4J76A

Crystal structure of a parasite trna synthetase, ligand-free
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
389
structure length
372
Chain Sequence
b'GINYNKLIKEFGCSKITENHIKRIEKLTNSKAHHFIRRGIFFSHRDLDFLLNYYEQHKCFYIYTGRGPSSLSMHLGHLIPFYFCKYLQEAFNVPLVIQLSDDEKYLFNQNYSLEYINTLTNENVKDIISVGLNPELTFIFKNTEYAGYLYPTVLSIHKKTTLNQSMNVFGFNHSDNIGKISYPSFQIAPCFSQCFPNFLGKNIPCLVPQGIDQDPYFRLSRDIAVKMALHKPVVVHSVFMPGLQGVNSKMDHNNSVIFLTDTPEQIKNKINKYAFSGGGTTIQEHREKGGNLDKDISYQYLRYLLEDDNKLNEIGEKYKKGEMLSGEIKKILIDVLTELVLKHQEKKKSLTDEEISYFFDPNKPSLQKFKNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
publication title Crystal structures of Plasmodium falciparum cytosolic tryptophanyl-tRNA synthetase and its potential as a target for structure-guided drug design.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Ligase
total genus 136
structure length 372
sequence length 389
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 4j76A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4j76A01
1NUUA 1QJCA 4ND6A 1T6YA 3IMCA 1N2IA 4HJXA 1NSYA 1MBZA 4MUKA 4BWVA 4ZCRA 1M8KA 2QUHA 4A91A 4DJAA 3H9BA 1KQOA 4DE5A 1IH8A 1MAWA 3I05A 1IQRA 5DB4A 4ZCSA 2Z09A 1M8PA 4KPUB 2X1LA 2A84A 3IOBA 4KPUA 3N8HA 3PNVA 4DDKA 2QUIA 3AFHA 2GKSA 1ULHA 1O94C 5DK4A 1VBNA 3X1MA 2YWBA 3IMGA 3FWKA 2OV4A 3L92A 3HFJA 4P2BA 1QU3A 3A2KA 1JIKA 2IP1A 4UZFA 1WQ3A 2QTNA 1JEDA 1ILEA 2QJTA 3A4IA 3FOCA 3D6VA 3Q4GA 2A1TR 4EG1A 4AQ7A 1WZ2A 3L93A 1QQTA 1MAUA 3ZUGA 1KAMA 1H1TA 1WXFA 3GMIA 1WJGA 4MW1A 2CT8A 1KH2A 3KFLA 3CLUC 2PIDA 4K03A 3VRHA 1JEEA 4MUJA 1EXDA 1O96A 3SP1A 3CLUD 3RK0A 1N2BA 1OBHA 3UC5A 1XNJA 4HK4A 4YBRA 3NBKA 1JILA 3TS1A 2ZUEA 2HMAA 1PFYA 4U7JA 4EG8A 1EFPA 4XFDA 2V0GA 1NUQA 2A7XA 4X0EA 3KT8A 4ARCA 2X0KA 3CLTD 2RD2A 3P0IA 5J59A 1LI5A 2YWCA 2AKEA 3MMXA 3G5AA 3AL0C 4JZYA 1QRTA 3FHJA 4MUEA 5HUHA 3COZA 5F23A 1GN8A 2DR2A 4G5YA 2X1MA 4MW9A 4DDHA 1YI8A 1R6TA 3IVXA 3N9IA 1J20A 1J1ZA 3SYTA 2R5WA 4ZT3A 1Q11A 1JGTA 2XRYA 4FZJA 3RBAA 4JXZA 4TS1A 4ZCTA 2AZXA 1I6MA 1KQPA 1Y42X 1IVSA 2O8VA 2BTEA 3UY4A 3KT3A 1GTRA 2WSIA 1T9GS 4NAUA 2JA2A 5DEOA 1N77A 1I6KA 1K4MA 3KT0A 1VLHA 1NURA 3G59A 5K0SA 4NATA 1IRXA 1U0BB 1F4LA 3IH5A 4HJRA 3IUBA 1NI5A 3CLRC 1TYCA 2PZAA 2Z3VA 4K0RA 1F7VA 2NSYA 1N1DA 3CLRD 2WB2A 1COZA 1K97A 1S4MA 3IDFA 4MVYA 3TNJA 5JBNA 1F9AA 1NYLA 4EG4A 3DV2A 2V0CA 1EUYA 1M1ZA 1B6TA 4ZT5A 1U7DA 1VL2A 3F3MA 2GOYA 3UK2A 4EF6A 3X1KA 1NUSA 2B7LA 3FETA 4MUHA 2YXNA 3MXTA 2CUZA 1YIDA 3HGMA 1WXIA 3P0HA 3QTBA 3ZXSA 4OUDA 3QE4A 1EE1A 2A88A 4PBTA 1KP3A 2DUMA 4ZCPA 4DDMA 2PZ8A 3IVCA 4G6ZA 1TYDE 2A4MA 2CYBA 3CVUA 3OTWA 1LW7A 2E89A 4EGAA 1YULA 1OWPA 3M5WA 4PY2A 3S3TA 4MLPA 1O94D 3MLBA 5EKDA 1GZUA 3H9CA 3SEQA 1QTQA 3DLAA 1IHOA 3FI0A 3GUZA 4MWDA 2CFOA 1JIJA 2A1TS 2D13A 3FH0A 4RPIA 1O0CA 1TEZA 1BS2A 1IFXA 3K32A 1DNPA 1EFVB 1EFVA 1YUNA 3LCJA 2CV1A 3ND5A 3TZLA 3H99A 2H29A 4ND7A 1O96B 4MW7A 3TQOA 2Z08A 2G36A 3KT6A 4ZT7A 3HV0A 4ZT2A 4EG5A 3E27A 3Q12A 1GLNA 3IODA 4I6EA 3ZIUA 1N2JA 4MWEA 2XRZA 1K92A 4ZT6A 3OP1A 5FNZA 2CV0A 1EFPB 1O97C 1N3LA 1MC1A 4DNXA 3SZ3A 1O97D 1WQ4A 3BL5A 2CSXA 1ZUNA 1M8GA 5KCMA 3QTTA 2D5BA 3N05A 3PNYA 1O0BA 4NAHA 1JECA 4MAFA 2DPLA 4YMIA 1EJ2A 4MUIA 3P0JA 3VU8A 1MB2A 4I6GA 2J08A 4MWBA 1JZQA 2NZ2A 4XFJA 4JYZA 1NP7A 3ZGZA 1RQGA 2DLCX 3HL4A 1T6ZA 2E0IA 2QTRA 3ILVA 1J09A 1WOYA 4F4HA 2RE8A 1NZJA 1JMVA 3CVXA 4EG3A 1KAQA 1H3FA 4KR9A 4R2MA 1ZJWA 3CA8A 2CV2A 4GRIA 5LM3A 3FY4A 4MULA 1KP2A 3AG5A 4UZEA 2CYCA 3IUEA 3ZXIA 5AHWA 3H97A 4MUNA 1TYAE 4CQNA 4CDNA 4E1AA 3ZJUA 3INNA 3GLVA 1MJHA 5HUJA 1NUPA 4GU5A 5FO1A 4QRDA 5H16A 3CVVA 2BYTA 1HYBA 5IJXA 3CR8A 4R2LA 4MW6A 3ELBA 2WQ7A 4MUFA 1KORA 2O5RA 1I6LA 3COWA 5KHAA 3NBAA 4YP7A 3ND7A 2IELA 1QRSA 4MUGA 4RUKA 3K9WA 1LI7A 1PG2A 2EL7A 5J58A 5TGTA 2DERA 4J75A 3LE8A 4YP6A 3NV7A 1D2RA 3RHSA 4J76A 1I2DA 1OD6A 3AG6A 4MW0A 1V8FA 1T6XA 3SEZA 4DLPA 3AIIA 4OUDB 3Q10A 5DASA 1PFUA 3HZRA 1J70A 1MRZA 1TFUA 2DETA 3LOQA 4NDAA 1KH3A 5LFAA 5HG0A 1X6VA 4S1OA 1U3CA 4MVXA 5TEVA 2JANA 5FO0A 2WQ6A 2ZUFA 4ZCQA 4HPWA 1R6XA 1V47A 3UOWA 1G59A 3ZJTA 1F7UA 4NX2A 1TYBE 3AKZA 4F3RA 1O6BA 1SURA 2J5BA 1OWLA 1NUTA 1OWOA 2PZBA 4KR6A 1O95C 2PG3A 4AS1A 1X8XA 3N2YA 3FIUA 4U63A 2PXHA 1WXGA 3IOCA 2DXIA 5TS2A 1O95D 3TZEA 2QUJA 1J21A 2DEUA 5IHXA 3IOEA 2EJCA 2JAXA 2QTMA 1N2HA 2J07A 1MB9A 2TS1A 4MVCA 1JZSA 1PFWA 3MUEA 1J1UA 3P52A 1P7PA 1YIAA 3IVGA 2QUKA 2C5SA 2J4DA 1OWMA 3FDXA 4JXXA 1GTSA 2HZ7A 1Q19A 3JXEA 1TQ8A 4WNYA 1XJQA 1KQNA 5K0TA 3D6UA 2GM3A 2QJFA 4Q93A 2IJGX 2QJOA 1N75A 4G5FA 4EFKA 3A05A 1M8JA 1EUQA 1QRUA 1N2OA 2X3FA 3CLSC 3CVWA 3ZJVA 1H3NA 3RFFA 1YUMA 1N2GA 3CLSD 1Q77A 4QREA 3PNBA 1MOPA 1ZH6A 2I1LA 3COYA 3CVYA 2A86A 2CYAA 1WY5A 1UFVA 3FNRA 1PFVA 5LLTA 1WXEA 4WSOA 3CLTC 1N78A 1U3DA 5KWVA 1JHDA 4Q16A 1PG0A 3ND6A 2PFSA 3C8ZA 4U8HA 3TQIA 2VXOA 4ZT4A 2YY5A 4EG6A 1G8HA 1QU2A 4MWCA 1OBCA 1FFYA 3DO8A 1WKBA 3X1JA 3G6KA 1R6UA 1G8GA 3UMVA 3IMEA 1M83A 3HMQA 1KR2A 4ARIA 1Q15A 3VGJA 1CT9A 3RJZA 1QNFA 1GPMA 2E18A 1OWNA 4NZPA 1WXHA 4MW2A 1KKUA 3ISJA 4EG7A 4KR7A 4CDMA 4MW4A 1GAXA 2ZP1A 4MVWA 3FG9A 4QBTA 1U7XA 3H05A 4YP5A 2A1UB 3SZGA 4OJMX 2A1UA 4MQ6A 1T9GR 4XSVA 4CT0A 1VBMA 1VBKA 4MW5A 1K4KA 4KKVA 1O5TA 1M8FA 1G8FA 3MLAA 1JIIA 2HGZA 5BNZA 1ZH0A 4PBSA 1XNGA 5H7XA 4H3SA 4PBRA 3DPIA 3PRHA 1KH1A 3COVA 1IQUA 2D54A 5TEWA 2E21A 2OQ2A 1IQ0A 1A8HA 4L2IB 1XNHA 4L2IA 4I6JA 3A04A 5J5AA 1H3EA 1FYDA 3U1VA 3RK1A 3SDBA 2J09A 3PXUA 2AG6A 2VTBB 4R0NA 4JFAA 1N2EA 2VTBA 2H2AA
