZCA 3TRIA 4AICA 1BRMA 3EVTA 4LCEA 3NT2A 5DNAA 4DUPA 3D0OA 3JD1A 3LU1A 4Q39A 1RYEA 1Y8RA 4BO6A 1A7KA 4Y6RA 3AM3A 4CM1A 4M89A 4Q3CA 1FF9A 2EGGA 4K6CA 4BGIA 3GK3A 2D1YA 2P4QA 4ONEA 2B36A 5A03A 2JHFA 1NQTA 2OP0A 4XRRA 4U6SA 4BO0A 1GTMA 3WQRA 3ROPA 1HWYA 1I3LA 1U3UA 2X7HA 2D5CA 5H82A 4IQGA 4D42A 3OJFA 2J6IA 3MJVA 5B4TA 4ZD6A 4GKBA 5I8ZA 3GMDA 5KWEA 3QWHA 2VT2A 4YRBA 1D1TA 4QT0A 4L4SA 1E3JA 2G76A 4YRDA 3CIFA 3FNHA 3NYWA 3OF2A 1R37A 2AG5A 2O23A 3IOYA 2YFHA 4O6VA 4W99A 4XCVA 1PGQA 4HNGA 5TJHA 1A27A 1LRKA 3KEQA 3WYBA 3X2EA 4AG3A 5AXBA 4DVJA 5K6AC 1P45A 4GI2A 3EMKA 3PLRA 1F8GA 1XA0A 2FN7A 2QRKA 4GBJA 3D7LA 2AEFA 2XOXA 3CKYA 4NBWA 5DOVA 1WAMA 2FP4A 4O63O 5CPBA 3GOHA 4QECA 2O2SA 3NKLA 4JQCA 2PLAA 2X0JA 2Y0CA 4ZHSA 5F21A 1O94A 3DB2A 1KETA 2VHWA 3ZN2A 3PJGA 4ZQFA 1ZNQO 1K6JA 3FPCA 3H9GA 2WYWA 1T4BA 1ZO8A 2O3SA 1TT7A 3HB4X 3PRJA 1QYDA 3JYLA 3RUCA 5CDYA 3M2TA 1ULUA 3DR3A 1YL5A 4RQTA 3G3EA 5IN5A 4BOYA 3H7AA 4MVJM 4XJSA 2C29D 4Y8VA 3MWEB 3S2GA 2UUOA 3DHYA 1Z6ZA 4UREA 3TWOA 3ZHYA 3QP9A 2O3RA 5LC1A 3RI3A 3UOGA 4GMGA 4N18A 2WTBA 4CMJA 1NVMB 4M87A 4CMAA 3BHIA 4ALKA 2IYOA 4YDRA 4EUFA 2QHXA 3KLMX 4J4TA 3KZVA 2YUTA 1JWAB 2ZCUA 4WLOA 3ZWCA 2C7VA 4YAKA 5I7SA 4OO3A 3MTGA 1Q7CA 1EE9A 2DKNA 2DFDA 4P4LA 3NGXA 1MFZA 2UAGA 5F5LA 5IDXA 5KVSA 2OOSA 1HSOA 5T5QA 4CQLA 3P7MA 5BSHA 1M75A 1PWXA 3UFXA 2RIRA 2AEJA 3AY6A 3UAGA
chains in the Genus database with same CATH superfamily
2VHQA 2WG1A 1JDBB 4LXYA 1JEAA 4PAGA 3OFVA 3RBXA 4MGKR 3N70A 3V1YA 4CQMD 5JD6A 3HCNA 4S1NA 2ZJ5A 3QUAA 4TTAA 1JKJB 4LKOA 3PS9A 1K5HA 1K0UA 3AL0C 1GPBA 1QH8B 4U8HA 1DBIA 5IXJA 1V8ZA 4H4CA 2ZM6B 3HJUA 2R79A 2ASEA 1V47A 2PYIA 3ES9A 4JOCA 3RRFA 3UF0A 5FD8A 3OKAA 3OSUA 3R75A 3GQBB 1E69A 1KVUA 3CZCA 5B3KA 1DQPA 2NUBA 2Q27A 1NXQA 2W6JD 2I66A 2OZLA 4LC1A 1Z4QA 2XMBA 4ZVTA 1K6IA 5KJCA 2ZGVA 1SCQA 3E7PA 4TYPA 1V37A 1OLOA 1OTHA 3D6AA 1X7ZB 3OM9A 2HBZA 5EQJB 3F4KA 4Z5XA 4K3VA 3AF3A 2ZPUA 2MSDB 3C3JA 3F5QA 3FPFA 4GQAA 4FWBA 4JP8A 2C3MA 3C5WP 3ENWA 4I3GA 3JQFC 3NYQA 2XEXA 3LGSA 4CKEB 2C4UA 3TDMA 3PGJA 3PWTA 1NWHA 1I7SB 2GPTA 3HA2A 1U5BB 1N0HA 4YJFB 4N65A 3HDQA 3CZMA 2XF8A 3K6JA 4HBZA 1LPPA 2ZYIA 3WL3A 1AT1A 5K8UA 5GY7A 1KTVA 4DXDA 3OZ7A 3QVUA 5J5VA 2A88A 4R3WA 3H97A 3UJ8A 4D7AA 3NJ4A 1T6YA 4IR7A 2XCLA 3IDFA 2IHTA 3ZD8A 4KNYA 2G9QA 4TZ6A 2B7CA 3KKMA 2EAUA 1RZRA 4F72A 1ZG3A 3SEFA 1PYOA 2PY6A 1FNDA 3DV0B 1CUJA 3CIOA 3RJZA 4GDMA 4LY0A 4UAUA 1HDRA 4H4DA 4TTQA 3W06A 1OASA 4QG3A 1RU3A 1TECE 1GNLA 1NNLA 2CLCX 2YR0A 1SNYA 3FNRA 3O4JA 2XHEA 5CT6A 2PWZA 1IB0A 1Y7PA 4C0WA 4EVIA 2OBFA 2O3TA 4PG6A 