4XCXA

Methyltransferase domain of small rna 2'-o-methyltransferase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
216
Chain Sequence
QFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGVDINEDKLRWRGDSLAPFLGDFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSGDLARFPEVVFGYLSPSMIVISTPNSEFNPLDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPGAENVGYCTQIGIFRKNQHDQHVYKAVFTTSYPSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Small RNA 2'-O-methyltransferase
publication title Crystal structure of human C1ORF59 in complex with SAH
rcsb
source organism Homo sapiens
total genus 63
structure length 216
sequence length 237
ec nomenclature ec 2.1.1.n8: Small RNA 2'-O-methyltransferase.
pdb deposition date 2014-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4xcxA00
1VP9A 3A7DA 3FPEA 4FT4A 1KPHA 2GA9A 3KPJA 3Q7EA 3SR4A 1KPIA 1SQGA 1IM8A 3LPMA 5EG5A 1BKYA 4JXJA 4HSGA 2P3LA 3A7EA 3KHKA 4OA5A 2AN4A 5E1OA 2ZULA 3KU1A 2ZW9A 3NW9A 5DX0A 3BXOA 4HH4A 4PYJA 5G02A 3RIEA 1RI4A 1X1DA 2BR3A 3GU3A 4C06A 2I6GA 3OU2A 1AV6A 3PX2A 5F2NA 4HC4A 3JWHA 3PB3A 1QAMA 3PFGA 2OYRA 1QAQA 3EEYA 5GP1A 3RODA 5GINE 5KQSA 3D2LA 5E8JA 5DTQA 3S68A 1SG9A 4WVLA 2PWYA 3EVCA 2GPYA 5EC8A 4BP1A 2XBMA 3CC8A 3MCZA 3MGGA 3BGDA 3LCVB 3DMHA 2V74B 3LKZA 4RX1A 4PGHA 2OPBA 3KQMA 4AZVA 1NBIA 3TOSA 1RJEA 1NV8A 3TPZA 4XUEA 2EFJA 1VQ1A 3CJTA 4GC5A 1O9GA 3FYCA 1Q0TA 3QOWA 1KP9A 2PLWA 4GOMD 4PYNA 3R9XB 2PGXA 4FGZA 5GM2A 3V97A 3HCFA 3G5TA 1ZQ9A 3TRKA 4RTQA 1XJ5A 2BM9A 1EJ0A 3Q87B 4X1OA 5EMMA 3EEOA 5EGSA 4KVZA 4CKEA 4R8SA 5CCBA 3ELYA 3BGIA 4UOEA 5C9ZA 3G5LA 3LHDA 4QDJA 4ER6A 1X19A 3NMUF 1XCJA 3LBFA 4OA8A 3P2EA 5EMLA 5DM1A 4GUAA 4RV9A 1NKVA 2IH5A 3FPFA 3OZTA 1SQFA 4GOLD 3G2PA 3H2BA 2CWWA 2I9KA 4ER0A 5CVJA 4M36A 3E05A 1R8YA 5CD1A 3DLIA 4PIMA 2ZIEA 3AY0A 4M38A 1UIRA 2PT9A 2ADMA 5K0GA 3HCAA 1P1CA 2NXCA 5HIIA 3UBTA 2P3QA 1ORIA 2JJQA 2O0LA 3LCUA 3GCZA 3HVHA 4HRAA 5DM2A 4HGYA 1U2ZA 3LDGA 3LL7A 4IKPA 3C3PA 2PSSA 5DTMA 5EEGA 4PONA 3C3YA 3EVGA 3HTXA 5D1HA 5C1IA 2IP2A 3CKKA 1R18A 3FPJA 3EVAA 2PV0A 3GO4A 3I58A 5EIWA 5EMJA 4Z2YA 2R3SA 2PXXA 3FUXA 5JR3A 4FZVA 4AX8A 2IBTA 2ERCA 2BM8A 1QANA 4E2WA 2YUIA 3CCFA 4EKIA 3TLJA 5K0FA 4ER5A 5BW5A 1FJXA 3FTFA 5K0CA 4RTRA 3HCEA 5HOQA 5EKXA 1VL5A 2ZFUA 1UFKA 3UJDA 5DXAA 1BC5A 1L3CA 2ONYA 4M37A 4RSRA 1JG3A 3PT9A 5FHQA 2JG3A 2GS9A 1VPTA 2HMYB 1L3BA 1YF3A 2ZZMA 2O07A 3GIWA 4LWOA 5B1SA 1WZNA 4YV1A 5K0BA 1DCTA 1G6Q1 3CJQA 2Z6AA 2XYVA 3G2OA 2ZBRA 4IV0A 3UWPA 5EMKA 2ONZA 2AN3A 3DH0A 5DRYA 1ZGJA 4CTKA 4DQ0A 4DKJA 2Z6UA 4OBWA 2KW5A 4E32A 3M70A 5BW4A 3EVDA 3EVEA 2G72A 4FS8A 4RTJA 1NE2A 3FUTA 5GIOE 4PYMA 3WSTA 2H00A 5D1NA 4HTFA 2E5WA 2UYHA 2IIPA 2CKDA 1X1AA 2VS1A 4C4AA 3HVIA 3NJRA 2XVAA 2YTZA 3F4KA 3GDHA 3KPVA 3DXYA 4XUCA 1Q0SA 3M6UA 5FULA 2ESRA 3LECA 1PRYA 1L3IA 4LWPA 2F8LA 4QTTB 5ICFA 4YMGA 4V0RA 2G71A 2P7IA 3TQSA 2NP6A 4HG2A 4PGGA 4MHTA 3CBGA 3R3HA 3DXZA 5CVEA 4DZRA 2H11A 3KKZA 3KR0A 1Y8CA 2WA1A 3ELUA 5FUBA 5CCXA 4GF5A 3QOXA 1V39A 2FCAA 3FPHA 1QYRA 1G38A 2CMGA 5FWAA 3UJ9A 2ZIGA 2P1DA 3DXXA 3MHTA 2NP7A 3HNRA 4ER7A 2P35A 3FRIA 2BH2A 3SM3A 1WXWA 5LQJA 3OZSA 2ZCJA 2AOVA 1JR4A 2ZTHA 4C05A 3HP7A 1OR8A 1I1NA 1EG2A 2AOUA 2AOXA 3ME5A 1R8XA 1VP3A 1YFJA 1MHTA 1WY7A 5CUQA 5EOVA 4EVIA 1QAOA 2ZIFA 3ANXA 4XUDA 2OB1A 4G56A 4HGZA 3T0IA 3UFBA 2XYRA 2ZSUA 3X0DA 4RTKA 1ZHFA 3DMGA 3GNLA 3R24A 3P97A 4PYQA 1NV9A 1ZG3A 2OO3A 2UYQA 3GWZA 5EKUA 3PVCA 2C7PA 3T7RA 3ER8A 1TW2A 3BT7A 5DXJA 3JWJA 3KQPA 2Q41A 1DUSA 5ERGB 4C07A 3TM5A 2JHCA 4RTMA 1L1EA 3LCCA 2CMHA 4CKCA 3VC1A 3UJBA 2ZZNA 3NVMB 2ZWVA 5KS2A 5MHTA 4KDRA 1QZZA 2YQZA 3IHTA 5HILA 3UA4A 4GQBA 1VLMA 1WG8A 3GXOA 1VE3A 2IPXA 4BLWA 3E7PA 4YUXA 5BP7A 2PT6A 3A4TA 3DULA 3KPUA 4QQNA 1T43A 4A6DA 1NW3A 4L7VA 1KXZA 9MHTA 3THSA 3E8SA 1F3LA 1IY9A 1NT2A 2PWPA 4PINA 5EHIA 4YMHA 2PX8A 2HV9A 4LECA 3OE4A 3LSTA 4NECA 2EX4A 5CM2Z 3UZUA 3ELWA 2EJTA 4RTPA 3JWIA 2VZ9A 3SSMA 1R6AA 2DPMA 2AN5A 4RTLA 3A27A 4E2XA 1BHJA 3EGIA 3T7SA 4RTOA 3MAGA 5LQRA 3NWBA 2IH2A 3TFWA 1G8AA 4MTLA 3B5IA 4F85A 5P8WA 3BKXA 1H1DA 2B25A 2YXEA 4P7JA 4RVHA 4Y30A 1KIAA 5FA8A 1NBHA 2AR0A 3SSNA 1N7IA 3A25A 5T67A 4QPNA 4PNEA 3DMFA 4E2YA 2FYTA 3M6WA 3FTCA 1TPYA 3FRHA 1RJFA 4FR0A 1KPGA 5FQNA 3EMDA 4BLUA 2PX5A 1X1BA 3G2QA 3G89A 3KR9A 1HMYA 3KQSA 2ORED 4HTFB 3UA3A 4H0NA 3AJDA 3HM2A 4PYLA 5DWQA 5DSTA 2PY6A 2OY0A 5FCDA 5K03A 1O54A 2O06A 4R6WA 4RWZA 1R74A 3B3JA 3HA3A 4DM3A 3G8AA 4EQZA 4ER3A 1P91A 2NXEA 1M6EX 3I9FA 1N2XA 2UYCA 2IFTA 2DULA 2G1PA 4RYLA 7MHTA 3OPNA 1JTFA 4QVKA 2ZWAA 2ZVJA 3DTNA 1VBFA 2P40A 