1RMTA

Crystal structure of apha class b acid phosphatase/phosphotransferase complexed with adenosine.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
210
structure length
210
Chain Sequence
PSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class B acid phosphatase
publication title Insights in the catalytic mechanism of AphA from Escherichia coli
rcsb
source organism Escherichia coli
total genus 71
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2003-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rmtA00
4KX3A 4Y2TA 3OCVA 4B6JA 2AMYA 4L57A 1T9ZA 4DW8A 4XQ0A 2WHEA 4EENA 4I9GA 3ZVNA 5AM3A 3U26A 2C8KA 1ZRMA 3BA6A 1RKQA 1RQLA 4Y2PA 3N28A 3VAYA 2CN1A 5AM0A 3WKDA 5AVZA 2RAVA 4YIHA 1SWWA 2WF9A 5ALHA 2C4NA 4Y2QA 2G07A 3P96A 3W5DA 5AKLA 2PR7A 3A3YA 1RMQA 5AW0A 3TLMA 3FM9A 2FUEA 3OTQA 3N8GA 2IOHA 1ZOLA 3E58A 1WZCA 4BX0A 3QNMA 5ALWA 3A1CA 4YCNA 2ZBDA 2YJ6A 2R8ZA 3DNPA 3NRJA 3PDWA 4HGQA 4DFDA 3DAOA 3L8EA 2HI0A 1ZD3A 2BY4A 2CFTA 5AK5A 1YMQA 4L6AA 1ZS9A 4ZEVA 2R8XA 1Q92A 2YMQA 5ALQA 5AW3A 3L8HA 3NUQA 3ZI4A 1VFPA 1ZRNA 3A1EA 3KC2A 3GYGA 2YJ3A 5AKKA 3L1VA 5AVSA 3WK7A 3QXGA 4F72A 3SHQA 3U7FB 2D2VA 4FYPA 1XP5A 4YCMA 1L7PA 1EK2A 2ZOSA 3L7YA 3RF6A 4BKMA 4QQFA 3CZ4A 2GHQA 4HAIA 2RBKA 4OFZA 3A1DA 4UM5A 3HYCA 2ZXEA 5T41A 4AP9A 3B9BA 3I1YA 4CF5A 3OCZA 1Z5UA 4C4RA 1QQ6A 3OCWA 1TJ4A 1X42A 2AGVA 2YJ5A 4UW9A 2C8LA 3WK9A 3W5BA 3IJ5A 4PNHA 5AKJA 3CNHA 3ET5A 4XPZA 4UMFA 1L7MA 2YY6A 2Q4RA 2Q5EA 4J2TA 4UM7A 3QUBA 1U7PA 2FPWA 4GXTA 3QUCA 2HCFA 2YFYA 4C4TA 1U7OA 1VJRA 2I33A 4UMVA 2HHLA 5ALPA 5AW1A 2HOQA 4IG4A 2HF7A 5ALFA 4Y2RA 4NABA 4YIKA 3NALA 1RKVA 3MC1A 5FP0A 2FPUA 4BNDB 1N9KA 3HLTA 3WKAA 1NF2A 4MWOA 2WFAA 5AM2A 1KYTA 3E84A 4BBJA 2WF8A 3WGVA 2EAUA 1YDFA 4KNVA 4Y3UA 5AK4A 1RLTA 2IOFA 2JAWA 2VKQA 3FVVA 5AIBA 3SMVA 3ESQA 1RC8A 3QGMA 5AW8A 1Z4OA 5AVTA 3UMCA 3QU2A 4C4SA 1L6RA 3EPRA 2NO5A 3FPSA 2WF5A 3QUQA 1QQ5A 2GHTA 4KYTA 2QYHA 3OPXA 1TJ3A 1Z4NA 2G09A 3BWVA 3L0BA 3WGUA 3MPOA 2HDOA 3N07A 3L8GA 4G63A 1Z4PX 2RARA 4XE5A 5AK6A 3L1UA 5IS2A 1XPJA 1PW5A 1TA0A 5AW9A 5AKEA 2CFSA 4BNDA 1QQ7A 2AH5A 3QU9A 2I54A 5AESA 5ALMA 4YCLA 2JGAA 3ZWDA 2FPSA 1ZJJA 5AW2A 2YBDA 2NYVA 4AS3A 1S8OA 2FEAA 5AVQA 4I9FA 2IA5A 3W5AA 5ALZA 3U7GA 3U7HB 4Y2JA 5ALEA 3UMGA 3FZQA 2NO4A 2EATA 5AKGA 2QLTA 2YMLA 4HGPA 3U7EB 2W43A 1IWOA 2CFRA 3SF0A 3I28A 2B8JA 3IB6A 4NFLA 3OCYA 4Y2SA 2FI1A 3WKEA 4CF4A 5AVWA 1J8DA 2JAOA 5ALTA 5ALLA 3N1UA 4ZEWA 2WF6A 1U2SA 2JAUA 5ALYA 5ALOA 1L8LA 4FFDA 3L8FA 3R09A 2OBBA 1RDFA 1XVIA 2C88A 2X4DA 3N5KA 2ODAA 3ED5A 2I34A 4Y2VA 1WVIA 1AQ6A 4UMDA 1RPZA 4YGYA 1F5SA 2MSNA 3S6JA 4E88A 4KNWA 5AIAA 3QLEA 3EF0A 3ZU6A 2O9JA 2WM8A 1L7NA 2ZG6A 1Z88A 3MMZA 3ONNA 5AKHA 4F71A 2W11A 2P27A 5IT0A 1RLOA 3KDPA 4DCCA 1RMTA 4EZEA 5A3RA 5ALIA 1Y8AA 2JARA 2P69A 5ALKA 4FE3A 2OM6A 3AR5A 2B1QA 4UASA 1T5TA 4BEWA 4G9BA 1NRWA 4EX6A 3F9RA 3KBBA 1RRCA 3ET4A 4H1WA 2G06A 4CF3A 4BYGA 3E8MA 2I6XA 3AR3A 4EEKA 1RQNA 1L8OA 3M1YA 3KD3A 4UATA 4HGNA 5ALJA 5ALUA 1JUDA 3SLRA 3PCTA 2HX1A 4J03A 3NANA 3UM9A 5ALRA 5IT4A 3WK8A 2HO4A 1FEZA 3U19A 1TJ5A 4QJBA 4JB3A 2OYCA 3W5CA 2FPXA 3B9RA 1CQZA 1QH9A 2YN4A 4JDPA 3PGLA 5AI4A 4DWOA 2GO7A 3QU7A 1Z4LA 2P9JA 1T5SA 3U13A 4OD0A 3ZUPA 2B82A 1YS9A 2ZBFA 5AVYA 5AW7A 1J97A 4HYTA 1Z4IA 3R4CA 2PQ0A 4HGRA 3AR6A 3WK6A 3ZW7A 2YJ4A 5A3QA 2B0CA 3SKYA 3QU4A 4L6CA 5AVRA 1SWVA 1U2TA 3M9LA 2IOFK 4Y2XA 3WK5A 5AW6A 2B30A 1YNSA 2FDRA 3NAMA 3I76A 3QU5A 3OCXA 3QYPA 1N8NA 5A3SA 3ZTYA 2P11A 5AK3A 2AUTA 3IRUA 4Y2YA 2WF7A 1YV9A 2O2XA 5AW5A 2HSZA 5ALNA 1RKUA 5AVUA 5AI0A 4KN8A 4OHFA 1S2OA 5AM5A 1K1EA 1QYIA 3SKXA 5ALSA 3ZX4A 4KX5A 4ZEXA 3OCUA 2OA0A 3J7TA 3EWIA 4OCZA 3AR2A 3WKCA 4YH1A 1WR8A 2G0AA 1RLMA 4BX2A 3B8EA 1LVHA 3KZXA 4RETA 3WKBA 5AICA 2I7DA 1LTQA 3QX7A 5AW4A 4NV0A 4UAUA 4O8CA 3ZTWA 3ZVLA 5AM4A 4MUMA 5AI9A 4NWIA 2R8EA 2I55A 5AI6A 2GMWA 5AKXA 5ALVA 5JJBA 4XOUA 3MN1A 3D6JA 4UARA 1RMYA 3ZX5A 2W4MA 3EF1A 3NASA 1SU4A 3PGVA 3QUTA 4EELA 1Z4MA 4BX3A 3AR4A 3ESRA 3AR8A 4NAVA 3I6BA 2IYEA 5AKZA 3AR9A 4UAVA 4RESA 1YJ5A 2R8YA 4UU1A 1O03A 2ZBEA 2RB5A 3FPBA 4UMEA 4GIBA 1ZD4A 3DV9A 5ALDA 1WPGA 5AVVA 1L7OA 2G08A 4UU0A 3ZWKA 3KOOA 1CR6A 5AI5A 5AKYA 3AR7A 3SD7A 2BDUA 1EK1A 2Q4TA 1Z4JA 2B8EA 3L0YA 2DQSA 1O08A 4AS2A 3L5KA 3WK4A 5AHXA 4BEVA 2BDEA 2YMPA 2C9MA 2EARA 1NNLA 5AI8A 1ZD5A 1ZD2P 1Z4QA 4IFTA 5AVXA 5AM1A 5ALXA 3L0CA 1Z4KA 4CNQA 3NIWA 1Z5GA 2ZBGA 1VJ5A 2HEGA 3ZVMA 4EX7A 3K1ZA 2G80A 1TE2A 1U02A 2YMMA 2HF2A 2FUCA 1Q91A 3FGOA 5ALGA 2B1RA 3E81A 2G1AA 3DDHA 4HGOA 5AKIA 3R9KA 3UMBA 2GFHA 5E0OA 2FPRA 3RFUA 4Y2UA 4CE6A 2MU1A 1MH9A 2PKEA
chains in the Genus database with same CATH superfamily
