2PQ0A

Crystal structure of hyopthetical protein (gk_1056) from geobacillus kaustophilus hta426
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
b'GRKIVFFDIDGTLLDEQKQLPLSTIEAVRRLKQSGVYVAIATGRAPFMFEHVRKQLGIDSFVSFNGQYVVFEGNVLYKQPLRREKVRALTEEAHKNGHPLVFMDAEKMRASIGDHPHIHVSMASLKFAHPPVDPLYYENKDIYQALLFCRAEEEEPYVRNYPEFRFVRWHDVSTDVLPAGGSKAEGIRMMIEKLGIDKKDVYAFGDGLNDIEMLSFVGTGVAMGNAHEEVKRVADFVTKPVDKEGIWYGLKQLQLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein GK1056
molecule tags Structural genomics, unknown function
source organism Geobacillus kaustophilus
publication title Crystal structure of Hyopthetical protein (gk_1056) from geobacillus Kaustophilus HTA426
rcsb
total genus 65
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2pq0A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2pq0A01
1K1EA 3U7FB 1YMQA 2FPXA 4MUMA 1S8OA 2GMWA 2FEAA 2NO5A 4BX3A 2EARA 5AW2A 5ALRA 4EZEA 1T5SA 4HGOA 5E0OA 4L6CA 3ZWKA 1RLOA 2AMYA 1MH9A 2W4MA 3IRUA 2G09A 3ZWDA 5ALJA 5AK3A 5AK4A 3QU7A 4L6AA 3OCWA 3U19A 2BDEA 2IYEA 3L8GA 4BBJA 1SWWA 2QLTA 3AR7A 5AK5A 5ALVA 1XP5A 4UMEA 2O9JA 4HYTA 1U7PA 5AM4A 2I6XA 4G9BA 2YJ5A 4Y2YA 3KZXA 3QUQA 4UATA 2IOHA 3ONNA 4XE5A 3HLTA 4JDPA 3WGUA 3GYGA 3U13A 4FE3A 3WKEA 1NNLA 2RAVA 2PKEA 3P96A 2FUCA 1WPGA 4UU0A 2WF5A 3AR9A 4KYTA 5AKIA 3SKXA 4YCMA 2YN4A 2HI0A 5AHXA 2HHLA 3ZTWA 1VFPA 5AI0A 4KN8A 1RC8A 4J03A 3SF0A 2P27A 1ZRMA 4RETA 3KOOA 3RFUA 1O03A 2CFSA 5AVQA 3OTQA 4YIKA 5ALMA 3FVVA 5AVRA 2YMQA 2PQ0A 1ZRNA 4KNWA 5ALXA 3WKDA 3ZX5A 2WF9A 4AS2A 1L7OA 1ZJJA 2VKQA 1U2TA 4HGQA 5AW0A 1YNSA 1S2OA 1Z4OA 3BWVA 2R8YA 1O08A 1TJ4A 4ZEVA 3QXGA 1PW5A 1VJRA 3ZI4A 2MSNA 4RESA 4Y2QA 2R8XA 3WK6A 4DWOA 5AI4A 5AI8A 2YFYA 1Q92A 3W5DA 5AW1A 2P69A 3MN1A 5ALLA 5IT4A 5ALPA 5ALFA 3HYCA 4UAUA 4YIHA 3CNHA 4NABA 2FDRA 2ZBEA 3E58A 2G1AA 1Q91A 3EF1A 2QYHA 2C8KA 5AKLA 4KNVA 3U7HB 5AKHA 2EAUA 3FPBA 3N28A 3WK5A 2R8EA 2JGAA 1L7NA 5AVUA 3IB6A 1RDFA 3L8EA 2R8ZA 2YY6A 5A3QA 3W5AA 4EX6A 1U7OA 5AIAA 3PDWA 2P11A 3DDHA 2AGVA 2OM6A 3KD3A 5AW8A 3WGVA 2W43A 3FM9A 4IFTA 4Y2SA 2JARA 3ZTYA 5AVYA 5AVXA 1LVHA 1TJ3A 3ET5A 3QU2A 3WK7A 3NALA 5AM5A 3VAYA 4Y3UA 3FZQA 1ZD4A 4BX2A 1EK1A 4XOUA 5AVVA 2G07A 1WR8A 4OFZA 2W11A 3NANA 3NUQA 1L6RA 1Z4PX 5ALUA 2WHEA 3L1UA 4C4SA 5FP0A 2ZBDA 3A3YA 4KX3A 2HSZA 3L0BA 5AW5A 4GIBA 4J2TA 2C8LA 2YJ3A 4CE6A 4UAVA 4UASA 1RKQA 4HGRA 3UMCA 3SMVA 1RLTA 5AI6A 3OCZA 4CF4A 3FPSA 2CFTA 1Z4IA 2RB5A 5AM0A 2JAWA 1RQLA 4MWOA 2Q4TA 3AR2A 4YCLA 5AVSA 5AIBA 1QH9A 4HAIA 2RBKA 3B9RA 2FPWA 5AVWA 1AQ6A 3SHQA 4ZEWA 3U26A 3NRJA 3QU9A 4XPZA 2NO4A 4FYPA 2HO4A 1RLMA 4UMDA 1T5TA 2D2VA 5ALWA 3N8GA 2HCFA 3L0YA 3KBBA 3L7YA 2X4DA 3ET4A 4O8CA 3L1VA 3N07A 4BNDA 5AI5A 5ALQA 3NIWA 2WF6A 3QU4A 3WKBA 1Z5GA 2B0CA 2Q5EA 4JB3A 4Y2RA 3W5CA 1KYTA 5AW3A 4G63A 3SD7A 2P9JA 2AUTA 2HF7A 5ALKA 5AKYA 3EWIA 1L7PA 2GO7A 3DV9A 1RKVA 1RKUA 3M9LA 2GFHA 3RF6A 3ZVLA 4E88A 1Y8AA 3BA6A 3F9RA 3WK9A 3A1CA 2HEGA 5AKJA 4EEKA 1RRCA 2YJ4A 3DAOA 1QQ5A 2ZBFA 3N1UA 4HGPA 4UM7A 5ALTA 2WM8A 4AS3A 3UM9A 3IJ5A 1LTQA 3QUCA 5AKGA 5AM1A 3ED5A 4Y2UA 3QUBA 4BYGA 3QX7A 1N9KA 3UMGA 3AR6A 1ZS9A 2C4NA 4Y2PA 1Z4LA 1L8LA 3QGMA 4BKMA 5ALZA 2FUEA 3QNMA 2WF8A 5AESA 2FI1A 2I55A 4EX7A 3B8EA 1YV9A 3ZUPA 3A1EA 4FFDA 1YDFA 4NAVA 5AW9A 4YH1A 3ZVMA 4OCZA 1NF2A 3EPRA 4QJBA 1ZOLA 1QQ6A 5AKKA 4F71A 4UU1A 4BEVA 3MC1A 3N5KA 2NYVA 1L8OA 1X42A 5AICA 3SLRA 5ALEA 4DFDA 5T41A 2O2XA 2I34A 4GXTA 3ESQA 4DCCA 3E81A 1J8DA 3CZ4A 1T9ZA 3PCTA 1NRWA 4EELA 5AKZA 4UARA 4CNQA 3OCYA 5AVTA 3S6JA 3ZX4A 4YGYA 5AKEA 3WKAA 2DQSA 2HDOA 4HGNA 3U7EB 1XPJA 3L5KA 4UMFA 3KC2A 1ZD5A 5ALNA 5ALSA 2YMLA 3D6JA 2JAOA 3E84A 1J97A 4KX5A 5ALIA 1IWOA 3ZU6A 3OCUA 2I7DA 4AP9A 2OA0A 5AW7A 2IOFA 4BEWA 2ODAA 4C4TA 2ZG6A 3I6BA 3R9KA 3R4CA 1SWVA 1U2SA 1Z4JA 3AR5A 2B30A 4NWIA 3KDPA 3OCVA 3AR3A 5AKXA 5JJBA 4OD0A 1RMTA 2OYCA 5AI9A 1Z4MA 2CN1A 1EK2A 1N8NA 1WZCA 2YBDA 2G0AA 2JAUA 4PNHA 3PGLA 4C4RA 3L0CA 1JUDA 3J7TA 3ZW7A 1YS9A 3E8MA 3MMZA 3UMBA 3B9BA 2HOQA 5ALGA 5AVZA 2GHQA 3U7GA 1Z4NA 2HX1A 2IA5A 3AR4A 3W5BA 5ALDA 4EENA 3NASA 3ESRA 1L7MA 1QYIA 2YJ6A 1CQZA 1WVIA 2RARA 4Y2TA 2EATA 1XVIA 4UM5A 2PR7A 3OPXA 2C9MA 4B6JA 1YJ5A 4UMVA 4Y2XA 5AM3A 5AW4A 1ZD3A 3SKYA 4NFLA 2WFAA 2I54A 4L57A 4DW8A 3WKCA 1U02A 5AM2A 1SU4A 1VJ5A 2GHTA 2OBBA 4BX0A 3ZVNA 1ZD2P 3QUTA 5IT0A 4IG4A 3R09A 4F72A 5AW6A 4QQFA 1CR6A 2FPSA 3I76A 3L8HA 2I33A 1F5SA 3EF0A 3OCXA 1Z4KA 4ZEXA 3FGOA 4NV0A 4Y2JA 2Q4RA 4BNDB 1RQNA 4YCNA 2G08A 3A1DA 1RMYA 2G06A 1TJ5A 2BY4A 3PGVA 2YMMA 3MPOA 2B8EA 3WK8A 4CF3A 4XQ0A 2BDUA 2IOFK 2WF7A 2ZBGA 4OHFA 3I1YA 2ZOSA 4I9FA 3QU5A 3WK4A 3I28A 4H1WA 5ALYA 5ALOA 3L8FA 2HF2A 1Z88A 5AK6A 5ALHA 3K1ZA 2FPRA 5A3SA 1TE2A 3DNPA 2B1QA 4Y2VA 5IS2A 2B82A 2YMPA 2G80A 1Z4QA 4CF5A 2B8JA 2ZXEA 5A3RA 1FEZA 2CFRA 3TLMA 1RMQA 1TA0A 4I9GA 4UW9A 1QQ7A 3QLEA 3AR8A 3NAMA 3QYPA 1RPZA 2B1RA 2C88A 1Z5UA 3M1YA 2AH5A 2MU1A 2FPUA
chains in the Genus database with same CATH superfamily