3AWIA 3MTEA 4GOND 5E2AA 5EVJA 1JG4A 3KQQA 1AQIA 4IV8A 5HFJA 3L8DA 3SGLA 5F2OA 1KYWA 5H02A 3KR2A 3GRZA 3DUWA 3IYLW 4RVFA 5HZMA 1MJFA 2ZBQA 3ELDA 5LQAA 4OBXA 1JQ3A 2B2CA 4FSDA 4OX9Y 3KQVA 4U7PB 2PVCA 5FWDA 5E1DA 5F2KA 4PCLA 2BR5A 2PXAA 3K0BA 3R6TA 1VIDA 4AZSA 1SUIA 2UYOA 2EG5A 2PX2A 5DT2A 3SMQA 3M6VA 3OFJA 5DM4A 4E2ZA 2AS0A 2AOUB 2G8NA 5FADA 2QY6A 4GBED 5IKMA 5FHRA 4GC9A 5LSAA 2UZ4A 4YUVA 2B9EA 3HCDA 5EPEA 5K0LA 2CL5A 3O4FA 5ICGA 2EJUA 3AXSA 3EVBA 3P9NA 4IWNA 4RTSA 5GM1A 2OZVA 4E31A 2IH4A 1PJZA 2WA2A 2HNKA 3RW9A 3PS9A 3U81A 5KYGA 4RVDA 2P7HA 4GOOD 2C7RA 3IV6A 4QVGA 1DL5A 5DTRA 2IBSA 3EVFA 3P9KA 3LDFA 3ERCA 3NDIA 8MHTA 5E9JA 4F84A 5LQNA 5HEKA 1D2CA 1EAMA 2ZLBA 1FBNA 4DF3A 2BR4A 2NXNA 4PIPA 2FRXA 2VDWA 4PYIA 5CVVA 5HIJA 1XTPA 1IXKA 1XVAA 1JQEA 4AZWA 1JSXA 5T6BA 1INLA 3G2MA 3I53A 1YZHA 4QQKA 1JTEA 3BUSA 2PKWA 3ID6C 4V0QA 3CJRA 1G60A 1SUSA 4YUZA 5KQRA 2IDKA 2YVLA 4KRGA 1BOOA 1RI1A 3EMBA 4MIKA 4DA4A 5LR6A 1KHHA 2QRVA 1N7JA 1XCLA 4EK9A 4RTNA 2GAFA 3M6XA 3BWCA 1NW7A 1EIZA 1I9GA 5DM0A 5FTWA 4E70A 4X63A 4POOA 1RI3A 4P7GA 5M5BA 4PWYA 3BWYA 5K05A 3G88A 4QPPA 1ZKDA 5EZSA 4WXHA 1SVUA 3O7WA 5T64A 2AOTB 3B3GA 3C0KA 1Z3CA 3IEIA 3P2IA 5ICCA 4R8RA 4X41A 2AVDA 4OQDA 1L9KA 1XDUA 3OZRA 5LQKA 1YB2A 5K0NA 5U4XA 2O05A 3JWGA 3VC2A 3DR5A 4KIGA 2FPOA 2C7OA 2ZZKA 2VDVE 5E9QA 1R00A 4YUWA 1M6YA 5CVUA 3NTVA 4YUYA 4PCAA 2AZTA 3B89A 2N47A 3HVJA 1RI5A 2NNWB 3TMAA 4E33A 2FK7A 3GRVA 3KQOA 2HWKA 4XCXA 5GOZA 4CXMA 3T7TA 3TKYA 2QYOA 3SXJA 3MB5A 2Y1WA 3DP7A 3KQYA 5DX1A 3ORHA 3CGGA 1EQAA 3AXTA 3KPWA 2B3TA 1G8SA 3P8ZA 1HNNA 2I62A 3UJ6A 10MHA 2Y1XA 2Z6QA 4ATNA 2PJDA 4KWCA 1O9HA 3EVZA 2HTEA 4FP9A 4CKBA 4QTUB 3EGVA 3GRUA 1XXLA 5DLYA 5EHGA 5E1BA 3C6KA 3B3FA 3REOA 1JQDA 3PX3A 1D2HA 3OE5A 3VYWA 2NYUA 3P9IA 3PTAA 4A6EA 5FA5A 3MERA 5JUWA 2JH8A 5K09A 1SKMA 2AOTA 4E30A 3PFHA 5EIFA 3UJ8A 1NW6A 2PBFA 2IGTA 3MTIA 3EPPA 4BP3A 1YZ3A 2BZGA 3SSOA 3HVKA 4QDKA 1P1BA 1WXXA 2C7QA 5IH3A 1ORHA 2AOWA 2VDUE 4GEKA 5GWXA 4RVGA 2R6ZA 3I64A 3A26A 5E8RA 1RJDA 2P41A 2YXDA 4PYOA 4CWAA 4Y2HA 3BKWA 3M33A 5K0JA 5K0EA 3NVKI 3PLAE 2JHPA 1FP1D 5DSXA 5K8VA 2HR1A 5K01A 3BWMA 3GRYA 3P9CA 5CIYA 1KR5A 3HCBA 3R0QA 3UJAA 3MQ2A 1M0EA 1RI2A 4F86A 3HEMA 3E23A 3FTDA 1ZGAA 3OU7A 3DLCA 5EZQA 3LBYA 1KYZA 3O31A 2IDJA 3ER9A 3FPGA 4FSXA 4C08A 3EGEA 3DOUA 4O29A 3HCCA 4C04A 3I5UA 3GRRA 3TM4A 2PXCA 4K6MA 5DRTA 3THRA 4C03A 4FT2A 4LG1A 1JG1A 4AZTA 4KIFA 4OQEA 4P7KA 2V7EA 2LD4A 3KQWA 4PYKA 3GGDA 1JSZA 5EQJB 4MQ4A 2FK8A 3KR1A 4AUKA 5DPMA 1NW8A 3MCTA 2QRVB 2YR0A 4X60A 3BWBA 3P71T 5LQCA 3TR6A 2QM3A 3NWEA 3FUVA 1NW5A 3LGAA 2AVNA 3G7UA 3KQTA 2WK1A 5KVAA 2OBFA 2I7CA 2XYQA 5E1MA 2JH9A 1EJ6A 4DMGA 3C6MA 1D2GA 3VSEA 2VP3A 3FYDA 3HA5A 5GIPE 3UJCA 5DX8A 2YX1A 3QV2A 2NXJA 2GLUA 2P8JA 3P2KA 3V8VA 2FHPA 3UJ7A 1AF7A 2JHAA 3OU6A 4B17A 3SVZA 5CVDA 1JG2A 1XDZA 2QE6A 4X61A 1X1CA 3LX6A 4KW7A 3TKAA 5ICEA 4M7RA 3FUUA 1G55A 2XVMA 1YUBA 3KPYA 2OXTA 1UWVA 5HIKA 3HA7A 5EEHA 2G70A 2ZBPA 3K6RA 1TW3A 4P58A 5C0OE 2A14A 5LQUA 1FP2A 1P39A 4ISCA 4EMSA 3CVOA 3LDUA 5BXYA 1WS6A 4YV2A 3BGVA 3G8BA 4P7FA 2B78A 2PX4A 2YXLA 3B7PA 4DCGA 2GH1A 3FZGA 3OCJA 4R6XA 1XDSA 5E9WA 2GB4A 3GJYA 2OKCA 4MWZA 2P3OA 3BZBA 1FPQA 2O57A 3FUWA 2H1RA 3M4XA 3SX0A 4YV0A 3LKDA 2OB2A 3OFKA 5HIMA 4CTJA 4BY9E 4U7TB 4ZTBA 3NDJA 4KDCA 1AQJA 4BLVA 1F38A 1I4WA 5FQOA 4EKGA 5E2BA 1B42A 1YFLA 2K4MA 4R05A 4DCMA 1RJGA 3FTEA
chains in the Genus database with same CATH superfamily
4LZWA 4G41A 4GVLA 1KRHA 3TF5A 1JEOA 3URMA 4CQNA 1ESMA 1OGIA 1R6BX 2AYZA 2V7WA 1KAMA 2ZEJA 4KXUA 1E18A 4QRDA 3KHKA 4CZ2A 1NVBA 4JQOA 1M7GA 2XUFA 3OX1A 3WK9A 4EYOA 3FW1A 4JUAA 1L4NA 3SHWA 4PN3A 3H2KA 4YP7A 5G02A 4ITVA 4BQOA 3F6EX 3NBQA 5B7NA 3OU2A 1J24A 4QHYA 6NULA 3JWHA 4Q12A 1EFHA 4EHJA 4L4UA 3BK1A 2YMLA 4Q66C 3VI4B 4JLSA 4C5BA 5HW0A 2DEUA 3T7EA 3L7BA 1QS0A 5DTQA 1C29B 1QNFA 4UD6A 1GNSA 4O5AA 5ICMA 4UUPA 1U3FA 1K7EB 3VU3A 1A98A 2AZ4A 1KFBB 4NYMQ 5G0VA 1FSFA 4YCDA 3QWBA 1PQPA 2GTIA 1QHNA 3RF6A 4B43A 4B0PA 4B6FA 4AN4A 3GT0A 4IJVA 4OP2A 2RSLA 3TPZA 4CG1A 2EFJA 3QGMA 4UULA 1I8TA 2FP3A 1Y8ZA 3BTOA 5F7JA 4DUYB 4Z0TA 1J8YF 4HXFB 4PYNA 2J31A 3U61B 3G17A 3JZFA 4KVAA 1ZVJA 1NURA 5EMMA 1LPAB 1WKCA 2H7VA 3PJRA 4GSKA 4IMJB 2XE8A 1XYGA 3FOBA 3OEED 1M8KA 4HK4A 1VSBA 5BURA 5K2OA 1DBIA 1UBTS 2IPAB 3LBFA 3G13A 4MW9A 5EMLA 5CYGA 3HO6A 3EC2A 3WSVA 4OF4A 4AYXA 4URVR 1NFQA 5HRAA 4HAUA 1NXWA 2OHOA 3G2IA 1N2EA 1DZIA 1BTOA 3AUJB 4UBJA 2IHVA 3B78A 4HQ0A 2WFAA 3AY0A 2OCGA 3CZQA 5B7QA 4NENA 2QSYA 2VSYA 3KOZA 1P1CA 4HRAA 5JSYA 3LCUA 4MI3A 1JQAA 5LUAA 3WO0A 2JD1A 1U2ZA 