chains in the Genus database with same CATH superfamily
3M33A 2A57A 4OB6A 3GPBA 2AEJA 2RC5A 1XMIA 3MHPA 3TTSA 4R8VA 3VAZA 5AW7A 3A1FA 5D3ZA 1TC2A 4CKEA 4B33A 2I2CA 4RGQA 4UM8B 3B9QA 1ZS9A 4C4YA 3OE1A 3QEBZ 4M0UA 1KJWA 3OUUA 4XKJA 2ZJ0A 3E2PA 1UXOA 5FLKA 1E94E 4UM5A 1AUVA 2QE6A 5JFOA 1NJ8A 3TJMA 4EHKA 3F67A 1YZLA 2ZIUB 2FPOA 1V45E 2HLDA 4X20A 1PHPA 5JANA 3AFHA 4AJEA 3EHDA 3TW8B 1CRPA 2GJSA 1NNLA 4DILA 1O94C 1A96A 4KBYA 3QNUA 4OGGA 5BN4B 4J90A 1BFUA 3NAQA 3GHHA 1E3DA 2KBFA 4IXDA 4RF2A 2JLAA 1AHHA 1XP8A 2VT7A 2IP1A 4F8EA 1NBME 1VXRA 4KXWA 4WXYB 4BX9A 3SJBA 2VSQA 2GN6A 2QTNA 4C4OA 1AOXA 2HRBA 2XMGA 2AGVA 4PO3X 3OOWA 4BY9E 4ONEA 1M7BA 2XMQA 2LWIA 1D4ZA 1YZKA 1E1RD 1EJBA 1S3SA 4LVNA 4F5DA 5A1TA 4DCOA 5AUNB 3PQ2A 1CS0B 1GNRA 5DYGA 2P3SA 1RPAA 4MVJG 3ROQA 3U09A 2WZCA 3PJRA 1FRQA 4W8HA 2OV6A 3WRYC 1GEEA 2JBAA 3L82B 1FP1D 3EVDA 1N5IA 2EW2A 3TXXA 2VBIA 2M9MA 4A1OA 4HK4A 4YBRA 2X7XA 4QJ3A 3NBKA 3I58A 1U0FA 1YZ3A 2Q5FA 4G1VA 2Q7OE 4ERXA 1QB8A 5KJEA 1NP3A 2CVZA 1XR3A 3S2IA 1G3QA 4B7AA 1EFPA 1BD3A 3MT7A 1Z0ZA 1IEVA 4RXTA 5ESDA 2EFEB 3SX2A 4D41A 2ODPA 1W0CA 3LJKA 4PTYA 2PAFA 1OA1A 3A4VA 4DMHA 5H5JA 5CXQA 1XDBA 2VPPA 2NZUG 2EZUA 2I7TA 1D03A 2GI4A 5E6RB 1BX0A 1K63A 2OD7A 1XLTC 3OUTA 1GKIA 2BP7B 2IYRA 3CB2A 3COZA 2P2ZA 3OIFA 1HETA 5BVHA 1GN8A 3WWDA 1KPGA 1KY5A 3OPYA 2X1MA 3B82A 3WISA 2ZQYA 2C8KA 2FCAA 2WJPA 3CF0A 4EB6B 1YV9A 5H02A 1J20A 2GF0A 2DY0A 4I50A 1K7EB 3DEFA 4ZWNA 3GUUA 1JGTA 1Y48E 4S3MA 4R2JA 4U4AA 3VPDA 4F5WA 4INPA 2GBIA 1CQIA 2I34A 2M1XA 3DC2A 5GQSA 3IQHX 4EG0A 4DY6A 4KXUA 2OLJA 1NJGA 5BPHA 4P4SB 2I62A 2RI1A 4QASA 4ZTUB 3HJAA 1ZK4A 2I1QA 4DLVA 2R6R1 1Y42X 1UADA 4S2UA 1IG3A 3FE2A 1J2EA 1X3LA 2YVQA 4ZOLB 3ZU6A 2BTEA 2WHQA 3EEOA 1RVV1 4K7JA 5DX1A 4CTKA 2EC5A 5K01A 4XWWA 1A98A 1I14A 1BE8A 1ZITA 4HDQB 4B44A 3HB5X 4QUAA 5F7OA 4C3VA 4KK3A 4PPNA 4YPOA 1AA9A 4NH4A 1AKTA 1XTTA 3KZOA 3T15A 1I94B 4MJ3A 4H0NA 1U0BB 3HJFA 2WIJA 3M9XA 2D2EA 4EHNA 2EF0A 3KG2A 4I1SA 3GJ3A 2G0NA 4XJTA 3QNWA 2AUTA 1H2EA 5CNKA 2QBYA 1KMQA 2FFAA 1BMTA 4ZANA 2GA9A 3PT5A 4LXYA 4F71A 5BOSA 4CETA 3VMFA 2VDLB 4NZZA 4P9NA 5LU9A 5JXGA 4K9KA 1MNAA 3UATA 3HUTA 1PQWA 1B15A 2COUA 2UU9B 2PK3A 2HTFA 2PVSA 3D3QA 3HEBA 3LPDA 3SDSA 2FUCA 1XZCA 4W5NA 1XELA 3RC3A 4CLDA 2ANCA 3DFIA 4LDPA 4HLCA 5SZIA 3F4KA 3GFSA 2NYVA 3OETA 3IDQA 5DTRA 2QTVA 2WABA 3CCFA 4FGSA 4G9BA 3IP3A 5CLHA 3VNSA 5TPZA 1Z7EA 4J7AA 4MV3A 5F2EA 3EGEA 3UFXA 1L5FA 5KDDA 4WH0A 1M74A 4TWJA 4FEYA 2YHSA 1UPTA 3ZOKA 2HU7A 1VYTA 4HAWA 1E58A 4ZZ2A 2P6UA 2AN1A 3OM9A 4L7VA 5F3RA 4QGBA 4RDXA 5KC9A 3DKIA 3CRQA 1M1YB 4EY8A 1BH6A 1R0CA 4QUDA 2ZTVA 2IYPA 3H4MA 5G0SA 2Y4OA 3LPCA 3C3CA 1XLUA 3IALA 1A1VA 4WCFB 2LR0A 2NO1A 1ONPA 1VA5A 3C1AA 4JOQA 5FPSA 5ALUA 2JEZA 3D8NA 4TWBA 4CMGA 1ZUD1 2LDXA 1LBQA 3DZDA 4NFLA 4Q3KA 3ZU3A 2O2SA 1QCZA 2WF6A 2C7PA 2R3SA 1E98A 3EARA 2DHCA 3FI0A 3OZAA 3PGVA 2ZETA 2HHLA 1Y6JA 2A1TS 3IUMA 1WXQA 5ICFA 5A4FS 3MW8A 2D7DA 1WB5A 3I52A 3NOVA 2IEDA 4K28A 4RHTA 4U39A 4ZYUA 4XA8A 3Q2IA 3RSCA 2UYHA 4PAWA 4PV7A 3V97A 1W5FA 3IHLA 4OHRA 2QW1A 3JS5A 4X62B 5MHTA 3HNRA 4OAOA 1C0LA 1EFVA 2PGDA 3GEDA 5KYVA 4C89A 3CJRA 4V0ME 2O8EA 1VCNA 4OI4A 1G8SA 1V7PC 2O3JA 3TZLA 4HDCA 2J7PA 1E5XA 2BFCB 4AJ4A 4XPIA 3ADOA 3BERA 1YOVB 4YQZA 5LNK1 1H1DA 2DM6A 3R44A 5DWQA 4NRDA 2OXTA 4ASUA 3PPWA 3X1DA 4QO8A 4WESB 1KQ3A 1X94A 2QNIA 3FHOA 2QVYX 4MWEA 4WY5A 3QOXA 3FMVA 4IUBS 1ZMXA 1JR3A 2JBHA 3DE0X 1TI7A 3Q0TA 4LECA 1TJNA 4N3CA 4FX2A 1ZBQA 1IHDA 4UW9A 3LC0A 4H35A 2R65A 5FNZA 5IK2A 3QV2A 3VFDA 4BL5A 4FYPA 2OCLA 1IONA 3IC5A 2HWYA 4J0KA 3SJAA 2BGLA 5AI9A 3B6JA 4KIWA 4RVDA 2CSXA 4L4RA 4FE4A 4R98A 3NO4A 2VTEA 3PNYA 3WY9A 1UDWA 1X92A 3U49A 1J0AA 3DFMA 5JXIA 2ECPA 4GG1A 3W5HA 4Z4IA 4R01A 4TVKA 3E4DA 4PZ0A 3VYSB 2NT3A 1JQDA 2X5XA 1AZWA 5AO9A 3HNOA 3GVCA 4BDTA 4ZAWA 4B48A 2J59A 5D5QA 3FUVA 2X77A 4DMMA 3Q88A 3OX1A 4X7RA 2VJBA 5JYEA 5K03A 3PPVA 1IBSA 1LKZA 2CJFA 1P1HA 2BUCA 2VF7A 3NMUF 1SCJA 1JHVA 2JAOA 1OT5A 1R6BX 5ERXA 4H6XA 1JR2A 1GPUA 3SYNA 2VJMB 5CRIA 1SD1A 3H2SA 4CM4B 3D7NA 1OE0A 3QMWA 1U0TA 3I9V1 2FUG1 3R9XA 4EYQA 2G7ZA 2FH5B 4LJ6A 5AIAA 4CM8A 4R2MA 3WIEA 1H0HA 1ULUA 3HA3A 3NYQA 1RE0A 2B6HA 2WUGA 4MULA 1JEQB 2GZ3A 2XAUA 4LQDA 5SV2A 2Q2QA 1E5DA 2P5YA 4BNJA 4ML3A 5HE8A 3NOOA 1HE2A 4B85A 4YYZA 1D2MA 2J30A 3HU2A 4I55B 5IAKA 5B7GA 3GLIA 1NG9A 1Z2NX 5AQEA 3EZFA 1FMTA 1YAHA 1L4KA 3SSNA 2BEWB 5B1YA 4K6MA 1NUPA 3ZWNA 2NQ2C 1OXSC 3A25A 3RTCA 4P7FA 3ECAA 4TS4A 3LL4A 1P3DA 1ZNZA 5I7RA 3QK7A 1HE4A 3CR8A 4LC1A 5FUYA 3WAGA 3L6EA 3KVRA 4AW9A 3LW8A 4DMUB 2HFJA 1D6JA 1FQWA 1I7NA 2F64A 4UCXA 4FCWA 1FPMA 2P1ZA 3SBXA 3MWFA 2IXEA 1SCQA 3HKEA 2WU0A 3CC8A 3CG0A 3K20A 3SFTA 3E9MA 5J58A 2HLNA 4J75A 3H2ZA 4YP6A 3S5UA 4LUCA 3MD9A 3RT9A 1RYEA 5FI3A 4DLAA 3AU9A 5FKJA 5FA8A 4HUJA 2GWRA 2IX9A 4LJ7A 4YPVA 1OZHA 3KYCB 1DAIA 2YC2C 3UCEA 1G3UA 1YR7A 2JIZA 