4J76A

Crystal structure of a parasite trna synthetase, ligand-free
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
389
structure length
372
Chain Sequence
GINYNKLIKEFGCSKITENHIKRIEKLTNSKAHHFIRRGIFFSHRDLDFLLNYYEQHKCFYIYTGRGPSSLSMHLGHLIPFYFCKYLQEAFNVPLVIQLSDDEKYLFNQNYSLEYINTLTNENVKDIISVGLNPELTFIFKNTEYAGYLYPTVLSIHKKTTLNQSMNVFGFNHSDNIGKISYPSFQIAPCFSQCFPNFLGKNIPCLVPQGIDQDPYFRLSRDIAVKMALHKPVVVHSVFMPGLQGVNSKMDHNNSVIFLTDTPEQIKNKINKYAFSGGGTTIQEHREKGGNLDKDISYQYLRYLLEDDNKLNEIGEKYKKGEMLSGEIKKILIDVLTELVLKHQEKKKSLTDEEISYFFDPNKPSLQKFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Plasmodium falciparum cytosolic tryptophanyl-tRNA synthetase and its potential as a target for structure-guided drug design.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Ligase
molecule keywords Tryptophanyl-tRNA synthetase
total genus 136
structure length 372
sequence length 389
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 4j76A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4j76A01
4DDHA 4ZCQA 4U8HA 1JHDA 1GPMA 1KH1A 3AG6A 4KR9A 2GOYA 2QUJA 4QREA 2WB2A 2A88A 3N2YA 2O8VA 3FDXA 2NSYA 2EJCA 5J58A 3PNBA 1X6VA 1YI8A 4OUDA 4GRIA 1WZ2A 3VU8A 1PFVA 1UFVA 3SYTA 1TYDE 3K9WA 1R6UA 1WXIA 1YIAA 2GKSA 2DEUA 4R2LA 1WY5A 2PZAA 3G5AA 3IVCA 3X1MA 4ZCRA 3PXUA 2RD2A 2J08A 3IOBA 1GN8A 4DNXA 1JECA 3FY4A 5HUHA 3AKZA 3UOWA 4ARCA 2ZUFA 4I6EA 1KH3A 3RK1A 3TZEA 2JA2A 1IQUA 2CT8A 1KH2A 2J07A 1NUSA 3RK0A 5KCMA 1ULHA 1NUQA 3HZRA 1T6ZA 5TEVA 2X1LA 1KP2A 4NAUA 1JEDA 1M8PA 1O5TA 1D2RA 1N3LA 1OBHA 3IOEA 2YWBA 5DASA 1K4MA 1N2JA 4ZT6A 4AS1A 3IODA 3F3MA 2G36A 1N1DA 1NSYA 1J70A 4MWCA 3IMGA 1F7UA 1YUMA 1H3EA 3N8HA 2AKEA 1FFYA 2D5BA 1BS2A 4JXXA 4WNYA 4QRDA 3JXEA 3SDBA 1K92A 3IVGA 2CV1A 4U7JA 3RHSA 3ELBA 1QRSA 2ZUEA 1VLHA 3FG9A 1B6TA 1M8FA 3QE4A 1KQNA 1X8XA 1JIKA 4UZFA 1COZA 2HMAA 3KT0A 1PFWA 1J09A 1KORA 2X3FA 3KT8A 1U3DA 3GUZA 4J76A 4S1OA 2X1MA 1QNFA 3CR8A 4MWEA 1T9GS 3HMQA 1U7DA 3FHJA 3P0HA 1G8FA 2QJOA 3RJZA 1K4KA 4GU5A 1TYAE 3LCJA 5TGTA 2A1TS 2CFOA 3IUEA 4EGAA 4MWBA 1QJCA 3ND6A 3VRHA 1QU2A 3A04A 3L92A 1LI7A 1EFPA 2J4DA 4YBRA 4EFKA 5H7XA 3IMEA 4EG4A 1ZJWA 3P0IA 1PFUA 2DLCX 1ZH6A 1N2BA 1M1ZA 4NATA 1WXGA 3SEZA 1IQ0A 3ISJA 1OWOA 1J1UA 1N2EA 5DK4A 4HPWA 1NZJA 1O95D 1T9GR 2AZXA 3IMCA 3HFJA 4EG5A 3VGJA 4WSOA 1J21A 4J75A 5J5AA 1PFYA 2PG3A 3CVXA 3C8ZA 1K97A 4NAHA 1P7PA 3FIUA 5J59A 2CYCA 1MOPA 4PBSA 2PFSA 2VTBB 2QTNA 2DXIA 1OWLA 2WSIA 3D6VA 1MRZA 1QQTA 1M8JA 2YY5A 4MW7A 3CLUC 4YP6A 2QJTA 5JBNA 3CA8A 3ILVA 4KKVA 1JZQA 1I2DA 1KQOA 3IDFA 2JANA 5HG0A 3OTWA 5BNZA 4TS1A 4R0NA 4MUFA 3Q4GA 1I6KA 3I05A 1PG2A 4MW4A 1WJGA 4KPUB 1J1ZA 2V0GA 3ZJVA 1JIJA 1PG0A 1IRXA 1O97D 4MVCA 2OQ2A 2GM3A 5K0TA 2E0IA 3CLRD 4Q93A 3P0JA 1EUQA 4NZPA 5LFAA 3UK2A 2V0CA 3INNA 1YULA 4I6JA 3TQIA 1O96A 4KPUA 1IFXA 3FNRA 1U0BB 2Z08A 5H16A 4DLPA 2IJGX 1MAUA 3P52A 4MUKA 4MW9A 2IP1A 2HGZA 4MW2A 3Q10A 1QU3A 3CLTD 4K0RA 1NI5A 1CT9A 5HUJA 3QTTA 4L2IB 1O0CA 2EL7A 4ZCSA 1TYCA 1KAMA 1LW7A 3AIIA 3K32A 4CDMA 3CLTC 2Z3VA 1F4LA 3TZLA 5F23A 3KT6A 5TEWA 1NUUA 4G6ZA 3CVWA 3IVXA 4MQ6A 3COZA 1R6TA 5TS2A 4CT0A 2QUHA 4PBRA 3UMVA 4EG7A 1OWNA 1TFUA 4JXZA 1GZUA 2DERA 2E21A 1T6XA 4MULA 2H2AA 3BL5A 1JZSA 2WQ7A 4JZYA 4JYZA 1O95C 1O94D 2Z09A 4KR6A 1IQRA 4X0EA 2I1LA 1A8HA 1YIDA 2PXHA 2A7XA 3H05A 3M5WA 2O5RA 3DV2A 1N2GA 3LE8A 1TYBE 2RE8A 3ZGZA 1NYLA 3CLSC 4MW1A 3ZJTA 3QTBA 4HJRA 3AG5A 1H1TA 3SP1A 1MBZA 5DEOA 2H29A 1Q19A 1JILA 1VBNA 4P2BA 3TS1A 2DUMA 4ZT7A 1M8GA 2E18A 4DDKA 5KHAA 4XSVA 3H9BA 4ZT3A 2XRZA 1GTRA 3MMXA 5DB4A 1H3NA 2CUZA 3MUEA 4UZEA 4L2IA 2TS1A 1RQGA 1ILEA 3IH5A 1QRUA 3GMIA 4R2MA 4CQNA 4EG1A 4PY2A 4OJMX 3CVYA 1V47A 1VBKA 2R5WA 4MUJA 1O96B 1U7XA 4RPIA 3OP1A 1NUTA 2A4MA 3SZGA 3A2KA 2CV2A 1Q11A 3GLVA 3AL0C 4E1AA 3IOCA 3Q12A 4HJXA 3E27A 1EJ2A 1NURA 1KP3A 1WXFA 5K0SA 1WQ3A 1MB2A 1FYDA 3N9IA 1O94C 5IHXA 1MC1A 1SURA 4MW5A 1JEEA 1Q77A 2J09A 3IUBA 4DJAA 4MWDA 1EE1A 1WKBA 3ND7A 1XNJA 1GAXA 4A91A 3D6UA 2D54A 4Q16A 4XFDA 3ZXIA 1JGTA 2A1UB 2A1TR 4KR7A 4F3RA 3ND5A 4I6GA 4ZCTA 2VTBA 3CLSD 3PNVA 1I6MA 4G5YA 1MJHA 1EFVA 1R6XA 3NBKA 4MVXA 4ZT2A 3DLAA 1M8KA 3HV0A 3H97A 4MAFA 3SEQA 1IH8A 1TEZA 1O97C 1N2IA 3ZIUA 2PZ8A 2PZBA 1XJQA 2WQ6A 2A1UA 2A86A 3LOQA 4MUHA 2BTEA 4OUDB 2C5SA 1N77A 1WXHA 4ND6A 1G8HA 3PRHA 2D13A 3COYA 4NX2A 3UC5A 1XNHA 4FZJA 2PIDA 1EFPB 3U1VA 4MUNA 3X1KA 1KQPA 4MLPA 1JIIA 1EUYA 1IHOA 1N2OA 4MW0A 2CV0A 3S3TA 2OV4A 3A4IA 2XRYA 1GTSA 1GLNA 1MB9A 4QBTA 1Y42X 1F9AA 3FH0A 3CLRC 3ZJUA 3G6KA 5LM3A 3MLBA 2HZ7A 5FO1A 4U63A 3ZUGA 4AQ7A 5FO0A 3TQOA 1EXDA 5AHWA 4EG6A 1HYBA 2QJFA 3A05A 1G8GA 3FWKA 4YP5A 1WQ4A 3KT3A 4MVYA 5IJXA 4MW6A 1VBMA 4YP7A 4G5FA 2DPLA 3RFFA 2QTMA 1OBCA 1ZH0A 1J20A 1N78A 1EFVB 2E89A 1MAWA 4ARIA 1N2HA 2QUKA 1Q15A 2BYTA 1IVSA 3ZXSA 4NDAA 1U3CA 2A84A 3G59A 4H3SA 1QRTA 3HL4A 4EG8A 4ZT5A 1NUPA 1V8FA 2AG6A 3FETA 2J5BA 1WOYA 2DETA 1M83A 4XFJA 4K03A 3FOCA 1TQ8A 3FI0A 1YUNA 2X0KA 4DE5A 1T6YA 4RUKA 2NZ2A 2QUIA 1JMVA 3DPIA 2IELA 4MVWA 4ZT4A 1O0BA 1OWPA 3TNJA 2DR2A 3RBAA 1XNGA 2CSXA 3PNYA 4DDMA 2JAXA 4HK4A 1F7VA 4MUIA 1ZUNA 3CLUD 1WXEA 3H9CA 4BWVA 3H99A 3NBAA 3N05A 1G59A 3X1JA 3MXTA 4YMIA 2B7LA 1LI5A 5FNZA 2CYAA 5KWVA 3HGMA 4EF6A 4JFAA 1OWMA 4PBTA 1KKUA 1H3FA 3AFHA 3COVA 1KAQA 4ND7A 1S4MA 2YWCA 3L93A 1I6LA 3SZ3A 2CYBA 2YXNA 2QTRA 5EKDA 4EG3A 4F4HA 1KR2A 3COWA 1N75A 4MUEA 1OD6A 3UY4A 3CVVA 1NP7A 1O6BA 3MLAA 4ZCPA 4CDNA 1QTQA 3NV7A 3CVUA 5LLTA 2ZP1A 1DNPA 4MUGA 2VXOA 1VL2A 3KFLA 3DO8A