4IKPA 4TRMA 1UM9A 5J2UB 2GJ4A 1DC3A 4NCKA 3VYUB 5CEJA 3RUDA 4R2JA 3ZDYB 2XWQA 1EWQA 3WE7A 3HI6A 3E53A 3MN1A 4KFCA 2SKDA 4BMNA 5A71A 1U2GC 3TTWA 3QELB 4MUBA 3N8IA 2ECQA 5JXHA 3ZDBA 1SU8A 1W36D 1FMCA 4GOJA 3K71B 2XH8A 2FG7C 2PGLA 5K0FA 3LX8A 4IXNA 3FDJA 3VO9A 1V3VA 1M73E 1U4NA 2YJ6A 1JNXX 3AJRA 3JAMA 3OUUA 2BKEA 1ZXLA 3K35A 1I7NA 4BCDA 4E5SA 1EWVA 1R5JA 1RP7A 4A03A 2FHSA 1RJWA 4D79A 2YV1A 4ZHSA 2GNAA 1RFLA 3EWAA 3LKBA 5EZYF 3TW4A 4IMPA 2FGJA 2XWJI 4OQPA 5IDQA 2Q6VA 4OHCA 1HH4A 2O07A 2JGMA 1TCUA 4MX8A 5EFOA 5IZ4A 1QYWA 4BVGA 1SXIA 4B7CA 3GLFB 4B35A 1RYEA 4Q6WA 3VH3A 2AJTA 2OCLA 1PR5A 3WK8A 5J2UA 2ZRNA 4PYMA 1BH6A 3E27A 3FNFA 1LQUA 1JLKA 3CLUD 4MGEA 4MVJH 5F4ZA 3WNVA 1P8JA 2HV8A 3DDZX 3Q72A 1PJ3A 4J0EA 1N33B 2R87A 4MICA 2HWXA 3DAOA 1IWOA 1DNPA 3A0UA 5G0TA 3ZDFA 1NNEA 5BMOA 2NZVG 4PRYA 2I33A 4EENA 3QKIA 4JL6A 1HX7A 4NMLA 5T8KA 1P4AA 1L4MA 2H4JA 5KHAA 4OHUA 5ER9A 1V95A 4I55F 4IJKA 4HCJA 3D6NB 1RXWA 5JAQA 4MA5A 4MHTA 4PFJA 4CMJA 2BVNA 4F5WA 5TV2A 1L7RA 2O50A 521PA 3KKZA 2YS7A 3LI2A 3OCXA 4GF5A 3ZKAA 3ZGXA 1AMOA 1TEXA 3LCMA 1E4VA 3DXXA 4KSBA 3R0IA 1BCSB 4MB6A 1GKKA 2XUQA 4JUFA 1Y5NA 1G7RA 1ELOA 6REQB 2XVXA 2CMDA 3IJRA 3A04A 4WSOA 3ZE7A 3HP7A 3UPUA 2B8JA 1A71A 3TXAA 1XZBA 3JQAD 1QFXA 5KYUB 5JXJA 1GNVA 4FMCB 3GLFA 5LUBA 2VWPA 2Z30A 3O4RA 4BO1A 3GDOA 3OZBA 1R8XA 2OGUA 4CDRA 5K3OA 3Q5DA 1RNLA 4IF6A 1SUWA 3ANLA 5BQPA 2HGSA 3MQ4A 2ZIFA 3O74A 4G56A 5T6MA 4ALLA 3UW3A 4RK7A 2BM0A 4WFQA 1N6PA 4Q03A 4BQSA 3UGTA 3K1YA 2UYQA 2QAGA 2R2AA 4DBZA 3OD5A 4FKMA 5CXQA 2FWAA 3OCVA 2XB6A 1EDOA 4EEXA 2I87A 2H16A 1RZ3A 1ANKA 1JIJA 2HQBA 3AW9A 3YASA 4DDUA 3LW7A 2AR9A 4O63O 4CM4B 4KDRA 3RHZA 2VJOA 1SCIA 3FX2A 4IG9A 3ZOZA 1YS4A 2ZI9A 2DP4E 3A4TA 1RJ9B 3QE9Y 1QZ3A 2G1AA 3GG9A 4CMGA 2C59A 1Z6PA 1H22A 1NW3A 2IXGA 3ZU4A 5DNCA 5I8ZA 1NR5A 4B6RA 5JTTA 2BKAA 3NBYC 4KMMA 4PINA 2NMVA 4TMWA 4EKYA 4YMHA 2HK6A 4L6IA 3VOAA 2C2XA 3OVMA 3ELWA 4JEHA 1KJWA 1MDFA 1N2SA 2E4WA 1JALA 3FBGA 4MR9B 5D3KA 2GZHA 4L15A 2YUTA 3HXPA 3X1YA 3QU5A 4R2LA 3L8YA 2L82A 1FSGA 2CXRA 1SBZA 3EIXA 5B1YA 1A7JA 3KUUA 3L92A 3GD5A 3K8OE 4L6AA 2H48A 3AF6A 4GL4A 4RZIA 3ZVNA 4K8RB 1B8NA 3KX2A 3IPXA 2POQX 5E4YA 3SBXA 2WWYA 3BZUA 2JKVA 3M6WA 3LT5A 3UF0A 4CI0B 2QW8A 5HJ7A 4W5OA 2KMLA 4CMHA 4C2TA 3IR5A 1S2NA 1I3CA 1QIFA 3VO8A 4M9QA 5DWQA 4H0FA 3STXA 1L5HA 4CM4A 3G2LA 4F9TA 3ZE1B 1O54A 5G2OA 3HA3A 5L4SA 1P91A 4KO2S 4CN8A 1RJ9A 4GS5A 2LDBA 4X8MA 4Z4CA 3CWQA 2IYUA 2NQ2C 4CTOA 2Q5FA 4YTEA 1KDTA 3DTNA 2VZLA 1Q1AA 2NM0A 2PSHA 5DMHA 4FN5A 1SVMA 3WA7A 1UKAA 4XWYA 5HFJA 5F2OA 4GP7A 4Z0HO 1Y6QA 5KWVA 2FUKA 4FQ7A 2D3TA 4COOA 2FKNA 4MR9A 1H0HA 5JANA 5IC6A 4KJZA 4P4NA 4LXUA 3KQVA 3B1FA 3STHA 2Y1CA 1GV0A 3OEEA 4E4YA 1IYZA 4GPZA 3GH3A 3HWWA 2QXYA 3NHKA 5PGMA 4A15A 1G9SA 5DLEA 1NQTA 4D4LA 2QSZA 1RM5A 3RD5A 4FCWA 3VZRA 1IQUA 3B20A 2XZDA 3ICPA 2IY8A 1AUXA 4ZT5A 1JLMA 4JI0B 1JI0A 1T3ZA 2CL5A 1XCPA 2ZJ0A 3ET5A 3O4FA 5FP0A 3P9NA 4QATA 3AP3A 3L1UA 4BO6A 1J5EB 4BOYA 1SB9A 1Q0HA 2EZTA 4P22A 1EBUA 2MSEB 3B6ZA 4FFSA 3G79A 4R1UA 2WINI 3BJMA 2DR3A 3DLAA 4BRSA 5IZCC 4Y6QA 2C7RA 3IV6A 1O9BA 2GK7A 2JIBA 3MJFA 4V2UA 3W5JA 3ZUPA 1PWEA 3RTGA 4F4HA 3AHIA 3ERCA 5EZ6B 3K1ZA 2JI4A 2FPPB 2X77A 3HJRA 2FZKA 3O83A 2L42A 4B2PA 4OGLA 3QXSA 4AZWA 1EXNA 3P9XA 4EITA 3J80A 1RQXA 1FVXA 5CYPA 1Z0ZA 1SVOA 3DLPX 3WBBA 4B8YA 4IQ0A 3FNEA 3CGWA 3BUSA 2QU7A 4IJQA 3W2FA 2RH4A 1F20A 1SUSA 1TVCA 4NG4A 4K8OA 1EP2B 3LLMA 2BFBB 2XMGA 1OX6A 4RZQA 5G41A 3HBFA 3WYEA 1OTXA 3P2JA 4HLDA 3KIPA 4ARUA 5EUQB 3FR7A 1QPBA 4C2UA 1FQOA 2DECA 4N8SA 3FLEA 1NBOA 3KUDA 2PSEA 3NWJA 1ADBA 4NK4A 1IY0A 3N87A 4L7QA 4WXHA 3O26A 5SY6A 2BTQB 3AI1A 2ORWA 2YC2C 2V6FA 1LV8A 5A5FA 3C43A 4EA9A 4OI0A 4IGEA 1XDUA 3CLSD 5EXSA 5KJCA 4D26A 3L0DA 2NYVA 2Q62A 1EXMA 1T5OA 1U94A 3CX7A 4RZ3A 5G53C 3FMVA 2D0DA 2GT1A 3WISA 4C6TA 4F56A 1CE8B 5HE9A 1HYGA 3LH5A 5CW2A 1IG3A 2FPPA 3ZWKA 2AFRA 1JHMA 1ODKA 2GN2A 2N9UA 1IG0A 1RI5A 2B4YA 5KBYA 4CXMA 5GOZA 3U40A 4QNRA 4BJ5A 4C7VA 2AEFA 4OU5A 5JJ5A 2TSYB 2H4XA 4L8YA 2UZIR 3ES9A 3FJYA 4B82A 4JI5B 4B71A 3MWYW 1MEOA 4GMGA 5JYBA 3F5FA 4KYUA 3H83A 2ET6A 2BFBA 1RE0A 2FOIA 2R7MA 3OP1A 3DO8A 4X45A 3FOZA 1L7OA 2UAGA 1FTYA 5LIRA 2QZPA 3FYUB 2X2OA 5EHGA 4LC0A 1SWWA 1LWNA 2AE2A 2BL4A 2IJGX 1E2MA 2HHCA 2P67A 3PX3A 3QG5A 3DE3X 1V1RB 3OUTA 1H2ZA 3DBRA 4ZT3A 4PNPA 5SY9A 3PTAA 1BX1A 2B4KA 3JQAA 1UM8A 2BTQA 3KT3A 2O8VA 4MXDA 5GZ1A 5LOVA 1OWOA 3TMKA 4EYSA 4IDFA 1UKVY 3F9IA 1K6XA 1SVWA 3K6JA 3ZE2B 4BP3A 5FBZA 2X5NA 4IY1A 2HC9A 1GG2A 4GR5A 4XGIA 4XTRA 4K6KA 3WFJA 3KJZA 3PPWA 1WTCA 4MROA 4GEKA 3DOJA 1Y63A 