2HBZA 2F67A 4XLTA 4YJHA 2OXTA 1AY0A 3STUA 2J9YB 3CR8A 3KJEA 4NE9A 5BV2P 1TQ8A 3HP7A 5JZBA 3DTVA 1USGA 4EGFA 1AS2A 5CX1B 1CYEA 3TMYA 3UOGA 1GY8A 2XQGA 3HVUA 1B43A 2RHDA 2IXBA 4BX3A 2E4XA 4EHAA 3WLHA 4JVOA 1W6UA 2NZJA 1XZKA 2H31A 1L5SA 1LVGA 3ZWKA 1DLIA 1RLOA 4M8NE 4MDFA 5JY6A 3MS2A 1Q1QA 4M0UA 5DTMA 3AINA 4JS0A 2C7PA 1C8LA 2QN3A 2CVFA 3I9NA 2VJDA 1DFIA 2AI2A 4C0KA 1QU3A 5C8YA 1M8GA 2FU5C 1L5LA 5I5GA 2BDEA 4M1EA 3UT0A 3FSEA 1K63A 5TVKA 3SZRA 4EKNB 1DKNA 2QLTA 4LVUA 3CEAA 2PFSA 2NT4A 5DRYA 3UWDA 3ZNQA 4AI6A 2HJHA 1MGOA 1UXKA 1SB8A 2BF7A 4HNAA 2PCLA 3T7DA 4HNSA 1KETA 3LLSA 3UB2A 3H9EO 1HXHA 3LCCA 1HFKA 2M1XA 3OLYA 1YAJA 2E5FA 1DO8A 1XZLA 1PD0A 2IOHA 3L0SA 3Q9NA 2RGDA 5TF4A 4EABA 3KE9A 1M8JA 1VI6A 1AM4D 2NZWA 4PBTA 1L4MA 3KKEA 3AUUA 1KIFA 3HY3A 4AUMA 1QZTA 1GZDA 1YBFA 4HMQA 5FBQB 2CXPA 1T4CA 3B1JA 2AYYA 1M7HA 3CVJA 5FIUA 3AR9A 3SKXA 4GNRA 2BR4A 1ZU5A 4JWKA 4M99A 3TI7A 5K20A 1U4OA 2YN4A 5IF9A 1N0HA 2DWCA 1FZTA 2IYTA 1R4ZA 4KR2A 2IU0A 1R2QA 3IP7A 5GIPE 4X24A 2VP3A 1VJ1A 1FUIA 3ZDRA 1ZR2A 2FJ0A 3GP8A 1B16A 2DR3A 2ZP1A 3JAKA 1TQDA 4I50A 4RORA 1LCIA 3ZBTA 2XTZA 1DNPA 4YIKA 3ZCQA 4XVCA 4CDNA 5B12A 4WW0A 1M1UA 4TXMA 4L76A 2Z9DA 1XZDA 2ZSDA 2OG2A 3NBAA 2IXTA 2I2FA 1Z2AA 3I0MA 3FKQA 3GUZA 4IGIA 3FF1A 2Z6QA 2IDZA 2XZPA 4QAJA 1D6MA 1EVZA 4FM9A 1PUJA 5ADHA 4KQJA 2BN4A 3URMA 1P5RA 2ZSHA 3G3EA 1YQTA 5JS2A 1UBMS 4WJKB 4J16A 1F14A 3WOVA 2ZTSA 1X1BA 1H2HA 3ZZUA 2HJVA 2C3PA 3ONFA 5EKUA 4CM5A 2Q27A 3EB9A 4TV8B 4YMWA 1GO2A 2HRZA 2LCIA 2XOXA 1IK6A 4IKPA 4YI3A 4DLAA 4X84A 4F4DA 4RPIA 4Z0NA 1S2DA 3PU6A 5B6IA 1KI6A 4XOIA 3E5HA 2VXOA 4DL9A 1H22A 3LT0A 1KEWA 1FNBA 1Z0FA 4LHYA 4KNVA 2V65A 3DOJA 1HFEL 1LPAB 1YQQA 4JMPA 2V3WA 4AROA 4C14A 4ZYWA 1LQ2A 5AOVA 4YAIA 2OXIA 3GLIB 3FYUA 2JIRA 4KVFA 4NATA 3H11B 1HZZA 3EVTA 2UUPA 2CLDX 3BSWA 3G0GA 3N53A 4G9GA 4YRDA 5EKXA 5E6RA 1R66A 3CRW1 4EDFA 5AIAA 1T1EA 2B2XA 5IVDA 4BHTA 2BBOA 1J9GA 4D8WA 5INTA 2JFXA 5AHKA 1GNTA 1IBCA 4EMUA 3O83A 2XTNA 5AVJA 3GJRA 4G67A 4QDJA 2NVUA 1CERA 2W9XA 4R40A 3R7AA 1SNYA 4M60A 1H1LA 4A8JC 4DUYB 1UFKA 1QVAA 3B7GA 3DE3X 3KETA 2EJBA 3NALA 4GPIB 4Y3UA 3WS7A 5DCYA 3KR9A 4KZPA 2RJOA 4OM7A 4QOIA 3KO8A 1NVEA 5A5EA 1Z08A 4BL5A 2QAIA 3VDMA 4Y0AA 3FCYA 3P4UA 5C81A 2GYVA 3H0KA 2N1MA 1L6RA 5JR3A 3A4YA 2CCKA 1XXHA 3EC7A 3TZBA 1AQNA 2W6PA 4O33A 2EF1A 5I9MA 1UFQA 4UJ3A 5JAIA 3O93A 1RLIA 1RQXA 3RSZA 4G65A 5EA2A 4D3FA 4F6CA 5EIEA 1BDJA 3LQKA 3WB0A 5TQ0B 1NI3A 3G2KA 1ZQ9A 1HT2E 3OT1B 4ZA2A 1TQ4A 1GVHA 3PXDA 3SDBA 4LQDA 1XAHA 3LXXA 1V1JA 2WKWA 2A7QA 2ZVQX 3RS8A 5LQRA 3QNWA 5KVQA 3HABA 1VCOA 1MO5A 5I5EA 4ALMA 4FJ1A 4KSCA 1E3IA 3TQRA 1H23A 2WB2A 4R81A 2VO1A 1XC7A 4BNZA 4YUZA 2QV7A 2PHZA 3HLKA 3TJMA 1EZ4A 1Z4IA 4AMUA 1BXGA 1DJNA 1S1MA 4IZHA 1HNZB 4PRKA 1AG9A 5KVCA 4NLLA 3INRA 2JJMA 2OZKA 3RH0A 3HB9A 4DLPA 3LUFA 1EBBA 1ORDA 2ODBA 1AO0A 2W48A 2RBKA 1EVEA 3LUKA 1OTXA 1WB5A 2OQ2A 4B3BA 2DUNA 4MVJD 4QLBA 5GAJA 2W5UA 5E7JA 2EZUA 2E2WA 2Q3EA 1SVLA 4YRNA 5A5FA 2QHXA 1XD2A 2VAXA 3A6JA 4YT2A 1O5IA 1DO0A 3VPCA 2FN7A 3KKKA 3N8GA 1JFFA 1VBKA 2HU2A 2NO9A 3JQ8B 4JYMA 4M4SA 4MRRA 5KYYB 1Q7BA 1PTKA 2GCIA 1QUEA 4RQUA 4Q1FA 4A1OA 1CQJB 2Z5GA 1ZITA 3W8FA 2R3SA 1JAZA 2P4SA 2ZULA 4JHXA 2YBEA 4I5GA 3N6XA 4FX2A 4UUMA 3WKBA 2QUJA 1XLUA 2F4VB 2J0VA 4OHZA 3T7TA 3BC1A 3OF5A 1ZL0A 2C9BA 5HIMA 1ESNA 5EJ9A 1JAHA 5H82A 3KEMA 1A7KA 2ZJ1A 1GZ3A 3ZDQA 1TD9A 4Z4FA 3PRYA 3F9CA 3JTEA 3ZJ5A 2CV1A 1G6Q1 1RKUA 3GLQA 1AD2A 2YV4A 3GWGA 3F7TA 4R1UA 5ESXA 4BAZA 4EF4A 1GKLA 1PJLA 2F9MA 3VHLB 2F00A 3CRRA 3I5MA 4L7VA 3F3YA 2C7QA 1PJ2A 1FVHA 4AUEA 1R7RA 1S2NA 2P1ZA 2WKSA 1BVRA 3HU2A 4OU5A 3DAOA 3W1EA 3CF6R 3N1UA 2PIAA 4LF4B 1MR3F 3ZY2A 1HGXA 1Z7BA 1DC8A 3IP8A 1YQWA 3ABZA 4KLNA 2BELA 4NICA 2BTOA 2UZAA 2PS1A 3WVNA 5A4MS 1YQGA 4S24A 4ZOLA 1QG6A 3GT0A 4KUEA 3WGOA 3DKIA 2H2GA 3MFQA 3QVOA 2J9ZB 1HUQA 4W5WA 2HZ7A 3O26A 2HWYA 4YR7A 5L7TA 1GQRA 1N9KA 1SVOA 2QZZA 3RIEA 3H5RA 4UQOA 4MQLA 2VHYA 2VCEA 1L1RA 1Z74A 5K0GA 2ZB2A 3Q8LA 3DUFA 1FDSA 3PR1A 5LQUA 1WCYA 4MLDA 5ITWA 3E7FA 4GO1A 2E4VA 5DHSA 2BM1A 1E5VA 5EUMA 3NAQA 4D4KA 1L4YA 2YHIA 4K8OA 4OJQA 5AWFC 3WGHA 1ZM3A 1T2EA 4QU9A 4KE6A 4LSGA 1R37A 2CUNA 1Y6ZA 2J5XA 121PA 4UCQA 4DZTA 2ZQZA 4FR0A 4FFDA 4DDVA 4OP2A 5E9QA 3WWZA 1LZKA 5E95A 5FOUA 1TM4E 3IVMA 3ZVMA 2OLEA 2HRDA 4RYLA 1LXCA 1T5HX 2PX3A 3KAPA 3N2ZB 4ZPJA 5JBIA 1NXPA 5ARCA 1BX3A 2ERXA 4J1SA 1EJ6A 1PZHA 3X3HA 3JQ8A 1Z5VA 5KYYA 1I1NA 1SHTX 2D06A 4WWHA 2MYTA 1CZOA 3L4EA 4NMLA 4GG1A 4HTFA 2LCQA 1SVSA 3EISA 1T2VA 5D3MA 4C78A 4CETA 1EESA 2LZ0A 2PGNA 2X5KO 4DCCA 5M34A 3OQ1A 2ZTHA 4IY1A 1U9YA 2Z9BA 3R3VA 3SXPA 1CJTC 3RLFA 3TMKA 5AKZA 3I73A 1TKCA 2I87A 3KJXA 4MI9A 3AUYA 4PONA 2PZBA 2RGGA 4JJ6A 1MB2A 5EJ5A 1B8OA 2BC9A 2O2GA 1XEXB 1GGNA 2P40A 2HTFA 2ZJ0A 4NMMA 3UCEA 1OYWA 4QFCA 3NVKI 2IHVA 1P72A 3WKAA 4C43A 3U4QA 2ZYUX 3BILA 4EBFA 4Q4JB 5F7ZA 1EVIA 1K7XB 2UXDB 3FTDA 4QTUB 1N7IA 2EDCA 2XCSB 1OZGA 3BL6A 5LM3A 2XUDA 3ADPA 3TRJA 1CZLA 3ZDEA 1DB3A 4AF6A 1N92A 3NV9A 1ADJA 4DHWA 4QLAA 2H1RA 3GUVA 3K6SA 1XRJA 1F7UA 3JYNA 3A7DA 3CNOA 1DARA 3VO8A 3OWHA 1X7WB 5FPQA 2H5LA 1WUTA 1CV2A 5HUJA 1Z6ZA 2F9FA 1OAOA 4J1QA 4WDRA 4QJ3A 3V1KA 2R5NA 1VQ1A 2XHZA 3O47A 2ODQA 1P8AA 2QE6A 3BTVA 3MT9A 1KC3A 2B7CA 2H2AA 3T6KA 4LSMA 2D54A 1UQTA 2NUBA 1KVQA 4AP9A 1KI1A 4WCFA 3GCZA 3BJRA 3B3QA 5B1EA 3ICCA 4K8RB 3U7JA 2M6RA 