2PQ0A

Crystal structure of hyopthetical protein (gk_1056) from geobacillus kaustophilus hta426
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
256
Chain Sequence
GRKIVFFDIDGTLLDEQKQLPLSTIEAVRRLKQSGVYVAIATGRAPFMFEHVRKQLGIDSFVSFNGQYVVFEGNVLYKQPLRREKVRALTEEAHKNGHPLVFMDAEKMRASIGDHPHIHVSMASLKFAHPPVDPLYYENKDIYQALLFCRAEEEEPYVRNYPEFRFVRWHDVSTDVLPAGGSKAEGIRMMIEKLGIDKKDVYAFGDGLNDIEMLSFVGTGVAMGNAHEEVKRVADFVTKPVDKEGIWYGLKQLQLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical conserved protein GK1056
publication title Crystal structure of Hyopthetical protein (gk_1056) from geobacillus Kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Structural genomics, unknown function
total genus 65
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2pq0A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2pq0A01
5AM3A 3IRUA 3NANA 3UMCA 1K1EA 5AW4A 3U7EB 3W5AA 2G08A 4EEKA 1RDFA 2QYHA 3SMVA 3L8EA 5A3RA 2CN1A 3I28A 1J97A 3A1CA 3U7FB 3GYGA 4UM5A 3ZW7A 2G0AA 3P96A 3QU2A 2B82A 2JAWA 2YMPA 5AHXA 5AI9A 5ALGA 3U7HB 3MN1A 3KC2A 3NAMA 4EZEA 1F5SA 2O9JA 1L7OA 4YIKA 2HX1A 1RC8A 3WGVA 2FPSA 3WKAA 3NALA 4NAVA 3L5KA 2NO4A 4BNDA 2ZBEA 5AM4A 2QLTA 3OCWA 5AVZA 1Q91A 3L0CA 5AM5A 2YFYA 4L6AA 3R4CA 3PDWA 1XPJA 3TLMA 5AVYA 3OCVA 5ALLA 2FPXA 2YY6A 3FM9A 2YN4A 3ESQA 2C8LA 1WZCA 1XVIA 3QUBA 2WF7A 2FEAA 1YS9A 3L0YA 5ALKA 1NNLA 5AI0A 3L1UA 1RQLA 2FDRA 2HDOA 4UARA 4XE5A 5ALSA 3AR3A 3QNMA 1VFPA 3FZQA 3ZTWA 3L7YA 2YBDA 3OPXA 4F71A 1Z4JA 4Y2RA 3QU4A 3NUQA 2RAVA 4HAIA 3WK6A 3KDPA 4GXTA 2JARA 2RBKA 2PKEA 1N8NA 4G9BA 4BX3A 3W5CA 1Z4IA 2C9MA 5AW7A 2BDEA 5AW1A 4YIHA 5ALWA 2VKQA 3RFUA 1T5TA 1ZD4A 2GHTA 3EF0A 4NV0A 4NABA 2GO7A 3PGVA 4Y2YA 1WR8A 5AVWA 3E58A 4MWOA 4CF5A 1SWWA 4ZEVA 2HI0A 3HLTA 5FP0A 5ALDA 3WKEA 2WF9A 4MUMA 5AIBA 4OCZA 2HOQA 3WKDA 5AIAA 2I54A 2B8JA 4Y2UA 3AR7A 4Y2PA 1Z5UA 1TJ3A 1XP5A 2DQSA 5AW2A 2G80A 3UMBA 4CF4A 4UU1A 4CE6A 2YJ6A 2HSZA 5ALFA 3J7TA 1Z4PX 4OD0A 3EWIA 4Y3UA 3UM9A 2AGVA 4HGRA 3AR8A 1YDFA 2GMWA 5AVSA 4NFLA 5AM1A 3E81A 3R09A 2GFHA 4BEWA 2EARA 3QU7A 1Z4NA 5AVRA 1SWVA 2WF6A 1JUDA 2ZBFA 1ZD3A 2I7DA 3ET4A 2Q4RA 3OCXA 4H1WA 2CFSA 5AESA 3IJ5A 3CNHA 1TJ4A 4AS2A 5ALOA 4EX7A 2PQ0A 1RRCA 3ONNA 3N07A 1O08A 4HYTA 3ZWKA 1Z4KA 4OFZA 2W11A 2JAUA 1X42A 2HCFA 5E0OA 2IOHA 1LTQA 3IB6A 4UMEA 5ALYA 4EENA 1S8OA 5AK3A 3SHQA 5AKYA 1YMQA 3U7GA 2G06A 1Z4MA 2C4NA 2CFTA 4OHFA 2GHQA 2I6XA 1QQ6A 4BKMA 4Y2SA 3AR5A 2HO4A 3AR4A 5AKHA 4EELA 1ZD2P 2FPUA 5A3QA 3WK8A 3NASA 3W5DA 4BX0A 5AVUA 5IT0A 2ZG6A 1RPZA 5ALTA 2WF8A 1QYIA 1QH9A 3A3YA 4B6JA 2G07A 4HGOA 4QQFA 3DDHA 3FPSA 5ALZA 1NF2A 4HGNA 1RMYA 4C4RA 4IFTA 1YNSA 1CR6A 3KBBA 3N1UA 3B9RA 3ZVMA 4CF3A 3EPRA 4JB3A 3L8FA 5ALXA 3N28A 2OBBA 4AS3A 3FGOA 1KYTA 2ZXEA 2FUCA 5AW3A 4XPZA 1TE2A 2NYVA 1U7OA 3AR9A 3ESRA 2HEGA 1LVHA 3ZI4A 2IOFA 5AKGA 1Y8AA 3NIWA 2EATA 4O8CA 1L7MA 1TJ5A 5AKEA 1RKQA 5AW8A 4KN8A 3N8GA 4UW9A 2ZOSA 1AQ6A 2ODAA 3AR2A 4JDPA 1RLOA 1QQ7A 4IG4A 4G63A 3ZTYA 1L7NA 1U2TA 1ZS9A 4L57A 3SKXA 2EAUA 1Z4QA 1O03A 2HHLA 2ZBDA 5AKKA 3CZ4A 4UMVA 1N9KA 2MU1A 2Q5EA 1WPGA 2JAOA 3S6JA 3FVVA 2P11A 2W4MA 4DFDA 2B1QA 2FPRA 2IOFK 1ZD5A 1RKVA 4PNHA 2P69A 4I9GA 4ZEXA 2O2XA 3M9LA 4UM7A 4RETA 2IA5A 5ALNA 5JJBA 3HYCA 5AKLA 2FPWA 2D2VA 4BBJA 2NO5A 2WF5A 3R9KA 2AH5A 1L8LA 4UAVA 4KYTA 5ALHA 3ED5A 2R8XA 3UMGA 3AR6A 3I76A 3I6BA 3MPOA 1Z4LA 3SKYA 3DAOA 5ALQA 2AMYA 2I33A 5IT4A 3WGUA 3ZX5A 2G09A 2OYCA 1ZJJA 3ZVLA 5ALUA 3WK7A 2OM6A 3DV9A 3WKBA 3ET5A 3L8HA 4YCNA 5AI4A 4UU0A 5ALRA 5AKXA 1CQZA 4HGQA 4J03A 1U2SA 3QXGA 1EK2A 3OTQA 3KZXA 4Y2XA 1ZRMA 1Q92A 2B1RA 2C88A 3BWVA 2B0CA 3I1YA 4E88A 5AKJA 3QX7A 1RLTA 5AK4A 3D6JA 1L8OA 5AVQA 3NRJA 3FPBA 1RMQA 3B8EA 3QU9A 5AKZA 1J8DA 2FI1A 1T9ZA 1VJ5A 1L6RA 4FYPA 3F9RA 4BNDB 3QUTA 3KOOA 5AVTA 5A3SA 4AP9A 2WM8A 5AI5A 2W43A 4XQ0A 3QLEA 2MSNA 1SU4A 5AK5A 5AW5A 2I34A 1U02A 5ALEA 1TA0A 4QJBA 5AK6A 4ZEWA 4KX5A 4RESA 4C4SA 1Z4OA 3ZVNA 2WHEA 2RB5A 1EK1A 2YMLA 1Z5GA 3OCYA 1L7PA 4KNVA 3RF6A 4YCMA 4NWIA 3OCZA 4UAUA 3M1YA 1YV9A 2B30A 4CNQA 5IS2A 5AW9A 3QYPA 5AI6A 1RQNA 5ALJA 2R8ZA 3E8MA 3QUQA 3U13A 1RKUA 4J2TA 4GIBA 2YJ3A 3B9BA 5AICA 3QU5A 3A1DA 5AM2A 5AM0A 2FUEA 3SD7A 4YCLA 2BDUA 3EF1A 1WVIA 5AKIA 3KD3A 3U26A 2AUTA 4Y2TA 4YH1A 4YGYA 5ALIA 1RMTA 3ZX4A 2JGAA 2YMQA 4F72A 2I55A 2C8KA 2R8EA 3QGMA 4HGPA 1IWOA 3SLRA 2B8EA 4UMDA 3A1EA 4BYGA 3L1VA 1VJRA 5ALPA 4UMFA 1QQ5A 5AW0A 4I9FA 3WK4A 3PGLA 4L6CA 4C4TA 4Y2QA 4UATA 3L8GA 3MMZA 5AVXA 3U19A 2YMMA 3N5KA 4XOUA 5AW6A 4KX3A 4Y2VA 1FEZA 2BY4A 3L0BA 3SF0A 5ALVA 3BA6A 1MH9A 4DCCA 4FE3A 5T41A 3QUCA 2RARA 2PR7A 2YJ4A 2G1AA 4UASA 3ZU6A 3W5BA 1YJ5A 3VAYA 3DNPA 1U7PA 2P9JA 2X4DA 4Y2JA 4FFDA 1ZOLA 2P27A 3E84A 3K1ZA 2R8YA 1RLMA 4KNWA 5AVVA 3MC1A 1ZRNA 2HF2A 2HF7A 2OA0A 4BEVA 1S2OA 4DW8A 3ZWDA 1Z88A 1PW5A 3ZUPA 4DWOA 3WK9A 3WKCA 1T5SA 2Q4TA 4BX2A 2WFAA 2IYEA 1NRWA 5ALMA 3OCUA 3WK5A 4EX6A 2CFRA 2YJ5A 5AI8A 3PCTA 2ZBGA
chains in the Genus database with same CATH superfamily