3DXYA 2XCRB 1MO4A 2WOJA 3C0KA 4W8GA 4O4IA 3RRXA 6CHYA 3BB1A 7MDHA 2ZRIA 4P4TA 2W6JD 2RGAA 3I2HA 4KDEA 1AUPA 3QE2A 4PHGA 5AXDA 1KJZA 4MHTA 5HZGA 4MUMA 1AGRA 3C8DA 3D8UA 5BR7A 1GGHA 3ASVA 2K5UA 1YWGO 3MUNA 4HSGA 3WLHA 3AEUA 4Y0AA 4S1OA 1E61A 4CMHA 1SXIA 2Z8ZA 4CL2A 3LWZA 1A71A 4JLWA 1NPTO 2EW8A 1OXKB 2IDKA 4EVIA 4OVKA 1TLTA 3LOPA 1UJ6A 2ZJOA 5TSDA 2PNJA 4BP8A 4ZCQA 2XSZA 3G5UA 3IXQA 1CZOA 2K6GA 2CLLB 4NX2A 4BIMA 4QOIA 3G9QA 1LDGA 1Z8FA 2GD2A 3VXKA 1YRAA 2I2FA 1CVRA 4ICIA 4J91A 4UVDA 5DT2A 4DGQA 5LQDA 1OUMA 4JI0B 3ZU2A 2XYPA 2BAGA 4I1RA 2X40A 4U63A 4N48A 1NW3A 1WXGA 1ZM4A 3P19A 5TS2A 1F1JA 3BULA 2O9JA 4JR2A 5H68A 1C41A 4NJMB 3AOGA 2IS1A 3R7WB 2HV9A 4GPBA 4MV4A 5TC4A 2Y9PB 2YV1A 2R4TA 4LCJA 5I9IA 1MVLA 4YJ3F 2W2VA 1NONA 1F4PA 3G9TA 3N2KA 3R20A 4FSDA 4OL9A 5CM2Z 5KKNB 5EWJB 2QLLA 4HYTA 5KYWA 3UAGA 3W7AA 2ISQA 1AUQA 1L7DA 2BM0A 1J9GA 1Q7CA 1ZKDA 3MBOA 3DEJA 3T5AA 4DV5B 2C61A 2PLAA 4X9XA 3OD1A 4H27A 5YASA 4DMGA 1BMDA 1S3GA 4TXHA 4OI0A 1EVIA 1NW9B 3I9NA 1D5CA 1N92A 4PN3A 4IS2A 2YS7A 3ZE8A 5KOYA 1E6EA 3PR3A 3SY8A 2J3JA 3TSOA 4AJPA 2J32A 1BTOA 2F1KA 1R9MA 1DPFA 3E8XA 3ZLJA 1NLYA 2CVQA 2FQ1A 4LYEA 4ARVA 5E2IA 2CB0A 3S99A 3L9XA 2CHVA 4L4UA 3SZLA 2AC4A 5DBFA 4Q18A 5FB3A 1E3EA 1HO3A 2RGGA 1O6ZA 1Y89A 3KEGA 3RFCA 5DM0A 3QA3E 4IIXA 3WK8A 3WXMA 3HVIA 3ZWDA 5CNJA 1YC5A 1S02A 2PGJA 2QRGA 2Y71A 3RE1A 3RVQA 3V7UA 2ZSEA 1YFKA 4FOSA 3ECSA 1GGVA 1I2ZA 1PIWA 3PRYA 2H63A 4DXAA 5F3WB 3RFUA 3DE3X 1QP4A 5KYGA 3FOFC 4WSOA 5HMMA 1U3TA 3ZXUB 4NNPA 3B9BA 1KMCA 2GPTA 3EVAA 1CCWA 4Q16A 2VATA 2ZZKA 3GJ8A 3CH5A 3GRFA 5LYYA 3VC7A 4K6OA 1N6OA 2A5DA 1USGA 4Z4HA 5K3EA 5CVJA 2R0QC 1QHXA 1ZOOA 4U7WA 1A95A 2IQ5A 1BW9B 4DIDA 1E0SA 5J5VA 2QV7A 5IVPA 4WBNA 1W36D 4BFWA 1MQ9A 5HTKA 3CJQA 1P77A 2RSLA 1GPH1 4OMUA 2JGIA 5LQMA 1UXIA 3BHJA 3IUYA 4BNVA 5G2OA 3U61B 3IA2A 4D4IA 2AG5A 2EHDA 4UPEA 1DS6A 4BB0A 2Q41A 3FCCA 4CLXA 1V71A 5THQA 4BHTA 3T3OA 2IYSA 1KE2A 5HZMA 2VT2A 4LPKA 4GX5A 1KJIA 3KPJA 4MYUA 4RVHA 4UD2A 4ZOBA 4Z4FA 1SRQA 4KG7A 5J63A 5FTWA 1FXWF 3H3XA 3OJXA 1B41A 1QTNA 3HP1A 3STUA 4LF9B 1K7YA 3QKSA 5ECYA 1L7QA 3MQ2A 2BZ0A 4FEAA 1CU1A 1JPNA 3U4DA 4N8EA 3DTYA 1P45A 4W1PA 5T67A 4B6GA 4R84A 2I3DA 5CFRA 1YZGA 1JG7A 2P9ZA 1A2KC 1YKSA 4QYMA 4YP5A 5LLSA 2PA3A 3QU9A 4CKWA 4TN5A 1D6MA 2BKVA 4URHA 4YAIA 2CXHA 1BHSA 3LHDA 4I7EA 1T2DA 5FWXA 3PGMA 3R7LA 5JNSA 2VSXA 1S8NA 3WLQA 2VTKA 1G8FA 4P22A 4N0DA 2GDJA 4NCJA 1YOBA 1YE8A 3HYSA 4O4LA 1XNGA 4QICA 5H0IA 4CV3A 5DNWA 3WS7A 4P7BA 5CDYA 1PFQA 5TEWA 1IG0A 2ZT7A 3LD9A 4JBIA 5FX2A 5FOXA 3N58A 2QRJA 1KEKA 3QFSA 1FYWA 1MIHA 1JPJA 1N9KA 1L7PA 5ITWA 5BSHA 2ZJYA 3FGNA 3I6MA 4MRMB 4YN3A 1C1YA 4BLVA 3TRDA 4H3KB 3QIAA 3QSGA 4BZPA 3JQAD 5JAZA 1L5NA 3SIXA 1T26A 4JHLA 3M4YA 5ALLA 3MINB 3HKDA 5I6DA 2EATA 4FWBA 4F7WA 1QV9A 1ZEMA 4N12A 4GI2A 4Y9RA 2AXEA 1CJUC 3D1JA 3RVLA 2GEJA 1XTZA 2GO1A 3L7LA 1VG1A 3NS7A 1NF9A 4MQLA 3VHRA 3I2YX 1OT3A 1WW8A 1E4YA 3DXXA 4REQA 1W4RA 1BWQA 1GTL1 2AQHA 3K0BA 4RE6A 2VP0A 3AESB 3INGA 4AMYA 2EKPA 3R3SA 1NI3A 4HVAA 3ECCA 5TDHA 5JTUA 3TQCA 2SKDA 2ZG6A 4CM1A 3TINA 1AV7A 1RJDA 1VCHA 2EG5A 4OIFA 4QSMA 4Q1EA 4X8MA 4A6PA 4ZGGA 2ZBVA 1YBVA 3ANSA 2C29D 3CIFA 4M9SA 4RY2A 4FNOA 3UC9A 4HQ6A 2D62A 3WJ2A 4FGLA 1TXGA 5KX5F 5ICMA 2ZBEA 4FFRA 3WJ7A 2AFIA 2BFEA 4TM8A 3WB9A 1R0KA 4D3YA 3ROPA 3A2KA 1OYWA 4G0OA 3OZIA 4L5CA 5IP5A 3OP4A 4LY9A 4EJSB 3I5YA 1XROA 3IAHA 4I4NA 3DCIA 4WNIA 4FDTA 4M0FA 3H5NA 1XA4A 2OCPA 4BN4A 1H42A 1QCYA 2GD0A 3RROA 1YNOA 3RVKA 4TV9A 2O6LA 3AH8A 4C4XA 1X1CA 2HHJA 2NPIA 1EH5A 4WFIA 1RYNA 4A15A 1WO8A 3V3KA 1NQTA 1FE8A 3E1SA 2NYUA 4L22A 1T4CA 3ZC3A 2V55B 2BMWA 1QLJA 4PPYA 5AXAA 4CUZA 1E1QA 2R85A 3CWQA 2GD1O 1Q0LA 3RIHA 3VR3D 2K2WA 3CX7A 1WIWA 2WICA 4BNFA 1P18A 1G98A 1XDSA 3V2GA 1APBA 3AUXA 1R18A 4X6LA 1A9QA 2PIDA 1NMQA 2FSPA 3RC1A 3U9SA 3DQPA 6REQA 4L9WA 5LUBA 4KN6A 4RMGA 5AOVA 3C6BA 2UKDA 2VT6A 2DQSA 1SMKA 2O8DA 1PDWA 3L4EA 3LKDA 3UC5A 1JALA 2YYSA 3DA8A 1A7JA 5SYNA 3TKAA 4C7OA 4H77A 1CB7A 4MDHA 1X77A 3BSSA 3UV3A 4I2NA 1P31A 5C8VA 2P0AA 2A30A 3ZIAA 5BN1A 5HQ3B 2WG2A 3LGAA 2E6UX 4X41A 1TIBA 1Q7EA 1MA3A 1TQ4A 3R0XA 2XA1A 1N8TA 4LJSA 1KRWA 1Q14A 5SY4A 2QORA 1DV1A 1T5HX 3GFRA 3HDQA 4CLOB 2WWGA 3NC0C 4WIAA 2O8FA 5DBOA 2W22A 5J59A 3GDOA 3LZ6A 4B5KA 5KOIA 1VKRA 1QVVA 4GPAA 2HJHA 4RTNA 3TFOA 4RORA 2JD0A 1O57A 2XHEA 2XKAA 3TPFA 5L40A 4YCJA 1QRTA 4FYHA 4Q48A 1OSNA 1NPYA 4QTUB 1WTAA 3DE2X 3AQ4A 2FK8A 1Z2DA 4MW9A 3DD1A 4HDMB 4JN6B 4PFKA 3BS4A 3CY6A 5EL0A 1NVAA 5ALDA 4OLBA 4RHUA 4UNRA 4ZT3A 4MPPA 4UVEA 5KMGB 3ONEA 3KWMA 1Q11A 3DHYA 3G3EA 2PV7A 4A8JB 1GRVA 4G4SO 4C0AC 5JUWA 3T5MA 4RL6A 2AR7A 1NBWB 4OQZA 1CY6A 1TF5A 1VKJA 2PY6A 3MUFA 4I3GA 3IDAA 3RBAA 3FDFA 4A2CA 2GJKA 2AZXA 2N3ZA 4JUDX 3WZLA 2PZJA 1R4AA 2GFQA 5JMPA 4CIXA 3L6OO 3T35A 3QFFA 3KSZO 4MQFB 2QLFA 4FDMA 3F6EX 3IUPA 2BFPA 4QOJA 4CCYA 3SSMA 3RYHA 7YASA 1CUYA 4PQRA 4OXNA 1AD2A 4B8YA 1OXMA 1V8DA 5HCNA 3D6MA 4DLWA 1AZTA 3PQ4A 2RK3A 3UAWA 1JYFA 2WLSA 1QOPB 3FTPA 3N0RA 3AF5A 2MOKA 3H6KA 3U80A 5C1PA 2CFIA 1H8ED 5FEMA 4OCZA 4EPXA 4C43A 1R1DA 3CZ9A 4P80A 2BFFA 5E2AA 4OKIA 2XMZA 4J6FA 4ER3A 2VQEB 3G7UA 4QDTA 5LDDC 5FPHA 3WGGA 3KTDA 2RGCA 1WLYA 3TD2A 