1RMTA

Crystal structure of apha class b acid phosphatase/phosphotransferase complexed with adenosine.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
210
structure length
210
Chain Sequence
b'PSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B acid phosphatase
molecule tags Hydrolase
source organism Escherichia coli
publication title Insights in the catalytic mechanism of AphA from Escherichia coli
rcsb
total genus 71
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2003-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rmtA00
3A1DA 4G9BA 1RKQA 3WGVA 4BX0A 1RRCA 5ALRA 3ET5A 3WK6A 2BDUA 3U19A 2O9JA 3ESRA 3MN1A 4UASA 2P11A 5ALHA 2P9JA 2I34A 2R8EA 3PGVA 4IFTA 4UM5A 4KN8A 5AIBA 1Z4PX 5AK6A 3MMZA 2FPXA 2NO4A 3QX7A 5AVVA 4G63A 2G1AA 3L5KA 3OCUA 5AM5A 3QGMA 2HOQA 4BX2A 3WK5A 1TJ3A 5ALUA 2MSNA 2AGVA 4BNDA 2C9MA 5ALDA 3ED5A 5ALZA 3U7EB 2GHQA 3BA6A 4FFDA 2HDOA 2HEGA 3NALA 2B1QA 5AW3A 5A3SA 2ZBGA 2B82A 4J2TA 1Z4OA 3OCYA 3AR9A 3L0YA 3SKYA 4BBJA 2B8JA 4UU1A 2WF9A 1S8OA 3OCVA 2HX1A 1YV9A 3ZVMA 3MPOA 3L0CA 3N28A 1VJRA 3W5BA 1NNLA 5T41A 4CF4A 1N8NA 1L7MA 2HHLA 2ZBEA 4ZEXA 4XE5A 2BY4A 2EATA 5AK3A 2IA5A 1QQ5A 3U7FB 4ZEVA 2FI1A 4Y3UA 5IS2A 2R8XA 3QUCA 5ALOA 3SMVA 1F5SA 4I9FA 2YFYA 4BNDB 4AS3A 3WK9A 1CR6A 1O08A 3AR5A 3NAMA 3FPSA 5ALKA 5ALWA 5AVQA 5AICA 4EENA 5AI0A 1XVIA 1ZRMA 3E8MA 3L1UA 1MH9A 2G09A 3I1YA 1PW5A 1T9ZA 3PCTA 1AQ6A 4I9GA 2JAWA 1EK1A 4YCNA 3WK7A 1L8LA 2C8KA 2RARA 4UATA 2WF6A 3QNMA 4BYGA 3UM9A 2Q4RA 3N1UA 4UMFA 3ZUPA 3N8GA 3IB6A 4MWOA 3BWVA 3M9LA 3QUQA 5ALPA 2HI0A 2GHTA 4NAVA 4NV0A 3ZU6A 5FP0A 2YN4A 5AVZA 1WVIA 4BEVA 1Z5GA 4CE6A 3NASA 3NIWA 2RBKA 2FDRA 2NYVA 4HAIA 4YIKA 4AS2A 2IOFK 5AI8A 5AVUA 2FEAA 2GO7A 5AIAA 2G07A 4UMEA 2R8YA 3ESQA 1U7OA 1K1EA 3W5DA 1JUDA 3EPRA 5AKYA 3KD3A 3QU5A 3R4CA 4C4TA 4Y2UA 3N5KA 5AW7A 1Q92A 2WF5A 1ZD4A 3EF1A 2JAOA 4GIBA 5AVTA 4E88A 3L8EA 1XP5A 2C88A 4FE3A 1QH9A 4YH1A 3W5AA 1ZS9A 3A3YA 3RF6A 4Y2XA 1TE2A 5ALEA 5AKKA 4KNWA 1NRWA 4DCCA 3OPXA 4HGQA 2QLTA 5ALJA 1RLOA 3B9BA 2ZOSA 4H1WA 5AVSA 4UU0A 2HO4A 4GXTA 4NWIA 3I6BA 4KYTA 1WR8A 2I54A 2OYCA 4L6AA 4HGOA 2YJ3A 4OD0A 5AVWA 1J8DA 2HSZA 4YCMA 5AW0A 4O8CA 4UARA 3UMCA 1L7NA 2ZBDA 3B8EA 3AR4A 5ALIA 1QQ6A 1RMQA 3L8FA 5AKXA 4IG4A 3L8HA 2CFTA 2G0AA 3L7YA 2QYHA 1ZRNA 2B8EA 5AI6A 5AKEA 2B1RA 1RKUA 3U26A 3DNPA 4QQFA 4XQ0A 1YJ5A 3K1ZA 4L6CA 5AKIA 3J7TA 1SU4A 2JGAA 2P69A 3ZX5A 3ZWDA 4CNQA 1ZD2P 5AW2A 1L7PA 5ALXA 3ZTWA 2W4MA 3UMGA 2OA0A 4EELA 1ZD5A 4F72A 2YJ6A 4KX3A 2JARA 3ZVNA 4EX6A 5AM4A 3ZTYA 2ZBFA 4Y2JA 5ALLA 1NF2A 3QYPA 1VJ5A 1TJ4A 5AW4A 4B6JA 3AR7A 3L1VA 1FEZA 3VAYA 5IT4A 5AW6A 3KOOA 3NANA 2EAUA 1VFPA 3U13A 3IJ5A 5ALQA 5AVYA 5AKGA 5ALYA 2R8ZA 4Y2YA 4DFDA 5AM0A 2EARA 1RMYA 2FUCA 5AHXA 2ZG6A 3DAOA 4NABA 1YDFA 5AW9A 3RFUA 3NUQA 2ODAA 3FZQA 2CN1A 2FPSA 2I7DA 3KZXA 3D6JA 5AI5A 5ALSA 4Y2TA 2VKQA 1RC8A 1EK2A 2YMQA 3L8GA 1RLMA 3CNHA 2WF8A 5AESA 3KC2A 2X4DA 4OHFA 1Z4NA 1T5TA 1CQZA 2G06A 4FYPA 3U7HB 3ZW7A 2YY6A 1XPJA 2G80A 3SF0A 4DW8A 2W11A 3FGOA 2IOFA 3OCXA 1X42A 2GMWA 2C4NA 2FPRA 3SD7A 1ZD3A 1KYTA 4HGRA 4Y2VA 5A3RA 4Y2PA 2IOHA 2JAUA 3F9RA 2CFRA 2FUEA 4KNVA 3ZX4A 4JDPA 3EWIA 3QU4A 1RMTA 1RQNA 4UMVA 5ALMA 3AR3A 3IRUA 3PGLA 4J03A 1RPZA 3N07A 3FPBA 3CZ4A 2PQ0A 1Z4IA 3I28A 3SKXA 2FPWA 2FPUA 4C4SA 1S2OA 2D2VA 5AI4A 1YNSA 4CF3A 2YBDA 5ALNA 1WZCA 4YGYA 3WKAA 3R9KA 3ZI4A 3GYGA 1LTQA 1ZJJA 3AR6A 2WF7A 4XPZA 1LVHA 3OCWA 3FVVA 5A3QA 2HF2A 4XOUA 3QXGA 1U2SA 2W43A 4BKMA 3WKCA 1T5SA 3R09A 3WK4A 5ALFA 3SLRA 1O03A 2GFHA 5AM1A 3OCZA 3WKDA 4OCZA 4Y2QA 2WFAA 1TJ5A 2I55A 4BEWA 4HGPA 3WKBA 3AR2A 5AKZA 2Q5EA 2C8LA 5ALTA 2O2XA 1Z4LA 4UAVA 2OBBA 4Y2RA 4CF5A 2HCFA 5AK4A 5AI9A 4JB3A 3QU2A 3DV9A 2YMPA 3QUBA 4HYTA 1YMQA 5AM2A 2RB5A 5IT0A 3ET4A 2DQSA 4UW9A 1L6RA 1IWOA 4YCLA 3I76A 3TLMA 3QU7A 4OFZA 2NO5A 3E84A 1L7OA 2YJ5A 3ZWKA 1YS9A 1U7PA 3HYCA 2OM6A 4YIHA 3WGUA 3EF0A 3KBBA 3ZVLA 4HGNA 1SWWA 4RETA 3A1EA 2PR7A 1J97A 1QQ7A 5ALGA 5E0OA 4EX7A 3E58A 3QUTA 4NFLA 5AKJA 5AW5A 2MU1A 1QYIA 4L57A 4F71A 1WPGA 2BDEA 3WK8A 5AM3A 1RLTA 4RESA 5AW8A 3A1CA 3OTQA 4MUMA 1Q91A 3B9RA 3SHQA 2AUTA 2B0CA 3W5CA 3KDPA 1U2TA 2YMLA 2P27A 4UAUA 1Z4JA 5AVRA 1Z5UA 3QU9A 4C4RA 3DDHA 2AH5A 5AK5A 4KX5A 2IYEA 2G08A 1RKVA 5AKLA 4UMDA 1RDFA 4BX3A 4EZEA 3UMBA 3MC1A 4Y2SA 4PNHA 3S6JA 2ZXEA 1Y8AA 3WKEA 2YJ4A 4DWOA 3PDWA 1Z4QA 3HLTA 3NRJA 2AMYA 1U02A 2PKEA 3AR8A 2I33A 1Z4KA 1Z88A 4EEKA 4ZEWA 3E81A 3FM9A 3U7GA 2YMMA 1L8OA 2RAVA 3M1YA 2WM8A 4UM7A 1ZOLA 4AP9A 2B30A 1TA0A 3QLEA 5AVXA 5JJBA 2Q4TA 1SWVA 2WHEA 3P96A 5AKHA 4QJBA 1RQLA 2HF7A 2CFSA 1Z4MA 3L0BA 2I6XA 1N9KA 5AW1A 5ALVA 3ONNA
chains in the Genus database with same CATH superfamily