1LBTA 3LGSA 3L8MA 4NCIA 1WOMA 2AFHB 1PK8A 4RA9B 1CE8A 1TVMA 4HAZA 4YV7A 4W5TA 1UINA 4RXUA 4CWAA 2VPWA 3OA0A 1B6GA 3VZDA 1VPEA 3LQQA 4R5MA 3LVRE 4S1PA 4X97A 2V3VA 4D4MA 5K8VA 5K01A 4DV7B 3KB1A 2H2AA 2RK6A 5D01A 2FMUA 3GLRA 3IURA 2WILA 3HJAA 2GXQA 4LY9A 4BKUA 1CZUA 3DE6X 2YASA 3NIBA 3ON5A 3SCZA 1Y3DE 4Z9BA 1VI5A 3EUWA 4XH9B 1FXWA 3OM0A 3WB2A 1TZMA 2NZJA 3I0MA 1CUUA 1CVIA 4RHTA 1SO8A 4MVWA 4XM1A 3T7JA 5HWSA 5HVNA 2AYYA 4AUNA 4FT2A 4OUDA 3FYUA 2V45A 4P4GA 1CKEA 1JYFA 3GGDA 4LXHA 4D9BA 3AUXA 4L02A 1D6SA 1FA9A 3CR7A 1GD1O 5MGBA 2XDWA 5TQ0A 5LBIA 3S40A 3NWPA 2LZ0A 1WO8A 1CY8A 4KN6A 5DBOA 1G2PA 1K6IA 1Z4QA 4AYWA 1ZXXA 3T3DA 3W2TA 3DDUA 4TYQA 4CM1A 2O5CA 4MWSA 4OLFA 4Q3BA 1YTLA 3ETHA 4YR7A 4Z2AA 3BFVA 4R7ZA 1NU6A 1ZIOA 1LK0A 2AFHA 2OM6A 3DT9A 1C1HA 3H2ZA 3HJGA 5AVKA 3TL2A 3EXHC 2VOJA 3M7IA 4RO0A 3V2IA 1RVDA 2VJMB 1Z2EA 5GONF 1XSEA 4RF4A 3T7KA 2BFCB 4MV4A 3THXB 2O7NA 4ENUA 2EWMA 1QIHA 4FFWA 1GZDA 5AJYA 2Y9MB 4F6CA 4PR0A 1YC5A 2WVAA 2ZE7A 4EW2A 3AM5A 5HTKA 3WWDA 2LKCA 1ZOIA 4XCQA 5F78A 4RGBA 3TKAA 1C4OA 1JHOA 3K73O 6PFKA 1QGOA 2C1XA 5HIKA 4LXIA 3C6ZA 3T3EA 2QLTA 5C81A 2O5RA 3EXFB 2P6RA 3AUUA 4MJ3A 5AVSA 4JLWA 4FW9A 3RFUA 5JEDA 5DULA 4UHHA 1S6YA 1FP4B 2ASVA 2R85A 3G02A 4WLUA 3ZY3A 1HM5A 2OOSA 4R81A 4RHXA 4F1WA 1WB4A 2OQIA 3SOPA 1A4IA 3UPTA 1M1UA 3H18A 1IJBA 1V8BA 2C88A 2IU4A 3H8WA 4Q7KA 4UM5A 4BFSA 3EPKA 2FDXA 2CHUA 3L01A 3ZXYA 2PPLA 1YBVA 1O7JA 2VUSA 3L0SA 3KAPA 5AESA 1P9NA 4KWTA 4DJEC 1BHO1 1QH1B 4FE7A 4L85A 4E6EA 1BZYA 4ZVSA 2JGNA 2P9TA 1C4WA 2ZANA 4OHZA 2I66A 1MKYA 3DAHA 5F4BA 2Y1LA 1PNRA 4N0EA 4F2HA 1B42A 5HSGA 3D0OA 1QXSA 4XLZA 2BFCA 4P9NA 4D9KA 2EOAA 1LXCA 1NT4A 3R7SA 5FH9A 1STOA 1EI9A 1FYVA 1RE1A 4RKRA 2H0AA 3MS7A 3R9KA 3A6ZA 2NQ8A 2H17A 2L69A 3A58B 5ALMA 3WGMA 3C4QA 4EVSA 4F3KA 2XLBA 4LOAA 3VXKA 3FNBA 4KI7A 1JECA 5HBGA 4F3RA 4PG8A 1J1IA 3Q0EA 3E0XA 4QOSA 4UCFA 1MO4A 1VKJA 1X1DA 1CDDA 5G3YA 2PUCA 4WZZA 2ZJ6A 1IZ9A 3EXFA 1S2LA 1M2EA 1N5MA 2PWAA 3PB3A 5KQSA 4I8DA 1Z45A 1CETA 2BHLA 2CJXA 1X8XA 4PS0A 3R8XA 4B32A 1KY2A 5DGDA 5C2JB 1O6ZA 1PDVA 1Z2CA 3BX1A 3MG9A 4KQ1A 4X93A 3RHSA 4DUZB 3P52A 1FBTA 2EDCA 4EUNA 1RHKA 4NOJA 3NRCA 5HBRA 4PGHA 2POCA 1YQQA 1ICIA 1ULAA 3WRXC 2OO5A 2J0VA 5BUQA 2IUYA 3PT5A 4NEHB 1XKLA 4PICA 3M81A 1QH1A 2GCGA 2A4MA 4QJ4A 4DE5A 3HB4X 3COSA 3C7KA 3HXTA 4UEWA 3TLKA 2DMRA 1IN5A 3JYLA 3UT6A 2PGXA 2QY9A 5GM2A 3ZYCA 3V97A 2YJ3A 3IAAA 1H2XA 4G0MA 3SF8A 1GNPA 3GA0A 4UNPA 1ZIPA 1ZH4A 1ISSA 3IQIX 3OPXA 4PQYA 2RBEA 1OVMA 2VDJA 1MPTA 3L6DA 1P62B 3IDQA 1NNUA 4OLAA 1BRMA 1EZ4A 4R16A 4KYIB 4Y9RA 1YR2A 3GFBA 1BXZA 3TQQA 3ZIAD 1U2RA 2AKYA 2NO7A 2OZEA 4GDFA 3G6KA 4ZALA 4UAVA 2QVXX 1FEZA 4OGKA 3GBVA 1O57A 3KNZA 4D9NA 5E7QA 4DIUA 4FD2A 3JD4A 1UBRS 2IGBA 4R2IA 1GARA 1OPXA 2XLCA 1U6JA 2JLUA 3HVHA 2F62A 4KIWA 4ENSA 2P6NA 3CVYA 4C4ZA 1I2AA 3MT9A 3FUCA 2ZBFA 4KH0A 4QO8A 9LDTA 3WSWA 4F93B 5C1BA 1P74A 4Z2YA 1T8WA 2O3UA 4ZOLB 4HRXA 4NABA 2P2LA 2I1QA 4W6QA 4CTNA 5L95A 2REBA 1C81A 1AKEA 2Y1GA 4OGFA 3ZNQA 1G8JA 1LY1A 3RKRA 4QVIA 2BRUA 4DLZA 1LNQA 1PJ2A 1ZONA 1W44A 1X7HA 3HO8A 1SD2A 4LNHA 3UYKA 4CM7A 1KEWA 1L8AA 3LQ4A 2WWVD 3EPHA 5K0CA 3T3OA 1AQ6A 1MU0A 3LPCA 3SMVA 1YQUA 1N6RA 1KBQA 3R3UA 3OOSA 2IYNA 2HLNA 1JR2A 4FFBB 4BO3A 2RHOA 2HMYB 1JFLA 3RT7A 3T1NA 2O2XA 4Q4DA 2BHNA 2X9GA 3K70B 1U81A 1ZZEA 3EZYA 3LP8A 3PIIA 4F2PA 2JAHA 4C4RA 3T1QA 1BSVA 4HH3C 1BNCA 4TTQA 4Y1RB 2ES4A 2C7GA 3BHJA 2KW5A 3LPDA 5MF6A 1DRJA 4OXXA 2IX3A 3EVEA 4RTJA 4HAOA 4R9RA 1N3BA 4Z9AA 1QP8A 3A9UA 3MUNA 3SC2A 3OJXA 2WTUA 2R0QC 2CFIA 3QBVA 2CVQA 1MIOB 4FR5A 2HPAA 1U2PA 1Z7WA 4DGQA 4LMRA 4WEOA 4ETWA 4ZOLA 3OEHD 4LY0A 2AV6A 3KK0A 4UDOA 3GDHA 2XZPA 4XUCA 1KARA 3IO5A 5BRJA 3M6UA 2SKEA 4C4PA 2B8TA 2VJYA 4PZAA 1M6VA 1I5RA 1O0BA 4EO7A 2C5AA 1G8FA 2R48A 2JFPA 4WDRA 2G71A 1UJ2A 2AFVA 2GJKA 1G66A 1AU9A 3ANYB 3PUZA 5MFZA 2EVWX 4EA7A 5CVEA 4KO4S 3VUEA 1CVRA 4RKQA 2QNIA 1J9GA 2X86A 2BFFB 3FPHA 1XTBA 1QYRA 4LDRA 5FWAA 3HVUA 5FTMA 4DZZA 4FFBA 2QPAA 4HNAB 1JEYA 2XEDA 4MR7B 1GNRA 4O2BB 1YR7A 3OF2A 3D3JA 5H3CA 1L4HA 4BFVA 3ET4A 1P5RA 2GRAA 4EI8A 5AKIA 1T5TA 1CRWG 2AOXA 4Y1RA 2CHEA 4DB4A 4BS9A 8AT1A 4RNDB 1D1QA 4MYRA 1VP3A 4Q6BA 1YRYE 3D3WA 4IHJB 4G1FA 5ARCA 4TQAA 1NPTO 1LDEA 4AN0A 4HNQA 3D02A 2IBTA 3U3ZA 4DGSA 1MA0A 1GXSA 1WNTA 4AP9A 3C15C 3NBAA 5EERA 2QP9X 4H08A 4MUMA 2C9BA 2ZUCA 3PF8A 3GXBA 3L3BA 3JWJA 2GJ8A 4A1FA 3N2LA 1HV8A 1Y48E 3PRKE 4ND5A 4DQDA 2F6RA 5FJIA 4D74A 4M4SA 3MGKA 4JI1B 5MHTA 4U2BA 1O87A 1EFUA 1EUYA 4BBPA 1WG8A 2Q9AA 5IEJA 3OKAA 1G3RA 1Q3KA 1NC3A 4V0KA 5FEUA 1RHMA 4OQYA 3LQYA 3QU4A 3B82A 