2JCBA 3LYAA 4E2YA 1VGRA 2Y1XA 3CUEF 4ZCLA 1M0SA 2GDZA 3W5SA 1D2NA 2FW1A 3GGGA 5B7PA 3UJNA 1W75A 2X9VA 3GT3A 1NSFA 1B6TA 2IF2A 5AKZA 3SHWA 4XVUA 6NULA 2GWHA 1SD2A 5SZKB 2XF8A 3LVQE 3X1KA 4BRSA 2WUDA 1L7EA 2Z56A 1NXTA 1NLFA 3D2AA 4Q4JA 3SZRA 4BV2A 4D3SA 3FVQA 3EUFA 4KJXA 3EX7C 2PRKA 2WWIA 2CUZA 4OA5A 2X8LA 1CZRA 1KYVA 1WS6A 2WPNA 3EEQA 4K3UA 4L8LA 4LHWA 2F3QA 1Z35A 2AT1A 2V7PA 1ID1A 2DU8A 1YONA 4MGYR 4WK0B 2A5LA 3NETA 1T2VA 1WLSA 2FV8A 3AETB 4FHDA 4OXQA 1PAUA 2ES4A 2GSWA 4Q37A 1K66A 4DDMA 3P9ZA 4BMCA 3JQ9A 5DN6D 1NW5A 3TSYA 3TGWA 2FWJA 2RI6A 1OB2A 5DYIA 1DX4A 5EINA 2EWMA 3G5MA 1OU4A 4CCWA 1ZK1A 3T38A 1MAAA 1I7LA 2IA5A 4TUYB 2RG1A 5FBKA 2WM9B 3H9CA 4YC7A 4F86A 4MP3A 1DEHA 1HT0A 1Z15A 1Q84A 5MN5A 3M34A 3NQ41 1IBMB 5B1EA 1AB6A 1JA1A 3K4HA 4OHXA 5GVSA 2CFOA 3EVTA 1HYQA 1ZLXA 3FH0A 1D5WA 3VNRA 3VBCA 1A82A 1PEKE 2GD6A 4AD8A 2DUWA 5CH8A 5D7NA 2W4IA 4JVSB 4TS3A 4C87A 3ZD9A 3GT7A 2XMCA 4M9CA 1KYYA 1E2EA 1G63A 4M86A 4AUKA 2Z6QA 2NZ8A 5INTA 2XDQA 3DTNA 5CX1B 4Q9DA 5DWVA 3SC2B 3UAYA 4YMUA 1Z33A 4XUDA 4ZT7A 3FJ1A 5IF9A 1RRKA 5DU2A 3CF4G 3B1KA 4NI5A 5LMUB 3V4RA 3OE7A 3ZTYA 2ATEA 4RIEA 4X64B 3TLEA 2AI2A 5DYWA 1RPJA 3KKKA 4FZRA 4HOYA 4FDAA 2FSVC 4R3UC 2F17A 1ATIA 2R8YA 4G63A 1O97D 1WQ4A 2DJ5A 3Q87B 4FMCB 5F1OA 1Y37A 1BXZA 1USUA 4BE4A 3PXBA 4X1KA 5EJ8A 1CERA 3DTVD 3FUXA 3K0CC 1Z2EA 3M6UA 1G2QA 2P62A 3PEUA 1EFTA 2IY7A 2JAHA 1ZESA 2B34A 2P69A 3QXJA 4IZ6A 4B09A 1UBLS 2PQ0A 2D1SA 2Q5LA 4OHBA 4Q4HB 4E5SA 4JUAA 1NBEA 1ZMTA 4OXYA 1A04A 1NNEA 3DWIA 1XZHA 2BBSA 4LV6A 4LDZA 1DQNA 3NHWA 4M6WB 5IZCA 1QIMA 1RI5A 2A5YB 1NW4A 4AWXA 3ZE1B 2OPBA 5TV2A 1C8BA 3VAAA 2QTRA 4HY3A 4YDQA 3N7AA 3GRZA 3N53A 3AVWA 1I7DA 2AOTA 3WHKA 5BNIA 3C7KA 3EF0A 1TK9A 3TLBA 3WDKA 1KI2A 4K6FA 1NVFA 3ZNOA 2BRUA 3B3AA 4MO9A 1U8FO 2J6BA 2ODBA 3E18A 4KRGA 5C7OO 1W9HA 3HJRA 2QD1A 2X8JB 1E9VA 3CEHA 3DXFA 3L18A 4KOAA 4PC2A 1SKYB 2PM8A 1WEKA 4UE2A 1Z2PX 2VZLA 4HX5A 5JG7A 2ZLBA 2CNKA 2EYUA 2FDRA 3HUUA 4GPTA 3TZQA 2YH2A 4KQJA 5I7FA 3RT7A 1H0RA 2FQXA 2UYOA 4WXRA 1B26A 2Q3DA 3DOJA 2JFXA 2JL1A 2XWSA 4PGGA 5MDHA 4RKEA 2DULA 3RUDA 4M46A 2RGBA 1QAOA 4O4JB 2ODAA 4PPFA 1UFKA 2ZBUA 4D02A 3R3YA 1QIEA 2Q99A 2GZMA 1RACA 1R10A 1PL8A 2QSZA 5NLLA 1LI7A 2PGIA 3PTAA 4ZI7A 1Q95A 4CFZA 3NIBA 3DHWC 1S9DA 3K0FB 1D2RA 5IT9A 5ELXA 3JQ8A 2BSXA 1WF3A 2LTAA 3EXHC 5DHAA 4DPLA 1NSTA 3WWOA 4RJ2A 4UASA 3IIIA 5BN5A 1G55A 2X4IA 1Z4KA 4KFCA 1HWYA 2Q6KA 1DWUA 2BFOA 4U3JB 2I4MA 1Z5PA 2QSUA 2IYQA 5CVUA 1UR5A 2M6RA 1QVRA 3WGHA 3TG8A 1TMYA 4JFRA 4NEGA 9LDTA 3ADBA 4OUDB 2Q21A 2BZ1A 4X97A 1QQAA 3OTQA 1X3SA 2WPDA 3AIKA 3H84A 1XAGA 4NYJQ 3EWIA 5I8PA 2GZHA 5L8VA 4NBNA 4GP7A 4NFSA 4FFSA 4A16A 3V00A 2H3HA 1UC5B 3GN2A 1BGXT 3L1IA 4BN0A 5ABPA 3ZH9B 3GO4A 2RAUA 4K9OA 1R6DA 1E3WA 2VDQB 3KU4A 4G81A 2P8JA 4W7HA 3KXPA 4QUIA 1YDEA 2C97A 4WY2A 4D74A 1J4AA 4HPWA 4L95C 2QLTA 3R4CA 4EY6A 2N1MA 1Z4QA 2GYYA 3LVRE 4G1MB 4KLAA 5AKIA 4C88A 5CTAA 1C80A 3AKZA 1NM5A 4KKXB 3C3WA 4QARA 2CXOA 5HKLA 3QF4A 3UUWA 3TF5A 1G60A 1GGNA 2GYUA 4ZEWA 2UYCA 4F45A 5A6SA 5CAEB 1T6BY 1DLIA 2QE7D 1ZNQO 4BP9A 5TXGA 4Z9BA 3UENA 3LHKA 1XMOB 3CNOA 4NOLA 4U9UA 4NDNE 4K0KB 3PQFA 1XXHB 2IDMA 2QM8A 3WC4A 1EK1A 5HE9A 1VI6A 1BJTA 5C1IA 4QHSA 2CFSA 3KKPA 1T0JB 1MO6A 1IOLA 2RJNA 3RADC 4M1YA 1M2OB 3WHIA 4QU9A 3G68A 3BE8A 2GNOA 3OBIA 2QUBA 3DR3A 2O2YA 2ZDQA 4NOJA 3MUEA 2YN4A 3EWAA 4FFNA 4DSNA 1JB9A 3GLKA 3KUUA 1BMFD 3CZPA 5DW3A 3AVYA 1OWMA 4EUKA 1JHQA 2JJYA 4YQYA 3I62A 1PK7A 2HY7A 1X15A 2GF2A 3PC3A 3SMVA 3D6UA 4D4KA 2IJGX 3QU7A 1JYSA 4RVOA 2AFHA 2IV2X 1SVIA 3AVVA 1L5SA 1DAKA 3C6QA 3KB8A 3PA8A 3R3VA 3WSVA 2GRUA 4DR4B 3FBWA 3QW4B 1PT8A 3EIWA 5FJJA 1MHTA 5JO0A 3QLUA 1E1LA 2F00A 3KKNA 3EYAA 3KELA 1Y6FA 3ZJVA 3ADDA 3KOXA 5BMOA 5BORA 1SIOA 2QI9C 3A6KA 4HB4A 5KHOC 3LT1A 3NWJA 4ZRMA 3DCJA 3NXSA 1PVOA 2I1LA 1T15A 3CW8X 4BGVA 2A86A 1ZM9A 1LFAA 1PSZA 3JAKA 2E1PA 4CN9A 4HRAA 2NTVA 3R5TA 2NNLD 2NXWA 3QA9A 4X1KB 2CXPA 5TMBA 3C8MA 3WKBA 4K05A 3WLIA 3R7SA 5LZ2A 4G5RA 3E9QA 4LXTA 3IDZA 1JHZA 1I51A 4LISA 2VA8A 2V7GA 3PFCA 3QVGA 3GDFA 3JYOA 5KNDD 3OSUA 4C5AA 3DHEA 3V4SA 5KYUB 2AF3C 3ITDA 1RWBA 2H7CA 3P0RA 4Q39A 3ZBUA 1ESZA 3HO6A 5E7QA 1XDUA 4JC8A 4W1SA 3UUFA 2AFVA 4PYLA 4YI3A 4M9ZA 3UMVA 4DEYA 3OLWA 5DTJA 2BJWA 2HF9A 3HMQA 5EE5B 1UWLA 3I32A 2Q9AA 5MFZA 2QL6A 1VE1A 2AN4A 4AURA 3KAKA 2HLDD 3OKCA 1LDEA 3AJAA 2HCBA 2A5JA 1HNXB 5EJ5A 2HQOA 2QTZA 5FQNA 1ZPDA 4Q00A 1SC4A 3B6KA 2BE9A 1FXUA 3A2LA 3OZRA 5ITVA 2IGTA 4Z1MA 4L73A 4N01A 1CIPA 4EJSC 4F2PA 2PJRA 3Q5DA 2V5UA 2ZJBA 4AJKA 3G0HA 3DL4A 1SU6A 3H05A 1MW8X 3H1EA 3PDIB 1KQFA 3SZGA 1XPUA 4HT3B 4ZHQB 3SM3A 1NUHA 3CKYA 2JF0A 4EDHA 1X86B 4QXMA 1KPIA 1VBKA 3GX1A 2W70A 3MD0A 4QHTA 1YR1A 3VR6A 1H2AS 1MEEA 5CB8A 2C7OA 1E5VA 3MWLA 4AZ3A 4I8XA 2HU8A 2JAUA 1M8FA 1NHGA 3JZFA 2BBOA 2YZ7A 4CG3A 4MWTA 5A3SA 4LV8B 4UJ3A 3DPIA 4JJAA 2ETXA 4EH1A 1CUVA 3JPYA 1IQUA 2VZ9A 4TMKA 2OCDA 2YV2A 5DCLA 5B64A 1ZU4A 4C9BA 5FWNA 1BVYF 2OQ2A 4J2OA 3ACCA 2GUGA 4HNHA 4PPQA 2QMZA 2R6DA 1GDHA 4BO5A 4LQ4A 1H3EA 3WYGA 2EOAA 1GZDA 3DPSA 4HMQA 4EHAA 2EX0A 5CA1B 1E0AA 2YY6A 2KLHA 4DRYA 2NU6B 5IVHA 3DHNA 3EG9A 3K1ZA 4PCUA 1N2EA 4KWTA 5IF3A 4O4HF 4PRYA 1NUUA 