1SBIA 3DH0A 5JARA 5JANA 5LWQA 2A86A 1T36B 3QVWA 4GX1A 1LJUA 5LIRA 5G0SA 1MTOA 2VJBA 1W96A 1P7ZA 2NSJA 2QTTA 2E6UX 1M6WA 2JJ8A 5FL7D 5AVSA 1YE5A 1NRXA 3GHYA 2PX0A 5KINB 1W36D 2J0EA 4MV6A 3P5SA 3MJFA 4HK4A 4IZIA 5CFOA 2JD0A 4FP9A 2BZ1A 4P80A 3ETHA 1IATA 4ZQGA 1XMXA 4PZAA 3SMQA 1FA9A 4OJTA 3ON5A 1LS6A 3BIOA 1QQBA 1JSLA 1L5KA 2BFCA 5AKYA 1YHNA 2WJPA 1C9EA 2HX1A 4GG1A 2X9GA 5CRIA 2GM3A 2LRHA 2VVTA 2FDRA 5AW4A 5HGXA 5IDWA 4B43A 4TMKA 2FPXA 4Q03A 3KJZA 2H85A 1UPAA 1Z5GA 3C97A 3QEJA 4OL9A 5CPBA 4CF5A 3PFNA 1P3DA 1F5SA 2PLWA 1EGMB 2BE9A 2JF0A 4KH1A 4AIIA 1XYGA 2QNIA 4U3JA 3EHEA 3KYJB 1QBGA 3QMPA 2AGVA 3Q2KA 1W44A 4A82A 4E1BA 1YB6A 4GR5A 3RNLA 1LB1B 3EWNA 1H5NA 3CHYA 4R98A 3PNOA 2QGFA 1BS1A 4BGUA 3TPFA 3TRJA 5BMVA 5FTLA 4ZJUA 4HYTA 4NCNA 1CJBA 3T0FA 4AJNA 5AM1A 4L22A 3FMIA 4BEVA 4RFVA 1BWSA 3LBAA 2GI4A 3T9BA 2PJDA 2JCVA 4PNPA 4HZGA 3HB7A 4BLSA 2JAXA 2JAUA 1RBMA 1UPCA 3R3ZA 3SHTA 4B44A 1QQTA 1X2EA 2OAGA 2QXYA 2YZNA 3QFRA 4AJLA 5LOVA 1KBOA 4EG8A 3PC8A 4BBPA 1BCRA 1G55A 2Y0PA 2GEUA 5CFQA 3I1FA 4JVMA 5JD5A 4NENB 1HTBA 4HDSA 4DHEA 3DF7A 3IV6A 3L43A 2NM0A 4Q47A 1J2YA 2XBLA 6Q21A 4IOMA 3H1GA 1DV1A 3N0WA 4IDQA 1U94A 4IILA 1L4UA 4C1BA 1M7HA 3SC2B 3F6YA 4C6HA 4W5RA 3GLHB 2NU6B 3VPXA 1FY2A 1Q0ZA 2DUNA 2RGGA 3FZGA 3GCZA 4M98A 5D1HA 5EFOA 3RODA 1BJKA 1K4KA 3U3ZA 4QYIA 1VTKA 5AHRA 2IW3A 4V1CB 1EK2A 2DWUA 2GNOA 4BAUA 2PT6A 4CLRA 3G7SA 4KBYA 1DPGA 1RKXA 5JASA 4Q3AA 1IQRA 3RU7A 4ZCQA 1SXJE 1VGVA 2GNPA 3IUBA 4I4CA 1YGYA 2JKVA 4Y6PA 3SJBA 1A1VA 1YONA 3RKRA 4MQEA 2MMGA 3JU3A 1M10A 2REQB 1FNMA 4M8LA 2RHMA 3OF3A 1V3QE 2AN9A 1N3LA 2ZBVA 5F52A 2IRWA 3D5TA 3IEIA 4F56A 3OJWA 4HDKA 4CV0A 1PJAA 3AESA 3QPAA 2VS1A 1O08A 3U1VA 4C5CA 4DAOA 4ZI7B 3RVBA 1PQWA 2W6QA 2PUWA 1E2KA 3Q3CA 3JALB 1C7EA 2PEYA 1K2VN 2J3DA 5DHSA 4A6PA 4REOA 3GIDA 3VZRA 2C61A 3ETLA 2BMAA 3TZLA 4AKHA 2J3HA 1VHQA 3GIWA 1RWVA 1JPJA 2ZDQA 2WIDA 2E4UA 1AKNA 1XMVA 2H1FA 2PDAA 2DX7A 2ZE6A 3BREA 3DOIA 4MX8A 4JEMA 4LHVA 4MR8A 4Q3LA 1GFSA 2J33A 4Y6QA 3VGPA 2GJ9A 3IRUA 1N2CE 2FUKA 4DIEA 3JD4A 1AS2A 1T24A 4Q9HA 1XP5A 4MW7A 1V35A 2RGNA 5MF6A 3KEGA 2VH1A 3KS9A 4EY3A 2AN3A 4PZ9A 2QUJA 1G6KA 2VATA 3OC6A 3DE7X 3QV2A 3I58A 4MHSA 3EXFB 4RO0A 1NONA 4ER7A 1XT6A 2HRRA 3ZW7A 3IV9A 3HACA 1N3BA 1F2UA 3KSZO 3L3BA 3KQMA 4CLHA 1N25A 1ZFNA 4L2IA 4ZDWA 1SVIA 1T15A 5CNMA 1E4EA 1R16A 4XVUA 2LUOA 4RSGA 4UE3S 1CYDA 3MJRA 2ANCA 3CCCA 4RPGA 3G0IA 3DMDA 3OQIA 3SX4A 3WHIA 4Q21A 2EZ9A 1KSHA 4PTZA 4BNZA 2GJSA 1O97D 3WAGA 3U60B 4XB6B 4KYTA 3HDJA 4NL4H 3NTXA 1CNMA 4ZIRB 2OCYC 4EVSA 3BDIA 1Z6QA 3NOQA 1ZVJA 5H81A 1FRQA 4ZT3A 