chains in the Genus database with same CATH superfamily
1VIAA 2XT6A 2IH4A 3B78A 3HUEA 3KJNA 4N4AA 3E9NA 3MM4A 4Q3KA 1E6EA 1Y4ZA 2G67A 3RM3A 1K2VN 1M5RA 3IV7A 4KR9A 1AQJA 2QUJA 1VPDA 4M0CA 3ZS8A 1CHNA 4E5YA 3O8LA 1AXRA 2FCRA 2VHCA 3A26A 3HSKA 4QNRA 3RSLA 4X64B 5JCPA 3FKQA 5F78A 1CVIA 1X6VA 5EYPB 1GG9A 1SA0A 1P4HA 2YICA 4EQ6A 2CJPA 4I0WB 4QWWA 3NALA 2O9JA 4QFMA 3N2KA 1Q0RA 2EF1A 3GK3A 3GT4A 1RQLA 1J8DA 5A5DA 4E94A 4ESHA 4ZKDA 4LSMA 3HHPA 1K4YA 3QU9A 1Y8ZA 1XKQA 3O74A 2ORED 2PZAA 5E3IA 3ZI0A 4AN1A 3B9QA 2BKUA 3BWYA 2M6KA 3UK0A 1ZWKA 3F6YA 1B8PA 3FDZA 1MD9A 2G83A 4EI2A 4P7BA 3QSYA 3INGA 2Q5JA 4QDKA 1FL9A 4LDNA 4E21A 1DBQA 3BDIA 4WX2B 4P4SB 4QVKA 5IDXA 3WG9A 5KC8A 2O8BA 1VGRA 2I2AA 4YASA 2ODWA 3CGWA 3MWFA 5T4BA 2D00A 4HAYA 1DTEA 1E2FA 2CNOA 1I5EA 2X7JA 2GPNA 2A30A 5FBLB 1BU8A 3NOXA 4W1RA 3CZAA 3WKEA 4LF6B 2DY0A 3ZHCA 2J07A 4F84A 4IHJA 4LVCA 2VEOA 3BGWA 4BWGA 1DXQA 1F6DA 4D9MA 2QX4A 3GT3A 3RFXA 2MT9A 4A2WA 3KXPA 2YV5A 4WOCA 4MICA 5JAQA 4PRLA 2YZGA 4GMXA 5J4VA 1CUFA 2Q6TA 1D2RA 3R5FA 3HN6A 1NVMB 4MO2A 5DYTA 5TDHA 2O8EB 5DHQA 4P4NA 4C7BA 4EKDA 1XZHA 1IY0A 3DL0A 3QHPA 3SS9X 2V6MA 5KTTA 3EZ7A 1G20A 2AOXA 3MTIA 2WFMA 1SU7A 1N57A 1RBMA 3E2MA 1BWQA 1JPUA 3B85A 4XPZA 4DYDA 5KQPA 4WDQA 1VMIA 2DH6A 5LBTA 5FNVB 1LRKA 4F4UA 1PL7A 1AK1A 4B1FA 1V5GA 4FE3A 1GL3A 1NNI1 4LF9B 2JEZA 3IAS6 2D5BA 1GPUA 2RB4A 1V71A 2WIFA 4MVJM 4ZVVA 1XNRB 3PD1A 5DIZA 1E2HA 2BLNA 2A9VA 2HXSA 1FUIA 2W90A 3R7FA 2FMIA 1NBIA 4J8PA 4RD1A 5D87A 4YCCA 1BQ3A 1PI3A 2HMAA 2CUNA 2PRSA 1NJGA 4Z6KA 4QBIA 2P78A 4KFSA 3W1VA 3L7CA 3HGQA 3SE7A 1P45A 1BHO1 3NH6A 3RVRA 3R9KA 3C8MA 1CWUA 2HWKA 3I9KA 1NHWA 1MZVA 5HIMA 1MQ8B 4J43A 2A1TS 3OU7A 2LPMA 3Q6MA 2YMMA 2GPJA 4GHWA 4JKOA 2JLYA 5D84A 2ALJA 1QJCA 1X7WB 3AKEA 2C2OA 4W7IA 4YT4A 4YAOA 3NKFA 1G7SA 1DSSG 3FYUC 4IYRA 4KWEA 3V5NA 4AUNA 2D8AA 4MDFA 2BGJA 4MIEA 5EQTA 5FUBA 3TTUA 3VH1A 1J8QA 4ZZ1A 4X7MA 3D31A 3HE3A 1P5JA 1J0AA 2GAOA 2KW5A 1MXFA 4HNUA 2XUJA 2VQDA 3TG8A 2XYHA 3EOBI 3EA4A 1FW8A 2Z1DA 3LLVA 3FTPA 1AA9A 2C42A 4BRWA 1JTVA 4II3A 2Y1KA 1NZJA 4MPDA 2ODEA 2JHCA 2HCRA 1O54A 3AI2A 3P5BA 2NTJA 3U3DA 3LV8A 1X7WA 4FFRA 2R6ZA 3FPSA 1LQUA 4O29A 4IFIA 1GQRA 4A0QA 3WL6A 4YMVA 4RHYA 1LNZA 1QYDA 2EBWA 2YY6A 1VPTA 4GGMX 4C5CA 2PU5A 3AINA 5EESA 2JF0A 3V97A 4DLXA 3LY9A 2XOKD 2D2XA 4M0PA 3H8JA 2IYWA 4L9RA 2DXIA 1Z3IX 2WSIA 2D0IA 1JZTA 3JD1A 1QQTA 4UHKA 2YHAA 3VBEA 4R6WA 1R6VA 2PUTA 4MV5A 3FCAA 3AXSA 1U8CB 2WFAA 3I52A 3Q6NA 4H31A 4P7JA 4UAUA 5AJHA 5IVPA 3SS8A 5L9AA 2BGWA 1QK3A 5J5CA 3RYFA 2D1FA 4XLZA 1OC4A 1UK8A 4X6LA 2I3GA 1Z88A 4K8OA 2VJMB 5AHRA 3U3RA 2ZSJA 1R2QA 2A5JA 1GSIA 3QP9A 3F49S 4HLCA 5LJLA 1AUQA 1AUVA 3LPDA 3PQEA 4GMDA 4I2NA 1P2FA 3SEAA 4EENA 1DIRA 1U0EA 1YRLA 4DLNA 3FYUA 3OSZA 3G68A 1G5IA 2XWSA 4RPJA 1DBWA 3GG9A 4EB8A 2GUGA 4BLVA 1HL3A 3D8UA 3LBFA 2BZ0A 1JHZA 4AMUA 4BO4A 5BV8A 1T1SA 3SJ7A 4BGDA 1Q16A 2GM3A 4BFWA 4ZZIA 3C7DB 4EEZA 2DBZA 1QJ4A 2IX3A 2M32A 3WADA 3PWZA 1T2VA 3T35A 1R5BA 2O3TA 1DQZA 3UUGA 4BLTA 1IFXA 1E5XA 3IO5A 1E3TA 3M1IA 1YHZA 4A6PA 4NK5A 2HR1A 3IQDB 4G89A 3KO8A 4CM3A 5BV2P 4MW2A 5COQA 4C4TA 5HHTA 4TVBA 4UFOA 3UEOA 2QDXA 4FGJA 3MS4A 2CL6X 2WAMA 3OT1B 4BQRA 2FF5A 1OBVA 4J4HA 1DCFA 3NXKA 1R0XA 3S8EA 3K15A 5AVOA 3WL3A 3VPGA 3JASB 3M9LA 5DYYA 3MINB 2AMFA 2ROQA 2WLSA 1XXHE 3KT6A 2HF9A 3KOMA 4LKOA 4G6ZA 2JIPA 3VH4A 3CVWA 2H07A 1G20B 1UZMA 2IEAA 2PMDA 1W73A 1H8EA 4DBLC 3MTAA 2GBGA 1Z13A 4LN1A 4G63A 1R6TA 2E4UA 1C7EA 1BZYA 2IVZA 3MJDA 3WKAA 4OLAA 3FKSA 4BKPA 2R2GA 3LP8A 4JXZA 3HB5X 5JD5A 2BEWA 4BVAA 1EAMA 1T6XA 3IS3A 5B7NA 3D8TA 3BL5A 1I3MA 5GONB 1NVFA 5FCDA 2VJQA 3MWYW 4DLRA 2WQ7A 1Y34E 1RM4A 2Z09A 3W2EA 5ITSA 1HDCA 1WMFA 3FCOA 5CXUA 3WSVA 3EQZA 3JQQA 1A1VA 4CMHA 4CNQA 4YGXB 1KO1A 4K9NA 1ZXBA 2C0PA 3RC2A 5IYZA 1R8YA 1XZNA 4BNIA 4HTFA 3CZ9A 1C9EA 1A2KC 2GM4A 1YAJA 2OPHA 4URVR 4IIEA 1LDGA 4QELA 2BEVB 1RAHA 2GZAA 4IHJF 1Y6JA 1E8DA 1U8TA 2F64A 5KYUA 3ZHVA 1F0PA 1QG4A 3OFSA 3SQNA 3FNEA 1IRIA 3TE6A 3GF4A 3VGPA 2W2QA 4OL0A 1I1OA 5H82A 1VI6A 5IT0A 5DEOA 2NSDA 3F3KA 3DT9A 2OXFA 3MTGA 2V7BA 4G81A 3P2IA 2H1FA 4GMFA 3P26A 4RYLA 2FPWA 1F17A 3V3KA 1SC1A 1I4TD 1ZA1A 1QTIA 1CY2A 5KNBD 4WGFA 4C43A 3EDRA 1RIFA 2X0FA 3CO5A 3RT9A 5HOQA 1BWPA 1PR1A 1G9XA 1SIBE 2P9TA 3TMKA 4E51A 3EXHA 4D7AA 2FQXA 3KJFA 3PBKA 4KO2S 2XUAA 2ZJ0A 3MC1A 3EB9A 1TIPA 2IQIA 1WX1A 1YR6A 4DCTA 1BDJA 1I4DD 1YRWA 3CUSA 3OE1A 4PLTA 5JXHA 1AQYA 2EXXA 4IZ6A 1JHYA 4HDKA 4ZI7A 3P20A 3OSUA 4O4HA 1X9GA 2AE2A 2WSBA 4OATA 4PCLA 2V5UA 1M2HA 1QONA 4RSMA 2AXQA 2CW5A 2WJGA 4NICA 4PCAA 1JHOA 2QN2A 2V9PA 4CF3A 1G9SA 3B5JA 4YAJA 4CEJA 4QE3A 1TM4E 3U4AA 3LY8A 2P35A 4BVJA 1P1BA 1OUMA 4M54A 2WNSA 4Z0PA 3TGPA 1DC6A 3EZFA 4WVFA 4UOEA 4D99A 1UBTS 2IPNA 2VZ8A 4P7FA 3DKKA 2JFUA 4UD2A 3JX9A 3U13A 4CKWA 1N5JA 1QDLB 5IC4A 1MX3A 3FI9A 3DXZA 2AB0A 3UXHA 2ZJOA 1EE1A 3AVQA 4G86A 