1OI4A 4RS3A 3N6XA 3K8YA 3FCYA 3AKYA 4QPJC 1MO3A 2N3ZA 2YN2A 5CA0B 3W5AA 2VWPA 1A5BB 4W5NA 4D98A 5JBNA 5HM8A 3NTQA 3CSSA 1INLA 1O8CA 2QJOA 1FX0A 4HRYA 3OUUA 4PLGA 2P91A 5BUQA 5GINE 1KDOA 3RBAA 5CHYA 4AJNA 2H92A 2EP8A 2CL5A 1MX3A 2DQ4A 2R1ZA 3OH8A 3TIFA 3OE7A 2R7LA 2IUYA 2JIQA 1XJCA 4UEJA 4PRZA 5LB2A 4OHWA 4IZIA 4D74A 3WYAA 1T5OA 2I66A 3TGPA 2PZMA 2AMJA 3Q98A 5B2FA 4XA8A 1Z6ZA 2Q5FA 4HWSA 3O94A 4A8JC 4ZI2A 3MWJA 1TFUA 1PD0A 2F8SA 1ZHHA 1BAPA 1WRBA 2CZGA 5LA6F 3I2JA 1NPDA 5HF5A 4TYYA 4RIFA 1WL8A 3AUTA 3F97A 3NALA 2RFLA 4QTTB 4YLYA 4COOA 5A4IS 4NF2A 3AGQA 4OJMX 3OIFA 1PI3A 3CGWA 5CX1A 4D0RA 5KQPA 1JH9A 4IO0A 4G1MB 2F1KA 3DKPA 3OEYA 4TRJA 4B48A 1DWUA 4Q05A 4QDUA 3BWMA 1E8DA 2C7OA 4Q9NA 4EFNA 4KR3A 3GBPA 3I64A 1PYGA 3H1BA 4RE6A 3WYCA 4PTLA 2HYIC 2O5VA 1TVMA 1C9YA 1H65A 3BB1A 4EARA 5FA5A 4BMXA 5LP1A 3ESQA 1WUHS 2JCXA 2JI8A 2PRKA 2L69A 5E6SB 2H1HA 3FSJX 4JJAA 5CVJA 4RFSB 2OECA 3R3HA 3RSOA 4U39A 1X19A 3G2IA 3NBUA 1IMJA 5MN4A 4FIZA 1K89A 2ZTMA 4AJ1A 3VX4A 1EWYA 2QIPA 3U44B 3IP3A 4X9XA 3L7YA 1NHGA 3T7JA 3R3YA 4I4IA 3CZQA 4HQNA 1LEHA 2Q1WA 3OP1A 1J8FA 2EFYA 2UYHA 3FH0A 8GPBA 2R44A 2FMFA 1V35A 1RAHA 1ZNWA 1N8NA 3ADKA 4RK6A 5FOTA 1P60A 1WWKA 4Z4QA 2QUKA 4IWXA 1VB5A 1XMQB 1II8A 3PYLA 5AW7A 3RAPR 3GJYA 1KBQA 1N6KA 3K73O 4QTZA 3PQFA 4YEDA 4DGQA 1OI2A 3UG7A 5CDGA 6AT1A 2ESRA 5IDYA 4XPIB 2ZIFA 1NRIA 3ZZ1A 3ZQJA 4CFYA 5BQ3A 1GNLA 4MWBA 1JIJA 1WQ4A 4EG4A 3AUAA 3DD1A 3FCCA 3CJRA 1GV0A 1HFWA 3LOPA 4ZRDA 1W0KD 1USGA 5IM4A 5KTKA 3EA4A 5EKUA 2SCUB 2ZUWA 1WUKS 2H85A 4BB9A 1CK4A 1AF4A 1OFGA 1WULS 2C97A 2BMAA 2FE1A 2YWJA 4M8IA 5C0OE 4OMFG 1NNUA 1D07A 4I36A 3R76A 5H4GA 1JZSA 3ZCSA 1BMQA 1F0NA 4YDQA 2HJRA 5JSFA 1YDHA 3A11A 2CFIA 4MJXA 3CRW1 1BSVA 4DC1A 2QZ4A 5JCXA 4Q3KA 1JA1A 1PZHA 2X40A 3AF0A 1E6EA 2PUWA 4GZ3A 4CM9A 2WOOA 3NIBA 4TZTA 2QPTA 1SRQA 2QA5A 2QDKA 3QJGA 5I9BA 2Q3DA 2YWDA 1GN9A 2APJA 3HXOA 2UXDB 4YJ2B 5DIFA 2BKAA 4Y2PA 3HKCA 5F52A 1TEZA 1IXSB 5K8JB 5IZ4A 1POXA 2OFOA 2Z6VA 2XYRA 4JSTA 3VOSA 4D9IA 3HADA 1OB2A 2QM0A 1JVSA 1AGPA 4PZAA 5KBYA 1QGDA 2YV5A 3FHCB 4D80A 4F5EA 1LB1B 2NZYA 1LLDA 3K32A 2Y9PB 4D0NA 1LC0A 4R1OA 4EKNB 5G0SA 4RCVA 1BYIA 4UTRA 3W5IA 4UNIA 3RBXA 1QG4A 1NWHA 3Q12A 1NW5A 2LE0A 2QTCA 3EE6A 2IBSA 3PLNA 2IXBA 4MYCA 4YPOA 4Z7QB 4W6QA 5DLEA 1XKTA 3UAGA 5EZ6B 1KYVA 3BCSA 2P6RA 1D0VA 2NADA 2FPOA 1CHNA 3EODA 1TW2A 2FUNB 3AKDA 3HABA 2E4UA 1E7QA 3QNUA 1QWSA 4KEAA 5CCEA 3W5SA 1LS6A 1YAHA 3H3JA 4RH0A 4NVRA 3TO5A 2DSTA 4WXEA 3PP8A 1KOJA 3KXIA 1DC3A 6REQA 2GZMA 3JALB 4GVLA 5FB3A 1RD4A 1P0PA 2AQIA 4DV0B 1ZJYA 4CIBA 3H1EA 1CY1A 3DTVA 4W9NA 2VSXA 4BP1A 2J0UA 2HCTA 4OG2A 1G8MA 3DP7A 4TKZA 2YW2A 2WP8J 4AWBA 4EUFA 1QP8A 1JVNA 4N0PA 4Y30A 1SULA 4KWEA 1G8JA 3IAFA 4YQFA 5LOVA 2VQSA 5GONF 4CFSA 1QQ6A 1VJ0A 4RTNA 3EMDA 1R66A 3LU1A 2AX4A 1CS4C 1TYEB 3C3BA 3FBWA 2IYSA 1O58A 2DU8A 3JZAA 3KX2A 3SS9X 3ZGVA 2MSCB 5K7SA 3AF6A 3JZDA 1Z7YA 3N3BC 3WK8A 4CR8A 4DBVO 1JR3A 2ZIEA 3PHLA 3HNRA 1CP2A 1BG6A 1D7OA 4LZJA 4K9RA 4KLAA 3GEBA 1AZSC 3TLYA 5ALTA 1XMIA 1PP4A 2YNMC 3ESXA 5F7XA 4KIFA 4AY3A 1MW8X 3EA5A 3GP5A 1YQQA 4BGUA 1VQ1A 2BR3A 4UNNA 4LV8B 3RC9A 3C8UA 3K6JA 3FPSA 2G76A 1C1XA 2IYAA 4LAFA 2IIPA 4IEEA 2XRZA 4AP6A 3ER8A 1RWWA 4U7HA 4D9BA 4F6LA 2B34A 3GB9A 5B7NA 4J16A 2XGOA 3RS4A 3F74A 3HN7A 2PPVA 2W93A 4LMRA 1TIKA 4YHBA 1G6Q1 1SM4A 4MKHA 4V1CB 4NL4H 1ADJA 2F6RA 1G4HA 4PHTA 5FUVA 3SX0A 4BQFA 4R1UA 3WLHA 4GEGA 3BJEA 3M6UA 1P8AA 1E0JA 1I30A 2UXCB 2J5KA 3D1VA 3IUSA 4F6RB 1OLUB 2QRPA 3MCUA 1VJDA 4YRIA 1NNEA 1K3UB 2CJPA 2ZSIA 4CIVA 2I4LA 3H8JA 4LWQA 1JI3A 5E2AA 3IEXA 4YP5A 1DWQA 2G1UA 2EFHB 2EATA 1CUWA 2IPNA 3JRWA 3KSZO 3DO6A 4IDHA 1HNZB 3D6TB 1PJZA 2A1UB 4BNKA 4BASA 1CQIA 2HU5A 4TMWA 1CSEE 1J9GA 2VZ9A 3TLBA 3GEPA 5KOJA 5EHIA 2FW7A 3ESCA 1NXOA 2HHAA 2IP4A 3P2IA 3DMYA 1FB5A 2J6CA 1W9HA 3SZMA 3OU6A 1IXZA 3GT3A 3KO8A 4JIGA 4BEBA 3HM9A 3QTBA 2H65A 3GJXC 5HYVA 2JLQA 1T2FA 1HM5A 1WXEA 2MDTA 1J22A 4JNCA 4YAWA 1C4XA 1Y7TA 3E4DA 3JWJA 4FD3A 4PSVA 2OAGA 4Y2GA 4L0CA 3T5AA 3QENA 3LLSA 4Z1MD 2N0SA 4RK7A 4ZVMA 2ON6A 3A9TA 5ICSA 5C53B 1NLYA 1ESEA 3F2IA 4I46A 3UJBA 5JISA 5E6RB 3CONA 3MELA 3P0HA 1FRNA 1SKMA 1P39A 1LLCA 2HK9A 3B82A 3LS2A 1T8PA 3JQFA 2WF5A 3OY2A 4H3VA 5FL7A 1NJGA 3S55A 4F9FA 4L50A 3A8TA 2CB9A 4I55F 3GVIA 2QRKA 1WXHA 3MT8A 3QG5A 1K5PA 2V65A 4EY5A 3QE2A 1QMGA 3KKQA 1W34A 4ACAA 5L8VA 4ZZ0A 1V39A 3AESB 3LHFA 4D25A 5E7JA 5GY7A 3IJPA 4EH1A 3EG9A 2Z5GA 3LBHA 1T0UA 1AN0A 2QN1A 1CDOA 3E7XA 2ZETA 4G97A 821PA 1N9ZA 5AKXA 3B20A 4RK4A 1PK8A 1VXRA 5F4BA 1UQUA 3ESAA 4EHNA 1BDMA 1XG5A 2H4JA 2JJ1A 2ATCA 3RYTC 5JDCA 1C3VA 1ZRMA 3JX9A 1FVHA 1FRFS 2GOYA 2HWWA 1VBMA 2XX3A 3BWVA 3EW9A 1D2AA 4HP8A 2H1IA 4N8EA 5IXSA 1RLTA 1RLIA 1O87A 4HTAA 2A84A 3TAHA 4X93A 3N2GA 5BQOA 1SO8A 2XYVA 3B38A 3HBMA 3C97A 4JD5A 1SU8A 5I7AA 2OFPA 3BDIA 3FMVA 4GW3A 3BK7A 3EY4A 4GGOA 3SNHA 1UMKA 3S8YA 2OHHA 3WDLA 2E4VA 1Z6XA 1E66A 1AOXA 1JBQA 3ELDA 3SVZA 1VJ5A 3DE0X 1VBKA 2Q3MA 3G82C 3UUGA 4C2BA 2P2YA 4XAQA 3ADOA 3IE2A 1E58A 1QK5A 1LBSA 3MWKA 1TK3A 4YMLA 3EDCA 4BRZA 1U9IC 1U3WA 2JLBA 1H4TA 2QD2A 1SPBS 2OD2A 3HXTA 1V5EA 4IHJB 3WL6A 4JKIA 5KTTA 1PR2A 3NWJA 3RT9A 4B31A 4CEJA 3VA7A 4MR7B 3W6OA 2CXSA 2QM7A 4YBRA 3QRWA 2VAXA 4IV0A 2B37A 2CXHA 2W6PA 3P5SA 5K0TA 1ZYUA 4V3CA 2VHJA 2VTBB 2B1IA 3T94A 1KXJA 1AA9A 1Q0PA 4C0XA 4I5EA 1IONA 2PJUA 