4FDMA 3VZDA 4DR5B 5C80A 1F2UA 1Q6ZA 2YX1A 3V2IA 2JFUA 1QLWA 5BUZA 1UT6A 2J41A 1S5PA 1A9YA 1ESZA 4OUKX 2VDPB 3FFXA 5CGZA 3IILA 4I1IA 1Y8RB 2W8BA 3HV0A 3DO8A 1PVDA 2WDPA 4I4IA 3T54A 2O05A 1RMTA 1DQNA 4IR7A 2QVLA 1ABFA 2JEZA 3HZRA 5TT0A 4DSOA 5CYGA 3LBIA 3W4JA 3P9CA 5FT9A 4ZZ3A 5F77A 4QJ5A 3PVZA 1NW9B 1EU1A 3R20A 3WJ1A 3DHEA 1IHUA 4AMVA 3BGVA 1M34E 1MJFA 2FQQA 3I45A 3L4SO 4C01A 2GRAA 3KTOA 2IXFA 3RSLA 1YS9A 4X1KA 1P1HA 1DVRA 4AZVA 3UMBA 5KQSA 2H4ZA 2IYAA 3A4MA 1NAIA 2JIPA 4HH4A 4OP1A 1OYVA 2C4UA 2YRWA 2AN4A 3U81A 1YUMA 3A9TA 3FI0A 1C29B 2WTNA 2ZI9A 3EHEA 3MWDA 3UYLA 1TVMA 3WHLA 1YZQA 4CFZA 2QZJA 1CQZA 5KX5F 1OXBB 3F9IA 1QH1A 4RACA 2PQMA 5DYNA 3RVRA 5HSGA 5MN5A 2BKVA 4OHKA 2IX9A 2WABA 5CBPB 1CEYA 2GN8A 4E7PA 3PZBA 3HB0A 1YJAA 2QYTA 2X1LA 2I9KA 3FAKA 2C2BA 4HLCA 4DIMA 4EY5A 1Z68A 2JBAA 5ISMA 5LOVB 3ACDA 5EPUA 4D4GA 2H0AA 3SLGA 2WJVA 1VSQA 1ONBA 2NPOA 4C7BA 5IJ0B 221PA 2WSBA 4YQZA 2I54A 2IWRA 3RHTA 4LCJA 1ISGA 4FR5A 1BRTA 4B6GA 1R0LA 2X8JB 3HS3A 2G88A 4OKSA 3DVQX 4XGKA 4R7GA 3UKJA 5EN4A 2FK7A 2XUGA 3M4XA 3L5OA 3WLSA 4IV5A 1QGYA 2HTEA 1MAHA 1Z28A 3ECAA 4O5AA 1P19A 1W52X 1I7NA 2C03A 2ZANA 3KALA 4XFJA 1WQ3A 1U9JA 2REXB 1M73E 1NQOA 3ZVNA 1AV6A 2C9DA 3Q7IA 4DCOA 5KDLA 3OFKA 4FT4A 4IINA 2F3PA 4WXEA 2VK4A 3TFQA 1KFEB 3QNUA 1JU9A 1PF7E 2GAFA 3R09A 3R5HA 4IHJF 4JY7A 3IKLA 1PZGA 5BW6B 2OG1A 4TWBA 1VMIA 3ZQUA 1VBNA 1D2HA 3SXUA 3OQPA 3QA3E 4UNIA 1S9DA 1YCHA 4HRVA 2AJLI 3IKVA 1JMKC 1F0KA 3CMCO 1OT3A 3M0EA 2IPOA 3OFJA 4HUQA 2G9ZA 4TSFA 1OW3B 2VHVA 3FTPA 5C4MA 5KNLA 2HPVA 4MVCA 5AP9A 4UBIA 4F38A 1Q11A 4IZ6A 2YHAA 2ZRQA 4QGAA 4BWFB 3NWEA 4ZEXA 1UZMA 1Q0LA 3LJKA 4WKNA 1RQNA 4H9GA 1SOWA 4ZI7A 4KYVA 1ZNWA 4CEIB 3O95A 2HCJB 3MZ0A 4LC9A 1RMYA 1U3GA 3O4VA 1L7VC 5FH9A 3OU6A 1Q1AA 3SOPA 2YMMA 3TSYA 3SWWA 2Q3BA 2IQ5A 1LLUA 4BNYA 1CDOA 2HMSA 5A4KA 3BCUA 5BQXA 4GPEA 3QEAZ 3IV7A 4PR0A 5EIBD 1P4SA 2WSIA 2ZOSA 4CQLA 2YC4C 2NYRA 2GVNA 3C6MA 4IH9A 4DABA 4XJXA 1ODKA 2RKBA 4CMIB 3IVRA 2FF7A 1ISIA 4OFXA 2V0CA 5K09A 4R7TA 1I2DA 2DP4E 5H7XA 2J9RA 3BRSA 3G2JA 4ZDIA 5EWJA 4FB5A 1ZY2A 1O6ZA 5L3ZA 3IE0A 1AHNA 2I67A 4NOKA 2G80A 4U5XA 4D79A 2ORVA 2ZXEA 4AP5A 1WPRA 4N9QA 2CEAA 3GCWA 3TW0A 3LK7A 1CETA 4TV9F 3ZD9A 2X5NA 4BRSA 5LA6A 1F9AA 1GN9A 1ZM2A 1D4FA 1XVTA 2VA8A 3LUJA 4PW0A 3VBCA 1J4AA 1JQ3A 3E9YA 1OFUX 3MWJA 2E21A 5JD5A 3O2SB 3DT8A 1JX6A 2V0NA 3AJ9A 2PXXA 3FPLA 4RTMA 2IPLA 1T3GA 1DT3A 4NCHA 4D1YA 4DM4A 5C4IA 4WXHA 5FPTA 4IDAA 4X7BA 2EKPA 5IVIA 2J4CA 1MX3A 2QT0A 2I65A 1A7JA 4DLRA 1RHMA 4E5KA 4D8TA 1NYRA 2F2TA 3GGSA 3O92A 3JQFA 5H81A 2X4LA 3FYUC 2YOHA 5AHRA 5LZ4A 2N47A 2ETXA 1CT9A 1OE0A 2IDJA 1CIVA 4HAVA 2MWMA 4ILKA 4IV0A 5EJMA 3B70A 3K0AB 5D3ZA 4MHOA 2W4MA 4DSAA 2QN2A 5CDTA 3OO0A 1H3EA 4Y98A 1R6VA 1ZCFA 3TCNA 1AQUA 2PE5A 4M8IA 3WSVA 3GFPA 3ID6C 3UV6A 1QPGA 2W00A 2OAQ1 1E2LA 4N01A 3IIEA 4PRZA 5KNBH 1E2MA 2D2XA 1IVSA 2GJ4A 1NOIA 3QI7A 3IAUA 5B58T 1VRVA 3JQDA 3PPWA 1GAWA 1CRZA 3AR7A 1V1RA 3NFRA 1XP5A 2ZJFA 1XZJA 5HF5A 1UBFA 2OLKA 5DBHX 4K6MA 3P9ZA 2DZDA 2HWXA 5B3JC 3F8SA 3Q5DA 1Y5NA 3F1LA 1NXWA 1IJKA 1JE1A 1OFGA 2XXJA 5CH5A 3CZMA 5EJ6A 1QTNA 5K0SA 5IUNC 2DPLA 1PT5A 3QUQA 1I4EB 1I80A 3ER8A 3WIUA 2ZVJA 1RXIA 2GDJA 2UZ0A 4FE3A 4PZAA 2NYAA 2PKEA 2P2DA 1RCFA 4F8YA 3NV7A 4MB2A 4FKBA 3SC3A 3UGQA 3DO5A 1Q14A 4UNRA 3DE5X 2H9AA 1C3LA 2Y0BA 3N5CA 1Q7TA 3KJGA 3OIDA 1YA8A 1ZSYA 2HBRA 3O1IC 4RHYA 5DCLA 2RHWA 2VHCA 1Z06A 2R1TB 3SF0A 3EY4A 4JLOA 5C5EA 2ATCA 5EJFA 3L4BA 3VMMA 3UMYA 4W9NA 2OVBA 4O4HF 4ECAA 4Q15A 4L85A 5A4AA 1YWGO 4EFNA 1M6EX 2FFQA 1JB1A 1SBQA 2B69A 2JCVA 4YP7A 3WZLA 2PWBA 2PQ0A 2OGSA 4PYKA 4AS2A 2O23A 3AP3A 5FWDA 3H5OA 4FFOA 3RSHA 1K8RA 4DJ5X 2DUMA 3EIWA 1OH5A 4Z0TA 3AY3A 2P3QA 3HDQA 3GFTA 3AEQB 2O57A 2QAGA 3DTNA 3SBDA 3DZCA 3P5SA 1K92A 2OWDA 4RSHA 4MMXB 4DWOA 3TN7A 1CUEA 2FH5B 2FETA 3NQ41 2Q2WA 2QUBA 4P34A 3G8CA 5FHRA 4YREA 3NHUA 2VHZA 2M6KA 1XF9A 3MN1A 1MOZA 1D2RA 1U5BB 1WHSA 2J6CA 5ALPA 1FF9A 3HYCA 5CYPA 1XNRB 1OLXA 2ZWVA 1ZK1A 3HNRA 1J06A 3ENZA 5I4KA 2G1AA 3CZRA 3SZOA 1KQGA 1KAGA 2CF6A 3VR3A 4DIDA 1NW6A 1XB2A 1L5GB 2RK4A 2DE0X 2H07A 2LPMA 1YD7A 4AY6A 2J09A 2FJUA 5AVOA 5D3QA 3TD6A 4XVUA 2GQ0A 5DISB 1P4HA 2QP3A 1RDFA 4F85A 4DBZA 3CVVA 1CJUC 4IEEA 3HFJA 3V80A 4UAGA 5JQGB 1Z7EA 4ZMSA 4EX6A 1SULA 1M6NA 3W8RA 3PDWA 3A7EA 1D1TA 1CZNA 3GCGA 3NBXX 1U0NA 3UXEA 1G9TA 1UM9B 3FM9A 4YRAA 5A0TA 1XK6A 1OVGA 4Y2SA 3FZYA 5JSUA 1XDSA 3LLUA 4G5RA 5AVYA 4XGNA 3L0IB 3VUEA 1LVHA 1O89A 4KR9A 1JAXA 1LPSA 3HBJA 4R7ZA 3EOZA 5ERXA 1V6CA 5H3CA 1XKQA 4LUCA 2CNWA 3QX8A 3RYFB 2Q1UA 3T5AA 3AVYA 1K5PA 1R0BA 2ZIXB 2QD2A 1RW4A 4OFZA 3DLCA 1H4SA 1CDDA 2IHKA 1BJRE 1W34A 1FRVA 1YZUA 2H5EA 3AI1A 4JJZA 2VPZA 4Q7KA 1LBEA 6AT1A 2AG8A 2KM1A 3IALA 4HEA6 1MTZA 3T9CA 3OMLA 3QELA 1XDWA 4DUGD 1I2BA 5K0ZA 1NUPA 3AFNA 5LQSA 4TQGA 4D9KA 3G8BA 2HUPA 2OENG 4OSEA 5KJ1A 1UJMA 3RGGA 5HX7A 2ZZMA 1E20A 3K9WA 5F5LA 2GD0A 3C3KA 1YU9A 2PM8A 2DEUA 1KP2A 1D2GA 3EA4A 4GP9A 4JBHA 1QG2A 3RYIB 1O58A 1RQGA 2CDBA 5K05A 4TRMA 1FOEB 2QMHA 4ZOQI 3DE0X 4QDKA 4CR8A 3SQWA 3STXA 5L40A 4QXOA 4B3RB 1QUFA 1LQTA 3BDIA 3OZVA 3RE1A 1RYDA 2JAWA 1YZ3A 5A5VA 1EK0A 1ODFA 2YC2C 1E6UA 4I46A 