1RMTA

Crystal structure of apha class b acid phosphatase/phosphotransferase complexed with adenosine.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
210
structure length
210
Chain Sequence
b'PSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B acid phosphatase
publication title Insights in the catalytic mechanism of AphA from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 71
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2003-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rmtA00
2B1QA 3OCYA 3AR4A 5ALVA 3ZX5A 5ALUA 2AGVA 2WF9A 3L0BA 5ALFA 3OCUA 3I28A 1J8DA 4Y2XA 3QX7A 4C4RA 3ZVMA 2CFSA 3M1YA 3ET4A 4UW9A 4CNQA 3NANA 2CN1A 5AW5A 2WHEA 2JAOA 1U2TA 5IT4A 3L8HA 2OBBA 4NFLA 2PR7A 4CF3A 4BKMA 1RLOA 2WFAA 2W11A 4B6JA 3QUBA 1U2SA 4NABA 3UM9A 3L7YA 4FFDA 2G07A 2YFYA 3ONNA 3IB6A 3L0YA 4Y2PA 3ZTWA 4DW8A 3W5BA 3U19A 1WR8A 4I9FA 4F72A 3U7FB 1Z4PX 3F9RA 3QU5A 4Y2RA 1TA0A 5ALQA 5AW7A 2P11A 3ED5A 2G06A 3E8MA 5ALWA 1L7OA 1FEZA 3WKDA 2I55A 1K1EA 3QLEA 4EEKA 1RRCA 3EF0A 4Y2JA 4ZEXA 4KX5A 1Z88A 4XPZA 3WK8A 2C88A 2FDRA 2PKEA 2ZOSA 2ZBGA 3WK5A 1ZD4A 2YJ5A 2GHQA 1ZD5A 5ALZA 3WK7A 1Z4QA 5AKZA 3FPBA 5AI5A 2EARA 4Y2YA 5ALPA 4UAUA 5T41A 2EATA 4UATA 3OCZA 1XVIA 5A3QA 3KDPA 3QUTA 5ALLA 2C8KA 1TJ5A 3MMZA 1RC8A 4KYTA 3PGLA 4BBJA 4CF4A 4JDPA 2C4NA 4G9BA 2NO5A 1IWOA 1QQ5A 5ALOA 5AM1A 2Q4RA 2RB5A 2JAUA 3ESQA 5AW4A 2JARA 3N1UA 4KNWA 3B9RA 2R8ZA 1YMQA 2Q4TA 5ALIA 5AVYA 3ET5A 4YGYA 2DQSA 5AIBA 1ZRNA 1JUDA 1TJ3A 2HDOA 1YS9A 3L1UA 1YNSA 1KYTA 3QU7A 4EZEA 4PNHA 5AK6A 3ZTYA 3IJ5A 1U7PA 3R09A 3RF6A 4QJBA 1F5SA 3QU2A 1RMTA 1SWVA 1CR6A 3A1EA 4L6CA 3AR2A 3ZVLA 3SHQA 3E84A 4HGPA 2P27A 3FVVA 2C9MA 5ALYA 3KC2A 2BDEA 3MN1A 4EENA 1Z4NA 3L5KA 3BA6A 2IOFA 1T5TA 3ZWDA 3ZU6A 3ZI4A 1YDFA 3J7TA 5ALEA 4BYGA 5AI0A 5AI4A 5ALJA 2JGAA 5ALKA 5AW2A 1RPZA 2FPWA 2AUTA 2HHLA 4UM7A 1L7PA 2ZBFA 4HGQA 4NAVA 4O8CA 5AKKA 3L8GA 4DWOA 1XPJA 3N07A 4KX3A 2YMQA 4NV0A 2FUCA 5ALMA 1T9ZA 1RKUA 2RBKA 4XOUA 3UMCA 1MH9A 4XE5A 3U7GA 3W5AA 5AKJA 2AH5A 3WKBA 5AM2A 3EF1A 2GO7A 1TJ4A 2HSZA 2FPUA 5AM5A 2BY4A 4IG4A 4KN8A 4YCNA 4UARA 4Y2TA 4YIHA 4MUMA 5AIAA 3ZUPA 3QXGA 5ALXA 2EAUA 1Z4IA 3E58A 1YV9A 3DNPA 1QQ6A 4BX2A 5AKLA 2AMYA 5AVWA 2G0AA 4L57A 3ZVNA 2OA0A 1NRWA 5E0OA 1VJ5A 3OPXA 4XQ0A 3MPOA 1L7MA 1L6RA 2YN4A 4HYTA 1AQ6A 3QU4A 1O08A 1L7NA 4YH1A 1QQ7A 3CZ4A 3D6JA 3CNHA 1EK2A 2HEGA 5A3RA 4Y2QA 2W4MA 2YBDA 4EELA 3FPSA 5JJBA 3SKYA 3I76A 2YMMA 4J03A 1YJ5A 3OCXA 4BX0A 4YCMA 1RLTA 1Y8AA 1J97A 3QUQA 4YIKA 2IA5A 3U7HB 2HX1A 3U13A 3WK4A 1Z4JA 3KZXA 2NO4A 2FPSA 4BX3A 1VJRA 2ODAA 2YJ6A 2MSNA 3KBBA 5AW9A 2WF5A 2G80A 4RESA 5AK4A 5AM4A 1WVIA 5AK5A 2IOFK 2FPRA 4UU0A 4UMVA 4CE6A 3AR8A 3UMGA 3PCTA 3IRUA 4GXTA 4HGNA 1Z5GA 1N9KA 4C4SA 2I7DA 3PDWA 2I33A 4JB3A 5AICA 1SWWA 3EPRA 3NRJA 2B1RA 3FGOA 2MU1A 5AI6A 4MWOA 2YY6A 3KD3A 3A1CA 3QUCA 3N28A 5AI8A 2O9JA 4UASA 4ZEVA 2NYVA 3WK9A 5AW6A 3A1DA 3U26A 2GHTA 3NASA 3PGVA 3ESRA 3AR7A 2HF2A 3QGMA 2BDUA 5AKXA 3E81A 2I34A 5AVSA 3W5CA 3W5DA 4BEVA 2IOHA 4Y2VA 3L8EA 3R4CA 4UM5A 1CQZA 2YJ3A 4BEWA 3K1ZA 2CFTA 2I6XA 2HO4A 4HAIA 2B0CA 1O03A 2Q5EA 1RKQA 5IS2A 3WGUA 5IT0A 2WF7A 2G08A 2JAWA 3NALA 1RDFA 4HGRA 2RAVA 5ALNA 4AP9A 1X42A 3AR9A 5FP0A 1Z5UA 3WGVA 1T5SA 3P96A 3QYPA 5AKYA 4UAVA 3ZW7A 4G63A 2HI0A 3I1YA 5ALDA 1S2OA 5AESA 5AVVA 5AVQA 5AM3A 3N5KA 5ALTA 3B8EA 4I9GA 3AR5A 3WKAA 3BWVA 2B8JA 2QLTA 2CFRA 2X4DA 5A3SA 3TLMA 4EX7A 1Z4KA 3SLRA 2YMPA 3HYCA 1ZRMA 3L1VA 5AKHA 1Z4OA 2R8YA 2FUEA 3A3YA 4YCLA 5AVUA 2ZBDA 3N8GA 2B30A 2G09A 3OCVA 4UU1A 5ALRA 1RQNA 5AVTA 5AW0A 4HGOA 4H1WA 2WF8A 4DFDA 5AK3A 3NUQA 1RKVA 2WF6A 5AVRA 2IYEA 5AW8A 3ZWKA 1NNLA 5AM0A 3KOOA 1U02A 1Q92A 1ZOLA 2YJ4A 2HF7A 4OCZA 1TE2A 1SU4A 2YMLA 3GYGA 1RMYA 3SMVA 2G1AA 4EX6A 3DV9A 5AW1A 3WKEA 2ZG6A 3RFUA 1XP5A 3FM9A 4KNVA 4UMFA 2D2VA 5AKGA 1L8OA 1Q91A 1N8NA 2B82A 4AS2A 5AHXA 2P69A 1VFPA 2RARA 2FEAA 3AR6A 3SKXA 2FPXA 4ZEWA 5ALGA 3DDHA 4DCCA 5AVXA 4QQFA 5AKIA 5ALHA 4FYPA 4L6AA 3DAOA 2R8XA 3QNMA 4CF5A 1WZCA 2R8EA 5AVZA 4BNDA 5ALSA 2PQ0A 1LTQA 3EWIA 3VAYA 4F71A 3B9BA 3M9LA 1RQLA 3MC1A 3AR3A 2FI1A 1QYIA 2OYCA 4FE3A 3L0CA 1U7OA 1S8OA 2ZXEA 1L8LA 2W43A 3OCWA 1RMQA 4Y2UA 4Y3UA 4AS3A 2P9JA 2O2XA 4NWIA 2HCFA 4OHFA 1WPGA 4IFTA 4OD0A 3NAMA 4GIBA 2WM8A 4RETA 2HOQA 5AI9A 2GFHA 1Z4LA 1PW5A 3ZX4A 2ZBEA 3SF0A 3NIWA 4UMEA 1NF2A 4C4TA 2OM6A 2B8EA 3HLTA 4J2TA 3OTQA 1ZS9A 3QU9A 2I54A 3WK6A 5AW3A 2GMWA 2C8LA 2QYHA 1EK1A 4OFZA 3U7EB 1LVHA 3I6BA 3FZQA 2VKQA 1ZJJA 1QH9A 1ZD2P 4UMDA 3UMBA 3R9KA 4E88A 1RLMA 3S6JA 4BNDB 3L8FA 5AKEA 1Z4MA 4Y2SA 3SD7A 1ZD3A 3WKCA
chains in the Genus database with same CATH superfamily