3FBGA 3VR4A 4R2JA 4AT1A 4EO4A 1G3UA 5C9ZA 3QXJA 3I83A 1KWGA 1K1EA 1W73A 1W85A 4CPDA 2QS9A 1TYEB 1BHJA 1PDVA 3CNBA 3EE6A 3BCUA 4LXXA 1QGUA 3IAS1 3VU9B 4RTMA 5CFMA 4I14A 1QPGA 2FP4B 2V98A 1R18A 2YV2A 2E5WA 5JWHA 4B2YA 4EI7A 1DAKA 2ZRQA 2NO4A 3EOBI 3GR6A 5ALEA 1JAYA 3ZW9A 2AQ8A 4FKBA 4P31A 4H15A 3WYCA 4E08A 3Q8KA 3QVTA 1JEJA 2X0FA 3V5NA 3WLTA 5ETJA 2M98A 1APBA 3FR8A 3I9FA 1HGXA 3E58A 5K3CA 1IVNA 3THXA 4UAJA 1GTZA 1XMJA 4Z7NB 4JI0B 1SXHA 2Y27A 2IVZA 2FOIA 3NKFA 3ODGA 4ITUA 4NC9A 4GE3A 2R2GA 4IIGA 5TIIA 3BTUA 3VPFA 3MG9A 2GHTA 1VKRA 2J85A 2M6RA 2AJCA 3MT7A 3O31A 4W9NA 4TXNA 1HNXB 1IN6A 3O1IC 3GDFA 4M1WA 3THRA 1SHLA 1HOTA 1HDEA 3VR5A 3EIFA 3KT0A 3GLIB 1KZYC 3DEHA 2QTFA 4QU0A 1A82A 2ZI5A 3VVBA 1MVOA 2P1RA 2O2HA 3Q9NA 4LF5B 1DX6A 3SHOA 4A8PA 2PZFA 3IV7A 4JLAA 2FV8A 5DWDA 3RUHA 3HFGA 2AZMA 3FJ1A 4MQ4A 2HCRA 1RYDA 1ZN7A 2JI9A 3W5SA 4D74A 4H6WA 2OCGA 2QRMA 3FETA 4I4TA 3TDNA 2X8BA 3ZGLA 5HZMA 1M1YB 5ADHA 2X42A 4Q05A 1E3DA 2XXAB 2BGLA 2OM2A 3B82A 5A7HA 2SECE 1X7XA 3BKXA 3DVAB 1WCIB 1DRVA 4KYIB 2JLUA 2CV1A 3DCIA 1QHFA 2RHHA 3IIJA 1JYSA 1XXHE 5B1DA 1PR4A 5DW3A 4M7OA 3DZCA 1N1GA 3I53A 4MS3A 5TGDA 3RASA 2YWCA 4PSCA 2JNWA 3WHKA 5TMBA 4E2FA 2AG8A 3HKDB 5B3AA 2H7YA 2W2VA 2R25B 1NI5A 1JJBA 3KETA 2ZEJA 1L4EA 3DSRA 2RB4A 3QWAA 4CNQA 3S29A 1HDGO 3CJTA 2OK8A 2Z6QA 5K3FA 1JR3E 1JXQA 2NGRA 3BORA 3FFTA 3IDSA 5FI5A 1J5XA 3M9LA 4DAEA 1EMDA 4I1RA 1NAHA 4ZVNA 5JQGF 2ODPA 1D04A 2DXIA 4OI4A 4CTJA 1CQJA 5JXHA 4KXLA 4FUTA 4XQEA 4CM4B 5DMHA 1MAAA 3LGXA 4QPCA 4RIIA 5C1IA 1AQUA 4DTIA 4HQ6A 3NAZA 1R10A 1IJBA 4G89A 4QYWA 3QU7A 4Y2JA 4DSZA 4EX7A 4AI6A 1QIFA 1F17A 1SBZA 2CCKA 4D99A 1H3NA 4C6SA 4GI1A 4WXRA 3L7KA 3N2LA 3GDHA 3V4RA 5IF9A 3EVNA 5JFOA 5BN5A 2Q28A 3PFBA 4MV0A 3KXKA 5FOXA 3WGJA 4EFNA 4CEIB 1YZNA 3FWYA 3U3OA 2HA2A 3GEGA 1M74A 1C30B 2WWIA 3MUEA 3NO4A 4TSKA 4X85A 1UWLA 1P2FA 1WMFA 5KREA 2JG3A 1QF7A 1VIDA 1KFCB 1OF1A 1B93A 4D0NA 3EMVA 1NR1A 2BAGA 3NIWA 3SZOA 4WOCA 4P3YA 3GJ8A 4JCCA 4P4SB 1E6WA 1P5ZB 4R2WA 4UEOA 4DSTA 5CBKA 3AUJB 1ZJYA 3M7IA 4DMCA 1SD5A 1K86A 2AEMA 2ZE7A 4HNHA 2GZ2A 3FTQA 3CRQA 4DJDC 2YYAA 3P2MA 1ZHFA 3L8HA 1A4XA 4P7GA 4F5EA 4IPTA 3U09A 2WYUA 3QIVA 4PCLA 2ZTUA 1G4HA 3CLRD 1HZZA 4I2NA 5AJHA 3G2JA 7ADHA 1Y6GA 4ND8A 4KHPB 3UJ9A 5M7EA 4HCJA 4BEWA 3ZH9B 4AD8A 1XPOA 4A6EA 1N6RA 3FHOA 3CNLA 4XDZA 2CDCA 2XNJA 4CW7A 1UBMS 1WABA 2JHGA 2QPAA 4AMGA 1KGSA 3C6KA 4DLLA 3T3NA 3KELA 1CWUA 4QL3A 1VRCA 1V1MA 3ZX4A 4CDRA 1UFVA 4D4LA 5C8DA 5JJKA 3I9V6 4C0QC 3KWMA 4AO8A 3DAPA 4QO7A 4ZDJA 2VYQA 2FR8C 2BZGA 3N8GA 4DVGA 2DETA 4DARA 3DBVO 1RWMA 2P9BA 