4FI3C 3ND7A 2RB5A 1JAYA 4M0EA 2FPPA 3CHYA 3UOAB 5IP5A 5A9SA 4DPKA 2COKA 1EFTA 2X6TA 3RS0A 1XRSB 3JVEA 3A3KA 2QBYA 1XA3A 3CEHA 3WAGA 3OCZA 4ENRA 1Y6JA 4YACA 4AZSA 2B30A 3CVWA 4Q3BA 2QL5A 3O91A 2W2VA 1O6ZA 2CBZA 5T7BA 3FUCA 5SY9A 3U3JA 3IVRA 4HDRB 1T4GA 2P2ZA 4CWAA 4ZZ3A 5I47A 2YICA 4ZOLF 2JDIA 3B9BA 1VHWA 2DH5A 3T0FA 1EB9A 1XDGA 3CT4A 5I7RA 2OGTA 4BJ1A 2PLNA 2ZIUB 2CV1A 4FYXA 4ZT7A 2DWUA 3DDNA 3ZDQA 1DKUA 2O3UA 3IPAA 4Z4IA 3R7NA 4FCTA 4PZPA 3G5MA 4JVMA 2GA9A 4MARA 3VTKA 2YV4A 3MWLA 2QG4A 1RMTA 4G1FA 3ESYA 2EGUA 1QB8A 5SY6A 3GMTA 3CKLA 4QUDA 1YE3A 5G3YA 3H0KA 5JAQA 1RFLA 1JJFA 5LWQA 3NM4A 1G20E 4HDOB 1JR3E 3P52A 1PD1A 5TMDA 1BEUB 1UJ5A 4MYHA 5FR2A 1OZHA 1YIDA 1B0ZA 3SS7X 5D87A 4P3YA 2G0TA 4XM0A 4CLXA 1UQTA 2HWXA 2W2OA 5DYNA 4GL2A 4C7OA 3HU3A 1WHTB 2OMEA 4EO7A 5EERA 1G9SA 5CDFE 1FP4A 2FSPA 1R0CA 3B6ZA 1OYVA 4PSKA 4I9FA 2IE0A 4OBEA 3TLAA 2Y1GA 4PSCA 2X0JA 1HKUA 3TSAA 4CM6A 1GPWB 1CY2A 1TPYA 2NTJA 3FB4A 3QHPA 1DDIA 2N46A 3GEMA 3EGOA 3UXHA 1EHCA 3GMDA 2XVMA 3KKPA 4OAQA 3UB2A 1SUDA 5I51A 1O1YA 3WWZA 1GM5A 2VO1A 1AXEA 1XXLA 2VAMA 2VRCA 1NVVR 4KPUA 4TZ0A 4ONEA 5JU6A 3FDJA 3GBSA 2DR2A 4JI6B 2IPLA 2CVHA 2TRSB 3MT7A 3DKRA 3B51X 1J9ZA 1QAOA 3FA2A 2FG7C 3UN1A 2O4CA 3DMFA 1Z73A 4P93A 1L5NA 2IODA 2Q21A 2YJ4A 2IQ5A 3W7VA 4UASA 5DHTA 4N82A 5H80A 4LYJA 5JY1A 1Y8RB 3W5BA 2ZSKA 4RF5A 3HA5A 4E0BA 4HNSA 4OHCA 1BWSA 3LUDA 3G02A 4DXDA 5JWHA 2ZWOA 4C5CA 3F5SA 1SD2A 1NI5A 4MA0A 1C1YA 3EULA 1SK8A 5TY0A 1A69A 4JLJA 1OCEA 1SIWA 3I9V1 5TGDA 1ZK1A 4DPLA 1XNQB 4OQNA 4G0PA 2ZB2A 3ZWXA 4MRRA 2HWYA 3G0OA 4DV4B 1ZRNA 3EGXB 2HF2A 4FHZA 1B6TA 3AB7A 5DXFA 4PX5A 2PUGA 3T95A 2YJZA 4JSYA 4RF4A 3BYZA 3HXKA 1XL0A 2QP3A 3NAQA 4KSCA 4RF2A 3BHNA 5CDHA 3W4JA 5F7JA 5IM4F 2H7XA 2RIPA 2IPOA 4ZTZB 1LDNA 2JIMA 3R6LA 3VYVA 1B6SA 5ESDA 3LRTA 3LYUA 1MJFA 1RM3A 3UHPA 4AYTA 5JW6A 2VJKA 5GGXA 1DJNA 1MV5A 2VDRB 3WA6A 1K9VF 2AN3A 4UEWA 1K68A 1J2YA 3VSBA 4TS1A 3MGGA 3FNRA 2JI7A 1T2AA 2CXQA 4JI8B 4FDVA 3ROPA 3DP9A 2PH7A 3NTVA 3V7YA 3ZW8A 3I2YX 3FY4A 1X7ZB 2I4MA 4EAQA 1GZDA 1L1RA 2X76A 3F6YA 3JARA 3H99A 2X77A 3CRNA 5CT5A 1Z36A 5DHQA 3L8MA 3WGNA 3V33A 4OMDA 3V7UA 3U7FB 4BNFA 1C1DB 3O0TA 4HX9A 5AQ1A 5K6RA 2A14A 5LXTB 1E6CA 2DMRA 3ANNA 4G0YA 5T5QA 4OJYA 1WCIB 2ZDGA 1QAQA 3VU1A 4D92A 5C46F 4F5YA 3FR8A 3A6HA 1G6HA 3B3QA 2C4MA 5GJVC 5D6OA 5A0VA 1A96A 1RI2A 2HQ1A 3PPIA 4G0XA 3R7SA 1PS9A 3PHJA 5CB0A 1BE1A 4UEOA 1N0IA 4PYRA 1M8FA 2MSLA 4L8VA 5A0TA 2ZUSA 3A6LA 3ELBA 3URKA 1Y9DA 5JAHA 3ASUA 4LBVA 4Q4JA 1HT2E 1T8TA 1B26A 1WVMA 2I03A 1LPNA 3JWHA 2O5RA 2BN4A 3VOBA 3P5BA 5AM5A 4IDFA 1Z37A 3LXMA 1XPJA 4MKXA 2QG9A 2AD1A 4URHA 4YHHB 1DC7A 1MJHA 3R8CA 3VYTB 3IDSA 4CM1A 3JQGA 1JJ7A 4PN3A 1XDZA 2VF7A 3WNBA 3GEGA 1TZBA 4AS1A 2CMGA 1J1UA 3DYVA 5IMSA 1BU5A 1HY3A 4NXNB 1QH0A 4KGDA 5EUQB 2GRUA 5EWJB 2O3JA 3KQMA 1QH8A 4NBSA 4X90A 2GF0A 1LDEA 5ALKA 4GWGA 3WL4A 5LOVF 5DU2A 1KEKA 1RQLA 2B2CA 3L6OO 5CU7A 1CIJA 1YH3A 3OTHA 3JSAA 4XASA 1TKRA 4B71A 3FZQA 1NQUA 3PD1A 1NYTA 4R2LA 3OTIA 1Z4JA 4ZO7A 3A3NA 3EEOA 4AJLA 2PZAA 1LX7A 1H3FA 1P75A 2Q8QA 1K8XB 3Q7RA 2WVJA 1H3EA 1VIDA 1XROA 4J0IA 3LUAA 1VB3A 1U98A 3P9PA 1QRDA 3BE4A 1SHTX 1KYQA 1RI3A 2WIKA 4IMPA 1LK5A 1CR0A 4LWPA 1J4AA 4U2DA 4ARZA 3L7IA 4GOMD 2ZFUA 1NI4A 4N5NA 4NV0A 1IOZA 1ISIA 3SEAA 2FRXA 5ADHA 3RK4A 2VDWA 3FJ1A 4L7VA 2AIRA 3K20A 4XH9B 1X7WA 3HVIA 1IM2A 5UKDA 5A1JA 4ZQEA 5DM70 1BEZA 3TKYA 1JEDA 1I3LA 2JIPA 2OBNA 4JBIA 4QQ8A 4WLFA 3EIQA 4CQMA 4EPXA 3S8EA 3QEMA 4V2UA 5BWBA 1YZFA 1QZTA 4BB0A 5LZ9A 1LBHA 3GWGA 5IN4A 5DGHA 2F43A 4HLQB 3OQOA 1ZITA 2YYSA 3TTUA 3VZRA 3BORA 4BFUA 1Y8QB 2A0XA 4ZOEA 2JGIA 4DMUB 5ICGA 4QHYA 1DJPA 4I9NA 4YXFA 1X8JA 2DPHA 3ZCRA 4ABTA 3ZHOA 3ZDBA 1FDUA 4HH4A 4AUMA 2F3PA 2ZTHA 3GVHA 4DIOA 4F2WA 1O77A 1U7HA 4O2AB 1K9SA 3R0IA 2AVNA 1PF7E 1KFCB 2IHBA 5H68A 1SCUB 3SXUA 2ZJ8A 4F21A 1S3SA 2G0NA 1WNFA 2BZ0A 3KLPX 3LPAA 4W82A 3IO3A 3H8SA 1S7GA 1P45A 4LXYA 4NBTA 2FN8A 3UQZA 1L4KA 4RTOA 5DTRA 2FMTA 4Z9XA 4F2DA 5J1SB 2GSWA 4CRWB 4OD0A 4RY8A 3CH5A 4O4IB 5FV4A 4OJNA 1TZMA 1VTKA 1X7XA 2R5NA 4EB6A 5L45A 3OKAA 3OURA 3T8YA 1LV8A 3TI7A 4NZ9A 4RZUA 3VPBA 1R4NA 1HORA 4LQCA 4DAOA 3TGLA 1X39A 1SZJG 4IGAA 5HKKD 5EXPA 2EKDA 2B9VA 1M0WA 4QU8A 1WZ2A 1FUEA 2PS0A 1ZSVA 2ZCUA 2PM8A 3CZ9A 3IP8A 5KTRA 3I5UA 4OH7A 2QRJA 4JEHA 5SZIA 2XUJA 2CUZA 3GT4A 3VM6A 4PX2A 4FBLA 3KSBC 1CDDA 2CFSA 1O4VA 1U3CA 2RGYA 3FNFA 4ISCA 2ZYUX 2CUTA 3VAAA 1Q57A 1XN4A 3KU1A 1LNQA 1VI2A 1APBA 3M3HA 4EW1A 2AYXA 1D1SA 2ZIAA 4RC9A 3I2HA 1EP2B 2VA9A 3SYMA 2Q8PA 2GGSA 5HX7A 3WB2A 4ZRNA 5CA1F 3A1FA 4J43A 5DYYA 3U7GA 3V3TA 2HPZA 3OJWA 5GV7A 4ZC8A 4B45A 1TMOA 3HCBA 2PMWB 3UAXA 2QE7D 2QZZA 1AO0A 1AG9A 1M2KA 3DBRA 3HCOA 4HMPA 1TM2A 3G85A 1ZK0A 4X44A 1N1DA 4MITA 4FEAA 1F5NA 2KJQA 4Y1GA 4YQYA 1ADYA 3UV7A 3WK9A 2WKSA 4OQEA 8ADHA 4ZVQA 3M0EA 2FWPA 1ZI9A 3NKLA 1TQ6A 1T13A 3O84A 4HK4A 4RWEA 4LFBB 4HWTA 4E5PA 3VGPA 3G2OA 3WNZA 4C89A 4IS2A 2DQZA 4OSOA 3KJGA 1Z2NX 2G07A 3T5CA 5FI1B 4YRZA 5BWCA 4UFOA 5BV2P 2MSEB 2P5SA 2FAXA 2JH8A 2VJBA 1NF2A 1YR6A 2GEUA 4JVNA 4IFTA 4X65B 4HB0A 4O4HB 1TQHA 4ZQIA 5A5FA 5JZMA 2ZZNA 3RQIA 1H1DA 3TQTA 2WI8A 4DR2B 4M36A 1R6BX 4JBGA 