1I51A 4R0NA 1R6XA 4LYAA 1E1LA 1IHUA 1N0IA 2D54A 3NEAA 3GP3A 3M33A 4J0DA 4PLVA 621PA 1R8JA 1YJ8A 5JNRA 3UY4A 3EVZA 2R1UA 1T8SA 1UCFA 1HTBA 1VKHA 2CLHB 4FYIA 4RANA 5LQAA 4R3UC 3AF2A 4LEIA 3OOEA 3GLVA 5K8LA 2NUBA 1V3QE 3PQ4A 3QX7A 1MKYA 3LBIA 1U7WA 1I2DA 2CFSA 3P9IA 2DPXA 2IC5A 3AQIA 3BWCA 3BCUA 4Y18A 2DSTA 1KQOA 3GMDA 1LNQA 3LUKA 2ZAIA 1WW2A 4MWBA 1L5LA 2HXYA 3UKOA 5JWHA 1OVGA 1MO4A 3SG0A 1HG1A 2PR7A 4DG8A 4DWJA 4O02B 1FNBA 1DCTA 3C6KA 2E3JA 3NPAA 2B7LA 2AFIA 4NABA 1IN7A 1K6MA 1EU1A 1GSOA 2C77A 2HFKA 3ONEA 2YFYA 3L4BA 3HNPA 2OMKA 5KX5A 2ZSIA 3ONNA 4PXSA 2HTEA 5D51S 4DREA 1IBKB 3KOZA 4HWRA 3BAZA 2FN9A 2A1UB 2RGUA 2C1ZA 4BLQA 5B1EA 4HLUA 2O3QA 3ZDZB 5BV0A 5EKDA 1FF9A 2HJ9A 1CS0B 3AVQA 2YIVX 5C3MA 1F6WA 4FGJA 4Q4DA 3PXCX 1JSZA 4KE7A 4D02A 5KYVA 1MFPA 3ZKWA 1M0EA 4H4DA 1D5WA 1Z8NA 2IPOA 2ZIVB 1GRRA 3A2NA 2RK6A 3K94A 2D1QA 4Q3AA 5DOZA 3KQUA 2WAMA 4QXRA 2IX3A 1AJEA 1ND6A 4PN3A 4P2GA 2H1SA 2JH3A 3NORA 3EF0A 3DEKA 3EUFA 4UVIA 4G07A 5DXFA 1P19A 3R7AA 3PFKA 3W9YA 5ILOA 4LMAA 2J7PD 5EXTA 4ZI7A 4COKA 3QE0A 3LG2A 2XTZA 4XPZA 1Y8CA 4B3JA 4BXOB 1ATIA 4RM2A 1RRMA 4EYSA 1DJMA 1DG3A 4R1UA 4GXQA 2XIJA 4GFDA 1QTRA 1UXHA 3QKSB 5CITA 4R7ZA 1CUCA 2XGGA 1C41A 1IE3A 4W9RA 5LYYA 4PYLA 3B1FA 3AUYA 2VJDA 5HSGA 1O4WA 1NKTA 4UAUA 2YYAA 3JQAD 3ZWVA 4L28A 2OHJA 1ZUHA 4TRRA 4DJDC 3INNA 5KWVA 1DFGA 3TCNA 4MUGA 1I0IA 4RCVA 4AMYA 3BN3A 3U40A 5EMKA 2ZYAA 3T3IA 4OHOA 4LOJA 1U28C 2C8KA 3ABQB 3DWEX 3LKBA 4A0GA 4DZZA 3U7JA 1SC9A 2OV8A 1ULSA 2O1SA 4KYTA 5F2NA 1FTYA 4HZIA 2G72A 3UOAB 4W5QA 4PSVA 2H54A 4G0VA 5CLGA 5FOUA 2W2NA 1MV5A 1RZUA 1SB9A 1Z0ZA 1ZUNA 2LCIA 4OHRA 4OSPA 3TQIA 2H7CA 2PTGA 3EB9A 4AO7A 5C5EA 2TMDA 5CNKA 1HRDA 1OH7A 4KFTA 2P1RA 2AQIA 3JARA 1Z8DA 1HE3A 1PJ2A 2CXUA 3RK0A 4KXXA 3F8TA 2B0JA 1IVYA 4OREX 5IUKC 1X7DA 3VJLA 1G7RA 3W34A 5BRAA 2XVXA 3Q15C 3UB2A 3K6SB 1QTQA 2W6IA 1E63A 5ESRA 3JYLA 4J0CA 1SOWA 3PPVA 1M34B 3H8JA 3IAS1 1TAGA 1WXFA 1ISFA 1Z5WA 5AK6A 1QU2A 1DAEA 5KDDA 4DLUA 2JPDA 4I46A 1PTKA 4Z7JA 1EZ4A 2QD3A 3STTA 1XTRA 3GFPA 1MTZA 4K6GA 1AHNA 5D3ZA 4Y0NA 3JYOA 5CT6A 4A23A 1F1JA 3TECE 3PL1A 3GRAA 2GTHA 4PXAA 1BGWA 1Q84A 3JPYA 4P3XA 2YDXA 3STVA 1X7WB 3I9NA 2MINA 1RS0A 3L5KA 2P2SA 4R98A 4XASA 4GSYA 3K5HA 4OA8A 1NYTA 4YJFB 5L3ZA 3ZU6A 1OAOA 3FHOA 1M34E 1KEZA 1YB2A 2OGZA 3EVCA 4YCSA 4GUDA 4M9RA 3U37A 3BWXA 1WX1A 5F2OA 2NU8B 4G0NA 3U6BA 1T3HA 1NQTA 4J7XA 1ISMA 1E3QA 2HZ7A 2HHLA 2J6CA 2OVFA 2QZPA 5AUQA 3ZHUA 8ABPA 4ZMSA 1YQ9A 3BWYA 3TSAA 4HGQA 3RS8A 2HIAA 1K3TA 3A27A 4LDNA 3QH4A 4LC0A 3OO0A 3DTYA 3LDUA 3N07A 5EKXA 4AJNA 2DQZA 3Q2OA 3K9FC 4MVJP 2WJIA 4OXNA 4XOUA 4BFLA 3H3FA 1P7ZA 2OPHA 3TQQA 4YASA 4KQEA 5KOIA 2XH8A 1AGYA 2PZAA 3EF1A 4TM8A 3ROPA 1MC8A 1LLCA 4NL4H 1Z0UA 4FE7A 1IB6A 1TTPB 3HM9A 4ZREA 3WA6A 5JJLA 1UWLA 4R2HA 4OFXA 2WU0A 4OMFG 1B6RA 4Y2TA 4JEMA 2YXDA 1DRKA 3BMQB 2B2XA 2VJBA 4AMBA 4HRXA 2B4RO 4CI0B 5BYJA 2NO1A 1NVXQ 1Z15A 2XQKA 3I72A 4JEIA 4G09A 4DMGA 4DV3B 1FNDA 4NMMA 4OHBA 1UADA 2PVSA 4Z5XA 3TRDA 4FFBA 4FM9A 3QOYA 3M6WA 3QW2A 4V2IA 4MB0A 2VDJA 4EMBA 2HWWA 4PGGA 1O94D 1YFKA 4R8SA 1HTWA 2X0RA 3VKWA 1R6UA 3EEOA 1VL2A 4OQXA 3L49A 4C01A 1YRQA 1FRVA 2C5FA 3DMTC 5CPBA 2IIQA 4XYMA 3E7XA 2C07A 5EXXA 4CQLB 3K0CA 4HNTA 1IDOA 2OCDA 2Y0EA 2Z0MA 5EHIA 1EVLA 1EJ6A 1WCYA 1ZNYA 1PNQA 2EFDB 3ZC3A 3WGQA 2PRZA 1W73A 2XUJA 5JLAA 5GVSA 4EWLA 3L2OB 4FUQA 1NLMA 1Y1RA 1FYWA 2HAEA 3ZS8A 4A6DA 1IY2A 2XMPA 3K1AB 2OY0A 4JA0A 1QB8A 1FRFS 3EMVA 3BSYA 3T9EA 2XB6A 4GOKA 3FUXA 3P20A 3ZHOA 4EELA 3FPSA 1XHFA 3PPYA 4GHWA 3D4OA 2YMMA 4X00A 5D3KA 4D8VA 3REQB 1YS4A 2AMJA 2BGNA 2WSBA 1E7QA 1GYPA 3FZYA 1Z9BA 4RM3A 3RVDA 3T38A 2FETA 3K32A 3GL9A 4Q05A 4Q15A 3FB1A 3VU9B 4AMVA 8ATCA 3T12A 4MRMB 1PTJA 1Y82A 2HQRA 3KWMA 1FDOA 2BGJA 3CTMA 2PLRA 2AFHB 3EQ8A 3IEIA 1UT5A 4BVBA 2E82A 2CXHA 3V7NA 5F23A 5HHTA 2GARA 1GYRA 1Q0SA 4C4YA 4DKXA 4X62B 1GV0A 3AR8A 4RHCA 1R9JA 1JLMA 3UMGA 4A2CA 1WEHA 2FXVA 1NRIA 1T5LA 3ML1A 4GQIA 4HRVA 5GMOA 4ER5A 2PRJA 1VLQA 2A5GA 1C3XA 2XRMA 1XALA 5JD6A 3ANTA 1AXEA 2I33A 4MW9A 4MZDA 4ONEA 3RAJA 2C8JA 3GX1A 1JPUA 3QZUA 2ZT8A 5K7SA 4OSOA 2ZPTX 3ND5A 1RWWA 3R5KA 1V4NA 4TKUA 2AFHE 3SYRA 3GJ5A 4AICA 1JU9A 4JA2A 3C6YA 3N2ZB 3QBEA 1V41E 4XVCA 4DV4B 3JD0A 4XX0A 1L5RA 3JYHA 4QFBA 5EWLA 3BJRA 4QYMA 3D54D 3P9CA 3MJTA 1OLSA 2ZIUB 1PEDA 1QF6A 4ZAXA 3KVOA 4CKEB 4K81B 3AM4A 2NW6A 1CRZA 4P81A 1QYCA 3TLYA 3PQDA 1DO8A 4DZRA 3RRJA 1O95A 3OZUA 4EJ2A 3VZSA 5KNBA 5LM3A 3TD2A 2B7CA 3SZOA 1SHKA 4ILKA 4UNRA 5JFGA 1VCHA 2GVDC 1HURA 2X4LA 3CKLA 1LK5A 2A0KA 2B6HA 2OHOA 1RWBA 3GLIB 2YOFA 4U1RA 1GGNA 5ERGB 1ADJA 2I99A 3AEKB 1GG8A 1BYIA 2GH1A 2QXTA 3KUUA 3OQVA 3TZEA 2RCNA 4YACA 5JS2A 2A9JA 4MJXA 1A9XA 3H5VA 4HPJB 3ZWQA 4XJVA 4G0PA 2HDWA 1CY0A 1SKUA 2TS1A 4HWGA 4Z0TA 4CMIB 2VHWA 2PCLA 1P4RA 1RHQA 2X2EA 1SXJC 2NZ2A 1P4HA 4YDHB 3TL3A 4BFYA 1K5HA 4JUBA 3QSYA 3NHWA 4AMZA 1DX6A 2ONKA 3U3RA 2H5JA 4LOIA 4KNYA 2VUTA 1MO6A 1X7ZA 2ZB2A 4IS3A 3LOQA 3WADA 1SD1A 1NN1A 1KYQA 2HJWA 5HS6A 4EO7A 3E2IA 5A06A 1ZO8A 5FH9A 1JPJA 4OQNA 1G3MA 1KI4A 4EQ6B 1YO6A 4X5OA 2GXSA 4ZK2A 5KYKA 4W5OA 1VE5A 1VE9A 3FZGA 5F5LA 3RREA 2VNSA 1XMOB 1PDVA 1XZ8A 2PU7A 1BHJA 2VYVA 5B2ZA 2AKYA 4KU4A 3MLEA 4DGSA 3N0VA 1VHJA 3H0EA 1V5GA 3MUNA 4OQEA 3GLIE 1P1JA 2CWDA 4B2YA 5IBPA 2PV0A 3SFVA 1TT5A 3D3WA 4YR9A 3R7BA 4UTPA 3EC1A 1CDZA 3FNHA 4E09A 4IZIA 3HY4A 1TUBB 2Q3CA 2QI9F 5F21A 2XJ4A 3RVOA 2IDZA 2YNMD 1WTAA 5KNLA 1JR4A 1E4EB 2ARKA 4EI2A 2PX0A 3Q7PA 2R5WA 5AKHA 3IUPA 3O26A 1C3OA 2F1RA 2UVPA 2O5RA 4QUBA 3DHYA 5FLXA 2FUEA 5AVUA 4DIKA 4NS4A 2NSHA 2QUAA 3G8DA 2BMFA 4WLVA 2NT3A 2WV7A 2H85A 3WGTA 