5LYJB 4EJFA 1L5YA 3IKLA 3V3TA 3W5CA 3THXB 5EIWA 4JP3A 2XHEA 3KFVA 3O3CA 1MGPA 1JGTA 3S81A 2DYKA 3W5BA 2LCIA 5HNKA 4W99A 3QKRA 5HR5A 1F9EA 3ND5A 1V43A 4HYTA 4OHVA 4CKEB 3QVTA 5JHHB 2W6ZA 3R5HA 4Y1RA 4EGQA 2HDHA 4ZU6X 2SBTA 1XTPA 1JJBA 2ZI5A 1WCIB 3KYIB 4HZGA 4FDAA 1JYFA 1UBMS 2VAWA 1FSZA 4I4TB 4BNLA 2G63A 3G2KA 2F3PA 5DN6D 1MJHA 2PD3A 3JQAA 4PX9A 3T0IA 1E9FA 4GM0A 1WXXA 1XT6A 3OX1A 4NYJR 1RC0A 4CG3A 1XPUA 4LHWA 4EB3A 3ER9A 4LJLA 3RT7A 3KDPA 1ZFNA 1F1BA 4IGFA 3ILSA 5CLGA 2RK6A 2QRNA 2GJSA 3TAHA 4D0LB 5GVSA 2EZ4A 1UINA 1JJFA 1NNLA 2JD1A 3BHIA 4RM2A 3M3PA 5GADl 3NDBB 1PYDA 2GEBA 4CKYA 2Z9CA 1CIJA 2XUGA 4U7FA 6PFKA 4BC0A 1NXTA 2VZEA 4LXGA 1WZNA 3PC7A 1AHNA 2CNDA 2VSQA 4NBLA 1CR6A 1PGNA 2HYDA 3NYIA 5COBA 1CB0A 4M1YA 1EZ1A 2NO5A 1XD8A 1Z5UA 3BFKA 3R0ZA 1P31A 2Q4OA 1YC5A 4Q02A 3TQHA 4D9EA 3F0TA 5CDYA 3CZQA 2WA1A 2WAXA 4UM5A 1MRNA 1UPFA 2OV4A 1OZ0A 4Z9XA 2PX4A 1NNUA 4D45A 1TJ5A 2E4WA 2PWYA 2LBPA 3FMIA 1MTOA 1GLNA 3HB1A 4B76A 1PJRA 5CFMA 1RI5A 4TMFA 1Y42X 621PA 4U00A 2G06A 1D0VA 4J3FA 4I3GA 3W05A 4GD3Q 3FTNA 4N1AA 1ZAYA 5I4KA 3EODA 2Q1XA 4PLPA 3KQLA 4B3GA 4KXNA 2R86A 2P6UA 3RS8A 4AXBA 2OEPA 2WIGA 1FNDA 1A72A 1P9WA 4HNSA 4NABA 5IDVA 3RE1A 4BTEA 4EI8A 1FMFA 3DA8A 1KJ8A 3HRKA 1HX7A 2MYPA 1XCLA 1KMCA 1C1XA 1Q0ZA 4UVEA 4BUZA 1ZY2A 2BR4A 3OOHA 4KQGA 1BGWA 3IHKA 5CVUA 1AHPA 4DXAA 3FOEC 5FADA 1NOKA 3RREA 3R7WA 2C3PA 3K2BA 1BKDR 3JWGA 1EFVB 4JP2A 2PUDA 1MAWA 1E6MA 3OLVA 4ARIA 4B3JA 1ORWA 3VR1A 3U56A 2Q5FA 1M2VA 2ZTSA 1DG3A 4JSTA 4M9SA 2YUIA 4JJZA 3S2ZA 1IVSA 2VF5X 2JIOA 1U3CA 1WDTA 4AO8A 1IBRA 3VO1A 3AFNA 4CJXA 1YDEA 2LUOA 3V8PA 3H6HA 2JH8A 3IILA 1N5RA 3PQ2A 4FUTA 4KFCA 2HQOA 3CRW1 4C88A 2Z8ZA 1SKBA 2DWUA 1AKRA 1K7XB 1ZSVA 2BBSA 2OXCA 3HU3A 1ZEMA 1BHQ1 3OCUA 3NVAA 4BO8A 1CF2O 1W8IA 3FI0A 1P29A 2DQSA 2H4JA 2OM6A 2PTHA 4DE5A 2Q3LA 1XZJA 2YC2C 4FGUA 4P4TA 2FV8A 5JPCA 2WJWA 3VR4D 4A6XA 5HVNA 5EAIA 4AYWA 1ABEA 4BKOA 1POWA 4RPKA 4RKFA 5KJEA 3KUXA 2ZK7A 4IV5A 2AF3C 3U49A 2UZ1A 1M76A 2E48A 4HYQA 5EPOA 3S2SA 4IFTA 1RMYA 3MCZA 3CLUD 5LWQA 3EVNA 1A2BA 4BWVA 3JU3A 3H99A 3MHTA 2TSYB 3I3OA 2B1IA 3WLAA 1L5WA 1AMUA 2XH8A 4KAXA 3IBTA 3O90A 1NZDA 4YNBA 1TGVA 2JJ1D 5FV7A 5TF4A 5GZ3A 4Y2HA 1IB6A 3IVAA 4N0QA 1SXQA 3D1JA 2X86A 3SX4A 1PJ8A 1JLSA 2REXB 4CUKA 4C6TB 4N3CA 3OE7A 4JD5A 5IAAA 2RC6A 4B6OA 5AKZA 4I4CA 2XHZA 4H2DA 3TXXA 5FBQB 1LC0A 2J0EA 4EG3A 2DECA 3LC7O 4RJKA 5CU7A 1N75A 3NOOA 4HSEA 2IEGA 4EHAA 3WDSA 4BCDA 1LZKA 2C78A 4RIGA 4DMMA 4NJMA 1ZSYA 3ISVA 3EZ2A 4F9FA 3EJWA 2H85A 4AO6A 3WAGA 2OHVA 4TWRA 4CDNA 5I9LA 1JE0A 3NV7A 2WG2A 4UJ3A 1YK1A 2LWIA 1VRWA 5FYQA 1FF9A 2F1OA 2WMNB 1Y7HA 4R5MA 3KFLA 1E7RA 1VZ2A 4BO9A 1VHWA 1K5GA 1XKLA 3HGTA 4C2UA 4HH0A 3WIVA 1EX1A 1ZNQO 1GPMA 3PQ5A 2REOA 4WFQA 4QXMA 3SY8A 1Q44A 4F45A 5JAPA 4X65B 4PZYA 2BGLA 2HHLA 1WMAA 1OHHA 2JH9A 2VR1A 3D3WB 4EG0A 1DAFA 2AN5A 5E4FA 5A0VA 3IT0A 1SVNA 3H2HA 3CZRA 4MGZR 2C2XA 1J5XA 1C7JA 1KMIY 3LQRA 4OI4A 4QGBA 2XV1A 2IHYA 3GXOA 2P2CA 5FBHA 3VTKA 1C0EA 2OO7A 2X9LA 4JLUA 4YS6A 4B4OA 3OX2A 1EP9A 3S40A 1JH9A 2AC7A 2VK2A 3CVJA 4N6NA 2XZDA 3RODA 5IT5A 4YLYA 3TIXB 1FUUA 1R6UA 3OMWA 1C29B 3LQ2A 2EP5A 3CB2A 4NV1A 5B1IA 3SEFA 5LKRA 1YIOA 1BXRB 5K8CA 3O75A 2NU9B 3G9TA 2HJWA 4KITB 4TVOA 1L4GA 4TQGA 2I0FA 5IASA 2VH5R 4ZV9A 4TOIA 2XOXA 3T1VA 4UW9A 1W0JA 3SZRA 2UXCB 3NTQA 3WWDA 1AVTA 3GLIA 4G67A 4MOWA 3MA0A 3O4JA 4CL3A 4AJNA 1OH6A 3O7MA 2ZB7A 1X8KA 5DRTA 3WIDA 4WCDA 3WQQA 4A2QA 4S1WA 1IPEA 3WGUA 1A98A 2VP6A 4I4LA 1JSLA 1TF5A 3THRA 5JWRA 3OP4A 1OFVA 1PZFA 1QLHA 5LKAA 4FEGA 4D25A 1XRQA 2HWWA 3CHYA 1L5VA 2HRDA 2O2HA 4I55F 3WBBA 3KK0A 2Q0SA 3K0AB 3KAJA 1RM5A 4REQB 1ZRMA 2JB9A 2ZVDA 3DV0A 2ZRAA 4OXRA 1EM8B 1OBHA 1SIUA 4OKSA 1HE1C 1KEPA 1SBHA 5BSWA 2EARA 1Z6PA 3EFOB 2QN6A 5TR9A 1SUSA 3N8IA 3KKQA 2G76A 3VNBA 4O2AA 4YJHB 5J4YA 3MOIA 1NC1A 1GARA 3GCXA 3MRSA 3B7PA 2PSHA 4FJ2A 5P21A 2FUG1 1GP2A 3FPAA 3DKVA 3FWHA 4OQNA 4RIEA 3TOZA 4RLSA 2R1ZA 1E7MA 2M9MA 2VHZA 3L7AA 5CCBA 2FX5A 2B6HA 4LBWA 5F1YA 3M7IA 2D4AA 1IOLA 1QYCA 2QUBA 4OIFA 4A10A 4LS3A 2AN4A 2WWRA 1NWHA 3OMLA 4HB4A 4HO1X 4WA7A 4D97A 1L5HA 4HNTA 4RULA 3AHGA 2XGJA 3H5RA 1OV6A 4OBEA 1A96A 4EKGA 3OPYI 2FEWB 5AW9A 3S2YA 5C7YA 2PGNA 3ZWWA 3AVWA 1DAPA 4EEXA 5DI3A 4ZQCB 3QLEA 2PRZA 4S1OA 4IIVA 1GKKA 1LQTA 1PNQA 3EN0A 4NEGA 4RQBA 3MPUA 1UMCB 1EUZA 3FHJA 1ZJJA 1G8FA 1E4VA 2NZYA 2Q3MA 2RKOA 1FU4A 3RJZA 3ZWDA 2FEXA 4C6SA 2GEFA 3SSMA 1KEEB 5KUTA 1A9RA 1L4BA 2ZUTA 4N0PA 4W8OA 4UVHA 1RWNA 4OI2A 2VJKA 3KR9A 2C5BA 3GRRA 1QHGA 2I6UA 2YHIB 4YUYA 1JQBA 2LDXA 3GJYA 4R1UA 2JIQA 3KTOA 1OAOC 3QYFA 1V95A 2ZSIA 1C4KA 4EFKA 1K2WA 3QUSA 1SEVA 2REBA 1P9NA 1B42A 2O3SA 3B3FA 3DR5A 1JKFA 1RI1A 3IBCA 4JB8A 4ACAA 4RMIA 3TLGA 1M1ZA 2QRQA 3KKPA 5DNEA 1J9GA 5JMWA 1GRRA 2IV2X 3SEZA 2YWGA 1EGMB 1YR1A 4KLAA 5HJ7A 3DBHA 3JRXA 3ZG6A 2YMLA 3U3MA 3GD5A 2HQSA 4BP1A 1K7SN 5ALDA 1J1UA 1DIGA 2C96A 3U19A 2WOJA 2J85A 2PL5A 3L7KA 3U61B 2PJZA 1QTNA 1MH1A 3REQB 2WD8A 3O84A 3SBEA 4HNHA 3AEZA 2JLWA 2C5LA 3DDOA 1CUXA 1RP7A 4XR9A 2DJ5A 2GPTA 3WGQA 5A5FA 3VPXA 4MCAA 5BWOA 2I9KA 2EFDB 3ZWMA 2PXCA 3O26A 1Z5WA 4CTMA 1KI2A 4WKOA 4WL0A 4CIYA 4KUEA 5H3CA 2NP7A 4PBSA 2EIHA 4J2HA 3UIEA 1Z74A 