3HXTA 1U5CA 3DBHA 1G5TA 2QL7A 4CV0A 1C0LA 3KQYA 3CLUD 1A97A 1W47A 3T5MA 1ZEJA 1D6SA 2O9JA 3H75A 1R00A 1AK9A 1GQQA 2O7QA 3FRHA 2A33A 1PGQA 3HCBA 4CMAA 5T7BA 4E03A 4XVUA 3CRNA 3TZBA 1CR2A 3LSYA 3BGVA 3M83A 1I1HA 3BFPA 2EP5A 1T1SA 1I0IA 2QAGA 3SFZA 2O0MA 3VYUB 2HXGA 3KTFA 3BT7A 1XF9A 2GQ0A 4YPFA 1V16A 2WNHA 3D0QA 1KMIY 1Z22A 1CUXA 4G63A 2QU7A 4MWCA 5U1PA 1ZUWA 1NW9B 2BEVA 4B3CA 5A4AA 1S01A 1TUBA 3G0IA 5AOVA 1V7ZA 2JJ2D 3AEQB 3FETA 3LCRA 3OIFA 4I66A 4P4TA 1M34A 3SBEA 4DCNA 2HWWA 5AH0A 2XSZA 421PA 4EMUA 4DNPA 1SBYA 1ZUNB 3BA6A 1PIWA 1QHSA 4MITA 2E5LB 5C80A 5LN1A 2A9KA 2VQEB 3DKPA 2I29A 1FU4A 2V7WA 5JNRA 4MVJP 4A9AA 4BGIA 5EE5B 5MF6A 4AKGA 1G8KA 3VNSA 2XE7A 1KXZA 1KZ7B 1UM9A 1CDZA 2YNMC 3HEMA 2JZNA 1CJMA 3I8OA 3SU8A 5JANA 2B82A 3R8FA 1N5KA 5EHIA 4YN3A 5LJLA 1U3TA 1V5GA 3NHLA 4RSGA 4DJAA 1Z5VA 1V1RA 4HX2A 3ZIAA 2XUHA 2OGSA 1U9IA 4BO8A 3PR3A 4KLAA 4WKPA 5DEIA 3KEGA 4KBYA 3AIMA 4YC7A 2GN8A 2XYRA 1TVKA 3M33A 3UTCA 3IMCA 3VUFA 4I50F 3QBDA 1LUAA 3LCCA 1P91A 4CF4A 3DZ8A 4XGIA 1L7MA 4JI8B 3G9QA 3PV0A 5DNVA 2NTNA 2R1TA 4MIOA 5SY4A 1C3OA 1R9GA 4LRUA 5IULC 2VNIA 2WQ7A 1GPH1 2F4VB 2ZDQA 2CDRA 2OFXA 1VMKA 3HY6A 4PTZA 2WUGA 2GNOA 1E9FA 3AWDA 5EIWA 1FP1D 4OQZA 1W8IA 1AY0A 4F6RA 3G9ZA 1ZGJA 4FS3A 1NR5A 4PXYA 4FE7A 1OVGA 1OAOA 4OI0A 1R15A 2YFYA 1RLJA 1NI5A 3U44B 4F12A 4D9NA 1IFXA 3MJSA 2D1TA 1C5KA 3WLPA 5KDOA 1SAYA 3F4KA 1J9GA 3GVCA 1VZ2A 2QVBA 3H6KA 2OO5A 4KVFA 5TPZA 4DMHA 1ESMA 5I6DA 3EWSA 4DLTA 1Z8HA 3LE8A 4TUYB 1P1IA 4FHCA 2WJ6A 3DFKA 5EMHA 3BFKA 3E8MA 4J7UA 5E1OA 3ZHTA 4M9UA 2XR1A 1K7EB 3UXEA 2QU8A 3EY4A 1B8PA 3SJ7A 1DEHA 4I9GA 3WDKA 2QVCA 4JQOA 2V74B 1H6BA 4G5QA 4RACA 1IYZA 1KFKB 2GJ4A 3COSA 2D2XA 4BDTA 2QT1A 3T7CA 4RHYA 3BRCA 2HRRA 4II3A 2HGZA 2WF6A 4R8SA 5DBIA 5ENDA 2RGUA 1FDOA 1QF7A 3E5HA 4HQ6A 4BVBA 2A5JA 5HFJA 4DQUA 1OB5A 1Y1KE 2I7XA 3RABA 4PHTA 2AXNA 1DRJA 2YCBA 2QMOA 4MXDA 3N8GA 3LZDA 3FZYA 2VWGA 1N77A 2WJIA 3BWVA 5EA2A 2YNMA 1MGPA 1H2RS 3EXG2 1P6QA 3W2IA 3A6DA 5DTEA 4ZQGA 3B6IA 3W8RA 3KEQA 3E2MA 5I8ZA 4ETWA 4M0MA 4DDUA 2Z98A 4G1FA 1KHTA 1A71A 1Y5IA 1HETA 5EXSA 4CE6A 3QHQA 4ZZ1A 2I2CA 3EHEA 4ML3A 4QHSA 1KQPA 1S1CA 4I08A 3TL2A 5FPHA 3ZGYA 1JBKA 3MWYW 2HBRA 3QVWA 2G04A 2IZ0A 2PVSA 4P4SB 3T1QA 3V1YA 4DMLA 5JBIA 1G2QA 2RG7A 2JC3A 3LO5A 3UAGA 4IZIA 4IMJB 2ZK7A 3MBIA 1O57A 4Q4HA 4QBGB 5C7YA 2W70A 2AJTA 2X86A 2RGAA 2YHIA 4BFTA 2EP7A 4OIMA 4PLFA 1C7IA 5C1BA 2VQFB 1ZR2A 1COZA 2HH9A 5KC8A 4N7JA 4WCFC 2AX4A 4LSMA 4RPCA 3W5DA 5JQGB 3NONA 3T5AA 3VYRB 4F93B 1UZAA 3CW8X 3BE8A 1WD5A 2G4LA 2BHTA 1FP4B 1UPFA 1ZMTA 1FLNA 3MWJA 3AY7A 3L40A 4FBLA 3IR6A 4NU0A 2XE8A 3LF2A 3GCZA 3L8EA 4KLNA 4MVJF 4O4HA 4G5FA 4RMIA 1A82A 4UEJA 5KNBH 1S2GA 1UP6A 1QZZA 2VJLA 4DMKA 2HRCA 4BFVA 3NNSA 2FCRA 1L4EA 2VF4X 2XE4A 4N3GA 2PD3A 4Y6OA 3UK7A 2G17A 4B6FA 3AVVA 3FWNA 3OQ1A 5B58C 3G0GA 2NM0A 3CUVA 5ALEA 1EH5A 1K0FA 4D9KA 4E5UA 1NRWA 2WUDA 4XQEA 2GAFA 3SQDA 3ZCUA 4JA0A 2QN1A 3CEJA 3I2IA 4DN6A 2RHOA 3HCCA 1QE0A 1PN3A 5FXMA 1E94E 3IO5A 2XUPA 1JEQA 1SBCA 4KDFA 3WBKA 2O07A 3DT8A 3ZHBA 5JS1A 2CL5A 3UCFA 2WRZA 4DSAA 3PC7A 1QIFA 3KR9A 1TGYA 1V5IA 3IDOA 1INLA 2ZYAA 1KK2A 4I0WB 4IIBA 3GLFE 2IVZA 4YAFA 1I9GA 4F1JA 1XCMA 3CZ5A 1JQJC 4TV8B 4D57A 3UKDA 2VL7A 3O47A 1Z6XA 3LWDA 4RK1A 1P19A 4AICA 5DHRA 1QX3A 2ID7A 3MERA 1E7WA 1I2AA 2UAGA 3NBZC 2ZJ8A 2IDKA 4GLJA 1WUHS 4Q7LA 3RE1A 3RRJA 2A1TS 4YUYA 2Z30A 1Z36A 1PR0A 4FYHA 3TW6A 1WV1A 1NGSA 2D8MA 1ML4A 2P7IA 1BMQA 2JAXA 1O4WA 3M6VA 5A5EA 2QXUA 3NHAA 3UCXA 4W5QA 1RHJA 2D0OB 5KCMA 5GZ3A 3TVDA 2YZ7A 3U26A 1B6SA 4Q6WA 1FXWF 2Q46A 4R8KA 1QVAA 4GMDA 3OMWA 1LV7A 1SXHA 3CKKA 5CGZA 3OT1B 4PBSA 1E6KA 2ZYIA 3ME5A 4XQ0A 5IUKC 4J9VA 3NWJA 3ZBUA 1XTSA 1BS9A 3RAFC 5IVKA 1YR3A 1ZCJA 3MQ2A 4K81B 4CUKA 5JWRA 2XT6A 1JXAA 4GKKB 2NU8B 4F45A 1YK1A 4ND3A 3C4QA 1G5FA 5A06A 1QHYA 1TU0A 1PG0A 3FBTA 3FKJA 1ISPA 4L6IA 3E03A 4HX5A 2GZHA 3H83A 4A8JC 1U6KA 1ZIYA 3I2JA 1E2NA 2ZZKA 3ZVNA 4ARIA 2QTHA 3TGLA 3TZHA 4G9GA 4IV0A 3M6XA 4WZAB 4Z9YA 4E32A 3DC2A 1KHHA 1C1DB 1TJ4A 4A23A 1NI3A 5KOHB 1TM5E 4F6RB 1NNSA 1JLMA 1NJ1A 1M3SA 2RFLA 3PVSA 4YRQA 4WEQA 3FOFC 4WH0A 3WRXA 2IV2X 4UNSA 4NCIA 2J9XB 3MCWA 3IURA 1XTBA 3L43A 1WUTA 3MUEA 4MV9A 3X1MA 3HADA 2IQIA 4KQCA 1XMSA 3KUKA 2V6IA 1EE1A 4L4XA 3RCBA 1JEOA 1UMKA 2O5RA 4Y2YA 3ZIUA 3GBSA 3H9GA 2Y1EA 4IX9A 3NNNA 3CX8A 3FTPA 2R87A 3I0MA 3FN4A 4C3OB 1FS5A 5EC8A 3GF4A 3O2SB 3NUQA 2QNIA 3NHFA 4X7RA 4UREA 1YKFA 4F5WA 4BU1A 2C2OA 4JL6A 4GX2A 1Z5WA 2Q6OA 2XNHA 2ZSAA 4LGCA 3K94A 4LNUA 4TLCA 2VKQA 1EK2A 3AF2A 4MA0A 4XIGS 3GRPA 4O4JF 2BRUC 1PGJA 3WGQA 1JDNA 4EW6A 2AYYA 1JLLB 1T9AA 1PJSA 1QGOA 1T8WA 3A28A 1G0OA 3BF7A 1CNFA 1O9HA 1FXUA 2WLSA 1T8YA 3M3HA 4U1RA 1ORDA 4S05A 2QNBA 3MFYA 2FUKA 1C7EA 2OV4A 1EGHA 3M5PA 4PSAA 4G0YA 5LL6P 3OMXA 1XDSA 1ECBA 2V6JA 3DAPA 4LTNA 2CVZA 2DOKA 2GMWA 4Z7OB 3JVIA 3CLUC 2FWJA 3LVRE 4PLYA 1FFHA 3AHJA 2ZZMA 1U4NA 4MZXA 4QYMA 5A9TA 1ZK3A 2ZJZA 5TPWA 5FA6A 3PTAA 4ZAGA 1VLHA 2QJTA 2YL2A 4EIWA 3KKEA 4JOBA 2EG9A 2ZETA 3ROFA 1RXWA 1PRYA 2VHEA 1EXWA 4JDPA 3PQ4A 2JLVA 3A14A 1ECJA 1KIFA 3R74A 2BC9A 1S2DA 3T8YA 1ZEMA 1T6NA 5CA1A 2QJFA 5JXGA 3GELA 3OFNA 1MDFA 3MGKA 1Y8QA 3DCIA 5KDLA 1DAGA 4AS1A 1QTQA 1Q1QA 1EK6A 3N76A 3DBHB 4U5QA 4WA8A 4ALKA 3JW8A 4EUFA 2JASA 1A0OA 2XZDA 1CUWA 1EP9A 3CZ4A 4TQUS 1UFRA 5BUSA 1C29B 4AF8A 3ZZTA 2JGRA 4C29A 2O8DA 2J0VA 2MTBA 1JPJA 1X6VA 2BP7A 3OZSA 1NL3A 2H85A 1ZZGA 1KMMA 2UZ1B 1SM4A 4HVAA 2PZLA 3CNEA 2AIRA 3C3MA 5I5EA 4CNBA 1A9TA 4EW3A 3VC7A 4BRSA 1MPTA 3HRHA 2E3JA 3GLKA 1DWOA 1QRTA 2ZITA 1BX3A 1XD9A 2AS0A 1MBZA 4CUJA 4D8UA 