4MVJM 4QLAA 5ANRB 1L4LA 1V41E 3FYSA 5HE9A 3F47A 4WE3A 1EIZA 3ZGLA 4ZVOA 1AZTA 2VDQB 1Y9AA 4WA8A 1ID1A 2CLEB 3IHTA 5HILA 2GCNA 3PGMA 3EIOA 3P9QA 2X5KO 3VKHA 1DAFA 1RAFA 2QTGA 1XLUA 4DIBA 1XFDA 3QEAZ 1JU3A 1I1QB 1T9CA 1E4EB 4OYRA 2VJMB 4DM3A 4MKZA 3CB2A 1GUAA 4BVEA 1TJ5A 2DHDA 4XKJA 1ODJA 1UXJA 2QU7A 2AOTB 4IX1A 4N3NA 4PG8A 5FEMA 3RVJA 4B79A 4KQCA 1KIMA 2Y4OA 3S2SA 4W9NC 4KLZA 1KY3A 2CNNA 5EJ8A 4X00A 3VJKA 4KUGA 4G63A 4L57A 1ZK3A 1I51A 4A0GA 2WNHA 4EAAA 4CMGA 3BXOA 4F92B 5JNRA 1J2UA 1VCOA 4ATNA 1U8FO 4L8YA 4ARVA 5E6SA 2NVOA 1O03A 3O4HA 3UW1A 1PT7A 1S3GA 2P6UA 3SVLA 2BCGY 1E6MA 2JHCA 3ND8A 4RFSA 1L4BA 4PYLA 2H1RA 3F6PA 4E11A 1LDGA 2PDAA 4QE3A 1PSWA 1H1TA 2GPBA 3ZY2A 4FQ5A 4M8KA 1P7PA 1XZLA 1GPYA 4WOCA 3R9IA 2MSWA 1BXGA 2ZEJA 2ZBVA 4UU7A 1EE2A 2M98A 1OGIA 4LTNA 1IZYA 5ALNA 4W7HA 3HYCA 1G7CA 2GD1O 1UCFA 2PN1A 3K0KA 5EFZA 4C0SA 5IDXA 2NO5A 2R5WA 4LOAA 1Y8CA 3WQSB 4DLLA 1HE4A 3HA7A 1UPAA 4FNMA 4JH0A 1N0HA 2QROA 5IJWA 1N33B 2GERA 2OSVA 3KSAC 3QBVA 3WSWA 1VE7A 2GZ1A 4CGYA 4XPIA 2XLBA 3H83A 4ZTBA 1TLTA 3OMWA 1XMPA 3RWBA 1SXJE 3A2KA 1M2FA 2HSDA 1DRUA 1MDFA 4IIJB 4JOSA 3E6AA 2VWHA 4O4JF 4HV4A 2SCUA 1DAKA 2ZWVA 3WGUA 1F4VA 3MG9A 4NCKA 2JD0A 1A7AA 4J16C 2JFQA 4PTZA 3ZVLA 1IIRA 3ZX5A 2OM6A 1NVUQ 1S0UA 5HCIA 1H42A 3NP7A 1ADGA 3PJDA 5L4LA 4KN6A 3TOXA 1QOQB 1CQZA 3QXGA 2PQ2A 3AY6A 4JBLA 4U4AA 2O0JA 1A4UA 1CF2O 3PG5A 4JI7B 4JLUA 2AJLI 2XUPA 3LP5A 3ZC3A 4BKRA 1NJ6A 1T0JB 3UKOA 2G88A 3HY3A 4HFMA 4NU5A 4MKGA 4X1IB 4YJ2A 4FDTA 3TZLA 2HMUA 3DPSA 4ZMRA 4JXZA 2HZ7A 1GZSA 1WY5A 1L5FA 2R48A 3G59A 3PQDA 5IH7A 3G13A 2YWXA 2V9ZA 5G41A 2MOKA 2ODEA 1KMHB 2XBLA 3O3NB 1GTMA 3V8VA 4K88A 1JIIA 2ZYIA 3ZY5A 4GX0A 4HG2A 3U61B 4BQQA 3PSAA 1E9AA 3L4BC 1ODCA 3QMMA 1JQKA 1PZNA 4MAFA 2XKBA 5GV8A 5J9FA 3ZDFA 4DSNA 4F5ZA 5BNZA 3AKZA 4MP6A 2YJTD 4PINA 3W9BA 2IH5A 4XRRA 3UHOA 3H4MA 4Q9LA 4ARUA 2FDCA 3TRJA 2UZAA 4MI6A 1O5TA 4UE6A 3CNEA 2XTJA 3ZVNA 4F86A 4ZYYA 4PX9A 2WHEA 4LCEA 4DIEA 3JALA 1NUUA 4LUCA 5I01A 3ME5A 4NPHA 1D6NA 2JF0A 4RKEA 2BTEA 1ZW6A 2BMEA 1Q1EA 2JI9A 3A28A 4K9PA 1E2NA 1PQWA 2HIAA 2J3QA 2ZB8A 3L06A 4JLNA 4O0LA 5DMHA 9ATCA 4WOJA 2PZ8A 4TTQA 2NYRA 1U0LA 3HPQA 1I3MA 4BFXA 1WQ1R 3D59A 5IS2A 1DBPA 2HA7A 2B78A 3BQNB 3PNPA 2DWCA 3LX4A 3O2NA 4G0QA 4U7GA 5FA6A 5E1OA 2BZGA 4KB5A 3E8MA 1YR1A 2FJPA 1O2DA 2IGTA 2XKJE 4J2TA 1KOGA 4I0WB 1LJLA 3EOAI 2O52A 3C5CA 2GQ0A 4QUGA 1WCYA 1Y9EA 2DR0A 3LCUA 5KS2A 2Y3IA 2O1EA 1ZIYA 2BGJA 1RTKA 2Z2IA 1OV6A 3MWDA 1NW8A 5KI6A 5K3OA 3BGOS 4L85A 4XR4A 3THOA 5K0BA 4EGSA 1R5OA 5CM8B 3TMKA 2XUGA 1DJLA 1JT2A 1JG7A 1I3KA 3FMOB 5IU6A 2R62A 3O8NA 4RNDB 5JDCC 1P4JA 3UMYA 1J00A 4KXXA 1J0DA 2I7CA 3JZIA 3MHTA 1EXMA 5BNTA 1VMDA 3COPA 4P2BA 3V34A 5LZ7A 2MSKA 1Z39A 5D7BA 4CM4A 3RNLA 4EYEA 4UE2A 3ENNA 1UC5B 3CNOA 1H2ZA 4M7WA 4UMDA 1WW8A 1GNTA 1NLMA 5K3BA 3SDBA 3OQHA 2QJRA 4PLVA 3UVEA 4AZ3B 4BCCA 1HNXB 2JLVA 4PVCA 5H16A 4LJ4A 4LTDA 2OK8A 3ZOZA 4RDCA 3QLJA 3M6WA 3W6UA 2VYNA 4A26A 2YY5A 4WACA 1DTWB 2O3SA 5CFMA 3IODA 3WK4A 4LGYA 2AEJA 3FUVA 4XWKA 4GO1A 5ILOA 4V1CA 2QRMA 5BV7A 1LSUA 3DE3X 1RC0A 5EMHA 5AVXA 5KKAA 4OJKA 2ZZKA 1XTZA 2DFLA 3N5KA 4QREA 4AMVA 4RSMA 1OLUA 3D6UA 2X1MA 3QV1A 5K03A 5DM4A 3GLQA 3UUFA 5F3WB 5EQDA 4L8LA 1B74A 5EIAA 3UNXA 2VUSA 5IXYA 1SOMA 2XT9A 1YU6A 2BY4A 4PLHA 2VPQA 4BB6A 2C57A 1UH5A 2X8AA 3R3SA 3EWAA 4YASA 4JKOA 2A1UA 2QUBA 1AURA 3NWOA 4FOPA 3I6YA 3UJ3X 1N7IA 1OAOC 2RARA 4ODIA 5ELMA 2HWUA 1JDSA 2XMZA 4WERA 1WG8A 5EI5A 1R18A 2G1AA 3K2BA 1JR3D 4RA6B 4CIDA 3ONWA 1VXOA 3HCEA 4GXNA 4J0JA 2GF2A 1VSTA 2QQFA 3GGJA 4H9GA 2PSDA 5HTKA 4QVIA 2YHAA 5G0WA 5A71A 4W5RA 2GN1A 1IXKA 2WT9A 3RYIB 2FWMX 1XZDA 2FMIA 4PPGA 3G79A 3OIUA 2A35A 1ZJZA 4Q7QA 2WICA 3QPCA 5JY6A 5JIBA 4FEYA 2HM7A 4Y7DA 2IPXA 4RTJA 2W2NA 2XDWA 2WQ6A 2YVUA 4HC4A 5DWDA 5E6RA 2C2ZA 4D79A 5G53C 1F4LA 3LHIA 4BN0A 2NUPB 4RH1A 3HJBA 4N0MA 1CT9A 3MJ4A 4JASB 3ZWDA 2PWAA 1PW5A 4MHOA 4DWOA 3ROEA 2PSFA 1T43A 2OCIA 2ZCVA 3CUWA 4JLAA 4XQ9A 4YN3A 2WU1A 4L51A 1A82A 2UUOA 1OIVA 4FYKA 3K0AB 2ZVDA 1PT5A 2WFAA 3ZV4A 1TUBB 3EARA 4WI1A 1E9VA 1PO7A 4IJKA 3AV0B 1P31A 4UHFA 5IARA 4M0DA 5DM2A 3COYA 1NMSA 1SH7A 3K1AA 3PCTA 4TKUB 2Q27A 4WT7A 4BTEA 3UYLA 2ZIZA 2XT6A 2V4MA 3GGSA 4PS0A 3UMCA 2WTBA 1QV7A 3DLCA 4EGCB 1JSZA 5AW4A 3CTPA 3MILA 2WJWA 4MVWA 2UUCB 4Q4HA 2YZ2A 3L6UA 4ML3A 2VXYA 4WW0A 2QN3A 2RHLA 1TTTA 3MB8A 3OECA 4DKJA 1SXPA 1ZX1A 3P0FA 1ONOA 1PJ2A 5GJCA 3D3WB 1JKJA 4BZWA 1ETUA 1UBLS 3V1NA 2BGGA 1DIGA 3EOBI 3IP5A 1C2YA 4UM5A 5JVDB 2PQMA 4FU0A 1KNQA 1KR2A 1GTZA 1TCBA 3JYPA 4C03A 2OUIA 3M6MD 3FLMA 1VCMA 2C5HA 2PLFA 3JPYA 1Y9ZA 2O2ZA 2VHXA 3D3KA 3IT0A 3MN1A 3V6MA 2PEZA 4QKQA 4MR9B 5FFNA 3Q0TA 3J80A 1EDDA 1HLDA 1J5XA 2OV1A 3CB4A 1WZIA 5TV2A 4E1AA 2HQSA 3T1QA 5FWNA 3C3KA 2H8GA 3ILSA 2QNBA 2Q7DA 1YR2A 3DLPX 3JAMA 3NJ4A 2D0IA 4NAVA 2MSDB 3L5KA 3KUUA 3C3XA 5EIEA 1VBNA 4BFSA 3G5TA 1R9NA 4WIAA 3G0DA 1J23A 2JW5A 3CNNA 5DULA 3ZHQA 4FB4A 3R9XB 2BH2A 1QGZA 3L0CA 1T4CA 3C6BA 4QC2A 4B81A 1I2AA 1ODLA 2EW2A 2J9GA 2Y9MB 4S2UA 1X92A 3E5RA 5FL7D 1BHSA 3P2MA 3K92A 4TVOA 5BNIA 2I9PA 4MV5A 1BN7A 3DVAA 4WK0B 2Q5OA 2RHCA 2AWOA 2YY6A 1QRAA 1U0OC 2LTAA 3AUKA 2ZRAA 3GLKA 4IVNA 