1GD1O 1KZ4A 3DD1A 4OUKX 3DOOA 4KTVE 2HJRA 1X9GA 3GT7A 1C1XA 3EXIB 5CX1B 5FWNA 3J81k 5JEEA 2NXEA 1YL7A 5AK3A 5DYTA 5IW8A 1LBTA 4FONA 1RKVA 5G4KA 3GEDA 1JZTA 4CV2A 4DNOA 2R4QA 1Q57A 3SS9X 1KDPA 1CJKC 1YONA 4DDHA 1T9AA 1E1RA 2P1ZA 2R11A 3KQOA 4B73A 5AJTA 3TF5A 3IAEA 3MGBA 3PKJA 1P3JA 1P8JA 4Z9XA 2QTVB 1UOQA 1WD7A 2H29A 4M1YA 3RK4A 1RNLA 1TE2A 1XRRA 2R00C 2H4HA 2H8KA 2Q45A 2P6OA 2G1AA 3P0FA 4KAAA 5HCIA 4ENRA 5L6MB 2YJGA 3L77A 4Q4AA 1YHNA 3RC7A 5I3CA 2C3MA 2HRDA 2F8TA 2FWRA 3PDIB 4KXUA 4XUCA 1PDWA 3IXQA 5DLDA 3W04A 4EGJA 1A2OA 5LWQA 1DZIA 3CXRA 5FFFA 4MJ3A 1QYVA 3TR0A 3ZNOA 1I1NA 2CVOA 4HKTA 4F2DA 3LBYA 2JJ8A 1LBIA 4KQ1A 1DPGA 5HG0A 3K5IA 1NR5A 4G5QA 1OX4B 4DVJA 1GGFA 5CURA 1AA9A 1P2GA 3GPDG 5IWCA 4O33A 4NBVA 1DKNA 5KVSA 1VFPA 4QUAA 1WCIA 4EI9A 2HRBA 4OJYA 1EWTA 2LWIA 4S1TA 4TYWA 1UM8A 3ORFA 5IKXA 2Z6VA 2SKEA 4K6FA 3GK3A 2WYWA 1R9GA 4RSHA 3O2QB 3AMVA 4URWR 1RM4A 4AG5A 5FOTA 2VF5X 1IL0A 3PWZA 3NVKI 3SM9A 3I34X 3WRYA 3C5WP 1OXKB 4QFDA 1BKSB 2RHOA 2WKRA 2X0NA 1M73E 2NXJA 1K6IA 1VMIA 2RJOA 3QVMA 4FGUA 4KDFA 4RMJA 1PEAA 5G1PA 1ODTC 1HWYA 1LZLA 1VXOA 2LIVA 4YA6A 1RQLA 2QENA 1AZTA 4ECEA 3ZZ0A 3FTNA 1U9CA 4MI9A 3KKMA 4GEKA 4B9AA 4HLDA 4XWGA 2VRWA 4CHTA 2BN4A 1QH1B 3ZBTA 3ZNQA 4DXDA 3OLQA 3EXG1 4YT8A 2AD1A 4QBHA 5JUWA 1IIRA 4F6RA 1UBGA 3AEUA 3GMIA 3KOWA 5L4LA 1EFVA 1R64A 4ZYWA 4LX8A 3IDOA 3ACCA 2CXQA 4HLCA 2B9EA 3V8BA 5C31A 3JCZA 1A9SA 3UHFA 1U90A 2Q6VA 1B8NA 1ACMA 1NX9A 3B60A 2FWAA 4ME6A 3EXHC 3EC7A 4BP9A 3V1LA 2QXUA 3HB5X 4WXMA 1VIYA 3GLTA 1CQIB 3O9VA 3VAAA 2IBTA 3NKFA 2Q7OE 5ISMA 3HJHA 4JHXA 1JLLB 1X1SA 3HCNA 5HZMA 1J5EB 2A9VA 2CSXA 3SM3A 3NJ4A 2CV1A 3HKBB 1R6TA 4NQZA 1R88A 4TXMA 1LBQA 2UYGA 3MJFA 1VYVA 3OJWA 4KBFA 2ESRA 4OQYA 5KNCD 3G0HA 1QPBA 5DGCA 1H2FA 5EIAA 1HE4A 2FU5C 3DEIA 3CW2A 1C2YA 1M2JA 3R75A 1WEKA 2GMWA 1JWLA 3VSEA 2RGAA 2C2WA 3NYWA 3QHAA 2EFJA 3BRCA 1NY6A 3OQPA 4WLNA 4Z9YA 1LC3A 1UOEA 3IJPA 3KSMA 3QE4A 1OYYA 4G1UC 4UMDA 4WN3A 3EG9A 3LI2A 4AN0A 2OGWA 4TSRA 1EE9A 4L15A 2B20A 2CDRA 5AYVA 2X41A 1TYAE 3M6MD 4G5OA 4PG4A 3VKGA 4DS3A 4LJAA 3W77A 3QIAA 1X0XA 1U94A 2JATA 3RIYA 4BLRA 2E5FA 1FA9A 3FCEA 3FAZA 2AXPA 4V0LA 4TVKA 2X1VA 1TB4A 3BERA 3B1YA 3G7UA 3OCYA 4WXRA 2C82A 4QARA 3ZX5A 3N05A 2J33A 3COJA 4TWIA 3IVAA 4YJ2A 1U8YA 1J8QA 4GF5A 2REQA 3L1HA 3MTAA 1VPVA 4TQGA 3E5MA 3TZQA 3O0TA 4TX1A 3FCXA 3ASUA 3Q87B 3U0BA 3U4DA 3U1TA 1CZUA 1LC0A 4W6ZA 1XA4A 2FPPB 1GM5A 4KE9A 2G9RA 3TGWA 4C4PA 1ML3A 4C20A 3R9XA 3RJ5A 2PT6A 4KHZA 1N7JA 1XTJA 2OWDA 1O9GA 1VIDA 2VXCA 4QSHA 3L7KA 4D4LA 5E6SB 4XJTA 3T5CA 2XXBA 1Q1BA 2VP2A 2X6QA 3L07A 3CR3C 4X90A 4H60A 3RG2A 1E64A 2CMFA 3HBNA 6NULA 1X7YA 3OZIA 4G1VA 3U4QB 5HRAA 2H5IA 1MW9X 1KJ9A 4G0XA 4WOKA 4GBMA 5JYBA 4ARSA 3ZEAA 1ETUA 4OF4A 1XEXA 4Z7OB 1JIUA 2HXGA 2E89A 2WFLA 3WSTA 4JLKA 1XO1A 4EHIA 3KO8A 2BHLA 1U7HA 2CFIA 1DAFA 1I2CA 3MG9A 5CYFA 3OE7D 3K70D 5KYUB 1SA0B 1DJQA 1ZA1A 4FHEA 5DX8A 4I55B 4IGKA 4RQAA 4Q9KA 4U4AA 3WS7A 5MHTA 2BP7B 4R2XA 4IVQA 4RLQA 1BVRA 1EVJA 1YIDA 2J3QA 4K28A 3ZXIA 4JLNA 3OP1A 4ZEXA 5K1ZA 3TUJC 3AKZA 5LQMA 4MGEA 4N5LA 3RM3A 3I83A 2CW5A 3ORQA 3DT8A 3WDMA 1S2IA 2C88A 3GDFA 4QPZA 4RY8A 1G5PA 2HK7A 1JTFA 6ABPA 1HL7A 2B2NA 5E4FA 1ZD5A 3ZUGA 3EPKA 5HKAA 5AKZA 1BEZA 5PNTA 3V4PB 3CB2A 1H22A 3QE2A 1GG5A 1L1QA 5U4XA 2FW0A 5EY5B 3IAFA 2Q1YA 3TZKA 4C88A 1AQUA 1OY1A 3HPQA 1RQRA 4P3PA 4RY0A 5EMHA 1HO3A 1S6YA 2ZVJA 4WOPA 3R3JA 2EQ5A 2QUHA 4FDMA 4C1NA 2X1LA 1YD7A 5CDHA 1JEYB 2FZWA 3OBBA 2PGAA 2PUVA 5E4JA 3I30X 2NPFA 1B15A 4E4RA 1U6IA 2E2WA 3PGLA 4NVRA 4R3WA 2WA1A 5DHAA 4BLSA 3ZU5A 3IQFA 4EKIA 2WNHA 4Q3KA 3O84A 3SIRA 3GCZA 3IXLA 5JT1A 1Q12A 5LWHA 2QRZA 1PQPA 3B6EA 3C5CA 2AJDA 3L7CA 3O31A 3OC0A 4ASUD 3O1JC 5KEIA 1VJTA 2PJUA 4OAPA 1U3UA 2AYXA 1FDRA 2VHYA 4ALMA 4EATA 5ALIA 1YNOA 1T3ZA 1WDTA 2A58A 4OXKA 2DQSA 1WMEA 3G3EA 2HDOA 4G5YA 5A5DA 3VMFA 4JJ4A 2JLAA 2MJLA 3KE8A 2DLNA 2XUOA 2VSXA 3TAXA 1PG5A 3IPRA 1MQAA 1GIAA 4O5AA 2C4TA 2ZRKA 4EY8A 5JAMA 3GLGA 1CW2B 1KYWA 3UWDA 2AKEA 4BNKA 4ZMBA 2PKCA 4QULA 1F5SA 1EX7A 3MXTA 4YP1A 1YQDA 3OQHA 2XJ9A 1BC5A 3B2QA 2YASA 3ZVLA 2EBUA 2WIAA 3LBFA 2POCA 2A1UA 3EF3A 2C42A 3V32A 4GRIA 3AEQB 4RYDA 5E0KB 3KYJB 1MU0A 2BCGY 1L5FA 3IDZA 3A10A 1D6NA 2X9NA 2PUGA 2IYWA 1CS0A 5BN5B 3H9CA 2HJGA 5D84A 4L6IA 4JENA 3ZWDA 4RF2A 4KYIB 1S01A 5J4YA 4PO1A 1GTRA 4CLEA 5FCDA 5ES4B 4CTOA 4GE3A 2L42A 5FI3A 1ZI8A 3FCUB 3EUEA 2BJHA 2A7QA 2BH9A 3G0IA 5COAA 1Y7TA 3KUXA 3KYDB 4BNXA 3QVOA 1PWXA 2PUWA 1YGYA 3HJNA 4DSAA 1ZW6A 3MWFA 4G4SP 2ZK7A 1ZVJA 4G5HA 1NFRA 1L4EA 2B4YA 2QMUA 4D80A 4EY5A 2CCJA 3EA4A 1GGVA 4R41A 1QZZA 1R8XA 4YP0A 4BXOA 3F6RA 3E27A 1GKKA 3X1WA 1RQXA 1VG0B 5CFZA 4I36A 3TR6A 3W5AA 1SG0A 4A15A 2CV0A 2YWDA 3KZCA 3QKSA 1Y9AA 1EUCA 4B3CA 3QLVA 1FZQA 3JW8A 4KQCA 2FG5A 4CM5A 3IMFA 5BR8B 3DXYA 2VO1A 1Z7BA 1WJGA 1KJNA 1QPZA 3HBLA 3MPUA 2GN9A 4NMLA 1SNYA 4B2IA 3LWZA 4AB1A 3LUAA 4GPBA 5DKFA 1NMSA 1XQ9A 2E87A 2WG2A 2XW6A 4R8RA 5ADUS 6REQB 5J58A 4ITUA 4BZQA 4L4YA 5DIFA 1PVVA 3FNGA 3O7WA 2JI8A 3E58A 3KV1A 3GELA 2G76A 3C87A 3ZY5A 4YPOA 4ARBA 4FTWA 1N0UA 2VDMB 3A1UA 3ANXA 3O9MA 1CDOA 2PGIA 4BVGA 3ZVNA 3LVFO 2OA0A 