4LJYA 3BVPA 3L9XA 4RS3A 1EG7A 2YV4A 4MIYA 2ZRCA 5EZ5A 2BMWA 3AV0B 2ZRDA 1HFWA 5AJUA 2O3SA 4RDXA 3NDJA 4E11A 3HYSA 3OJFA 2W58A 4X1KB 1XCGB 4RDIA 1GRCA 1UUFA 1LDNA 1E5XA 1FUKA 2HQSA 3GFRA 5EGNA 1RAHA 4H1HA 1A95A 4UULA 4KXMA 5H68A 2P9GA 5A0FA 3RGGA 2ZS9A 4M0LA 5HMMA 1DTWA 1PEAA 3DMGA 3EIHA 4IQFA 2VTEA 3HVIA 5CURA 5TQVA 1N8TA 5BRAA 1FCJA 5JS6A 4LZLA 3WKBA 1JJBA 1JJ7A 4CU5A 1I1OA 1W52X 2PFGA 1Z4LA 2A1UA 4P4GA 2DMRA 2G1JA 3FR7A 1K75A 2ATIA 1C7QA 3SQMA 3JQ9A 5LQUA 3OFVA 4Z4EA 2UUOA 4ZKDA 4A36A 5M29A 1DQZA 3V8QA 4LKRA 4LJ4A 4FXPA 3R9IA 3HN7A 3AM3A 3U48A 4O0LA 4UFPA 3KE9A 3GFVA 2O7RA 4LQ4A 1K8XB 4DV3B 1H8ED 1KK0A 3E3NA 1G0NA 3I1FA 3TLMA 4PNZA 1PFYA 1ESCA 1P1RA 1N6OA 1QHHA 2NO5A 2UZAA 1GVHA 2HMTA 1L7OA 4U9HS 3SQNA 4DDTA 5I3ZA 1ULZA 4I9NA 4YEDA 2ZCUA 2RKWA 3Q15C 5H16A 4LJ7A 4LC0A 1LC0A 3UT6A 4HNAB 4F3TA 3BWMA 5HTOA 3D3NA 4Q19A 3BK1A 5KREA 4QJ4A 3NWPA 2OV3A 3SM3A 4UUMA 3C3BA 1AHPA 2XKBA 2HNAA 1K2WA 3JPWA 1L4MA 3QE3A 4ON9A 2MJLA 4ES6A 4ZVKA 1J2RA 1WPQA 2JH3A 1V7QA 3AL3A 4TS3A 1LLQA 1CZKA 1EFRD 5M7EA 1KP9A 5F98A 5A2GA 4ZRDA 2GA8A 1B0ZA 5CB0A 4I46A 3DFZA 1DPFA 2CV0A 3DEYX 3B6JA 1PT6A 1U1CA 1PS8A 5CLQA 1Q2XA 3U81A 3K16A 1N5OX 1PCXA 3MQFA 3ZWMA 1ZH2A 3NTQA 3FYUC 3QTLA 3FYSA 3MELA 4BRZA 1M54A 4F4UA 1AV7A 1G8PA 3RU2A 3ZE9A 1Q7EA 1BXRB 2R11A 1JG3A 1GN8A 1TT5A 2QVGA 3E9RA 3QJYA 1MJGM 4DA4A 5F3WB 1MJFA 2V8BA 2AXEA 4TWRA 3WLSA 1JEJA 4OJMX 4WZAA 3H3JA 1H2AS 1P2FA 2E48A 5ETJA 2CXHA 4AMZA 1KC3A 1P39A 2NTEA 2ZBQA 3GBVA 2B99A 2XI4A 3H5AA 3MS7A 3Q7RA 4FYKA 1YE5A 4LZWA 4UAUA 5JAQA 1R4ZA 3OC0A 2FW7A 4JH0A 1SVNA 1YZYA 1BU8A 2XB8A 3KHKA 4PLVA 4HAVA 2FTKE 3TEMA 1KYXA 4FOLA 1PT5A 2HMWA 2P5UA 3MJDA 4MZDA 4OEHA 5A5FA 3H1GA 1SN7A 1HG1A 3AIKA 1XYVA 3LZCA 2J5KA 4PNHA 3CKMA 1XNJA 4XARA 5LUBA 3WKEA 4MYHA 4LISA 2Y1FA 2ZJ0A 4GE3A 1ODLA 1NOJA 1Z4QA 4H08A 4DB2A 2OXFA 3DCNA 3AYXB 3ZZNA 4E7PA 2HU7A 1FRFS 4F3YA 1QK3A 1K0UA 2ZJ4A 2FW1A 3PFKA 2VZLA 3DLTA 5AJYA 4QYTA 4C0KA 4QICA 5IABA 1V6SA 1FX0B 3AHEA 3E9MA 3U17A 2WM8A 4KAFA 3C1TA 4R16A 4HUQA 4I50B 5JTUA 3V8MA 4RY0A 3K0SA 4AP9A 2B30A 2I6SA 1XMIA 3KETA 1Z5PA 1RHMA 4U2KA 3M8KA 3EIXA 1MUUA 2OV6A 2PV0A 2VO1A 3C4JA 3ON5A 1ZINA 2WTXA 2RKOA 4KQ1A 3RC1A 2DFKB 3BH6A 1TAGA 3CUUA 5E9QA 3P0RA 1EIZA 3IAS6 3SICE 4DS3A 1VXRA 2BDUA 1ZOIA 2NPIA 3JQAD 4ESEA 5BVGA 2FOXA 1E1QA 3GA0A 4HQFA 4MLCA 2F8TA 1QANA 3MCZA 5G2OA 1CX9B 3NPMA 4IO1A 3SIWA 2QD2A 3PEUA 4KXQA 4OG2A 2I1LA 2P1DA 4H9GA 1XHEA 1RFLA 3L8YA 4MR8B 4O25A 3B6KA 4DL9A 1J5PA 2A5LA 1NBMD 1WSWA 2OCDA 3WNZA 3ZWPA 3KLMX 2I99A 2KM1A 1FFXA 2HSWA 3NEYA 4X41A 3STUA 1HKHA 3PDIA 2E85A 1I4TD 1GHTA 3H11A 1PTJC 3QYAA 3S2YA 3VPDA 4KREA 1Z73A 3VYSB 2JI6A 2HC9A 4XJTA 4FYIA 4PTYA 4X66B 4OVKA 3BRQA 3LUKA 1PK9A 4TTRA 3T5DA 2DQZA 2RHHA 5BOSA 3EXHA 4JN6B 1IUKA 1JF8A 2BFNA 3G0HA 2MDTA 4KN6A 4QQ8A 2YS7A 4IZ6A 2AFRA 1MFZA 1WCYA 4IAOA 3NWBA 1M0WA 5FUVA 4FN4A 4YT8A 3OTOB 3JZIA 3F6CA 4PONA 2REOA 4JELA 5KVCA 3B78A 5E6RB 1TZMA 4C0JA 5JDIA 4UQLA 3HCDA 5COBA 4CI0B 1V25A 2VTKA 2ZW9A 4FLFA 3IP5A 4KFSA 4K9SA 1FTSA 3FMGA 3DO6A 4NRDA 1HM5A 1ISIA 1GFIA 2DFTA 4NZYA 3QX9A 1G5QA 4XJXA 2V0GA 5HP4A 4W1PA 2P2GA 5EHXA 3OQPA 1YJAA 3OZBA 5L3ZA 1XCBA 2VUSA 1NQOA 1ONNA 4WLVA 3OKAA 1JU4A 3ELDA 3HN2A 2C3OA 4GRDA 4BECA 2PA3A 4J1TC 2AOXA 4F21A 5CR9A 4GUAA 5J9FA 5CB8A 3BZWA 2FH5B 5LLTA 3OIDA 3T1VA 1BNCA 3I52A 2ZIVB 2GPYA 2DTDA 1XWWA 3BCSA 5JBNA 2LDXA 4F38A 3QX8A 1NLMA 4ZO6A 4TWJA 1WSBA 2VPZA 1KDYA 4RVCA 1TQ6A 1ND6A 2R6R1 2O2EA 1CD5A 1IHUA 1NVGA 2W2NA 4TWIA 4Y3UA 1RAFA 5EMMA 3WQHA 3SM9A 2E1RA 2ZWPA 3LYLA 4FFWA 4EGAA 4AJNA 1VCIA 2BKXA 2XWQA 4WKGA 3EMBA 1T5LA 2CUNA 3EZFA 1RD4A 5SYNA 4X91A 1PUJA 3JRXA 1NVMB 1ICEA 3TRKA 3W34A 3U6KA 3K9LA 3N0VA 1P8AA 3RV3A 4ZEMA 3FPSA 1ADFA 3LFUA 3QW2A 5JOQA 2QYTA 5HYVA 3BMXA 4BN0A 4EENA 1IU9A 2HJWA 1Z5NA 1FVXA 4D9BA 1HLFA 3L18A 4OJKA 1LZLA 2GM3A 1BJRE 4PLZA 1Q20A 3K15A 4AT1A 2IYFA 2X7HA 5BR7A 2IYLD 5B2EA 1N9ZA 1YO6A 4RFSB 4MW6A 1H8HA 5B1DA 5KTTA 1PJRA 2JAWA 2J6CA 4I5EA 2R96A 3I9KA 3ZU2A 4Z2YA 4HK4A 2VYQA 1ENZA 4LG1A 2C8KA 1U2PA 1XALA 4HKTA 4HNVA 4I19A 1C0EA 1EGVB 1WMDA 1ZUD1 3AV3A 3E1GA 3R44A 3BD6A 3USCS 4DR1B 2C58A 3RSQA 2F55A 1TEHA 2WA1A 3CUKA 2IP1A 3DE4X 4PGFA 4KYUA 2ZXUA 3MTAA 3D8UA 4MCAA 3ND8A 1HNNA 2JGEA 4IH9A 1WBDA 4QTUB 1D3AA 3AZOA 3GLTA 1NQVA 3OX4A 2C00A 3PGXA 4OQXA 2O23A 4PW0A 3RTAA 4IXNA 5LQAA 1GRNA 1PT9A 2FXVA 4DEVA 5M2QA 4I1PA 1F8FA 4G0VA 1FDTA 1XEWX 3GXBA 2H57A 3I12A 3GT7A 3G0BA 4EYGA 5C8YB 4TXMA 2I2FA 3L82B 3MRXA 3OQOA 4CTOA 5JHGB 2O8CA 2IODA 1BXZA 2IDZA 2NACA 1G21B 3L05A 4B3JA 2WTMA 3IEIA 1XQ9A 4JBLA 3RJMA 3TXXA 6ABPA 2MWMA 3SZRA 2YV1A 4DSTA 1KEUA 2EP8A 3SX4A 1PLLA 1TQHA 3HEBA 3EZYA 4YS6A 5J23A 4YJGA 3D7MA 1DC8A 1E5LA 4D6YA 4U7WA 4H60A 3RVMA 1MFPA 1MO5A 4RF4A 1ISJA 3FZEA 3RVNA 2EQBA 2A6PA 2IHTA 3VR3D 5JZMA 2BJHA 3GAMA 1L1FA 4Z3DA 3ZQ6A 1EM6A 2IYPA 2P3LA 2X23A 1PJBA 4ECEA 1F7VA 4PC7A 1ODCA 5LMCA 1OXKB 4BV2A 2F3TA 4YUWA 2FPPA 5LA6B 2ZE6A 4ENUA 1B76A 2G9VA 3ACBA 3EVNA 1SC1A 4LF5B 1NF9A 1IOVA 2VSXA 3G9TA 1IOWA 4GPTA 1FNBA 4WNIA 3SC2B 3V00A 2PX0A 2Y92A 4F9GA 1L9XA 2J45A 3ZZ1A 1UADA 3JAMA 1ZS9A 2CYCA 3KJXA 1Y6RA 