1YMUA 2YOFA 2NV0A 4HH1A 4HKTA 4L76A 2C8LA 3IXLA 5HR5A 2VTBA 1UAAA 4D8WA 1HF3A 3UICA 3FVQA 3CR8A 2XIQA 4BBPA 3UWDA 4CU2A 3GLFB 1ZGCA 1UP6A 3JWGA 2HSJA 3LUCA 4C0HA 3T7DA 2BVNA 3P2OA 3GAMA 2FE4A 2ZRLA 3NNSA 3I52A 4LOHA 4P5DA 5CYFA 3ICQB 1H4SA 1FX1A 1JAXA 1I2MA 1N9GB 2FMKA 1WSDA 4L27A 2O1WA 4JYZA 1RNLA 2YZKA 2GZSA 2FMUA 1SOVA 5FT9A 4BQEA 5FNVF 1YQTA 2YXPX 4IP0A 2RHHA 4G09A 4XYGA 2PKEA 3W5CA 2MTBA 4Q24A 2CSXA 3K16A 1EM6A 1B41A 3M1IA 2V3WA 4JYAB 4MVJP 5HFNA 4RJTA 3EPJA 3HO8A 4XQEA 5CA0F 1NP6A 1RFGE 2PKQO 2VKQA 2D2FA 2GN8A 2HT6A 2XCOA 4U5QA 1B16A 4Q9IA 1AH2A 2J9FB 3HRIA 2H4YA 2I1LA 1DAIA 3EAGA 4X8LA 5LQAA 5DNWA 1V26A 2CHEA 1PGPA 4OH1A 4Z8YA 1YQWA 1RWKA 3U4AA 4XVCA 1XEWY 2H4HA 1IK6A 1DV2A 2AF3C 1N5LA 1X7HA 1SUIA 3EZFA 1E2BA 3JQPA 2ZJOA 4B80A 4YMTA 1MOSA 1P81A 1DQSA 1QO0A 5E38A 5FUXA 4ZI5A 3OUTA 2V97A 2A67A 5K5EA 1D2NA 1X74A 1XTPA 4MUMA 1WHTA 2OOKA 2GPAA 3KJHA 4G4IA 3FROA 2FUG6 1GVNB 3EEFA 3F5MA 5IJXA 3T9EA 3THSA 3TTWA 5AIBA 5C7YA 2W2TA 3L7CA 4NK5A 2BM0A 3DAHA 4IZOA 5JJ5A 4AY5A 2A1TR 4WBNA 3AY0A 3Q7PA 2DULA 3P4YA 4LCBA 3W0LB 2RJNA 4PAQA 1K7FB 1D9XA 2FN4A 2QLFA 5HUHA 3ANXA 5I9NA 4CM8B 4M9CA 5JS8A 5CGZA 2C3UA 1XMXA 5BSEA 2DQSA 2R3SA 4G5FA 3SBEA 4ALJA 3GF4A 4KPFC 5L51A 1C29B 1N2JA 4DNXA 1RRGA 3DLIA 3QVXA 3QWHA 4P92A 1QS0B 1OFIA 2EHJA 4G3XA 4E32A 5A7FA 4M0CA 4ZQBA 3UK0A 1N6IA 2KMLA 2FSFA 5JQGB 1UBFA 4MPRA 3VPHA 2C31A 2G5CA 2R4QA 2BEWB 2P30A 3NBZC 4DPMA 1C7ZA 1W46A 5TJ9A 3QK7A 2JDID 1KPGA 3R09A 1D8AA 1GZVA 2CEKA 5EJFA 5BUZA 5KX5B 4NJOA 3UXYA 4J0DA 3G6KA 1HPLA 1SQFA 1Y8RA 2RKOA 3DOOA 3PRYA 2ATXA 3VNQA 4M1TA 3ZNNA 3ET4A 3AVUA 3SSNA 4EEZA 2WAXA 5JE8A 3CNHA 1XZMA 1TJ4A 2G8LA 4KQJA 3T3HA 5A6VA 2ZAGA 4E3ZA 5JS7A 2R9VA 1NMZA 4OA5A 2G9UA 3GNLA 1SXJC 4IGKA 4P53A 1CJBA 4PHCA 2O2DA 4MH0R 5B7PA 1Q0ZA 1IG0A 5G4KB 5U4QA 1Z0FA 3PUYA 4EENA 4QDTA 4L72A 3EH2A 1PJAA 2D74A 1QZXA 5CK4A 4CMKA 1REQB 3EGXA 3RVBA 2C03A 5FHRA 4E21A 5I7UA 4EW3A 4BV8A 4OLAA 4UTXA 4RIGA 2OC4A 2QRZA 2IXTA 5FV7A 3VR6A 1ZVQA 3BSWA 1LI7A 1BDIA 3HYRA 2R6JA 3LWNA 5K09A 1THGA 2H5JA 2ZAMA 1OZAA 5A4KA 3AR4A 3ISVA 1M10A 2YYAA 1FU8A 5KSZA 1W5EA 2HPAA 2Y27A 2J5RA 5D5PA 3TZBA 2FPUA 2ISQA 2OBFA 1GZHB 2JJQA 4IQ0A 4QOJA 4BPRA 3NASA 3OQ6A 3PICA 3H6HA 5JH7B 3D3NA 1U5CA 4BX9A 1GGFA 1JDBB 3QKWA 3H17A 2VRCD 3CV3A 4RPCA 3L2OB 4FFOA 3M9XA 3K15A 1VIAA 5MF6A 1G0OA 1TM4E 4OI4A 3KT8A 2Z09A 4H59A 1G21B 3EQ9A 3QXXA 4TXHA 5FBKA 4AK9A 3X1YA 1QBKC 2NU7A 1P72A 1FCJA 2CD9A 2JD2A 4YJ2F 3X1WA 4BEJA 2EWWA 4EEXA 3RT7A 3J7AC 5F7ZA 2JGDB 1C1DA 1G8AA 1V7CA 1E79D 1NSTA 2WSLA 3ZGYA 4Z2YA 1ACJA 1DT3A 5IANA 1WCIA 3GR6A 4N39A 2R6FA 3M4ZA 2AUMA 4DEVA 1FJXA 1JWLA 1NWCA 5CBPB 2PAAA 2WPDD 4F7DA 3TXXA 3ZZNA 4BVGA 5C5CA 3M70A 2FW9A 2AI3A 3MCZA 1RRMA 4ZQHA 1NYRA 3TBFA 1AKMA 1EG7A 3TEJA 3DUFB 1YCGA 3MINB 1GR0A 2WW8A 1CY4A 5TMEA 4CV1A 1IB6A 4ZK2A 1RS0A 5DP2A 2JC3A 5KOYA 1A5AB 1OZGA 3HXQA 2HEGA 2YXDA 5AXAA 3CJQA 2Z30A 3VOTA 2Q3CA 2OO5A 3GJ0A 5KKNB 3GJSA 3G2JA 3T4UA 2RI6A 4K6OA 4Q9HA 4J7AA 4QDKA 4P7JA 2HNKA 1ZQ9A 2Q6VA 2Z56A 2HUPA 3OOJA 2V1XA 2RI0A 1YA4A 4MQMA 5HS6A 1KSJA 1O95A 2VP4A 1QLJA 3OE5A 4UW9A 4ZAFA 1ODTC 5DWQA 2P67A 4HT3B 2VUHB 2QTTA 3LPLA 2NVUB 1IH8A 1ZXXA 3D4LA 1W6UA 3PC3A 1VE9A 3KOMA 1CY6A 1YACA 5EWJA 1FPMA 1ACLA 3OIGA 3S99A 2FSIA 1NG1A 4QLBA 2AE1A 3PVSA 1VDMA 2WD8A 1W4RA 2PLAA 2AEMA 2OOSA 3MJFA 2O7SA 2Z5VA 5GIOE 3FZYA 2G6BA 3EVDA 2OD7A 5AWFC 3RDPA 4EVRA 2X4IA 3GMSA 1H0HA 4TWAA 1P2GA 4I9GA 1W88B 4NZPA 4CKBB 4UM7A 2A59A 2JVJA 3TLXA 3IO5A 3QLUC 1Y3DE 4NCHA 2IEIA 4LN1A 1JDVA 1W4AA 3CR7A 2F2TA 4GP6A 4QU9A 3OM8A 3T52A 4RENA 1NVGA 2TS1A 4LXIA 1U80A 4N5LA 4QELA 5F5XA 1S4MA 3M8KA 5IDVA 5IMBA 2AJCA 2HC9A 3BMNB 2FFHA 3K30A 5EWMB 5JH7A 1L7DA 1ZPDA 3FYUC 1Z12A 4G56A 2LRHA 5CFOA 5GADl 1KBZA 2FWRA 1P1FA 3JQ9C 4B3XA 3A6ZA 3LDGA 4LJYA 4TT3A 4YRTA 4YRCA 3CNLA 4YP7A 4V0LA 5IDQA 3G23A 5J1TB 4H7DA 1K8QA 1P2DA 2E0IA 4KH1A 4TQ9A 1CB7A 4X7MA 1Z29A 2AN1A 2GKOA 4I8XA 2C7GA 5KOHB 4RZQA 4TYQA 3KQUA 2V98A 5L4NA 2EZ9A 4FX5A 5EXTA 3G9UA 2AQKA 3L8CA 1QH1A 1ZUIA 2RGAA 4R6XA 4ARSA 4K81B 4RD1A 4GMXA 1Y8QA 2VLBA 3C5VA 1U8AA 4QUEA 1S2NA 2AE2A 2CLSA 2P8JA 3MUEA 4HRAA 2NU8A 1XCLA 5J47A 5KHOC 5EMJA 1J2RA 1HC7A 3NWBA 1I7LA 4G1CA 3VI4B 4O2AA 2ZUBA 4XVHA 1MJNA 3ZE1B 1WZNA 1P9OA 3QU9A 3JQ8A 1SCUA 2ZYTX 3NYWA 2O8DB 4IH4A 1DIAA 3I2FA 1T91A 4TUYA 5EMNA 5KQRA 3BT7A 4MPDA 2VSNA 3IS3A 1PKEA 1T9ZA 2IE8A 2PVSA 4KREA 4FSDA 3TPFA 3OZFA 1PG5A 1K8RA 2PYIA 3ED1A 3JD2A 3VR4A 3QUTA 1NT4A 4XM1A 4BE7B 2VAWA 1S3FA 1M54A 4CMEC 1SXJD 3LCCA 4X7RA 5D5QA 3FDIA 5DT9A 2CE7A 2HV8A 3W8NA 1U28A 4NR0A 4HZIA 4XUGB 3TZCA 5FTJA 3RTEA 2J6HA 3HUEA 5IT9A 5G1PA 3TCNA 4KU4A 3WIEA 5MHTA 1V37A 3P9RA 1G3QA 4KX5A 4N47A 4TV9A 4C4SA 4TLCA 1EIWA 1P17A 2QX6A 1CRQA 3KTDA 4MR8A 4PGMA 2H59A 5TPWA 5LIPA 3IAXA 1NN0A 2ECKA 3RU2A 3KWLA 4KQFA 5IAAA 1HMPA 1ST3A 4CZ2A 4KNVA 1NVFA 4KODA 4OI2A 2H2WA 4NWIA 1GLVA 6PFKA 5L7TA 1FF9A 2XDQB 4ZAWA 3VNVA 3OF3A 4TLLB 4AYWA 1T8YA 3HB0A 3RJMA 721PA 2RGUA 4ARCA 1ZRHA 2NP7A 1GZ5A 1S5PA 1SKUA 2GZ2A 4JJKA 1KMMA 2A2ZA 2HMTA 4GYJA 4CI0B 3PD0A 5DBHX 1P0IA 5H5JA 1IOWA 2CCGA 3IGFA 4LYGA 1GSHA 4RXMA 3CG4A 4LDJA 5I3CA 1DOAA 3OOWA 