1QLWA 2C3YA 4GVLA 2JFBA 4MVJH 1A50B 1QP7A 4GKBA 4UOQA 3VPCA 4JQSA 5GVRA 5F2EA 1EK2A 2ZB8A 3CA8A 2KWIA 3FYCA 1E9RA 4UDOA 5LZ5A 4ZPJA 2PQ6A 2XITA 1VMAA 3Q7SA 4X1IB 5ENZA 4MI1A 5K0NA 3TLCA 3UHJA 2PU7A 3ORFA 4F85A 4TS1A 4HI0E 2WPDA 2X0RA 5A9SB 3PICA 2IK8A 3BBLA 1D2GA 3KPJA 3L0SA 5F7XA 3WLFA 4WACA 5AMXA 2I4MA 5FWDA 2OZPA 3S1AB 1TJYA 4Q48A 4WMLA 4BNYA 1DC8A 3IELA 1E1RA 4MUBA 1JDBB 1L8AA 3U4CA 1PJSA 4EELA 4WUTA 2ZETA 5F3RA 1NVVR 5EUMA 3OM9A 3IPYA 2A0FA 1FXWA 4MYHA 5CTAA 2WJZB 3GN2A 1XUOA 1NRWA 2XQKA 1U65A 4CM9A 4CL2A 1SVMA 1CE8B 3ABZA 4TKZA 4U0KA 5LIPA 3L8EA 3IV6A 1O4VA 1QHHA 1S3GA 2YZKA 3G9XA 3ISTA 3KUCA 2CC2A 3PTZA 1AS3A 2FFAA 2XD9A 1Z0AA 1IK6A 2XNJA 3N58A 3MW8A 3O95A 4KZKA 4ON9A 4B6JA 2R8BA 1H2HA 5IH7A 1OI4A 4QYTA 5HDQA 9MHTA 4TV8A 4MW9A 4WOBA 2CFCA 3D4NA 4R3NA 3DCIA 3N86A 3ZDEA 1R4AA 3NHBA 4E11A 4QXOA 2XCOA 4U7GA 1NJ5A 5CB8A 5CM2Z 4E22A 1KMHA 2P9CA 3EGVA 3M6XA 1YE8A 2FHPA 3CZMA 1PGQA 3ZEIA 2NTNA 5BW4A 3UGQA 4F5ZA 3K32A 4U2FA 4DMGA 3PDHA 4MP8A 2Y27A 1SU6A 1CQZA 1K6XA 2O8FA 5AR1A 1S8FA 1X7DA 2WINI 1FQWA 4LGYA 5ALRA 2W8BA 4RGBA 2G1KA 5T8KC 2X9VA 4JYBA 4M55A 1W8DA 1GGEA 3FF4A 3CSUA 3CLHA 5JAHA 5JOQA 2Z4TA 5FA5A 2BH2A 3ONNA 2GX6A 2A35A 3JQ8A 1M2GA 3GHYA 1SGWA 2PYIA 4OQQA 1EU1A 3SBXA 3H2JA 1A77A 2FPXA 5A4AA 5E3HA 2IY8A 2Y1CA 3QLUC 2W8ZA 4D42A 3M6LA 5AKHA 4RDHA 2C1ZA 2V55B 3QTLA 2BH9A 5EWLA 2BGKA 2VHVA 3KSMA 2PUEA 1VKJA 3E48A 3PUIA 5KAPA 1QIEA 1T3GA 3M4NA 2IF2A 4Y9TA 4CR7A 5KHOC 3VX3A 2EYUA 4UEJA 3EQ7A 3EG5A 1TZJA 4NFSA 1A7UA 4Z3DA 4QD3A 1EIZA 5DKFA 3ZE2B 1BX0A 1UPUA 4KWTA 1Z4JA 5EHZA 3Q88A 5FEUA 3EXIA 4ZYVA 1WBDA 1H1TA 2WUFA 2ODAA 3TFQA 3HVUA 1S2IA 2PLWA 2PWAA 5CA1A 1E6CA 3I6BA 3AX6A 2ZR7A 1VBNA 3G02A 3TS1A 1UBOS 3D6HA 5AOVA 5AVVA 3OHMA 1U0JA 4BJ5A 4OLFA 1E96A 3A1DA 1HDOA 3M3HA 4PHHA 1DDIA 1W44A 3JZIA 4LSWA 2E2WA 2P5SA 1YMQA 1QRAA 1WSAA 2CWDA 2WWHA 3GJ7A 5AFSA 1H0KA 4F1WA 1C2YA 3HA3A 2IC5A 1QRUA 1VCNA 3GMIA 1DOHA 4CQNA 1T91A 4U2BA 1ZMRA 1TJ3A 2D62A 5LJIA 1JFLA 3HI4A 4BRSA 1XMPA 3TAUA 4H3VA 4U2KA 3OZGA 2FP4B 1BC5A 1D04A 2PGLA 3E03A 2FW1A 2VH1A 4DR4B 1W30A 1J42A 3A2KA 3QYJA 5DTEA 2VHTA 2G82A 2YBEA 3L4EA 2WIKA 3OQ1A 2H5LA 2GB4A 3W5IA 4NCHA 1S1CA 1IWPB 1KP3A 3K9CA 5FJJA 5EWMA 2PT7A 4NBSA 1NJSA 3G49A 2ENWA 4A8JB 1IZ8A 1IUPA 4AK9A 1NN5A 4FGKA 3BJRA 4M9UA 5C80A 3IUBA 1CK4A 2H17A 3JQRA 3K5IA 4MWDA 3OY2A 4HQKA 5J4KA 3RSHA 2GD6A 4CQMA 4WFIA 3D6UA 2HAEA 3TE7A 1UP7A 5K6TA 3C4VA 5HQ3B 4F5WA 5DPMA 2BDTA 1RADA 3CS3A 3MNFA 4MV6A 2OXTA 1E2DA 4F3RA 2OPBA 1JHUA 3FB1A 3T41A 4MR9B 2XTAA 3EVEA 3OPVA 3I3SR 3A7EA 3MOGA 4DG9A 2FZGA 2NUAB 2UVQA 3HWWA 3QLUA 3U80A 4B6PA 4EDFA 4DV5B 1E6KA 1ZBQA 3NDIA 4F2WA 5AD1A 3BRCA 4MRMA 4BFCA 3CPEA 4HUQB 1N36B 3R3VA 2WG0A 4IL5A 2MSCB 2UVPA 4C5AA 1DTWB 4B9EA 3DMPA 4J4TA 5AKJA 1B8NA 1G8AA 2XKAA 1GU1A 3YASA 5ICGA 4A8TA 3TZCA 3Q6IA 1IH8A 4ZEXA 3T1OA 3SIXA 5AIAA 2RHMA 2WQ6A 4WKNA 3IP8A 2M1XA 3GI1A 3NC0C 4IIJF 4UUQA 3VZSA 5AOAA 1JHQA 4FFMA 4XRRA 4Z7JA 5LDDC 4TZ6A 1E4EB 4CE6A 5BXQC 4OUDB 1AKWA 2BEUA 2Z0MA 1ST2A 2ZRHA 1E60A 3OIGA 4LCBA 1KOLA 4RKYA 4BKRA 3FMVA 2BGUA 4IVNA 1XMSA 3EBLA 1R3UA 2GARA 4WINA 2GZ2A 3FX2A 3TKYA 1QIJA 2FZVA 4KB5A 4E5MA 2NXNA 2HH9A 3NCTA 1XRJA 1XTSA 1PX2A 2PL1A 5CLLA 3T9CA 4CV3A 1XMVA 3B51X 4W1PA 3VJKA 1JIIA 3HSYA 2C2WA 2OV6A 2X0JA 1EUYA 1ZD9A 3P0FA 3L7LA 4GL2A 1TKAA 2Z9DA 4ZQHA 3BHMA 2PSEA 1U2GA 1VFPA 1IMJA 5CT9A 1X1EA 3TIIA 5H9VA 1XL1A 1CZLA 3HXTA 1KZGB 2QLTA 2OILA 4JYAB 2ZI4A 3KLOA 4G1VA 2XUFA 3G0DA 3F7OA 3PF8A 3SPXA 4EITA 5CDHA 3ANLA 2R6R1 4FVTA 3SE0A 1CIVA 1XU4A 3WA6A 1QVRA 5AK4A 5IANA 1DIBA 4Q1DA 5KTOA 4E5NA 1CUHA 3RLFA 1PT7A 1TZBA 2K2WA 4JVNA 1J06A 4YWJA 1AO0A 2B98A 2PNFA 2O2DA 4R40A 5KVSA 4YP5A 3AF2A 5F64A 1YJQA 3IE1A 3PWKA 2EJVA 3BD7A 3K6SB 2NTYC 3O73A 3AF0A 4FI3F 2EC5A 3L7NA 3FOAA 2I7TA 3JZAA 1QHEA 4KAFA 4NBVA 3BJEA 3B7WA 4TKLA 5EXDA 1N9GB 4KJZA 2OK7A 2WHYA 1NBHA 1JVNA 4EGFA 2BEJA 2XECA 3CEMA 3Q87B 4IUCS 4CLRB 1N2HA 3NGLA 1KMQA 5A4IS 2C2GA 5I7UA 2O4UX 1PBTA 1RJ9A 4HRVA 3PDCA 4H3SA 2CZGA 2J45A 1JN0A 1QRTA 1XGKA 1UQRA 4EG8A 3VV2A 1NUPA 3KR1A 5CFZA 2Q28A 5DH9A 3R8XA 3KQTA 5JLJA 1CJSA 3MCWA 3NAQA 5FUQA 3GELA 2H2DA 4N8DA 4QGSA 1ZINA 3THWB 3C8HA 4XFJA 3CH7A 3ZE9A 1SBZA 3FOCA 4PG4A 1NUAA 2I3DA 3V4VB 4KMMA 2VDUE 1BO6A 1FK8A 1V96A 3ESCA 4WY5A 4ZD6A 2XUHA 5B53A 4TLBA 4URFA 3KU4A 4IFEA 1G8KA 3I23A 4UU0A 4DA6A 5CDUA 4QVIA 2YYSA 1U0SY 4A5OA 3JVVA 3EW7A 1IJKA 1XNGA 1GL9B 1NV9A 3B52X 3TB6A 1YFLA 1M67A 2DCMA 3AU9A 2FFQA 2QT1A 2XF8A 3KEMA 4QM7A 2OOSA 3LIIA 3I6MA 2YVKA 3NPMA 2YV4A 4DJEC 2XKBA 3QEOA 1KPHA 1MUUA 2I8LA 2GEUA 3A1VA 3IP9A 4IIFA 2OHOA 3BWEA 4MPTA 4DWOA 4Z5XA 3AFMA 1EWRA 2ADOA 5ESRA 5IN5A 2IYEA 2OYSA 4CV2A 4YCNA 1GVHA 5KOIA 3JPYA 1A9OA 1QCYA 1EFTA 2VHWA 2OXEA 2EJUA 3BMQB 1JFSA 1JEYA 1PS0A 3AEQB 4Y6LA 4CKZA 3HCNA 4I8IA 1PG5A 4JB2A 5B3KA 3R9IA 1PLLA 4I9NA 2BBWA 4FHEA 4A0GA 1H1LA 3QRWA 1ESNA 2CYBA 1JLLB 2F3QA 3DP7A 3X1XA 1WHSB 1XZQA 4PIMA 2W43A 4G1FA 4K7JA 2UU9B 2XB4A 1KR2A 1IUNA 4PSAA 3U0VA 4ALJA 4B3XA 4C4RA 4PAOA 4TPKA 3U81A 3VPSA 1XSEA 1W52X 5JZOA 3ZDXB 1T4CA 1T2DA 1QZTA 3HXPA 3SSNA 4IO0A 5LLSA 1ADFA 3OESA 5BN5A 5AW7A 3STWA 5T3UA 5E9JA 4J94A 3GFOA 1X7GA 1HQCA 