1UK6A 4BV3A 5FO1A 4WY8A 2WWYA 4DB4A 4MB2A 1E2KA 3GAAA 4KRYA 4ECAA 5ALJA 2HA4A 3K9QO 4IQ8A 4BQFA 5BRJA 4KUGA 2HO4A 4ZQIA 3DNFA 5JU6A 1NHGA 4ITVA 4RTKA 4CQNA 3DAYA 4EOGA 5IC6A 4YP6A 4R98A 5K99A 2PUDA 1CCWA 3FNQA 5HF6A 4KOEC 1FFDA 1OYYA 1A9QA 1Q17A 2BBSA 5KYVA 3C3CA 2JZCA 5EE3A 5LQNA 3JAKA 3VU0A 1SHJA 2HADA 2RIRA 1LZKA 3HWX1 4ZODA 2XYGA 1QHIA 3SQXA 4EGCB 3CF6R 2HSZA 2GVDC 1D6JA 1QHFA 4FONA 5I9TA 3BE6A 1BW9B 5BW8A 2J67A 5J3JA 2GCOB 2G5GX 3NNDA 4OSPA 1T29A 5JLJA 1NXWA 5B4UA 5ILQA 1NVUQ 3BERA 4EFMA 1GZVA 4P54A 2VP6A 2VF2A 4IG4A 4UOQA 2WHRA 4KSYA 3LDAA 3R6WA 4FINA 4HWSA 4KO2S 3IR7A 2QYHA 3H5OA 2ZP1A 1EB8A 2B8EA 4X9XA 4HNQA 3S8MA 3U0VA 2XY4A 5FAKA 4BGVA 2JPDA 5JAPA 1KIMA 3JQGA 1FSSA 3ORSA 1SUWA 4NJMA 2Y1XA 5I9MA 5JPCA 1J70A 4D3XA 3R3VA 1WUYA 3EN0A 5B1SA 2GJKA 1U8ZA 2OFFA 3ZY4A 2QRLA 3C87A 1EHYA 1LPNA 2XD9A 3G59A 4O33A 1Y81A 2QPAA 4UTXA 3M4NA 5DF1A 5DSZA 1CV2A 2CFOA 3A0RB 3GNTA 4AWAA 4U39A 4EKYA 2PGAA 2ZBVA 4I6JA 2C0QA 1SVIA 4RJ2A 5AD1A 2AR0A 4CLRB 1DIBA 2DLDA 2CE2X 2Z2ZA 3AOGA 4IO0A 5ARCA 1JFTA 5GGXA 3S7ZA 1NRIA 3AUTA 3A1FA 4PZUA 3ZTYA 4LDRA 4G0NA 2FZCA 5ALLA 2DFPA 1DELA 2B4RO 3CG4A 3VTZA 2PMWB 3I2KA 4FEEA 1DKOA 3KR1A 3GMTA 4OQEA 1DBRA 4MJXA 4XSHA 1UBLS 1Y3BE 1B74A 1O2DA 2WWIA 3C85A 3PF8A 3QVGA 5LP6C 3IEUA 3W5VA 2CSUA 4UHEA 1JFFA 1ODJA 3FUVA 2N9UA 3EFOB 2NZJA 2KSQA 2GPTA 3RNOA 5K51A 3IJ5A 3THWB 1FNMA 2R8ZA 2IXGA 4XQCA 1IAQA 2GN4A 2NVWA 4DLWA 4H4DA 4HD8A 3TG2A 2R44A 4OHBA 1XAGA 3DOEA 3U4CA 4TTVA 4A0QA 2ZG6A 1ESZA 2GEJA 4TTTS 2LPMA 4YRBA 3VZQA 1R5NA 2ZIXB 4UUAA 1P2GA 4KIGA 1JIIA 4UE2A 3FNIA 3EDYA 3PNKA 4PAGA 3GN2A 4MUAA 4DLKA 2ODEA 3V9PA 4EHHA 3QE4A 3W04A 1GGVA 1GQSA 2D3TA 4C0AC 1O6FA 1PX0A 1HLGA 4N6NA 3BZUA 5LQDA 2I78A 1H6AA 1C3XA 3H9CA 3WLTA 3R7LA 3LKVA 4Q1EA 5DYTA 2R5FA 4EB8A 3ITDA 4YJ2F 3U3KA 2KJQA 4HLCA 3OZCA 3VC3A 2UYHA 4L4YA 1JQDA 3TRHA 3C45A 3CVUA 3GT3A 2EKDA 3FGOA 3IUQA 5LU8A 4XA8A 2NZ8A 5J59A 3IUPA 2Z3VA 2D4AA 1PGPA 1PL6A 2JFVA 2X2FA 1V8ZA 1WV0A 3B5IA 2ZYWX 4JMLA 4PM4A 3ZV3A 2YDXA 1UH5A 1CQIB 4PYNA 2BAGA 1CB0A 2G3YA 2JLAA 1NI4A 2CFRA 4OK5A 4KNVA 4D43A 1HURA 3EPLA 1TTQB 3F5DA 1U7XA 2XTJA 4EFDA 1LF0A 4DC1A 1OYOA 1XYGA 3WDMA 4GMKA 2PH5A 3MIZA 1MJHA 5EQTA 4Q1DA 3FKSA 3TN7A 4D99A 3W6PA 3PENA 5EIXA 3SDZA 1GUDA 2R6DA 4RY2A 1W1UA 3NM6B 4KFRA 3DEIA 4LJ8A 2OCGA 1RS0A 4M1EA 3CNQS 4D26A 2A9RA 3OI7A 4EP1A 3TNFA 3JYLA 5EIEA 1KOJA 1OFUA 1YBVA 8AT1A 3RYFA 4CTMA 3GUHA 4DARA 4FC6A 1JU9A 1USKA 3AOEA 3B38A 5CDGA 4QDOA 4XPZA 1DFIA 1CERA 2AJCA 1WDLA 1T0UA 3CT6A 1M83A 1IB6A 2BEJA 4MPTA 4ZZ0A 1T9CA 2YHBA 2I22A 3LT5A 3MWDA 2OK7A 4BNJA 2Y1LA 2ZGVA 1Y3IA 4XOUA 4E5MA 3VOAA 5CM9C 1DJNA 5FOSA 4UBJA 1IDOA 4HNTA 1WW8A 2WG0A 1ADYA 2VF7A 5ADWA 1DOAA 2ILVA 1UXJA 3AJAA 4PYLA 1TYBE 1UPTA 4REQA 4ZVPA 3MBKA 4HEJA 1CG6A 1YJQA 2VXCA 3KJHA 4B2YA 3H1EA 2XLBA 2VTBA 2IUFA 1M75A 3AB8A 3Q3GE 4CM3A 3OWXA 4FFBA 1JSCA 3VDRA 2B1IA 1I7LA 1TO6A 4ZDIA 2XF8A 3F71A 2XTZA 1MZVA 1X86B 1I3MA 3GZ4A 4OP2A 4ZQHA 3C6YA 1DUSA 1JKIA 1H4TA 1KJNA 4H7JA 1IPFA 2A9FA 2OM2A 1T43A 4ZQBA 2RCNA 4MKGA 4WBNB 1KYWA 2P9YA 2I4NA 1YDGA 4MVJG 4NHEA 4B9EA 3CIOA 4I14A 3QUBA 2ZT7A 3OJLA 3SGLA 2QXTA 2RB5A 5IW8A 3U2QA 5IDQA 1JEDA 1IWOA 3ABIA 1R6VA 2XMSA 1RPNA 4MULA 4RE6A 5HRCA 4RTPA 3WXMA 5BSKA 3TTUA 4C5BA 1QYDA 2P9ZA 1M1YE 2V97A 1YI1A 3AETA 1QIEA 2YWJA 4NEQA 4RH3A 1HMPA 1L8XA 1IXZA 1KJJA 1XA0A 3D8HA 3BXHA 1R0WA 4W5NA 3TM5A 4DQXA 3OIGA 3E5RA 1SCJA 3DQQA 1IZ0A 3PX2A 1VHWA 1P2SA 2RBEA 1AKTA 2OWDA 3V4VB 3VYTB 1GDHA 4DGSA 4F4CA 2QW8A 2I66A 1TA9A 2MHCA 5ICGA 3EUFA 3QQPA 1GUZA 3TMYA 4ZI2A 3A1EA 4DLYA 3U4MA 2QZPA 4NCAA 1OTHA 3HWWA 1BE0A 5LUAA 4IY1A 2PSDA 3A4IA 3FTCA 3WB1A 1X38A 4Q3DA 3KKOA 3P19A 1DOHA 1VJGA 4JA2A 4AK9A 1K3FA 4PLWA 3LO8A 2BI4A 1PQPA 4HXEB 4J0JA 3VSDA 1LS6A 4JFAA 3G49A 2DFNA 4KSCA 4AY4A 4BUZA 2GBIA 1B6RA 1XXHA 2IBMA 4I5FA 1NRXA 3DDOA 1CK4A 3EQ2A 3QVSA 4KFUA 2FPMA 1Y1SA 2Q6TA 2BE7A 3P9YA 4UJ5A 3TOSA 3ZLUA 1E4YA 4AJ4A 3SE7A 4F11A 5K0SA 2XCRB 3D4LA 1QV7A 1T8PA 3DBVO 4KKVA 4EY3A 4NJEA 2Z2KA 3FR8A 5L51A 5D7NA 3CWQA 4LJLA 1W30A 1R66A 1W34A 4IDPA 5DOVA 2NVUB 4WOKA 1JPNA 3FI9A 3TBKA 4E46A 4ETMA 1DTSA 1D07A 2D1RA 2DSNA 2EWVA 3QU9A 4J90A 2X58A 2QM8A 5BQOA 1Z2EA 3TGWA 2JDID 2YIJA 4GR9A 3ZWCA 1Z47A 3OMLA 3PNPA 3UHFA 2F64A 4E6EA 4TUYA 1T3HA 1TW3A 3PC6A 2Z8YA 1SQ5A 1HDCA 4JP5A 4Y2SA 3THOA 1VSVA 2Q3BA 3ZK8A 3S44A 4TL7A 2RAFA 2AMYA 3GFFA 5KSPA 4A6DA 2QNRA 3WB2A 1AKUA 4DREA 3E2PA 5CLIA 5JNUA 1SD5A 5FB3A 4JC8A 3RUIA 1LX7A 3WYFA 2F2TA 5BXYA 4ILKA 2XUAA 2K5UA 2C5HA 1IRIA 3MK31 4OKNA 4UNNA 1CIPA 2XBLA 5TEWA 5KNDA 1G16A 5CU7A 4L9WA 3G2LA 4JGIA 2DR0A 4TRJA 4P31A 5F12A 4FT4A 4ENPA 1E6EA 5G53C 3CS3A 2IP4A 3O5AA 4B17A 4CMBA 1Z4MA 3H7IA 1P0FA 2CC2A 1YDEA 3O2QB 1JZQA 4G9BA 1NY5A 2WA2A 3TRJA 1UBTS 4BX0A 2OAGA 4MJ3A 2IZZA 1UXHA 3OT1A 1VCMA 4CCYA 3GJ5A 3JQBC 3TIIA 4L0QA 2D00A 1WZUA 1S3IA 2HNBA 1KEKA 4JD5A 4BBAA 4QT4A 1YVPA 1HQDA 1EFUA 2WWRA 4UD2A 1AKEA 5DULA 3RVBA 4BEJA 2PE5A 3B7GA 2B8NA 1UIMA 4GE0A 1YULA 2CMFA 1P45A 1KC1A 3I4CA 3QBJA 5F7OA 1D2GA 3N86A 2OGWA 1UIRA 3QGMA 4S12A 5JS2A 1M8PA 1XD2B 2V1XA 2WILA 4QREA 1NC1A 2BZ1A 2R7NA 4RGQA 