4E1BA 3NQ41 3RG2A 1Z06A 2YZ2A 5F5LA 2MDTA 4ZJZA 5JIBA 2PWPA 5G4KB 2CKMA 2Z58A 3ONDA 5EY5B 4MR7A 3BC1A 1Z63A 2EX4A 4DNFA 1SBIA 1GL9B 3AERB 2PLFA 1OXTA 3JWIA 2VZ9A 4I4NA 4BGDA 1PLKA 1HDZA 1WP4A 1FNDA 3WIBA 5GV7A 2Q7OE 3B5EA 2DWCA 3E1GA 1RT9A 1YQWA 5P8WA 3O3CA 2B25A 4M98A 5AM0A 3AETB 2RMKA 2YVAA 3H5RA 5JH7F 1FRFS 5ADVA 1C2YA 4PQGA 3NHUA 1GV1A 1N7IA 1R6TA 1Y1LA 1Z68A 3FCYA 3R20A 4H7KA 4NBWA 5I7SA 5DLDA 1J23A 2A86A 1O6CA 3GZTB 4G0PA 3LW8A 1TPYA 1D0IA 3MTJA 1K2VN 2AA3A 1ODFA 4FR0A 4GKKB 1PL0A 2E49A 1ZK1A 2H07A 4I6JA 4RORA 3G89A 3THOA 1QYXA 1EUQA 1UZAA 1K8YB 4K2AA 3A6LA 1FDIA 3II6X 4PXYA 2UXCB 2GPAA 2RARA 3BSFA 4NAUA 1AV7A 1CUJA 2OY0A 1UPUA 3OX2A 4MVCA 3MPOA 4WDQA 4DM3A 1I01A 4WN9B 3EGWA 1AQYA 1XDDA 1SA0A 2AB0A 3CW2A 3AFIA 2XUZA 3D3QA 5JOQA 1YJXA 3UGJA 1HE3A 2XPCA 2ZWAA 3LPLA 1Y3IA 2A59A 1REQB 2WD8A 3A36A 1SCDA 5G4KA 4D4HA 4X94A 3O4VA 3TQIA 3VDQA 3UMFA 5IX8A 2QUKA 4AI6A 2QN9A 5H02A 1BGXT 2H2DA 2F43B 4UU0A 2GBLA 4B6PA 1A9OA 2I8CA 4W9NC 2LIVA 3GLQA 4L72A 5ALSA 5EYPB 1WCIB 1T4GA 3P5BA 4UJ3A 1PP4A 4DJ5X 1FDTA 4L0MA 3HMKA 2QT0A 4B3RB 2O14A 3ABOB 2BR5A 3BXFA 3LBIA 1NXXA 4WKCA 3W3AD 3AETA 4QPJC 1C0KA 3EDOA 2SECE 4YVFA 3WI7A 4JL5A 2AS0A 1SVIA 2AOUB 5IUJC 4I1RA 1TLFA 2RGBA 3ZIAA 2HXYA 1R0WA 1RYNA 3HB9A 3SJUA 2IHTA 2XUKA 4EGCB 2UZ4A 1GM5A 5EPEA 4PZPA 5DI9A 2Q46A 2YVUA 2X23A 2RGYA 5JPIA 1PZEA 2OD9A 3R74A 1A8HA 3BFXA 1I2DA 2KM1A 3LY9A 4C30A 1CRLA 1VSQA 1Y89A 3GH1A 4NFSA 1GZ7A 4XXHA 2XRYA 3NTXA 2WM2A 3DVSX 2RH9B 4BAGA 4WN9A 3T4UA 1ISHA 1QHSA 2OCBA 2OCAA 1QRTA 1UFOA 4H59A 1H42A 1EK1A 1M75A 1NLUA 1XTVA 1XQYA 5DM60 2VHTA 4CFSA 5GPBA 3I0NA 1EK0A 4W8HA 1SC4A 4BKQA 1E2IA 3FFTA 1HG1A 2HIGA 1Z5PA 4IL5A 3K4HA 2IY9A 3PRJA 3C6BA 3KJXA 2NG1A 1COZA 3W0LB 4DCTA 1QH0A 1QRDA 5EYPA 4S1VA 1Q95A 1WCIA 3PIDA 5HZGA 3USZA 1WPRA 1PBTA 3ABRB 1GUAA 4XASA 3EHDA 5J5VA 1BOOA 3BXXA 2PL3A 2ZCVA 1EM8B 2HLPA 5KYNA 4Z4FA 3OZWA 1P60A 1KU0A 5THKA 4DZTA 1TCAA 1V26A 4DBLE 1Z6XA 5DM0A 4UXHA 3T7DA 2PX0A 3U7IA 3ZS8A 4B2YA 2VF4X 3OLZA 4QUAA 3OJLA 3OE7D 1X7DA 4R0VA 5KKAA 2RK4A 5M34A 3WLEA 1C4XA 1SIBE 3C6QA 1ECCA 2J4FA 2ZUSA 3O38A 4G6ZA 1P9OA 4IDGA 4JUIA 4PLWA 3V4ZA 1G59A 2Q6TA 4EIWA 1MGPA 3V55A 3AUAA 3D6FA 1XNRB 3UHPA 4G5GA 1A5TA 1F2DA 1Z3CA 2CBZA 3QMPA 3RNOA 3ZU6A 4G63A 2AVDA 5IYZF 2Q1TA 2BE7A 1XD9A 3HU1A 1Z13A 3PQFA 1GZ5A 5K0NA 2ZT5A 2IUUA 4FNMA 3VC2A 1C0PA 2X9VA 3T35A 2IEGA 3A1UA 1OFUA 2I2XB 3D81A 3Q41A 1DQRA 3I2JA 3IULA 5U4QA 2XT6A 4PLPA 3FZQA 4EWLA 4IJWA 2ZSFA 1T2VA 4EOGA 5J4YA 2XRMA 3CX6A 3OEHA 4Z9XA 3C7CB 3SXUA 4FDVA 4KV9A 2NZYA 4BX0A 3TGLA 3HR7A 2JANA 1MFZA 3C2QA 1GUBA 1FUEA 2QUJA 2ZVQX 3DNFA 3PG5A 4GVXA 4ZVTA 4F3TA 3MB5A 1H2WA 4Z3OA 2VXYA 4GWLA 5PNTA 1FW8A 1OUMA 1P44A 2C2BA 2B3TA 1G8SA 3P8ZA 1M2WA 2HREA 2NO5A 1D4FA 3D4OA 1AHNA 2PJDA 4ATNA 2PA3A 4EATA 4F46A 1XPJA 1A5SB 1EM8A 1UT8A 3M4ZA 1SBYA 2OLEA 2YMPA 2KLBA 1UFVA 1JHXA 1JTVA 4OG2A 3INYA 5AJZA 4O5OA 2RHGB 1Z36A 2QBYA 3EGVA 1OAOA 1EHIA 4DILA 1DBQA 2IE8A 3DTYA 5I4IA 1A2QA 1V25A 5LLTA 1NBMD 2FR8A 4HNRA 4D41A 4HDQB 1G16A 2XHEA 4GR9A 4UHFA 2RGCA 3QXGA 4H60A 4EW1A 1PGOA 3HCWA 1SKMA 3JSAA 3UJ8A 1NP3A 3G2HA 4TL9A 4Z49A 2O1XA 3T3HA 2BZGA 4R3NA 4X1KB 1LVHA 1NLFA 2VJPA 4M0CA 1DDGA 5JJBA 3PC2A 3DPIA 3QFRA 1ZN2A 5IVIA 5A4IS 2OBMA 3LYUA 4MCAA 4BBZA 5LXTB 4MIOA 5E8RA 5LZ5A 2BMEA 2BM1A 5K0JA 2MYPA 2IZZA 3VA7A 1SCJA 1SY7A 2CHFA 3RU2A 3DSRA 2BSQA 3HCBA 4P36A 4JLDA 2B1IA 2DFDA 3FI0A 3WL6A 2H6EA 3DF9A 3T52A 2ZUEA 3DLCA 1ZVMA 7AT1A 1VPWA 4BMPB 1OASA 1JAIA 2ADOA 2Q0SA 2F67A 1GA6A 2UZ1B 1JVBA 5BWOA 2W2VA 3WDKA 4A8HA 2GZSA 3G0DA 3T9DA 4BZWA 2Q3MA 4NJEA 3ND5A 2QZSA 1KGSA 3RFFA 3MOSA 2AG8A 5JAMA 3HUEA 1FK8A 4LZJA 1DIHA 3SK0A 4NFLA 2PSDA 1E7RA 2YYSA 5EWLB 3MCTA 2MHCA 1OFHA 4ECAA 3SFVA 3E58A 3AUKA 3R77A 3ASUA 1TMOA 2NTNA 4LI3X 2IYFA 4UNQA 4CM6A 1XMVA 2I71A 8ABPA 3H1GA 5CTAA 2HCBA 2VG8A 4X1KA 1NMSA 4XFKA 4F0JA 4OO3A 1VL8A 1MGOA 5SYNA 1ORRA 4F7WA 1E9VA 1EFVA 1EJ6A 2IYTA 3AR4A 1AX9A 3CNNA 3CVJA 3ESZA 4G1MB 2IHUA 4GOKA 5EQFA 3SZLA 1ABBA 3BOSA 3IP1A 2HFJA 1S2IA 2A2ZA 4J6FA 2I03A 4MKRA 3UJCA 1I7DA 4LRTB 3QV2A 2NXJA 4KXQA 1L5RA 4L9WA 3WLPA 2HT1A 3COYA 1X6VA 3ECSA 3I01A 3KP1A 3RM3A 1RRPA 2Y2UA 1PG5A 1UPCA 3JY6A 1ZGBA 3IQXA 4MPJA 3PCTA 3SKVA 3T9AA 5KTOA 3RLIA 4P93A 3UT5B 3PV0A 5KNDD 5U9CA 1LLUA 3JQFA 4EHNA 1BXGA 3CF6R 1XQXA 3C74A 2EFHB 3HA7A 3IT0A 3L82B 4I1OA 4UDXX 3UYLA 4EB6B 1LZLA 1M8JA 3MFYA 5A5GA 5LDHA 4XWOA 1WXIA 3ILVA 2RIRA 1P39A 3FSEA 2XMQA 3G82C 3CVOA 4QGHA 2WIBA 4YMTA 5JD3A 3FVTA 4LJRA 5BNTA 1MAWA 5BN3B 3F5DA 3PHJA 3GJ8A 5EWLA 3H16A 3IMEA 1A9XB 2X1VA 3MJ4A 1A95A 4LKOA 