2BF7A 2JL1A 2BI7A 3FYHA 1DJLA 1N2SA 1VL2A 4G8BA 1D9ZA 3GCDA 5GJCA 5CK4A 2YJ5A 1PU2A 1S02A 1RI2A 1Z0SA 2DQ4A 2NACA 2RHDA 2V3WA 1FX0B 5LLSA 3M1LA 4ND3A 3OJCA 4PYKA 3C6QA 1MG5A 4KHZA 4R1PA 1EUDB 1I9GA 2R1TB 1S4QA 4B6QA 4NBKA 3BMQB 3VPBA 4D96A 3FUWA 2XTZA 1C7JA 4FC6A 3L1KA 4OUKX 4UOEA 3KZMA 5HF9A 1UXKA 5AM0A 4E1AA 4AS1A 1WDLA 4RZHA 5ALLA 4KR9A 2Q2VA 2BKAA 2SBTA 4L9AA 5G0WA 3RSHA 5TQ2A 1TJYA 5HIJA 4CCYB 5DOZA 5K20A 2R8OA 4AJ9A 5LQKA 4K9MA 1CLEA 1E1RD 2Z3WA 4DA7A 1JHYA 4PO9A 2ZUFA 3PC3A 3D5QA 1HRDA 3JZMA 1LBQA 4JJ7A 4C43A 4DWVA 1SWVA 3ZBPA 3DTVD 4FEAA 1GTVA 1ZUNA 4A91A 4AJ2A 5JZOA 2BF4A 2ZRGA 4E5NA 3LZCA 1XXLA 4M9CA 2W8BB 3LZDA 4OLFA 3UKJA 1XL1A 1JNYA 1PTKA 1ZBQA 3SVTA 4HSGA 1A5TA 1PNTA 4LJ5A 1N5OX 1UINA 5TS2A 4OA8A 3QKSA 4EVQA 1SVWA 1WOMA 2R8XA 2I2BA 1EHIA 1KA9H 4EH1A 1TUBA 3ZY4A 1CV2A 4EPTA 3NWOA 4XPZA 3UWPA 4BX9A 4U63A 1O8CA 3MWJA 1COZA 3RRJA 4DSOA 3T0GA 5B7GA 3HY6A 3CKMA 5M3BA 1M73E 2J9XB 4R40A 1DG1G 1SUBA 2QJTA 2WB4A 5JJCA 3O2NA 5CVEA 4X7MA 5JWOA 1ARZA 4R1SA 3TXYA 1LS1A 2G5PA 2P1ZA 1GNPA 3T9CA 1E3MA 1Y8QB 5ES4B 2AZDA 2QW8A 1EHCA 1RFGE 2C2OA 2FPPA 1I33A 3D4OA 4NAUA 2GEFA 3VRHA 4B0PA 3FYDA 3I2YX 3T7EA 3IO5A 1BE0A 2GTIA 3TLYA 5AUPB 4GYYA 4JP1A 4L5BA 4I6JA 3CLVA 1LW6E 4OB6A 3X1WA 3GN2A 4HVCA 3IEVA 3GVXA 5CU7A 3ZWOA 1MB4A 4YJ3B 2A1TR 3L02A 5E9JA 1J90A 4ND4A 1SM4A 3SZRA 3AKCA 1U8AA 3PXXA 3ICVA 1GYQA 2WV7A 3SDZA 1ESEA 1FQOA 3RAEC 3AYZB 1RR6A 4C3UA 2UZAA 4HX9A 1CF9A 4DT1B 5L4NA 1KMMA 2Y77A 2Q45A 4KPUB 2BFOA 1GTJ1 1PRYA 3I6QA 3GNSA 2IW1A 1F0KA 2ESRA 3LY5A 3Q4GA 2AZTA 4NK4A 5FI3A 3UMGA 5IN4A 3U4MA 1VPWA 4DANA 4MUGA 4IJ6A 3PD0A 3WKEA 2VCYA 4Q9JA 1LJ8A 3FLAA 4WEQA 3PGLA 2OQ2A 3E8XA 3ONFA 1KO5A 5KOIA 2EKQA 2F1RA 4BKRA 5EMHA 3GVPA 4EPYA 2ZIVB 5FJJA 5SZKB 2PKQO 2CMFA 5IU6A 3KAQA 4CUKA 2WJIA 1MV8A 2GZRA 3O2SB 1KERA 4QDXA 2XWBF 4ZU1X 2EYUA 4QQRA 3AIOA 4YDHB 1EBBA 9LDTA 3OQOA 3TX6A 1PL0A 3EZ9A 4AVYA 1TCCA 3LLMA 4FC7A 4TV9A 2H92A 2D1RA 5EZYF 2FMUA 4Q7QA 4B3IA 4WW0A 2HQBA 3OPYI 1TZJA 3VTZA 1NP6A 3A36A 5TEVA 4KGDA 3ZQKA 2OFPA 3A1CA 3N86A 3CLSC 1JS1X 2JRLA 1DWPA 2R4UA 4MWGA 4ETIA 1WXEA 2JFGA 4NPAA 2W4IA 1SQSA 5I7OA 4W8GA 4B2LA 1NHWA 3EVGA 1PUXA 3K9CA 2HBYA 4B2PA 1G7RA 4Z7QB 1NT4A 5BV2P 3DLHA 4P9NA 1UJNA 3FLEA 4OKSA 4GGOA 1PBTA 1W2HA 4RH1A 3EXIA 2VXOA 4KDEA 4LRTB 5AKJA 2HJGA 5G4KB 1DLJA 1X7WB 2A5DA 3DOEA 5FQOA 3BRSA 2E5FA 5H0IA 3UK6A 4D6PA 4DPLA 2RE8A 4FOPA 4BRWA 3UAXA 2IPAB 1KE2A 4Y18A 2UVQA 3FI0A 1P3JA 3IPAA 2HDHA 2WTNA 4DDUA 4QNNA 3UXEA 1YIDA 4G0XA 1KEZA 1MO2A 2Z98A 3ZJUA 4MQUA 1NC1A 1U3VA 3I76A 3OPMA 2XAAA 1EYZA 3D0KA 3HRIA 4LOIA 