4BMPB 5ARBA 3DMPA 2MSNA 4Z2AA 4HNGA 1U3FA 2IU3A 1NJSA 3GDWA 1L3BA 3RUDA 2LKCA 3TQFA 3GD5A 1VA5A 5ALDA 4S3MA 1NUUA 3A1NA 1RC0A 4LDAA 1T5BA 5T64A 2XGGA 3IT1A 3OJEA 5E9WA 2FEXA 4CMEA 2AFVA 5KQLA 4IW3B 1CR4A 4WBNA 1JA1A 1GZ3A 1A77A 5F77A 5MGBA 5A4JA 2IEIA 4XYBA 2EHDA 1SQFA 4J1SA 1KQNA 1HZZA 2H4JA 2JL1A 3VDXA 3ZD8A 3CVJA 3CY6A 3BMNB 1N2XA 4B76A 1E3LA 3A27A 3MT0A 3REFA 1EQ2A 4DABA 4LZZA 1NONA 1RKXA 1SRQA 1WWKA 3L7IA 3PLNA 3QFCA 5J5AA 1S8OA 3NHSA 1BX1A 3G9UA 3L9WA 1Z2PX 5DTIA 3RHFA 1RYYA 2A9QA 3GFQA 1Y4ZA 1N6PA 3T9BA 3WDLA 3WAJA 3H99A 5JJIA 3WO0A 1EFTA 3UG7A 5FPSA 1AZSC 2FMFA 5TQ0B 2X3UA 1VECA 3ZY3A 4P22A 1DQYA 3IBTA 1V3VA 1BFUA 1ECPA 3HUDA 4XE5A 1P6XA 1JVNA 1UMBB 1U2ZA 1UM9B 3DL2A 4MJ7A 3BJEA 3RS5A 2NZWA 3LC1O 1HNWB 2QLJA 5GVRA 4YUXA 10MHA 1LRJA 4L22A 1RCUA 1C0KA 2R6JA 4IOJA 2Y0PA 2GM5A 4EPWA 3RYFB 4FEYA 2CHGA 3PRHA 5FPPA 2B5OA 2PL1A 2YDYA 4H35A 1BSVA 4YRDA 1HYHA 2QQ5A 3IQFA 4C4PA 3SVTA 1O6GA 2IBTA 1E1RA 2BLLA 3NHUA 4JP1A 3NZEA 5LXTA 4EI9A 4JSTA 2ZUDA 4N82A 3FMOB 5LB2A 4YT2A 3VO1A 5IHPA 5JRJA 4GZ6A 4X7BA 3WHLA 2QQ0A 2ZYSA 4RXMA 1CJBA 3EG9A 2WIJA 4E08A 2HUNA 2P4HX 3AJRA 3PCTA 3HCPA 1UZMA 2QORA 4IGAA 5A4KA 5HE9A 1H2WA 1YQUA 4GI7A 4RPGA 5COAA 1RAEA 1D2HA 2PX8A 3KD2A 3Q11A 2ZVPX 3E0QA 5EIHA 4W7SA 2PSEA 5LZ8A 3Q88A 4Q3AA 3KX2A 3UAYA 2MIIA 2D59A 4CL8A 2PKCA 4Q18A 2QTVB 4S2EA 4Q4CA 1A72A 1JEYB 2FNAA 3IRVA 5J2TF 2CXPA 3HJFA 3SPXA 3H5RA 3QELB 4QDXA 3JYHA 4A5OA 4RY8A 5K8CA 1A4RA 2HMVA 4YP5A 5LQMA 2CJWB 3IE0A 3SFVA 1RWNA 1ZJZA 3PQ5A 2FHSA 3DV0A 5C3UA 4X90A 3IMGA 4NBWA 4FQ7A 5CVTA 3PRJA 1L0BA 1MC1A 1NVEA 1WB4A 2VSQA 5KOJA 3U16A 3ZV4A 5FP0A 1FQWA 1JS1X 1K6JA 5BUZA 4YXWA 3MEQA 2F7SA 1KAGA 4RMHA 4LOAA 4DLNA 4O08A 1SUFA 3N7AA 1UPAA 5HX7A 3IQXA 4MA4A 4QOEA 4DHWA 4YMHA 1ZN9A 4M1WA 2OZLA 4M7RA 4PIPA 2E9SA 3WZLA 1UQTA 3V2UA 3X1JA 4ARSA 1QS0B 2XAUA 1Q57A 3ACCA 3VUEA 5HUHA 1EWTA 3GMSA 3IV6A 4LGMA 4GC5A 5AI8A 5T8KC 5CJ2A 1MVLA 2DPMA 4KV7A 1NAIA 4DOMA 2FF5A 3GVIA 4DR2B 2QL5A 1C7FA 1YOBA 4RZHA 4OOFA 2RGNC 3M6IA 3QU5A 4NQZA 4JUAA 3P9KA 4DPMA 3OQMA 3ES9A 2NU7A 3H2IA 4M99A 3FNRA 4RA9B 5L53A 2FKAA 2DBRA 3NYWA 1VIVA 5CMLA 1ZHFA 2XGMA 5FI0B 3FMPB 1KS9A 4NFSA 5A9RA 4H6PA 3LRPA 3U62A 4DLXA 5JEEA 2OFPA 3KU4A 3I5UA 4OQDA 4D1YA 3B1ZA 2IEDA 4R7ZA 4PANA 1L8AA 4EARA 3LFHA 1QB7A 4KR9A 1J2UA 1SY7A 2C07A 3AUXA 4W99A 5K6TA 3NHRA 4EWLA 1MB3A 2ORYA 3NIBA 4H6WA 2WHPB 1C8VB 4BKRA 5JECA 2GDZA 5FWYB 1JIUA 1K3UB 1IC6A 1U7ZA 1BN6A 3IDSA 3LDHA 4IHJA 4QEDA 3VKWA 2Q2NA 1D5WA 5DHQA 1VZ3A 2QRJA 3TQOA 4A2QA 1P5HA 3L0OA 1WTAA 5H4HA 4DVGA 4ZCTA 2QENA 3L01A 1U5BB 1ZR4A 1P1CA 4YMVA 4KUHA 2EFJA 4DMUB 3JAWB 4I4IA 1U2GA 4NX2A 1GR1A 3BK2A 3HR7A 3H2KA 1L5KA 3QIVA 3GOQA 4EMSA 5M04A 4YY3B 4LWPA 4YCMA 1FFEA 2V3WA 2BKVA 3WA7A 1J42A 2OD7A 1JH9A 2NG1A 4KNYA 3UY4A 4C0BA 5ALIA 4JHXA 3ZI7A 3G7NA 2R7AA 3CN9A 2GTIA 1D7OA 2CBGA 5EJMA 2BONA 2I6GA 1C41A 2ZUTA 4C22A 2G83A 4KPEC 4D9JA 2W2PA 2VSYA 3GK3A 3KZKA 1N92A 1TF5A 2VRCD 4FHZA 5BW4A 5KTOA 1JE1A 2CLOB 3RU3A 1PYOA 4LV6A 1T6BY 2V7BA 4IH4A 3SLGA 5A4DA 3F5MA 4Q1VA 1DT3A 1O96A 3GZTB 1KZHA 3VC2A 3GX1A 4OI4A 4QFMA 3ZDBA 4A6XA 4YMGA 2W2OA 2WEKA 4QBHA 2K7FA 4E6PA 1YJ5A 2OOSA 3K1ZA 4JUFA 2WAXA 1Y9AA 1XRJA 2BBTA 2O4UX 1PJ4A 3HB1A 3BKXA 1WDTA 4BO9A 2WWVD 3Q1LA 2XECA 3VJRA 5JH7A 1A4UA 1XRRA 2PMKA 2F1IA 3MS4A 3HJAA 2EJUA 3BJZA 4UAJA 4IQ4A 1FTNA 5E6UB 2RJOA 1JVBA 4MR9A 2XAAA 2PX4A 2D7DA 4RJKA 4Y9DA 3AVWA 4QHYA 2YWBA 1Q16A 2NVUA 2VBIA 3FROA 4IDCA 3KXKA 2HQBA 1E5QA 2W8BB 3QYPA 2Q2OA 1KBZA 1N5JA 1MRZA 1Y4SA 3QM1A 3U4QB 2JCGA 3AR7A 4JJAA 4OLHA 1BHQ1 1TQDA 4LYFA 4JVSB 1OGYA 1CR0A 4ZZ2A 3JARB 3T3NA 1HDOA 1XXHB 2H1RA 1TA4A 3U13A 3UAVA 1VI6A 3F4BA 2WSSA 3K1AA 1F3OA 1K7CA 1UEXC 3GNQA 1ZUIA 1G20B 2PGIA 3VH3A 4C1BA 4JQSA 2EGHA 1T4CA 4G1CA 5LFAA 3C1AA 4QTYA 3FZNA 2AYZA 4B7XA 1P80A 1WU7A 1ZG3A 4HVLA 3GLFB 5FL3A 1AUQA 4UEWA 2JDIA 5EYPB 3S2EA 3FIJA 3X1ZA 2AOVA 2V7GA 1U9YA 2YYSA 3EZ9A 3F78A 3BN3A 3KK0A 3L8ZA 3O74A 5DYYA 2PYDA 4FCTA 1Z5ZA 1QUEA 4EPYA 4EY6A 3S8YA 2Q7XA 1UDAA 4OUDB 3H04A 1GQYA 2B8WA 1N1DA 4FBGA 4LJSA 4RNDB 2CCJA 1L5YA 4ZDWA 3M3DA 1GPUA 4BO4A 1ZNZA 4KH1A 3T15A 4B2PA 1Y34E 1T9BA 4LW8A 2I3AA 1YZVA 2B1GA 3RODA 1ONPA 1T5TA 3ITNA 4NYMQ 2C2HA 4HLQB 3TW4A 2BFBA 2IH5A 2G80A 5DX0A 1OBCA 1PFGA 4IQ0A 4J0DA 4TM7A 3IL2A 2P9FA 4BMNA 1E79A 1EEHA 1XJ0A 3ENWA 4HYYA 4ITRC 2HFJA 2RONA 1J0XO 5CTJA 3I09A 2O0KA 4Q5IA 3U7QA 4BVGA 1KI2A 3DKVA 4FB5A 4XJVA 4RANA 2R25B 4M38A 1DAHA 2ETVA 5FBLB 3UF0A 3S1AB 2FZ4A 2REQA 2Q8PA 1CLUA 1Y48E 2OD2A 3N5CA 3HCWA 3MD9A 4HEA1 3BSWA 4RGBA 4YA6A 7ADHA 5KQSA 2ZUWA 3OCCA 1VG9B 4F96A 4UMVA 5IBQA 1EDOA 5JXHA 3PPWA 5G41A 1CJUC 2C9YA 1TIPA 4FZRA 4PX5A 4LGYA 4ZT5A 3EW7A 5DN6D 1SUEA 1IDN1 3O31A 1N6RA 3N07A 1TIBA 2W6MA 2YV2A 4G8CA 2W48A 3I28A 4UAGA 4R01A 2FPWA 3DTVB 5HKKA 1E9BA 3RVKA 1JHVA 1C30A 3KO8A 5JCPA 3QELA 4IQGA 4ZHSA 1V1MB 4E3ZA 4PGHA 1MV8A 1Q1GA 2J6BA 3OCJA 3Q9LA 5EIFA 1G8JA 1J21A 4PS1A 1PJ2A 1XDBA 2OFWA 4MI3A 2FEMA 1L5OA 5ICFA 2GTPA 1H94A 1AGPA 2WWHA 2Y99A 3X1WA 1TKCA 3HZRA 1DXQA 2WF7A 3CKLA 1SKYB 3OZIA 1QQAA 5E2AA 1G17A 1QNFA 5JT1A 5G0TA 1IE3A 1LI4A 2LXNA 1JXQA 1OPRA 3EG9B 