3C3XA 2ISQA 3D1JA 4Q5IA 1DO0A 1XD8A 4HJRA 1SFRA 2VYFA 1VKHA 5IKOA 5J23A 4YJFA 1JHPA 4KFSA 2MYTA 3W3AA 1ST2A 3CY6A 2QDXA 3TQOA 4RFSB 3WVNA 3WIEA 3BJRA 4TV9B 4C3UA 5JQGF 1DSSG 3OQIB 2LCQA 1NVXQ 4LE1A 2D7DA 5EJAA 1DKLA 3TJMA 3AV3A 3WGTA 3W5BA 2EBWA 4LBWA 1F0PA 2VAXA 1PT6A 2RGDA 1QGZA 4QAJA 3WQHA 2JA1A 3F1KA 3UT5A 4CNQA 3R8FA 4B3IA 4B8ZA 3KU1A 4H7FA 5DNVA 5CCDA 4TXNA 4ROSA 4DA8A 3E4DA 1JH9A 3K5IA 3WL7A 2OCIA 3HK2A 1VDMA 4QC2A 3OTWA 1Y4SA 1GZ4A 1A7AA 3H65A 1EESA 5IJ9A 2TS1A 3TVDA 5KQGA 5E0KB 1WM1A 1W19A 4D56A 4JASB 2XBMA 2HK8A 2X4LA 5IJZA 3LYLA 5B3LA 2HUNA 4RAQA 4EF5A 1MTZA 1JWAB 5I9SA 4N0QA 2FN8A 1BW9B 4XDGA 4ZRDA 4ZICA 1BQEA 1A9XA 1M1YB 1OYYA 4I66A 2YVKA 1L5SA 1VMIA 2PKYX 3H8JA 3WICA 3PWSA 4ZI3A 3CJTA 4PVCA 3D7NA 2QKYA 3IH5A 4HBZA 4RFSA 5KNCH 1AKWA 5B4VA 3S2YA 1M5TA 3OE7A 5CW1A 3AHJA 3OQIA 2C3UA 4O02B 3V48A 5A04A 5HQTA 1EJ0A 3Q87B 3MJRA 3EEOA 4ESVA 4R1OA 3A1FA 2C4MA 4KVZA 3ILSA 4F4DA 4JDPA 1CUVA 3JS5A 4FB4A 1X2EA 4GI3A 4F5EA 3F6RA 4IBOA 1WW8A 4D8VA 1W0KD 1MXHA 3KXPA 4G81A 4LTMA 1UBGA 3FPAA 4PM4A 4Y1GA 4ZVVA 4CODB 3DZIA 2O54A 4BMVA 2REXB 3UWKA 2GEUA 3GEGA 1SQFA 5KCZA 4M22A 3VDXA 4DEVA 5CVJA 1C2TA 1UXKA 4A0FA 4OXKA 1Z22A 4AY5A 4YBZA 3EHEA 4D0GA 1TUGA 4J4BA 4UMDA 2ZQYA 5K0GA 2N3ZA 1IDOA 3NH6A 4JODA 2IV3A 2P3QA 4EPVA 2O0LA 1UMKA 1YHZA 4EDHA 2VP0A 2ZRCA 4RELA 3ZTWA 2AN1A 2VL7A 1BW9A 3A0RB 2ERXA 3GOQA 4MW7A 5JSKA 1M1YA 4DUPA 2O8EB 1XDWA 2R5NA 2WOJA 1AB6A 4JY7A 4KYTA 3ZCSA 1GL7A 1OLXB 3QYAA 3PE6A 2HHAA 2P0AA 3ER6A 3K3PA 2VI5A 3QUTA 1D6JA 1XG5A 2HJRA 1S2GA 2X6TA 3DZGA 3K0AA 4OHRA 2QQEA 5BVGB 4YO8A 4BZQA 4MW4A 5J4LA 5KKNB 2BM8A 1WLSA 1YU9A 3EA0A 1NBMA 2V65A 4LX0A 3BMQB 4AJ9A 3RRJA 4N7RA 1VA5A 3CCFA 3CVUA 3G0CA 4LTDA 3UJHA 4LJ6A 1LWOA 1GY8A 4RWEA 5DYNA 4FFRA 5EP4A 3PYXA 4LYFA 1K4YA 2OLJA 1XWWA 2Y92A 3GFQA 4N65A 3UMSA 3CVWA 3E3LA 3QLUC 4Q3CA 1BC5A 3LLSA 2ISCA 1MQ8B 2ZYUX 2EKPA 3HKCB 1SOAA 3ISVA 3QWHA 2FJUA 4MP3A 1A9PA 2ZS9A 3DZCA 3BA6A 3GIWA 2WFLB 2O7QA 2PMCA 4XEUA 2RHTA 4BNYA 1IHUA 1NUAA 1R0YA 1TCCA 2DJ5A 3DH0A 3Q9SA 4YCBA 2X2EA 4DIDA 7YASA 2NVUB 3IGFA 4IS2A 1EYZA 1JKMA 5LA6B 3UW1A 2WI8A 1PG2A 1K8RA 1WVGA 2H00A 3KWMA 2PA0A 4TN1A 3TBFA 1NW4A 2VS1A 3A14A 2VNKA 2F48A 2XTZA 3NAZA 3NJRA 5KOYA 2ODWA 1U7DA 1U90A 2WWHA 2GM5A 3KG2A 2HH9A 3UA4A 5DK4A 3KPVA 5BVGA 1Z5OA 4GX5A 5FULA 1E5XA 3IVXA 3LECA 5AP9A 3PFNA 2DETA 3BMQA 1JV2B 2NU8B 1UC8A 3I52A 3ROKA 1N2JA 1YZFA 1CU1A 2CMFA 4HG2A 5K9ZA 4OU4A 4KQ6A 3GZNB 2XQJA 4J8PA 5LJIA 3UC9A 2CE7A 2H1FA 2LTAA 1NRJB 2VNJA 3DTVD 2PXHA 2HRQA 3E82A 1NUTA 3H7AA 4PNHA 2BCJQ 1Q20A 2LBPA 1FDVA 1G38A 3HKCA 2G6TA 4YPVA 2VF7A 5TMDA 3QVLA 4EJ6A 3HNRA 4G24A 1QHFA 3LV8A 2IELA 1JDSA 2IYAA 3OECA 3OZSA 3PCRB 4JWTA 4LMAA 2AOVA 3H2HA 3RGGA 4DMUB 1RXIA 3AUSA 1UADA 2H54A 4L9AA 3ZWOA 4BE7B 1ZMTA 4LBVA 3K2EA 2NVUA 2AEJA 2DPHA 1MHTA 4HSEA 1WY7A 3O8QA 5LA6A 1JVSA 1UOEA 1JDJA 2I22A 2NUTB 2V0CA 3K96A 1JEDA 1DOZA 4GGPA 3NWOA 1XJWA 4HFJA 3IOYA 4GZ6A 4LJKA 3VC3A 5KNDA 2GUGA 5L4NA 1C8VB 1KVUA 5EJ8A 2R11A 2AR7A 3D0KA 1IEXA 3Q10A 1RCTE 2ZAOA 4MQBA 5ALNA 2X1MA 3ER8A 3TEMA 4PSUA 1S0UA 2IS1A 1DS6A 3GCXA 3IAHA 1QRRA 2Q41A 4EP1A 4GECA 4J75A 3GRAA 4DLTA 2UYGA 3VHXB 3V2GA 1T0UA 5JNTA 4IMRA 3HB7A 3VC1A 3AIMA 5HHTA 3JAWB 5KYTA 1Z6TA 1NFRA 3O1LA 5CH3A 2IPXA 1U31A 3KDAA 4AWBA 3GZNA 1MN6A 4MVJF 1DHRA 2IY7A 1DFIA 4UD2A 5I5EA 4AKGA 4KAJA 3BQNB 1DARA 1PK9A 3LUDA 1NF8A 4M0EA 3W05A 3WLTA 4BPRA 3I9JA 1LQ2A 2FNAA 1NJFA 3QHPA 5AVJA 3MAAC 1MJGM 2XAAA 5EQDA 1RRMA 4RK4A 2Z2XA 2OHXA 4AYTA 1XA0A 2JH3A 2E1PA 1BU8A 4XQ0A 1E61A 2J1LA 4HWSA 1GZVA 1CQZA 4HDAA 5B2EA 4Y67A 3SIRA 4X62B 3GLHE 3OUZA 3G7NA 1GN8A 4HMQA 3A2LA 1RPJA 2MSLA 4NV0A 1E1KA 1J1ZA 3DHEA 1V3TA 4MTLA 4WZAA 3MHPA 5J59A 1L7MA 3WIOA 4UHDA 4D4IA 2NUTA 3PD1A 4NH0A 1U9JA 3O84A 2PNJA 4CIVA 1KIAA 2JCBA 5A7GA 1NUHA 3ECAA 5K6AC 2C4HA 4YRKA 4OJTA 3P0RA 1KY5A 5KPDA 4JJAA 3HEBA 1FUYB 1ZS9A 3FRHA 2EP8A 1LSSA 2NVWA 2PKEA 3IDSA 3JYOA 1IPFA 4PAMA 3G2QA 4ILEA 3EC7A 5HKOA 1U0GA 1FSZA 1AKVA 3O4JA 3RWMB 3R41A 3VQTA 1DZ3A 1QDUA 3JAWA 3IMCA 1CR1A 4HZUA 1YOBA 3G8AA 4UQOA 4YAKA 5M7EA 2YFHA 2WKRA 3GLGE 4S04A 2AZXA 1N4AA 3RDPA 3U17A 3E5NA 2PBZA 3A6FA 3MF4A 4MQUA 1BDMA 4RS3A 4BPBA 1O58A 3TGWA 4UE6A 1KYIA 1QHHA 1ZRMA 2AZMA 3MINB 4IV8A 4ZHQA 4ZV4A 2EJCA 1QFSA 2K5UA 2JCYA 2OLKA 1PTJC 5KTSA 4M8NE 2XY4A 1L5FA 3WNZA 2B9VA 2BUAA 1LNSA 2G06A 1T4DA 1IHYA 1ABEA 2OAP1 1PGNA 2W8ZA 4CNBA 4RMGA 1SUIA 1W0KA 2VDKB 4B2IA 4OFWA 2FZEA 1G7SA 4ETIA 1K88A 4R1QA 1YZTA 1UOOA 2QY6A 3ENVA 2XDQA 3OZUA 1CUYA 2DY0A 4MH0R 2NO6A 1YFKA 1FFBA 3AXSA 3F2VA 1AXEA 1XJCA 3IAXA 5JNWA 