4JNCA 4DA7A 3U61B 2R44A 3BWBA 4EL5A 2WU3A 2O48X 3UQZA 4P31A 3W2EA 1A1VA 1C7RA 3A6FA 1PKXA 1ZP6A 5BPHA 1P0FA 1SOMA 1Z73A 2HEIA 3PICA 3FVQA 3DSRA 5CBPB 1T4CB 1XWWA 1Z7GA 3QI2A 4LYHA 2DFVA 3LP5A 4X1KA 4HRYA 1NMXA 3K6SA 1HH4A 2R6CA 1IG3A 4GNRA 1U2DA 4P8RA 3PNBA 4BDSA 1KY2A 1WPXA 4FBGA 4QGBA 5JQGB 5JTTA 4NBLA 3PUJA 5K3SA 3JRNA 1WLYA 1Y5MA 4PYQA 1VL6A 2G88A 1PL7A 4DBLE 1MG5A 3OVMA 1Y3IA 5EJ2A 2FXIA 2VZ9A 3PQ6A 2QMQA 1N8KA 4OIMA 4PGHA 5CPFA 1JR2A 1MX5A 1X7WA 2HX1A 1GCGA 1M6HA 1GKIA 3EXEB 2LPMA 3KZXA 3M70A 4IW3B 4LOKA 4UUMA 4BRWA 2RAFA 3F5FA 1EHCA 3HVUA 3H3JA 4LXGA 3CF4A 1V26A 3LU1A 1GPAA 3DGEC 4ZVPA 5B57C 4GH5A 2GTIA 4KXFB 2WK1A 3RSOA 2GPBA 1IY1A 1B7GO 4DDKA 3ONDA 3FNBA 3URMA 3KUKA 1VSBA 5FL7D 5CAEB 4XGNA 1SBTA 5GPBA 3WMEA 3HPRA 3HEBA 3C41J 3R20A 2XCQA 1X39A 2XYPA 1QO0D 1DOAA 3MVEA 5LUBA 1G8HA 1BX3A 1G17A 3CZPA 3BTOA 3OZCA 3F97A 3QG5A 1ULBA 3ZLJA 2I1WA 1QC5A 2GZAA 1KTVA 3NWJA 1OLXB 1XYYA 3HN7A 3QEOA 2G83A 1YU6A 3WIDA 4B4DA 1P44A 4FDLA 1LDNA 4MUBA 1BX0A 3JRXA 1PR3A 4F46A 2E4UA 5T6BA 4JLVA 1X8JA 1E0SA 1SU6A 2O9JA 4J07A 4R1PA 3GJYA 5C4GB 2HQ1A 3ZLBA 2RB4A 2WSSD 4F5ZA 5DHUA 1N36B 3OPQA 4YP6A 4J4TA 5EYPB 3AKYA 4FOLA 3F49S 3PGVA 3K0SA 3BMQA 2HF2A 1JQEA 1BDBA 3F90A 5L9AA 3IR7A 1BGVA 3DH0A 2ECFA 1GFZA 1X9HA 2N9UA 2CGEA 3OZFA 3DHWC 4PZ0A 5DGTA 3L8EA 1Y8QB 4ISCA 2CNWA 3VBEA 4D3SA 5NLLA 4H3KB 3NOXA 4L5JA 4YY3B 1M2WA 4TZKA 1H69A 3TBHA 5HEKA 1PWEA 3QVXA 4WW0A 3ZQKA 4CQLA 3NAGA 4HNSA 3WQHA 1C9MA 2TRSB 4P4LA 1W46A 2P0EA 2JKVA 3EMBA 3M6FA 1SQ5A 1UBNA 4H4CA 3WL3A 1W36D 4AULA 2NXCA 4ENTA 5CNMA 2RAVA 1CUDA 4K6HA 4MA4A 1XMIA 2X3UA 3CRRA 1U7TA 2DB3A 5E7QA 1NT2A 1QP8A 4AQ7A 2VNJA 3E3LA 1COZA 3K1AA 5C5CA 4V0QA 4PTZA 4D4IA 3QYPA 3UGQA 1PU2A 5IZ4A 2R66A 2YJTD 4ACAA 2VKTA 4PTYA 1P0PA 3COPA 3L5OA 2G4VA 1E3JA 4ARAA 4JP1A 1BDJA 3BZUA 4KYVA 2OHIA 1S2OA 4HN4B 1KYYA 4OXRA 5FADA 3E4CA 2RONA 3VU9A 3CNQS 1JILA 1KZ6A 1KXJA 1RYZA 2IZ1A 3AB8A 4JXJA 4L3WA 3VU8A 1AS0A 1Q17A 4XM0A 2AFHA 2PS9A 3NKLA 1NATA 3VR4A 4AWAA 1EBUA 2BFFB 5IM4A 1E3TA 4KPEC 2LDXA 4RKWA 5L3QB 1QRTA 1BKDR 1UKEA 3KNZA 1P5ZB 3QHQA 2BTEA 4AJIA 2J8ZA 4LG1A 4DR7B 1Y6GA 1J56A 2YZKA 5KTRA 5LA6B 4WKBA 2IEZA 4ND7A 1G42A 4CV1A 4NULA 5FPKA 2GCOB 2REBA 3Q8MA 4MV8A 3GLQA 4Z51A 1YBHA 5CG2A 2IY9A 3DKPA 3CRZA 1MAWA 4JWKA 2G09A 3OCVA 4MSUA 5HA5A 2QL9A 5A1JA 5CFPA 3E18A 1E5DA 3S4YA 2VPQA 2P5UA 3REOA 1CUEA 3VNUA 4IL5A 2XUKA 2BMVA 3B70A 1NI3A 1PJAA 1UR5A 1V96A 2AOTB 2ZE5A 4QYXA 3ZH2A 3UOWA 4CKEA 3RH0A 2ZYSA 3KD2A 5EUMA 2RBEA 2YHBA 3C5HA 2C7GA 3CEHA 3ZWKA 2C84A 5LIRA 3KJNA 2HMTA 2JJ1D 4FJ1A 4I66A 5PGMA 1E3EA 3CLHA 2QT0A 1N34B 2JKZA 1DWQA 1BVHA 1RAAA 3NETA 3P9PA 1KSJA 3O1LA 2QRKA 2CK3A 1ZBQA 4BP3A 3GLIA 1TFUA 3GRRA 3HADA 1AURA 2FX3A 3AEKA 4XUDA 1QZTA 3UAOA 1D3AA 1PFKA 1WZEA 1Y37A 2OB1A 3LV8A 4LXHA 3WISA 3EIOA 1EFAA 2V7QD 4FHDA 2QLMA 2E4ZA 5TE9A 1WL8A 1UFRA 1ZD9A 1IZ8A 3BGWA 3D6UA 2FPOA 3QELA 4H77A 4HBGA 4CMIA 1A4UA 2D2VA 4WERA 1WIWA 1EGHA 3H1FA 4NBUA 3CZAA 2CXXA 2X5JO 3O8LA 1OYWA 1OTHA 3GAAA 3OEHD 3T9BA 3JVIA 1OZFA 4A0RA 2QVZX 3CISA 2P9HA 2X5OA 1KEPA 1JDVA 4FPXA 5AK0A 3ZV6A 3F74A 1DIOB 2Y77A 2VATA 3GT4A 3IFSA 4NMXB 5DSTA 5EMLA 2G63A 1H6DA 1JIIA 4FEYA 1KO1A 1PRYA 3L0PA 1IG0A 1A8HA 2NV0A 2I03A 3AHDA 1XZFA 3AF4A 3N70A 1USVA 3VO8A 1Q5PA 5P21A 2QD1A 4Y6QA 2R1TB 5DN6A 1NR7A 1EQ2A 4HH1A 1D8AA 4B8WA 2P6RA 3VISA 1CULC 3PDCA 4AY5A 5BVGB 2AZDA 2JI9A 2DG2A 1IHYA 3PYLA 3IP3A 1U0HC 1ZH8A 2OCPA 3CCCA 4FE3A 1DO0A 2Y92A 1TUBA 2FEOA 4QQ8A 3VPSA 2FMXA 1CQJB 2VJOA 1A72A 1WV1A 1E1QA 4YT5A 3AKCA 4G41A 2V1UA 5JISA 3VH2A 1C8KA 1YBMA 1ZNZA 1AS2A 1E4EA 3NC0C 4ZVNA 4E3ZA 5DCUA 3H2BA 2DWUA 3DWIA 3HY3A 2WR8A 3PXAA 2E0IA 1UBHS 1ZN9A 2G4LA 4XW2A 1YR6A 5IASA 1OFVA 3QPUA 2HA4A 4GM1A 2VUIB 2GPAA 3V3TA 4FEEA 5DM1A 1ZR4A 1GUAA 1CQPA 3PQ2A 3BUSA 1ZGAA 3DGFC 2PO5A 4HNGA 3RSLA 3GXOA 3U80A 1SM4A 1LX6A 1IM2A 1FFYA 1GNPA 3RE1A 3SOPA 2HB6A 1L5YA 5CX1A 1AZSC 1PG2A 1ZKMA 3EXIA 1CVLA 3IHTA 3PNVA 2OK8A 3EBPA 1E6WA 2GFIA 3DVQX 3KL4A 3N58A 1Z6YA 4YAJA 1QFXA 2ACKA 4MGHA 4W1RA 2J4FA 2PBRA 2J6IA 3RT1A 1SRQA 2X42A 1DRVA 2R65A 1OU4A 1F17A 3JYNA 5EWMB 5BQ5A 3K09C 1OBOA 4Y6OA 3EJ6A 6LDHA 1EK1A 4OFZA 2QAIA 4ALLA 1J0CA 1O0CA 3MTJA 3IQIX 4X1IB 4WV3A 5KYGA 4CEIB 4UHBA 1HQCA 3ECSA 5JJCA 3EQ2A 3W2TA 4ZYXA 2GF2A 3Q7SA 1C1DB 1SB8A 1TECE 4KVZA 2O5VA 4B4OA 4C03A 3SD7A 3FLMA 1Z6QA 4FCVA 1X1QA 2PIAA 4UEJA 1X13A 2IXAA 3QFTA 16PKA 3ILXA 4O0LA 4DCJA 4DA6A 5CCBA 1OX4A 1KE1A 1TMKA 2BC9A 1RLJA 1H94A 3JAKB 4HLQB 1L7AA 1AY0A 1MR3F 1AIPA 1RWXA 2XB4A 2OLKA 3HRIA 4FYHA 2YN2A 2AGVA 4IDPA 4PC7A 5F2KA 5JSFA 4ESEA 1GZ4A 1UQRA 2DFPA 5IANA 3BJMA 2DUMA 3IT0A 1FQKA 3EHDA 4Q1EA 3KPYA 3SMQA 1E2LA 4FGKA 1GUBA 2IW1A 1QBGA 5FAKA 4FGWA 2Q27A 3A05A 4CNQA 1E3DA 2OSBA 4QLOA 5BUSA 2BGLA 2R4TA 4U2GA 1M10A 1K66A 3PD7A 2FUKA 3E7WA 3SN6A 4ZYLA 4LJ6A 1NGSA 1JJ7A 3FD8A 3OTHA 4MVJG 2R6HA 4XQCA 5IKEA 1RU3A 2XCIA 3GLHA 4DUYB 4ISBA 1P60A 2FEPA 5ESWA 1CYDA 3KKQA 4X20B 4XD7A 1QIDA 2I4LA 3FR7A 1T2DA 3TFOA 4QAQA 2A9RA 3LQFA 4RKEA 3S8MA 4EJ0A 2HQBA 2UYHA 1WB4A 4RMIA 1WR8A 4S1NA 5TF4A 2H6EA 2F64A 4ARUA 3ASVA 3B6ZA 4LRQA 3VOAA 2QGFA 4Q9HA 