1Z35A 4DCTA 3FOWA 5K0JA 5F3DA 5AIBA 4COKA 4HNRA 3ETJA 3GROA 3ROTA 4DJFC 2IL1A 3KQSA 5AVWA 1DXYA 3CUSA 1WWKA 3I4FA 4ER0A 5IM4F 3EGVA 1OOEA 1Z36A 2O8VA 5AJVB 3GWZA 4BFZA 2RH9B 3U60B 3E3AA 3UWPA 4B74A 4LMRA 1H2BA 3RS0A 2Y9PB 1E1YA 5T4EA 4ZDJA 3LH5A 1XQYA 1RLMA 3OSUA 4KAFA 4Q3BA 3X43A 1WUKS 2JEOA 2DR0A 2XT0A 3Q0EA 5JDCA 4D6YA 1VE7A 1YU6A 4A2WA 1OILA 3DLPX 4G84A 4RTKA 1CS0A 3OZBA 4TKLA 2GPSA 3P4YA 4KFTA 3N58A 4GM4A 5ALQA 4WV3A 4FSHA 2WWRA 3NWJA 1EWRA 1OY1A 3IO3A 4W7SA 1ZK2A 1DAPA 2W2MA 3PHJA 3IV9A 5FBWB 1CLUA 2IITA 3GG2A 4QVKA 3EE6A 5FR1A 5BSUA 2X2FA 4ZKEA 4BUCA 4R9RA 2HQRA 2RGRA 2H1FA 2OOKA 3EZLA 4NS4A 2HA4A 4BMCA 5FWNA 2ESRA 5AKYA 4AG3A 4EB0A 3WIVA 2ZIXA 4QFMA 3F71A 1LK5A 5DEIA 2GO7A 3RHSA 5AVKA 4I8DA 1ULSA 2WEKA 4OTZA 4HEQA 1GYRA 3HJNA 1W0JA 1L8XA 3G2OA 3PNPA 2ZWMA 1YA6A 1POXA 1RZRA 4OQYA 3A1WA 3VR4D 4UTNA 3LQQA 2Z2ZA 5C51B 1RZUA 1XUOA 4MO2A 2HMWA 3LC7O 3CUYA 4LF6B 4XCVA 4URZR 2C4HA 1XCJA 4FT2A 3LWDA 1R9NA 2JDIA 3UM9A 2RG7A 3CLVA 1M8FA 4Y6PA 1Z15A 3CVYA 1XALA 2HIAA 2V9CA 3M4YA 3OIVA 4LOKA 4EFLA 3QUBA 4HWOA 1T2AA 4MUNA 4CG0A 5BO5A 5ED0A 1YUNA 1NR7A 2VBCA 1T91A 1KYIA 1YULA 3E2MA 3GVIA 2FSGA 1Z4LA 3QGMA 1JHDA 2QTBA 3EUAA 4HKTA 1KEEA 1PR2A 4KGDA 4AKEA 2JK0A 2NSDA 4I3GA 3HCWA 4BQPA 5KS2A 1IONA 4TL6A 3N7UA 3L02A 1CEEA 1M2WA 3BJZA 1LDEA 4EVIA 1JYFA 4MJ3A 5AD1A 1BQ3A 2FDXA 5E9JA 4II3A 1Z25A 1I8TA 3SR3A 1XVLA 5IJ9B 1JKMA 1N1EA 2G9UA 5JE8A 3GC6A 1E1DA 4KP7A 3UUWA 5C46F 2P5TB 2W2QA 1ZOPA 1RXYA 2O4UX 4ZZ1A 3DEIA 5EMMA 5TVGA 3UJ3X 1V2HE 3NBKA 5JCJD 1H1TA 3RVQA 3K31A 4BRUA 1PO7A 1RIIA 4N7MA 5M2QA 2BKUA 4UM8B 1GNQA 4MYHA 1DTSA 1NRWA 4I1VA 3MTAA 1VL0A 4G3XA 2HRQA 1SD5A 3D2LA 2RHGB 3IAXA 4LPSA 3LUHA 3L82B 3OJWA 2J0QA 1ZJ4A 3M49A 4DSNA 5DXAA 3W4KA 5LUAA 4M7WA 2ONKA 3ZU3A 1R10A 1BA3A 1ORVA 3KUXA 4IIEA 2A57A 2QQ0A 4AYTA 3GHHA 3LHDA 1JH8A 1T2DA 1YZNA 3TNLA 1RHUA 5F9FA 5JJKA 3THRA 3VDXA 3UAWA 1NG9A 4HVAA 1BWPA 3KWJA 1JECA 1YSCA 1B8VA 3H2ZA 3JZMA 4DCMA 1M34B 1N5MA 3E84A 4C30A 3SIXA 3HN6A 5BYBA 2GN2A 4RPGA 4ZT7A 3W3ZB 2BFFA 5BQPA 5CBKA 1HA3A 1DBSA 1C80A 1PQYA 3CX6A 4XM0A 3MHTA 3FDFA 3JVEA 2OA0A 4Y2HA 4EA8A 2ODAA 1MDBA 3MRXA 4XWAA 1P1CA 4NF2A 2J67A 1U6KA 1JHVA 3AB7A 3LLVA 4DQKA 3OOEA 4H2DA 1Z4JA 3NC0C 5JVDB 2OP0A 1IM2A 3L7IA 3RAJA 2RHTA 3GBPA 1QC5A 2HV8A 4NH0A 4PC6A 4MPDA 3W78A 5DCWA 1I1HA 4FCTA 3KQWA 2BMVA 3TNYA 1VMKA 4YJ3B 3EXEB 5JAHA 1E3DA 3LTNC 1N8TA 2NVOA 2QRZA 4LQCA 3UICA 3RAPR 3ZW7A 3HA2A 2FSVA 3TFOA 2JI7A 3MJVA 2XPCA 3LWNA 1FJ2A 1I4TD 1G5FA 1PHRA 1TPZA 2W6IA 2HAEA 3CEPB 3JSAA 4QOEA 2OTCA 3TSCA 1QYXA 4PX9A 1NIJA 5E3IA 3F67A 4PN3A 5JISA 1Z22A 1TYDE 5DBEX 2E1PA 3LY7A 3L92A 4EMBA 2Z0MA 4FSDA 3W04A 1EGMB 1QZUA 4HAOA 3FI9A 3OURA 4BMDA 1SBTA 3PXEA 2EATA 5CPBA 2CMDA 4L7QA 5HHTA 1H8HA 3T4XA 1XEFA 3WMEA 2CY0A 3C8UA 5FUYA 1SC1A 1ZONA 2WYWA 1YJ5A 3TAXA 3Q72A 2EDAA 4M0EA 5HKLA 5BMOA 2XV1A 2N3ZA 1EGAA 1ZD3A 2YINC 1ZIPA 2PKQP 2XTAA 3EA0A 1ULZA 1KBZA 2NO1A 1FDIA 2A0FA 1Y63A 4OAPA 4YK7A 4PYIA 3KKPA 3M6VA 2O5EA 1EE9A 1WXEA 4MQFA 4CMGA 1N9ZA 2FWRA 3IVAA 4OXQA 2CLFB 3M5CA 1JDVA 3PQ7A 4K0RA 1U1FA 1TIPA 2WU0A 4P36A 3OEHD 1JH9A 3WZ2A 2BFFB 5B1HA 2A5LA 4I6GA 3PHIA 1W46A 1UBJS 4HLUA 1FRZA 1HQDA 3JWEA 3UJNA 1GAXA 5KYUB 3LC1O 1SRQA 1PDWA 2I3AA 1DAEA 5LYYA 4BZXA 1DS6A 3MTEA 4JLDA 1P74A 4ES6A 2EG9A 4K9OA 4L5BA 4LN1A 1JEYB 1HY3A 4JJFA 4HMOA 3GLGB 1NYQA 2QRVB 1DC6A 2ATXA 5PGMA 3ZZ0A 5F2EA 3D5TA 4F0JA 5BV7A 3LWBA 3JATA 2ADFA 1YOVB 1HDXA 3JQ6A 1NI5A 4QU5A 4XCXA 2MCFA 3RFXA 2XDQA 4U7FA 2I33A 4G26A 4NCNA 1BD4A 1PL8A 4FMCF 1CJMA 1C3JA 1L3BA 2X2EA 2Y1KA 3CTMA 4X3CA 3OEHA 2PS3A 4GSKA 1FSPA 4O5OA 3K6KA 2P6RA 1P4GA 1SELA 5CA1B 5HEKA 1EWVA 1YOBA 2C97A 1UODA 4L5CA 4QBGB 5D3MB 5DM1A 3TXYA 3GP5A 4KG7A 2IX3A 1FS6A 5EZYA 2YCBA 3KHSA 2QY9A 2UYYA 3FDXA 4RK4A 4RZ3A 2ORYA 4YAFA 5BURA 3PGVA 3DAPA 4V02A 1D8AA 3K9QO 3LFTA 3CLSD 1FJGB 1BEUB 1SEVA 4YI5A 2IIPA 2EIXA 1NVMB 2JFYA 4LQLA 5JO0A 2ECQA 4MVJG 4DEXA 1PR0A 5HMMA 3EW9A 3I28A 1E5LA 4BWGA 3QFCA 4H1WA 1GUFA 4Z86A 1J0AA 4N0DA 2YWGA 2IEBA 3P8ZA 3K32A 2XMDA 4E2XA 4RGVA 5JNRA 1E2QA 1E2DA 3G2QA 5AT1A 4A16A 5ALHA 3S5UA 2CE7A 4M9ZA 3MBKA 2ZTUA 1TIKA 3B1XA 1G2QA 4UTVA 1C0IA 5FOTA 3EPLA 2G7ZA 4MZDA 4CF5A 1P2TA 1VFNA 3D7LA 4PYQA 1TO6A 3FYCA 4D74A 4I99A 5A6SA 5HKBA 5C7OO 1TT5B 1ZINA 2AXEA 2E4YA 3Q7QA 4M87A 3SPXA 3SJ7A 4PV7A 4HWSA 4ZVRA 4K9KA 3G1WA 1X1QA 1D2NA 3RKRA 3VC1A 1CULC 2E4AA 4G1FA 1GAJA 2RH8A 3O74A 3G5MA 3ZJUA 3RC2A 1N9GA 3T8YA 4EG4A 4MW6A 1Y3FE 3NJ8A 3EY9A 1EZ1A 4JCCA 5HK9A 4CJXA 1XR3A 2C07A 1MUUA 4TKMA 1XTJA 3VR4A 3G85A 4J8PA 1CYDA 4V2IA 4ISCA 2PUDA 1YRHA 2XMZA 5JCXA 1P81A 4GRAA 1R9MA 3UBMA 3ZLUA 2V97A 2VJYA 1L4NA 2V7BA 1X6VA 2A2ZA 2C5HA 2I1QA 2JIQA 4PNPA 1FP2A 2ECPA 2ZCUA 4QUHA 3ROKA 1OXVA 2MT9A 4EBBA 1FMLA 2R7KA 4KB5A 4WTOA 3H2YA 2EU8A 2Z2JA 1DKOA 4BRZA 5EJ8A 4ZIRA 1CG6A 1SG0A 3G17A 4PYOA 1W2WB 1GKIA 1NFRA 1J0EA 2O5RA 2PZLA 4JKIA 1C3VA 1Q6YA 4X95A 1R18A 2YN0A 1KZ7B 4MQ4A 3IIKA 5F7OA 3IQFA 1Q22A 3H4TA 3S2EA 1HWYA 1Z38A 3T0IA 1OAKA 2AW5A 2Q62A 3MNFA 4ER5A 1P44A 1TYZA 2ZT6A 3MXOA 3C5CA 1JIVA 5AM4A 2OVFA 1E2IA 1NBHA 1GRCA 1UPBA 1QH1B 2PUGA 1U3DA 4BN0A 3ZHQA 3TTXA 1BE1A 4Q3OA 5ANRB 2CXXA 