5ICGA 2QRPA 4PS0A 5EMMA 1E1DA 3FCYA 5KWVA 4LZLA 3PT9A 3V1MA 1L4FA 1V4VA 2IKQA 1DCTA 2QRQA 1UPFA 4KWIA 4JT2A 3E7DA 3IURA 5F9FA 2GKOA 4B6JA 3G2KA 1F48A 2A3NA 3C4VA 3VH2A 5IEBA 3G2JA 2FK7A 4PYJA 3X1JA 2VZLA 2Q28A 5IDVA 2WHEA 1KE2A 2BFFB 3O2SB 1C80A 4YMVA 3NT5A 3FWNA 2V59A 2BD0A 3RHTA 1XJWA 3L7DA 3D81A 4IWYA 1R0CA 2W58A 5CVJA 3HB5X 4RDXA 1TK9A 2VHVA 2VH1A 5THXA 3HDHA 3K9LA 4KACA 5E4FA 1XZFA 4A2PA 5DN6D 3BAFA 5DYYA 1U9IA 2R1UA 3L41A 4J2OA 3LUAA 5HJEA 1LI4A 1T1JA 1TXGA 1HLGA 4Q4DA 3GFBA 5JATA 1QF6A 3A3YA 4DZRA 2EBUA 3WSVA 3W6NA 4AULA 2BKLA 2P9YA 3FM9A 3KSDO 4HRXA 2J08A 3OTQA 2F9FA 3PFNA 4PAWA 4AN0A 5IJ0B 4R1SA 5FHQA 1WMFA 4CEHB 1W36D 2YWXA 5KTPA 3R3SA 2R8ZA 1CQWA 2JGDB 1H8ED 4BCCA 1QIHA 1PF7E 2CJYA 2Q99A 2CVOA 1DJMA 5LUBA 1DB3A 1GA4A 5CDFE 3F1KA 4B6SA 5IT5A 5LOVF 2HI0A 1Z18A 2B69A 4GZ5A 4G1UC 5EZ6B 4HZUA 4BO9A 2O8EA 3B6ZA 2YRWA 3B9QA 4EWLA 1QZXA 4QQNA 3CXUA 1VJ0A 1ZEJA 1XPOA 4A8JB 4PYLA 2RC5A 2IYRA 3FHJA 3VR5H 4ZVRA 4G09A 2V6MA 3RG2A 2RHLA 5EXPA 3LKVA 4UE2A 3IE2A 4Y6QA 2DXIA 3VR4A 3KB6A 2ODNA 1OIXA 3SICE 4B3RB 3VOTA 5DNYB 3N8DA 1WB6A 3D8RA 3GJTA 5TS3A 3CPSA 4EPTA 4RTLA 4DAOA 5DLYA 3H8JA 2B2XA 4FMPA 4WLEA 1MIHA 3WC4A 2ZKLA 2L69A 4FYPA 2A58A 2ZOSA 3KR0A 2H52A 3FNRA 1H1LB 5FFMA 2JFVA 2A5LA 3L4BA 4M8SA 4JI8B 4H7EA 3QQPA 4J91A 5FUQA 2AJBA 5CT8A 5CJ2A 2PJZA 3SR3A 3A1DA 4DRXA 4OEHA 2TECE 3BA1A 3LPDA 2V3VA 4HXEB 4AFNA 3HLKA 4JWTA 1GRCA 5IXJA 1AUPA 5G0UA 2GF2A 4LGYA 2PNJA 3GDOA 3D3WB 3LJKA 4M76B 1VPTA 3OCZA 3UBMA 2DFKB 2IKSA 3EX7C 4K26A 4OLBA 5LSAA 1WU7A 1MB0A 2XUHA 3Q4GA 2FYTA 1EE9A 1ZN9A 3DL2A 4UW9A 4ZAZA 2NP7A 2PUEA 4FWIB 1DJNA 4Q7QA 3N6VA 2NO6A 1MJGA 4RA9B 3GELA 3UTCA 1D2MA 4B7AA 3CZPA 5GAJA 4WFIA 4EJSA 2DTEA 1U3CA 4K3UA 3VGPA 1NC3A 1EGQA 3SQLA 4E2XA 4NCJA 4IIDA 3P9NA 2Q4RA 3EC7A 1JAYA 1JBEA 4MPJA 3GMSA 5F4ZA 4QODA 1VMKA 3GRZA 2NUPB 2QX7A 3W5SA 2RD2A 1T8YA 3OZGA 1FU7A 1L3IA 2VUTA 2X13A 1GP2A 2G1UA 2XMDA 1YBVA 1EFVA 4FDMA 3TR6A 5JZMA 2OAGA 3MCAA 5GMOA 5GADl 5A7HA 4Y2RA 1ND6A 4MR7A 2YNMC 1RBYA 1G21B 3HY6A 4KUGA 4Y9DA 3H3XA 4TL6A 3PWTA 4DXHA 4X62B 1X7YA 3EVZA 3BGIA 4LSGA 1GTVA 3UA3A 4CODB 1NF2A 2GCOA 2JBAB 4XUCA 1KYTA 3VTFA 1NI4B 5MFPA 4BBJA 4EG8A 1P1KA 1PG0A 3O7MA 3AMVA 4DG9A 1V2HE 3O73A 3RVNA 1UJ4A 4BV9A 4F4UA 1TKBA 1SUPA 2WRZA 1R00A 2VFAA 1B43A 3EXIB 4NG4A 4G23A 3ODGA 3FVVA 3MELA 1FUIA 4LCBA 4BFWA 5CFMA 1EZZA 1JLLB 2C20A 1JFTA 2HD4A 2I7XA 2D0DA 3I01M 4BNWA 1QKKA 1XE3A 2ZRHA 1UXIA 3UMCA 3MAAC 5HVNA 1QVVA 3M0EA 3N2NA 1DBPA 1PT5A 2C5GA 3DBLB 4U8GA 4S35A 1NPTO 4QEKA 2CMGA 1TJ3A 5F1PA 3MJFA 5WRFA 4F2WA 1YDWA 3CPJB 3LCVB 5HM6A 5GJCA 4ZGBA 5FUBA 3ZDCA 4LJYA 1K9VF 1MGOA 1Y9JA 2YH2A 3I2FA 4KMRA 3B70A 3EZLA 2CLEB 5I7FA 4PLFA 8AT1A 3H9QA 1QORA 2C5LA 3JAKB 4YI3A 1NNEA 1U31A 1TA0A 4XM0A 2H1IA 1UOOA 2V74B 3UFBA 3ZCPA 5JBIA 4LJ8A 1DTEA 4BZQA 1SXJA 4BTVA 4GRIA 2XUQA 4XYLA 3N0VA 2W4IA 5FOWA 4EA6A 2YFHA 3QVVA 3O84A 4HFJA 4ZI3A 2ICAA 2RI0A 2I5PO 3QKUA 4ABTA 1T8TA 3SR0A 1L1RA 1AK9A 2V97A 5CDYA 2IA5A 2Z58A 4EB6B 2WVAA 4W5WA 4L78A 5K6TA 1RAHA 3AV0B 3FZQA 1M6YA 3MB5A 3EXHB 2XX3A 5LMCA 1W5BA 4OXYA 4O1MA 2ZM6B 1V11B 2OO5A 2VA8A 3RVJA 4A1OA 2YVLA 1PVOA 1UBMS 3F7OA 3HYSA 2HU5A 1J8FA 1I36A 1ZK2A 4MW4A 1DAKA 1JAIA 1FNNA 2OV2A 3STYA 1JHMA 1UBGA 2Q3MA 4XEHA 5EIBD 5J4HA 3PXEA 2PXHA 4RMNA 3ANYB 4D9EA 1M1YB 2Z56A 3H4VA 4KP7A 4EEZA 3LPNA 5AVWA 5SV2A 3IMKA 5BSUA 3IAM1 4BS9A 4N40A 1YBAA 2J9XB 3KOUA 4WCDA 5ALTA 1DHRA 2YS7A 3ICWA 1E2HA 1DI0A 5FUVA 1QBGA 5ALOA 5IBCA 4PZLA 3ICCA 3GIDA 3IQDB 4RIIA 3RS3A 2CVZA 3W1VA 5BSVA 2DPMA 5LYJA 2ZCJA 4NNOA 1TW2A 2MR5A 3OQBA 4LCEA 3HA5A 2W8BA 2X7JA 4LQ4A 3U7JA 2QORA 2X2OA 1SOMA 3M4ZA 5CLHA 5JD3A 3USES 3UTDA 3G5AA 4IS3A 1HEUA 3L0SA 3C6ZA 5K3FB 4Q9IA 3IPLA 1H05A 2XTMA 3C1OA 4YGYA 2AEEA 4EUHA 5KNCH 1ECLA 1VLZA 2GJ9A 2LKCA 4EDHA 4XVCA 3EF0A 1PSZA 1J0XO 1OGIA 3GFOA 3C7CB 1PUJA 3TW4A 5CVTA 1O1YA 3COPA 1Z88A 4GX0A 5DWVA 3ANXA 4GYKA 4XDYA 3RAGA 2WJVA 1OGJA 2XW6A 1EVYA 4FLMA 4WV3A 5L3RA 1E2QA 4IKOA 3RS8A 3ZE1B 3GEGA 3ZWQA 4EK9A 1F9AA 4LYHA 1JVBA 1WD5A 1SC9A 1VLJA 4XB2A 4RZHA 3BD9A 4B3IA 1JI3A 5C8DA 4L5IA 3L4KA 1W8IA 5JAMA 1OTXA 4JK3A 2YBEA 2LD4A 2QI9C 1NNUA 2E89A 4MVJD 1SU7A 5GV8A 4K6KA 4F4DA 1IUPA 2ZCUA 3RJMA 3U7QB 4EX6A 1L5VA 3EIXA 4MQEB 2IIPA 3S8MA 4IO0A 3L6UA 2PIDA 4GDFA 1FX0B 3PQ3A 4IJWA 1R9JA 2VUHB 1M5TA 5E1OA 4ESOA 4B3HA 1ZA1A 3KKOA 4I3GA 4US2R 4X9XA 1TK3A 3GD7A 4L08A 1L8OA 5IBQA 3KXPA 1MVOA 1N36B 1EWRA 1N8SA 2JI8A 4NV1A 5DGDA 1MJ5A 3E9EA 1GLGA 4HBGA 1JRLA 1MEJA 4LDPA 4CCAA 5HYVA 4AAYA 4QECA 2ONKA 1YQDA 2CBXA 3IQEA 4GR9A 3VZQA 1XXHB 2GEBA 3D59A 3DWIA 4OO3A 4C0QC 4DJEC 2D5AA 1PJZA 3PXXA 3LD9A 2OXCA 4YMIA 3ZE0B 5EJEA 1PR0A 4NCIA 1PHRA 4QHYA 3DTVA 3G85A 3KELA 5SYMA 4HAOA 2BE7A 4OXNA 1C50A 3NNSA 2AXPA 2GX6A 3QKWA 5F23A 3ZXXA 1P2GA 5ULLA 3E35A 2ZRQA 4EZIA 4GE3A 1UF9A 4F3YA 2W6JD 4FDVA 4MRAA 2IOQA 4PE5B 1Y48E 4LHVA 5E1BA 2ZKIA 2ZJ5A 3LMKA 1KGSA 4ME6A 1Q2UA 2EJCA 3E5RA 1JU9A 2DR0A 4Z6KA 4GXRA 1GPAA 2JJ8A 1PJ2A 4EARA 3K1TA 4GH5A 4LX8A 4M7OA 2OUIA 4DSUA 2YL2A 1B00A 4HLDA 3HB9A 2Q4DA 1D8AA 2NX2A 1KJZA 3B48A 3CSUA 5CA0A 1KEEB 1CE8B 2J87A 3UK0A 4X64B 2OZLB 1XQYA 3I01A 1PDWA 2FDRA 3TSYA 1CJTC 1JQAA 2XITA 1ZVMA 3DM9B 3PQ2A 1HEIA 2AB0A 3U37A 3FSRA 3QKIA 4G9EA 2CXHA 2D06A 4P98A 2F9LA 3HEAA 3WO0A 1QMPA 1NRJB 1YV9A 4WLNA 4CF6A 3NBMA 5B53A 3GVHA 3HV0A 2XF8A 1FRFS 3FLAA 4ZJUA 3HWSA 1JGTA 5CFNA 5AJVB 3HNOA 1Z34A 3PLNA 4B6RA 4X44A 1UJ5A 1JG6A 3EG9A 2R8BA 1ZJ4A 2OOSA 3ICPA 2UVQA 2UZ0A 1G55A 3SM9A 3MFQA 5LP6A 1O95D 1ISRA 3UEOA 4G5HA 4ZCMA 2ZIVB 4FI3F 1E1YA 3O4FA 3SOPA 5T6MA 1A50B 1W59A 4YV1A 