1QJCA 2OORA 1U7HA 4X71A 1O7JA 1MBZA 3PJGA 5U4XA 3FDZB 4YJGB 1L8LA 1XP5A 2O48X 4JWKA 1C81A 3U7QA 1UC4B 2A92A 1WRBA 1SHTX 3S8YA 4MR7B 4UXIA 1KNQA 4YRIA 2Z09A 3VVBA 4GQBA 1SU7A 4GXNA 3E1KA 1JSZA 3VYVA 1X1SA 1EUDA 4JYMA 4NBUA 1M5UA 1WCYA 2Q8NA 1JMKC 3QVUA 1UJ2A 1WTCA 4IOLA 5DK4A 1C3EA 2JFUA 3DF7A 1K2VN 2GJ4A 2DRIA 4N3AA 4L8FA 2Y0PA 1E79A 3OZTA 1Y1PA 1DAMA 5ELMA 1H2FA 5I5GA 3UHPA 1U63A 3WAJA 3G79A 5ANRB 2I3BA 2R5NA 4PINA 3OECA 4P2BA 4L0CA 3SNHA 4D4MA 1YJ8A 4XTCS 1A50B 2QYHA 2G9QA 3RIMA 3ZDEA 5JISA 4F91B 4EGJA 1Y4UA 1KO8A 3ZK7A 1YVUA 3RM3A 1ESCA 1P2DA 3QWFA 1R00A 4E31A 3QELA 4ECAA 1UAYA 4YJHA 2P9FA 1LRKA 2IYWA 5J4KA 2YHIA 1C4OA 3MMNA 3A1CA 3WGJA 3DZGA 4YA6A 2C9MA 1L3CA 2B8WA 4OSEA 1TZMA 3VYTB 4E6EA 1H4TA 1I3LA 1L5KA 1BFKA 1DEOA 3ZUGA 4G0VA 5TT0A 1H1TA 4HX9A 5F9MA 1N0HA 2PKYX 3CRVA 4X8HA 3DMGA 3OEHA 1ABFA 3ZD7A 5DSTA 3OHPA 2HFKA 1EVJA 4BWYA 1OY1A 4H9GA 1CQZA 4HDKA 4ZI5A 2QY9A 4RA9A 5FNVA 4DG5A 1O96A 4KSBA 3QBVA 2HB6A 4LC0A 2IZ1A 5I9MA 4ZCIA 2LVBA 2ZJ8A 1NR5A 1OTHA 1QAQA 2CXNA 1IJBA 1BN7A 2HRCA 3SHVA 4B82A 1DC7A 3COJA 2ZUEA 3S4YA 2XKKA 3A28A 1P5ZB 1DKRA 1E2IA 3PQ5A 3RU2A 2ZI7A 1CG6A 4P81A 4TYNA 2JHGA 3WSWA 3A9TA 4LA4A 4GYYA 2NMVA 5KREA 5EMKA 1NBOA 1RQ2A 3K9GA 3WLEA 3Q2KA 3LPLA 1CUFA 2OBBA 2PGNA 2B7CA 1LQ2A 4J0CA 1S8FA 4RGBA 5D2CA 3X1WA 3T7AA 3LTEA 3JARB 1JLHA 3M4ZA 1J7JA 1GAEO 2A35A 4LGVA 1SGWA 5TPZD 3T4UA 2OKGA 3F90A 1CHNA 4LN1A 4E4TA 5F23A 1EHCA 1VE7A 3QVSA 4L8VA 1H6AA 1LH0A 3M8KA 4IFEA 1K86A 1QOZA 1GNLA 1W76A 3IVXA 2I78A 1XD9A 4F0JA 3HHEA 5DH9A 2DP4E 3QWIA 4RPLA 4ZOAA 3WL5A 3WLNA 3DOIA 3ZDRA 4DCCA 2WG0A 5E95A 1PR1A 4G9GA 4P7GA 5L6LB 1M5RA 5FUBA 2ZBDA 3QF7A 1UKBA 2EJTA 2FW9A 3HSSA 3ESBA 3M83A 4LGYA 4L6AA 4B4KA 4YMVA 1TCBA 4A2QA 4KWCA 3C15C 3IJEB 1A4XA 1IVSA 2HMVA 1XZEA 1AA6A 1HZJA 4U6NA 1X1EA 1NASA 3HR8A 4CMBA 5JE8A 5HVNA 1PEYA 1IY2A 2CDRA 3BRCA 2IXFA 2VDPB 1IMJA 5TARA 3SZUA 3TPZA 5CURA 5JR3A 1JLKA 2HGSA 2V6IA 4YCAA 2H5IA 1NURA 2LBPA 3EUEA 3LY7A 1E7SA 2F43A 2QDKA 3ENQA 1WUKS 1ULSA 2G9ZA 5FL7D 4KNVA 4GZMA 4HJRA 2QD2A 4TKZA 1GFZA 1UAAA 3A7DA 4CW7A 5DIZA 2C3YA 2LDBA 1JI3A 1DBIA 1J8QA 3THYB 4POOA 1L7VC 2OTCA 4Q3OA 1OAOC 1BD4A 4LSMA 5JCOA 1EXVA 4NFHA 4Z4QA 4F5YA 5HSGA 4LNUB 2HQ1A 2J7PD 4KO4S 2YJ3A 4NNOA 1XCOA 1EZ1A 4Z8XA 4C20A 4WFJA 1YFZA 3M82A 4P1ZA 4TGLA 4V24A 3FKSD 3ZD8A 4WOCA 4ZO6A 5T4BA 4ASUD 4Y1RB 1HXHA 1F3LA 1K8QA 1LV7A 2XMPA 1PTJA 4QSHA 5JWRA 1EVYA 5HGJA 5CW1A 1JR3D 2WHXA 4QBFA 1C4WA 2C96A 4M8LA 5IK2D 3A1TA 4MKXA 4Q1CA 2HW8A 1E3QA 2C8LA 4FJ2A 4AN4A 3IMFA 1CFJA 3NEAA 3FHCB 1PGOA 3AO0B 5ALHA 3TSCA 2A67A 1AUXA 2L2QA 2JBWA 2QT0A 3ML1A 2Y1CA 3OQPA 2Y1WA 3GZTB 3I4LA 3KDAA 3QVXA 4KAXA 4ALMA 4HB0A 1CUHA 4Y6GB 4D57A 5EUMA 1KU0A 1X7ZB 4XGKA 2IHJA 4URFA 1DXOA 1KI6A 4O1HA 2WWYA 1V9SA 5ADHA 2NADA 2A9VA 1C9JA 4RM2A 3EDYA 3MTDA 3PUJA 1DBRA 1YTUA 1QZZA 2YJTD 3DVSX 2JRCA 1NJFA 1KS2A 1FYEA 2YJGA 1QS0A 1PWXA 4W5TA 1QPBA 4R81A 4TT3A 4KXQA 4PVDA 2ZSKA 4PQEA 4ER0A 4V1CA 4WECA 1MJFA 1OF1A 4E13A 4GP6A 4MA0A 1TTTA 3ZTTA 2WSMA 3PL1A 3W4KA 2NUPA 4R68A 1JIJA 1CJKC 1E60A 1QXSA 5I9SA 2Q6OA 1OW3B 5DGHA 2NNWB 1T2CA 3IKLA 1NBHA 3K5IA 4RMIA 2QP9X 2RGUA 1M1NB 3KJXA 2DPMA 1U8AA 1BS2A 2JFYA 3MJ4A 3OQ1A 4N8SA 4XB2A 2H1CA 2XUIA 3TQHA 1QG2A 4BAUA 4FBGA 3T9AA 3UQZA 2JZCA 2H2GA 3C4QA 3VZPA 1UBUS 1ADGA 1UM9B 1LX6A 2LRHA 1CIVA 3O03A 2FEOA 5EP4A 3VU9A 3AXSA 4UBNA 1DARA 1PJLA 3SS9X 4O8CA 2IH2A 1V25A 2FPIA 2X1VA 4XQCA 3V6MA 2XNCA 2FX5A 3BREA 2D5CA 3HLKA 3ZJ4A 4BCDA 1XIVA 1T1JA 1UQRA 2XE4A 3DP7A 4HX2A 4NCXA 3EMKA 3ZV5A 1R8YA 5AUPB 5KJ1A 1GPYA 1P19A 1VIDA 2FI1A 3UXMA 1DTEA 3K8OE 4UBOA 5FAKA 3HFRA 4RVNA 1DCKA 4FR2A 1YQQA 4E0BA 1KBZA 2EVWX 2P7IA 2AXQA 4IH9A 3UGQA 1FBTA 1TKCA 4IVNA 1GQYA 2REQB 3ZZMA 1OH6A 1NL3A 1XOIA 2CLCX 4QYIA 4JQSA 3D7KA 4WV3A 2JH8A 4BFUA 2H9IA 5C8YB 1T10A 4MGEA 4FYVA 1N36B 2DPLA 1C29B 3N2ZB 3P0JA 2XI4A 1LRLA 3I0NA 1JDTA 3IAAA 1YQGA 3ORFA 1QGED 3ZYCA 1B42A 2G06A 1U9IC 2IY8A 4I6GA 5JVDB 1DMRA 3JRNA 3I5MA 4BATA 2J31A 4X3PA 1KF0A 1LX7A 2BTQB 3LO5A 1V41E 4BLTA 4CG2A 1NE7A 1N6LA 1PP4A 1ZG3A 1WPRA 3CRNA 3H3FA 3WWZA 1UQUA 4GHWA 1E9DA 3ELDA 5T3UA 1QWOA 5M3BA 4BVFA 4E5MA 5ES4B 4HR7A 2BWJA 3U0BA 3T3EA 5EXSA 5KSYA 1WW3A 1MH9A 2WHRA 3KFVA 4EG3A 3WIVA 2XT6A 1PS0A 1XHLA 4PXSA 1XG5A 2L82A 3LFTA 4HAIA 3QY9A 5ENZA 1Q7RA 1TZ2A 4FP9A 3U31A 3B3JA 3FY4A 2PQMA 3R3UA 4F11A 3F5QA 4G67A 2FN7A 3PYLA 3V1LA 4F6LA 4WVLA 5EESA 2MSWA 3T3GA 3VNUA 4L72A 4DM7A 3JSAA 5ECGC 4GGMX 4E5KA 3AEKA 1C0KA 3H75A 4P53A 4U2BA 2POCA 1U9YA 2MHCA 1NU8A 4KLNA 4CTMA 2YQ4A 5HUJA 1Q44A 3FAZA 4FKBA 5JCZA 2B3TA 1N0WA 3F9RA 2WJZB 4IHJA 3SC4A 1ES9A 4QRDA 3KQNA 4HFNA 2QB5A 1QFMA 3VU1A 4QFDA 1GRQA 5JD3A 4CV0A 4B32A 3EASA 2IELA 2VJAA 3TIVA 5MN6A 3QFTA 4F1JA 2MR6A 4CEIB 1UMCB 2PTHA 3TZ6A 4AJ9A 3NTUA 2G70A 4LWQA 3HI6A 3WIDA 1DKLA 5CXXA 1NE2A 1I3KA 3E53A 3GRRA 3WNCA 1HM5A 4UDNA 5CYOA 3B6IA 1Q7GA 1THTA 3URMA 2Z2KA 2IP4A 1V8FA 3D4BA 4OFBA 3LCRA 3SEZA 3GN1A 3A3NA 3ESDA 1Q1AA 4TKLA 5G4KB 5CCXA 4P3OA 1LJUA 1P2VA 5K2MA 4WZBA 3S40A 1GFWA 3GJXC 4CIWA 3MCTA 1PFUA 2QVGA 5HBRA 3T61A 1MRZA 1ZHHA 4J4HA 4ZYZA 3GRAA 3IKTA 2FZKA 1SCIA 4XLTA 2P79A 5AW6A 3TE6A 5KOHA 2QL9A 3TLXA 1PT9A 4L7QA 4YRBA 