4Y6GB 3V32A 3MVEA 3UW3A 4Z54A 5JCJD 2J4DA 2B8WA 1PX2A 2JJYA 2VYNA 4LY6A 4BNNA 3E4DA 1UODA 4CIVA 2JIRA 3ZLJA 2XUJA 4G0YA 2XH8A 2HIGA 2I9KA 1GG9A 3HZRA 4GL4A 4RTPA 2QMYA 1AKQA 2AOTB 4F5DA 1DIGA 2HSDA 5EJ4A 2AX4A 1JG4A 2OQRA 2ZRIA 3DDCA 5B1IA 4OGKA 3RIXA 4CMGA 1VPVA 4B4UA 3PGVA 1YOBA 4AG6A 3IOEA 3CLTC 2QRVB 1VGRA 5DBIA 1F20A 3QI7A 1IYZA 4LJSA 3PDCA 1YVUA 4ZARA 3QE0A 1S5PA 3DAFA 3PXDA 4RMIA 4TL8A 1RBZA 1EVJA 1ZHHA 1PK8A 4OJKA 4RD1A 2QV0A 3CURA 1YNSA 4F1WA 1IBCA 1E8NA 5AI6A 3B6JA 4QPNA 4QSMA 4GXTA 2PN1A 2VPWA 2BM0A 2Q3HA 3UK2A 4DA0A 5K9ZA 2ZU6A 4R41A 1AO3A 2QLTA 2VJDA 4YWJA 5A9TA 3R3WA 4N3GA 4NU5A 4DYHA 1U11A 5HOQA 1LK0A 2OHHA 2C82A 2HY7A 5JE8A 1MT0A 5BO5A 1CY6A 4TVSA 5KWVA 1M67A 1N4AA 4ESOA 5ERGB 4EJ2A 2G9RA 1PI3A 2PHZA 2HSWA 3FSRA 4JNCA 4LTDA 4MPDA 3NOXA 2HF2A 2IBMA 1GRVA 4TLMB 1YF3A 4JI6B 5FWXA 1M1NB 5ICSA 5DGXA 3GRFA 4ED9A 2KLBA 6YASA 4OREX 4YRJA 4CIBA 3GP8A 2HJSA 3OVMA 4M0CA 2YXLA 1ZCBA 4UTPA 3IAXA 1G2IA 1D1QA 2P9JA 4Y2PA 3HMKA 1C7RA 3U48A 1XD9A 1NSTA 4WKOA 4D98A 4H7PA 2FQ1A 3VSEA 4C87A 4DR4B 2BBSA 1IDOA 2IYUA 3KUDA 1E7SA 5JSHA 2FH5B 4XYGA 1V9LA 1QRTA 1V5EA 1ML3A 1D1SA 3JAWB 4DDVA 5BV1A 4LTNA 4LXUA 4BEJA 1KOGA 3E27A 3PICA 5JBNA 4FFRA 4MLDA 4BATA 2FPSA 4G8CA 4U7FA 4GM4A 1G8HA 1HG0A 2VZ8A 2Q99A 1ZM3A 5L6MB 2BUBA 4C4RA 4HUQA 2G72A 4GAEA 1VI2A 3ZWQA 1C0EA 1ST2A 4B5KA 2Y1CA 3RYTC 1P2VA 4RX1A 5DGHA 5BYAA 3NH6A 1YE8A 3R0QA 4RH3A 3NMUF 3VV2A 2D2FA 4JR1A 4EY8A 1W76A 1X7HA 2GJ4A 1JHPA 1M2EA 2PUJA 3PNLA 1U1EA 2A92A 3DVLA 4GXQA 4IEEA 1KOJA 3WWYA 1Z62A 1D0SA 1FPMA 1O89A 4RABA 4RDCA 3W5UA 3ZZ1A 3NANA 2QMQA 4PRZA 2YVLA 1O95D 3JQ8A 4RJKA 4WY5A 4HX2A 2GZDA 1E1CB 2IXAA 5KQRA 3PQ5A 4KQXA 4AG5A 5KTYA 1Q57A 1L7OA 2V8OA 3WGIA 3QNWA 5CFRA 1L5MA 3LCJA 1BMDA 3E7XA 4NJMA 2OWEA 3KJHA 4IVPA 4YWHA 3RVJA 3NPAA 1Y37A 3KTAA 3ZHSA 1R5OA 2V97A 4Z9YA 3GARA 1F3OA 2AYZA 3NHYA 1Q21A 2RHJA 2RCNA 3BTSA 5CT5A 3W34A 2I5PO 3AEQB 3EGWA 1GL9B 3LVRE 4PNHA 5LB2A 1R00A 3ZKWA 1EFAA 4IX1A 4ZFNA 4DR7B 3NRJA 3P0IA 2P5SA 4LE2A 4N49A 4D3DA 3GBSA 3NX4A 1CF4A 2HDWA 4GPBA 4YV7A 2H1HA 3I09A 1Q14A 1V45E 1ZBDA 2VLBA 3KT3A 1VLQA 3LW7A 1CUYA 3EZGA 5EYPA 3FGZA 3Q1LA 2CDNA 3BH0A 4PPGA 2NU7A 1ULBA 2ZS7A 4NOLA 1T2VA 3TCNA 5FA6A 4C4YA 4BFTA 5KYWA 4ZYZA 2RHRA 5ALKA 3F6RA 4FONA 1QYRA 3OQPA 5A6VA 3HI6A 4KITB 5EZYB 1F9AA 4I99A 3OFNA 3LRPA 4FDUA 2OG2A 1GAWA 1NZFA 4P86A 1PKEA 2WTAA 4FS3A 1AKEA 1DC8A 2P9HA 2X3UA 5I4BA 1UBFA 1WCV1 2B2CA 3EZXA 2DTXA 1IZ7A 4J0IA 4JEUA 3ZWVA 1DJOA 1PT6A 5A04A 2X5OA 2XSZD 2XMRA 1QO0A 1U0GA 2GBGA 3GWZA 5IAJA 4QTTB 3G0OA 3WNQA 3BJEA 2ZJAA 4LRSB 1QHYA 