1UC5B 3PC3A 1J0AA 4DLLA 2Q7XA 2R65A 4PLCA 4PPNA 5EYPB 3AR2A 5CPBA 3ZBPA 4QUAA 3O1LA 2WQZA 1V48A 5FTLA 4W7IA 4ENTA 4ZICA 3CE9A 2VNHA 2VSQA 1PFVA 1F14A 1XZMA 4ZA2A 3V48A 3ZZTA 2FNAA 4TPKA 4K2AA 4D02A 1XNGA 1QC5A 1IN4A 3QE2A 4ZQGA 4C89A 3QTLA 2G6TA 3MRVA 2J09A 4MVJE 3U6BA 5HRUA 1E9BA 2VRCD 3K5IA 3UJBA 3WDMA 4FFSA 1AURA 2UVDA 4IIXA 1S6YA 1JEOA 3WNCA 5BSEA 4CETA 3GRCA 2Z3VA 3VNQA 1OLSA 3GP3A 2O59A 4IOKA 4PGAA 3PK0A 1EHIA 4JOCA 1T5LA 3NS7A 2ZJOA 4CMEA 2V55B 4UARA 3CXRA 5CCXA 3NB0A 4D3YA 3LLUA 4OYLA 5TJ9A 3RTAA 5ERYA 2PO7A 5C53B 4FFWA 4P4SB 2ODBA 5HSGA 1MIOA 1W36C 2JC3A 1FJHA 1B74A 1F1BA 5LB2A 1OBVA 4RKWA 4J75A 4B0PA 5BR1A 4IGIA 1Q1ZA 1XRMA 5AOAA 3OHPA 3ESRA 4C87A 5A71A 3M49A 4BNZA 3O95A 4UAVA 3ZYCA 4BKPA 1GUBA 4RESA 1CQPA 2RKBA 1JTEA 4WKPA 1W0KA 4E1BA 1UBKS 3ACDA 5LP6C 1ZITA 1L5RA 4N5HX 1P6XA 2X0EA 1NT2A 3KR9A 4X93A 3UCFA 2HJHA 2GLUA 4M1QA 3UV3A 4B7ZA 1ECGA 3ANMA 2VPWA 5JD6A 1ZD4A 5ER9A 4FR2A 2C5AA 2FW9A 3IIEA 4NQRA 4ON9A 1YS2X 4PAGA 1NWCA 3RVDA 4PSUA 3WLQA 5B57C 5JSZB 2ZZNA 4KUEA 4DR4B 1FRNA 1MTZA 4QOSA 3UG7A 4JQYA 2VK1A 4AROA 5F35A 2BFAA 3BCSA 1WG8A 1LS1A 4ZVNA 1AQUA 3R8XA 4ZV9A 4M22A 1XZGA 2B8NA 2PLWA 2FW8A 4FFBA 2AN4A 3DUFA 3EGXB 4WESA 1QR6A 5HF8A 1XZQA 3QMVA 3HADA 3SFZA 4DLKA 5L7YA 1PGJA 2QN8A 4WXHA 4QYWA 4WI1A 3HJRA 1CJCA 2JCSA 3INYA 5JCPA 3GO4A 3Q3IA 5COQA 4H4EA 3TZCA 4CG0A 3L7MA 3D3JA 3QWHA 1LF0A 5B3AA 2NU8B 1LPAB 1O0SA 2VUSA 2ZWAA 1N92A 2FW6A 2GI4A 4ZARA 3SHOA 4NENA 4CMEC 1EVKA 5ALXA 4QGSA 2VJKA 4DEYA 5A4KA 4CFZA 3FMIA 4U6QA 3AF0A 4JLSA 3LCUA 3U3DA 1KZ7B 1U6JA 1K8QA 3GVXA 1J5PA 4LK2A 5KX5F 3I5YA 5E6SB 1R66A 3D8UA 3E23A 1E32A 2FG6C 2V54A 2GWHA 4LYYA 4M7WA 3DDHA 4N18A 5AKIA 4OI2A 2V3CC 4GUAA 1SVOA 5KJ1A 2P4HX 1A88A 1AQNA 1RWPA 4EI7A 1C8BA 2OV4A 3EPPA 3B52X 1GTL1 4JLDA 1JR3A 2A4MA 2P6PA 2ID4A 5CFPA 4MEAA 2FUG1 2XJ4A 1K3FA 3Q3GE 1H4SA 1SN7A 3RUEA 1KNQA 1P9NA 2QR3A 3JQQA 5AJHA 5G2OA 1DAMA 4TTSA 4BC1A 4B2YA 3WA7A 1XTUA 1WSAA 5EOVA 3OCVA 3E22B 1U28C 3QSGA 4KXMA 5TQVA 4ARVA 4CU5A 4N7RA 1VZ2A 3PR2B 5D5PA 4ZI7A 2WTEA 4MGKR 1U2PA 1WD7A 1XG5A 4C08A 1WS6A 1Z28A 2ROQA 2BW0A 5I9NA 4WK6A 4Z3KA 4DC0A 3WWEA 3DMDA 3F5FA 5EE3A 1OX6A 5JISA 4RFSB 2NQ2C 5JYEA 1W5AA 5FNVA 1JJBA 1U11A 1W87A 4MQFA 4TWAA 1YI8A 4KXNA 2ACVA 4R9VA 4RIGA 3VAYA 2E85A 2PT5A 2VDMB 2CUNA 3D3QA 4LAFA 2GO1A 1AMOA 4RHUA 4FPXA 4JHXA 3RWBA 3OEED 4PG6A 1R8JA 2QJFA 4D8YA 3GCXA 1SVKA 2B5WA 2O2CA 4KFCA 1C1XA 5CX1A 1EI9A 5FTWA 3IIMA 1RMQA 1N6HA 1GPNA 3VXKA 4DLAA 3DOCA 1OBHA 1H22A 2VRBA 2WWTA 4G86A 4K86A 4YUWA 3I39X 4FNAA 1SBZA 3M4NA 2VAVA 1JDUA 1TPZA 2J46A 2QTGA 3SX2A 2LR0A 2WSSA 4K40A 4MUNA 3FDJA 3RRNA 1SUFA 1G8KA 4FMCB 3L2OB 4L5JA 1ZHFA 4WACA 3L4JA 1C81A 3IC5A 4Q3NA 4N5MA 4TYMA 4OXQA 1AJEA 1ESDA 1DEXA 1EUZA 2H59A 3BERA 1PN3A 1FNDA 4ENQA 1PR6A 1F20A 3T4UA 2UXDB 3WB2A 4L7QA 4J0HA 1WY7A 1M73E 3PNPA 1KPHA 4N4AA 5ALQA 3TR0A 1EG7A 1UXKA 2O5CA 4GSKA 4OM7A 3S1SA 1M5UA 3S2GA 1E3SA 1T13A 1WXDA 3FWKA 4HQRA 4KFRA 5BPFA 3E0XA 3V9PA 1K5DA 1T8UA 1QLJA 3TD6A 3R3HA 3L1VA 2ZR0A 5AVSA 2QRHA 1YC5A 3BG5A 4AC9A 2FN4A 4RL4A 4FCWA 2X0KA 4HWTA 3ESXA 4TXNA 5A2QA 4E08A 3FTFA 3AEQA 2Z5FA 1SXQA 1U8ZA 3QXGA 4F72A 1I3OA 1OSNA 1FDIA 1SXGA 3QVTA 1EK2A 4LRUA 1E3TA 1S3FA 2VXBA 1ZCAA 4OLFA 3ZW9A 1J2JA 4FONA 1N2JA 1T1IA 5EIBC 4GL4A 5TQ2B 2A4KA 1US8B 5IAGA 4MI1A 5LBTA 2QD5A 2RH4A 3DO8A 4RZIA 4F97A 1P2UA 1U8EA 2ASVA 5ADVA 4J4HA 4DM3A 1G3IA 4PCUA 4M1TA 3VUEA 2J0EA 2FUKA 1MDFA 2B7BA 4LGVA 5FI3A 4UHBA 4GPAA 1X1BA 4LXHA 5DNAA 1BS2A 3PI7A 5KYGA 4AD8A 2F00A 2GGSA 5FA5A 2HYIC 1YL6A 1E96A 2OCBA 1T15A 1ZSYA 1V1JA 1JIIA 1WIWA 1KP3A 2JANA 2V9PA 3B3AA 1CJKC 2CYAA 1XZIA 2A9JA 4GE0A 4PNHA 3V7FA 1IRXA 3CLKA 3ACBA 2X6RA 3GHHA 3UJNA 2A9OA 3BKXA 3JYNA 4G07A 4FJ0A 5KDDA 4UMFA 4F4FA 2MSDB 3A25A 3OWHA 1U9YA 3PGJA 5FV4A 1M0TA 3T5GA 4BP3A 1KWGA 4M86A 5K09A 3MF4A 2BTOA 2I3DA 4GMDA 4WCFB 4Z9FA 2QOEA 4QICA 4GX1A 2GEJA 5ALPA 3FD8A 4IG4A 2DUMA 5C81A 3PJRA 4EECA 2AN5A 1WP9A 1A2QA 1JHRA 2FSVC 4NDNE 5H4HA 3T1OA 4DQLA 5JNSA 1JXAA 2VLIA 1D4AA 2FPUA 1YBMA 2F1RA 2H9AA 3PFWO 4R8KA 2H1LA 4PZZA 1ULZA 4G1VA 4RL6A 2XF2A 4ND1A 1E7RA 4KXYA 4PSAA 4ZDKA 1YQQA 4URVR 3OA2A 4N0MA 4BX9A 1CV2A 2D7DA 4RHCA 2WI8A 3H6GA 2JFZA 3IQHX 4IINA 1OBCA 3A0UA 1Y4SA 1TZBA 3QHQA 2GXAA 2WMOB 4UHDA 3TZHA 4TKVA 4YRIA 4L0DA 3HFJA 2OBLA 3VPBA 3WSWA 4IKPA 4MWTA 4R3WA 5B4VA 7REQA 3BWBA 3LX5A 4I1RA 1PT9A 1T2FA 4A2WA 1ADYA 5BQXA 4CT5A 4D8TA 3EVFA 4RVOA 1WEKA 3D02A 1ZD9A 2X1MA 2ZUBA 1QH8B 3KVNA 2H7XA 4XVHA 2J3QA 3CIOA 2VSYA 3LGXA 4GI7A 4M49A 4XM2A 3H05A 1QQ5A 4QAQA 5AOVA 3RJZA 2D0IA 1LFAA 4C7OA 1UKZA 5JFTA 1Z4NA 1YQGA 3BWVA 3IKVA 3L0BA 2EGGA 4QWMA 3JARA 4RWEA 2DLDA 3NHJA 1S4MA 3OTGA 1V0JA 3ILYA 4G63A 4OAQA 3TJMA 3L1UA 4BWYA 4KL8S 2G9VA 2BFBA 1ACMA 2VTKA 5AVOA 5B2EA 4U2EA 5D6OA 1V47A 3H4MA 5BN1A 4Q3BA 4B9EA 1AN9A 4N5IX 3DE4X 1QQ7A 1SKYE 1ZWLA 1JI0A 2OBMA 1VMEA 2BSAA 1ARZA 2TYSB 3GRYA 1E2EA 2XD4A 4M8KA 3BGOS 5C1DA 1EFRA 2HCJB 2P6OA 3OQIB 3ZWDA 4F04A 2HQRA 3SDBA 4PLVA 2YQ5A 2JI7A 1QDLB 3EIWA 3MUOA 4XPIB 3ZPXA 4ENSA 1ORVA 4LISA 1KMMA 1NJFA 1UKAA 5ES3A 2HMAA 5AVQA 1JWLA 3T3OA 3A1SA 2XUKA 4QUKA 3AM1A 3DHEA 