1E2UA 1JDTA 3C4QA 1V8ZA 1WD5A 1WNTA 2VPXA 5JAIA 2Z56A 3JAMA 1H5NA 4PLPA 4MV9A 1OREA 3DZKA 5H9VA 3VR5A 1O8CA 3CEMA 2BFEB 3D4PA 3OUUA 5A71A 3V3KA 5G1OA 3IJEB 3NR2A 5TDHA 2VQSA 4YMHA 4XEUA 1NZJA 5L3SB 1ZGJA 2NU7B 4LNAA 3AUUA 1UOPA 3E2MA 1MD9A 1MAUA 2OOKA 3SHFA 1XJ5A 5F35A 1JG1A 4B83A 3DXXA 2C8VA 3K96A 3RWOA 4B74A 2JS7A 4N8EA 3IGFA 4IGFA 1SXHA 4GOND 4JUAA 1UF9A 2V9CA 4UTOA 4A2PA 3HKBA 2UU9B 1OUMA 3GEIA 4J1NA 3CEJA 3P32A 5JWOA 5A2GA 2G1JA 1H4QA 3ER8A 2YXNA 2O6HA 4B5LA 5EIFA 4MUAA 2JHPA 1FJGB 4PYIA 5EE3A 1UFQA 5B6PA 4KWCA 3RUAA 2FWMX 2EU8A 4FOOA 3A8TA 3MOIA 2NACA 3KWJA 5ALZA 1YOVB 3NHYA 5C46F 1Z4QA 3M6XA 2GBFA 2PRKA 4I4NA 2GJAA 2EARA 2XDWA 3ZNNA 3PXEA 3E3NA 4Q3EA 4D3DA 1TC2A 2VLIA 3NATA 5K4GA 1Z5NA 1G4AE 2GKSA 2V7VA 1KBOA 2F7SA 3R3UA 4KW7A 3B7WA 3O3CA 1CRPA 4FN4A 4OGKA 2PGNA 4JBLA 1N2JA 5ALLA 1VGRA 2Q41A 3RUFA 4JB8A 4O4HA 3MA0A 4BRZA 2VNAA 1DOZA 1TT7A 4NS1A 2ZUFA 1VSVA 3VYSB 6YASA 4RD1A 3A28A 2JIMA 2CF5A 2ZSEA 3JQAB 5B58T 3N7TA 1PWYE 5FOQA 2O7NA 1NXSA 3AIMA 3HR4A 3PIRA 5HBRA 1MO2A 2CSUA 2Y93A 1YKFA 3OM0A 2DMRA 4U7TB 1PJZA 2FPPA 2JH8A 1RM5A 2OUKA 2ST1A 2R8ZA 2WWVD 2OXFA 2DR0A 2IDKA 3AVWA 1P6QA 3ET5A 2ZYHA 4A91A 1Q14A 1N1GA 2AN3A 1G5HA 3M9WA 2Z3WA 3WI7A 4HEA6 5J2UB 3R7SA 4J49A 5E6SA 5TJHA 5DHQA 3D7SA 5JSHA 1KYTA 1DQSA 2BTQB 3ZCXA 4W5HA 3HXLA 1JL3A 2DOKA 5K0SA 3I8OA 2H2AA 1SCJA 4QVGA 2R8OA 4Y9DA 1U7PA 2W90A 2PLWA 3LQ2A 2W71A 2JIZD 4Z0NA 4RY9A 1EB9A 5HF8A 5JC1A 4X1OA 1DAKA 4GP6A 4Q1CA 1MENA 4UPEA 1CR6A 3AO0B 3I53A 1U1EA 4XFKA 1L7QA 3CW9A 4K5QA 3QWAA 2P27A 1DDIA 1XAHA 5KVVA 1M1ZA 2ZYWX 2WICA 2VSNA 4MTCA 3FHTA 1Y98A 3I4CA 4EENA 4NXMB 1RTKA 1UT6A 1SJ9A 4E21A 5IZCA 1RCFA 1H2HA 2YWGA 5BWOA 4F1WA 1L9XA 3ZI4A 5KYUA 1E1MA 3NWBA 4DLKA 1I14A 4I55A 3B89A 2OR3A 1Z3CA 5AI4A 1GLGA 2XSZA 2BP7A 4MVJI 2ZP1A 3QQ5A 4L02A 1GL7A 2AUTA 2O2GA 1WUYA 4Q7LA 1OHHD 4OHUA 4G5SA 3ZWAA 4I1UA 1E2QA 1S02A 2XMDA 5HJ7A 4LY0A 4TVOA 4CM9D 2FW9A 2ANBA 2QXYA 3C1TA 4MTLA 4NQRA 2ODTX 5CR9A 2PR2A 2WT9A 5K4HA 1IB0A 2WMYA 3RCBA 3RROA 2ID7A 4Y9RA 4B6PA 2O8DB 3H75A 3FYTA 1C9NA 1I5RA 2QW1A 1UKZA 1YDWA 1J2UA 2WVHA 4C0HA 3QLUC 3BEDA 4WX2B 5FLYA 5GAJA 4LDZA 1OIWA 3ER9A 4MMZB 4EBFA 3W7VA 4ALKA 4FSDA 1MEJA 3FPCA 4PFSA 4HEJA 4IIVA 3JASA 4R69A 4AG3A 4NCBA 2KHZA 4OB7A 2A6PA 3RKSA 2QZJA 4KO8A 1ZCAA 1FX1A 1YI8A 3G2OA 1V3VA 5AIAA 2VDKB 4CQMD 5ALXA 4DLWA 5C7OO 1EE2A 1SKYB 1YGPA 2Q3BA 2YV4A 5CM9C 3FKJA 4H7IA 3B1JA 4TZ0A 2WT4A 4EYQA 2DHQA 4OHVA 2XVZA 5SZJA 2JFUA 3L6OO 5SY9A 3GVPA 2XQGA 1HV8A 4NYMR 1IEWA 2VRCD 3R7FA 4IDCA 3LDGA 3R9IA 5T7BA 3DUFB 3ECAA 1NRWA 2Q46A 3NI2A 4ZTZB 1NJSA 2HU5A 3GFVA 3H6HA 1ZWKA 4RA9B 1T5DX 3KCQA 4V0NA 5AVKA 3OQNA 2VIIA 3DE6X 4QL3A 1GPDG 4EABA 1SKYE 1DIHA 4PR3A 1IC6A 3ASYA 4BIMA 3ZY3A 3E9NA 1O77A 1PR4A 2UYQA 4PC6A 1AKEA 3WBJA 2WQ7A 1IN1A 4HXFB 4LYYA 1JECA 2Y1LA 1JEOA 3QNUA 5ITSA 2J5BA 3X43A 5FI1B 3OJLA 2XYVA 3NVAA 4GUAA 4N1AA 4YJHB 1N2HA 2W4MA 2XGMA 4PZLA 4QDJA 5EUCA 4NE9A 4EQZA 1C3VA 3W0LB 3G1WA 4IH4A 3NTLA 3D6TB 2FW7A 2UAGA 1JIQA 2APJA 4B3FX 4MCHA 4EA6A 4ZCSA 4DLYA 5JZVA 9LDBA 3CLTD 2CE7A 4KV9A 4OBEA 2PKQO 4WCVA 3FUCA 5JRJA 4EHNA 4GNKA 3AEQA 2IA5A 4X41A 5E7JA 1OGIA 3SFZA 4Y30A 1NJ5A 2NO4A 5BN5A 2YQZA 2YJ6A 1KDRA 1Q15A 2MSNA 2PA3A 3OZBA 1C9DB 2WF5A 2BZ0A 3NV7A 3S27A 3G5AA 4PIVA 2FG6C 1W87A 4UU0A 1VLHA 2XODA 2CD7A 2HCJB 3UT5B 4OA5A 1G7SA 2FEWB 5KU7A 1R6AA 3OUTA 2BI4A 2JW5A 3KR2A 3N59A 5CA1B 5C53B 2WP8J 3N87A 1ORIA 1K4YA 1RVV1 4IO1A 1K5GA 1T8RA 3ONVA 1IFXA 3AW9A 3LQ4A 4S1VA 3L79A 2JHFA 1BA2A 3G17A 5KTTA 2OQIA 4R4JA 4URXR 4KEAA 1GPJA 2BJWA 3O94A 4OJKA 4N0PA 1RYYA 2GN2A 2ROQA 5KYXB 4LXQA 2O2IA 1CUHA 1X8KA 3GCGA 3S68A 4YJGB 5F98A 3MTDA 5BYAA 2IS1A 4YUAA 2AN5A 3T3OA 4U9UA 4D2IA 5BW4A 2EEZA 3AXTA 2FMIA 2NYVA 1K86A 2IE8A 2Y27A 3NHUA 4IG9A 3V7WA 4A0FA 3KZMA 1C14A 2QAJA 3ZCSA 2FSFA 3S8EA 1CUIA 4GLFA 1A69A 1NVVR 4ZAZA 3VAZA 5K6TA 4P82A 1U0GA 2P8SA 4LZLA 2JFHA 4X3OA 6REQA 2VP0A 4N0EA 5F1YA 2XADA 2QD2A 1AX9A 4Y2VA 5FYQA 4IVPA 1BD4A 4G5XA 2CHQA 4KIWA 5CHYA 3VC2A 4AVYA 3NIBA 4DQDA 1L7XA 4QKQA 2YINC 5H0IA 3E53A 4JLBA 3TH5A 2OHXA 3LCVB 4QQKA 4DOMA 1HETA 4V03A 5D3MB 1N9GB 2C98A 4QNMA 3TMAA 3E6AA 4PCUA 3O1IC 2OFPA 3RUPA 5L4NA 2UZ4A 5EC8A 4OK5A 1X19A 4Z0HO 3CKYA 2D2FA 1ISJA 3RVJA 3H05A 2JLVA 4M7OA 3CB4A 4AZ0B 3EEIA 4DV7B 3BCHA 2O8FB 5CBPA 4HGRA 4IM7A 4RGVA 3FZEA 1XNJA 5ALNA 4MS1B 4ZK6A 6AT1A 1PEYA 2QIPA 5E3IA 3TJMA 3T95A 1QG2A 2PHZA 1OZHA 4QWMA 5IG2A 3PD0A 3P96A 1A97A 5A2QA 5JQGA 1IHXA 3RHSA 4F6CA 2DLCX 3ILSA 3UG7A 5HBGA 4BGUA 2YJNA 3B82A 2Q4EA 2O0HA 4XDHA 4XWWA 5CMLA 2JCVA 3Q5EA 1NURA 5ALDA 5EZYF 5I8PA 3WJAA 1A04A 3KSAC 2PZBA 5YASA 5AVVA 1W9MA 2GZMA 1L4YA 1XQVA 2QS9A 3EXEA 4IUCS 3NYQA 1H2AS 3U3DA 2X4DA 4YO8A 4QE3A 4RK6A 1QIHA 4G2NA 1Z2DA 4XRGA 2PSDA 4RCZA 1AKVA 1NG1A 1DBWA 2WTMA 3DBOB 3AL2A 3NVDA 3QBJA 4M54A 2E18A 5DOVA 1XKXA 3PYXA 1LW7A 1OXMA 3ESXA 3WGLA 3WGJA 5CAEA 5J43A 4WADA 3BAFA 2VP6A 3MINB 4B6OA 2QVXX 2W6JD 1IXKA 4W7IA 1RJFA 4MUXA 4E5MA 4HS4A 5I9BA 4X6LA 4HQLA 4GPD1 5AHKA 2QUZA 3LVBA 4YTEA 1XNRB 2W4QA 3LGSA 1JB1A 3WLLA 1OLXA 4N3AA 3AB7A 3WIVA 4J0GA 3OCJA 2PJRA 2R751 1QR2A 1QGED 3G8YA 