2FWBA 1LXCA 1E98A 2JH8A 3FCSB 4JLSA 1QSGA 3FSJX 1J0BA 4TV8A 4IGAA 4KQEA 1DP4A 1PGPA 5ILQA 3T1YB 1NRIA 1URPA 2ALJA 3TD9A 2QRUA 3MTJA 1SG6A 4GVPA 2CF6A 1CR4A 3C7DB 5CYOA 5C8YA 3GGSA 3K0AB 4E70A 1XZHA 4YT5A 3SSOA 3V1LA 3WRVA 1PVOA 1JZSA 1BU8A 3HZZA 2H16A 4JGGA 3A1VA 3ABRB 3LYAA 1FFWA 2ZB4A 3QVXA 3BFXA 5KYVA 3T3OA 1C9DB 3KVVA 1GPNA 1FPQA 1PJCA 5EG5A 5THXA 3PEYA 4DEXA 3DMTA 1LI5A 3QTLA 5ALNA 2HLHA 3R9KA 5AJYA 1SUFA 3MSCA 4E7PA 1NLMA 1GZSA 1P60A 2NVUB 1RXCA 5B64A 2IX9A 2PNFA 3T5GA 3X1DA 2BH9A 5F3DA 1V7ZA 3DBHA 4EENA 4Y9TA 2Y0DA 1DRKA 1HFKA 3E3MA 4UFOA 2HRZA 5DVZA 2IITA 2HHJA 4XB2A 3L9XA 2V7PA 1ZP6A 3G8DA 4CV1A 1QQ6A 3X44A 3O8QA 4DOMA 1A98A 1QANA 3K9LA 5DB4A 1AMUA 3ID6C 3IYLW 2H5LA 2I2WA 3H04A 1M0TA 5FOVA 2YMPA 4JVOA 4L85A 1UOQA 2FYTA 2WRZA 4KWIA 4K9OA 1H4SA 1ZN8A 1MEEA 3E9EA 5DLPA 1O87A 1WTCA 1CTQA 3MEQA 1YI8A 5E9WA 3ZE8A 2Y92A 3CWCA 4TL9A 4W5QA 4HR7A 5HQTA 3BDVA 4FIZA 3OKFA 4BVKA 1MUUA 2CVPA 3OIFA 2HV8A 3RC8A 3VNUA 1WEHA 4EIWA 3GJ4A 4GBGA 2G6TA 3U9SA 1M5TA 2Z83A 4Q3DA 2UUBB 4Z99A 5TPWA 3DBRA 1USVA 2V6IA 1ZLXA 2AVDA 3F5FA 4KO2S 3CMCO 3S2YA 3NTOA 4NY1A 2P5UA 3LM8A 3CRRA 1G9XA 4S35A 4WN9A 5DHFA 5IC5A 1DKNA 1QE0A 1YDMA 1JLKA 5IVPA 1BFDA 1WMBA 1YQQA 3B8HA 4RK5A 1AUXA 3B7WA 3K9NA 3L0CA 4UFNA 1I4EB 3QEMB 5REQA 3NHAA 4XX1A 1DEKA 2ERCA 3JQPA 3HWX1 1WUIS 3AILA 3ZLTA 3I12A 2GCGA 1L6RA 1PZXA 3CKLA 3N8NA 4P34A 1XQYA 3FCOA 3NUGA 3K9HA 6NULA 3QBDA 3CUUA 5HM8A 3VH2A 4I5GA 2Q4RA 2AD5A 5KKAA 2PXXA 2GFHA 2DQYA 3M2PA 3P97A 4FYPA 1Q2UA 3MRTA 2ADOA 4RQAA 4TXMA 4AM8A 2PSSA 2C5BA 4N4AA 2X9LA 2R65A 3FA2A 4G2TA 3BDAA 5ENDA 5KOJA 4EKNB 1T0HB 4LFAB 3RVMA 2GBIA 1OREA 2CCJA 4EF4A 1C3LA 2DGDA 4HDMA 5TSDA 10MHA 3JWIA 1VB5A 2W2QA 5L40A 2ODAA 4GWLA 5AK5A 8AT1A 2V5UA 2KI5A 1XZPA 5J2TB 2L18A 5CDTA 2I78A 2WJ6A 3DEAA 1F6DA 2HHLA 4NZYA 5H4GA 4JXXA 2E48A 4RTJA 4PC2A 4ZPXA 3GUUA 2ORED 3PNPA 1SKAA 4B6EA 4BVJA 2NTYC 2VF4X 2XIJA 2BDEA 2OESA 5T8KA 4CTNA 2QUAA 1RTKA 4Q1CA 1JAHA 2HMSA 1PFUA 1OBCA 2HC9A 3BXHA 2HKIA 1QORA 2Q46A 3CPEA 1MQ8B 3M5PA 3H4IA 4OK6A 4BVAA 4UCXA 4ICIA 5CHYA 2RB5A 1R1DA 1YS4A 2O7QA 5ALDA 4E15A 1L4BA 4EITA 1SD1A 2OORC 3FWKA 2WZQA 4U6QA 1GCUA 2DR2A 1FFYA 3W6OA 2QI9C 2TMYA 4EL0A 5SYNA 2WSSA 5EJMA 3MHPA 4QOIA 3ZY2A 2PLFA 1YB7A 2MSEB 4E5MA 4WFKA 3VOSA 2HNAA 3HO6A 2LKDA 1W36C 5LQMA 1JECA 1I6MA 1O9BA 2D1TA 2J9GA 2P2CA 4K88A 2MU1A 2PUHA 2VWPA 4NH0A 1S2DA 3V4LA 2ETVA 2ETXA 1EZZA 3DG9A 4GMDA 1K98A 1MXHA 5BMOA 1TAUA 2VDNB 1Z6GA 5DHAA 3LCCA 3G89A 3O95A 2ZLBA 3IT3A 3S27A 1M8JA 1B0PA 1NURA 1WJGA 3GBVA 1XRMA 4YBRA 4ETNA 1UAAA 1TIKA 1HDYA 3CH5A 4G26A 1C4WA 