1RYDA 3OUUA 1MV5A 4LYYA 4QLOA 2C04A 3ICVA 3OF5A 4IDEA 1T1RA 1WLYA 4ENPA 3E82A 5A5VA 1UANA 3UWSA 4AUEA 3CRNA 1P7CA 4ISBA 4J29A 4D4LA 2HK8A 1I0LA 4ER0A 5J47A 2H9IA 4DV7B 1KRHA 1CUEA 4IQ8A 3TNLA 5JY1A 1W1UA 3HZHA 3NONA 5BURA 2XQIA 1H4TA 2G88A 2J3HA 3BMQA 1KARA 1WG8A 5FUXA 3RD5A 5CYOA 3C3CA 3PCRB 3T9DA 3ZDCA 2ZRMA 3SVZA 1DJLA 3BF7A 2EFJA 2G4LA 3OOEA 2W48A 5EHIA 4HAOA 2LDBA 2WJ3A 2WILA 4JI7B 2BJWA 2GVZC 5E7MA 4RL6A 3JRNA 1R37A 3BCRA 4CR6A 3DZ8A 5FWYA 3RFUA 1PYGA 1BCSB 3IOYA 4H6XA 4Q6WA 1AXEA 2XA1A 2R6CA 3HJRA 4Y8VA 1TM2A 3GLFA 3L0PA 4CGYA 4PHTA 2ZJ7A 1VIDA 3WGHA 5CIWA 3MGAA 3SU8A 2PYZA 4BMOB 2VJPA 3KD3A 4N65A 1E2PA 1OXMA 5CFOA 3KJIA 5ADHA 3ZWKA 2WMDA 3OEEA 1EFAA 5IM4F 1AB5A 1Q20A 4QSMA 5AUQA 5I3ZA 1PWEA 4MYRA 1DX9A 1GRCA 4H6PA 2H7VA 4C2BA 2CJFA 5KNBA 4US1R 4HLQB 5EUCA 4XWYA 3RK0A 3WKCA 1KI9A 5REQA 5KWSA 4D43A 4IRUB 4IIJA 1YMVA 1J90A 2PQ2A 1TJNA 4ZVUA 1G7TA 4LYHA 1BYUA 1G291 1O5TA 3K09A 1FFHA 1RXWA 3QBDA 3ZDRA 4Y7DA 3DC2A 2C82A 4MQFA 5DSTA 3N53A 2C4HA 4F1KA 4CLRA 2H4XA 2ZAMA 3OVMA 4ITRC 5KI6A 4EKYA 4Z8YA 1T9HA 3A2NA 4OP1A 2R6JA 4I9FA 1F2UB 1SELA 3P9QA 5I01A 2VHQA 4OL9A 3O4VA 4TTRA 3GJ8A 3PUHA 4CCAA 1QHXA 5A03A 2NPFA 5HF6A 3K0HA 4JROA 1O5OA 1FP4B 3B6IA 2EDCA 3RHSA 3PV0A 4KMOA 4XIYA 3DZBA 2AHRA 4FNGA 2WU4A 2X23A 1GG5A 1U7TA 1T5SA 1M2OA 4TLMB 3ZE0B 3L6EA 2FPIA 4UZFA 1XCPA 2YIVX 3P71T 4LRXA 1I33A 5DI9A 1LNSA 2DZDA 2HLDA 3HN7A 4MEBA 2XWPA 3EFBA 3PXDA 4MR7B 4DR2B 4YRQA 2YZ2A 3HPRA 3ZHOA 1TEVA 2AEMA 2QLFA 4R81A 3P0HA 1Z37A 1I24A 5DLQC 1CS0A 4C76A 1SC3A 1FXSA 2XUQA 3HA2A 2CEAA 2CMFA 4GU5A 3LYUA 4IJKA 4LFAB 1TYAE 1A76A 3VOBA 3PWTA 2CFOA 3O4FA 4HR7A 1JALA 2I7VA 4NNJA 1ULSA 3WGZA 3WS7A 3KB1A 3L3BA 5HK8A 6NULA 2H1VA 1PR9A 1QR6A 3L2OB 1FC0A 4X45A 5CJJA 3RC8A 5F3WB 3BILA 3ZQJA 1RKBA 2DTEA 1M74A 1NIJA 4L6CA 3T9EA 4KQ6A 3SVTA 4HGOA 2BE9A 2JAOA 2WVGA 1PJBA 2PL3A 3ANXA 4OU4A 2IPAB 3PEYA 1ZH6A 1D6MA 2EKQA 5G0WA 4ID3A 2YMPA 1PX0A 1TO2E 3TW0A 2D7CA 4LVUA 4QTXA 4TYMA 5ALKA 3TLXA 1I13A 1T2EA 1X8JA 1Y8RA 1T36A 2EAUA 3Q7EA 4RHTA 5A3JA 2AJCA 2CE2X 1G17A 4L95C 1I4OA 3OICA 3ZKWA 3JTMA 3C3EA 1GY8A 1L5GB 3E15A 2R4QA 2QI9F 3DVRX 2FR0A 1RZ3A 4GGPA 2A94A 3PFHA 5J5AA 2CNLA 1ZIDA 4HUQA 4AROA 4GFDA 3KQKA 1ULZA 4JUCA 5F4BA 4Y2YA 5BNFA 4ANFA 2F67A 3VC2A 5E6SB 1NLFA 2DPHA 1OWLA 5A7FA 2DSNA 2W0SA 3Q7QA 2AMLA 3DWGA 3GIWA 1JG7A 4JLMA 3TLZA 4IMIB 2JGDA 2J3LA 1N3IA 3GLHE 1JZQA 1SA0B 1FU7A 5IM4A 3U60B 1H2FA 4GDMA 5JIBA 2ZYAA 4QAJA 1L5QA 2JFVA 1R0BA 4KN5A 3LDAA 4AZWA 5BMVB 1EAYA 4BKQA 3MJHA 4L07A 4YQEA 1V8ZA 3VKWA 1VI2A 3EVCA 4EO7A 1JEQA 4KPUB 3AUXA 2F9LA 2H52A 3QWFA 5DN9A 3SHVA 2PSSA 1GWNA 1YS9A 4NJEB 4OHRA 5ERYA 3T4PA 2B2NA 2BSQA 4LMPA 1PHPA 1ZITA 1YQQA 2HNBA 4V03A 4IKEA 3WR5A 1XHEA 3JYLA 1H6BA 1HEUA 3GJ5A 3IPLA 1P4GA 2KJQA 5HTKA 2PZMA 2V6JA 4II2A 2IEZA 2VYQA 2XCUA 3OQIA 2RI6A 2N47A 4NJMB 1BN7A 1KP9A 5BO5A 1L5ZA 3ESQA 2NQ2C 4WOKA 1U0BB 5I9NA 3HDTA 4RVGA 5D3QA 1JPVA 1RRFA 2E1RA 3GLKA 1ZD2P 2G6BA 3AR4A 2H65A 3MQFA 1FY2A 3NWEA 1JEQB 2P4SA 3CH6A 1AB6A 2DLDA 3EGEA 3SQDA 3OF3A 1RXCA 1Q7GA 3JD0A 4H4DA 1AO3A 3L9XA 4J3JA 1PS8A 3QX8A 2PLNA 1RI2A 2IP4A 4ZCSA 3K1AB 1KO5A 3IP6A 1TYCA 2GETA 3GJ0A 4PC1A 4D3SA 1L7AA 3MMSA 3AIIA 2VIIA 1BFUA 2FN9A 3C5WP 4IF6A 2RG7A 1J5EB 5F98A 1Z4PX 1ZWLA 2A8YA 4WLEA 3IVXA 4S2UA 5AXDA 2YVLA 3OKFA 4JDUA 5J4LA 1EWTA 1ZUNB 1E3QA 2G9RA 2R6HA 4RA6A 5E2AA 3RIXA 5GMOA 4K9OA 4UNPA 4AU1A 3H86A 1GCOA 4IDQA 4I1VA 4M1SA 1GGKA 1CTQA 1TFUA 2G72A 3OPQA 1O9GA 4Q4HB 1IBSA 4IVQA 4W5NA 1DPGA 2PUBA 1E77A 4HC4A 5JEDA 3I01A 4YRDA 4BAZA 3B20A 1G38A 2OBLA 3KVRA 4CM6A 2HK6A 1I01A 1OBOA 1WHTB 3H3FA 2R4TA 4Q9JA 2ZYSA 4OX9Y 4PLGA 4R1OA 1H8HA 2QJWA 1IXZA 1PKXA 3KTFA 1G2OA 1FLAA 2PV0A 3QPAA 4I50F 1Y9JA 1HXHA 1SD5A 3C97A 1LS6A 4TUYA 1XDGA 2XEDA 4E3ZA 3UAYA 2FE4A 2DFNA 2Y0BA 1MPXA 4HJRA 3DZDA 2GFIA 5DULA 1W75A 3QF4B 1SG6A 3KTAA 2O7NA 5JDIC 2CHVA 2WQZA 1P62B 1UDXA 4FFSA 4EGSA 2VWGA 1XVLA 3A31A 1JR3A 5EWJA 5BSHA 3TCNA 2F59A 3B3GA 4IDNA 4YDHB 2PUCA 2CMDA 2ZQYA 4OU5A 4W1SA 1GFZA 2NZJA 1TO1E 3LF1A 3SZLA 2OQVA 2XVYA 4DARA 1TNDA 2QMOA 2VF2A 4F71A 3RNOA 3TEMA 2GKOA 2HA3A 5IF9A 4XJXA 1ZO8A 1OKKD 3AEXA 5ESXA 4G3XA 1T9KA 3ZDFA 5HRUA 1P7YA 1T4GA 2YFYA 1P0QA 1PEAA 2IDZA 3I1JA 3V6MA 4ENRA 2EF0A 1D6JA 4OJMX 3Q0EA 4YRIA 2H3EA 4INPA 1OHHD 3IAUA 1L5KA 4B80A 4ER3A 3PXXA 4RPLA 1XTJA 2I91A 3FLEA 4N49A 4O02B 5IRCD 3SHFA 4G23A 4F4DA 1D09A 4AMZA 5E3JA 2CXTA 3CMCO 3R0IA 4QLBA 5EJ9A 4EABA 1T9AA 2HCJB 2J3QA 4URZR 4TMWA 3TD2A 2GXQA 4ROSA 5L3QA 4WT7A 5E1OA 3QFFA 1VE7A 1OFIA 2Z6VA 1NLMA 3NHFA 4XVQA 3PNQA 2AWNA 5DCWA 4MUAA 1LDNA 2PMWB 1Z5GA 3G0BA 1SKMA 1I5OA 2HMYB 3MZ0A 2CDAA 4QHTA 5SY9A 3RS7A 7MHTA 3QFHA 1U2ZA 3QKSA 2G4CA 2R79A 3VSDA 3RW9A 3TRIA 2NP6A 1O57A 3A9VA 2QX8A 3LWZA 1UJ4A 4AIIA 5FDFA 3KQVA 1ZOLA 3P2JA 4X94A 4MPPA 3CX3A 4ZPXA 1IOZA 1GSAA 5ERGB 3ZD8A 2A9KA 3NR2A 5KAMA 4E4TA 4P34A 4RK1A 3IQWA 2A1UB 4B4DA 1X7YA 2I6FA 3T38A 3BT7A 2VPYA 3IXQA 4GPZA 2X15A 1UBEA 4DV0B 1H9CA 2ACEA 4GXRA 4JBGA 1Y8CA 2CLEB 4UPDA 3MWDB 2IQ5A 4G0YA 3NBKA 4LBZA 3L1VA 1XXHB 4MVXA 1MNQA 5HRCA 1N9GA 3FCUB 3IIJA 5TMPA 2E4ZA 4ITUA 5DV9A 3TNYA 3EPLA 3ZH9B 2F3SA 3DEKA 1UAGA 1LK5A 2WD7A 2WW8A 2BKLA 2ZVQX 