1XDSA 2X9QA 3DMDA 4BO3A 4Q18A 4RJ2A 2QMOA 4OQLA 5JJKA 1FDUA 5ERYA 2NX2A 1LS1A 8ADHA 5KSWB 1M72A 1U8FO 2F2TA 3L0ZA 4LVUA 3KK0A 4YBZA 5FLEX 1E9EA 4OLHA 3VPAA 4BZZA 4RBNA 1XUOA 2ECOA 3FWYA 5JFOA 1C5KA 4C3UA 5AW8A 3OFSA 2QUBA 4XUGB 3ZJVA 1A2KC 2XMGA 4BBPA 5T3UA 1N4DA 2AX4A 1SBIA 3E0QA 1RVDA 1V0JA 1IAVA 2ICAA 2P4SA 3F8SA 4TLMB 5A9SB 5AW1A 2GZ3A 5LXTF 3S5UA 3Q3JB 4MAAA 1Y8QA 2E4WA 1P81A 3C3CA 4MUFA 5AOVA 4F91B 4WSOA 3GZJA 3DXZA 1YFLA 3V1UA 2ZCJA 2WAOA 1RYHA 1GILA 2IYTA 3D4IA 1DB3A 3B6JA 3I01M 4MS3B 2DR3A 2WRZA 2XWJI 1J0XO 2F62A 3ILYA 3LY8A 3GPIA 4CFYA 5TGDA 2OVBA 3ZNPA 4DKJA 4DA0A 1DI0A 4IQ4A 4WK4B 2Z1DA 2E6UX 1MQ8B 5CJJA 2P9FA 1P74A 5A4KA 2AS0A 5LSAA 3ENNA 3SBDA 1MZVA 4D7AA 1R0KA 1PJSA 5JOQA 2P62A 1EIZA 3EE6A 3BD8A 4ZEWA 1M2VB 2I7CA 3NTXA 3L4BC 3L7BA 4I1IA 1WDMA 2V7WA 4JQOA 3VH4A 4UBNA 4IIJF 4LDPA 3S2GA 5AVXA 1FFCA 3T7IA 2P77A 3DZHA 3IAXA 1S8AA 3F6CA 4DJFC 1NP6A 3U1BA 3PRJA 1C7JA 4QOIA 2PL5A 3EGCA 3B9QA 1P80A 4HLUC 1FRQA 3G5MA 4LJ9A 5THQA 3U4AA 5A5GA 3QQPA 3OLXA 1MDBA 1T0UA 4Q4JB 4NEQA 3E70C 3M9LA 3QKRA 4TQUS 4D0GA 2LR0A 1P45A 5JS8A 3L1KA 2O52A 3IBFA 1KI8A 2BUBA 2FI1A 3KQQA 1JA0A 4LE1A 5DCLA 3Q1LA 2BFFA 1HF3A 3PXBA 2VF7A 4LAFA 3GLUA 4O2AF 3UWSA 1PR0A 3CUUA 2HWYA 2YZ2A 3G7SA 3L02A 4NPCA 4OBWA 1GGJA 5LA6A 4GMHA 3FOFC 1KVRA 1RPJA 1E18A 3JQ8B 4KK4A 2GCOA 4MQEA 4ZO8A 3WGIA 1WF3A 5JPDA 3BMXA 4R9RA 4KN6A 1D6JA 1MP0A 2OHFA 1XHEA 5CT5A 1O8BA 1E9SA 3TNYA 1UBRS 1FJXA 4WY2A 4DT1B 4C30A 5K8CA 3H87A 5J23A 2IH4A 1K9SA 2YV1A 2AMVA 4FNMA 1Z12A 4RFLA 1TW2A 2O14A 2P4EA 3OICA 2HOQA 3CNBA 3RB8A 1AV6A 1HQKA 2CNOA 4CGZA 3V1YA 2KE5A 2CLSA 3NPMA 3RU3A 4BY9E 1PFWA 2PYDA 2ZI3A 3I64A 3LBHA 4JL8A 4NV1A 1RI4A 4N01A 1NF2A 1MC1A 2C2HA 3BPSA 3DBRB 1L0BA 1CUJA 2G1UA 1Z8HA 4C3VA 3D0KA 2GN6A 1YE5A 1PV2A 1COWA 3EGDB 4KLZA 3D0QA 3SLKA 2Q5OA 2ZJ5A 5K3AA 3R5XA 3ZDXB 4Z7QB 2NADA 2QJOA 2AW3A 2WHPB 5F7ZA 1LJLA 3FDJA 3ND8A 2DE0X 4Q39A 1W4AA 1T6BY 2YUIA 1ZD2P 2Q5CA 4N49A 2AUNA 2YDYA 4WESB 4YCBA 3RUCA 1KIMA 2EDAA 4JAVC 4J7CA 4DILA 1CDEA 1ZSNA 2C92A 4XQEA 1UKBA 4GX0A 1RAFA 4PX9A 1VKJA 4R84A 1VKOA 2P6MA 2GCEA 1WZIA 5EXSA 2VK4A 5FTKA 4ZHQF 4UUQA 4Z4FA 3GFFA 3EAQA 2M2IA 2R6GA 5BNIA 1ZNQO 2HYIC 4NG5A 2KBFA 3SSOA 4HRAA 3IUQA 1G8JA 4RW0A 5IC5A 4H3VA 3B3GA 3QOXA 1UOOA 4R8LA 2WYOA 4C0WA 4LK3A 4GICA 1R4ZA 2L17A 1KI9A 3MB8A 3DL2A 3OOHA 1I7QB 3FLAA 2WG1A 4PFKA 4YCCA 1ID8A 3H5NA 3NANA 2GEDA 3ZGNA 4F7WA 3L6RA 3EOBI 2CCGA 4ZAGA 4R1LA 1JH8A 1G8AA 3RLIA 2FMFA 3L8HA 1M2OB 2VCHA 2BFWA 4BV2A 2NYAA 4EJ6A 4NFLA 2BI8A 4OU5A 4R6XA 2HPZA 1XVLA 2OG1A 2XVMA 3UBMA 1N2GA 1QHIA 2W11A 3P8ZA 2H18A 2LTAA 4B6JA 3DAYA 2R1TA 3JALB 1Z6AA 3LX4A 5C8DA 2EFHB 4YT2A 1GZDA 1GQOA 4OAQA 1JHPA 4QELA 5BVGA 1OAOC 1DUIA 3L7YA 5CD1A 1W5SA 3B1VA 2HPAA 3OY2A 3PYMA 2NAPA 3LY9A 4N0MA 1LPSA 1HFWA 2RH4A 4KE8A 3U19A 1VLVA 1UJ6A 2J59A 3ZI0A 3NYRA 1X70A 4B09A 3MSXA 1CQJA 4CL3A 2X8AA 1TIKA 2Q5JA 1EG7A 4I9FA 3AI1A 4J9UE 3DCIA 4M22A 3HXMA 3DW3X 4ARIA 3S28A 1YHYA 4JLSA 4UQLA 4P4GA 5EVCA 4N3BA 1UXKA 1ONNA 1RQPA 2W8BB 3WWOA 1ZZEA 2HA7A 4ZIRB 2P91A 4IF6A 5JAQA 3WSWA 3D31A 4DDMA 3A9SA 1V7PC 3RLFA 3I62A 4J16A 4WFJA 3ED5A 4QX6A 3ZXXA 1N92A 4O2RA 3WLQA 4KLNA 1NL3A 4EGCB 1NM5A 3OFNA 3C8DA 1QNLA 4W99A 4KGVA 1EXWA 1IHPA 4D25A 1P9WA 2WV9A 1KRXA 3Q3EA 2YVKA 2JF0A 1Z47A 3HUFA 3V97A 3PVCA 5FQNA 1S2NA 1TMOA 1OBCA 3DO8A 5JIBA 1R16A 3K70B 4LZPA 4KSCA 3VOSA 4BLOA 2VCYA 3THWB 5C4IA 1KZ1A 1Z74A 3FMGA 4ID9A 4XCVA 5EWMA 5JADA 1QE3A 2P2GA 3IMEA 5DFAA 1T1IA 5GP1A 4BFSA 5K3DA 1U7DA 3HG7A 4JU9A 4X1IA 4CEIA 2NP6A 1KI3A 4H16A 4R2MA 3QEMB 3Q10A 4ZVKA 3VRHA 2PFSA 1XT6A 2G5TA 3ZCPA 2PGXA 1Q1AA 2QN2A 3CN9A 3EMKA 2FQQA 1C1DA 2ZROA 3HCWA 3IUSA 4HEHA 2P9ZA 4LGMA 2O2HA 2DP4E 4CM3A 3K0CC 3HDTA 5KJ1A 3UF0A 1VHTA 4L1KA 4DWWA 3MK31 4DMKA 1HXHA 1KDTA 4HDSB 2OZLB 1M2HA 2WJAA 2K5UA 3JAKA 3DE1X 1GSAA 3MJRA 2QF7A 5GJWC 1RC8A 4BBJA 3D6NB 2MMGA 4K26A 3IOEA 3TOZA 1P1FA 5C1OA 2OT3B 5KREA 2Z98A 3LK7A 3TKYA 2D74A 2Q8QA 1KU6A 4D45A 4E32A 1F8GA 3GB9A 4FC7A 2QQ5A 3ADOA 5FHQA 2IBSA 3K2QA 1BE0A 1EHIA 1YR7A 2X8BA 1Y8RB 1LPMA 2AQHA 1DRWA 4NR0A 4BMVA 1RFGE 1WV0A 2J4CA 3INTA 4ZO6A 4MLDA 5BQOA 1LVGA 1G9TA 2VAPA 2JHAA 3UWOA 1PTJC 1ZAYA 4YPVA 3HHPA 2VJMB 4TXJA 1M0WA 4EF6A 4BO0A 3B48A 1Z26A 4DRXB 5J4HA 2VG8A 2AOVA 5IC6A 3PE6A 4BQIA 4YUVA 1IWBB 4FDVA 4GOXA 2B34A 1ONPA 2HADA 2EVWX 4C2UA 2YZMA 1CZLA 4OLFA 3U7IA 1D9XA 2WHXA 3C3KA 4N5IX 5TQJA 1YBFA 4CTNA 3MWLA 1VYHA 4EW6A 1KFBB 3JQGA 3L7NA 4CKCB 2OYRA 2FH5B 3W4JA 1J1UA 4H1HA 4OGLA 2L2QA 2BFEA 3CUSA 1T5TA 3EBLA 2A9QA 5ED0A 2YV2A 4RF3A 3J7TA 4V24A 1PZGA 4NH4A 3FG9A 3P5SA 4G6ZA 4BKQA 1TYCA 3H6KA 5L3SA 2NU7A 1JSXA 2JGAA 1HA3A 4KR0A 3RTAA 3UYKA 2A86A 2CUZA 2JGKA 3D9QX 4P22A 4DLBA 4QHTA 2ODPA 1K63A 4O4LF 5J2UF 3QEAZ 2XGOA 4D5EA 2AN4A 4RF5A 2R87A 2FP4A 1IUPA 1L8XA 1LVUA 1O95C 4HDKB 1DWPA 2HF8A 3L7JA 4YAFA 4XB2A 3IQXA 2J3DA 4NV0A 2Y1WA 2FUCA 4IOMA 4WUVA 2JFNA 3OJFA 4XDYA 4UXIA 2D1TA 2YW9A 1YB6A 2PBFA 4LXIA 3U7GA 4FMDF 1YOVA 3FFWA 1JG6A 1XDDA 3THOA 4EDFA 3UJ7A 2VN8A 3G0CA 2YWCA 4LV5B 4ZVRA 1MCZA 2D7JA 4B71A 3ZQ4A 5DLQC 1YMUA 3E5RA 1KP9A 2PRIA 4R0VA 4FYYA 3W5VA 2J7PA 