3Q40A 2EGHA 1H05A 1CIPA 2NUTB 1JYEA 3NDPA 3L05A 4DV5B 4WDRA 1JKXA 1P2UA 2QW1A 3R6DA 1K7YA 4MW6A 5FBRB 4U2CA 1RE1A 3W5HA 4E70A 4EHKA 1KARA 1E1NA 3KDAA 4D3ZA 2DR3A 3ZE0B 3FOEC 5TS3A 4EFMA 2J1LA 1GGHA 2C8KA 1YCFA 1N6NA 3KR2A 3MLEA 3ONVA 5MGNA 2N1MA 3FNIA 3HZOA 5B7QA 4MJLA 4W8HA 1PJ4A 2GR9A 3I2IA 4UPVA 4D3YA 3C6QA 1ST2A 3DFKA 2REQA 4W5WA 1W59A 4O4HA 5EAIA 4NNPA 4KE6A 3SQLA 1DDOA 4B3TB 2FEXA 3RUAA 5CVCA 2FQQA 1Y1PA 1U4SA 1RWPA 1YXMA 3KL4A 2QN9A 1ZGZA 3LY5A 2VEOA 4BWFB 5CXSA 1II0A 1T3HA 2XKAA 4YCSA 3KETA 1NW3A 1FMTA 4KDCA 4HJXA 2ZJ6A 3EGIA 3WLAA 2QUJA 4FFSA 4R7GA 5JPIA 3RRMA 1O4WA 2KBFA 3U48A 5I9IA 4P4NA 3EG5A 4IHJF 1PGOA 2QNIA 1QE0A 1KIAA 3FG9A 5JCOA 3MJVA 1Z74A 1M1YE 5JC1A 1QK4A 4LDPA 1E4EA 1PEYA 1XU9A 1YONA 3LBNA 3TQQA 5CDTA 1ZL2A 5C34B 4AP5A 3MTEA 3OBIA 4ANFA 2EKLA 3UJ6A 4RIHA 4A10A 3L7AA 4LC9A 5TR9A 3ZU3A 2AOTA 5JG7A 1F0YA 1PNOA 2QPAA 4KBGA 4P54A 1KKLA 5F1OA 3KSMA 3ZDDA 5BT9A 3RJ9A 1C81A 1GEEA 1VJCA 4K86A 1PS8A 4XLZA 4MW5A 3LT4A 1E6LA 3MSXA 4IIXA 3KQLA 1TVEA 3UJCA 1UADA 1ULAA 4XFDA 4BRSA 5ICMA 1XVAA 3HK2A 2EP7A 1C7RA 1JYSA 1Q44A 1ZDMA 2WIDA 3VFDA 1SKYE 2W8BB 3E84A 4FW8A 3ZJYA 2XQGA 3K1ZA 1MC4A 4WEOA 5DX1A 1PZMA 5K3CA 5KAPA 1ZJ6A 3IEKA 3OZXA 1GRNA 3BWDD 2WMDA 3DBIA 3DF9A 1BXKA 3W3AA 3ST7A 1CX9B 3USZA 2OA0A 4UVDA 3U4QB 2R2GA 4Y98A 3CZAA 4I1OA 1KU0A 1O8BA 1S2OA 1VYUA 1XPUA 1Z88A 4DQVA 3CPSA 3LUBA 3FTQA 4FI3F 3HSYA 2C3YA 4YJFB 4EI7A 3NHSA 5M3BA 1KZ1A 1DJMA 1EBUA 2Q29A 2QGFA 1W5SA 3DEFA 3KS9A 2F8MA 1QGUB 2FSUA 3BRQA 4TZKA 4DLVA 5ENDA 1SVNA 3I72A 1DZ3A 4KZKA 4HZUA 3ZOKA 2O57A 2AG0A 4KO3S 2B35A 4JODA 2W4IA 3AP1A 3E48A 4IIJA 3H8WA 4IUYA 4Q1FA 4CETA 4EF4A 3AUJB 2NUBA 2GD6A 1KH2A 5AM3A 1A4XA 2Y77A 4G0ZA 1EX6A 5I4CA 1H5UA 3NANA 5CXXA 3VO8A 1M2NA 2H4WA 2XECA 4JT8A 3T0IA 3ADBA 3NHRA 3K8ZA 5ADVA 1JDNA 1I6MA 3KVYA 5KPJA 1EH5A 2A0YA 2OHXA 3ORQA 5HDBB 1RP1A 4HN4B 4ZHQB 4JB0A 5IKPA 4DC9A 3NAGA 2IITA 1B8UA 1XD2A 4MI9A 4Z9AA 5BR4A 3GFVA 2FN9A 1CLEA 1TCAA 5DXJA 1FTQA 1QHYA 3WHPA 2DCMA 2R87A 1ONBA 1IQUA 1ZGHA 4NBWA 3IAHA 4YRQA 5LP6C 1TC2A 4X1IA 5ALGA 3EC1A 3EZGA 3KVVA 4MJ3A 2VAVA 1VYTA 4LJAA 5L3ZA 2BC9A 2FR0A 1JAZA 4LBZA 1XQWA 2O8NA 2IVZA 2XUOA 4OLJA 3O8RA 1B6RA 2V7WA 3FWHA 4US0R 1F4PA 3DBOB 4YMWA 1EHYA 1SVOA 1TO1E 3O8OB 4EY6A 4RPHA 3WGVA 3U56A 3MVEA 4UBOA 3TLCA 5C7IO 1X14A 4IJVA 4YMSA 1RWVA 2Z8YM 4CKWB 1CV2A 4C4OA 1RWXA 3IIKA 3LPDA 3PI6A 3VSAA 1QP4A 4E13A 2A3NA 1LRJA 1RQ2A 3FTNA 4B83A 1EJ2A 3BSFA 2XF8A 1BIFA 1W48A 4RVGA 3PDWA 1IIBA 4CODB 1G5TA 1EFPB 4DMRA 3ETEA 1EZ4A 2NT3A 3HP1A 1AS2A 5AJHA 2O2EA 4AZVA 3WLJA 4D9GA 2V0GA 3H97A 3O4FA 4XFJA 3ICWA 4NK4A 1JTEA 3PB3A 2JS7A 1HMYA 3SDSA 4H7PA 3QWFA 3QPAA 1GG2A 1PFVA 1UPXA 4I8DA 1N5OX 3LQ2A 3P20A 4UCQA 1TECE 1WZCA 3WLSA 2Z2YA 2X19A 1YI0A 2QB5A 4Q3NA 2FEAA 1I2DA 2ZB4A 2FJUA 3G0CA 3L9WA 1NNLA 3HWX1 5K51A 3WTBA 4DARA 1C9DB 2QVYX 3RYFA 1RE0A 5DN6A 2W90A 1Z47A 4MUFA 1W49A 3ZV3A 1PEDA 2OD9A 3GDGA 1HA3A 3OPXA 5BN1A 1ZLXA 4MI1A 3V4ZA 3VAZA 4JUFA 1LU9A 4JBNA 5IHXA 2BGWA 5CJJA 4YB8A 4TXLA 1ZIOA 4QARA 1FOEB 1N3BA 1Y4AE 1IY2A 2QI9C 3OZIA 1U2GC 2EQBA 2G1JA 4INPA 5NULA 3A6FA 4PC1A 2C9MA 2C9OA 1UFVA 3LZDA 5IKXA 4LFAB 1LW6E 2I7VA 4ES6A 1NUHA 3DKKA 3NHBA 2JB9A 1XA4A 5AW1A 1U1DA 3KJIA 2GHTA 4Z4EA 3BWCA 3G0HA 1SBCA 2W2QA 1VECA 2F3TA 2H5LA 1JDTA 1T9AA 4MX8A 1UK6A 3C39A 2RC5A 1AHHA 1E1RD 1CULC 3CPEA 3KQOA 2H2DA 3PSHA 4FGKA 1MHPA 2HJSA 4C9BA 4BATA 1XRNA 3BTVA 4J0GA 5AVWA 4D8VA 1Z5WA 4KGXA 3BHMA 1KBOA 1GDHA 2CKMA 1TTPB 2NPFA 5LXTF 1B8OA 3EPLA 4L3WA 4GZLA 3B89A 1P0FA 1NXPA 2HH9A 3C3EA 4HPWA 4AZ3A 1P2BA 1FQKA 1Y6RA 1EGVB 4UD6A 1KI9A 1XVUA 1KVSA 2HQRA 2RGNC 4JOQA 1O96B 4S12A 1BCSA 3PR2B 1DTWA 4CCWA 2YS7A 4PWYA 3G2HA 2QTVB 1PG0A 4I6JA 4BO9A 2G70A 3W9UA 3KJQA 3EXHC 4BE4A 4N41A 1ISRA 3PDHA 5AOCA 1C9EA 3K31A 4PCVA 2X23A 1UBKS 4PQFA 5A4JA 4UVIA 1VL5A 1VPVA 1CZHA 1UPBA 2QAJA 3ZDAA 4DDTA 4NH0A 1IY0A 4G9GA 1HLPA 3BGVA 3DMPA 4IWYA 1VBFA 5ALFA 4TVSA 1KS2A 3NDBB 4HLUA 4BJ5A 4Q4CA 3H16A 2P68A 2VPPA 3MRTA 1P4AA 1MXFA 1HDZA 4HEQA 2D0PB 2GLXA 4NFLA 4QNNA 3F4LA 1DV1A 1FNNA 2CXNA 5AM1A 4OXNA 4J29A 5E2IA 2XUDA 1EFKA 1JHQA 4F4UA 1T5DX 1YCHA 1M8PA 2E7ZA 2VFAA 3BIJA 5KDLA 4QEKA 1U8CB 4QXQA 2A1TS 2X9LA 1R00A 1B2LA 1JJBA 1CEQA 1FPQA 4RA6A 4ZVTA 4WL0A 4KLRA 3QEJA 4RJIA 1X38A 2GI4A 2VJCA 3ECSA 4GWKA 3BVPA 5D86A 3I8XA 4DLAA 2PUHA 5EJAA 1VKHA 1EUDA 4P3KA 5ALOA 3RYIA 4RKYA 4EX7A 4AMZA 3N8IA 1RBYA 3IPRA 2A9FA 3GFGA 4F5DA 3WIBA 1L7AA 2ZI5A 3HDTA 2JAUA 4LYYA 5E0OA 2WIBA 4UMEA 3TNDA 3WLOA 4CHGA 5BWLA 5MFZA 2O2HA 3D31A 4MQFB 5GQSA 2OB2A 1R50A 2VTKA 1PT9A 1W4LA 3MMXA 3O6VA 5DHPA 4DADA 2C95A 3O4IA 1Z4MA 4XUCA 2CFTA 2ZSUA 4RU1A 5GP1A 2RH8A 3OX4A 4Y2SA 1UZAA 4QVKA 4QM6A 1N8SA 2R1VB 1ILEA 3K0AA 2VHYA 3QTTA 2ZT6A 3K9WA 3I32A 1PE0A 2QTRA 3LKDA 4J7CA 4WXHA 5BWNA 1SUPA 4MJ7A 4TKUA 3DDWA 2GKSA 4JUDX 1KFBB 3SC6A 5HRUA 4REMA 1QFZA 2X86A 4U2BA 3DMRA 1XX6A 4JCOA 3GJ6A 3PIIA 3BMQA 1ND5A 1BVHA 2R8RA 2WA1A 4MYDA 4P3OA 2R0QC 3W4IA 1XDWA 1IJBA 2B8WA 4IQFA 5REQB 4YCJA 1R6XA 4O2AF 4HGNA 3IA2A 4LHEA 2W22A 4L5AA 3D3WA 3DCIA 1YT5A 1BCRA 1YFLA 3TL6A 3R74A 3ZVMA 1JAIA 3D6HA 5JVDA 1PQUA 3X1ZA 4QD3A 1IEWA 2WJAA 4F0JA 4TROA 5FD8A 