3LXRA 3B51X 2YQ4A 1EP9A 4G8CA 4D4KA 3BTUA 3WXBA 3DDNA 1JLRA 1SA0A 4IVQA 2C59A 2WTAA 3VQTA 3BMNA 1JWAB 4GPTA 1P8AA 1RJ9B 1Q16A 2EYUA 4KVFA 1Q7TA 3HUTA 5AWFC 2H6EA 2VYND 2MHCA 3Q2IA 4TMYA 3NCTA 4LNAA 4G8JA 5CYGA 3DLIA 1O4WA 2FZVA 3I5MA 5D7BA 2ZSFA 1FX1A 1WBJB 2B7LA 2XCQA 5L3SB 4NU0A 3HN2A 1LW7A 1UOEA 2L42A 5ELLA 3RLFA 3C3BA 3KLBA 5IJ9B 3TZEA 3OCJA 5HK8A 4BJHB 2XMRA 5FLKA 5CAEB 3LVQE 2JAUA 1V35A 621PA 1UPAA 2BFEA 3E3LA 1UFVA 2OBBA 1JXQA 4M38A 2BWJA 1Z45A 4Q3AA 1KORA 2QGZA 2W6QA 3B89A 2BR3A 3O74A 2ODAA 1MH1A 3PNKA 3N2KA 1HSOA 3TS1A 1APBA 5KKAA 1AQ6A 2ID9A 3WQHA 3KNZA 4M2LA 1O94C 3P0EA 4LC1A 3RDPA 2QV7A 4ER5A 5JT1A 3X1WA 5KQPA 4MDEA 4A0SA 1OLOA 1EDOA 1QOPB 2GN0A 2XKAA 4MIKA 4UZFA 1L7NA 1CWUA 5CUQA 3GJSA 5CIWA 1N2CB 1XDBA 5HKAA 1JFLA 1Q50A 4C6SA 2IW1A 2CVPA 2OCGA 1XKLA 2W98A 5A06A 4G5FA 5ELXA 1RWQA 2QYTA 2FMFA 2V5VA 1FLVA 3DJFA 3EXEB 2Q6VA 3RUAA 1DXYA 3LI2A 4X66B 2JD0A 2P69A 4PZ9A 2EKBA 2CLMB 4UHEA 2D5IA 3ZHXA 4HLUA 2KX7A 4M6WA 2I2CA 3AKYA 1G4AE 1HQDA 5EMNA 1T5TA 4C0SA 4KR2A 1CRWG 1G291 2A1UA 2PSEA 2VL7A 4GR4A 2APJA 2F1OA 2Y27A 2WINI 5LU9A 4RHFA 2NSJA 3KP1A 1KYQA 4TM8A 5IT9A 1FSSA 2QUHA 2XNCA 3J7AC 5JS6A 4Z7OB 2OK7A 4BYGA 1ZK4A 3FYSA 2M32A 4ILKA 2I6XA 2ORIA 2PO5A 1BU5A 2HEIA 3RUDA 3TQSA 1CR2A 4C7XA 3AVUA 1ORHA 1RQNA 4YDSA 5K7SA 5T3YA 2ZRAA 1JQDA 4YCJA 4HH3C 1L7XA 1V5WA 3AHEA 4FYVA 2DPXA 3V8BA 5ANRB 2WSBA 4L8WB 4J03A 1M8GA 2Q3HA 2BEVB 4D6YA 2IUYA 1WMAA 1FW8A 3OICA 1TZKA 2C4KA 4HWRA 1FSGA 2HGZA 3O8OA 5G4KB 3VHRA 1RLIA 2OFWA 2VHJA 1UL1X 2XSZA 1ZVKA 3K1AB 1N2ZA 1DV2A 3NNDA 4OBWA 3UFXA 1KK1A 5I7WA 1IG3A 1SG6A 1ZONA 5AJTA 1RC0A 2W6NA 3WGNA 1HLPA 1KOJA 3DH0A 1H93A 2P9JA 4LY6A 4OQXA 4CEIA 1PGOA 2R97A 1INLA 1DRJA 3U13A 5TT0A 4QFBA 2IUTA 2RBGA 1A9XB 2WWRA 4JEUA 3E7PA 5FL7D 5FBZA 2Q8PA 2ZAIA 2HHJA 4COOA 3KLMX 3MW8A 7MDHA 2FSHA 2DUUA 2P0EA 3S2ZA 4BMPB 2FKNA 2A2ZA 4I5EA 4ZOQI 4WNIA 4PS1A 1NVDA 1GILA 2VJDA 5JLAA 4GP6A 3LVFO 4FKMA 2QPTA 4BO3A 2HFKA 2VSXA 1BXRA 4I3FA 5L8VA 1P1BA 3IUYA 4N3GA 1PT6A 2QHXA 3PPIA 4WUVA 3GN2A 4RV9A 4YRPA 1U0OC 1U1CA 3PEVA 1OI2A 4ETMA 2B30A 4ND7A 3C4QA 1TO1E 1R0XA 3RVPA 1BVUA 1KH2A 1C7IA 1CFZA 4IRUB 4OATA 1N8NA 1RAIA 3P32A 2FDXA 4R05A 1NUUA 5IAJA 4PYQA 3VX3A 5BQOA 5AK3A 3KJEA 4XW2A 1U0SY 3A6EA 1O0BA 1QGYA 4R2KA 1IXYA 2IS4A 1CP3A 3UWOA 2FPIA 4YUAA 4PO1A 5E1MA 3IH5A 3MUNA 2WA1A 5M29A 1MJHA 5EXEA 3A6DA 3O92A 1CLEA 1ZR4A 3RIGA 1WA5A 4AJ9A 1KYWA 4BMCA 1KI6A 2X41A 3WZMA 4IXTA 1TUEA 4OQFA 5HUQA 2YYZA 3SIPA 5LM3A 2WDZA 4QULA 4XVRA 3C6KA 3GLHE 3OFNA 3JPYA 2JCXA 4RVSA 2AFHB 3IRVA 1GTG1 1EHCA 3T54A 3Q8MA 3ZIAA 3JYQA 1XA4A 2OA0A 2J45A 1TYAE 5M3BA 1R6TA 3EYWA 4MVWA 4W5RA 4OXKA 1VZ3A 2FN8A 1HTWA 3U3XA 2D1TA 1M1ZA 5BW8A 1PP4A 1U5BA 2H63A 1Z0FA 2JA1A 1DAEA 3QBTA 4KMOA 1LLQA 1YOVB 1PT8A 4QDUA 4ZOEA 3EEOA 5JE8A 2HW8A 1T6NA 1JX6A 3BQNB 4OB7A 4XTRA 4CFYA 1DIBA 1GPBA 1PZGA 2IYYA 1GUDA 2BGKA 2PBRA 4O29A 5AJWA 3ZV5A 1IIBA 1W35A 3BL5A 1GGNA 4YGXB 3OIVA 4XAQA 4MVCA 4C4OA 2BMWA 4LW8A 3ZVLA 2FKAA 4BBZA 1P74A 4QHSA 3FTPA 1SAYA 1KI4A 4MUMA 3HKCB 4URZR 3RQIA 4BASA 5LFAA 3LNTA 4PG5A 3KL4A 4DPLA 1KI8A 2GMWA 3QHPA 1RHJA 1GGEA 5ARCA 1KI1A 3VSCA 2P3OA 4HDRA 1JIQA 4XDGA 4X60A 4LVUA 1XCJA 3ORQA 4TOIA 2XZPA 2N3ZA 1XL1A 5L3VA 5IKOA 3UJCA 2I1QA 1PQWA 1ZK3A 3HNRA 1F2TB 1KEPA 1MB4A 2ZT5A 2W4MA 4BMYA 3D9QX 3NASA 4M0DA 3MRXA 5H68A 1G7TA 2B6NA 1YB6A 1TTPB 3KYJB 2HO5A 2J9RA 3MJ4A 4LOAA 3WA6A 2YV3A 1XC7A 2QUBA 2W5UA 3AR4A 3GDWA 2IZZA 2ATCA 3VR3D 4UKDA 1IUOA 1L4MA 2QPLA 2VDJA 3GXOA 2CBGA 5IH7A 1YJ5A 3HWX1 4GLJA 4EG0A 5A5DA 4W9RA 1YUMA 5KTYA 4WINA 4F9TA 1H3NA 1QNLA 5G1PA 3A58B 1M66A 1XQ1A 5LMZA 1N7IA 1DS6A 3WBFA 4COKA 2CSXA 3KWFA 3DV9A 1XEWY 1WPGA 1PS9A 4JC5A 2A94A 1AT1A 1XROA 2J5KA 4B4WA 1KTIA 2VC2B 2QE7D 2H0RA 4J16C 1UBOS 1P29A 4DM7A 5C1OA 4G1BA 1DRWA 1POWA 1PWZA 1XZJA 2EWMA 1P3Y1 2V7XA 3NO4A 4HQNA 3MOGA 4IH1A 5LQSA 1ACLA 3M89A 4CLRB 3K9FC 1EGMB 1PZEA 2X23A 4Y7CA 4FZVA 4G65A 3R5TA 4UM9D 1SUWA 4YRZA 5GZ1A 3L7CA 1GL3A 4P4LA 5KOHB 2CHVA 3A4TA 4CJXA 4QUHA 1NVXQ 2JJMA 2AMVA 4IEEA 5C8YB 2C9MA 4P4TA 4YMHA 3FVTA 1TCCA 1JFSA 4KN5A 2R1TB 3NTQA 4UXHA 4JBIA 4GLOA 5H16A 2R7MA 2GKGA 3MXTA 2X8JB 2H18A 5JJLA 4IPTA 1ZD2P 2IHVA 3JATB 2JZOA 4R6XA 2ST1A 3MT0A 2ZPAA 5AMXA 1ID8A 1XO1A 2I4TA 1JIXA 3OOSA 1NG9A 1QNFA 3CGGA 4WKNA 5FUYA 4FYYA 3T34A 3G0GA 2ZAMA 2ZBGA 5ADHA 1PZNA 4LFBB 3BWEA 4ZAWA 5TPWB 2QAGC 3ZCSA 5KVSA 4LSZA 1HT3A 4CL0A 2HF2A 3SWWA 1UWVA 3GU3A 3CVOA 4Q21A 3UMRA 1BJRE 5HQ3B 4E30A 5KVAA 2P9GA 1U3VA 2PM8A 5GZ6A 2BE9A 3JQBC 4WSOA 6PFKA 4ZEMA 1TU0A 2DFDA 2GYUA 1P61B 4WZAB 3D2BA 3AEYA 4CIBA 3I34X 3T0FA 1X74A 2NUBA 3FUUA 3UC9A 5I9TA 1AKUA 2CSUA 2AEJA 1OYOA 3BIJA 2PUCA 1CCWA 2XUPA 4ZTZB 4FKBA 2E4ZA 4NONA 1IBKB 2B4RO 1J1UA 2PWZA 3ABQB 4GEKA 3LFTA 4JOSA 1QK4A 3FY4A 2NV0A 2G7ZA 2Z6VA 3GPCA 3MWJA 4KN9S 4L57A 2XZTA 2C3MA 5F78A 721PA 3RD5A 3ZU3A 1B0AA 1T4CB 3LDHA 4HAVA 4AUEA 4ITRC 1RKXA 1XEAA 2ODPA 2IDZA 4MNTA 1ORIA 3OY7A 3MGCA 5CVEA 2A14A 3GJYA 4N0QA 3FBTA 3B1ZA 4G5SA 3H5TA 4REQA 1A0OA 2B34A 4DA8A 4OGLA 1EXNA 1ZRMA 2D62A 3ONWA 1DAIA 4H7PA 3FAKA 3PRKE 4MB6A 3SJ7A 4DIUA 3R9XA 3VVBA 2PGDA 2BFWA 