1UZMA 2PL3A 2YS7A 4B46A 4AUEA 2WWYA 1XPUA 4ZV7A 1MEOA 1RSZA 4C0JA 3K1YA 1TEVA 2ENUA 3KAJA 3L0OA 5E6UB 2E9SA 5KQGA 5I7FA 1PNRA 4E2YA 1W1UA 1QVAA 2QD4A 3LXMA 5LBIA 3DD5A 3T9FA 2EAUA 4ZGWA 1TEXA 1NOIA 2G1KA 2XYHA 1YV9A 3I1JA 3L7DA 1FRZA 1TVKB 4V0KA 1WA5A 2HU7A 4HDAA 9ABPA 1U4SA 4JYAB 4OH7A 1D4ZA 1R12A 1KPHA 2NO6A 3JQAA 4JOBA 3AVTA 4BNIA 1LX7A 4K0RA 1QHSA 2MYPA 5DP1A 2H4ZA 4YDRA 3IP9A 1SMKA 2EV9A 3HJRA 3SZUA 2FWJA 3GFQA 1J90A 1AQ6A 3U48A 3O8OB 2L19A 4ZZIA 3BFKA 1T8PA 4FSXA 2A30A 1CEQA 2H51A 2VBCA 4HDRA 2BTQA 4JJ7A 3TPFA 4M1KA 2IYZA 4ZVLA 5LZ2A 4AI6A 5M7EA 4CN9A 2P0AA 1AKYA 1DXYA 3M89A 4B84A 3II6X 3E9EA 4G2TA 4JLMA 3WLMA 3RK1A 3LYLA 4TPKA 4QXOA 3U4MA 2IXTA 3QY0A 2KPOA 1JHRA 1EFCA 1RKBA 1F8YA 1QNFA 2Z8YA 4EFNA 4OFWA 4F4DA 3H19A 5HGJA 2MSWA 3JQPA 5ULLA 1LBHA 1T35A 2C99A 2OXIA 1Q7BA 3I6QA 5KTNA 3GZNA 3CYFA 5CGQB 3N0XA 2B36A 3L8MA 3KL2A 3H9BA 1YT5A 1ZRSA 2VHCA 9ATCA 2J9YB 3DZDA 3NHAA 1BQ4A 2GF9A 2PKXA 3CHYA 3BKXA 5DCYA 4Q1FA 3TX2A 3VGJA 3THYB 1HKUA 1MOPA 4Z3DA 2WHQA 3UANA 2BBSA 2B35A 3FB4A 1J9EA 2P4QA 3LD9A 2WTBA 4ID3A 4NDZA 2WKSA 5EPEA 5CXUA 4YJ3B 1L5SA 4JT8A 1MO3A 3B3QA 3G89A 3PGKA 1SWWA 5GONB 2RK4A 2CXSA 2D2IA 2OL4A 1JKMA 4XARA 4YJ2F 2FR8A 3IESA 1Z7YA 2YHUA 4D3YA 2D4AA 3J81A 1IM5A 1K88A 2JCXA 1M2EA 2WQZA 3TMKA 3C1UA 2FLKA 2O8DA 1EK6A 1JQBA 2FW1A 3QUCA 4IR7A 1TEHA 4LKOA 1Z13A 3AVXA 4Q3NA 5G40A 2NSDA 3FUWA 3KFVA 4FZJA 1U8TA 5KPJA 4UEQA 4ZD6A 2J7KA 3MRXA 5H82A 4EECA 5DNVA 4ZT5A 5BWMA 2O8CB 2W2VA 1AKQA 1YDEA 5L95A 4E08A 3T7AA 2WWRA 3BL6A 5JLJA 2ZRGA 1VG1A 3KXIA 3A7DA 4LWOA 2KSQA 3STWA 1GPMA 2GK3A 2YV5A 4ND4A 3ZLVA 4MI3A 3KKEA 3OMLA 1OQAA 2IS6A 3I2HA 3DUFA 4NATA 4OYLA 3X1DA 421PA 2LV8A 2G82A 2P2DA 4E46A 1HNNA 2B0CA 2Q5EA 2VBFA 5KJFA 3K73O 2JLUA 2IPAB 5CDFA 3UK6A 4U39A 4RA9A 3Q40A 3TZHA 2BR5A 3DKVA 1W4ZA 3RVLA 3V7FA 3WRYC 1QONA 2DULA 3ST7A 1QRRA 1IZ0A 1FFEA 1X8XA 2PANA 1A8QA 1MB9A 1YDMA 4M1WA 4QXMA 1G3RA 5IBRA 5HZKA 1O94A 3AR9A 3KVNA 3KSUA 4C6TB 2A33A 2R6R1 1M1YB 2I3DA 1BS2A 2IYOA 3HR8A 2OO3A 4LRWA 3TNDA 5BURA 4YJHA 5T4EA 4YXFA 2XWSA 1NLYA 5JMOA 3GARA 3CF4G 3H2KA 1RHRA 3OU6A 4FFLA 5EKTA 5LP1A 4QEZA 2Q6TA 4BB9A 3TLEA 1E7MA 3WYCA 5ARBA 1W36B 1A7UA 2I1QA 3I0MA 3PC6A 1Z7EA 4JYBA 3LQQA 3BYZA 3ZGZA 4I81A 5KAPA 2HHAA 1V3TA 3KEFA 2Q99A 3OU2A 4K6KA 3WKAA 2QBYA 3EEYA 2YJZA 2EP7A 2FQXA 2GN8A 2HBQA 3N6XA 5M2QA 1M1YE 1OKKD 1VDMA 1FLVA 4Q1AA 1PNVA 1QIIA 1Q7EA 1KL7A 2QJFA 2W6OA 3U5TA 3HYCA 4BU1A 2EJBA 3FHJA 1A5TA 1NFQA 3UT5A 4TMXA 2X13A 3OIDA 4B33A 3VZQA 5A4AA 1E3SA 2CHUA 3I9V1 3E03A 3H9QA 1NFFA 2HM7A 3FRHA 3OA0A 5CA1A 3T3DA 5HRCA 3HGTA 2LVBA 1C4KA 4NC9A 1PJTA 3CIOA 1J5PA 3IAM1 1KMQA 3BILA 4M21A 4QU0A 5K4AA 3GFBA 1U3CA 4MULA 1DKUA 2A3RA 4GM0A 4RZXA 4D8YA 2D3WA 1TXGA 3GAMA 1DLJA 2CDBA 3G6WA 4ZKDA 5JZSA 3D4LA 4LF5B 3SJAA 3L0IB 1EVKA 2DWCA 2JFGA 2GASA 3LT4A 5KYXA 1T8UA 2SBTA 2I7XA 3KVYA 4CIYA 3VYRB 4BJHB 3GH1A 5EHQA 2JDID 4HOYA 1TQHA 1BG6A 1LLQA 4W1SA 3P9QA 2IHYA 3Q3IA 4PX2A 3GRKA 2ZAOA 4R0MA 1XD2A 3TI7A 1ZOLA 4JBHA 5LYJB 4PGAA 3T1NA 2YJ4A 1QTIA 5EJ6A 1XZEA 3DBHB 4MW1A 1RMYA 2BFAA 4TSFA 3KQWA 1TQ8A 5DBGA 3IOYA 4BU0A 1KJQA 3K9HA 4RU1A 2AUMA 2FLWA 3I9FA 3IAAA 1DOHA 1KP3A 1NBAA 3IP6A 3SR3A 5B37A 8GPBA 1LXCA 1HL3A 2WJWA 4RPIA 1XP5A 3ODPA 2XYRA 4X44A 4NZYA 1N9GA 3L18A 5D3MA 1VKRA 4BEBA 2IF0A 3RD5A 4JASB 2H0AA 3WJ7A 3PR1A 1J6UA 3G13A 3AJDA 1IONA 1DKPA 1UXIA 2NV2B 2NVWA 2OCBA 2Z30A 4GO1A 4HAZA 3AC0A 4R40A 1IZYA 1BVUA 1ZCZA 2QMYA 4XM2A 4N48A 4QRHA 1U6KA 5D6NA 5AHXA 3OOWA 3NTQA 4L8VA 5KUTA 4MS1A 2ILVA 1YC5A 2ZWMA 4US1R 3GZ4A 4WEQA 1ZNXA 5CB8A 1W7AA 3ON5A 5IF3A 1BU8A 4JJZA 7ABPA 1XRMA 1O6CA 4F45A 2ZI9A 5DM2A 5IMSA 3AZOA 2FTKE 2PXXA 5IT9A 3WMWA 2XT0A 4BATA 1THTA 4LDJA 4EB3A 2R8XA 1LK7A 3M9XA 4KAFA 3OTIA 3R5FA 4AF6A 2ATEA 4CMKA 5AUPB 2FJUA 4HXYA 4YRFA 3AKEA 4M0PA 3WFIA 3WLKX 2RHHA 4IQFA 4MW7A 1GNLA 1GT91 1ZI6A 4L16A 1JR3E 1KKLA 3CBQA 3GJ4A 3P52A 1ZMRA 3A6KA 3CRNA 5J63A 3TN7A 2EZ4A 5M34A 3L01A 1T5IA 1RI1A 4LECA 5DHRA 4EW3A 5EE1A 2QROA 4FOPA 4WVLA 2BFCB 4F38A 2ZXEA 4DIOA 3BK1A 1M1NA 2VHTA 5HZGA 1HEYA 3TGLA 4LJ5A 4RJIA 3MINA 1EMDA 1XDGA 2QUJA 1FYDA 4RSRA 2C4KA 1C81A 4DMHA 2RH5A 4YGXB 1BFDA 3E22B 7REQB 4ZPXA 3IPYA 3TLJA 3O2JA 4LBYA 3H5RA 3LPNA 2PH7A 1JEAA 4FEGA 2IF2A 3TW8B 1A4IA 4YQEA 2UYOA 1JPVA 3B8HA 4HAVA 4NKRA 2YNMA 3PSHA 4Q01A 4RETA 5FNZA 4B6FA 1Z4LA 2IRWA 3ME5A 1VI6A 3TRKA 1ZIOA 4JQSA 2CBZA 4DQLA 5BQXA 1F7VA 4ZCQA 3CT6A 3PFWO 3IOMA 1FOEB 3U3XA 3UJPA 1Z06A 5EJMA 4XGRA 1A8UA 2CWWA 2NZWA 1JDBB 1VGVA 1GGKA 4HMPA 3FFBA 1DBVO 4NJOA 3SQWA 2QIOA 5DTIA 1XCJA 2BEKA 4QJIA 3MFYA 1VLJA 2I4RA 1BHQ1 3WXBA 2AEFA 1EAMA 3W2HA 4RNDB 2W00A 4L0MA 5AP9A 3VQTA 1CRLA 1MABB 2IQIA 4K9DA 3K9WA 3HH8A 4IMIB 4X93A 3WLSA 3J80A 2VQFB 1LDYA 1NJ2A 3TI9A 2RHJA 4MS3A 1QHHA 1F3OA 4QYIB 5LFAA 4NCNA 4IOKA 1ZD3A 4BAGA 4KR3A 4J91A 3HSYA 4JR0A 2FKNA 1IQUA 5CLHA 5F52A 2A92A 4NCJA 2F00A 1RR6A 2HHCA 1BXKA 3AR4A 4XI9A 4EFLA 2G71A 4EF5A 3WGZA 3OZXA 4X54A 3TVTA 2EFCB 3L46A 3KT0A 4PHFA 5C8VA 2GPWA 2Z43A 4FW8A 5GADl 1NQXA 1M2VA 1JQLB 2CJXA 2Q9UA 1HSZA 3H5OA 5CYOA 3Q6NA 3CRQA 1PR6A 2GAOA 1JLKA 4IZOA 5SV2A 1XQYA 3H2ZA 