4TM7A 1UXJA 1F06A 5JS7A 5DTIA 3N8IA 1TVKA 1DJOA 3OKPA 1EK6A 3M6AA 4HNVA 3A3YA 3RBVA 5K5EA 4ZDKA 3VR4A 4V0RA 1C8LA 1U5CA 4HWKA 4IDAA 1MF7A 3DNFA 3ZHCA 3ZI4A 4DCUA 2R7LA 3DDSA 1ENOA 3KJZA 3X1YA 3AUFA 3TSZA 4PZCA 3QW2A 1CLEA 3M6XA 1N6HA 5IPFA 4S04A 4C6TA 4YONB 2CW5A 3LQRA 2EQAA 5FNVF 4XE5A 3NTXA 3TVDA 1AKYA 1JYEA 2GAJA 1Z7BA 2BONA 3WXBA 2E48A 3HL0A 4RH3A 5JAOA 3RS2A 3GXBA 5EI5A 1IZ9A 1AKUA 1IB0A 3B8HA 4NYIQ 4WLVA 5D85A 4BQEA 4UBLA 2PE5A 1J21A 4P93A 3R7BA 1QG4A 2YXEA 3P9PA 4TV8B 3UMGA 1WDKA 1V26A 2EJCA 2MYPA 3PWSA 2XVZA 1BH2A 5IJ0A 3ACBA 1JX6A 2WU3A 2C54A 4EKNB 3O90A 5DO9A 4BNHA 1O08A 3NP7A 4EJ2A 1P7PA 4R8SA 1DKUA 1QIGA 2PH1A 5GZ6A 3UKJA 1SVMA 4BFVA 3IP8A 3W5CA 3QX3A 1A9OA 2CJWB 3JXEA 5ALQA 2D1YA 2ZJFA 3KYIB 1YFLA 1SRRA 3NG1A 3L77A 5ICSA 3PL5A 1PUXA 4JKYA 4QFBA 2Q6IA 5AM0A 4AYWA 1KQGA 4GMGA 3SXJA 2IS4A 1R0ZA 4BEVA 3BXEA 1B8UA 1KE1A 2VPZA 1KK1A 4DARA 3EODA 4G23A 1E2HA 1FDOA 2BE7A 3MK31 4LY3A 4BXOB 1DI0A 4DR2B 1NAIA 2P4SA 4UAJA 1PDVA 1VOTA 2G6TA 2O6HA 1M66A 1V5IA 1PR2A 3LLUA 3QWAA 2QTFA 2V6JA 4MVJA 5EXXA 5TQ2A 1B1CA 1Q77A 2TSYB 4I81A 2R00A 2ZK7A 1HNWB 2BF4A 4QBKA 1N8NA 2Y66A 3HYTA 1P0QA 3RNLA 1MFZA 1Q0ZA 1Z6QA 2QP4A 1NC1A 2XRMA 3LZDA 5C7YA 1G1AA 3JV7A 3GEBA 2QY6A 3NBUA 2WD7B 3Q7QA 3J81k 2OVFA 5KWVA 1DGQA 1BE6A 2KBEA 5AW1A 1I2CA 3ND6A 3AYZB 1XAJA 3B2EA 2W2XA 3SQXA 2IHNA 1GG5A 4HDSA 4RTPA 3GVPA 1UZLA 1KIMA 3FPKA 3O6VA 4BJ6A 4DIMA 5JQGB 4AKIA 5JO9A 1C5KA 2QZSA 3ZQUA 3ZY2A 4RGVA 1KDOA 1ZNYA 2AIRA 3Q8WA 3U7HB 4UARA 4OKSA 1KS9A 4I9NA 4LJRA 2OFXA 3IPAA 4UNIA 1CUJA 2QUZA 4P3NA 3OF5A 1E8MA 5BSEA 4PCAA 4ARIA 1Q15A 1XZFA 3KNZA 3ZD6A 4MV7A 1SCBA 4QEKA 2QMOA 1OLSA 2WKRA 1JJVA 3IPYA 1GPMA 1EHIA 1KI4A 2AMVA 2ORIA 2ODWA 4N9WA 4C5CA 4HS4A 1W6RA 1T2FA 3LV8A 4LZJA 2FFJA 2IBSA 3HCEA 4GR4A 3BVPA 4A6EA 3EISA 5GJWC 5KQSA 1QP7A 4YAEA 4DBLE 1GAXA 1HDXA 1XDWA 3AVOA 3SJZA 4QBTA 1YJBA 1Z38A 3FCYA 4XX0B 4YJ2A 3R2JA 4N39A 2UZ4A 2I99A 4P33A 2M32A 4FSHA 4PC7A 1VHTA 4XSVA 5F35A 1T29A 4F06A 2FRXA 1IY0A 3ELYA 2GNAA 4OK6A 1K4KA 1ZIYA 2V6FA 3ZHRA 4KUEA 3U3XA 1B14A 2JIRA 3ZUPA 1WP4A 1TIKA 1Y5IA 2WFLB 4EHHA 3K6SB 1A88A 1AT1A 2PXCA 1E1QD 3SN6A 1NQVA 3BMNB 4OQQA 3D6HA 1XK7A 2VDUE 3DDZX 1LWNA 1L4BA 4CQLA 1YK1A 4L02A 4JI2B 5DN9A 1P8AA 2E21A 3RRYA 3IP9A 2Y3IA 4XDYA 3W5UA 4KO1S 1YMQA 2VXBA 2AX3A 5COBA 2XOXA 2EU8A 3JALA 3O82A 1P0FA 2VAWA 2IPMA 1FJ2A 3LU1A 4L2IA 4X61A 3SLGA 1UFOA 3PG5A 4BEJA 5AJXA 4RS4A 3SDBA 3EHEA 4ETNA 4GC9A 1DG3A 3M81A 1HLGA 2PEYA 2PMBA 2H2AA 2RHJA 3OLXA 1MORA 4TZKA 1N2CA 3ZIAD 3KLBA 2R8ZA 3GGJA 4GUAA 2X0JA 3IAFA 2E55A 3UKOA 1QG6A 5FULA 4IVRA 3WRVA 3HYCA 4E11A 1QR6A 1RAAA 3HVHA 4TKMA 4A91A 1SCDA 4WOKA 1Q6YA 3UW1A 2OBNA 3ESQA 3NP9A 3OX3A 4XGNA 1FFXA 3R7AA 1C30B 1SK8A 4QYWA 3AHIA 5DGTA 2GCOB 3UMMA 4U2GA 4RZSA 3NH9A 4DCSA 1SXJC 4BNNA 1W25A 2RGDA 4PLGA 4DUYB 1RWOA 1ILWA 1L5GB 3ZWAA 4PO9A 2CMKA 3OFNA 4QUKA 2BGJA 1NX9A 4UVHA 4EKIA 1V2GA 1QBGA 2CLDX 5FCDA 1LRJA 2WSSA 1X38A 2FPPA 3HFJA 4L5YA 2D8AA 3CT4A 4M8NE 4WKNA 1NQXA 3R7DA 4RZQA 3QFRA 4J0JA 3JVVA 2J45A 3TMAA 3OPXA 4YAKA 1MA0A 2H1VA 3A7EA 3RYCA 3DV0B 1ZD8A 1YZNA 3INYA 4IDOA 3VPBA 1TZKA 2ZAMA 3KSAC 1PRYA 2FZGA 3I72A 1EESA 4DMKA 4BPRA 3REFA 2ZCUA 2A1TR 2X76A 3NHSA 4GX2A 4Z0TA 3V2HA 3D6FA 3IR5A 1ORRA 1ONBA 4GBED 4UU8A 3KX2A 5GJVC 1VYUA 4HDNB 4BNGA 3B78A 1VL0A 3GT4A 3TG2A 1OLUB 2WKQA 4M7PA 2PVPA 3IAXA 3GA5A 4YI5A 2XXAB 4G0YA 2SHKA 2PH7A 1AF7A 2CXRA 2C0PA 3GFOA 1BDJA 1UPUA 2NQ8A 2LIVA 3KZMA 2IUEA 3AX6A 3ZXYA 5A6VA 3RUCA 1DQYA 4PRZA 1MB4A 2WMDA 2X5KO 2Z9BA 3EGXB 1KMHA 1UJMA 1RXCA 1YB4A 2ZBPA 3HCAA 3O3NB 3CKKA 4IIEA 3LKZA 1XTKA 4NQZA 3LSYA 2G8NA 2HWWA 4KE7A 1WX1A 3PUVA 4W63A 2PWBA 5I7AA 2PUTA 4KXLA 1IMOA 3F5DA 4H7DA 4J94A 4B6FA 1IBKB 1YCDA 4BKPA 3CHYA 1EX1A 4Z8YA 5B3KA 2VUHB 1XZMA 4PLYA 3RU3A 5BSTA 3TDNA 2I7CA 1AKVA 2HX1A 3ZGOA 1GQ2A 3G2LA 5EVCA 1MC4A 2WM3A 4CLRB 5JH7A 2HMSA 2C2GA 5LQNA 4WOJA 3PICA 1X80A 4E07A 3LDFA 5DYNA 4FNGA 2GHTA 4KX5A 5DCUA 5C51B 4EO4A 3C6MA 2NXEA 2IYXA 3JX9A 4MICA 5FL3A 3ANTA 1YR2A 1MW9X 5KOJA 3DLCA 1ISGA 1Z6ZA 2D2FA 2ECQA 5I4BA 4JMPA 1SR8A 2AFRA 4LE2A 2ZWVA 2CDCA 2G9UA 1W0KD 2DWPA 3DB1A 1VE6A 1G2PA 1Q7BA 3ENNA 3O95A 5FLXA 1UP6A 1A76A 2ZT6A 3DSRA 4RIHA 2BTOA 4EQ6A 1GV0A 3WWPA 5EVJA 1J1ZA 3U4HA 4W9NC 1JEAA 3V7NA 3MTJA 5EPOA 1P4AA 3GQBA 1JR4A 1UAGA 2FLWA 4RA6A 3VO9A 1FMFA 3N3BC 4LCEA 1M2WA 1DAOA 5F4ZA 3T0GA 3U9LA 5FV4A 3VSCA 1XLVA 4DIBA 3F2IA 4ZVNA 3PGKA 2PCLA 1T3HA 3H1AA 3R8XA 4MR8A 4EDFA 3DDOA 2RK6A 3MFQA 4DC1A 3F9IA 5ALSA 4O3MA 4GOXA 3QMVA 2LUOA 4U7TB 1KMIY 1VG8A 2HMYB 5TQ0B 1FL9A 2CL7X 3DT6A 5DEOA 3OQMA 1GQOA 1U5BB 4LC9A 5IDYA 4A27A 5CD9A 1N77A 4NZ9A 2AJDA 3D6NB 1UBGA 3L04A 4MV1A 4ZC8A 4MRSA 2C8VA 3EGOA 3OT5A 1IRXA 2ODTX 1IPFA 2G83A 5E0OA 5EZ6B 4MIKA 4M0DA 3KB1A 4C05A 3EC7A 5I9BA 2OAQ1 3V9PA 3WRYA 1A69A 3T9DA 3G2NA 4RMHA 3CQ9A 2IGBA 4PHTA 2X2FA 4LTMA 4YRDA 1QKKA 1D1PA 5AKKA 4AJJA 2E87A 4US2R 1WXXA 1I6WA 2VPQA 4V0LA 1LBEA 4PLVA 4U1RA 5TY0A 2OG1A 2OWEA 3FB1A 1ZOLA 1E20A 2PRSA 2B8EA 2DWUA 2IEBA 2ZJ1A 3KPYA 3OE7D 4N3NA 3RK4A 4CKCA 4AO7A 4ALKA 4EZBA 2YXPX 2OUIA 4Q01A 4ZT5A 5HMLA 4H1WA 1N2XA 1A9YA 3B85A 1MX5A 2CLIB 2J8ZA 5MGBA 1EDBA 2V5AA 4BNKA 1MJ5A 