3LJKA 1AOXA 2XITA 3Q7TA 3UXHA 1UMDA 2OKGA 3OOSA 2RGCA 2VT2A 1K7SN 4BKMA 3ZW8A 4BNFA 1A98A 1V71A 3AVQA 3X1KA 1T5SA 1XLTA 4F4DA 4L9AA 5KNCA 1GSOA 4CEHA 4YI3A 2QXYA 3B1VA 3FNGA 4RSRA 1MIOB 2YFQA 2QAIA 1T91A 2VP4A 3L4BC 4DCTA 3PDCA 1S02A 3D7SA 5KTSA 2AJ8A 2QIOA 2I80A 4WOBA 4YAGA 5ELXA 1KAOA 3AR2A 1NVXQ 1NG9A 4HDQB 3RF7A 2NPFA 1C4WA 1S4MA 2R00C 2XGOA 2D5CA 4O4LF 2IH4A 1G21E 1E7SA 5E6RA 4WK0B 3A1WA 1VP9A 2QF7A 5CFMA 3DKRA 3OFKA 1FPMA 1E3IA 1NV9A 3I6ZA 1PZMA 5B7NA 1CUFA 1YMQA 2GFIA 4RMJA 1P4SA 1JQBA 2QLNA 3FRJA 1HMYA 2CB9A 1NBOA 2GUGA 2VWPA 2IF2A 4R4JA 4Q15A 5B1IA 4FJ0A 3UJ7A 1QU2A 1RTKA 3RRXA 3SWWA 1CUIA 1VL1A 1SQSA 2RI0A 1ZVKA 1US8B 4GOOD 4OQLA 4YRPA 4CIAA 1XU9A 2EEPA 2H52A 4FQ8A 3U31A 3TWOA 4AY3A 1H65A 1ZJ4A 5B5SA 1CIJA 1D6NA 2ENUA 2FR1A 3S1AA 2W6ZA 3EH2A 3FRIA 3O7MA 4GMXA 3LK7A 5EVJA 3NTVA 3U3DA 821PA 1HZZC 4QGHA 2FP3A 4IIVA 3FOZA 1H0SA 2GTHA 2E4UA 4B4OA 1DIAA 5EMKA 2WNIA 1DHRA 1B0AA 1NQUA 2ECQA 3VR1A 1N57A 5TMEA 4MI1A 3IPLA 1YFLA 3Q8KA 5BXQC 1RWWA 3R3UA 2LWIA 3MWLA 4BNYA 3VR5H 1VL5A 4Q24A 4XD2A 3ITEA 2XB4A 1V4NA 1P7PA 2I4MA 4W5JA 3WP1B 3ABOB 4TRMA 3THWA 2CCGA 3H4MA 2IGBA 1SK8A 3WG9A 3HDHA 4CCWA 3U09A 3O8QB 2VHWA 2YZKA 5JW6A 2FPGB 1XFAA 1VMDA 2R48A 2XUJA 3IUBA 4UDOA 1PNRA 1SCIA 4LVNA 4ER0A 3C3KA 5BSFA 4QJ3A 2ZWOA 3RSOA 4KQFA 4R2LA 3A9TA 2QBYB 3A26A 1DSSG 2RB4A 3O0DA 4M87A 2IV7A 3H5LA 3ZU4A 4XR4A 2I2AA 4QVKA 2O05A 3ZTTA 1I4DD 5KX5A 4R0MA 4C4RA 2WVAA 2D13A 2X9QA 2Z8YM 3N2IA 3BXGA 4IL5A 5FA5A 3U4HA 3UN1A 3CVXA 1PSWA 2A2ZA 2O8NA 3S7TA 1WXDA 1RDFA 3A32A 3KB2A 4H7EA 4MV7A 3WLRA 3GEIA 2KLHA 4DY6A 1WRBA 1YIOA 3NTXA 4CUZA 1CY8A 4CFZA 3C74A 3D0OA 1I7NA 1ZESA 4PYIA 5IK2A 4BL5A 3IP7A 4DXDA 2KX7A 3W8FA 3ZNQA 2CSXA 1KRXA 2GVZC 2NO1A 2Z57A 4O1MA 1NKSA 1DAKA 3QMVA 5IXSA 3U7GA 2WTAA 2A0XA 3DB2A 2ODTX 2Y67A 5HIMA 3DA8A 2VHCA 1Z6PA 4MCIA 5EXEA 5CDFA 2DULA 1FJ2A 1T10A 4CG2A 4TZTA 1VE5A 4QVGA 7REQA 3K09A 4NZPA 2XVXA 1M1ZA 1Z15A 3PPVA 2JFOA 1QOPB 1J22A 1LWOA 2G8NA 4U00A 3L0BA 4Y6LA 4D8WA 1T6ZA 3A3OA 1GAXA 1W4LA 1RKQA 5CW1A 1NA5A 3SS9X 1S2MA 3SR4A 4CWAA 4BNNA 3T1HB 5TMDA 1R64A 4I5GA 1S7CA 5FV4A 4PSDA 4DA9A 2BFPA 5KTMA 1D1QA 1RYZA 5CVJA 5A05A 4UM5A 1XZ8A 3VI3B 2B34A 4HOYA 2ACKA 4ZAZA 4ID3A 1R6UA 1YL6A 1HLPA 3K8YA 2I76A 5M34A 4G6ZA 2F8SA 2XNDA 1I1QB 1SD2A 1QRRA 3BWEA 1H2XA 3M49A 1R8SA 5IBPA 2HOQA 1FP2A 2Z2YA 3RW9A 4JI1B 4ZOBA 3VPFA 4GGOA 1IZ9A 1Y4DE 1T9KA 3NBKA 3AILA 2CLCX 1UWCA 1U4SA 3WLEA 3ZBQA 3R9XB 1VLLA 3I6MA 1GUAA 3DO5A 1LQTA 5DCYA 2XKKA 2J85A 1B41A 3P71T 3G8DA 4AKEA 4PQRA 3GGSA 4J0CA 5FF9A 2VI5A 4FFNA 5MDHA 5J43A 3HDTA 1XNHA 4IICA 2QDXA 4URZR 3HM9A 4AKIA 2FG7C 2FRXA 4D8VA 3GZNA 1AS2A 4KYVA 4I55B 3GJTA 1UFQA 4TT3A 4BS9A 3P0FA 2PIDA 9LDBA 4LZAA 5EP2A 3PLRA 1MOSA 5CB4B 4BBZA 5GINE 2NU6B 2ZIEA 2RD2A 3QIAA 2GCPA 5IJ0B 3Q98A 1Z12A 1QAQA 2B69A 3KPWA 5EP3A 1P77A 3MGCA 1Q1AA 4ZOCA 2IL1A 2HX1A 1ZD8A 1ZH6A 5SZKB 3DEJA 3EGEA 4ZOLB 2IU0A 4EPTA 2G9UA 3EGWA 4B6PA 1SQ6A 3FFXA 3BQ9A 2V59A 1DUVG 4Q9DA 1AV6A 3RT9A 3WADA 2ORED 1VKNA 1YVRA 4PC2A 2FA9A 2I9PA 2OKCA 5K3BA 3O8OB 1KO5A 4YJ3F 5LKRA 2H2AA 2HK9A 2Y6VA 2ZRNA 4FUQA 2NNLD 3GB9A 1JXMA 1ZGAA 2NTVA 2DBYA 2O3TA 3CSUA 3PR1A 2IVFA 1KEWA 2NU7B 2O06A 3IERA 4RA9A 3PQ2A 3H7AA 4GX1A 4ISCA 4YTEA 2LDBA 4Y9UA 3IR5A 5CXQA 3A6LA 4IJ5A 2LIVA 2NSHA 4O2AB 4A0SA 4AS3A 3EFBA 4FFBB 5HF5A 4NZMA 1WMAA 3IHWA 4CCSA 2FPOA 3WOHA 4KQGA 3BAFA 3FFAA 2JBAB 2N0SA 3AG5A 3VV3A 5THXA 4BLPA 1JR3D 1XAHA 4XZ3A 1QS0A 1G7CA 2DSTA 4LZOA 5CPBA 2MSCB 3AHFA 4Q1BA 1R6AA 1A88A 1JDZA 1W46A 2HTFA 3IIJA 4UNPA 4B8WA 3F47A 3BWXA 4HDKB 1T36B 4GNKA 2HA6A 1KAQA 3RS8A 1KWKA 1KI6B 1Y1PA 3FOWA 1A50B 1AQ6A 1J2JA 3CKYA 3KALA 5F33A 4KFCA 3BJMA 3WK7A 2QSYA 4TMWA 2VQ6A 3OX3A 4RVDA 3WLHA 3QFRA 1E3DA 2Q3DA 5GQSA 4M1TA 4FOTA 1ZQ1A 2QB5A 3RBXA 1UEIA 1KBOA 1G55A 2BM0A 3FY4A 1LPSA 3E7DA 2WYIA 4ZYVA 1ZFNA 5C7OO 3L4KA 4CMJA 4D9IA 2Q4RA 4AUKA 1ZVVA 4YQZA 3KBOA 4KH0A 1H9BA 4EY4A 5FPKA 3U6BA 1P7YA 3VPGA 3NP9A 1EP2B 3HS3A 1KSFX 3L02A 3ZOKA 1HI9A 4ZT6A 1FMCA 4G5YA 4JASB 2VEDA 5JD5A 2V03A 2HSEA 4N9WA 1QXSA 1C4XA 1XMPA 2ARKA 2EV9A 1MVOA 1QPBA 2Y1WA 3P8ZA 1EVIA 2GN2A 3VJMA 4EHIA 1EDZA 4L16A 3IBGA 4ENWA 4JJ6A 5CYOA 2IYRA 4HFMA 5CTAA 2JFGA 1QH1A 1TM4E 1Y3HA 3FPCA 2FN8A 5HDBB 5D5PA 2DGDA 2XKJE 4CRWB 4QKQA 1T2VA 2YJZA 1EFPA 3JS5A 4I3GA 4PRZA 4NATA 2O2SA 3OLCX 4L50A 4LDPA 4EHJA 2P2YA 2EFEB 1M2EA 2EW2A 2PKRA 2D7CA 3IOEA 3NT2A 3OX2A 4YIKA 3N6RA 5DI3B 2B1JA 4IG9A 1WB5A 2R62A 5BNTA 1OFTA 2Z1DA 1QR2A 2A59A 2QP4A 2ADMA 4JU8A 2EXXA 3B36A 3ZK9A 2R8YA 3OE4A 1HZJA 4GP7A 5D5HA 5IXYA 3RAEC 5T4BA 3NO4A 1YK0A 1I0LA 2ZR8A 1EZ1A 3GGGA 3SDSA 1HSZA 4JX9A 1L5GB 2QJOA 1JDTA 4FK8A 2O8EB 3RFCA 2LKDA 4L5JA 4XLTA 1NBME 1SZJG 2FPPB 3I9OA 3W5HA 3RC2A 1P81A 2ZI7A 2QEQA 1DXYA 4WJLA 2VXBA 1CVIA 1XP5A 5CH3A 1DADA 2LE0A 4J4TA 2H06A 4R9UC 4V2IA 1ORTA 4N5LA 2OV1A 1I01A 3MRSA 1OAOC 7GPBA 1O5OA 1ULHA 1YQXA 2C4HA 2HDWA 3A3YA 5DASA 1JEAA 1JPVA 3UWPA 3H11B 5FWDA 3ZWBA 3N8IA 2FV8A 1GL6A 1JAXA 5CVCA 2ZOSA 1NQTA 1PR5A 2HSJA 2M32A 3CO5A 3LBIA 4UU0A 5F4ZA 3RHZA 3I6BA 1CZUA 4KYTA 2H54A 2ZIFA 4X6LA 4Z8YA 5LIRA 2PLAA 1E2FA 3CB4A 3WLAA 4BKQA 2HJRA 