5FNVF 5SY4A 3R0IA 2OENG 3WAGA 5BMOA 4CF3A 2VDVE 2VJQA 1L7VC 5BVHB 1HQYE 3HWWA 1EM6A 3OSUA 3ADBA 1DS6A 3QUBA 3TR5A 5FR1A 1KSFX 1XTPA 3DZBA 2Z2YA 4CMGA 1IAQA 1V1RB 2EJUA 2ZVPX 4Q4JA 4MRAA 2VH2A 4UFNA 4C0QC 4PO9A 2GKGA 2YICA 3KB1A 4JYCA 3RODA 4YRBA 5ICFA 4BTVA 4DW8A 4G8CA 4P34A 1KH3A 3C7TA 4CT5A 4NJMA 5MFPA 1U4NA 1K8QA 2J0EA 3FPFA 4DJTA 3QBVA 2AWNA 4AW9A 1FDSA 2CNBA 2RKBA 5KHLB 1Z83A 3WMXA 1JEQB 5IT5A 2H7XA 4RO0A 1Q3KA 4G0WA 3PUZA 3JQ8A 1BWPA 3L8YA 5FWYA 1AC5A 3TSOA 4AY6A 1G8MA 3UIEA 1NOJA 3T1QA 1XRPA 1SVSA 3HJUA 4DSZA 1YMVA 3R0VA 4TMTA 3QLVC 4S35A 2J5XA 2NZVG 2O2JA 4F4FA 3FOCA 3V00A 1FK8A 1Y1PA 4EPVA 3C8UA 4IJWA 1YZQA 3EIWA 2FF7A 1A98A 4MV7A 2FSIA 4EFKA 1UL1X 3DBRA 5FOSA 1GPLA 2UXDB 2ONZA 4RZQA 5B2EA 3WDSA 2I91A 1PFUA 1DT3A 2B99A 3ZDYB 1SGWA 5TRTA 3PCXA 4G01B 1S8FA 4YRPA 1CV2A 2IUUA 4CL8A 3TUZC 3O8RA 4RXMA 5B2FA 2PSSA 2ZB3A 2WHPA 2E21A 3ZGLA 1PZHA 1CXZA 2IODA 4CDRA 1MTOA 1NXQA 3KU4A 2PS3A 4TL8A 1Q16A 4UATA 1W2HA 1GUDA 5D5HA 2W2QA 1ZL0A 5KNCA 3FVWA 4HMQA 2C94A 5G0VA 1XDBA 2ZWAA 5E1BA 1YSCA 3Q72A 2JGFA 3FFAA 2AMFA 2I3ZA 3P2IA 4Q9NA 3CWZA 2PDAA 1HZJA 3VJKA 2JGRA 3L7AA 5L53A 2FY8A 4J0HA 3ORSA 3UNXA 3DEAA 1RXIA 1U2DC 2GN0A 3SK0A 5ALOA 1AKMA 2WJGA 1T3GA 2B98A 1CT9A 3RC1A 1F0PA 1VB5A 2WHYA 1GZUA 4FLMA 2DZDA 3B9RA 5BWCA 2XRZA 1HSOA 1OROA 5FO1A 5MN4A 3BT7A 4LNUA 3CX6A 2H2GA 1M2OA 5BMVF 3A9RA 3F2IA 1E0DA 4GVPA 1XZDA 1BXRB 5AR1A 3NCHA 3SVZA 2O20A 3ZE6A 4P3YA 1LCIA 3A26A 2ZJYA 3CVXA 4JX9A 1T2VA 4PC3A 2NN3C 3JALA 2X86A 1K6JA 1U8XX 2LKCA 4RLSA 4KVAA 4TT3A 1DJLA 2RHMA 1GL3A 2R8BA 3OBIA 4JUFA 4P4SB 4LRXA 3DV0A 3SC2B 3MLBA 1DUSA 2BSQA 4KLAA 2PGOA 1N0VC 4P3NA 1XLUA 4HGPA 2BELA 3WLIA 1UJBA 1DRJA 1I3NA 4OP3A 2ZUEA 1OVMA 1JMYA 4BCBA 2R7MA 1ZY2A 3O3NB 1L4GA 1LKZA 3MN1A 4JC0A 1M7BA 5LZ8A 2BOVA 2W8BA 3SLGA 3FW1A 4Y1RB 4L08A 5D5QA 5HIAA 3VYUB 4ZIRA 1ORDA 2BE9A 2OKCA 2WUGA 2A5JA 4REQA 5DRTA 2FHSA 4X24A 3TZCA 1HYQA 2OCGA 3DA8A 4EO4A 5EJ9A 5IKPA 3TEMA 3C74A 1YQTA 3BKWA 4XIYA 5A7FA 1N2XA 2NUAA 1QX3A 2VRNA 4YAWA 5MDHA 1FLNA 2O54A 1ZPDA 4RHXA 4DSNA 4JS0A 2J4DA 1HX7A 3CMMA 3C6BA 1L7PA 1SD5A 4NAVA 3ZJ4A 3D2AA 5GZ3A 5TNXA 3L4JA 1KI1A 1OILA 1D8TA 3OE7A 1Y1KE 1I9GA 3B36A 4BMOB 2UUOA 4CV0A 5BSVA 3THWA 5KDOA 5KOYA 3D6FA 2O2EA 1TAUA 5LMCA 3HFRA 2O50A 4XCQA 1I4DD 4ZQGA 1VHLA 1W19A 3C8ZA 5CFNA 2V0NA 3COWA 1YR1A 3HB9A 1E2BA 3ITKA 2BMDA 2F17A 3X1ZA 1JHXA 2H1FA 3F9CA 3HZOA 3KQMA 1SVIA 2FX2A 1HLPA 3K9NA 3MCUA 5G53C 5A9TA 4RLFA 4B79A 1EVIA 2AB0A 2C0QA 3QXGA 4MW0A 3UB4A 4DA8A 1YR8A 1YZYA 1ZM2A 1FRNA 3KZ1E 4HDSA 2OZLA 4X64B 5A6SB 4AKHA 2L82A 1AK2A 1NUTA 4WJLA 4R71A 3CX3A 3ZD6A 1QQ6A 1Y1QA 1KJWA 2IFTA 1A7AA 4PZZA 5AKLA 2AMYA 1KOFA 3PUWA 1KZHA 3LC0A 4N8DA 1RC1A 1ZG3A 3AG6A 3GJ3A 4M38A 3AM3A 1FSPA 1D2AA 2B8NA 2XV1A 3DO6A 3LPCA 3RADC 2HLDA 4DB4A 3IT2A 4J0IA 4CQMB 2F1JA 3IIJA 1RBQA 2WSMA 3OI7A 3Q8WA 4FHGA 4MA0A 2VHXA 1GPNA 5DM4A 4Z3KA 5IU6A 3DMGA 1SHLA 1G3QA 4CKYA 4RJJA 3Q41A 2WZDA 5BSEA 4YH1A 1B16A 1GTSA 3ZHYA 1NDHA 1U9YA 4PANA 2VJMA 3SQMA 4DHWA 2FFJA 2Q6OA 2HK8A 2QJTA 3HBMA 4INOA 1LH0A 1NYQA 4ASUA 2YBDA 3EY9A 3H9JA 3ZW9A 1U2PA 1P1RA 5ER9A 2GJSA 2JZOA 4UJ5A 3S8YA 1DU4A 3AETA 4OHCA 4ZJYA 2QX6A 5DXAA 1DE0A 1BSVA 1FDWA 1UQUA 3NAQA 1EINA 1YUMA 3BXGA 3GEPA 4Q21A 4BNYA 1I1QB 2SICE 1GA1A 4LTMA 1I6WA 1P4JA 5E4YA 3TSYA 4BFWA 3QOWA 5LDGA 5IVHA 5AW9A 5B7QA 4X61A 2I2CA 3RRMA 1MQ9A 1JJIA 2YHIB 4GR4A 3GBSA 4GEGA 2ZRBA 1XWFA 1TM5E 1C3EA 1UZAA 2GHIA 3D8BA 3PCTA 4BVJA 2R7KA 4A4DA 3C98A 1Z5GA 1NU8A 1R1DA 2CL5A 1DBQA 2OD2A 3N8KA 1I2ZA 2QX9A 5JCXA 3IL2A 2XTMA 3GGDA 3IA2A 4PHGA 2LBPA 3F3KA 4G1EB 3WWYA 2QNBA 4HDKA 3ZY4A 1M83A 3VR5H 1TKCA 3RRFA 1CIVA 2EBFX 2ZRCA 2ZUUA 4B4WA 4C0KA 2R47A 4K2AA 3O0DA 1OC2A 5EJ8A 2WHRA 3UUEA 2GEUA 3Q85A 1VCMA 2J41A 3TLGB 3V55A 4YRRA 1N6OA 2W2KA 4JITA 1J0EA 4AP5A 2XUPA 1NAHA 2ID9A 4NCHA 3U0VA 4RMNA 2RAUA 2YRXA 4GGOA 4P7BA 4TMFA 4Q3OA 1O9HA 3WHKA 2P3OA 1IUKA 1FL9A 4LBVA 3STXA 4DNPA 4NYMQ 3TPZA 3DC2A 1XA3A 5LP6C 3JZDA 1GQYA 1TQ6A 3AR7A 4GZ5A 1P33A 2I34A 5C81A 3AWIA 3DE7X 1LRKA 1V35A 2YWJA 3QVGB 4LRTB 4RZIA 3SHVA 5T4HA 4L8YA 1R8QA 2M6SA 4LTDA 2PUEA 3HUUA 3SQDA 4L5BA 1G9SA 3KEGA 4MH0R 1KRWA 4XJXA 3QRWA 4PYJA 5JY1A 5L8VA 2JANA 2ORYA 4LJYA 4WN9A 2CFTA 3C48A 2B2CA 4WY8A 4YMWA 2QW8A 4H3SA 2VK2A 4BQPA 5FEUA 1NUQA 4F96A 6ADHA 1WAMA 3RU2A 2GYYA 3SZRA 3W5JA 5CVDA 3ZV4A 4CFZA 4GOMD 3TTYA 4TVSA 3PE3A 3O8OA 1N2CB 3T7EA 2G08A 3K35A 4S24A 3ZXUB 3DOCA 1JNXX 2NTVA 2V54A 4EG0A 1QUFA 3AEYA 3NDBB 2IYPA 5F4ZA 3WYAA 3DL0A 4DSUA 2J07A 4ZICA 1T8TA 4BQQA 2VYCA 5E2IA 2XE6A 1L7RA 3TQFA 3YASA 3ZW7A 2XDQB 2CB0A 3L41A 3T5BA 2IU3A 1GN8A 3KPWA 1XK7A 4X0EA 2JLBA 1OFUX 2CYBA 5H68A 1Y6ZA 3DFMA 3AI3A 1N2CE 3I04M 5FUXA 5FA6A 5IDXA 2X19A 1E7YA 3PNSA 5IBCA 2AV6A 4N7MA 4URYR 5DTMA 1KF0A 2XOKD 3LQ1A 4IWNA 4LMRA 5DYNA 4LC1A 1MA0A 3GPCA 1MORA 1F9EA 2AOWA 3A3PA 1FS6A 2Q1XA 4WK2B 5J1SB 4EITA 2WZQA 4MV3A 4BN5A 3ENKA 1UZLA 1VPEA 3N2KA 4WGGA 4RKFA 4DCTA 2C2MA 2OCKA 2YMPA 3THYA 3TFWA 1BDIA 4RS4A 5KX5B 2VP4A 4Q34A 3FFXA 1AKRA 4MDYA 3GJRA 4I3FA 1XTBA 4ESOA 1YDHA 4YJ3A 4O4HF 3TTXA 4WNAB 2CDAA 1IVNA 4C89A 5IVDA 2H9AA 3CE9A 3KVRA</