2ZIWB 4TS9A 3PI7A 3MHTA 3UXHA 5CH5A 3IDOA 3DNPA 5L8VA 3GYGA 3NCTA 4UM8B 1Z39A 1FDUA 2V7VA 2XECA 3MW8A 3ZHCA 2JLYA 1TLTA 4D8YA 3L0ZA 5COBA 4F3RA 3T9DA 1UXHA 4JENA 3DYIA 1JPNA 4NFSA 1GQYA 3N6VA 4PAMA 5CMLA 2VNSA 1WXGA 4NKRA 5CVJA 3PWZA 2P3QA 1IEWA 4KMSA 4A3SA 2TRSB 4NCJA 1UK7A 4JLUA 3HXKA 4GS5A 5DK6A 3VZBA 4BNVA 4KR3A 3T3EA 1UIRA 3LP6A 1O54A 2CXSA 3RLIA 5FL7A 3HKCB 4CMCA 1QB8A 2X5KO 5A4DA 4DSUA 4FFMA 3L06A 3R44A 4J0DA 1Z8FA 5BWCA 1SPXA 4IJ5A 3HVJA 2CE2X 4PU0A 4WV3A 3SD7A 3V8BA 1QVRA 5FUMA 3S1LA 2Y1KA 1E2HA 3DAYA 1TKBA 2GEDA 3OD1A 3EPHA 2ISSD 1B8VA 1M2NA 4HDNB 1SKYE 1XD2B 2X23A 1WDWB 2JBAA 4GXRA 4PX5A 1X1BA 4EARA 2GR9A 1E5QA 5KTNA 2QTMA 4TXJA 3UT0A 5LXTA 2DOKA 4X6UA 4C7OB 4MUNA 1FFEA 1N8NA 3CH7A 1LNZA 1H69A 1T9CA 2P4SA 4LJ9A 3TMKA 3ZHRA 3WYEA 1NDUA 2CXTA 1DAFA 1KYZA 2PWYA 2IS1A 2HMTA 4KGXA 2Y2VA 3E9DA 5KYGA 2A0UA 3K6KA 4MVJD 4FYMA 3W6PA 4DCCA 3AFNA 3CGWA 2FR0A 1FP4B 4R2XA 2YXBA 5BV7A 2WM2A 5EINA 1Y0BA 4NJEB 2YJNA 3IOCA 1E3IA 2J5XA 4MQ5A 4KXFB 1BE8A 1P1FA 2WILA 4NCIA 5TY0A 2P9FA 3S70A 3SFZA 1HH4A 1JG1A 1WW8A 1Z4PX 1ZQ1A 2RAPA 3H2ZA 5CCDA 3WIUA 3ZBQA 1FSSA 3QE3A 4R2IA 3FCXA 4MW5A 1PGNA 5B2ZA 1SXIA 4EVRA 3JQGB 1JBKA 1DBQA 2ID9A 3CWZA 3MMNA 1LPNA 2FQQA 4XA8A 3RSOA 4R0MA 5HJ7A 1QLWA 1TVEA 4TTTS 5DMXA 3WLJA 4XVCA 2L42A 3VZQA 4NICA 4ER5A 4BO5A 3DDWA 2ZYDA 2QBYA 1NBIA 3WJ7A 2F55A 4GVXA 3F8SA 2SKEA 2VPTA 2FP3A 1JR4A 1RYNA 4CKYA 2PU7A 2FW8A 3ST7A 4CF7A 1Y4UA 2R86A 2YDYA 1BX3A 3B5IA 3AW8A 4FFNA 3KXIA 4U6NA 1WSWA 5CB8A 3N6XA 4YV0A 7REQB 1CRZA 4IZHA 2BLLA 3H5VA 3M1IA 4NESA 2EEZA 4B3TB 1N75A 3KBOA 1A9OA 3C14C 3F4LA 1LQUA 3DL7A 1N1EA 1NMYA 4O29A 4MYTA 1ENPA 2QL7A 1NVVQ 1R6XA 1OAAA 4FMDF 1E2DA 5EIWA 3TIFA 1DJMA 3EFHA 1EFHA 1XFAA 1Y8CA 3ODPA 1BGVA 2XE4A 2FN8A 3BULA 1KEEA 2WWTA 4G65A 2ABWA 1CLUA 4NZZA 4DEVA 3BX1A 3GLTA 1FMJA 3ZNNA 1YVPA 2YV1A 5JISA 3N6RA 4Q1VA 2YN4A 5F33A 4I1PA 3ZD7A 3HN6A 1QYIA 9MHTA 5FF9A 4JR2A 4C6TA 1WU7A 3H2JA 4RANA 4IO0A 3L93A 1YU6A 2CFOA 2QZSA 2Y1LA 4IICA 3T3IA 1LZKA 5J2UF 2WU4A 2HTFA 1GR1A 1A1SA 1CVLA 3L8ZA 1XGKA 2K2QB 2V4UA 4RVFA 3TNDA 1MA0A 1P0PA 2FPWA 1H8HD 1E2LA 1FUYB 1O97C 4DNXA 1I5RA 1FRFS 1ULHA 3R8CA 3IDQA 2XR1A 4EJFA 4LI0A 2G5TA 4V2IA 1GKIA 5COAA 4W5OA 4IIUA 2POCA 3ZE7A 3SZUA 1KZ6A 4ZVKA 1DMSA 1YK1A 1RPTA 3VDQA 4N8SA 1Q0SA 4UDNA 2ZCVA 2J5BA 4M7PA 2B4TO 3TR6A 1E1NA 1JIVA 3ZDAA 3A9VA 4W1RA 2IU4A 1QF6A 5BSKA 2V7GA 3H84A 2W7TA 1T5OA 3W1EA 3I6MA 2ZBGA 4EZEA 4D8UA 1NQ5A 3OU2A 3DKKA 1H4VB 3DFUA 2V6MA 3EEYA 3IXMA 1AJEA 5COQA 4DB4A 2GJKA 4HQKA 4XJXA 2O20A 4I7EA 2X0NA 2YQ4A 4HB0A 2OV6A 4JHXA 4O2AF 1DC4A 