4TKUB 2ZXUA 3N2IA 1KI9A 2AOXA 3LBFA 4XE5A 2FLVA 1UZAA 2GZSA 3B1VA 1QV7A 2XWJI 4AW9A 3ULKA 5IJ0A 2RAVA 3ZE9A 3W5JA 2VAWA 4V39A 5BPFA 1YIAA 4JSRA 5IWAB 2PT9A 4M22A 3BXZA 3FUTA 4JQSA 4HWGA 1GEGA 3ZTWA 4BNLA 4E09A 1CR1A 1EXMA 3TLKA 1QYVA 4LKRA 1PX2A 4Z54A 1RRPA 4LYHA 2ZRLA 3GDHA 1HKUA 5KX5A 4KDFA 3SZGA 4AZ0B 3BA1A 2XSZA 2VUTA 1GAEO 5ELXA 2PZMA 3OOHA 3VGPA 4TVKA 4RAQA 1W88A 1F0YA 4BCCA 8ATCA 4D4LA 1GPKA 1HOTA 1ZJJA 1WV1A 2NWQA 4LYEA 1BN6A 2ZUDA 5EHIA 3TZCA 1YCFA 4IXDA 4BECA 1S3SA 4DIBA 3ROGA 4HQKA 4GM0A 3DLIA 1A88A 4U2EA 2ZSAA 3MPUA 1PW5A 4Z2YA 3WGKA 2OZLA 4XWTA 4NMHA 5TSDA 1DAHA 3C43A 4GQIA 2CBXA 3WK6A 4ND6A 1U7HA 2GYWA 2MMCA 1HC7A 5GP1A 2XMSA 2TMYA 3SYLA 2GUGA 4ARCA 2CBGA 2VH1A 2OMKA 3A2MA 2XXAA 3DJFA 4CCAA 3KWMA 1K66A 4DARA 4BVKA 3CSUA 3IPXA 4NABA 3V8NA 1T5OA 1NMZA 3S2UA 2HW8A 2Z4RA 2Q0HA 2FRDA 5ERYA 2PBFA 2O3TA 3A27A 1RHRA 4G5QA 3ER6A 5LMNB 1XU4A 2KBEA 3WXBA 5A3VA 3FWYA 4G24A 2B36A 5I9TA 1ANKA 2OGUA 2XYRA 4WNYA 4WY2A 2BFBB 5D5PA 5SY6A 2AK3A 1CP3A 1Y8QB 1ZCBA 3PDIA 4OBBA 3CH6A 4DMFA 3OM0A 4NOJA 1U28A 5A3QA 1ZW1A 3VNAA 1R0CA 2D8MA 1WBJB 1KZ1A 3W6NA 2W22A 3L4KA 3ORRA 5C9ZA 2QW1A 1L8AA 4D45A 1GVNB 5KO2A 2RAFA 3I05A 1KDOA 1MB3A 3SG0A 1FVOA 3AETA 3PRHA 4BU0A 4NE2A 3UT5A 4CM4B 3ORFA 4LTMA 2BM8A 5CHEA 3EPHA 2FPPB 2EKZA 1PS8A 5LA6B 5DNWA 1Q19A 1Z6TA 1KTIA 3KV1A 1V8DA 4NBUA 2HXSA 3FSGA 2B3DA 1BHQ1 1TA9A 3I9KA 1E3TA 1PGOA 2G07A 2R86A 2Y67A 3PS9A 3R6GA 4YXWA 4C4OA 4I9NA 1IUKA 4GEGA 3RM3A 1LRLA 4X71A 1FDRA 1Z4PX 3AEYA 3WWCA 5A02A 3L1UA 5GGXA 3WFZA 4DZRA 1T6ZA 2OFWA 3OJFA 1NQUA 2PMWB 1ZK3A 1YI8A 4WADA 3K9NA 4KAAA 1KMHA 2W2VA 1DIAA 1W8IA 1E79A 4MKFA 3AFHA 4Y0VA 2E89A 2AD1A 5JXJA 4A6XA 1ZSNA 3H13A 1ZNYA 4UEQA 4MW9A 2ECKA 1TLFA 1C50A 2PRKA 4KXYA 2H29A 1RLTA 3NDJA 3NIBA 1N1GA 2D00A 3OCZA 3PD0A 4FGKA 3ZIAD 5FCDA 1VOTA 2P9FA 1X70A 3HBFA 3JR3A 3NORA 2NIPA 3C3BA 3N6VA 4QUGA 4EG5A 3OTIA 5CEEA 3UJPA 4B87A 1T3TA 4BFUA 3MM4A 3QRWA 1PUXA 3U9TA 3THWA 4JKYA 2DQKA 2IK8A 2NZ8A 1FP7A 1IUNA 1V1RB 3GPDG 4M49A 4WOJA 5FEMA 2NUAB 5A5DA 1UC9A 1TO2E 2H1SA 3DTVD 1SKAA 2PG3A 4GICA 1U5CA 3STWA 2CXRA 2O3JA 1RJ9B 4A6PA 3KU4A 1OR8A 2Z4TA 3RYCB 4YNBA 4RULA 2QLJA 3OQMA 2WWFA 1NLYA 1S4MA 1SKBA 1SJ9A 3AB3A 3JRXA 3QMWA 3ESDA 1DG1G 1RR6A 4AXBA 1V2GA 3OEWA 2VJOA 2EV9A 5ALWA 4BMSA 1XTUA 3KSDO 2G83A 1N3BA 1TL7C 1SK9A 2ARKA 3PTLA 3DW3X 4IIFA 4BNDA 3EVNA 4OHBA 4ZO8A 4PO3X 3NIWA 4WCDA 1YACA 4ZVSA 3LXUX 5HW0A 3R44A 3BKXA 1NSTA 1YR9A 1LDGA 3I42A 3ASVA 4CU2A 3HB5X 4M1QA 5C53B 2ID7A 3HWX1 2V54A 4UVGA 2AUTA 4DLUA 7YASA 1W44A 4MWDA 4ETWA 2Z58A 3KEOA 3VMFA 1KR5A 1MC1A 2EF0A 4H6WA 3DVAB 2WM2A 1L7PA 2PT7A 1EMDA 4EGSA 4BLTA 3DV9A 5F52A 3BXGA 4GI2A 2GFHA 4L9RA 2GJAA 1OV4A 5G2OA 1W581 1CZHA 3RVDA 4GDMA 4I1OA 4LY0A 3H87A 3BHIA 4CM6A 2FW7A 2HEGA 1QG0A 4KWTA 3E22B 3QKUA 3ZBUA 1HDGO 1KR2A 1UEIA 1V9SA 3GZ4A 4IP0A 3RASA 5CDYA 4HQNA 4C1NA 1MHTA 2I6UA 3A2LA 3PIIA 1ZVJA 2C7BA 2KHZA 2R4QA 3QOXA 4FLMA 2HHJA 2GXUA 3UXHA 4C7OA 4EG3A 5CMLA 2Q8NA 2XT9A 1L4EA 1OLUA 2GBGA 1DIBA 1SCKA 3UJCA 1DBVO 4HHEA 2AMVA 4DIKA 5AM1A 5AKGA 4R1OA 5CDUA 1ABBA 4I1SA 3PYMA 4LZOA 3P2KA 1EFCA 4N41A 1RRKA 2XLCA 3UJAA 3ROZA 1ZIYA 3KCNA 1NSFA 1QRRA 3ZKWB 1A8PA 2E6UX 2E85A 4DKXA 4UTPA 3HA7A 3Q2KA 4BU1A 4YCCA 2A1TR 3LT2A 2PL3A 1E2KA 3G68A 4F3TA 5ALZA 3R5XA 2G6BA 3H0EA 3BMCA 1XXLA 4PGMA 2R5FA 2QQFA 1PL7A 3BE5A 4LOJA 4PZ9A 5DBIA 5J5CA 3ZHYA 3U4IA 1T0IA 4DNQA 4F4JA 1N5LA 4Z1MA 4DJJA 4DGQA 1NM5A 1XAJA 4QL3A 4A0SA 1G8KA 1P4JA 1TLLA 4A27A 4LMAA 2PVPA 2JASA 1P5HA 3ASUA 1B6GA 1FX1A 4IBOA 4UHCA 4CODB 2AN9A 2QRKA 1JIJA 3NC1C 5KKNB 1L7XA 1CZKA 3MBIA 3ZZNA 3F5MA 3C41J 1N2CE 4Q5IA 3H7IA 3ZCXA 4BKQA 1JTEA 1W0CA 3KTDA 1ZK4A 1AO3A 3MB5A 3MJEA 5AH0A 4D9BA 3SLRA 4B3TB 3K96A 2DOKA 3IRVA 4R6XA 4Q1AA 3TQFA 4GW3A 5HOEA 1JWAB 2O2XA 3HA3A 4C89A 2BVNA 2GBFA 3D5EA 3I2KA 1QX3A 1Q74A 5HS4A 2QJWA 3RTBA 3MCWA 1H2FA 3V9PA 3WLAA 1PVVA 1AH2A 3IXQA 5DLDA 2D7CA 2ZATA 4UXHA 4ZO9A 3SQXA 2RI1A 3P9PA 4XJSA 2R85A 3GNSA 1X80A 2WW8A 2Y66A 4JSTA 3W3AD 4B6OA 1NDUA 1XZ8A 3INNA 2WFLB 4KJXA 1I33A 1WMEA 2FZ4A 1KK2A 1QCDA 5EXTA 3TQIA 4R9SA 4EQ6B 1E3LA 3UXYA 4N82A 4HGNA 3SC6A 2X5XA 3U7EB 5BR4A 2GEVA 1CQPA 1SKMA 4F46A 3KQYA 3E53A 3IUYA 3NPAA 1W36B 4KIFA 3KUKA 4XFDA 2J0SA 3W6UA 3DOOA 3RYIA 3CG0A 1RU3A 4NBRA 2XW6A 2GFIA 3ZBPA 5IARA 3BJMA 2HSJA 4B8YA 3LDUA 2J0EA 1FLNA 5HK8A 3OHMA 1NBIA 1QH8B 4EJFA 1PNRA 4RQTA 3SN6A 3FWHA 1PD1A 3MCTA 1QAMA 2MSEB 2FY8A 1QGUA 3OF2A 4TLLB 5IJAA 2MIIA 4RGBA 2H4YA 4OHYA 2OQVA 4G1MB 3OMWA 4C7XA 4LFCB 3ZYZA 4YV0A 4FJ0A 5FBLB 3RTGA 5JS6A 4KVGA 4R0NA 4D81A 4GBJA 4FB4A 5L6MB 4BMXA 1TJPB 3H3FA 2OBYA 4CQMA 3B9QA 4E1AA 2B30A 3N0TA 2ZIFA 3BXPA 1OBOA 3D3NA 4LZLA 2QBYB 1DFHA 5D01A 4FBGA 2H2IA 1L7BA 5E6RB 3P9IA 1MMFB 2XLBA 5FL7A 2PGLA 2UXCB 1PK7A 1JG7A 1YI0A 3JQAA 4DRYA 2CMGA 4GU5A 1RWVA 5EIFA 4MDEA 4RY9A 4C4RA 1U9IC 2HDHA 4G4IA 4PXSA 2C9CA 1U7UA 3PV0A 1OIVA 4JYCA 3M6AA 4QOJA 4C0XA 1VXRA 2AN5A 2R6ZA 2OHJA 1YBMA 1Y9AA 1QLHA 4B0OA 4INPA 4QPPA 4BAUA 4DMMA 1R27A 1QYIA 1SD1A 2F9LA 5GTDA 3UENA 3L18A 3KAQA 1QDEA 1P3Y1 3DBRA 1EUQA 1WVIA 4CLHA 2EG5A 1YDWA 3CVWA 3AK4A 1C0LA 1U6IA 4IIDA 4L8LA 2OLJA 2XHEA 2X6QA 4MYCA 