4HUTA 2ZGVA 3C97A 2HA6A 1PX2A 3P0HA 3EDOA 1AN0A 4R3NA 8AT1A 4R8MA 1RC8A 2HA5A 4WZZA 1XLTA 3UBMA 3HR4A 2AJLI 2N42A 3C3JA 3G0CA 4Q3LA 4FOPA 3L7OA 4HDAA 2CYBA 3SXPA 2G1PA 2G28A 3GGDA 1TKAA 1O9HA 4EEZA 1FVOA 4C6RA 1B0AA 4DB4A 1KL7A 1EQAA 1YRQA 3RANA 1AGXA 3DZHA 2RGNA 4RABA 4J3NA 4BV9A 2A5GA 4D6YA 2PO7A 2F1OA 1HDGO 1QC5B 1ZRNA 3OEEA 3TXAA 2ZUUA 2IKSA 3BQ9A 1FRNA 4O08A 4ZJZA 3VO2A 1Y9AA 2R25B 5BWLA 3IPXA 4Y2RA 2BV3A 2CMHA 3H1BA 2DSNA 5CFLA 2QPOA 2HRQA 2BJHA 3GUZA 3Q72A 2PEZA 1C3JA 1RIIA 2FZCA 2V7WA 4YP0A 4MZDA 2VVTA 2ZJ4A 2Q0SA 4LHXA 1G5RA 5HQJA 3NBZC 2XE6A 3H6GA 4JI6B 5BT8A 3LX4A 5LA6B 3UTCA 4A8PA 5BVGB 2HF7A 3M1IA 3OEWA 2VLBA 3V9AA 2UUAB 5I7WA 5JY1A 1MO2A 2EGGA 5I45A 5ALEA 5F1KA 2P77A 1NR1A 3UT6A 2AL7A 1Z13A 1LDBA 1GZ7A 1M2NA 1WHSB 3ANNA 3D2BA 1VB5A 4GLOA 4MW7A 4Q02A 5CDSA 3TW4A 3Q0EA 4B3GA 3LF2A 1U7OA 4ZAZA 3HCDA 3UEOA 2BFBA 3U5TA 3MGBA 1R4MB 4RACA 2X9QA 4I6EA 4M8IA 4O1MA 1KJJA 2PD4A 2XIQA 5T41A 3SE0A 3ZCVA 1CRQA 4HV4A 1XKLA 1MT0A 2IXDA 1VI2A 1XVAA 2XRFA 4KR2A 3ZWYA 3DDNA 3FPEA 2FA9A 3FF1A 3GAZA 5FTMA 1TLFA 4CEJB 4ABYA 1RAEA 4PG8A 1D8AA 1DQSA 2WWVD 3SBOA 3HBNA 4K81B 3UT5B 2C5EA 2J0EA 2PFGA 4EVRA 3I3OA 1ODIA 3MA0A 4LY0A 1YKFA 5AR1A 1USVA 2H8KA 3AL2A 1ZZEA 4DSZA 1AO0A 1GFIA 2C5GA 2F1JA 2J08A 3D8TA 2Z5GA 2CFCA 4NDZA 4CF7A 4JYZA 2WPDD 5E6SB 1YI0A 2Q2OA 2J0VA 2QAGC 4JU9A 3PJEA 5CG2A 3BDAA 4DANA 1XTRA 2R96A 1NPDA 4JJ6A 3QBTA 4BV8A 4F4HA 3RSGA 4FCCA 3SF8B 5IAAA 4NCAA 4L4YA 3TIXB 1FMCA 1NJ1A 2WU4A 4KQ9A 3TKYA 1QANA 4JJ8A 3TQSA 2HD4A 4RAOA 1RM3A 4DXDA 2GEDA 2GJ8A 2DUJA 1NDQA 1PT5A 3V7WA 4KU4A 1KYIA 2J0UB 4OYRA 5IRCD 1EFCA 2NZJA 4WBNB 1W6UA 2PQ6A 1QGYA 2QGZA 2FTKE 2DX7A 4II3A 1Y1TA 3CBQA 1KU6A 1WM1A 3E03A 4KFSA 4LXXA 3VPXA 1ULAA 1IPHA 1Y4AE 1QF6A 4EJ0A 3A6DA 3RH0A 3VH3A 2AG8A 3Q8MA 2NQTA 4GPEA 3PPIA 2VDRB 2RHOA 2IC5A 4KPGA 1V5FA 4OFWA 1ND6A 4WKPA 5LMCA 1J49A 2YV4A 1YJCA 4NZMA 2FPRA 5C52B 1T9HA 2H2FA 3GLUA 5DNUA 4PIVA 4HQFA 1K06A 1M7HA 2Q62A 4KRYA 1ZJ6A 3WYDA 4E7PA 3T3IA 3H8JA 4JX8A 2W0SA 1JIXA 1Y5LA 2BF7A 1G7CA 4XDZA 5FTNA 3AWDA 4XQ0A 4B4UA 2FRVA 3FCOA 1XRLA 1UMDB 2GLXA 3GRYA 1A5ZA 3R4VA 4S1PA 1R37A 1ECCA 1QJ4A 2X3YA 2O07A 3HSKA 3EDCA 3WG9A 1KK0A 1L7BA 1TA0A 4MGZR 4M37A 1LLDA 1BE0A 3K0EA 3N74A 4QDZA 2Z8XA 5H80A 5JY6A 4TSFA 1FQJA 2W6MA 1BVRA 1CJBA 1BJRE 2HLHA 3BSWA 3HDJA 3KZNA 1MLDA 3M0EA 5KYTA 3INTA 2XUJA 3G2IA 4RF3A 3DWEX 4CV2A 1DZ3A 4RLSA 5IT4A 1VJCA 1Z34A 2AJTA 3SHOA 5IAGA 3TSWA 1SCUB 4RM3A 2NW6A 1T3ZA 5A4DA 1KSHA 1TE2A 3DV9A 3N2GA 4JJ4A 2VZ8A 4DLBA 1VXOA 1I1NA 3L7AA 5DISB 1VKZA 1KH3A 3CONA 3OOSA 1YVEI 5CHYA 2ZWMA 2VJCA 2FLKA 3FGPA 3HA7A 3HXQA 4QM7A 2VYCA 2IVZA 3PHGA 3E9NA 4R0MA 4F5EA 2XY4A 4AMGA 2WQ6A 2ZYRA 2YIJA 5EHGA 1C1DA 4FFVA 1PV4A 1UK9A 2HBYA 3GBSA 1PR3A 2IZ0A 1PWZA 5FPKA 1F7UA 4W8OA 3DJFA 4LX0A 2F6RA 2XGMA 1D2GA 3KLMX 2J5BA 1E9RA 4AXXA 4NU0A 4OBBA 3IIJA 2H65A 3NBFA 1PJCA 3R7NA 1C9KA 4RK5A 4CMEC 3GLHA 5A04A 3FTNA 3UK7A 3H5AA 1TA4A 4O2BA 3TZEA 3KSRA 2HJ9A 2D8MA 3ZCUA 5LQRA 1WB9A 1M0TA 4J1TC 1QYXA 2ADFA 1ODKA 3QYPA 4WEOA 1ESNA 4MJ7A 1HQYE 4TX1A 3D8SA 1YQWA 2XX3A 2EKZA 2ZTUA 3LUKA 1EI9A 4RIGA 4KH1A 4MYHA 4QRHA 4AXBA 5JH7F 1THMA 5ALXA 4RS3A 1P29A 3G9UA 2ONYA 2FZ4A 3IX7A 3OX2A 5TF0A 1P2UA 4BMDA 4JXXA 4ENVA 1MAHA 5KNBA 3ENVA 2HZ7A 3L8FA 1YE5A 4Y9TA 1EVZA 1AY0A 2XJ4A 1WVMA 2OR3A 1LC0A 3VSBA 4HWGA 3O47A 4JB2A 3V1MA 2MR5A 4P86A 3CLHA 1URPA 4OP1A 1L4UA 5JC1A 2VJLA 3PD7A 1R8QA 4IGAA 1AKEA 3OIUA 3L01A 3NRBA 1ANKA 4C4ZA 4JKOA 1T3TA 1LU9A 1H6BA 4YCMA 2GS9A 4W82A 5TB5A 1HGXA 4GL4A 1QHNA 2JCVA 5BV1A 4A03A 3ZXXA 1G20A 1KNXA 4G85A 1OI4A 1H2HA 2QX9A 4MH0R 2WLTA 1QK5A 4GH5A 2GPYA 1OV6A 2VQ3A 3E3NA 4GZLA 1WW2A 1KZYC 3KHSA 1YR9A 3KTAA 2AZTA 2BFDA 1FW6A 2DCUA 3AJRA 3OM1A 5DBIA 5LLTA 4G4GA 2E5WA 3AF3A 3PYMA 1U3DA 4OQNA 5AMXA 4BE9A 4BMSA 1JR3E 2V4MA 4ZEMA 3UMFA 3FCAA 3ICQB 3ZKAA 1ESDA 3TQIA 5H9WA 4P0TA 4XD2A 1JU3A 3IVMA 2GSDA 4IO0A 1NKVA 2AKYA 2ZI4A 3CPJB 2NU8B 3U7JA 5LQKA 3OJWA 1RP7A 2C2OA 1K88A 4LV5B 1L4NA 1SVUA 4E09A 2WNHA 2WTUA 2HN9A 4J29A 3MWDA 3T12A 5AVWA 5AVTA 5JAMA 1DOHA 3JWJA 5LQJA 3F3KA 1YJ5A 1P7ZA 4INJA 1GG8A 1K08A 2HSGA 3C5CA 5JS8A 1Q74A 1IM2A 3KEFA 4CU5A 3H3JA 1EX7A 2INGX 3N59A 1MDBA 3QUQA 2E18A 1V39A 3W5VA 4DJJA 3BCUA 3JR3A 1ML4A 1ESEA 1Z4IA 3H2YA 3TIIA 4CG1A 2ZR0A 5BW8A 1E79D 2F9MA 2QRHA 1ABBA 2IH4A 1CP2A 1Z75A 4YMSA 4ED9A 4NICA 3RWBA 1SBYA 2G8LA 2WT8A 3W1WA 5IW8A 1WF6A 3ZDQA 4NP6A 5EE3A 2VRCA 5DZSA 5C4GB 1X74A 1CS4C 1HYHA 2NSDA 3A9UA 2X0RA 1JAXA 3D5TA 3IEUA 4PGMA 3NTVA 5BWNA 4P5DA 1KEUA 3K1AA 4N5HX 3H16A 2LCQA 5GONA 2APJA 3NGMA 3KQUA 1E6WA 2VHWA 3FX2A 2PV0A 3GLIE 1A8UA 2FMFA 1E3LA 2Q1YA 3KL4A 3L2OB 4EMUA 2FW0A 1NVVQ 5CA1F 5IABA 2RKWA 3C7TA 3ED5A 4BQIA 5B4TA 1Q3KA 4PBRA 3I23A 3KQHA 2KYRA 5EJGA 1QH1A 4N5DA 1U31A 5K3OA 3OEHD 1SQ6A 1XE3A 3LBNA 4F1WA 3RG2A 4CNQA 5BQ5A 4BNDA 1NMSA 2IU4A 1XNHA 4NE7A 1CIJA 1ADBA 3MOSA 2VPTA 2IIBA 4OK5A 3UHOA 1SVKA 2ZIAA 2B1RA 3YASA 3RU9A 2ZTLA 1OBFO 2FKAA 1EFAA 1QAMA 3HJBA 4OEHA 4G8DA 4RQBA 4DIFA 1QPZA 3LX5A 3B3FA 3BTUA 1GCOA 3GRCA 1IY8A 1KFCB 3IMCA 1A8PA 1T35A 4KYUA 5BR8B 3PGJA 4HJXA 1JLLB 4X95A 3JVEA 1QH9A 3ZWKA 3L0YA 4GSLA 4G8BA 4MZXA 1LPMA 1KGSA 4IDPA 3SLKA 