4RF5A 1G21B 1X14A 3F78A 1CHDA 3X1XA 5KJFA 1GQSA 3B89A 3DOUA 1CYEA 2PUFA 2FZWA 3U3KA 3U62A 4TQ9A 3UAZA 3GLGA 4AY2A 2ZJ2A 2Z4RA 2XB6A 2ZQ5A 3WZLA 5BR7A 5HHTA 3M9WA 1M5RA 2X8LA 3AEUB 1HPLA 2Z6UA 3Q72A 3KHTA 1AGPA 1VJTA 2I6XA 5KS2A 5LMZA 4ENPA 4Q4LA 4XFKA 1A2QA 4E1VA 4PO1A 3I05A 4M7RA 4RM3A 3T38A 2D0PB 1JXOA 2J59A 5LLTA 5BT9A 5CD9A 3EWSA 7ABPA 2OZVA 4C4AA 2RKWA 2D7DA 3ANLA 3T5DA 2VYVD 3C85A 4D2IA 1I5OA 3PL1A 3IUSA 4NPCA 1FFAA 5CM8B 2VF5X 3OCVA 4WZBE 5KTPA 1L9KA 4NG5A 3SS8A 5IYZA 2RD2A 1JI0A 2CL5A 2AYXA 4L8GA 4YMTA 2YV4A 1Y3AA 2I2CA 4WAUA 4C7KA 3CUVA 4O25A 1GA4A 1KO4A 3FOBA 4WECA 4C06A 2ZKIA 4XIJA 1VKOA 2NPFA 4KREA 1UJMA 3Q3JB 3LIPA 1XQ9A 2WMDA 1L4LA 4Z49A 3ORHA 3KJQA 3M5WA 3DXZA 4QYSA 4TT3A 4AXXA 1N5IA 2VPYA 1HFEL 1QV6A 4GPD1 5A5FA 4LF4B 2Q3JA 1NM5A 2O2GA 4TKVB 3P0RA 3S1AB 2P9QA 2AKYA 1T8SA 4ZOCA 1GPAA 3EGXA 2CYCA 2GBLC 1W4BA 4UVDA 1B6RA 1F2TB 3VC7A 2HT1A 4X60A 1W87A 2VXBA 3NAQA 1SG9A 2JHAA 3NNNA 1H2WA 2G1KA 4KIGA 3ROKA 3IT0A 1WP9A 2BKUA 1LU9A 4L8LA 4YC7A 4E32A 4YVFA 3IPCA 4IFBA 4BZQA 3QE4A 4M0FA 1MJGA 3DKPA 3O9MA 2ADFA 2C2ZA 3DDSA 4UM9D 4MRVA 5AICA 2FJ0A 3AVUA 1GAQA 1MA3A 1JIJA 2XXBA 3QITA 2P9YA 1WSBA 3CUYA 3MQFA 4ZALA 1JVSA 2ZYHA 1DSSG 2QIOA 3H83A 2ZIXB 3EULA 2OQVA 2DZDA 1Z4OA 4X8MA 1O6BA 3CLKA 4H7JA 4ZWNA 4HQNA 5DNDA 2JFPA 4LF7B 2WMNB 3F96A 4F84A 3G0HA 3AFGA 5L3QA 1M2JA 2JGEA 2ZIAA 3QPDA 1ILWA 4O2BF 5BSWA 1E63A 2JIBA 2P9GA 2E89A 1OLXB 2ID7A 2J07A 2VDJA 3OT1A 1FLNA 2F6RA 1X15A 3KPYA 4H0FA 4HB2A 4MUAA 3EISA 2Q49A 3D31A 3IP8A 3WYDA 4PYQA 2KWIA 4PVDA 5EHGA 2GN8A 2P2SA 2PAAA 4F45A 3CRVA 4AY4A 4LKRA 1VMDA 5C35A 3WWOA 1MQAA 2X7JA 1WL8A 2ZB7A 3H13A 4NU6A 1JPUA 1DQZA 2FPMA 4NBLA 2G08A 1SCUA 1FFXA 4CEHB 1JXAA 2HQ1A 1C3VA 2KJQA 2B0JA 1W35A 1G7CA 1TPYA 2UVPB 3L05A 3L6UA 4P54A 5BRNA 5DM0A 4A8HA 4KPFC 4F5YA 2DBVO 2DQKA 5JAMA 5KWJA 2X2FA 2EOAA 1VSVA 3QV1A 4NWIA 5F9FA 5KJ1A 1DOZA 5HUHA 2O8NA 3ZOZA 1NJ2A 1AGYA 4JB8A 4DRZA 3TE7A 1RIFA 1KDOA 1G291 4ZMRA 2IPLA 2B1IA 2GARA 4IF6A 2IJGX 3U7FB 5DKFA 3C5VA 5UKDA 2YWXA 2BEWA 3T3GA 4FMDB 1XBTA 3ZX5A 5BN4A 4RHTA 3O4HA 3A32A 3B85A 3HYTA 3UA3A 3ZJ4A 3S44A 5M04A 1V9SA 4F8JA 2BFFA 4UAVA 3I0MA 3Q9LA 3W8RA 5CLQA 1JQDA 4BP9A 1AKWA 2C94A 4IIDA 4JIGA 1KY5A 1EFUA 1YDWA 2G0TA 2GN0A 3CB2A 3KZKA 3OA0A 3ITEA 4FN5A 4N39A 3H42B 1J8MF 1HO3A 2XOEA 4LNUB 3S0JA 4E7OA 1T9DA 1VJRA 4X63A 3IS3A 5J2UB 5ENZA 3BS4A 4J4HA 1BTOA 2R11A 4MUJA 1VG0B 2ZQYA 3IKLA 2R5FA 1DAEA 4LXHA 2OZEA 1T9ZA 1G41A 1TTQB 2CUNA 4KG7A 3CNHA 2XQJA 1R8YA 2FEPA 1A5SB 2BCEA 2CXUA 3LHDA 4EYKA 2KX7A 4URXR 4K3UA 5C1BA 2ZJ7A 5CLLA 2RARA 4I8DA 3TW0A