3JTEA 3QVSA 4FWBA 4L0DA 5JSYA 3HLTA 1FP2A 4MTCA 3EGDB 5LMZA 2A1UA 4P81A 1A4XA 1MA3A 1K75A 1C4OA 2XTJA 3JRWA 3PQ4A 3T06B 1VE6A 3ILXA 5U9CA 1QKKA 2FUG6 1ISJA 4ESVA 2VP0A 1QPBA 2YVQA 3ACDA 1SKUA 1LFDB 2VBFA 3GLHB 1Q91A 3A6GA 1QOPB 3N2IA 1RWKA 2YRXA 3AIOA 3N75A 2O57A 1GQFA 4V0QA 4ZDWA 5KDLA 1NN3A 4DXDA 4HX9A 1VXRA 2B1GA 1KKMA 1YUBA 4B6GA 2XZTA 4MUNA 2F1KA 4TKUB 4ZN6A 1L5SA 1KQPA 4FYJA 4GC5A 3SR3A 3ZV6A 3VAZA 4RIHA 1MJGA 1ZP6A 4EHKA 2R4UA 1L3CA 1Q5PA 2ZBRA 4M9CA 2C7QA 2V96A 4GVXA 3HU1A 3CIFA 4OBBA 4BZPA 2QLBA 1Z0IA 4UXJA 2IX9A 3RSFA 2NIPA 4NMLA 1QZ3A 3ZYCA 4PHFA 1EHYA 1GGHA 1XLTA 3EOZA 5KYKA 2PXAA 1NLZA 5IX8A 1V5WA 1CY1A 4KQEA 2VDPB 4GW3A 4JUAA 2UUCB 3C5VA 5FO0A 5ECYA 3ZZTA 5I4CA 2Q50A 1USKA 2I2FA 3M82A 3EF3A 1NXWA 2IZZA 4TV9B 5DLYA 4LIPD 5TPWB 5B6PA 4W5RA 3CKMA 4MVYA 5NULA 1BHSA 3O94A 4W8HA 2WJIA 2NSJA 1JXOA 4H6VA 5KQLA 4IGAA 3BGDA 3INRA 3S8MA 1W93A 4IV8A 4UAGA 1DAMA 1WZUA 2VP2A 2WABA 2VUTA 4KV7A 2ZJFA 4PN3A 3UQZA 3FB4A 1ZDMA 2DKFA 1RRVA 2RSLA 5SZHB 4YDQA 1TUEA 1QQAA 1PBNA 1RAAA 4Q39A 2PA0A 3HL4A 1JI3A 2VEDA 4MQLA 4ZVOA 2C8VA 5D1HA 4ZT5A 1R9NA 1NF3A 1V8OA 1B8VA 4RA9B 1T9CA 5D7NA 4N47A 2C9ZA 2X0IA 1Z3CA 3R0JA 4DWVA 4INJA 4ETWA 3ZDBA 3PX7A 1A9XA 1V5EA 3SXUA 2C8JA 1RPZA 4TL9A 2RC5A 5DOVA 1DIHA 4PO3X 4RUKA 4HNAB 4X93A 3L0DA 3H1BA 3M1YA 2QUIA 1Y3DE 4WN9B 2GYVA 1E1DA 1JMVA 5M7EA 5LZ4A 2AXEA 3IAS1 3ZLVA 2FN3A 1V6CA 4A2PA 4DXHA 3RAGA 3IA2A 2DR2A 3K9GA 1V26A 5HS6A 3H1FA 4JI5B 3PGVA 3VUFA 2BKAA 2EFCB 3FWPA 4TZKA 1O6FA 1XAJA 5ER6A 1FVHA 3KEFA 3OE4A 2K2QB 4XX1A 4E5KA 1ZW6A 1A4IA 1DBSA 3DBVO 3QUAA 4NF2A 5TQ0A 1T0HB 3KCQA 4ARUA 2GYUA 4QQRA 4IWNA 3A6PC 4CYMA 3VKFA 3M5PA 1ZK3A 1ISRA 2JGJA 2M6RA 4N82A 3WQHA 5B30A 2JD2A 5DNAA 1FLNA 4TTSA 1ZOOA 3MXTA 1BCRB 1ONPA 3GCGA 3WMRA 4AMVA 3EMDA 1RTKA 4XDGA 4HX5A 4JLPA 4KIWA 4Q9HA 4EF6A 5KWVA 3IAEA 3D54D 1WETA 1X86B 2O2YA 3KAQA 5CURA 3SAJA 3KQYA 3T54A 3DE4X 5B3AA 3N2GB 1EE2A 1L4UA 4YJ2A 3G8BA 1MG0A 1P5ZB 2PKCA 4L02A 2O8CB 2NO9A 2INGX 1PFQA 1QQ7A 2P40A 3HXMA 3NWOA 5F1KA 2BHSA 1RAEA 5IXYA 1OD6A 1FNBA 2DRIA 5IC5A 3TUJC 2ZJ2A 4C30A 1ZQ9A 2P11A 3EIQA 5IT9A 3ELYA 3IGFA 3IB6A 4HHEA 3Q8MA 1NYTA 3M6AA 4N7RA 5JHGB 1QGOA 4JBHA 3S2GA 3K6RA 5IARA 4KYTA 4UVGA 2F8MA 1WOMA 1NZFA 1PYOA 2VCHA 1FUYB 3UYLA 1T24A 3R74A 4JS0A 4JKIA 3ET5A 1RRCA 3I8OA 2GEVA 3G0CA 1KH1A 3WIBA 4IIJB 1Z38A 1OTHA 3BERA 1EFDN 3TGLA 4KK4A 1ODSA 5EJMA 2VJMA 4BU1A 1YI8A 4L8YA 5FUYA 4UE3S 4ILEA 3EJ6A 4X91A 2WE7A 3I64A 2VDWB 3IQHX 1Q7EA 3DFMA 4HN2A 5KSPA 5JFTA 4EATA 2R25B 4AF8A 3ZD6A 4LF8B 5I5GA 2WD7B 1OZGA 3VU8A 4Q1BA 1F2UA 4H17A 3SYTA 3GLSA 1Y7LA 2VK1A 3ESDA 4C21A 4BNUA 4QXQA 2Q1UA 1LUAA 2D5LA 2DPGA 3EISA 4LX8A 5KKCA 2XVAA 1VIMA 2WF6A 1RLOA 3PS9A 4MKHA 1ZJZA 3X1MA 3DEIA 4XA8A 2IKQA 4FD3A 1UJCA 3IBSA 4X44A 2ID8A 3KKOA 2OHGA 2QVCA 3UOWA 2YXDA 2J5XA 1EM8A 2HIAA 4Y0AA 5DXFA 5F77A 1EGVB 2IHTA 1H8HD 4HB0A 2O19A 2F43A 2HA4A 3SC3A 1A0OA 1PZNA 1TVEA 1ETHA 1VYUA 3EPRA 3PSAA 4JJIA 3SMVA 4JT2A 1KH2A 4FONA 4P36A 1T5TA 1NUSA 3NCHA 4QJBA 3THYB 4K2AA 4FK8A 1S3IA 1KDOA 2F3RA 3CN9A 3U1TA 4BMVA 2AMYA 3NDRA 1Z5PA 1P72A 3F5MA 4BMYA 4L4SA 4MDEA 2VH2A 1O94A 2Z5LA 2ES4A 3BCSA 3GGOA 2O1XA 4FZVA 4H9GA 1P9RA 2UZ0A 2GPBA 1Z39A 1XJCA 3G1WA 4G37A 4YB8A 1MW9X 5A6SA 3BL8A 1YZYA 3HCRA 2X8WA 3W8RA 5D6OA 3CN7A 3I5YA 3IURA 4YIHA 2IPOA 2ZDQA 3AIMA 4RX1A 5IAEA 3H84A 1N6OA 1WDKA 3QIVA 4BX0A 3E3AA 1PK8A 3D81A 4QODA 4AWAA 1EP2B 1BS2A 3LX4A 3IP5A 2UDPA 5LWHA 1G66A 2ZUEA 2ZIXB 3CCBA 1ZX1A 4J1SA 3TRDA 5ITZA 3QE4A 1YO6A 3HWRA 1NKVA 4WXMA 5DTMA 4FLEA 4QYXA 2RGNA 2W11A 2YINC 1MX9A 3HABA 5JROA 5E9QA 1Z0KA 2ZBFA 3CG0A 4U39A 4BQSA 2AR7A 2VYND 2LKDA 2R5FA 3HBFA 3OZSA 4G2TA 1ZN2A 5EIFA 3QVWA 2B4TO 1HLDA 1OAOA 1IN6A 3A4YA 3STUA 2YHSA 5JSQA 4F9EA 2B30A 5CEEA 3R2JA 2IOYA 2CUKA 5LA6B 3S5UA 5EIBC 5J2TF 5FAXA 3JAWB 1AKYA 4JBLA 4BNWA 3PCTA 4MUXA 2ISQA 4EP1A 1VB3A 5EMLA 1HZZC 4PGFA 3W8FA 4WXPA 5K8IA 3RYCA 4LZNA 4D9CA 2JIMA 4OJKA 3M9XA 5CBPA 2R66A 1FTNA 4B44A 2FVXA 2QZZA 1KHTA 3CRZA 4EG4A 2C7GA 1Z2DA 1M7GA 5K0JA 1TZ2A 3VO9A 2NZ8A 2DUUA 1M5TA 1JG2A 1OGJA 1UKBA 1YZHA 3DEFA 1IQ0A 3BXEA 3ISJA 3TR5A 3OBBA 1P61B 2HWUA 1VL6A 1Z2PX 1L8QA 2YWHA 4HBGA 4HPWA 1DKNA 4JBNA 4RH1A 1BMQA 3TJZA 4ABTA 5KYYB 1WMBA 2QNRA 3DHVA 1BS1A 3DOIA 5EKXA 4ZVQA 1US8B 4CLEA 4ENQA 1W0KA 2HDWA 2DGDA 1PJCA 1RJ9B 2AQIA 2I80A 3LLCA 1UC9A 4YQZA 1ZOPA 3QHQA 3ZC3A 3AR2A 1H0RA 2AOWA 1XXHA 2QG4A 3R3ZA 4WASA 4X60A 5KYVA 1WNTA 5A9RA 2ZBUA 1XRSB 4V02A 2O3QA 5AICA 6ABPA 5J59A 1IULA 2N42A 3VC3A 2VTBB 4Y9UA 3L04A 4WXHA 1KEWA 1WMDA 2CF5A 3LTEA 4FFOA 1IZ9A 4PR0A 3F6PA 4QUHA 2NNLD 1NWCA 4DV2B 3H18A 4WBXC 2WG1A 3LT4A 3KZCA 3OH8A 2FG6C 1X9IA 3GRAA 3LBAA 5LPNA 3E22B 2EGUA 1HYQA 2ZUBA 1ZD1A 2DUWA 4G1BA 2DTDA 1R9GA 2AWOA 4EHNA 3UJ9A 4PZZA 4MW4A 4DNOA 4JH0A 3T61A 1BSVA 1NOJA 4UBLA 4N9WA 2ZVJA 4M88A 2Q45A 4JBIA 2O2SA 3J81A 1MO6A 1NLUA 3H04A 1OF1A 1MB0A 1GV0A 1CRPA 2PRIA 2H1RA 3MGGA 3N8KA 3REFA 1LVGA 4PINA 3OEHD 4HWGA 1T5HX 3CLRD 1ONOA 3ZDZB 3QENA 1R0KA 3VU0A 3CNQS 4B6SA 4C4SA 2AQ8A 2XUDA 4R1PA 4CFZA 4CCYB 1SVWA 2RHTA 1MIOB 3IJRA 2W4QA 2GLUA 4KPUA 4ONEA 4PQRA 4WNIA 3BSFA 4ZVPA 3TQFA 3IEVA 1XZGA 2Z08A 2O20A 5DM2A 3WYAA 4ZVLA 