3VHLB 3GROA 3PQ7A 5HPYB 3GNSA 1GA6A 4O4IF 4FNGA 4ZOAA 3OZBA 3ZNPA 5ECGC 5B2EA 5A7HA 5HK8A 2XXAB 4O02B 3EZ7A 2WP0A 4BVLA 4YQEA 4DY6A 1JQEA 1LVHA 1Y3BE 2REOA 4X6XA 4ENTA 3R8FA 3R9XA 1IK4A 4D57A 4PRKA 2POQX 3E9ZA 1M8GA 1X8XA 4G8BA 4R3WA 4RTSA 3MCTA 1GFZA 1X1TA 3KSUA 2WU4A 3NWEA 4HLDA 4QYTA 4B2YA 4ZCIA 4IQ4A 3PHBE 2OCKA 5JTUA 1PV1A 1E7SA 2TMDA 2ZP1A 3H42B 3AR2A 1YOVB 2UYYA 5F98A 1THTA 4A2WA 4C4YA 4MIEA 3EEQA 3KKZA 5KB3A 3F8WA 1GT6A 1AJEA 2OG1A 3ZTTA 2DX7A 4Q12A 3TGWA 1G9XA 3B3GA 2HNAA 2XE7A 4HB2A 5AHRA 2H7CA 3R7WB 3U9SA 2B69A 2OESA 3QQ5A 4UKDA 2EG5A 3F1LA 3CKYA 3PF9A 2QVCA 5J2UB 3WRWA 2AT1A 1LZKA 5KTSA 1L4HA 4TM8A 3ILXA 1G8KA 4OVKA 3B5EA 1G59A 5JOQA 2WZBA 1NXSA 3DT8A 2P11A 4WJLA 1EGQA 5FTKA 1YASA 1WDKA 3EJWA 3KUXA 3Q8LA 2P0YA 4HOYA 3HGTA 4ZARA 3RABA 5E95A 4DL9A 1IHDA 3DCJA 3PHGA 4TN5A 3VR6H 1V3VA 1GAEO 4Z51A 5J58A 1HDIA 4RDIA 3TNFA 3UENA 3LDFA 3ZCQA 5K8VA 4B4KA 1YQGA 1RYYA 1DT5A 4B44A 4AWXA 3R9KA 2ZBPA 1F6BA 2YN0A 1FP7A 2BGMA 4OB6A 5J4KA 4HAZA 5EZ5A 1G8HA 1N6LA 3TAXA 5EVCA 3K72B 5KINB 5BR7A 3FD8A 1OVGA 1VYVA 5HZMA 1AUOA 1XL1A 3SKYA 5COBA 3DAOA 3AOEA 1J5PA 2FFRA 2RGRA 4KTTE 3L82B 1OSNA 3H1PA 2ZUEA 1PR1A 4NP6A 1IM8A 1HE8B 1YVEI 2R7MA 4FFLA 1UBSB 3OE4A 4H18A 1N2BA 2Z2ZA 4FCWA 4BQSA 3T3GA 1XZFA 1YC5A 4JP2A 2BIFA 3ZWAA 5G3ZA 1V1RA 4UU0A 1CZLA 5ERYA 3HI6A 5EC8A 2EJWA 2Q46A 2VH2A 5JV5A 1E4OA 4FBMA 3R44A 1T0IA 1AKRA 3AZPA 3EXFA 1CQPA 1PNTA 1ENOA 4D4GA 3BXFA 3WAKA 3BHJA 1THMA 2VP5A 3OZSA 2XVZA 4KMOA 3K96A 5AKJA 3QX7A 2ECOA 1I5EA 1X7DA 3CGGA 3D6JA 4MCIA 4RHCA 5AK4A 4ETNA 3IE1A 2GWRA 1KXZA 4CM8A 2PBZA 3E7DA 3HFJA 4DQKA 5DNEA 5FAXA 3V1YA 1C7EA 4IDDA 2PKYX 1T9GR 3F3YA 2EZ8A 4US2R 3NKVA 2PE5A 3D6AA 5DSTA 1QS0A 4R69A 3ABQB 3D2CA 4N3GA 1AGYA 5DTJA 1CJUC 3DFFA 4HS4A 4EHAA 5JQGA 5LUAA 2VHWA 3I5MA 2BEWA 4DJAA 4AP9A 1P4SA 1WBBA 1GTSA 4KR7A 4GE3A 4X1KB 2PR2A 1V8FA 2OT3B 2PD4A 3CO5A 5AI5A 1CP3A 1XNGA 5EG5A 4E5MA 4EHHA 3C15C 1HT1E 1ZC3A 4GWLA 5E3IA 3LRXA 4F3TA 3A05A 1SVSA 2J31A 1JPNA 5AW5A 5KX5A 2GT1A 4LQDA 3B70A 4KR2A 4OQXA 4MV4A 1JVBA 4RO0A 4BUZA 4WVLA 4BDTA 5KWIA 1FFEA 4G67A 1I0LA 4U1RA 3H75A 3R24A 4RESA 1ZN9A 1C3XA 2BFBB 4HB4A 2AOUA 5CYOA 3WQRA 4DABA 1F51E 5D2CA 1WMEA 4JS0A 3TUZC 2BTOA 3H13A 2ONZA 1EK1A 3IQEA 5BV1A 3UMSA 5HGXA 3O1JC 1DAGA 4DEYA 2AK2A 5G4KA 4KUEA 1N2CE 1GKUB 4UAUA 4GOLD 3RUCA 5DHAA 4ARIA 3OIWA 2YVLA 2JIRA 1REQA 5GJBA 3DR5A 1QF6A 4IKOA 1LA2A 5AI6A 2JFZA 4G81A 4RIIA 3J81k 2VJYA 2OZEA 1TZCA 3QMWA 4RL4A 1U90A 3K9NA 4PZ9A 1JHRA 1UOOA 4AICA 1N1GA 3COVA 2YJGA 3NOXA 4NU6A 3RU7A 1IBLB 2A5LA 1WHSB 3ZHVA 2DPLA 3U62A 4DA9A 2A9OA 2SKEA 1UKBA 3L77A 1I7PA 2VSFA 4A0HA 1EVLA 4J0KA 1GNPA 2DUWA 3HDVA 3WWYA 4DNQA 2P75A 1AUVA 2FK7A 5H02A 5EKDA 4BU0A 2UDPA 3KQYA 3CXRA 1ZKMA 2IUFA 4YGYA 2WY2D 5L3VA 1QORA 3CSDA 3U49A 2X4GA 1I2CA 4NZMA 4AKGA 2JGAA 3PE3A 1CBUA 2CYAA 1SU7A 2CXUA 1MZVA 1G21A 2P79A 1KC1A 3AYXB 3JD3A 1UXIA 3L8ZA 3QGMA 1KKMA 2HAEA 2JLRA 5IN5A 4BLSA 5CX4A 5TNXA 2M6KA 4B73A 5JPCA 2C54A 4E94A 3R2JA 4LX0A 2H8KA 2C96A 4FM9A 1IYZA 2Q3HA 5HE8A 4X24A 2Q7XA 3N7TA 1MOPA 2B83A 4YDHB 4TMFA 3E23A 3F71A 5CBPA 2FZGA 3KNZA 2NM0A 1GTRA 5HSGA 3HZHA 4ND3A 3IVCA 4A5SA 3HR7A 5BSVA 3VR4H 3CSUA 5IJ0B 5EXXA 1ZRSA 2RCYA 4X54A 2XCSB 2C7VA 3DUFA 2MYNA 2PWPA 5H3LA 3MWYW 3SYTA 4JB8A 3ILYA 1A1VA 4NCJA 4E6EA 5C4IA 1DPFA 3RFVA 4TKVA 2WMOB 1QVVA 4D4IA 1PL8A 3OM0A 2VP6A 1Q1BA 2ZYGA 1G5RA 2BFOA 2WJJA 1CUXA 2W5UA 1GYRA 1P3DA 2X13A 1E5VA 1HBJA 3BUSA 3FPKA 3K3PA 4ILEA 5PGMA 1V3UA 3M33A 4M9RA 1K88A 2Z2JA 3NHFA 4FE3A 5T41A 4BQNA 1JQJC 4TLDA 4G0UA 4DYDA 2W2KA 2GAOA 1QIJA 1K8ZB 3C7AA 1N32B 3KLBA 3VR6D 3THWB 3R5TA 2NVUA 5FOUA 2GZHA 4RGVA 1QTNA 2V7EA 3OA0A 2HLDA 3PNLA 4OAOA 3B13B 4RM3A 5FORA 2GJKA 4EJ6A 1AXRA 2YBEA 1N92A 1Q74A 2CLOB 4NMHA 2VPYA 4Z3OA 2D3TA 1F7UA 3VX3A 4DLWA 4D6YA 5KTMA 2HBYA 1X1AA 1ORRA 3CKKA 4KNWA 1GA1A 4NG5A 1ZY2A 3VMMA 3BFPA 4ZVLA 5AVVA 2ZRCA 4QPCA 4HDMB 4B3JA 2Z6AA 1HG1A 3ROKA 4CKBA 3W7AA 4AG5A 5I9LA 1AA6A 3DHEA 3GJQA 3C24A 4B34A 1KE1A 3RVSA 4BY9E 2JFXA 1XCJA 1JMKC 2CLLB 5C8VA 1QIIA 3BICA 3O9VA 4XD2A 3L8YA 1U1GA 1KC3A 1USVA 2BM1A 2QD4A 4YNBA 5I4IA 3JR7A 2HIMA 3O8LA 2FZCA 4WKPA 4LMPA 4YAOA 5EWMA 3WK5A 3GEEA 3AJEA 4DLZA 1ZOIA 3AH8A 3DEYX 1EDEA 4TX1A 4OXQA 1GO2A 3B1FA 3A3OA 4BV2A 4CF6A 2B8NA 3JQCA 4PFKA 4TLBA 4DMHA 4GP9A 4JLOA 2G4CA 4NOMA 1E0DA 1DAHA 4W8OA 5KOHA 2PUTA 4WD3A 3LUFA 5A3RA 2NX2A 3IKLA 4WADA 1O95D 1RLJA 2C4KA 3B53X 3CQ9A 3W90A 1PZEA 4NPCA 1NUQA 3O47A 4YCBA 2XR1A 5FPQA 4LYAA 3S40A 1OLSA 2GCOB 2ES4A 4L08A 2P9ZA 1ZBQA 2CVFA 1V6CA 2H7YA 4WZBA 2QRVB 3MXOA 1M1XB 5C3MA 5LWHA 1MA0A 4ZT5A 1SAYA 3COZA 3NI2A 4PZZA 5AQEA 3KQSA 1JSXA 2GTIA 3SAJA 3V2UA 2OEPA 2VN8A 4YT8A 2D59A 2WHPB 2I2AA 1GCUA 2K6GA 4KBFA 4RMGA 2HX1A 4G5OA 4WMLA 5TC4A 3SJBA 4XWWA 1BVRA 3LK6A 2FRVA 4UQLA 3W7BA 3LF2A 2PY6A 3Q41A 4UM9B 2XWBF 2ZATA 2ZVQX 3LFTA 2VJAA 4YVFA 3SBXA 1SVLA 1O9HA 3FGPA 4KWTA 5DW3A 1CKEA 1NP3A 3S0JA 2DZDA 2XF2A 3VPDA 2IXGA 2CV0A 2OHJA 4L6AA 2ZRMA 2JFPA 5E1BA 1PBNA 5E7QA 3EZ6A 2VDVE 3W8RA 2NSHA 1QR2A 3PTAA 1U4OA 2DXIA 2P78A 1P9RA 2YW9A 1F9EA 2OWEA 1NQAO 2Q49A 3T7IA 1UOPA 2G9VA 5TDHA 4MV9A 2HW8A 4ZCRA 4E08A 1GL6A 3HR8A 