1JQLB 1A4UA 3NBKA 4JENA 4QDTA 4Z2YA 1NF8A 4IYRA 5E3JA 1YR9A 2Q1WA 4IILA 3W05A 4PHHA 1A5SB 1Y81A 3FMVA 1CSEE 4EVSA 3EVBA 1DG9A 1N1DA 1SG0A 3DZ8A 1J8VA 1D2RA 3EARA 2ODTX 2JGRA 3O9ZA 3MEQA 1P8JA 1N5JA 1X0XA 2R44A 2XBLA 3KZNA 2AKYA 1LDYA 1OAOC 5ILGA 3TRIA 2ZRNA 4TKLA 4V24A 3WAGA 4J0QA 5BSFA 4EQ6A 1EJ0A 3OIWA 1AIPA 1Z08A 3D6UA 5F5NA 3A6ZA 3CKLA 4MPDA 4N82A 1F5NA 1DVRA 4G4GA 3QWIA 4QUDA 4A5SA 5I01A 5F3DA 3L7KA 2ZUUA 3C4JA 1H2FA 4HTFB 4LOIA 3C3MA 4E3WA 3WYFA 2JJ2A 4B6GA 3NDBB 4OX9Y 1QYWA 3GJXC 1FPMA 2GZSA 3UPDA 3ZJ4A 4A2QA 4C0HA 2BY4A 2EJUA 3S2FA 5K8UA 1VYHA 5EWMA 4QYXA 2OAP1 1Q14A 2Q50A 1QHFA 2ZIXA 2O20A 3NHPA 4R8SA 4RACA 3FLMA 1ZOIA 5HJ5A 2OPHA 2XECA 1P4RA 2CNWA 4GL2A 3HU3A 4FZJA 4JHLA 1UDBA 1H5QA 2E1PA 3DOJA 4UUNA 4QREA 4YPFA 3MFYA 1U3UA 3SCZA 4DLWA 5BXQC 3OIGA 4CKWB 1STOA 3GPDG 1RWMA 2YUIA 4DV4B 1SBYA 3LC1O 2FP4B 3P26A 3IP9A 3AESA 3BHMA 2P62A 2O2DA 3DXXA 4GOOD 4HN9A 1ZXXA 5IF3A 3HYRA 4I1PA 4L7VA 2HSGA 3KQLA 2MYPA 4F92B 3BXEA 4YRCA 4OREX 1J7JA 1NHWA 2RGUA 4AYXA 4MR8B 2BGTA 3L7BA 4H1TA 5DCLA 5KSPA 2WQ6A 2WG0A 1G17A 4TTRA 3L6CA 4HAIA 2Y67A 3M83A 1THZA 2CNBA 1TEXA 1F17A 2PN1A 3NVAA 3RS2A 3VDMA 4OFZA 2PUGA 1F3OA 1U0JA 2NZJA 2O0KA 4HAZA 2CD7A 2VNIA 5HIJA 1XRLA 2QL6A 2PUWA 1NRIA 3QE9Y 1SCUB 4HTAA 5L3ZA 1NIJA 5PNTA 4LF6B 5JS8A 4L8YA 4NEGA 4WHMA 4A1FA 4ZZ1A 1XHLA 4Q00A 1KS9A 5ED0A 3OCWA 2B3TA 3IMGA 1MR3F 3GNSA 4BUZA 4FN5A 2E7ZA 4H3HB 2BM8A 3BMOB 1U2DC 4DIEA 1N3YA 4QFMA 1ULUA 5DTRA 5BVHB 4QSHA 4RH3A 2HREA 1NKVA 3JQGA 2PANA 3BDVA 3IJ5A 4F3NA 2B20A 4Q6WA 5AKJA 1P2BA 3UGKA 5G4LA 4C20A 4TVSA 3ZZNA 2AF4C 3ZNOA 1DPGA 2DBRA 4XPZA 1I51A 3C45A 4YAFA 5JWHA 2EQBA 2VATA 1SEVA 3Q6NA 3SC3A 2QI9F 3A4YA 1WF3A 3QMMA 3TX2A 3UK6A 2Q5JA 1LRJA 2ANBA 3VTAA 4YDHB 1VJRA 2X76A 2FWMX 4R41A 4B6OA 2HHLA 1JKXA 3OLYA 4GPIB 4NOJA 5BO5A 1LUAA 2HLDD 4BRSA 5LZ9A 1F7VA 1SNYA 1Q95A 4MRSA 5EFOA 1BX0A 2Z2JA 3MC1A 1JR4A 3GH1A 5FP0A 3AF2A 3RFFA 1CY4A 1HE4A 4UTVA 1ZUNA 1EPUA 2G9NA 3CT6A 3FZEA 3HFGA 3I2HA 4ZIRA 3H16A 3NTOA 1CXZA 4IRXA 3KU1A 3VZCA 4EG5A 3KE8A 3PKZA 5LYJF 2PKWA 1HE1C 4RVHA 4LF9B 2IIVA 4NXMB 2WSLA 4YQZA 2ZTVA 1ZMBA 1ETUA 1YDFA 1ZH2A 3F5DA 4Q1FA 5I9BA 5IYZA 4EVRA 3MRSA 3H1FA 3PNLA 4JB2A 3PUHA 4FDAA 4EY7A 2AVNA 4B82A 3SZLA 1PX2A 4P1ZA 1WE2A 2B0JA 3Q40A 1FRZA 2MDTA 1LDBA 3QMWA 2WY2D 2WJ3A 4PXYA 2B8TA 3A31A 3IQZA 2H2IA 1RBMA 4QPNA 4YJ3A 3FPSA 3QUQA 3Q9NA 4UUMA 1GTSA 1DU4A 3GCWA 2QYHA 3AFIA 1DC4A 3DEAA 4H1VA 2O8NA 5DHFA 5L40A 2G09A 4RNDB 1NJSA 3PCXA 4A15A 2QBYB 1GPLA 1YZLA 5KKCA 1RRKA 4FJ2A 3OPVA 2HLHA 4DN6A 4RD6A 2QN1A 5FHRA 3HP7A 2JFYA 4H18A 2C04A 3TXYA 1B8OA 1RVV1 2C9YA 2GZMA 3KJXA 4REMA 4YRAA 1MHTA 3MWKA 3OU6A 5BMVA 3ZG6A 4TLDA 1YR7A 5EVJA 3R7WA 1N0WA 1OAKA 1Q12A 1EUCB 4EY4A 2DWPA 1IZYA 1H4QA 2RJ3A 4O2BA 5KOJA 5KYNA 1X1QA 4NJEA 1NYTA 3WYCA 5FH9A 2FPSA 3K2QA 4CEJA 2JEOA 3WYEA 3ESZA 4MUAA 4M3NA 4RJIA 3ONDA 1GPMA 3LUJA 4L5CA 4PAOA 3OQ1A 1IBSA 2Z8XA 2QY9A 1EJ2A 5TF4A 2I22A 4PNZA 5D00A 4C4YA 4D6XA 5KYYB 3KSMA 3RS7A 1Z75A 3E1KA 1GU0A 3PXDA 2PGIA 1QP8A 4POOA 1IWOA 3IIKA 2C4VA 3N87A 4DMCA 4HS4A 1DOAA 3WICA 1QGAA 1G3RA 2HBYA 1JT9A 3KJNA 1E6MA 1V5EA 1UZUA 5BVGB 1QF9A 5IWCA 4CEHA 1SQ6A 4GHWA 1ZRSA 4EYSA 3PCRB 5JWRA 1NJ2A 2QN3A 4NPAA 1KDRA 2P4QA 2YN2A 1DIGA 4M99A 1KFJB 3CLTC 4H7FA 2WHQA 2O54A 5DGTA 4ID3A 4ZDIA 3QBEA 4J1SA 1Z7BA 1FMTA 1YUNA 3H1TA 2ORVA 5IMBA 4RSMA 9GPBA 1T6BY 3KX2A 3O8DA 1LFDB 3K05A 3PVSA 5JBNA 2BEKA 1IZ0A 2GAAA 3K16A 4ED9A 1XZ8A 2FMXA 2IYAA 1U94A 1QJCA 3KJZA 2P7IA 3N5KA 4MINA 1G2QA 3M7IA 4ZPXA 1Z3IX 4CMIB 1WXFA 2FE1A 1GQFA 4UMDA 1WXWA 3DZBA 5EUQB 3CRW1 1RKBA 4NV3A 4YFVA 2L18A 2BL4A 5UKDA 5AT1A 1TA4A 3QLEA 5JRJA 2VTVA 5AJXA 1NJ6A 2CMDA 3PD1A 1V8OA 5KYVA 2PGAA 3X1MA 5CA0F 2X3YA 3AVPA 4IJ6A 1D9XA 1XZPA 1Q0LA 5C51B 2O5EA 4W5TA 5BRNA 2FHSA 2I2AA 5KYXB 4YJKA 4K6CA 3BN3A 3RE1A 1X2EA 2K6GA 3H2BA 5A3RA 2D6FA 1SOVA 4DAEA 4RPGA 4Q18A 1LC3A 1OH6A 2GCPA 4JBWA 2ZYAA 4Q3EA 2D3TA 1WMDA 2B9EA 4BLWA 4FE3A 4RZ2A 1IM5A 1QZZA 4AZ0A 2A1IA 3FUVA 2ONZA 4L3WA 3CWQA 3Q98A 1GGFA 3RVOA 2XKBA 2OHVA 4O4IA 1RQRA 4Q4LA 2PAAA 5CX4A 5A3VA 3STXA 4EHDA 4MQUA 1DEKA 2XOKA 3QYFA 1MNAA 3VZSA 5EEGA 4RSGA 3U3KA 4EB3A 5FAKA 2FEMA 1I1OA 1QS0A 1BMQA 1EAYA 1KEZA 2AYXA 4G4SO 5ECWA 2OPBA 4CF3A 1KJIA 2D1FA 3HKEA 3TSZA 3IB3A 3ZY2A 5LP6F 4DJFC 5LJLA 2R1VB 4I4TA 2VUUA 1P3JA 4IJMA 4QDXA 3A9RA 2OHHA 4LJLA 5BYBA 2ZFUA 3UT0A 4JZYA 3OEYA 3WWPA 1GNRA 2IX9A 2IEBA 3TVTA 3IALA 2EQ5A 1DFGA 1WDTA 2BEWB 2R7KA 4QTUB 5E6UA 5ALRA 1FMCA 3AYXB 1Y5MA 2RHRA 1LX7A 4LZJA 3GP8A 4JYMA 2GCIA 4JB3A 4LBWA 4MEBA 1NN1A 1T9KA 4XIIA 4WJKB 1RWKA 2PV0A 1BMFD 1XD2A 5BN3B 1ODFA 4XVQA 4KIWA 3WVNA 2V1UA 4IWNA 2R84A 3ND9A 4WY5A 2P4EA 1ZNQO 2KLHA 1BKSB 5F52A 1CS4C 3KT3A 2Y68A 4J3FA 5EKDA 5TY0A 3I0ZA 1IONA 4WLFA 4CCYB 1RWNA 1YS9A 3KXLA 4WEOA 5F76A 2BTEA 4YMSA 3RYCB 4LRWA 5KI6A 2GA9A 4LBYA 4TKZA 1YD7A 5KAPA 4D4GA 3SSNA 2D00A 2UUBB 3G88A 2B8WA 2QU8A 2VYVD 2LKDA 3IQIX 4JU8A 3ZZUA 4ARZB 1SCNE 3PQ5A 4CM9D 5L45A 4BVBA 1FC0A 1Z0KA 3H84A 2DBVO 4RJKA 1HYQA 2OM2A 1QBKC 1F4VA 1MBZA 2AFIE 4EUEA 2Z43A 5AVRA 3CVXA 1K86A 3FPGA 4FOLA 1SWVA 4IIJF 4U00A 1YR3A 2WIBA 1JW9B 