4TM7A 4L3VA 4PZDA 4XM2A 1FTGA 1X1RA 2ERYA 4FE4A 4JV5B 1L7DA 1U31A 4OO3A 2GDZA 4EQ6A 2GKGA 4MWSA 5F1PA 1GYQA 5CXSA 3WICA 1YMVA 2IXDA 2QN7A 4I1PA 4AU1A 1SXIA 2YRXA 5IVHA 3SIRA 5KI6A 3FKSA 4NFLA 2H4XA 3K09C 5CURA 1ONOA 3X2SA 1VLLA 1K06A 2X3UA 4Q1VA 5H9WA 2H92A 2UDPA 3EQZA 4YRMA 4B9AA 3V8QA 2J9FB 5JDCC 3BGWA 4KL8S 4UREA 5D86A 3SFZA 5DM70 4ZKDA 3OQOA 1P7YA 4E6PA 4RK0A 5AFSA 1Y9ZA 1LI7A 1QK4A 4DRXA 5CEJA 1SY7A 1PFVA 2NZVG 2WJZB 1NU8A 1GGHA 3OPMA 5F2OA 1DQYA 4D8UA 1OQAA 4CW7A 4XW2A 2RK3A 5DX1A 5EIXA 4F72A 5CLLA 3MJFA 1OV6A 3GLSA 4WLUA 5I7RA 2Y4OA 4NL4H 3WL5A 3PJGA 5E7QA 4L0CA 5F76A 1XD2B 2VF2A 2P4UA 2PO7A 3ND9A 4MKRA 5CGQB 4N0EA 4OP3A 1SHLA 1I0LA 1Q20A 3FGZA 5JHGB 1O8CA 3JARA 3WP1B 1UR5A 1ZBDA 1YDEA 2MTBA 3AONB 4JUAA 3WDLA 1UIMA 4XZ3A 3KZNA 1CHNA 3V3TA 3MD0A 4XH9B 3O8OB 2H06A 4L8WB 5EJ2A 2G06A 3CLRC 3M7IA 2WU3A 4MUGA 2P9YA 2VOEA 3K1JA 1EDZA 2I22A 3H86A 4RS4A 1SA0A 3QE0A 1OWPA 4XQ0A 4CF3A 5F3WB 3OZUA 3GLTA 4D80A 2YDYA 1N5OX 3T9FA 1G1AA 3E6AA 1Z47A 3GQBA 4LWPA 4BNMA 2ZB7A 4N5MA 3V1UA 4EVQA 1P1RA 4W9NC 3JQQA 4MULA 3T5MA 2YHSA 4KQFA 4I6EA 4RS3A 2HADA 1C4KA 2GCOA 1G7TA 1LK0A 2DT5A 2OD7A 4X1IA 3WZMA 1FU7A 4XVHA 1K08A 2CLIB 2BKAA 3Q3CA 4NZPA 3UJBA 5B64A 2ZIVB 9LDBA 1ZOOA 2XZOA 2WD8A 3CVOA 1ZGJA 4KXXA 3PE6A 2VRCD 3ZGOA 1PTJC 3TR6A 3CN7A 1THZA 3YASA 3EMDA 3OWXA 4A5SA 3JASA 5IPFA 2PGOA 1EE1A 2DMRA 4WGFA 3D7KA 5DM60 2WJHA 4RK5A 3BT7A 3WGTA 1M6HA 3H1GA 1P1FA 1PK9A 1OZFA 3EK2A 3OZEA 2BAGA 4NP6A 3VHQA 4M7RA 3LX6A 3NTQA 1HDRA 2MINA 2BFCA 3AR8A 3Q3VA 4H31A 4XVRA 4P2BA 3WRXC 4CM1A 2C88A 2ISSD 2ZUBA 1Z5UA 4O8ZA 3TRHA 1Z0DA 5SV2A 1G7RA 3SE7A 2E5LB 4J0HA 1Z7GA 2AH5A 3THXB 3MGGA 4LOAA 2JW5A 4B6RA 2FZCA 1GUYA 3CLSC 4QODA 1EKXA 1YFKA 3GW8A 5FHQA 1JHQA 5CH8A 1JE0A 1XCMA 3LX8A 4BQRA 1VLHA 2B1IA 3VJKA 4F4HA 3UK1A 4B3MB 2ZCJA 1RHKA 2O8CA 2OO3A 2NSYA 3EQ7A 3ILSA 3R8CA 2A78A 1XVAA 2BFWA 1BMTA 4XCQA 1EA7A 2PMKA 1WRBA 1XLTA 4RANA 3S1SA 2V74B 1T5SA 1P2FA 3RT9A 2QRPA 3VR0A 2BI8A 1Q84A 2EQAA 3MJTA 4FPXA 4HN9A 3UUGA 5CT5A 2QNIA 4LHXA 5ALJA 1S3GA 3V7FA 4B33A 3SVTA 1ZAYA 5A2QA 1F20A 1RD4A 4LWZA 3ZE6A 1I2CA 4BEBA 1JLRA 3IQGX 3P4XA 4EUSA 1R5JA 3GZTB 4KQ6A 5JFGA 1JT9A 1PDVA 2AS0A 3LNTA 1JTVA 3MEQA 3LUBA 4IUCS 4ZWNA 1U7PA 2OBNA 4I4NA 5T6BA 1QMGA 4GYWA 3G49A 1G98A 3NT4A 4BV2A 4IQFA 4NXMB 2ZEJA 4NKRA 5G4KA 1NVFA 2ONCA 3NH9A 2O8EA 1KE2A 5BW5A 2Q2OA 1G18A 3QEKA 3PFNA 4EARA 4ZVOA 5KSOA 2QX8A 4WHMA 4IEIA 2FUCA 1WB6A 1WCIB 4NFHA 4OI1A 1WPGA 1F60A 3SJBA 3HMQA 1A5AB 4EY6A 1KEPA 5AR1A 5BWLA 2QE7A 5AI0A 5JY1A 3KVOA 3UGTA 3R6DA 4HPXB 1N2IA 1XZMA 1PCXA 3KOMA 4FW8A 1SZCA 4R05A 4LXQA 2FR1A 2I76A 3DG9A 3REFA 4AZSA 1FS5A 4YMGA 1L5QA 2D0DA 2YW2A 4RY8A 1JPNA 2HUNA 5ICGA 5JQWA 3GGOA 1F0NA 5TGTA 3KXDA 1LDNA 5FBZA 3K1AB 2QORA 1JS1X 2O8NA 3S2GA 2PXCA 2OFPA 4ED9A 2DWPA 1B6RA 4V0ME 4O1IA 5ICSA 4OX9B 1J8VA 2PX2A 3N0WA 1TEHA 4LSWA 3FHTA 2PAFA 3I8SA 1T5LA 2BGNA 1ZD1A 2VZEA 4ZEVA 3QXGA 5JWHA 4EB6A 2JCSA 2LBPA 5FO1A 2ZPTX 1DTWB 5L9AA 4WLFA 5AI4A 3DONA 3L05A 2IELA 2QE7D 1SVWA 2CUTA 5JTUA 5DYIA 1EEHA 5DMHA 2RGNA 1G1MA 1DWPA 2QJRA 1UKZA 2ZUCA 3T5CA 3IQZA 4Z7JA 1VA5A 3CW9A 2DERA 1EXDA 3OC0A 2PH7A 3I58A 4UAUA 4RZXA 5EERA 2WQ6A 1G6OA 1YE3A 3RR2A 2OCBA 1K7EB 4PWZA 2H1OA 2WTMA 1XTKA 4FKZA 1MJGA 4ZPXA 2SCUA 1VGQA 4WLEA 3CF4G 3SSMA 3ZCUA 1IYZA 3R75A 2FF5A 5DW0A 4IJMA 5AVUA 4GZ6A 4DV6B 2G1KA 4MWTA 4DWVA 3CT4A 3FLMA 1SZJG 3G82C 5DU2A 3OZIA 1P0MA 1JYSA 1RQ7A 3T4UA 4EWLA 2BUAA 4DC9A 1XXHE 3AT1A 1SUEA 3DWFA 3I6YA 4OUDA 3W7AA 2NV6A 3KHUA 1J2YA 3LPNA 1IB6A 5HMLA 1Z45A 3CLKA 2W43A 3VTAA 3PIRA 3K8YA 2JFPA 5IHPA 1TZ2A 4B6SA 2OKCA 3C3EA 2GD2A 1M6VA 1P9OA 4G5OA 1M8PA 3QU2A 5BN4B 1V39A 2F6RA 3SJZA 2EJVA 3Q0IA 3KSUA 1HE8B 2BGLA 4MHTA 2NGRA 2QLMA 1HEIA 2P41A 1Z7WA 2W6CX 3D6VA 4DY6A 4X7MA 5CB4A 1QP7A 5F23A 4TTJA 2IYLD 3A70A 1YR7A 2EGUA 4TWIA 3NTVA 5EXPA 1E6LA 3LNCA 3V1MA 3IBCA 4O2RA 2CV2A 3VRHA 2GZ3A 4P54A 3AP1A 1CUIA 4DJDC 3JPWA 3QJYA 3GDFA 3RBZA 3TLZA 4YUAA 3ZWWA 4EJ0A 1F6DA 1YS1X 1U8YA 3L3BA 4MJLA 4ZVTA 5KKAA 1G3IA 5C31A 4YFVA 4BQOA 5BSFA 3PQEA 1FVFA 4GD3Q 2EVWX 2DT8A 2GZHA 3NS7A 3R7FA 3GR6A 3PNYA 5JNUA 1FE8A 1X13A 2C4MA 3PGJA 3C3AA 4LX8A 1C7EA 1SUAA 1AF4A 3LPCA 3VOSA 3MWYW 4IFEA 2RONA 3E9ZA 2DQ4A 2JI6A 4FYXA 4ENRA 3DMNA 4CKCB 3SC4A 2PWAA 5KHAA 2IWHA 1HDIA 2PPLA 1MPXA 2GERA 5K51A 2PWYA 2BYTA 5FA6A 4YMHA 4KVAA 3IR7A 1Z26A 4BJ3A 5KQGA 5AM0A 4XUDA 4R0MA 1H66A 3KPUA 2ADMA 5EUBA 4MDYA 3GA0A 4FOTA 4NDNE 4NH4A 4MI3A 3WMGA 5JAQA 4G0VA 4JBWA 1WY5A 5E3JA 1DEXA 4BEJA 2NOAA 1XZQA 1M2FA 3ZDDA 4TQ9A 3CX7A 1K86A 4FNGA 5EKTA 1AQ6A 1ZW6A 3NGLA 1PJCA 4W1QA 4FFPA 2Q7OE 3TL2A 5HXAA 1UDXA 2F17A 2OD9A 3K4HA 3NRJA 5JZMA 3ML1A 3CWZA 1U94A 4QJIA 2O7RA 3I9JA 5DHQA 4B7CA 1WIWA 1E1QD 2XCIA 4B2PA 3QBDA 3KQHA 3FETA 1W2HA 2AOUB 4FNOA 5KU1A 1V4NA 4L78A 4CR6A 1ICEA 1ZOSA 2QL9A 3ET4A 1IATA 2VT6A 3V8BA 3DEAA 1G38A 1HKHA 4GGMX 1E9SA 1A9PA 4HDRA 3SX0A 4GF5A 1ETUA 4M55A 1Z0UA 5AW3A 1JHPA 1N7HA 2P9JA 3IPLA 2ETVA 3NPMA 5L53A 2HF7A 3IKTA 2B6HA 1GRRA 4XGIA 4U00A 5CLGA 5EEHA 4Z9YA 1O9HA 2AJCA 1J1UA 3V97A 2QI9F 4ENQA 4WAUA 1W59A 3ZVLA 1JL3A 4GP7A 4YLGA 1KC1A 2H51A 1MH1A 4ZQEA 1GGJA 1Z29A 1DKLA 1GLVA 