3H2SA 4RJJA 1RHUA 1QG0A 1L5HA 1U3UA 3F8TA 3N6VA 2OYCA 3SDBA 3V2IA 1W4CA 3AESA 4GSYA 2L0XA 4JT8A 3NW9A 3VJLA 4MUIA 3RYCB 3SN6A 1ILEA 2XWPA 4YLEA 3CRQA 4IKPA 1JEEA 3OIYA 3UMCA 3MUNA 1DZIA 1T2DA 1ZK2A 4FKBA 4EVRA 3AUAA 2VP3A 1T5IA 1M66A 1R0CA 1T1RA 4GPBA 1R16A 3Q10A 1YB5A 3D64A 2EDAA 2EIXA 3MJEA 1PHRA 4PEVA 4PGMA 4RVSA 4NSNA 4U6QA 5I3CA 1U3DA 5CK5A 3SHVA 2XXBA 1W29A 4WXRA 3IAM6 1JA9A 1HL3A 5AI6A 1IAVA 4A0RA 5FH9A 5H3CA 2DQYA 4PRKA 4V0QA 2EWWA 1TMOA 2VQSA 4IYRA 3DZFA 4D44A 3UAXA 2M6SA 3OFSA 2ZRHA 1W9HA 1T25A 4PINA 4QQFA 2YJTD 4ZOAA 4BJ1A 4G1MB 3EMVA 5EIBC 4GEKA 2QTGA 4NZOA 3HE3A 5BQFA 4CIDA 1E4VA 2X1VA 4GOKA 4CNQA 5BORA 4QNNA 3UMRA 2AFHB 4M9SA 2QG9A 3EG5A 2YQ5A 3RG2A 3UJ9A 3V8RA 4M0DA 4REOA 4O1IA 4B47A 3OWOA 3EXEB 1V2GA 4X3CA 1N0VC 4G4SO 1FBTA 2EYQA 3GJSA 4YMUA 3TZCA 4KWTA 4QEKA 2F3QA 3M7IA 4GX5A 1PDOA 1UL1X 4BTLA 1IQRA 1MC4A 5E4YA 1SOMA 4H7IA 3HBJA 1RYNA 4JLPA 3LUBA 4X8MA 3ETJA 4QU0A 2PLWA 5K8UA 3AY3A 3C5HA 2DUJA 1D8AA 1BDBA 2R84A 3ORHA 3OUUA 4KMSA 4LY9A 1MW9X 5L9AA 4B34A 4AULA 1RLIA 3DAOA 1DDIA 1GD1O 4NAHA 5EIAA 2WOOA 4BZQA 5EIOA 2ZJ2A 1X7GA 1WKBA 3BQMB 1R8QA 4RU1A 3DMFA 5CYPA 4HWTA 1FLDA 1R9MA 4Q37A 4NJEB 1O94C 2MOKA 2Z9CA 2PCLA 2RHDA 1COWD 2RH5A 2AHRA 1K97A 4OXRA 4BJHB 2JIMA 1U2QA 3PNSA 3V1LA 1R37A 4F06A 1OXUA 5LIPA 1Z2AA 4H18A 1E6MA 4Z0HO 3AZQA 3TXYA 3COYA 1CUAA 3D5QA 4WFKA 5KMGA 1FVHA 3FCYA 4QULA 3SF0A 3V4FA 3SJUA 2PH1A 2I67A 2G9QA 2W2KB 1Q77A 1ISSA 3EXHB 3FWZA 3N2KA 4IBOA 2YWGA 4IEEA 4LYGA 2BFFB 4OFXA 4PZDA 3F6RA 3U3JA 4RKQA 3LPCA 1BDMA 2ZDGA 3K6KA 1Y7TA 3W3AD 5E4FA 1N8SA 1OH5A 2A1UB 5A3RA 3RYCA 2OO3A 2IOHA 2GYVA 1PR9A 4L4SA 3E3MA 3GZJA 4EKIA 4RK0A 1EUQA 2RGEA 3T9DA 1C3JA 3ZOZA 2IY8A 1SVKA 5KQMA 1LPBB 1JAZA 3JD4A 4QJIA 3B7PA 2QG4A 3KYCB 1NPTO 3GJ7A 3RM3A 1KQGA 1U7TA 1DQSA 3M4XA 4RX1A 2Q4DA 2RK6A 3P0JA 3NKLA 1YDMA 4LBYA 3BREA 4LRQA 4EPVA 1EQAA 4C7VA 1IK4A 1IY2A 4NCHA 1T34A 2PQ0A 4IIUA 4CFSA 4JKOA 2FPUA 2C82A 3OQ6A 3DTVD 2D3WA 4RL4A 5FI1B 3SZ3A 3FYDA 3I61A 2OCIA 4Q12A 2BI7A 3V4RA 2A58A 2BPOA 3H1BA 5EIBD 2J1LA 3EIWA 1OXMA 1C0PA 4R81A 3HRIA 4TSRA 3NH9A 2Y1KA 1DO2A 1R3DA 3A4LA 2P2DA 2ZB7A 4ND2A 3GYGA 5B4VA 1GUFA 3ID6C 4AXBA 2DVMA 3QSYA 1V5EA 3X2EA 1ZM4A 3HB7A 1S89A 5I7HA 3KU1A 2ZJOA 4CMIA 1TKRA 4M3NA 1BKSB 1HG0A 4TT3D 1VFNA 3TK1A 4B7UA 2PT5A 1QC5B 1EUCA 5SYMA 4P86A 2DH6A 4J1NA 4NBKA 4QBFA 1MLDA 1RAGA 3HCAA 3ILHA 3UJAA 3WKCA 3H4TA 1M7BA 3BXXA 4C7BA 1RFGE 1LFAA 1A9XB 3OIUA 4PG8A 1V4VA 4DZZA 3L6EA 1R3UA 1E3QA 4IIGA 2W9XA 3DHYA 4HEHA 4ND4A 5AM1A 3AK4A 1XZEA 1Q7RA 1DAOA 2XUIA 3N0XA 1RJEA 3LOQA 2DFLA 5CXSA 5YASA 4M54A 4ZMRA 2KS6A 1ZZEA 4BLVA 4DA6A 1P9LA 1ZPDA 4LK3A 1GPMA 1HT0A 1O0SA 3NRBA 2WY2D 4ZRMA 1TUGA 4KQJA 5E3IA 5IDXA 3HKEA 4UHCA 1YQEA 2F3PA 1Y1LA 1P0QA 3PDUA 4JZYA 2NO6A 4KMOA 4EAAA 1KF0A 1G3IA 1QWSA 5EE1A 4PIMA 3R0XA 1RNLA 5KS2A 2GX6A 3IIEA 5EQDA 2BEUB 3HVJA 3DULA 2OEPA 1CNMA 1DAMA 1W6RA 1E6WA 2N1MA 1OLSA 2ZRMA 3AEQA 3KOMA 4F2PA 3F9IA 3RC3A 3K9FC 3FNHA 3KKPA 3PITA 2YN0A 2YWCA 1HSOA 3EVZA 4ATNA 4G86A 4YIHA 2QT0A 2ISQA 3BAZA 1RIFA 2X0FA 1IY0A 4J8PA 2BFDA 2YBEA 4M7PA 4PLCA 1P9WA 1WHSB 5EWJB 4ZVQA 2WM3A 3CLKA 5EQFA 4YQYA 1P1JA 4LMAA 3EQ8A 3SJBA 2ACEA 1OXSC 1KYZA 4PGAA 3W4IA 2QMYA 5E0OA 1P4RA 2WKPA 2F90A 2IIPA 4HNAA 1GPNA 1LRLA 3GWZA 4BUJA 4H27A 2X13A 3WMEA 1JJIA 5KOIA 4BMCA 1JB9A 1XROA 1A7AA 5JPIA 4R71A 1XMXA 2B4QA 2ZI5A 1R9NA 3ELYA 3QKUA 3U3RA 4L08A 2XMRA 1WPGA 2GXAA 2G9NA 2BDEA 5AM3A 2FX3A 4JXKA 4RUKA 4RESA 3OTQA 1DFHA 2VNKA 3D2LA 2WU0A 3A9CA 3NPAA 1OF1A 4HDMA 3B9RA 3O92A 3ZDCA 3ZD7A 4NE9A 2AZXA 3LYHA 3GLGA 4NYJR 1AZLA 5EZYF 2B83A 2VYND 2ZU0C 1N6KA 1N3YA 2JIZD 2MMCA 1OWPA 2PZBA 4MGIR 5TIIA 2ZAOA 3ENVA 1GTMA 1PT7A 2JFQA 4YB8A 5EYPA 4O02B 1FRVA 3LPNA 3QHAA 4MRMA 5FL7A 1CS4C 1RI1A 4PNEA 2QMEA 2PS3A 1GLVA 4GYYA 3PKIA 5F9HA 2QRMA 3DKKA 1XYYA 5DLEA 4KX5A 1RYDA 4ZDKA 4URYR 4LXUA 4TZKA 1N1GA 3SK0A 1EIWA 5DHTA 2Y1GA 1E3WA 3K1JA 4IIXA 5J2TB 4QTZA 1MIHA 2O1EA 5FPQA 4Z53A 3HV2A 3DMRA 3VTKA 2O6HA 2POQX 2BGJA 3F98A 4Q9JA 3KLPX 3WGKA 1W2GA 1C3EA 3GU3A 4I4LA 4ZICA 7MHTA 3DAGA 3HLTA 1CQXA 3TECE 5JATA 4LVOA 1WCV1 4ZJYA 3VR6H 2YC4C 3BIWA 5DNAA 1FL9A 3EFHA 1LJLA 3I0ZA 3U9LA 3RANA 4X71A 3TFWA 2A1IA 2P6MA 4UHFA 2UZ1A 3WYCA 3HWSA 3FJ1A 2WKRA 4HDCA 5LYJA 4DNOA 1ZOLA 4GI5A 1WXHA 4LA4A 4QBIA 5HMLA 4MV0A 1TL7C 3PP8A 2WHEA 4CI9A 1RIIA 4DDKA 1RQGA 5T6MA 5ICSA 1WXXA 1TM3E 3OQVA 1USVA 4RW0A 5DGCA 1VHTA 5DXFA 5HWSA 2PXXA 3A1DA 4OUKX 2IYWA 1QH8B 2YW9A 1ZN2A 1ZRSA 1HE3A 4FPXA 4DIOA 5WRFA 1M2KA 5BVHA 4HLUC 4JNKA 3WFJA 2P11A 1Q1BA 4QOIA 5ALHA 4B45A 5BV0A 4MVXA 4JU9A 4E2WA 3TTVA 3UNXA 5CDYA 2GWHA 3K0FA 4IDAA 3IUJA 1GNQA 3ZCQA 4NDNE 2EKQA 1ADJA 3AUFA 4CCAA 1SVWA 3OCUA 4GPIB 3GLIA 4BP1A 3BD8A 3I64A 3KVVA 4CKEB 2G6TA 3ZHCA 2Q07A 4C6TB 5EMLA 1E1NA 3AQ4A 2ATVA 2CZGA 1T3LA 2W2QA 3B20A 3MD0A 4YAOA 4MKXA 4NE7A 4GMFA 2GCNA 2WD8A 1EINA 2VUIB 5JCJD 1X3LA 3AIIA 5LA6A 2GETA 1SKQA 1DKQA 3VAZA 3C7CB 5F1PA 1X1EA 1DARA 4WEOA 2YNMD 3OECA 3VOBA 2YY5A 4JROA 4O4IA 1T2FA 3ORQA 3MLBA 4WWHA 5BQ5A 1FBNA 1XPOA 3M2PA 1UJ5A 1KZYC 4JMPA 5JQGA 4DIMA 5IEBA 4B43A 4X54A 3GCDA 3OLWA 1DAEA 4AC9A 3IBYA 2DR3A 