1ML4A 4BMVA 3K94A 2UYCA 1NP3A 3KZ1E 4LUCA 2IZ5A 3H5NA 3A70A 3C3WA 3FPKA 1YFKA 2OENG 4P81A 2WIJA 1E5LA 2DUJA 3M6MD 4FU0A 8LDHA 4V1CI 5KX5B 3FYDA 3PIDA 4MRMA 5ALNA 2XXAA 3P4YA 2E1RA 2OCKA 5DBOA 3L8MA 4KN8A 5B58T 1BFUA 5AM5A 4CL8A 3D54D 5FD8A 5JROA 3MINB 1JNYA 5FPKA 4PIPA 4GD3Q 5JJ5A 4ZEXA 4U7FA 5IJZA 4U7DA 4OMFG 2H2HA 1SVMA 1E0DA 1FP6A 2BELA 4MVYA 1MP0A 3JYLA 3MQ4A 3P2OA 4HNRA 2NUTA 1F7UA 2FPOA 1V5IA 4NBNA 4BE9A 4LMRA 1LVHA 1CUHA 2H1FA 4JI4B 3B60A 1PVVA 3KTAB 1DAGA 4U2CA 5ESXA 2QJOA 4B8WA 2HA3A 1PBNA 1SD1A 3T06B 2Z4RA 5JSYA 2PY6A 1AKTA 3FNFA 3GJQA 3KXDA 4B4VA 2ZM5A 4G89A 4LV6A 5KQLA 1P4SA 3UCXA 2AI3A 1C9JA 3PFKA 1O3YA 1O96B 1TCBA 3HRHA 4LXIA 3VR1A 4CU2A 4EYGA 4QTYA 1BHO1 4RHXA 4MGYR 3TO5A 3GGCA 3PG5A 1HX7A 2DZDA 3DM5A 3JCZA 1B8UA 1J2YA 4HQLA 2FHPA 5IHPA 4Y6PA 2JIQA 1SGWA 3TKLA 1V8PA 4OL0A 3AUSA 3ND6A 1R18A 5K0BA 2V7BA 5JCOA 3LUHA 2Z8YM 1J33A 1FZQA 1UDCA 3UB3A 5BNZA 4AJPA 5JNVA 1TIBA 5DT2A 1NM5C 1K5GA 3QXSA 2AX3A 1YGPA 2VYQA 2I4IA 1Z4MA 5MN6A 1NDQA 4WXMA 4ZI7F 1MTOA 3BD8A 2CDBA 3D6HA 4B79A 2FG7C 3FHCB 4I4IA 2WPDA 4PYRA 3TXXA 5AUPB 5CT6A 3AF3A 1PG5A 2HRRA 3TH5A 4XYMA 3K0AA 3QVWA 5TGTA 1Z6AA 1HFWA 1O03A 4D92A 4DJDC 1QGUA 3CTPA 1JEDA 3I8SA 4ZVTA 2ZRJA 4HWSA 3W5HA 1FRQA 5FNVF 5HKKD 4EI9A 4RTPA 3CO0S 3GMDA 5JAPA 1Y8CA 3MSCA 2K7FA 5HIAA 1QHHB 4IKEA 1NXPA 2FFQA 4C7MA 4EJ2A 1H1DA 1RYHA 4UU0A 4TMKA 2AX4A 5DBFA 5JR3A 2XZOA 4QA9A 2EW8A 3LTNC 1CUDA 3B6MA 3OEHA 1LWNA 1D2EA 2REQB 1PQUA 2X8WA 3EMKA 3PXCX 2IC5A 4A8PA 1Z4JA 2JKYA 5EJAA 4CQLB 2GN4A 3ES9A 3THWB 4Q34A 3L5KA 1WXHA 4DPMA 5CEFA 2EEPA 2O3RA 3AB8A 4H3KB 1FP4B 4JVLA 1WMEA 1O7JA 4LK3A 3V7UA 4BEBA 2W83A 5I4BA 4CGZA 1MA0A 1YFLA 1L0BA 1GAWA 4PNEA 3BX1A 4PCLA 1AMUA 3OKAA 1P7VA 3GT3A 3MJTA 4EUNA 2GD1O 4GBGA 5K3AA 1W47A 2VIIA 3LHIA 4N03A 5TNXA 1I6KA 2RH5A 5MHTA 4MIEA 4YV7A 4LMPA 3HYLA 1YCDA 1AQIA 5JI2E 1E3MA 2YWBA 3CLSD 2BLNA 3NIWA 5IU6A 1UZLA 2HIMA 1BCRB 4QD3A 5E1DA 3T7JA 2C61A 4BRZA 5KHLB 3BJZA 3HDGA 2LRHA 4PAMA 4TS4A 2FUCA 4P4GA 2ADOA 4RANA 5ALGA 2NZUG 3IUEA 4F6RA 3RC2A 4A23A 3DVRX 1YDGA 2WD7A 2V4ZA 2VZ9A 2G4CA 3GPIA 3HC7A 2H1OA 5U4XA 1USKA 1ZN7A 2QW0X 3PJFA 4UBNA 3W9BA 1UBCA 4YQEA 4CE6A 1RZ3A 3CVUA 3PKIA 4E2ZA 4L4SA 3W77A 4HAXA 1NYRA 4YO8A 1D4ZA 1T5IA 2XE6A 4CLHA 5HOEA 1B93A 1EB8A 4NCNA 4GKKB 1GEGA 1EFAA 4HEHA 5GM1A 3H1GA 1OPXA 4J1TC 2DVMA 5DCWA 5I4IA 3O8CA 2XNHA 3DDUA 1KZ9A 1SHZA 1UR5A 3WLSA 4ZDWA 3P5SA 5JSKA 3CY6A 1DIHA 1UPCA 2QK4A 7YASA 1C0KA 3AFMA 2SNIE 1JG7A 3IAEA 4R69A 2QIOA 3IDZA 3NOXA 1WDMA 1IQPA 3PQDA 1GPYA 5M5BA 4JJFA 5EC8A 2YJNA 1Q7EA 3DC2A 3L06A 4FCCA 2PQ2A 3MCZA 2FQXA 2G9UA 1P0MA 1E5VA 1GUZA 1EM6A 4MQ6A 3CNEA 4IXMA 1J1IA 4OMDA 4G25A 3QF7A 5AHRA 1Z0ZA 4HD8A 1IVNA 1XTQA 3M33A 4DNPA 1NKTA 3DTTA 3CJTA 4DT1A 3ZLVA 4GOKA 5FIUA 3GJ6A 4UNRA 3D3KA 1LTKA 3KZOA 3K8OE 3NHKA 3DULA 1GZVA 1RI3A 4H2DA 4GR5A 2EOAA 4F6CA 5HZMA 2IOHA 1ZOLA 5JO0A 4WFKA 2YXPX 2ODWA 2FMUA 2G9RA 3AY6A 3BBPA 3TZKA 4I0WB 3UG6A 5DFAA 3AEUB 3QKRB 1QRTA 1QK3A 2XYQA 5JCXA 2VNSA 2YICA 4AKEA 2HMWA 2HQBA 4UTRA 5JXJA 1QIMA 4DFDA 1S7GA 2V7EA 4FOPA 4PZCA 2QUJA 4RH0A 3NGLA 4S2UA 2IV2X 1VL2A 4RM3A 1JSRA 3DBRA 4Q3CA 4MWBA 2EFHB 1L5YA 2VCHA 4XXHA 4LYJA 4TXLA 4J3NA 2G76A 2E21A 2XJ9A 1TLLA 4B76A 5CFRA 4TKUA 4LJSA 1V4BA 1CUAA 3F97A 4BE4A 3A9CA 1R0RE 2VHZA 3DOUA 3BGWA 4ZCPA 5KPDA 2NQTA 2AZXA 2BFFA 3OIDA 3KHSA 5GINE 1HT2E 1EVEA 1HTBA 4YLGA 1FLDA 2R7NA 3JRXA 4HEA6 5LQNA 1N57A 2JK0A 3TLCA 5FR2A 1JDVA 3N76A 2AV6A 2XVMA 5AKKA 5AXCA 5HCIA 2HA4A 3TVYA 4S04A 3K35A 3LXMA 1ZQ9A 4MPTA 3H9EO 3IAUA 4N7MA 3SR4A 2VEDA 1WCXA 1WBBA 1B6SA 1GZ6A 1WQ4A 2R1ZA 4DVGA 3GNTA 2X4LA 3K2IA 4MV1A 4TXJA 1OH8A 2QE6A 2QIPA 4KDEA 3DYBA 4F2GA 3QJYA 4A36A 2ZAGA 4YEDA 5TVGA 2A59A 4QQFA 3A6FA 3JD2A 5E9WA 2BGMA 3ZD7A 3MJSA 1JF8A 3ABSB 3NM6B 1A76A 1LV8A 4LDAA 5FF9A 3B78A 1XNJA 3VJLA 2Z8YA 2JGDA 1F06A 2CZGA 4P6VF 3I2YX 4D81A 1X1TA 4YMTA 2VDPB 3KQWA 1ZX1A 2DTDA 5FLYA 2B21A 5C46F 1UWKA 4KAFA 1UM9B 3D4PA 5JO9A 1S01A 5C37A 4RLQA 1MABB 2EFDB 3MWYW 4ZQBA 1DNPA 1O9HA 3MWEB 3R76A 2JH9A 3F2VA 1COZA 4LRSB 4UXIA 4CMKA 3I5AA 3H9JA 4QU9A 4EG3A 1IPHA 4AKSA 2FOLA 3FOBA 1ILEA 5T7BA 1O5OA 1K06A 2F9MA 3LL7A 3I32A 1V25A 2V5AA 3LVBA 2HCFA 1SUEA 1C3XA 3KR2A 1XCPA 2MTBA 1E1LA 4IIVA 2O8DB 4ESHA 4MULA 3WADA 5JFGA 1FFYA 1JV2B 5ALFA 1KC3A 3FOAA 5H81A 2XBMA 2QYSA 4Y1RB 1X87A 2CXXA 2J3KA 2MSLA 2H54A 2QX9A 2YZ2A 2F3UA 3MYRA 4KGXA 3QSYA 2VUIB 2DFNA 4ZPJA 2ZDQA 1MKYA 1K8RA 1R4ZA 5BV7A 4TZ0A 3IHLA 3VPCA 4WN9A 3SNHA 2W6MA 2GRJA 3NKLA 3RS9A 2X9GA 3WLOA 5LQUA 4JP2A 2CUKA 2W6ZA 3KQHA 5G0WA 2FQ1A 1E63A 2G83A 5KREA 3TW6A 4D43A 1TQHA 1VL6A 2P8SA 2VDNB 3AFNA 4KUHA 4BRUA 4MVJH 3F4LA 1I10A 4B75A 4P0QB 1L3CA 4K0RA 4GOXA 3DT6A 2O2YA 1EUDA 2P41A 4JBNA 4ZC8A 5HGJA 1MHPA 2GZ2A 4UPVA 3ZHYA 1QPBA 1ZIDA 4KIUA 1ZMXA 2I4NA 4KODA 4RKRA 2E48A 5DNUA 1XJ0A 2IP4A 5DSXA 4DLVA 1RZUA 1CRLA 5CCEA 2JASA 3SEQA 2NUPA 4ASUA 4CL3A 1YRLA 4HDOB 1G2IA 4LWPA 4PTZA 5F77A 2XMBA 2JZNA 2FZEA 1UDWA 2Z2IA 3ABOB 5HS6A 3DZIA 4C21A 4V2UA 4LDNA 3ELWA 2QP3A 2RAFA 5C5IA 3I5XA 4Z7QB 3ILVA 2X4GA 4MRNA 1N6KA 3EC1A 2H1CA 1XU7A 4E07A 1ODCA 2HSJA 4HAWA 4DDMA 1BH6A 5C8VA 