3IIKA 3ZV7A 3E58A 2EYQA 3DMYA 3R3WA 2V7EA 2VHYA 3RG2A 4K0RA 1EK6A 1ISHA 2QY9A 4NCIA 5IKMA 3HBLA 4L2IB 2PT6A 2FJPA 1XKTA 2J32A 4X24A 1P5HA 1RS0A 4FEAA 4LYFA 5FI3A 3EEQA 1L1QA 4EGJA 1L4NA 4X71A 1KRXA 3UWPA 5F9FA 1XD9A 2OCBA 4G1UC 4M8KA 3VR4H 2VJNA 4M2LA 2PH7A 1I1HA 4ND8B 1SD1A 2Z3VA 4TLDA 2E55A 4Y1FA 1F4LA 3VNAA 4E33A 5F23A 3O4HA 4AP6A 4DUPA 5AHOA 4EUFA 4LJ9A 3N3BC 4BFZA 3NH9A 1NXXA 3GAMA 2FGKA 1ODKA 3COZA 4Z9BA 3TWOA 1R0WA 1U2TA 2JJ8A 1Z4NA 2NO6A 5LDHA 4ID9A 3QE9Y 2V1XA 1PL6A 4AX4A 2HMTA 1QIDA 2A5FA 3G17A 3TLYA 3BJMA 3MYRA 3WDLA 4BNJA 4N0MA 4AG3A 3CNBA 2PPLA 4ENUA 1G20E 3TFWA 5B4UA 4AMGA 1XEAA 1F3LA 3A4VA 3CUYA 4MULA 2Q99A 2PGJA 1DKRA 5FOSA 1PT5A 2XPCA 4BHTA 2PNJA 3VQTA 1YZQA 2NAFA 1QLJA 1L4YA 4ED9A 2H4WA 3SFVA 4C0AC 1B0PA 1E9BA 3EASA 4BXOA 1FSSA 1L7XA 3EXFB 1N6RA 2I1LA 4OMUA 2IUTA 1U9YA 3IUNA 1FSFA 2C0CA 1KZYC 2PHZA 2H63A 4D8WA 4GPEA 3AV3A 3DV2A 4D6YA 4RAOA 1F2TA 1WLSA 5DW0A 5HFNA 2RE8A 3DFZA 2ECKA 3FTCA 1AZLA 4HEJA 4QAQA 3V8VA 4XWOA 1TXGA 4KXMA 1XMIA 5C37A 5I7FA 2A5GA 4JQZA 5K3EA 4V3BA 3H5WA 1R0RE 2OCIA 2W58A 3E23A 5D5PA 4DQ0A 1ZRHA 4ALMA 1JFRA 2GRAA 3DAOA 4RJ2A 3RHFA 1I51A 3FDZB 2OP1A 4TQAA 4KG7A 1EFKA 1FUEA 4JYCA 4KN6A 3HM9A 4IICA 1G1AA 3B5EA 3HY3A 2A4KA 2X4LA 3C3MA 4NFHA 1DAOA 3VHRA 4B3CA 2N1MA 2GAJA 1NJ1A 2YRWA 3L9WA 2GBLC 3LBNA 3VPDA 2G25A 3WO1A 1FS6A 4N5IX 1N5DA 4KYVA 5ALSA 1X1DA 1CXZA 3NGMA 5BMOA 2BFDA 2WHEA 3PFCA 4X85A 5KTYA 3QXCA 4EL0A 2DCUA 3DDWA 1ANKA 1CP2A 3GRCA 3I4LA 3TZ6A 2RB5A 1SXJD 3MLEA 5C46F 3ZDAA 5GGYA 5CT4A 3KQQA 4AWXA 2QGZA 2GF2A 2YJGA 3WV4A 3FD8A 2ZQ5A 3RU2A 4BEJA 4BYMA 1HTWA 4AQDA 3E0QA 4U5QA 4BRUA 1U9CA 3P9KA 5B4VA 3EUEA 3GA0A 1M1YB 4RPIA 4RANA 1E3DA 3WWZA 3W2HA 2A4MA 3KD2A 2JFWA 3RASA 4X7PA 4IDCA 2GEDA 4GZLA 2BE7A 4O4LB 3RO7A 4D9HA 2CV2A 3CYFA 2YV1A 3P94A 1U9ZA 1ACMA 3EUWA 3HCEA 1CETA 1KU0A 4TKUA 4ZO8A 5AVUA 1KEEA 1YR8A 2Q1YA 3LDHA 4ZAFA 3WGOA 1ZU5A 2QX7A 4FQ5A 1QANA 4R71A 1V9SA 1UDBA 4KGZA 1PR0A 2AR0A 3HDHA 4W82A 1QDEA 3ENNA 3QUBA 4REQA 5LBUA 4GSYA 1BVHA 3OPYB 5BWCA 1QGDA 4HDKB 2R7NA 4C1BA 5JRZA 3QX7A 1AX9A 3MBIA 2IYFA 3Q0IA 2XNHA 4CEHA 4FTWA 1TM1E 1GSOA 5JCJA 3NZEA 5HRAA 1G1MA 2X5NA 1DKMA 1ZMBA 4WBNF 3MELA 4KQCA 5TY0A 1NKSA 3V1UA 1HNWB 1L4MA 1G5QA 2GN0A 3B6JA 4ARBA 4GI1A 2JG3A 2CLOB 4IIUA 3V7UA 2I4TA 3EXG1 3EQ8A 1XZ8A 2FXVA 3O47A 3RQSA 3UN1A 1G7CA 1ULBA 4H59A 5IK2A 2QD2A 2Y05A 3IQGX 1UT5A 3LQKA 1KZ4A 1UKEA 3MGCA 4LZLA 4B3HA 5EZQA 2RH8A 2JDID 3AESB 1PJ4A 4FZ5A 4L7VA 3NYQA 1W9HA 5EZYB 3E9RA 1RYMA 3KXKA 2JS7A 1VL5A 3NEJA 4FB5A 2O0LA 4WK6A 1N2IA 2IBTA 2PZBA 3AF1A 1A7AA 2XAAA 4MP3A 3ENWA 1O6GA 3I9V1 1HDZA 2Y1EA 3B82A 1C4WA 1WKVA 2JGIA 5F51A 4NYMR 2FJ0A 3VVLA 1OX5A 1IN8A 4QDZA 1GZSA 1N2ZA 3WGGA 5JNTA 4ND6A 2G9VA 4AD8A 4FFPA 4CM1A 1U2GC 3COYA 1P44A 3WLIA 1N5IA 4DMLA 4EW2A 2UVDA 4CKCB 3UC5A 2ZRPA 3IULA 3MN1A 4FZJA 4GVPA 2COKA 5HMMA 4RK4A 2GS9A 2Z5GA 2OLEA 2HEIA 3ZWQA 3Q2KA 4BJ1A 1N9KA 5B12A 5BQPA 2IYAA 4GICA 3PC2A 5C32A 3S3TA 2P2SA 1F2DA 1JV2B 3BICA 1PZMA 5GGXA 1YKFA 4EPXA 4QUJA 3HYCA 2ZYGA 4QBTA 2O0KA 3LC1O 4NC9A 5HQTA 5KVCA 2RHHA 1Z4QA 3EGXB 3HCDA 2X41A 4J07A 4DTIA 2OHXA 1ND5A 4NPHA 5K6AA 4JI0B 2P41A 2E4YA 2HZ7A 4CEIB 1YOBA 3BMNA 2WPNA 5KX5A 3CT6A 4ARVA 5J1TB 2QJFA 4FMDB 2R8XA 1BE1A 3L41A 2ZYWX 2D74A 3C3KA 1DKQA 1OH5A 2OVFA 3CTMA 3HKEA 3IR5A 3KT3A 3KSUA 4G8CA 3TQTA 4DSTA 3PPYA 3HS3A 5ADWA 4YLGA 4MS4B 5LNK6 3R7NA 5L6LB 1XZFA 3CCFA 2J9RA 2HSDA 2QVYX 2GN1A 2NV2B 3UNXA 1J6UA 1F60A 2H5JA 3EGXA 3HVIA 1J20A 4FSHA 3C1UA 3NTUA 4JLKA 4NP6A 2HMWA 5ISMA 5DHAA 2AJTA 1TAHA 1HEIA 1XG5A 4WK2B 1P0CA 2R1TA 4TSFA 3EFHA 5MFZA 3OKAA 3JATB 1E9SA 1SH7A 2A84A 2R62A 3A0UA 4RS3A 5IVIA 2ONCA 4QTYA 3P9XA 2VNJA 1Z45A 4H7DA 5EP2A 2W6IA 2HQ1A 3GEIA 1E92A 4NE2A 4BNVA 4E31A 1M83A 4X1IA 1I1QB 1RXEA 1W34A 2AFHA 3S2UA 2JFXA 3VZBA 3Q8LA 1ZRNA 4IIYA 1SUPA 4NWIA 3TM5A 1JQ3A 3IQEA 1DZIA 3QK7A 1YNSA 2NZ2A 4TS9A 1Z0ZA 2GXSA 3WA7A 2WLTA 2PM8A 1XCOA 2R85A 3GNLA 3DM5A 5E4YA 5FOVA 3MBKA 1I2CA 4ZT4A 2C9YA 2HTEA 4F5DA 1O0BA 4RDIA 2M1ZA 4U9UA 1Q1ZA 5E1BA 4GE0A 3L6DA 1RT9A 3BGIA 1V7QA 4HN9A 4R54A 5D3ZA 4GYKA 2Q6IA 2RKWA 1PQWA 3HJBA 1J0BA 1HM5A 2W00A 1D4ZA 3EPHA 1CULC 1G5TA 2R84A 1LPSA 4XW2A 1MW8X 1Q1AA 3IMFA 3OEWA 1VJGA 2VDVE 3EIOA 4RH3A 2EWWA 1Z5VA 3ZNQA 1T8UA 4OHBA 4TZTA 1H2YA 1QFJA 3FJYA 4ZV7A 4CW7A 1OXVA 3GVXA 1UXKA 1BA2A 2I7DA 1B2LA 2YWCA 1GT91 5FYDA 2GFQA 3U7IA 2NU7A 3Q9NA 2YXNA 2QRLA 4QO8A 2OKCA 1GGVA 5B1EA 4Y2QA 3AP2A 1R6BX 2QN8A 3RVBA 1X7ZA 3N6VA 2JCGA 4J1TC 4RD0A 4F4CA 3JVDA 1BMFA 3AHJA 1QZXA 2CB0A 2H6EA 1XCGB 2PSFA 2ZG6A 4PAGA 1NQAO 5IUJC 1VKOA 1KJIA 3R6DA 3UAWA 3UTDA 3W04A 4O4JA 2BHNA 4O1IA 1ZLYA 4RW0A 3J7AC 4NENB 1XO1A 2JFGA 2I4NA 2NM0A 1ZYUA 3DAPA 2QE7A 2XCIA 4Z9YA 4C0XA 4D44A 3GWZA 1OX6A 3EIEA 4MLCA 4Z9AA 3WK8A 3WJ7A 1BW9B 1HFKA 5DHFA 4OJTA 2ECQA 2AGVA 2OC4A 4CHTA 4CXMA 3TR6A 3FDXA 4DADA 1DBPA 2GCPA 2W2LA 1IATA 3QW4B 1WPXA 4V0RA 1ZGCA 3A3NA 1W76A 2ZTLA 4FBMA 5I8ZA 4L51A 3VHXA 4B4KA 3WWOA 3MF4A 3KAPA 3T3HA 1S3SA 1JDTA 2ECPA 2H8KA 4Q15A 4RF4A 1HFWA 2UVPB 1IY9A 3KQUA 1FVXA 2YFQA 3D4LA 4DLYA 3G7UA 3SM9A 3BIJA 4R2LA 4WBNA 1GNQA 4IVPA 3ENQA 3GPBA 4IXTA 1M2FA 3EVGA 2VDRB 3UMRA 1NI4B 4N7JA 2J08A 