3EVBA 4UU1A 1E2QA 3NYRA 4Q4AB 1JWBB 4ID9A 4A8HA 4QWWA 4MHSA 2ZYUX 1XUOA 4NQRA 3NQ41 4Z1MA 4CMEC 1KEEA 1NUHA 2QVLA 3WTBA 2JLUA 4P83A 3BHMA 4MKHA 3SC2A 5CCEA 4UTZA 2JCVA 3CRZA 1NNLA 1PZXA 2IOQA 1X1SA 4BN5A 1N3IA 4G5OA 3JRWA 3DV2A 4XB1A 1T9GR 1X1RA 1DKLA 2ZPUA 4ZEXA 3TQSA 3IEMA 2ZUEA 5LP6A 1NXSA 4ABYA 1LPPA 1BFKA 2XRMA 2I3BA 1GFWA 2BEWB 5IYZF 5A5VA 1G42A 4FTWA 4YJ3B 3RR2A 4MS3B 3GFBA 3U49A 1NVTA 1OYWA 2JRLA 4L3VA 3IQEA 3I0NA 4R84A 3SMVA 2RC5A 1RVV1 1C1DA 3MQ4A 2WWGA 3ZHQA 1D0VA 4AI6A 4ACBA 2ZIZA 1V1MA 4GPZA 2ZVQX 1WEHA 3M82A 4XPIA 1CUSA 2ZZNA 1VE1A 2XHZA 3F3YA 1VE7A 2X1HA 2VRCA 2LV8A 1HFEL 2X9VA 5ADVA 1RZUA 5HK9A 4FKMA 4NESA 1IIBA 1XLTC 3CW2A 4B6SA 3QWFA 1YU6A 3QVMA 4L78A 5A7HA 2XE6A 4DNXA 4TKVA 3BEDA 3P9CA 5C52B 1ZRMA 3UV7A 3UJ8A 5AP9A 5TT0A 3D7RA 4L0CA 2WM9B 5K8JB 3V9AA 3IMFA 3KYCA 3DF9A 2Z8ZA 2GAIA 3AHHA 5DJ5A 4XVCA 4RAQA 4G24A 3DVSX 5K3AA 1YT5A 3HJHA 4JLNA 1XL0A 4XX0B 1RQ7A 1GKKA 1JG6A 1FY2A 2XQIA 5DBOA 3AJDA 3IVXA 3ADOA 4DIEA 2XUZA 2W6PA 1UK7A 1KZ9A 1V39A 2HA7A 4JB0A 3KB6A 2WFZA 2FFBA 3AYZB 3O83A 3OQIB 4IF6A 3C4VA 1ABEA 2JFFA 1KFEB 1MX9A 4RTRA 1G6OA 3KSUA 1YRLA 3PICA 4DY4A 4YRSA 2GHTA 1XV5A 1OV4A 3DBLB 4NAVA 4ANFA 5JSFA 4XB2A 1SUDA 2IYAA 2BGLA 2Y93A 2P79A 5JBQA 4RDCA 3FBWA 5KWJA 1E2EA 1Z5GA 1P7WA 1WL8A 2ZJAA 3WWEA 2XWBF 3NBUA 4OJQA 1YBHA 1QQBA 4XWOA 2IZOA 5FR2A 2PD6A 4M22A 1LDBA 1EVKA 2B37A 2EDCA 2GA9A 3PXCX 4MWZA 3NCHA 1CR1A 2Q2WA 3HA3A 3PVCA 5I7AA 3WC4A 5UKDA 3D6TB 5AVUA 1QOZA 1L7VC 2WJJA 2IW3A 1A8QA 1M7GA 2FEAA 2KPOA 1E4EA 3KOWA 3SC4A 1L4GA 4A26A 5I7VA 2VSOA 4MAAA 1KFJB 5TGTA 3ZIDA 3ESQA 3PWZA 2CLMB 3WR5A 1ZSVA 1U9ZA 2HPHA 3QQ5A 4INAA 5JD6A 1ZAYA 2XXJA 4INPA 2CXXA 4MYRA 5A9SB 1WXFA 3U7RA 3BSYA 3P2JA 1O94A 4R1MA 1XZMA 4YHBA 2VXYA 2FG6C 3UB2A 1R0LA 4B73A 4ZT3A 4ZVVA 4D4KA 4BNZA 3KUXA 4ZYXA 3LSTA 2CXNA 5TE9A 2OAEA 1X7YB 1CY7A 5AVTA 1J5EB 4UEKA 1VSUA 3H4VA 4PV7A 5K9ZA 3P9ZA 5FUMA 1IVSA 4D0GA 3F96A 1G2IA 4KIWA 1E4EB 1Y89A 4NI5A 3I37X 3VXKA 1KQ3A 1PNVA 1XHFA 2WT9A 4RHEA 2QRVA 4KNWA 3GLIB 1JYEA 3DTYA 5BN3A 3GQBB 2H16A 5U4QA 2XOEA 3HUUA 4BO6A 3LCMA 1Z0SA 5BPFA 1L3IA 3BMNA 3PNBA 4JJ7A 4OA5A 3NMUF 1VTKA 2AXPA 3HGMA 3K6SB 1HKUA 3KYDB 3EVEA 3TYXA 3PHJA 4I4CA 4L6AA 3L8MA 3G2PA 4UNRA 1P75A 2ZKLA 3EW9A 4ZI7A 2GAJA 5HZHA 2DTXA 1VGRA 2NUBA 2OHXA 4QNMA 2EIHA 4Q3KA 1Z63A 3CEHA 3PFHA 5E7JA 4XR9A 3AP2A 2YVAA 4RCYA 4RVUA 1GP2A 1J00A 2QW1A 5HW0A 1DC3A 3STHA 3JZAA 4D80A 3KJIA 2OYSA 4G84A 4I1UA 4XGQA 5H3HA 1EBBA 1WOMA 4NYJQ 1XRNA 2F9FA 4IRXA 1QV9A 5D8DA 1W7AA 4QM7A 3UGJA 2MCFA 3MNFA 1PWHA 3VBEA 3STXA 4TQAA 3P2OA 3MOGA 5CBKA 5AT1A 5KVQA 3L7YA 3AI2A 5FOWA 1A9OA 1I3CA 2GK3A 1HNZB 4WPGA 4X1IA 5TGDA 1YS7A 4KGDA 2IYXA 3IQDB 4NS1A 4MHOA 3H18A 1EHIA 4B8ZA 4C0XA 2EKLA 3H1TA 5GWXA 2VZ9A 3K8QA 1BMTA 1GGJA 1UQRA 3L4BA 3SYMA 2VA9A 1JMKC 2Y1DA 4D74A 5DP2A 1IN4A 1XEFA 4WD3A 3TR0A 3FAZA 2PJUA 1P74A 2RJNA 5TB5A 5DISB 2ZRAA 2Q3JA 3ZWDA 5CD1A 3W2HA 2C2XA 1RHRA 1N3BA 3LL4A 2GOYA 4BP9A 4JC5A 4EGFA 3HYTA 4I9HA 2X0DA 5FWYA 4LY0A 3LY5A 5DW0A 4JI3B 2WTUA 2DP4E 2CWWA 1X70A 4EELA 1IZ7A 2VRNA 5IVIA 4UCFA 2AN4A 1DWQA 4O6VA 5F21A 3IKLA 3ADPA 4Y2JA 2P68A 2I0FA 3H5VA 1WCXA 4JLBA 5E1BA 3UJDA 2DY1A 4TQ9A 5I4BA 4GLLA 3TAUA 3T99A 4PLHA 2AX3A 1VJ5A 2VJAA 3D4OA 3G2IA 1EJ0A 1JG7A 5EKUA 5THQA 1FEZA 2D5LA 4C3VA 2UYYA 5DM1A 5LP6B 4JGBA 4Q4DA 2Q1SA 3V5NA 3K2EA 1DGQA 1GT6A 3DTNA 2DLNA 1VCOA 3U4DA 4R2KA 3S3TA 5L6MB 1GQRA 1VFPA 2JLWA 2OGZA 2Q5JA 4B0PA 1CRZA 5AKGA 9LDTA 5REQB 5FA8A 1UMCB 2WFLB 2IS1A 2C4MA 3WY9A 3K8ZA 2GYYA 1Z28A 1PUXA 4H0FA 2EZTA 2FWPA 4H4CA 4ZYWA 3NEPX 1YDFA 3D8TA 1JAYA 1NVVQ 1Q7TA 1T8UA 3GI1A 4Q7JB 3RUEA 1JG2A 3L4SO 1XQ6A 2PO5A 3K2BA 4TYMA 3V7WA 1U8TA 5C7LO 4PYOA 1V3TA 1R4AA 2I7DA 3IV9A 3KZXA 1S7GA 2GLUA 3ZH2A 5EE9A 5AI5A 1KYIA 5ESWA 1X14A 3C7AA 5JJCA 3QKRB 5IM5A 1OPXA 4NEHB 4A8PA 2QLLA 3CV3A 2O2JA 2ZTUA 4Y0NA 1FQKA 1GEEA 1P2UA 1T8TA 3OKCA 3LNCA 1RR6A 1X0VA 4KQMA 4OB6A 2FSSA 4Q9NA 2PH7A 1N0HA 1QZUA 2PYZA 1AK1A 4G1UC 1XTZA 3M1LA 2NPOA 4L51A 4P7GA 1SBNE 4L9RA 4LHZA 3QPUA 5TR9A 4KLRA 3SEFA 2IXTA 3O94A 2G06A 4FS8A 5DOZA 2PKQO 1W0JD 1JE0A 3OQNA 2RGNA 3AF0A 1QKJA 2P0EA 3ORYA 3QPAA 5JCOA 4BFLA 2XRZA 4ZAYA 3F97A 4XDGA 2BGWA 4IXWA 4YASA 3SAJA 1B8VA 3V4ZA 5TPZD 2ZS8A 1MX1A 2FPRA 4WI1A 2WYUA 5LQCA 1II0A 3LLCA 1WP4A 2RGRA 4BWVA 5CHEA 2XB2A 2XCLA 3ZGZA 1YNOA 1JTVA 1NP7A 2GRAA 3CHYA 4Y7CA 2SICE 3UWOA 4P38A 3ZE6A 3ZIAD 5EPEA 1YHZA 1Y4UA 3GPDG 5C8YA 1KI6A 4M0PA 3T5BA 3BC1A 1P17A 3M81A 5D85A 1NMYA 1YGYA 3QK7A 3U4GA 2VDJA 5HM6A 4CYMA 1RPZA 3KJQA 2JIPA 3CLTC 1NVKA 2NUTA 4B35A 5CAEA 2IY9A 3INYA 4ZQFA 4IIJB 5AI4A 1P5JA 3B7WA 3IUSA 1EFRA 1XE3A 2OFOA 1UWKA 3P32A 2PT6A 2YIDA 1O0CA 3EXIB 4PBTA 4AP5A 4EO7A 4F2GA 1PYDA 3P4XA 2ZRPA 3ZWOA 5BWMA 3ZI4A 3M2TA 1EWYA 1NN5A 3LG2A 4QC2A 1HNXB 3V80A 5KKNB 1NMQA 1AMOA 3DH0A 1IVYA 4DJEC 3IALA 2R8OA 3CIFA 4DKJA 2ZJYA 4PG4A 1JRLA 1MO2A 1NZDA 1XAJA 2V98A 3A4VA 4MYTA 3DOIA 2HSDA 5C5EA 1AS3A 4NKRA 1M2OB 4Q7EA 5DXJA 1ZM9A 4ICIA 2EFHB 4OSOA 1QUFA 3KQMA 3EHDA 3R5XA 3RTBA 4EFLA 4R2HA 1YB1A 2REBA 4UTOA 1XTJA 3KEMA 3T94A 4NBLA 3RJTA 3R09A 2JB9A 4L8GA 2JAPA 1FPQA 1IB0A 4Z1MD 4I9UA</