4O08A 4Q9LA 2JBAA 4YCLA 1R6UA 4CV2A 4Z9AA 3LECA 4BGIA 2X5KO 5KQGA 4DREA 1RWXA 2BM9A 1S8OA 1P5HA 2CWDA 1PWYE 1C9YA 3LK6A 4FK8A 4TQUS 2V1XA 4L0MA 4EELA 4DWWA 2Q5IA 4H6WA 4E13A 1EU1A 4NU5A 4RA6B 1F6DA 3SZRA 3EXIA 3UHFA 1VLQA 4AWXA 2IU4A 3IMEA 2CNNA 5CMLA 2R5NA 3BZWA 3H9CA 5JHHB 5D8DA 3GFFA 1C0PA 1C3LA 3BEOA 1RTKA 5BSHA 3UT5B 4GZ3A 1RWWA 1YE3A 3P9KA 3WGLA 2WU4A 3FRHA 3TVDA 1A9QA 4GQBA 3FPJA 3DAGA 4DQDA 4RCYA 3SY8A 1Z8DA 4L8GA 2QNRA 2PV7A 3RJ9A 2AR7A 1NIPA 3NU1A 2C5HA 3FCEA 4LE0A 5T5QA 1QIEA 1DKOA 4LOJA 5JSFA 4AKHA 1XQ6A 4IDPA 4JMLA 4MARA 4B8ZA 2XCRB 4RX1A 3JAKA 1WVMA 4MIYA 3L8FA 1UQUA 3FNHA 2R7LA 1MD9A 2LV8A 3R09A 2ZROA 2HL6A 3DBIA 3ZWPA 5L4LA 2Q8QA 3DO5A 1U4SA 1RDFA 3GT7A 3OE7D 4R83A 5EGSA 3WGQA 5IAOA 1XMJA 2F8TA 4XGIA 2IF0A 4N3CA 5IC5A 2EBFX 2FFRA 3IBYA 3ZHUA 3RU2A 2ZANA 3SQNA 3A28A 2W2OA 4M9QA 5IVDA 1ATZA 2XGMA 4X1KB 2XUDA 2QLJA 1GGMA 2H1WA 1BFKA 4J94A 3DKPA 1GXSA 1VL8A 1NRXA 4JASB 3JQ7B 3EXAA 4EB6A 4EHJA 2YY7A 3ZU6A 1O6ZA 2JFNA 5TB5A 2XTNA 2HA2A 3EXHA 5AKHA 3D2CA 3TBHA 4N3NA 3CBQA 5K0FA 1V11A 1XAHA 2F1KA 2NLOA 4KAJA 1QQTA 3LX4A 1TMGE 1QYXA 1G4UR 1V7QA 1VYTA 2WJ4A 3IAHA 4OBEA 3MWDB 3M1IA 2XYGA 4EGFA 3NHRA 4RV5A 1MUUA 4DCNA 5LMNB 1M1YA 3D6MA 4FYXA 1JJAA 3RVQA 3GUVA 3QRWA 3GC6A 4BNJA 3VC1A 2Q9UA 2IW3A 2Z98A 2NTVA 1NRWA 2J0QA 3ONEA 3KYIB 2ILVA 4QUBA 4YCCA 1PJAA 2PSFA 2IH4A 4TLEA 5DDIP 4EATA 1AHNA 4R0MA 2HA7A 1PJ8A 1RI2A 1L4KA 3AEKB 2JFGA 4MS3B 4P3KA 4J7UA 1JH9A 4EIWA 4OJTA 3OLXA 1EFPB 1FJ2A 3KD3A 1IY8A 4HGNA 3OPQA 4QYIB 4BXOA 3W4JA 1XEWX 5K3FA 4GI1A 4KO4S 3OZDA 3PCTA 1UZAA 4M46A 3EXG2 5C34B 1SIWA 4F21A 5SY4A 1FP2A 4B3GA 2FMHA 1C0EA 1ID1A 3ICVA 2N42A 2WG2A 2K2QB 1LNZA 2J1LA 3EGCA 3ZEIA 4YI5A 2DWCA 3VH3A 3J81A 1T8RA 4XIGS 3OOJA 3QU7A 1JPJA 4PQFA 2XVXA 3C8DA 2VF2A 4GICA 4XWAA 1N6NA 2PVSA 3B82A 1YAJA 3L40A 2CY0A 3EK2A 1IOWA 1OFGA 2CNLA 1AC5A 4FP9A 1U90A 4HYTA 1J8QA 1SBCA 3P0RA 3P71T 1COWD 4ONEA 5H3CA 1FFBA 1U4OA 3NBQA 2QM7A 3U7QA 3WL7A 1PUIA 1Z4IA 1NZJA 2JGEA 3R4CA 3RVLA 1A8QA 1UBEA 4Q7MB 1FX0A 1SVLA 2HWUA 3GLFB 3OMWA 3ZGOA 3FCSB 3TGWA 3VSAA 2ZYWX 1S9DA 1YVRA 3V4RA 2CL7X 4TN1A 4WPGA 1LSUA 3DAPA 5CK5A 4M54A 2GZHA 3ZBQA 3D6TB 3Q88A 1XGKA 1CBUA 2X77A 1ML3A 3QQ5A 5FJIA 2VF8A 4LNUA 3T3HA 4BMSA 5AW6A 4KLAA 1Z6ZA 3CLSC 2GM4A 2FPPB 3SN6A 2IYTA 3U56A 2B94A 3V2HA 1XNQB 3FFBA 4CM3A 4HZUB 4MHOA 3O90A 1GKLA 1GZHB 1LK0A 1GSIA 1LDGA 2I2XB 3ABRB 4PX5A 2VBFA 2IYSA 4QBFA 1K3UB 1Y3AA 1ZAKA 3WWOA 4MA5A 4BCDA 1FYFA 5AW5A 2O2XA 5IZCA 2HFJA 2I2WA 1BQEA 4MUFA 4IEFB 4BNNA 1KHTA 1EXVA 1XMOB 1EUYA 4GW3A 5C7LO 2Q5CA 2I6QA 3ZHVA 1RKUA 3M3DA 3PFCA 2H29A 5JIBA 5H9VA 1XD8A 3PDHA 1VECA 2XQIA 3G1TA 3HA3A 1Z35A 3FCOA 4RVGA 2O6LA 2B2NA 3DWGA 4XD2A 4P3YA 5MN4A 2IHKA 1I4TD 2YHIA 1P73A 3I9V1 4LXQA 4PTLA 5CVVA 3SXUA 4I6GA 4MJ3A 4NZ9A 5MF6A 1E62A 1KDPA 1NZDA 2V5UA 3OFND 1BMTA 3FOFC 4U0JA 2A9PA 2FR0A 1M34A 2G0AA 4BLPA 3LY9A 5LWHA 1C9MA 3E05A 1B14A 1OF1A 1W88A 4MWDA 4KOEC 1E4VA 2GOYA 3AINA 5T6BA 3UUWA 1S8AA 1DT3A 1UPBA 4E0BA 4QKQA 3ENQA 3H8WA 2OGTA 3EZ2A 1CE8A 4D26A 2CLKB 3I3SR 13PKA 2ZWOA 4JKYA 4LJ9A 1D1TA 5D5HA 4TTQA 3IE0A 1J09A 2C2WA 2OZLA 4WOPA 2N9UA 1KYXA 3IBTA 5DIFA 3VU9A 3WLKX 2QTFA 4ATNA 3IAM6 3QLVC 2J3LA 2G25A 3PNQA 3P1JA 5DM2A 4U02A 5IBPA 4BP9A 4BJ1A 1W0JA 1KETA 1XTJA 3M81A 5EIHA 3DC7A 1IHXA 4L8VA 4WLVA 1BXZA 1NXWA 4J29A 5CEJA 1OCEA 5KCZA 2W2LD 1FA9A 4WY8A 3WGTA 4TZKA 7AT1A 3BCRA 1W9MA 1DT5A 1FFXB 1G6Q1 2EG5A 3BOSA 1H6AA 3GGDA 3QFHA 2YUTA 4G4SP 4I7EA 2NIPA 1RRFA 3AJEA 2B61A 3FHTA 1MJNA 1HDYA 4LJKA 1DXOA 2V58A 2YJZA 4FQ7A 5TQ0B 5KO2A 2JIDA 1F0NA 1G20B 4JUAA 4N49A 2RDMA 4NAVA 2C42A 2F3QA 4OHWA 1DJOA 2CMFA 5EYPA 2FZ4A 3AIOA 4MR7B 4US0R 1SD2A 3MCVA 5U4QA 2G5GX 4UU1A 1C30B 2RH8A 1EFDN 1Z0UA 4P7FA 3NEJA 4NHOA 1UP7A 4OJMX 1SOWA 1AKQA 1Z37A 2GCOB 3AB3A 4FQ8A 1LI5A 3DDOA 2JNWA 1UQRA 1PNOA 1IK6A 1G8FA 4EDFA 3ZE8A 2Y71A 3KUKA 2FZGA 3NJ8A 2PGOA 1XMXA 2C2ZA 2V45A 4RPIA 5DNDA 2GS9A 2JLSA 3LYAA 2Q2OA 3IVRA 3CMCO 4CM1A 2FR8A 4ENWA 1XMQB 1AZSC 2CMHA 4BMZA 3UGTA 1E7QA 1P0CA 3PUZA 3OZFA 4OI1A 4I5DA 1ISMA 1NXTA 3GLIE 1HKUA 1Z6PA 2D59A 4CVNA 5I7HA 1BVHA 3O91A 3FDZB 1RYMA 4MHTA 2QTMA 2XQGA 1QXSA 4P4SA 3AHGA 1OBFO 3BGDA 4WJZA 5EG5A 1YA4A 3PFFA 3C3KA 1RWVA 3EODA 3HU2A 4HCJA 1IC6A 4IFTA 5AVXA 2P9HA 2XT9A 3DDZX 4DCPA 5JQGA 3AVXA 3FYUC 4R0VA 1KR5A 1UJ6A 3F9IA 4Z99A 3W9UA 4X61A 5FL3A 1N34B 2O52A 1NN5A 3PFIA 4AJOA 1VTKA 2PZBA 2R6AA 1PS8A 2AJ8A 5T4EA 3IVAA 3LKDA 1TD9A 1JKFA 1R9GA 3FGOA 1UXJA 1VCOA 1ZJZA 5CH8A 3LG2A 1TM7E 3IAAA 3ZWMA 4QPJC 1WJGA 5EQTA 2HMUA 3N2YA 4EMTA 4FD2A 3T9EA 2X0NA 1RXYA 1ZJ5A 3A1TA 3DFIA 1U7DA 2IEDA 2QD3A 4BFCA 1GD1O 4Y6SA 4LPSA 2L17A 1S96A 3LQ1A 1JHDA 3H4IA 1Y9EA 2PT6A 5CNIA 3VR2D 2JBHA 4D80A 1Z63A 1Q6YA 1N0IA 1IZZA 1VPLA 3IJPA 2CNKA 3WRXC 2QEQA 1L1EA 3EGXA 1XVTA 1XZEA 4ND3A 3SC6A 3VNBA 5A5EA 2CT8A 4KYIB 1DFIA 3D1LA 3DYIA 5KC9A 3H2ZA 4OSPA 3DV0B 4XQ0A 4DIBA 3L9XA 3TRJA 1XZBA 2R4UA 4IJVA 3S5JA 1LKZA 3KBOA 1UWCA 1XTTA 3KR1A 3DEJA 4HPJB 4IX1A 4RY0A 4Y30A 3WMXA 4WVFA 5H5JA 1P77A 2POCA 3VR5D 3GA0A 3ZOZA 3MUEA 5ECGC 2VPZA 4AJEA 2EKZA 3N28A 1TTTA 5TR9A 2JB9A 3K09C 1NUSA 1XCOA 4YIHA 