3E2IA 1WSBA 2FUKA 3LLMA 2F8LA 2R6ZA 1OY1A 2UZ3A 3W3AH 1TQ4A 2AEFA 1FFDA 2YWBA 1YS9A 3C74A 3LQ1A 1UEJA 2C99A 3LZCA 3QXJA 4HNRA 4UVHA 4EG5A 1XFAA 2XDQA 2B7BA 3FHJA 4PHFA 3WQHA 1AB6A 3KOZA 4MGKR 2H16A 1Z82A 1CJVC 2YBDA 4IIDA 1ZMTA 1VL6A 3Q4GA 3QKSB 4YFVA 2X5OA 1XEXA 1QVRA 2DECA 1EFAA 2OQRA 1N4DA 4G9BA 3LQRA 4X3OA 3NU1A 4IYJA 4BNNA 4JHLA 2B5VA 1PR5A 2WJIA 2OXCA 3F46A 4KQGA 1CF9A 2CNDA 2BDEA 1WV0A 2PFKA 5FPPA 4D44A 1CDEA 4X60A 1T6XA 3L6EA 5C9ZA 4S24A 1ORHA 4WH0A 4A0SA 1TT7A 2Y66A 1H0RA 1ZCJA 3EIWA 1X13A 1XDDA 5DTMA 1W36D 3BWEA 2VXCA 2WB4A 2ZI4A 4FYIA 3VR4D 1W47A 3I9MA 1KQGA 2RJ3A 1OW3B 4C87A 3NG1A 2QSUA 1Z5PA 5JVDF 2ZSBA 2CZQA 2M6LA 4AL4A 3A37A 1LK7A 4EUKA 4S1TA 2JA1A 3TEFA 4CL2A 1O0SA 5F35A 3HG7A 2F00A 3T61A 1WTAA 4ZPJA 5IYZB 5I9SA 3WKEA 3F7MA 3MJSA 1EX1A 3CINA 5ECWA 2A9RA 3QXSA 4XJSA 1ISFA 3AGPA 3OLZA 1T35A 4KO8A 3MTJA 1G21E 2BTQA 2HOQA 2OC9A 3PK0A 4MUJA 3RHZA 5DW0A 2B8JA 4D9EA 3MOIA 1NBOA 3KWFA 4R3NA 4YRPA 3NCHA 1FFWA 1NU6A 1TJ3A 3C70A 2EHDA 4M6WB 4AC9A 4Q3AA 1Z6GA 1N0VC 3DQZA 2G80A 4UQOA 2B25A 1A1SA 3DBHB 1R15A 5EE9A 3U3KA 4WGFA 3BN3A 3UGJA 4WLVA 2BFWA 3VVMA 1SBZA 1S7CA 1KEUA 1SQ5A 1UDBA 3NZEA 3AFNA 3EWIA 1N7HA 4IRXA 5KC9A 1KERA 1DHRA 2H52A 4GYKA 1Q19A 5BORA 3DEHA 2ZRFA 5KHLB 3HUTA 4B82A 5C3UA 1UJ4A 4QJ5A 1RM0A 1E94E 1ESNA 3ZS9A 4DM7A 1QHIA 4HVAA 1Z7WA 2ISSD 3QSGA 3MS4A 1U1FA 2AS0A 1O0CA 1HTWA 2FFBA 4BKQA 4CVNA 4HYYA 2PVCA 4A1OA 2H1CA 3I92A 1NJSA 2O7QA 5FNZA 5I7OA 1M34B 4MDHA 4MTLA 2W6IA 3RUHA 2A5YB 1KEWA 1LGYA 1NE2A 1YRAA 4BWVA 4HYTA 4E14A 2XITA 4J2OA 1X2EA 2DUMA 4J94A 4LOIA 1JLLB 4QSHA 5D3QA 4CDMA 4TSRA 1YJAA 1XDBA 3TIGA 2NTVA 5LQCA 2PT5A 3P2YA 5FLEX 2QZPA 4K3UA 3X44A 2Q6OA 3T7RA 3L1IA 2BJHA 4GX2A 2DY0A 1EFHA 4F3YA 2Y68A 3U4QA 3ZJ5A 2EBUA 1XSEA 2G06A 2GN9A 3HS3A 5CT8A 4EHFA 3RKRA 1ZW1A 3FFWA 1D9ZA 3U4GA 4K87A 3BFKA 1A71A 4YJFA 3U7QB 4E5DA 4DDWA 5KWSA 1WAMA 3Q72A 3C8ZA 2FOIA 2GEFA 2IEBA 3H4TA 3R6TA 4EELA 2OCDA 2QS9A 2LP4Y 3TBHA 1JHMA 3VC1A 1JG4A 1DFHA 2IC5A 2VCEA 1KAEA 4DIMA 4JI2B 3O3OB 4DTCA 3IIMA 2QHXA 1Q0UA 4YO7A 1ZH2A 5EGSA 3DEIA 4GI3A 3B1KA 4K9SA 4QUJA 3LKVA 2FQXA 2PMEA 3A3YA 1NOJA 2BSQA 3IPCA 1Z68A 2NO6A 1JKIA 4QDJA 4XX0A 3UGKA 5EJ4A 4BGEA 4TL7A 5KJEA 3PC4A 4ZHQA 2WTMA 2V9PA 4I7EA 4P4GA 4ZO6A 2E9SA 3C48A 4X8MA 4CDGA 1XU7A 5FWXA 3GJ4A 1WMBA 4I3HA 1ZWKA 1CUUA 1SOWA 2CYCA 3GP3A 4N40A 3PEUA 2HUNA 2O0MA 3KB1A 3T7CA 1U2EA 5M2QA 3UV6A 4R1SA 1XZBA 1F06A 3FGOA 5JQGF 3A06A 3SDZA 4UDNA 5B6IA 4E5VA 3TX6A 4WJZA 2V7TA 3ITNA 1RC1A 4FONA 1VGQA 3IH5A 3O8OA 4XDGA 4ZAVA 4WZBE 1Q95A 4JITA 2BFNA 4B75A 3ACCA 4LZLA 1QFYA 1UK9A 4MQLA 1BXRB 3W3AD 4PNPA 2IOFA 4PG4A 2OXIA 5ENVA 1Y8AA 3TI9A 1F60A 4X91A 4HNHA 4BMPB 3A26A 4GLJA 3PFHA 4KMSA 4LEIA 2NSYA 4DG9A 1EFPA 3ENZA 1D4OA 2YCLA 2R5FA 1HWYA 4L78A 5JS2A 3QHQA 3H2HA 2OLKA 4JP1A 4CUJA 2W6OA 1RLOA 3DMDA 3FE2A 4AJOA 4ESHA 4V39A 2VCHA 3C87A 3PFNA 1OFUX 1P3Y1 3JQBC 4UOQA 2B4QA 1TM3E 1ZP6A 2RGEA 4R8KA 3MBOA 3U3MA 3VTFA 4U5XA 1XRLA 2Q5EA 3A27A 4F8JA 4K0KB 2JAOA 4AG6A 3O93A 1VZ3A 4ZGBA 2XRYA 4O1MA 4G1BA 2J32A 1YJXA 3K5PA 2AMFA 4IXMA 5LC1A 3IKMB 2TMGA 1JSLA 5IKMA 1QHSA 2C4TA 4KQ9A 3CTMA 1F7VA 4YP9A 3Q3JB 3KM0A 3OPNA 1XTIA 3E9YA 4YTEA 3RHFA 3WLRA 3HZZA 4GRAA 5JH7F 1HDOA 4OIFA 3KEGA 4O0MA 1KJ9A 2JL1A 2FQWA 2AB0A 3UMGA 1SUFA 3G49A 1V11A 3EVAA 4YAKA 1MW9X 2YXNA 1MRSA 5C8ZA 2XRMA 2WIJA 3RSSA 3IYLW 1XPRA 1UC8A 5JYEA 4GFDA 3I4CA 4QWWA 1V8DA 1Q3KA 4J9VA 1YJ8A 5AR1A 3MT9A 3WK7A 5C52B 1PLLA 3CISA 3C4JA 2CLHB 3K2QA 4LF5B 1UZNA 5AI4A 3PJGA 3UKJA 3AKEA 1FTWA 5BUCA 4BLOA 1U2SA 1UEXC 1NP7A 1I4WA 3V48A 3V9AA 1M5RA 2F8TA 2J9YB 3ANTA 4GECA 5EUCA 1L7EA 1ISJA 1O96A 1P19A 2B1RA 2HJGA 3DO8A 4Y1EA 4Y67A 2O54A 4PLZA 2BFEB 2QTVA 4P58A 3DMTA 1S1CA 3NV7A 3EMKA 1H2YA 2HT1A 2QJWA 3Q6MA 3NBAA 5ISMA 3V32A 3CWZA 2G7MC 3BIWA 4MW9A 4BLPA 3OO1A 1Z2AA 3UPTA 1KTVA 1UODA 2OXFA 2REXB 3V97A 4D56A 1I3OA 2XHEA 2I2WA 3CEJA 4QL3A 4PC2A 3BE5A 3HXMA 3KOWA 4BNDB 4HTFA 1L5OA 3WIOA 5CJ2A 2W48A 1G2OA 1AS0A 1OU0A 3HLYA 4AROA 3QMPA 4TXJA 3ZUGA 3V42A 3MBIA 4I5IA 4J1TA 1ZSYA 3WO1A 3QLEA 3C3PA 5SZKB 4M99A 5CLFA 3T3EA 1E69A 2WIGA 1ZCBA 2ZE7A 2DWQA 1OAKA 3CRMA 5F76A 2IDKA 2H11A 3JCZA 4D81A 4M1MA 2PZLA 2VYCA 5JZOA 2HSEA 4M7RA 1RT9A 1TTHA 3ID6C 3C6XA 5JSKA 2ZXFA 1T9GS 4LQ4A 3EZXA 3D4OA 1SQGA 4RK1A 3U4DA 3PC7A 1LVUA 1IAQA 3UK1A 3M82A 1DRJA 1P1RA 3PKJA 4ZAXA 3N70A 3FCUB 3T99A 4C3UA 1V6AA 2Q1SA 4MYUA 2CHUA 3Q5GA 1R8QA 4OQDA 3VKWA 4ON9A 1XOIA 3SJZA 1JFTA 3TRKA 1SZCA 1GILA 1M3SA 2GK6A 4FGUA 5G4LA 2R8ZA 3QUQA 4FIDA 4HDCA 5K0SA 4MWEA 2IS4A 1SCNE 3OPYB 2PUCA 1NBAA 4CU5A 1G16A 2R1VA 1BRMA 4JENA 1PR3A 1F9AA 1QO9A 4M1YA 3GC6A 4RDHA 1JQ5A 5JSQA 5THXA 4NYMQ 2JIBA 3O8CA 2GBLA 1RWBA 1P6XA 1L5VA 1XRQA 3ZI7A 2HSWA 2FP4B 1N0UA 2AUTA 1G1AA 1MX5A 1SOAA 2QM3A 3GY0A 4DLUA 4ICIA 2EERA 5IVIA 5ALIA 2VRWA 3CM0A 2G71A 4YECA 4GR9A 1JX6A 1XVTA 3NJ8A 4BLWA 1WF6A 2ILVA 5CT4A 2YIVX 2FYTA 5DBIA 1Y4ZA 2R8EA 1J8MF 1ISSA 1IUKA 1H6CA 1NM5A 4X6LA 2REBA 3ZGXA 2W2PA 1FSGA 4R83A 3BREA 2J7PA 4PYKA 1EFRD 4JJGA 1BNCA 3SPXA 3RRFA 3LX5A 1VPDA 3QWAA 2J09A 3OA2A 1LI4A 4R1TA 4RZ2A 1TU4A 1JJVA 4LGMA 3THYB 3OWOA 4LNUB 2QN7A 4JI5B 3C5WP 3P9YA 2IY8A 3H7IA