4GSLA 1XPRA 5KB3A 4KGXA 1ISRA 4RKWA 3FKJA 3DE1X 2CLKB 4LUCA 2BYTA 1JSCA 2PH7A 4HH0A 3EVFA 3P9KA 3F97A 2FXIA 1GG8A 4TLMB 2C5GA 2AFIA 2FRXA 2VCYA 3MINA 3PQ4A 3DMYA 4W8OA 4C2AA 3SY8A 5F98A 1B6SA 1OSNA 4DA9A 4LHEA 5JC8A 2EF1A 2J3IA 4B83A 3I9MA 3U4QB 2P0EA 1ZFNA 4IWXA 2J9ZB 3NS7A 4ALMA 1VIMA 4V0QA 6YASA 2D59A 2QOEA 1IJKA 4M89A 4AS3A 1HNXB 1EP3B 1R9MA 3RVRA 3PWTA 2CMKA 4KNWA 3S6JA 3UTDA 5TMBA 2QRPA 1RAHA 1OC2A 1Y9JA 3K15A 5ITSA 1ECLA 4RHCA 2Z5LA 4NU0A 4WT7A 4U7DA 3KHSA 4MITA 2FETA 2JI8A 3G88A 2X0RA 2MT9A 2XCOA 3BMOB 2XCRB 2ZRIA 1JHZA 1OLSB 1Y3FE 3KKMA 5AIAA 4GKJB 1E1NA 2O3QA 3BEDA 2O7VA 4M53A 1D5CA 4F7DA 1EFPB 5F7XA 3EXHB 1QU2A 4WASA 1KIMA 5BV0A 1FFAA 2PFKA 1N8KA 3FB4A 3NKFA 4C4OA 4JBXA 2NZ2A 5BSGA 5IF9A 1G19A 5DNAA 4KIGA 4YALA 5E9QA 5ALUA 4IJ5A 1OH8A 3L0PA 3X1MA 2D1SA 4KLAA 3H0EA 4CIYA 3UB2A 3Q7SA 1LRJA 1GAWA 2E18A 4GDMA 4NAHA 1RM3A 2BFOA 4P53A 4PPNA 4RVNA 4YUZA 1ATIA 1YA4A 3QU7A 3C48A 3TB4A 3U4QA 3T1HB 4XQ9A 4K5QA 2A7QA 1QLJA 2BV3A 3HDTA 1TCVA 5FJJA 4QKQA 5KTNA 5D00A 3DTVA 4OFBA 1NHGA 5AH0A 1U3CA 3BWVA 4QTUB 5ECWA 1D4ZA 1DKPA 2QNBA 1GPBA 2Q3EA 4V0LA 1H3NA 3HBMA 2VVTA 4MUYA 4PLFA 2I29A 5EJGA 5DLPA 2WQ7A 2JDID 5JSFA 2YHIB 3OE5A 4QXMA 1Q12A 3THYB 3CNOA 1OLSA 1DIAA 2AXEA 1S3GA 5FA5A 4FNGA 5EESA 3D4BA 2DQKA 3I1IA 1YCFA 1C3EA 1EFPA 1T4CB 1RQLA 1NNLA 1ORDA 2C20A 2Z9DA 5CLIA 1YZ3A 2RGUA 2WP0A 3SSOA 1E7YA 4ZEVA 1WB5A 5HR5A 1Y3AA 1NA5A 1R15A 5I01A 4RLFA 2AFHE 2ZJ5A 1D2MA 3V2HA 2QGNA 2E87A 4Z4GA 1WMAA 1FS5A 1NY5A 2XCIA 1K97A 3BKWA 3OQ1A 5DFAA 1P2SA 2WAMA 4KXMA 1XZKA 1ECGA 2HU2A 4KQKA 1PS8A 1TQ8A 3GRYA 1S8NA 4Y0VA 2RDMA 3A06A 1Z7YA 4JBHA 3RRZA 1RI2A 4N47A 3AOEA 2QE7D 2FW6A 2HJVA 3E23A 3H11A 2NU7B 3CXRA 1RWBA 2V5AA 3B9BA 1X42A 3WGVA 1GOTA 1PVOA 5DB4A 4ID3A 3GQBA 1I4EB 5DGHA 2NOAA 3H8VA 3URKA 1JFTA 4GO1A 4EG5A 4F6RB 3HCCA 4BNFA 3LQKA 3OEWA 1ZISA 4IIJB 3SC3A 3THRA 5FOXA 5CG1A 2V0NA 2OAEA 1JIXA 3IC5A 3K31A 3K5WA 2BDTA 1DEXA 4ZT4A 3USCS 4AO6A 3WP0A 4IAOA 4CLOB 3THYA 2A5GA 1Z56C 4BNHA 4H7PA 2CL7X 2IKSA 3TCNA 3PU6A 1K8XB 1P1FA 4V02A 4P0QB 2OKGA 4JSRA 1FRZA 2V97A 1T4CA 1V8FA 3E2IA 5LIPA 1F2TB 3GLSA 4B34A 3HI4A 2DFPA 1E3IA 1T0BA 3KOUA 4KAAA 3CRVA 3JRWA 4KR0A 1GGNA 3LGXA 3O90A 2Z83A 3WY9A 2ZM5A 2V7UA 3E9MA 4X64B 4MQ5A 5CM8B 3ZNNA 4ZKEA 1RACA 1YB5A 2XMSA 1KVSA 3GLUA 3IX7A 1IXYA 2WHPB 3QRWA 1EINA 4GL2A 4R51A 1NN0A 3W6OA 5LD2B 2QE6A 3AHFA 1ISMA 1NI3A 1SC3A 2ORIA 3ZD8A 2XNJA 1OILA 1LK5A 3O1IC 2CXQA 4LRXA 2I54A 1UMCB 2WJWA 2XKAA 3L04A 4U2DA 3HO1A 2P4QA 3W06A 1QIMA 4F6RA 2HLHA 5AI4A 2XUIA 4NE2A 2BEUB 2I4NA 1KETA 3BCSA 2JK0A 5C0OE 5DTIA 4IIGA 3AHCA 3WRXA 4Q9IA 3DMTC 4L22A 4S05A 2AXQA 3LDUA 5AKKA 1G4HA 3WV4A 421PA 3VNAA 4BN5A 4D0SA 3A1TA 3E1KA 4HLQB 1Q7BA 4DLSA 3D0RA 3RYHA 1GPH1 3TJRA 1YK0A 2Y05A 3BIXA 3Q9UA 3CURA 4Q3LA 4JOCA 3RRYA 2XF2A 1T5HX 2WG2A 5AYVA 2H7CA 3FUWA 1MCZA 3FFBA 4H18A 1G18A 3S1LA 3TQHA 5C8XA 2A6PA 3QQPA 2KLHA 1GVNB 3WBKA 4ZTBA 4CT4B 1KQFA 1H3EA 4BLVA 4ZPXA 4G84A 2WFMA 1RWKA 4BBAA 2GD2A 4INPA 4ENRA 1ODIA 2EV9A 3U9SA 4ENWA 3DS8A 7GPBA 1EFDN 4FJ0A 1PX2A 2OQ2A 4GMXA 1DQSA 3UOAB 1VHTA 2BFAA 3FOWA 3NC1C 1JQKA 2WHPA 1QE0A 3M1AA 4W5JA 3HM9A 1FSPA 2WT8A 4JXJA 1TUIA 3R6GA 4I50F 4WEQA 4NS1A 2AN4A 1MO3A 2DRIA 5FBLB 2GYVA 2QRMA 1KH3A 1UMCA 4HH4A 2VF5X 3AEQA 3AHHA 4WJLA 3S3TA 3AVYA 2BEUA 4WACA 1HOTA 3PEFA 5GP1A 4DLBA 3UXEA 4OQLA 3ZEIA 1KH2A 1ZOSA 3B1ZA 3DDWA 3HFRA 4X95A 2FWPA 4PLHA 2BCGY 4JC4A 2IUFA 3EQ8A 4RHFA 2PL9A 3A9RA 3MGGA 4RFLA 2Y0PA 5K1ZA 3W5IA 3RUCA 1EBFA 5LP6F 4LHXA 1B15A 4RX1A 2PMEA 4R1TA 1U7XA 2J5XA 1XEXB 4DLRA 3D8TA 2ZUVA 5IT9A 1YHYA 1GLGA 2EW2A 2W58A 2IP4A 5JO9A 1RLIA 1Z4LA 3MIIA 1UP7A 1TC2A 1WIWA 2P9BA 4IVRA 1Y7IA 4AS1A 2B0CA 3RUPA 1NOKA 1OC4A 2JPDA 1NQ5A 3WR5A 2PQ0A 2GHRA 3H4IA 3OX3A 4LJSA 2GEBA 5DCUA 2C9ZA 4DCNA 4Z4QA 3L4BC 2EBFX 3NP9A 4CV0A 3QKSB 1KJ9A 4M86A 1R1DA 1QNLA 3D7MA 3QVOA 2WAOA 2OENG 2WSSD 4GUAA 2O2DA 4DC0A 3TFOA 5FI5A 3M2PA 3KZCA 4OGWA 4Y7CA 4BNIA 4C76A 1T0PA 1UXGA 3ETCA 3FCAA 4AWXA 2XD4A 3V4FA 3UB3A 3TTYA 3T3MB 3QE3A 1WMBA 2CT8A 1NMEA 1PR4A 1UIRA 5EMNA 4E14A 1CQJB 2VEDA 1NSYA 2DLDA 2YIJA 2AHOA 3AP1A 1K7CA 3SDZA 1VKOA 4PLVA 4BVEA 2NTJA 1RD4A 4KLCA 2OWEA 3JQGB 3LL7A 2A1TS 2FMIA 3PE4A 4HADA 5JS6A 1GPKA 3C3YA 5KSWB 1U8CB 4JHLA 4R9UC 1BWRA 1XEXA 3FVVA 3L06A 4LISA 3HU2A 2GN0A 4D8YA 4F21A 2OP1A 5D1HA 4Z1MD 2I91A 4DSUA 1SKAA 1R8QA 2OHVA 3KAKA 1JKIA 1UQTA 3H9BA 2DCUA 1Y6GA 1FFCA 5IAOA 1ZCZA 2MSDB 1WDTA 2HIAA 1Q1NA 1VCHA 2QUZA 4X85A 5AM1A 2ECOA 2G80A 4HUQB 2HDWA 9ATCA 2ERCA 1QANA 3QVMA 1UPFA 2JDIA 3A6PC 3PUKA 1XR3A 3DVQX 3C1OA 5ABPA 4KYVA 2W4QA 