3ELDA 5LYJB 1MQAA 3S1LA 3V6MA 2UXCB 3FOWA 2W8BB 5E6SA 3WIOA 3VH1A 3MT9A 4JLMA 1H2BA 1I0IA 1QLWA 2C4TA 3RSGA 3PUVA 3TNJA 2LUOA 2CK3D 2J6HA 1RQGA 3AUKA 1YUBA 3EWSA 5DNWA 3KSBC 5HUJA 4RUKA 2CLDX 5A4MS 2HWKA 4YT5A 3N8NA 1DC5A 2Y1FA 4C3UA 1YS1X 1Q83A 4BFVA 4XUGB 5AVJA 4G67A 4MX8A 1CUCA 1U6IA 3FVRA 3IS3A 4PRKA 3SLGA 3VO1A 4KR6A 1YCFA 3MOSA 4DBLE 3IOMA 3QXCA 5EQDA 3DZCA 4AP6A 1F2DA 2DPYA 4YP6A 4YVFA 1GNLA 1FQJA 1D6JA 1DBQA 3DD5A 4CT4B 3U39A 5CA1B 2YHSA 3FPAA 2IUFA 1T43A 4HGZA 1DAPA 4J0JA 2B1JA 1WCV1 4UPEA 4MWGA 2BONA 3L8HA 2G1PA 1JQJC 2VH2A 3E18A 3LHFA 4KFSA 5FAXA 4XDZA 5IYZF 2DQZA 1VJCA 4CKBA 2YOFA 1KSGA 1N2BA 2W90A 3N2IA 2F48A 3VKGA 3OECA 4MQBA 4I6JA 3EVGA 4E03A 4MQ4A 1RJGA 3I1FA 5EFZA 2H1SA 1JHPA 1H65A 3LQQA 2DF8A 2DRIA 2UZ1B 4JR2A 2JGFA 4P54A 3BM5A 1C9KA 3EBLA 4EFKA 3U7FB 4RVFA 3ANTA 3I8OA 4CDMA 3L92A 4J0IA 4ZCTA 1E79A 1ZKDA 5INTA 1E61A 1UXOA 5F12A 3UANA 3EHDA 1Q1QA 2F3SA 4DUGA 3P8ZA 3AJDA 4RVCA 5JFOA 1YCHA 1V1RB 2FJ0A 2QVYX 3BEDA 1PX0A 4G24A 3T9FA 3UK2A 1QRUA 3B9BA 3I1YA 4X8MA 5DTMA 3V8MA 5IZ4A 4B35A 1C1DA 1DC6A 3EWAA 4N6GA 1E6WA 3DTVB 3EB9A 4PO8A 4ENRA 5BMVF 3IJEB 4F9EA 1M74A 3IGFA 2AGVA 4XTCS 4ZT6A 4F91B 4O2BF 4NK4A 1C8KA 1S8FA 1ZN2A 2ZLBA 3ROFA 5JQWA 5KU7A 1MOQA 2MWMA 2F4NA 4C7BA 4YTEA 1NT4A 3L01A 3HVRA 3GGOA 5GY7A 4WLOA 4U4AA 3ITDA 5AVKA 1AKMA 4R31A 1DMSA 1Q0PA 4MJ7A 2BCJQ 1Y82A 2IF2A 2XA9A 3ZLBA 4BQOA 1DZ3A 1QGZA 2E87A 2QRZA 3N05A 3Q1KA 3LA6A 3PB3A 2ZE8A 2YFYA 3VKFA 3ZC3A 3KQMA 1MB9A 3PDUA 4IDFA 3MTBA 5SZIA 4DA0A 4DCSA 5KYKA 3R1IA 2FOIA 3RUFA 4TX1A 1C7QA 5AW1A 5CA0B 1D1PA 2HOQA 1PEKE 2JLBA 4I9UA 4AX8A 3JZFA 2F67A 1LA2A 3K32A 3QZUA 2XBUA 5CGQB 4EZBA 4F9GA 3B3QA 3AX6A 2VP2A 3L1KA 4EGCB 3U19A 3K6KA 4YCAA 1I1HA 2FZKA 4E70A 1QRSA 4TYYA 2HUNA 3NP9A 1AE1A 3SNKA 3TJZA 4LSMA 3VYSB 1U8FO 4RK6A 2G5PA 2AEFA 3B1JA 2DYKA 3CR7A 1YE8A 2QX4A 3SOZA 4PU0A 1CUIA 3QY9A 3IUQA 4NOMA 3BGSA 5JHGB 2UXBB 1D7OA 4OB6A 1EGAA 4NZNA 4LY3A 3TQRA 2H4FA 1DL5A 3OSZA 4XA8A 3VHLB 3ZY6A 1XXLA 2XB2A 1CEYA 4QFCA 5LP6B 3DEFA 1W94A 1SO8A 5K8CA 4I46A 1RC8A 3RC7A 2YYYA 5A1TA 4WOBA 5DTIA 3ZBUA 2Q7OE 3EPLA 2YHUA 4D3ZA 5HKOA 2FUG6 2NO5A 5CBPA 1WXEA 3UZUA 2FXIA 5DKFA 1J00A 2H5EA 4JD5A 4A27A 2IXGA 3QITA 1TYCA 2QP9X 3LX6A 4WCFA 1BC5A 1MPTA 3G23A 3C14C 1J1ZA 1XQ9A 2QLLA 5DXAA 3QVOA 2IPMA 4KSYA 4XE5A 2FCRA 1ZOSA 4F4HA 4DGQA 4RTJA 1QC5B 1AX9A 1XPJA 5BOVA 2EERA 1DG1G 4I8DA 4IP0A 5DHUA 4B80A 4A9AA 2HM7A 3G0HA 3EISA 4GNKA 3W3AH 4O4IF 4L02A 3VNSA 2J59A 4CMAA 4P80A 1ODSA 4O2LA 2HMSA 1WP4A 2JGAA 3RV4A 1KE1A 5FO1A 2NU6A 3GRUA 1V6CA 3RK0A 2WE8A 3K70C 2WJYA 3CNBA 1NYQA 2FR1A 1NOIA 2B4QA 4MRRA 4OJQA 5IP5A 3R6GA 4OSOA 3U48A 2V7UA 5DW3A 2QDXA 2ZB8A 2DTXA 3FYCA 3H8SA 4QDJA 4MV6A 5TPZA 2R4QA 2YXEA 2CL0X 4D41A 4HGPA 1UADA 1MIOB 1H9CA 3ISVA 4ZT7A 1SRRA 2Q41A 3D4OA 1A7AA 5HK9A 4NJMB 4W82A 3UWPA 2C4HA 4IHAA 2XMZA 4R9NA 1Z0IA 1KDZA 1QH8A 5GPBA 3VA7A 3EZYA 4RFLA 2JEYA 5A0TA 2DMRA 3EGEA 3KKQA 4IIJB 3AONB 2I3ZA 4AN1A 1O97C 3HZZA 1SUBA 2HU2A 3NH6A 3LP5A 5T3UA 4GQIA 3M6UA 2PLFA 5F4BA 3DE5X 1T1EA 4M1YA 4JSTA 4RCVA 2C98A 1KEWA 5COAA 4EI8A 2AOXA 1E92A 4K9MA 5F1KA 3VZPA 1NXOA 4R2MA 5JYDA 1MT0A 3L18A 2IYXA 2X4DA 1JMKC 3VSBA 1DLIA 5C52B 4D0RA 4UBIA 1IVYA 1B1AA 1ZK1A 3MILA 7ADHA 4QU0A 1P81A 1ZINA 1ZM4A 4OOFA 2UUAB 1JLSA 4A10A 4UBLA 4CMHA 4E88A 1NONA 5A4FS 2R11A 4QE3A 3IHWA 1T2EA 4G6ZA 4RPKA 4E11A 1QP4A 1I14A 2GBFA 5EIOA 3DUFB 2GXSA 2WM8A 1DC8A 1MV5A 4WESB 4YECA 3K0EA 1D4OA 4RLHA 1MRSA 4FDTA 1MLDA 1P7YA 1MPXA 3VU8A 2BAGA 3KDPA 2R7AA 1Y9DA 1RMTA 1YNOA 1QIGA 1K5PA 1X80A 3N6XA 3R74A 4ZMSA 2F59A 1PFWA 3L7JA 1JAZA 4JBYA 1SUAA 3RAPR 3S27A 3H5VA 3O0TA 3UMYA 1P33A 3AZPA 1MU0A 2C31A 4A73A 1I5EA 4BNXA 4C7VA 5L3SA 1H9BA 4OGGA 1CEXA 2VP0A 4BQFA 3IV6A 4K9RA 5FOQA 3ETCA 3GOQA 3HCPA 2IBSA 3PLAE 2I4RA 2EFJA 1O8CA 2FEPA 2M98A 2WJJA 4BNLA 4DNOA 1NQAO 4D42A 4WJLA 5EJGA 1U8CB 5CAEA 4JLVA 4QEDA 1Q57A 1JFRA 2NSLA 3OAAA 2DBYA 4KXUA 2C92A 1NOJA 2XOKD 2F8SA 1H5UA 1FUEA 2G9QA 4UXJA 5KJEA 5T67A 3RSLA 4TYPA 4BP1A 4DHWA 3GVPA 2QTVA 3UXYA 1WB4A 3QG5A 3DW3X 3QP9A 3WWYA 4D96A 1TM2A 2COEA 2F64A 2ZYIA 4G37A 4M53A 4NQZA 2P2NA 3NHFA 3TLKA 5P21A 3KFXA 3VMMA 5CW1A 1ZD8A 3QMPA 2W6IA 4P5PA 4QJBA 3WGKA 3T1NA 4ZI7B 1N2CA 3UK1A 4DBLC 2M2IA 3B9RA 3QF4B 3E7WA 1MX1A 3H8VA 5H8WA 4JU9A 1AXGA 4B47A 2O1XA 3EIFA 3L43A 3ZHZA 3ZD6A 4KGDA 4NAHA 3ZWYA 5I3ZA 1Z4LA 3EXEA 3JD1A 1KVSA 2VZEA 1IHDA 3CF4G 4JLAA 4ZO7A 3W8FA 5D3QA 5DGIA 5DTJA 5FNVB 2J0SA 1IDOA 4HO1X 2IUUA 4MQFB 3ZWVA 3GEBA 3GARA 4AMYA 4V0OA 2VAPA 1Z56C 2WWWA 4S3MA 4D9CA 3B2QA 3NTVA 3OM8A 3L8DA 1EIWA 4P82A 1DXHA 2ZBFA 4HDSA 2WB4A 2Q6KA 1G9XA 4X94A 1DQNA 5B6PA 1P1JA 1W93A 2DFVA 1AXEA 1U3WA 2Z3WA 3HY3A 4ROTA 3W9YA 4M7PA 4YBZA 1C1XB 3CRZA 3OZRA 3A4IA 5J9FA 3QNUA 3QENA 4TQ9A 3N3AC 3LC0A 4IIBA 1A4RA 2FXVA 3BRWA 1EWKA 4KXLA 4U7TB 3DPUA 4P22A 1LBEA 3UJPA 2DBZA 5DGCA 2JH8A 2ZZKA 1NVEA 4JS0A 4QVGA 4UD2A 4EHHA 4L8LA 1SOUA 2EG9A 4WFQA 4UAJA 4BLUA 1K66A 3DB1A 4MTCA 1KZ1A 4KXQA 4OXXA 2YHAA 2BEVA 1UK7A 2BT4A 3AK4A 3K0CC 4IZ6A 4C0AC 3R6WA 3TI7A 4DMHA 5G4KA 1I13A 1NZFA 3PBKA 5EVCA 5B58C 2XUOA 2A7QA 2Y1OA 3O6VA 4OQZA 3AF1A 4QBIA