2IE0A 4BKPA 5JS1A 1LF5A 1RC1A 4EATA 1QV9A 3CNEA 5EHQA 1N7GA 4ICIA 2OAP1 4DXAA 1MW9X 4KKVA 1J1IA 2RCYA 1CJSA 4HGPA 4UM7A 3WL8A 4TTVA 4PQGA 3QTLA 5CU7A 4DR6B 2CFCA 1CFJA 2QX6A 3HDVA 3MWGA 4GR9A 1G3UA 1AQIA 4QNNA 2PANA 1Z12A 3W06A 3TG2A 2QVGA 1PN3A 1YVRA 1LVUA 5BSEA 1KA9H 3QVJA 1F6WA 1FDVA 1SMKA 2IF0A 3BD9A 3MB8A 4H3KB 1ENOA 3JQEA 1JQLB 1ZS9A 3F47A 4ZHQB 2Z2KA 4AVYA 3D6HA 4TPKA 1ECJA 2TS1A 2CK3D 2D5IA 2I6TA 2RMKA 2I91A 3CPEA 4A82A 4I1RA 2ZUUA 3AVUA 1V4BA 1Z5ZA 2NTNA 4PGFA 1B93A 1IXZA 2VJNA 2Z1MA 1N5RA 4ZQGA 3D8BA 3T1HB 1AA9A 2CZGA 3N8HA 1ILEA 3B6KA 4OJTA 1RZ3A 4KIUA 3EAGA 1Y3CE 2OR3A 2H2DA 3LP6A 3C16C 4I8IA 4BIIA 5F2NA 1NW5A 4X45A 1OZ0A 4NPCA 4D9FA 2C82A 3LCRA 2QGFA 4FK8A 3GFRA 5IJZA 1U3UA 3EPRA 2ZUWA 2EZ9A 3L1JA 3M6WA 1YRWA 1JFFB 2R11A 4HH3C 5CXQA 2AOUA 2GCEA 2YVLA 1I0ZA 1I1OA 2F62A 2J46A 1P2BA 1AKRA 1YKGA 3B8HA 3CH7A 4L6IA 2QTMA 2VEOA 4LCBA 2V4MA 3EQ9A 4RJ2A 4UCFA 4ZCPA 2EP7A 4FN5A 4BO7A 3VNVA 2HPZA 2X8WA 4IOKA 4WUVA 2IODA 4ZYLA 5B4VA 1L7AA 4Z49A 3DSRA 2RD2A 3EVZA 4S0ZA 4Q9LA 1E4EB 5EMLA 1T3LA 3GXBA 1F38A 2RGEA 3LPMA 5C1IA 3WMRA 1PW7A 1JHYA 2AFRA 3K0BA 4EMTA 1DBWA 2UU9B 4HLUC 5JJ5A 3QY0A 4RZIA 4KQCA 2VYVA 4G1UC 5SY4A 4HQLA 4BB6A 2PVCA 1A9XB 5JOQA 2ODTX 1K6IA 1M6YA 3DTVB 3RRZA 4PG8A 1Y6GA 2VBFA 3O7WA 5DHPA 2VDLB 1YB2A 4CMJA 3KUDA 1P18A 2WNIA 4XYGA 1DCMA 1JVNA 1XZCA 2FFBA 3ACBA 4CIDA 3KYCB 2ZI3A 4LZAA 3BMQB 1G8JA 1Y6RA 4KXUA 4PRYA 3ZV6A 1RM4A 1HYBA 1QB8A 4CM9D 4NNOA 5C8YB 2GPJA 2R00C 1RYBA 2J59A 3DFMA 3PG5A 3C48A 3GAFA 2VPYA 5KJ6A 3O82A 1E3SA 3ZR4B 4EG0A 3ILYA 3IP5A 3UCXA 4GPTA 4UD6A 4CPDA 2YY5A 4P32A 1AV7A 1R6AA 1E92A 1UPCA 1ZMRA 2Q9UA 2QLLA 3Q9SA 4RK7A 3RVSA 4DIEA 4NZNA 1FP4A 1R64A 2COKA 3H8WA 1XD9A 2B1GA 2PTHA 2P3OA 2WIDA 3WJ7A 5FOSA 1Q7GA 4KDRA 3GRYA 1JFVA 2O6HA 4LTDA 3K1TA 4P22A 3U61B 2G0NA 3MUFA 3NVAA 4D3DA 4ASUA 3FOAA 4XR9A 2V6GA 1Z4MA 2Z08A 3WGGA 5L3SA 1G3MA 2I4OA 4JROA 1XHFA 3NBQA 3O7MA 4PNHA 4R2IA 4J49A 1L4LA 1E6WA 4WJZA 5EAIA 1GM5A 3NDBB 3LD9A 3AL3A 3DHYA 1R5OA 4H3SA 1VJCA 3P5BA 2GM3A 3JAWB 4Q7MB 4ZAXA 4E08A 2NU8B 2VF8A 5DZSA 3SOZA 1K4KA 4C0LA 1GDHA 3RYFA 4L8YA 1HG1A 4B32A 5F98A 3E5NA 2PGAA 1YCDA 3IHKA 3WO0A 4LIPD 4Y9SA 7MHTA 4C6TA 2Z3WA 1E0KA 4CFYA 1KARA 2RBGA 5B3LA 5FXMA 2PS9A 2PMBA 2CC2A 2VSXA 3BIXA 1XVIA 1C81A 1FQJA 4G25A 2VUUA 4BJHB 5L3VA 2R7MA 5EZSA 1XJ0A 1VE1A 5IC6A 1IAQA 3AWDA 3MOGA 3EBOA 3W7BA 1YO6A 1LH0A 4Y2XA 1ISHA 2VK8A 4PLCA 4BZQA 1SKUA 1Q95A 4O4IB 1N34B 1R8JA 1T0BA 3IJEB 4G0UA 3AERB 4OYLA 3STTA 3V5NA 1L7EA 2OO7A 2ATIA 5CAEA 3PNVA 2IP2A 4OY3A 3EEYA 2TRSB 4U7WA 5FNVA 1IM8A 4AJLA 2E18A 3KSRA 1PLJA 2N42A 4GSLA 4IH1A 2AF4C 1X39A 1W0JD 3OLZA 5FB3A 5CA1F 4GOOD 2YUIA 2O0HA 1A9OA 2V1UA 5HE9A 3PWZA 4IDGA 2HXYA 2QWXA 4JEMA 1QGZA 3ANTA 1XL0A 1KRXA 3IOCA 3OWOA 4MP8A 3KZ1E 2CD7A 4D4HA 2GT1A 4K6HA 3IUMA 2VTBA 3IUEA 3JZDA 1SKQA 2NUTB 3GP3A 3OQIB 3LQFA 4IUDS 2O8FB 1W5FA 2UYOA 1HQYE 3BQMB 3BYZA 5A4JA 4MNTA 4CEJB 3T1OA 2QIOA 2MR6A 3I9V1 4AMYA 4L4UA 4F12A 1EFVB 5GONF 4QG3A 1MB9A 4DREA 1HFWA 1GTRA 3BH7A 3B38A 4OXXA 2PZ8A 1NRJB 3ON5A 5HGJA 1PGPA 4QYIB 1JIIA 3RHZA 4L3WA 3TQTA 3DR5A 3KFVA 2V9ZA 5EJEA 2F3SA 2W2TA 4RDCA 4B4OA 4JYBA 3MW8A 4DV7B 4C6TB 1EP1B 1QYWA 1HEYA 1K75A 1T13A 2FFRA 3KKQA 1MF7A 3GQVA 3D3QA 3PUXA 1X77A 4HX9A 3G2NA 2QROA 2WT8A 3DQZA 5JAUA 4TMYA 2HF2A 2VDUE 5CM9C 1R6XA 4QPCA 5ILGA 3VNQA 2BFAA 4FYHA 3GPCA 2OHGA 2B5OA 1A4RA 1E4VA 4G2NA 4KIGA 1D5WA 1J9EA 3G9TA 4HZUA 3MMNA 4NX2A 4QOSA 4EKIA 3RS9A 5LOVA 3DNPA 5GOTA 2OK7A 2O3RA 4TKVB 2DFKB 2YRFA 2WU4A 1CNEA 1FW8A 3AERA 2QU7A 3DA8A 1A69A 1QK3A 2VP9A 4D9IA 3L7CA 1FEZA 3DVLA 3WL3A 2D1SA 2WIKA 4OQEA 5CNIA 1KO7A 1X7ZB 2HLPA 2B6NA 2X0NA 2WD7A 2WHXA 3G7UA 4PPQA 3TLMA 4BFXA 1DXQA 2Q3MA 3G8YA 3VHRA 5T8KC 3BQ9A 3QYPA 4P0TA 2D1YA 4EJSB 1NWHA 3HB7A 4LYDA 1JQDA 1DUSA 1VIMA 3P19A 2FFJA 1Y6QA 4OHPA 1FC0A 3IOMA 4QGFA 3UH0A 3V4FA 1KEEB 3WO1A 1VG1A 1NNLA 4L0QA 2QN1A 1L0BA 4AZ3B 4FLEA 4XAQA 3CKYA 2FRDC 3BTOA 3IIIA 1YDHA 2AEJA 3CGWA 5I7FA 1N77A 2NMVA 4HXFB 5TY0A 5HTKA 4XR4A 1UM8A 3H9BA 3H1EA 4GX1A 2VHXA 1RM3A 4COOA 4BB0A 2FEAA 1C30A 1A96A 2G6TA 2YJGA 5AJYA 2AG5A 2O7QA 3S1LA 3ZN2A 1NULA 1HBJA 5KU7A 1HG0A 1AS0A 1B23P 1YS7A 5JD6A 2BGTA 1WE2A 2QDXA 2CLOB 4UJ5A 4Z9BA 2C3OA 3BGDA 4CEJA 4NENA 4QYSA 16PKA 1GTJ1 4F92B 5J2UF 3M34A 4PU0A 3EIUA 3PUZA 1UKBA 5AK4A 4R4JA 4YRKA 3NMUF 1H2RS 3NETA 3A05A 4GMGA 4A0GA 2HDNB 2UV8A 4LOIA 4QFBA 2CNBA 3PIDA 1S8FA 4F6RB 2GD1O 4Z51A 1C0PA 2F43B 2EERA 1UBNA 3TX6A 2FMUA 3UCFA 2ZR7A 3HFRA 1VJTA 4MVJH 4ZYYA 2VPPA 4OU4A 2V8BA 2RK6A 1QF7A 1PFQA 2WJIA 3PXUA 4C4AA 5KAMA 2H18A 2J85A 3PGA1 3KQQA 4O0LA 3RS2A 2J6HA 3R8FA 4HG2A 5KPJA 3UMSA 1DBRA 3F8TA 3KVYA 2V55B 3KZXA 4GVPA 2IYVA 4B34A 3PEFA 5ITZB 4UOEA 4MJ7A 4PAOA 2PLWA 4CKBB 4LE2A 5GVSA 4CM8A 4CV3A 3BZUA 1DQSA 1BGWA 3RC9A 5LQKA 1UXJA 3QE2A 4J6EA 4BP1A 4GZLA 1G7SA 3KXKA 2P4EA 3IUQA 4FBMA 3DLAA 1KMMA 4B8WA 4CV0A 1K8ZB 1QH0A 4TROA 3N8NA 3OU2A 3PUJA 3FAZA 4H0NA 3MCVA 3SP1A 1J8YF 2IFTA 4D4JA 1Z6GA 2HI0A 3T3IA 1U99A 2XH8A 3RVOA 2JHCA 2UXBB 4TVOA 1X15A 2AB0A 1XJQA 4ZJUA 4Q1EA 4CL0A 3EXFB 3DUFB 4S3MA 3S1AB 4MRNA 4R6WA 3HDTA 1G8GA 2PX8A 2G82A 3A0RB 3PC6A 3KT0A 3LUDA 2ABWA 