4RELA 5JSFA 1MAWA 4QGFA 4HH0A 4U00A 1LFDB 4F9EA 1UWCA 3Q7PA 4G0XA 2WF9A 4D9NA 3CYFA 1YZTA 1EP2B 3RSOA 4E2WA 4EABA 2VNKA 1H6DA 2PKQO 4FE7A 1NP6A 3IMGA 4WHMA 3AUAA 3ME5A 3N6VA 5LBUA 2IF0A 1ZP6A 5EZ5A 4LOJA 3SIRA 3C6YA 4A6XA 3J7AC 4BBAA 4ZK6A 2B8TA 5JEEA 3B36A 2BGMA 2NYRA 3MRTA 4KFTA 1F4VA 4GBGA 2CCJA 4HH1A 1WQ3A 2QMYA 3DDHA 4GLJA 4N5NA 2EHJA 2C2HA 2QKYA 2W6ZA 3I12A 2AE2A 4J3JA 4E5VA 1CSEE 3N0XA 3RRZA 4B3XA 3FFWA 3ZHYA 3IULA 1OREA 3DCYA 4YH1A 2C92A 3GK3A 3NTLA 3I30X 3G49A 3MTIA 3WQBA 2WWFA 4UAGA 2B82A 1YL7A 4RZ3A 3L6BA 2WJ4A 4G0ZA 4LK3A 2ATXA 4TTPA 4MW1A 4NESA 1CS0A 5HILA 2CT8A 4XIJA 4TL9A 3KZXA 4Y6QA 4B73A 4Y2XA 1TDJA 3M6WA 4AG3A 4RY0A 4K03A 3T5CA 3T1TA 4REMA 5AVKA 4GX1A 3PHCA 4DKXA 1MX9A 4R6WA 4R2IA 3QPDA 1N1MA 3QKRB 5F7JA 1GZVA 1HEUA 3NFRA 3SP1A 4EPYA 4GDFA 5IXJA 3UHFA 3VSEA 2ZUBA 5HM6A 3VTAA 4D97A 1ISPA 1U4NA 1UKYA 4BWFB 3MGKA 2OYRA 5FUMA 1RC0A 2ZYIA 3CURA 1CNMA 1HDRA 3CF4A 3PR2B 2UZ1A 2QXTA 4FGKA 4WJZA 1RJ9B 1BQEA 2I4RA 2XDWA 4M9QA 3ADPA 5FYDA 2VBGA 1L8XA 3L6RA 3NH6A 4DZRA 1TECE 2Z8YM 5EIAA 4HNGA 5K8CA 3H2IA 4BTVA 1CZHA 3Q8XB 4PHFA 2Y6UA 2QPAA 4I14A 2QP3A 1GQSA 3E05A 4JGBA 2WK1A 2G17A 4I0WB 4G5QA 1X9GA 2V45A 2DY1A 4ZGBA 2P67A 4W5OA 3HRKA 3G5AA 2C2BA 5E6RA 2XMRA 2NUTB 1DL5A 1QDLB 2K87A 3U4AA 4WJLA 5HUHA 2OM6A 5J2UB 5K6TA 2GLUA 3GIDA 4RZXA 4WEQA 1SC9A 3SXUB 3D8BA 3NWOA 2OWDA 3PNSA 6Q21A 1YI8A 4NCKA 1Y3DE 3BXFA 4EB6A 5BP7A 2P90A 3D5QA 3NTQA 4OFXA 5JJKA 1U3WA 2PPVA 1ZN7A 2GESA 3LSTA 2CDNA 4QEZA 2C42A 2IPNA 1QRAA 4FDVA 4Y2YA 4LZAA 3FA2A 2YFYA 1GOTA 4KTVE 3NFYA 1UEJA 1I80A 5HBGA 1H94A 4KQKA 4WUVA 3OQNA 4P4SA 2M2IA 4UHBA 1T8TA 1SH7A 4TT3D 4BMXA 5IH7A 3AKEA 3OWHA 1RIFA 3PENA 4ZOLA 2OCXA 3RC7A 1NVKA 1S4QA 2OHFA 3QBEA 1E64A 4HGNA 1IOZA 4QLOA 4QT0A 2BGKA 4XGIA 2VTDA 4Q24A 5IM4A 3PEVA 2I9PA 2HO4A 1D7AA 1OFTA 3E58A 4EA8A 4F84A 3EVBA 4XVRA 3TLKA 5IFKA 1IN6A 1NXOA 4D4LA 3P9QA 5EEGA 2OFFA 5L3QA 1K8XB 2AHRA 4K3VA 3D0OA 4BB5A 2GVZC 3L5OA 4OQEA 2XNKA 1TGYA 3PKIA 5AIBA 2OUKA 2DQKA 1XQ6A 3H1TA 2FPLA 4IDHA 4MPTA 3T1HB 5F2NA 2O0MA 4Z4EA 2QXUA 2C3OA 1JFLA 1RYZA 4XR4A 3JRXA 1EGVB 4QXAA 2EBWA 4CUKA 2DC1A 3ZNQA 1EP3B 2XCSB 4XB1A 1GV1A 3GCWA 1OBOA 4G36A 4EF5A 4YACA 1SC3A 4KGDA 4EUNA 3O3MB 4W99A 1V48A 2AOUA 3TNJA 1BDIA 2YXLA 2I33A 1GM5A 5ERYA 2VF5X 1E9SA 2H1RA 3JQQA 2FSUA 3MWGA 1YKGA 4INAA 5JSKA 3W2TA 2RBEA 1QIHA 4M53A 4JBWA 1W36B 3GJTA 3HR7A 4DV3B 5LC1A 1ECLA 4O2BF 4ZAYA 4MUHA 4HGZA 3TR5A 4R2XA 3SOZA 1P9WA 3ZDXB 2IWRA 3T3HA 4ER7A 4A36A 2PZKA 1GXSB 1KVQA 1SIWA 2R5FA 1WXIA 5AHRA 5JS6A 1QZ3A 3DMFA 4Z9AA 3BTSA 1JTVA 1PJ8A 2PCJA 3DLIA 3ETEA 4DR5B 3G23A 4LZWA 1BDBA 3RSFA 3IVCA 4Y2QA 1HK7A 1NKSA 2V98A 4JL5A 1WDWB 1I4OA 2QZZA 4M21A 4EHLA 3ZY4A 5KKCA 3L8YA 1M1YA 2IEZA 4UJ5A 5GAJA 3ZBPA 4HEHA 1P75A 4GI7A 3AIMA 2XTJA 2JFFA 4WXHA 4WCFA 1T0HB 2XXBA 3R6GA 2R87A 3LYUA 1OZAA 4LOHA 4MITA 2HREA 4KXNA 5DHSA 1GZUA 2V97A 1K6XA 3DVQX 2XQKA 1XQWA 3DBHB 4BO2A 2D1FA 1DAPA 2YINC 1JG4A 1MABB 5EIWA 4BFLA 4IGFA 4EYGA 2J0QA 3KTFA 3DM9B 2QMUA 3OJOA 2YOFA 3DZFA 3IRUA 5T6BA 1NLZA 5KYYB 3E2MA 5DNEA 3EY4A 3HM2A 1PK9A 2XQVA 3RD5A 4HFMA 4RPIA 1CVLA 4LVCA 2WIAA 4R16A 2VYFA 4RLFA 4DA7A 1NQWA 5J47A 3DBRB 3MGAA 1NJ2A 4DT1B 4L15A 5AICA 1CHDA 1SVSA 1Y4ZA 5DDIP 1A9RA 1PQPA 2PUJA 4NK4A 5KJ6A 5BYAA 2C4KA 1U7UA 1QE0A 3EFOB 3ND5A 4ZEXA 2WYUA 2WHEA 4B74A 2BFCA 2AFIE 5AJZA 1JLSA 4H4EA 1P9OA 4JD5A 4XSGA 4DA0A 2K4MA 1YBMA 3JQAB 1T3GA 3TLGA 1UDXA 2WJYA 4WESA 3RAPR 3ZIUA 5C1BA 1JTEA 4KGVA 4BQPA 2CLKB 2XWBF 3DFZA 4LSZA 2AR0A 4ZT6A 5LBIA 3FOEC 2CV0A 2EQBA 4NV3A 3GFQA 5HA5A 1GILA 1YMVA 4FJ0A 3BIFA 3PFIA 4FI3C 1DRUA 2NP6A 1A9TA 1Z25A 2C7QA 4GC5A 3I01M 4FB4A 4EQZA 2Q5OA 2BGWA 3QTTA 1T8PA 2M98A 1YHNA 4JEMA 2J9YB 1C7JA 3DDUA 1J25A 2H4WA 2QVXX 3AZQA 3RTDA 3GLTA 1JJ7A 3DF9A 3F8WA 1E6MA 3QKTA 3BIJA 3BILA 1Y7HA 3WLAA 2SKCA 3ZLUA 4AKHA 2HRZA 4JP2A 4PLWA 3CX8A 1AN9A 1EP1B 2W2LD 2Q7DA 5AI5A 4BVEA 3TRIA 4WASA 2JI6A 1IDN1 5CXSA 1NRWA 1LA2A 4PGHA 2ZKIA 5LXTB 3VDNB 4BOYA 1XVLA 3U3ZA 3DC7A 1X13A 1YR8A 2IW3A 3C14C 3FN4A 3NBYC 4KTTE 2VJMA 2EAUA 4CM4A 4BGEA 1CDOA 1CX9B 2C0CA 2EJBA 1H65A 2Q5IA 4X44A 5DV9A 3KJFA 4M1WA 3WFJA 3G1TA 1L5VA 3EXG1 3VR4D 5LZ5A 2MYNA 3RQIA 4HNAB 2FLVA 2Q1TA 1JEQA 3QUTA 1JL3A 3E84A 5JALA 3HKCB 5CB0A 1VB3A 2RARA 4K26A 2Q0HA 4ADSG 2CVPA 3HBLA 4NBSA 2BM8A 1KZ9A 4XYLA 3JQCA 4I55A 3RCBA 3G6WA 2ADMA 3R1IA 2DQZA 2PSFA 4L8WB 3C3AA 5D3MB 1SBTA 3FPGA 2BEWA 1OAAA 3ETJA 4PNPA 4GMXA 3I8SA 4RQUA 1YSCA 5GV7A 4JJIA 4AY2A 4C2UA 5AYVA 2GAOA 3EPKA 5IJXA 4MW6A 1L7NA 2WQ7A 4MUFA 5LD2B 3HE3A 3OF2A 2CNOA 3UHJA 5HIKA 1NF3A 4PQYA 1P1IA 4DLRA 4EHIA 4DPKA 4MUGA 5JRJA 3B51X 3FOAA 4LTNA 5IDVA 2H08A 4JP5A 4PEVA 3PX3A 4R54A 3VVLA 3F6SA 2PQ2A 4JLPA 1VL6A 1D8TA 2XUDA 3H5IA 1IAQA 3WWYA 5KTNA 2IOFK 3WDMA 2FSVA 2PZLA 1JUDA 3RHSA 4EP1A 5TJ9A 2P41A 4J76A 4N0QA 1DJMA 2F3RA 4MUBA 4BIIA 2VT3A 3KYCA 3QHAA 3C24A 4IDGA 4X6YA 4ZDWA 1MH1A 4KNWA 5BUSA 5CIYA 5TLSA 1WZCA 3HJGA 1Q83A 1PZHA 1V8OA 3EY9A 4GI3A 3MOGA 4RSHA 2X5NA 3TJZA 2PZFA 4FJ1A 4EUSA 3GB9A 2V4UA 3ZNNA 3F5FA 2QG9A 1SO8A 1ZW6A 1UKEA 4XIFA 1G9SA 3OWXA 5FQOA 3TBHA 4MVJD 3TTUA 3B3QA 3DOHA 3FKJA 2P3OA 2X19A 3O2NA 1FDTA 3MT8A 4Q7KA 4F2HA 1JKMA 5JXJA