2M6LA 4DA8A 4EB6A 3KHSA 1ZVKA 1A71A 2QAGC 3S27A 3QU2A 4RGYA 3UV7A 5AVRA 3O8NA 4Q9LA 3PDUA 3LI2A 3TDMA 1BIFA 2ZYRA 4CLOA 3WAJA 3WRYC 1KBOA 4KSYA 1H5NA 2RI1A 2V45A 3C6YA 4IJWA 4YJFB 1Z8HA 3X0DA 4B48A 3NIWA 4HWOA 4V0LA 1X1QA 5BNIA 2XLCA 4DLLA 4MRSA 3GC6A 3OJ0A 1V6AA 2BEWB 1YACA 3O9VA 2LE0A 4XYEA 2PAAA 1MJFA 2JZCA 4ZJZA 4FJ0A 4LPSA 4OJYA 1EJ0A 2OORA 3CLVA 5JCXA 3GGPA 2Q49A 3A1UA 4JXJA 4RZQA 3UGKA 4FKZA 1G60A 1RCUA 2HJRA 2XF2A 1AGPA 4K9PA 2AA3A 4KODA 3WGTA 1E9EA 3T7DA 4N40A 4UTVA 3TSCA 4AJEA 2YCBA 2PY6A 2FSHA 3H8VA 4NZMA 4EUSA 6CHYA 4CKEA 3IP7A 4LTMA 2ZS8A 4QASA 4AF7A 1C9NA 4JU8A 3MAGA 2Y0PA 4WNYA 3SDBA 1RLUA 2XVMA 5C4MA 3LA8A 4MKIA 2C77A 1YONA 4JJ8A 5G2OA 4DLTA 1GEGA 1U8XX 5GM2A 3SDZA 2V7WA 1SK9A 2OLJA 1CDEA 5ITZB 4NYIQ 1A69A 4KVZA 4MKZA 4I36A 3WRXC 1S9DA 2WEKA 3RNLA 1GUDA 4G0XA 3VZCA 3T5AA 3WK4A 1HE5A 1BGVA 3CEAA 2YJ3A 3AMVA 3EXHB 1GQOA 4DCGA 5JAIA 4ER5A 2X9QA 3ITNA 1M33A 2QTTA 1FDVA 4JENA 1VZ3A 3PB3A 3OFNA 3AM5A 1FJXA 1UKCA 4FYMA 3IVMA 4JEMA 1PQUA 3OCXA 1P1HA 3UAOA 4EF5A 2JIBA 1TUIA 2NZXA 2YR0A 3DD5A 2PZKA 2PL9A 2QG6A 1SQ5A 2CK3A 5FI5A 1W47A 4ND5A 2G8LA 1Z4OA 2QY6A 4BC1A 4U2EA 3M6WA 2BDEA 2HREA 4E2YA 2IUYA 3DQPA 3OWXA 1A9TA 1C9YA 2H2FA 3OCCA 1C4XA 1ND6A 4G0OA 4DCUA 4IX9A 3QOXA 4QQKA 1DOAA 1WXGA 3O8CA 3THYA 3HVHA 1EFUA 1OWOA 2HC9A 2VRBA 2GSWA 2WJYA 4Y1EA 2QMQA 1A1SA 5BT9A 2FY8A 3VR3D 2RHCA 2ZTVA 3B1XA 2A0XA 3OQJA 3T7EA 2JI6A 3A9RA 3I4CA 4ZK6A 1J0XO 4J75A 2XLBA 3CF4G 3D8HA 3H7AA 5I48A 3I9MA 1O87A 3RJ9A 4D0SA 5ES4B 2NVWA 3H1GA 5C8YF 1F51E 3BGVA 3RBVA 5CFRA 1KFEB 1QV6A 2O2EA 2R1TB 3T1YB 3L7IA 1XLUA 5LD2B 2AOUA 2X14A 1YS6A 2YV2A 4LVOA 5FJIA 3T5GA 2UYQA 3P0RA 1MENA 5JPIA 2QX9A 4Z4CA 3GDFA 3HCAA 1G6HA 5BSVA 3WYFA 4P80A 3ODPA 4NQZA 5AK5A 4F21A 4NLLA 3ZNPA 4B8ZA 3Q15C 3T3MB 1RIIA 1OI3A 1XEWY 2QUAA 2I54A 5FI0B 2C8KA 2OG2A 1M5UA 3ZTYA 3I05A 1PG2A 3TB4A 4RV5A 3ZBUA 3QY0A 1DRWA 2RHGB 1XQVA 1J1ZA 4NCNA 5LC1A 3MCAA 3ZXYA 4P84A 1XKXA 1FYFA 5K45A 1BX1A 4WZBE 4YJ2F 1B0ZA 4FS8A 3CKLA 3IUQA 4R2HA 5DSXA 3TKAA 4P0PB 1HO3A 3JYPA 4KPGA 4FKBA 5CH5A 4BV3A 4NTZA 4QYSA 3N7TA 1JF8A 5EIBD 4DUZB 4PZAA 1EUQA 4Z53A 4RDXA 4RVFA 1PQPA 2C4TA 3QKIA 5IAKA 1CUDA 1I9GA 3ROMA 1ONNA 5JYCA 4LV8B 3CPSA 1LCIA 1FDTA 2MYTA 3QBTA 5A4DA 3GIDA 2V3CC 1G18A 3ZZ0A 4YV7A 4NMMA 3TUIC 1NAHA 4QUIA 2IP1A 1MX5A 1K06A 5FPPA 4LJYA 3N2GA 3I4FA 3K4HA 3H4VA 4L4UA 1B14A 4BNGA 2GSDA 1IMOA 4A15A 4U6QA 1Z6AA 2EL7A 3MB5A 1NJ2A 4LRTB 1RDFA 1WKCA 1PTJA 5AW5A 1YB4A 5CDTA 4BP8A 1JLHA 4P22A 1ZSNA 2PVSA 1Y6GA 1XJ5A 1JG4A 1S2OA 5BMVF 3WHKA 3TZLA 4FKMA 2JJQA 4M1TA 3M1AA 3BF8A 1OYVA 4DF3A 3KR0A 3WFJA 4QOGA 1VLQA 2FN7A 1KXJA 1Y80A 1Z2NX 4BMCA 4BQOA 4F8YA 5C1PA 1IWBB 5ALTA 4R2XA 2P7HA 4M8NE 2VT2A 1L8LA 2NU6B 4YEDA 5AI5A 3WYEA 3B1JA 3CEHA 4RTQA 1MABA 4S35A 5KQSA 3G0HA 2QVLA 3RSOA 4WEOA 1A5TA 3VSAA 1KVRA 5IFLA 4H08A 3A1EA 4KR6A 2DR3A 3E8SA 3UWMA 1AOXA 4RVSA 2HFKA 4WZZA 1AUXA 1BTOA 2BI8A 2BLLA 2MYUA 4CMGA 1ZI8A 4B84A 1JAIA 7ABPA 3FHOA 1HZJA 2VNAA 1ZOSA 4MNTA 4CNBA 4P82A 2XDQA 2YFKA 3UUFA 4WJLA 1PV2A 3MT8A 1TYBE 2MSEB 3ST7A 1A8QA 2E6UX 4KYUA 4CLOB 2RCYA 3CUUA 5DWDA 4EYQA 4PG6A 3TRHA 2OCGA 3ZJTA 1WF3A 5JV5A 2HNKA 4O0LA 4WESB 4ZV4A 3PKJA 4AJOA 3VXKA 1VFNA 2FSSA 2J9YB 1LX7A 3H1TA 2LKCA 4DQKA 5ESDA 3ADKA 2H1HA 3SNKA 1Q19A 3P9IA 3WLLA 5AM5A 4ZI3A 5CFLA 5JRJA 3ZHTA 2W37A 1KVQA 4N03A 4D74A 4NK4A 2WHPB 1WPGA 2R68A 3RGGA 3I53A 3SD7A 3K70D 2J46A 1DKUA 1KIFA 3GWGA 1M66A 1UBUS 2G28A 2YWRA 3BD8A 1LPPA 4XASA 5JUWA 1CEQA 5EZSA 1GTVA 1NXSA 2CUZA 3OX4A 1L5HB 4L2IA 5JE8A 3TI7A 3TAXA 4BN5A 2W2PA 3WLSA 4FIDA 5LP6C 4IG9A 2PMEA 3GJ6A 1T10A 1XPJA 3DO5A 5KTNA 2G04A 1YF3A 2X7HA 4DR1B 1PV1A 1JB1A 1YB7A 1ZA2A 1XEWX 3GZ4A 1DBIA 4IYJA 5H4HA 4HDNB 4PNPA 4JJGA 4LJ6A 3L6BA 1PR4A 4S04A 2ONJA 2PJDA 3IOCA 3CBGA 3GD7A 5AJXA 5EJ5A 5SZIA 1CUIA 5AKGA 1VCHA 3G8CA 1U81A 5IUKC 4O4HB 1PUJA 1YZVA 2D1QA 4PXAA 4G2NA 3GARA 4UASA 3OQ6A 1GR1A 1LJ8A 2ZSBA 3K2QA 4J90A 1KC1A 4BWFB 1SPBS 4DV4B 5BVGB 4PZPA 4PWZA 4CDGA 1D2EA 2B2XA 1N2CB 1QAOA 1ZVMA 4HDMB 1PGPA 4L4YA 4W5TA 3NHKA 4J16C 4UCFA 4YGYA 4B79A 1C8VB 1VKRA 4F92B 5CTJA 1U7UA 4Z9FA 3HCPA 3HP4A 5C9ZA 2G07A 3NWJA 1PFKA 1RQXA 1A7KA 2RK4A 5JWOA 1K8QA 3ND9A 4A23A 5DT2A 3WNBA 3F74A 4P0TA 1FEZA 3DLTA 4DIFA 3PNVA 1P2BA 4ETIA 2MMCA 4MV7A 4E5PA 1XWIA 5B3JA 3FBTA 3HCFA 4R16A 3FLBA 1R6XA 5DDIP 2QLLA 3DWIA 4ZTBA 3LLMA 3DLAA 5SV2A 3AM3A 2YQ4A 1P8AA 1US8A 3AFGA 2B82A 3O4GA 3QKWA 2H0RA 2RJ3A 2QIPA 4FE4A 3UQYS 4D8TA 1V37A 1MH9A 1NW4A 5DYGA 2PZ8A 2ZITA 3JPWA 2W0MA 2ZTMA 3HKEB 4EARA 2I6SA 3LK7A 4LV6A 2BTEA 3HYNA 2SKDA 1PEKE 1SOMA 4C20A 1TEHA 1CZRA 5AESA 4HDRB 1ES9A 1WXHA 4A73A 5AVKA 8AT1A 5JCZA 2E4XA 4ARAA 2CDRA 5HUQA 5HSGA 1G21A 1Z6ZA 3W9SA 1U80A 4CI9A 2PIDA 4QPNA 3ZCRA 2WF9A 2ZUWA 3L46A 4LNHA 4QOHA 4BATA 2NO7A 5AXAA 4YUWA 1QFMA 3HA5A 4LOLA 5L51A 3NHAA 2KE5A 5HF9A 4MWTA 2C7RA 5ITVA 1Z8DA 2FMUA 1A27A 1V3TA 3GEEA 3ZE8A 5JYEA 3A4IA 1TM7E 4UQPA 3MJTA 4ZRNA 5YASA 2VP4A 1GTSA 4DT1A 4GRDA 1K8YB 4QJIA 3U44A 1GPH1 2AFIA 4AB1A 2OBYA 5LP1A 4CM9D 1Y7PA 1HUQA 4E2FA 3CLRC 4CKCA 1MJ5A 2FOLA 3T5CA 1IEQA 1KYWA 3BSWA 4NKRA 2DC1A 2ZI3A 1XEXB 4ZOAA 1QIFA 4RIIA 4LECA 3BAFA 2SHKA 3OLXA 1IBKB 2C9BA 3OJOA