1UC8A 1XKTA 4JJIA 4OJYA 5AVRA 3JYLA 3TLBA 4ZYUA 4H7FA 4NYIQ 4HS9A 4GPBA 4M0CA 4D25A 2ZRDA 3H2SA 3UHAA 4UHKA 4EW1A 2VKQA 2BHLA 2F1JA 3S2ZA 4TKZA 5DBGA 1Z0JA 4NCXA 2WIAA 1O08A 2O3SA 3GFBA 3EVDA 2P2GA 4M54A 2FGJA 1W5TA 4FMPA 4MV7A 4D97A 3ZI4A 2KLBA 2MSNA 1LDYA 2FJPA 1Q3HA 1U8FO 3NOQA 5REQA 5LQCA 3SQNA 3NX4A 4OK3A 3K0AA 2PPVA 3W5DA 5HF8A 1GNPA 3BWEA 4MR8B 3UK6A 2P69A 2IZOA 4BE9A 2IIVA 4E2WA 2HMYB 3NKLA 5ALLA 1E2HA 2FZ5A 5A2GA 4TT3A 5A7HA 4MIKA 2BUBA 2JHFA 2JL1A 2QTNA 4PLWA 3GLFE 4U6QA 3H2IA 3KHTA 4L74A 2WUDA 2E0IA 4JI3B 1KJQA 1P17A 3IESA 3T5BA 1IUOA 4WZAE 5JANA 4OQMA 1GQSA 3N7AA 1XJWA 4MWZA 3D59A 3H5VA 2E5WA 2K6GA 4HRYA 4OL9A 4ZEOA 1OLSB 3FPGA 2JH3A 3QYFA 4RCVA 1HF3A 1XTVA 2ZBQA 4FFRA 4UOZA 1PQ4A 2IH4A 2I3ZA 4AN0A 4CKBA 2O5CA 4UBOA 1GCIA 2OM6A 1XEAA 3QEJA 3ORQA 4I36A 2QG4A 1ORTA 4LW8A 1O0CA 2VWHA 2ZSKA 4UVDA 1UZUA 3FTNA 4QYMA 1IWBB 3GG9A 3PFBA 4CMAA 2YR0A 4D56A 2ZIGA 3RU7A 2Q3FA 4BZWA 3FCSB 2X8AA 3OIFA 4ERNA 5BR7A 4BASA 4NXNB 1LBQA 2G9RA 1UEXC 3EZGA 3KP1A 2F8SA 2H54A 2TMKA 4XOUA 3BTUA 3SS9X 2OGTA 3A06A 2K87A 2LVBA 2XKAA 4A7PA 3H8SA 4AG5A 2POCA 3SU8A 3K70B 1SOUA 2NQTA 1F8XA 2LD4A 3B6EA 3UC9A 1PR9A 1JEYA 3QFHA 4U4AA 3ANYB 1XL1A 4LDJA 5GONB 3INGA 2IE8A 2Q29A 1KZ9A 1VSVA 4RVGA 5FOWA 3UMFA 1H6CA 1DSSG 3ZUGA 2X7JA 1E1MA 2YZ7A 3IIJA 3STYA 1YR3A 2C2ZA 3NYQA 1DAIA 1XLVA 3S7ZA 4D02A 4RSGA 1SOVA 4YLYA 5HQTA 2ZIEA 3UBTA 2WKPA 3VC2A 1FVXA 2XUFA 2X7HA 1FDWA 2H1WA 2P4HX 4C07A 4H6VA 2I8CA 2BGWA 3FNHA 4QJ4A 1AKEA 4NZOA 4QDXA 4RXTA 4W99A 1T3HA 1QU2A 3G79A 3TVDA 1PJTA 1ZM9A 3D1VA 3AR2A 4R9NA 2PZEA 2BLLA 2VSOA 2V7QA 1U1EA 5C3UA 3G8AA 2XNHA 3TSAA 1WNTA 3Q5EA 4CUJA 2VFAA 2JFQA 1CY4A 1HDCA 4P5PA 2WE7A 4N5HX 3HG7A 2WHQA 4CKWA 4Y8VA 1W30A 2A5JA 2CXHA 1T9GR 3DDSA 2HJRA 3DHNA 3KR2A 1OVMA 4BC0A 3BGSA 2QR2A 3OIGA 4J2OA 4U39A 3PX2A 1TXGA 3AF5A 5G4KB 3K70C 1WXQA 5DSXA 5ECDA 1YZKA 3OQBA 4QGBA 1OGIA 1FRQA 4CG3A 3N2NA 4IQ8A 1T9BA 1UJCA 3FCEA 3NOXA 5HZHA 5KTSA 5B2ZA 2VQ3A 1KSGA 2SNIE 3B12A 1RWWA 3KUCA 4G07A 3QF4B 1KZ6A 1PX0A 2XUOA 5KMGA 3STHA 3DOIA 3GMSA 4UHJA 1JSXA 1TT5A 4UUOA 3HXTA 2JBHA 3C6ZA 2W70A 3E9EA 3TDNA 4JEUA 2D5LA 1O4WA 2YASA 1SH7A 3X1DA 3MWLA 3NHSA 2ZAMA 3WDSA 4XIJA 2C3MA 2QRNA 3CH4B 3TX2A 1EFRA 4E1BA 2ZUVA 4HDMA 5B1DA 5DNCA 2FSFA 3Q3GE 3F9RA 1JNXX 5EFOA 5HA5A 4XX0A 2DQYA 4G6ZA 3ZD7A 3IAM1 4O08A 5FWXB 5AKJA 5JO9A 5GV8A 2ZR9A 4BNIA 1KSFX 1T9KA 2OV2A 3T7RA 2RGXA 4TL7A 1KYYA 4S1NA 2SKDA 4H0FA 5ALTA 4RHEA 4RF4A 4DNPA 5DWQA 2POQX 2WMOB 3EGWA 3MOIA 3QLTA 2DTEA 4K1XA 4PAGA 5LL6P 4RL6A 4Q19A 4ALJA 1LTQA 4WKOA 2G40A 1P7PA 4TRJA 1FMFA 4IDCA 4KQGA 4Y2UA 4BQIA 3C3PA 2GXAA 5DYWA 1QR2A 3FZGA 3P9QA 4MMZB 3VSCA 3UMGA 2DHRA 1DOHA 1U2EA 2A86A 1R5BA 2PL1A 3EARA 4O4LA 1IXSB 4TWJA 1I6MA 1QAOA 4Y2PA 5EE3A 1EB9A 1N4AA 4F3CA 4JXKA 1I4WA 1P6UA 1UBEA 2CZCA 1PAUA 2FVXA 3HZHA 2FI1A 1A1SA 3PPYA 3D2AA 3IERA 4GYJA 1YS6A 4PO1A 4B76A 4CQLB 5KYGA 2B7BA 2FW6A 3ONEA 3AUTA 1A8UA 4DVJA 3GEBA 3NONA 2XYVA 1GCOA 2RAPA 2WJ4A 4H7EA 2JAQA 2XWBF 3KLPX 3FYUB 4FBLA 2HIMA 4NAVA 5CVUA 2VDWA 5F5NA 3EGIA 5EHNA 1JILA 1VCHA 3QVUA 3PVSA 3ZYCA 4FCWA 5EUCA 1ZOLA 1M2OA 2DPMA 3P27A 2CCGA 1TVKB 2VK1A 4KUHA 4WH0A 5JNWA 4RHCA 2CBZA 2IYZA 2OWEA 1KDTA 2CMFA 4I5IA 4IIHA 5DOVA 4ZAYA 2FEPA 4DOMA 3O3CA 2A67A 1V41E 3DDOA 5FX2A 5FPSA 3MCZA 4X6XA 1ZISA 4TVSA 4X93A 3TD2A 2GK3A 3CZ4A 4UU7A 1Y6JA 4F2HA 1W73A 3RYHA 4HNQA 4A8TA 3KNZA 2LKCA 2XOKD 1FBNA 1NR5A 1RPTA 3A04A 1BWRA 4IGEA 2C4TA 3PSHA 3D3WA 2PU5A 3LOPA 1QIJA 2P8JA 1VA4A 2B4KA 5HIAA 4IVPA 1NJGA 5H3HA 3A25A 5BRNA 2DUUA 1GCAA 1NVWQ 4WX2B 1QYCA 1ZHFA 3FH0A 3HUFA 4O3FA 1Y3BE 2VF4X 1ODSA 1MAWA 2Y1WA 1GKKA 5JNVA 2QPOA 5JSZA 3AI2A 3LC2O 2BEWB 4CTNA 3LY9A 2W0SA 1N7JA 3BAZA 1P2VA 3HC7A 2EFDB 3HVIA 5ALNA 1D4ZA 1TTPB 3N2GA 4NPHA 4B7UA 2YIJA 3PCXA 4KI7A 2PVSA 2OPHA 3E9MA 4JFAA 1UBSB 4HLNA 4CLEA 3EZ7A 4KX5A 4IWYA 1IL0A 4K9QA 3AOEC 3FMGA 4RH3A 5M29A 2FE1A 3I39X 5DNVA 2OB1A 1IK4A 1KMIY 1NBMA 2QN8A 4Q39A 5F73A 3N2EA 4ZOLF 5JIBA 4G41A 5UKDA 1URPA 2GN6A 2X5JO 2QG6A 4MQEA 4YA6A 3O31A 1U3CA 2ZG6A 2EX0A 4EYOA 2YZNA 2BE9A 3CUTA 2NV2B 3O3MB 3G5TA 4EFMA 1M2VA 2D3WA 2IEZA 1BOFA 3AR5A 2CL6X 3P9RA 1Q1GA 3B1KA 3Q7TA 1J7KA 5F1YA 3L7NA 3IOBA 4K6FA 1L5WA 3MRVA 4RVNA 1YHNA 2ZR8A 4KREA 3EWAA 3N0XA 1G8PA 1H9AA 1BYUA 3LHFA 4KSBA 4R1PA 4UTOA 2GM4A 3Q8KA 4DV0B 3Q7SA 1WZCA 1PTJA 5CLIA 2GCNA 1CQJA 1Y4UA 2XCOA 1O0BA 5U1PA 1UBTS 1H4QA 3B5IA 2XZDA 4RKWA 1GSAA 1U11A 2C1XA 5P8WA 3CLTD 1DJQA 3C6BA 1HE1C 3OAAD 1S8AA 4JC4A 2BZSA 3IVXA 3PGXA 2GASA 4LF8B 2HOQA 3AVVA 1GR0A 1Z2PX 3JY6A 2IA5A 3PWSA 3LDHA 3Q6IA 1VG9B 3LLMA 1E3WB 2EFJA 3RUCA 3BUSA 3AHHA 4MHSA 3G0OA 4G4GA 3WV5A 4BTVA 1TM2A 4BB9A 2LCFA 5DE3A 2JZCA 1NW4A 3L84A 4LDRA 3WE7A 4AZWA 2A9JA 1L8QA 3E7WA 2HA0A 4QOHA 4OEHA 1E5DA 3DDZX 3HL0A 2XNKA 2Q3DA 1HNWB 3B7WA 1HK7A 4ZVVA 1Z18A 3E0QA 1FNDA 2EQ5A 1ELOA 1WD5A 3I4LA 1FSFA 2X8LA 3TNJA 4WZAB 2BEWA 1AKNA 4RTJA 2C9YA 2WFAA 3GIDA 4UD2A 1UDBA 4ZOLB 2QNRA 2UYHA 1R6TA 3FLBA 3Q1KA 4TM8A 5DN6D 4E2FA 4IGKA 4KMRA 1NDHA 1UFOA 3MGBA 3V48A 2NQ8A 1WMBA 1LC0A 2ORIA 3AF1A 3DZHA 3D4NA 4AC9A 4BO4A 1B2LA 1NC3A 2A1UB 2DFDA 4QD3A 1MABA 2CJPA 4MTLA 1CW2B 1ECGA 3UFBA 2OCAA