4YDHB 4B6QA 1DO2A 2PNFA 1G5RA 3QENA 1B8PA 1KMMA 4I19A 3QKSA 1K63A 4BGVA 5IT0A 3I23A 4AFNA 4NTZA 3AF5A 4I5FA 1KOLA 1Y6RA 1NRWA 1J2YA 4KK3A 4RSRA 4DNOA 2PLNA 3RV3A 5HGXA 2JG3A 3W5HA 2GZMA 2VJLA 2Y27A 3DP9A 2HA6A 1WSDA 1OH6A 5LQMA 4DA6A 7ADHA 1ZGZA 2XJ9A 3SHOA 2ZRAA 1FLNA 3PFIA 1Y7TA 3EDRA 3NBKA 4NP6A 3IAM1 4FOPA 1EM6A 2XRFA 5AICA 3T38A 5CA1B 1AJEA 3DJFA 4ZVNA 2BMFA 4C3ZA 5MGNA 3E15A 1CQJA 2B36A 3GFTA 4RYDA 3RWBA 4GICA 5DGXA 1P2GA 1Z26A 2QE7A 2WVJA 3F3MA 2G72A 3BGSA 3HJHA 1NE2A 3JQGA 3L1KA 3S2EA 3WQBA 4NE7A 1YAHA 3MZ0A 1WDLA 2PL1A 1GU0A 2FN3A 2O6HA 2MSNA 4X71A 4PHGA 1J90A 1YASA 2ATIA 2PVSA 2PRJA 5L7TA 1A8IA 3VO1A 1BWPA 1C7ZA 3OA2A 5ECGC 2GCEA 2GK6A 1P6UA 4LVUA 4UAGA 2KI5A 2QRGA 4HUQA 5AW3A 1M6NA 4L78A 3STTA 2VK4A 3ABZA 5BWNA 2HO4A 3DOHA 1X8JA 5ALHA 3UC5A 4TKVB 3BXHA 1EEHA 1LPMA 5FPTA 2X0IA 3AJ8A 2JNWA 4GKAA 4H31A 3FHCB 4HLUC 3R3HA 3PQ3A 1M9NA 4NBSA 4MYDA 1F06A 2V8OA 4G0ZA 4QARA 1PZGA 4X44A 3NCTA 4XLLA 3C4JA 5C8VA 3PGJA 2EYUA 3W6UA 1J70A 2XIJA 2XCSB 1FU8A 2PFGA 1NDUA 2XCLA 5KYVA 3GUHA 2C5LA 2P1DA 3FSJX 2CF6A 2N1BA 4J0QA 4O8CA 1Y1PA 3M4YA 3WL5A 4BO9A 1T3HA 4DVJA 5LLDA 1AUVA 3ILYA 4BVLA 1Z6AA 4J7XA 5COAA 3TUJC 4MUKA 5CA1A 4B81A 3CB2A 5TS3A 2TECE 2Q5JA 3NJ8A 2AK3A 2CLOB 2IVFA 4HQNA 4L27A 3NT5A 1HRKA 2COEA 4O0MA 2OC9A 3NOVA 5EWJB 2JGFA 3TLMA 2BGMA 4YCSA 4IIXA 3V46A 4KWIA 5CNKA 5FR1A 1BMQA 3A6GA 3P97A 3DBIA 5EJ6A 3T7RA 4WQMA 2QLNA 1EFKA 2IRWA 4HGNA 2D74A 2FWNA 4LCBA 5KSYA 1YGPA 1W4LA 3SVLA 4XIIA 1UBHS 1P61B 2HCTA 2PGDA 1N92A 4P2BA 4JBIA 2XB9A 1ONBA 4JP5A 1CP2A 1M0SA 3UJBA 1DTWB 2ZZNA 4TKVA 3UTCA 4E5DA 3CG0A 4UM8B 1RIIA 4DEYA 2M32A 2MIIA 3IT1A 2PT6A 4WY8A 3F5QA 1FVFA 4HI0E 2H52A 1VJ0A 5JHGB 2VPXA 3LY5A 2K87A 4QQNA 4I4LA 4XD7D 3IAFA 2C97A 5DHPA 5JECA 2EKZA 3OF5A 3CLTC 3THSA 2D5IA 4A3SA 1J07A 2G07A 3FPLA 1GQOA 1P73A 2G76A 2HYDA 3FSRA 5AVWA 1MQSA 4KE8A 1CHDA 3SYNA 1CW2B 4RTLA 1U99A 3FY4A 5EE9A 1PR1A 4G4JA 3WKCA 1Z0FA 3HA2A 4UE2A 3TFWA 5D5PA 3C8ZA 2XOXA 4WTOA 3DEJA 5CX1A 3U7QA 3GCWA 5EWJA 1Y8AA 5JVDF 4BFZA 4HNVA 3O47A 4OK5A 5B7PA 3PEVA 1V6AA 2VP4A 1AQUA 1MXFA 4MGIR 4NYMR 5FA8A 5KWEA 1C9YA 2ZI4A 3DDCA 3R7BA 5SZKB 1O6BA 2XF8A 3NETA 5JZSA 2NPIA 3B1KA 3ZZ1A 4E2YA 4QU9A 2XVZA 4Q3KA 1GHTA 1Z5WA 1LDYA 1YMQA 2C9OA 2V6MA 3B7WA 3KJFA 3O1HB 2J09A 4M0DA 1FFYA 4C01A 1DTWA 5CHYA 5H68A 5REQB 5FCDA 1D2AA 4L9SA 3CPEA 4CFYA 5UKDA 2H5IA 1RWMA 2G9UA 1LQTA 3ND9A 3I30X 4BWYA 2O4UX 4BIMA 4A0QA 2HPZA 1O1YA 4TN5A 2FOLA 3FLAA 1YJ5A 4L0QA 3SEAA 5TGTA 2Z8XA 3MPUA 2IYZA 2M6KA 1U28C 1U1FA 1KQPA 1VBFA 2ZS8A 3DFIA 4F5ZA 2YBEA 3QIAA 1AQIA 4ZJPA 3K9WA 1RHJA 1F9AA 5DDIP 3Q5GA 4RVFA 5I5GA 2ZBQA 1KS2A 2EX0A 5DGTA 4DJTA 1ZK2A 2B2CA 1JKFA 3OO0A 4X7RA 2QTMA 3E9YA 2RCYA 5ALQA 3U4AA 5IT4A 2PUVA 3MGCA 5JS1A 2WEKA 3OLVA 2OVFA 4YI3A 1U0EA 2FU5C 1TZJA 4YRCA 2J4DA 1DQNA 1ML3A 1ZC4A 3M1IA 3NB0A 4O08A 3NXSA 2KQUA 4MWDA 1YNSA 4PLGA 2YHBA 5D6NA 3AKZA 1KKLA 3CLKA 2WSSA 3EJWA 3JSXA 2NT4A 3OFJA 4FXOA 4UUQA 4EG0A 3RYFB 2IE0A 3PPIA 1JIIA 1XZLA 2QV0A 3HL4A 3Q7QA 4A8JA 5AD1A 1UP4A 2A94A 1LCIA 1XE3A 2QK4A 3EEBA 3T12A 3VO2A 1YU6A 1C3OA 3M6AA 4QRHA 1W48A 2I2DA 1OT5A 1XLWA 2WM9B 3KLMX 3WXBA 2JA2A 1L4UA 3GUZA 4EBBA 4A36A 2OZVA 2IH4A 3SYLA 3K4PA 5REQA 4HYEA 2DPLA 3RW9A 1XN4A 3MBKA 4PO3X 4E15A 4I6EA 3B6KA 4LF8B 1Z74A 2PCLA 4UFOA 7REQB 5BSHA 1VG0B 3OQJA 1E79D 1VGVA 1ZO8A 1W6RA 2FRDC 4Z1MA 5BV7A 3N74A 2XMCA 4CKCB 3KS9A 2YN0A 2IH5A 4DF3A 2AMLA 4CCAA 2C5SA 4R2HA 2V58A 3V4RA 3JRXA 3B9RA 5EE3A 3V1NA 3W7VA 1EGHA 5EJ9A 4RD6A 1X7XB 2O2IA 1NW9B 4D5GA 3IP9A 3PBKA 4ZOAA 4E1VA 3HVRA 1H2RS 4QTZA 3SYTA 1WXHA 1BYIA 1UP6A 4NJMB 3RBZA 5JISA 3WLOA 3L7IA 2RAFA 1OB5A 4L57A 4GW3A 4YRGA 1E1YA 2Z6VA 1S1CA 2B2NA 2I3GA 1T8PA 2DH6A 2ZSJA 2ZXFA 4RY2A 5FA6A 3P9YA 3AR8A 3RYFA 3HYRA 2EARA 1KSHA 4BMDA 4V0OA 2IOYA 1GTG1 3H13A 1JHUA 3QPWA 2AWOA 1HDXA 2DG2A 2RKBA 2XKJE 3O2NA 2ZI3A 4QLAA 2GTPA 1ZKDA 2ZWIA 1CQWA 5T64A 1U5AA 3EIOA 4PX3A 4AJ2A 1SD5A 2P2NA 3OCZA 1QDLB 1XU4A 1R0RE 2CJWB 4LV5B 3SOZA 4EY4A 4ZCTA 2XZLA 4CMEA 3QKTA 1S3SA 3DOFA 1ID8A 1YI1A 4J2TA 4MKGA 5AQ1A 4ZEWA 2DKFA 3EXAA 3DHWC 3MM4A 5JNRA 2FPOA 3LJKA 4I2NA 4NDAA 2IUEA 1CF4A 4U39A 4EMUA 3PNYA 2Y0CA 3B89A 4PCAA 5TT0A 4CL2A 2N47A 3EG9B 5JS2A 3HYNA 1TQDA 4JENA 4Q4HA 2IUSA 2ZJ2A 3FOAA 3RANA 4QNMA 4LZOA 1Y8QB 4BKOA 2JFZA 4YMLA 3IUMA 3JPYA 1X7XA 3CS3A 2C98A 1E5QA 1RWXA 4P32A 5J2TF 1AUQA 1IQRA 3HKBB 1EFAA 2GEJA 1PZNA 4Y9TA 3NT4A 1E3JA 1XEWX 2HU7A 1RC0A 2YW9A 4UQLA 1XMIA 4YACA 2FFBA 3LF1A 3VZSA 3ADOA 1E3SA 1WDMA 4DIMA 1Y82A 2JAWA 1DRUA 1NJ2A 1R4MA 2BBWA 1DBPA 3C5WP 3DBHA 4L5YA 4MV7A 5TQVA 3W3AH 4WBNB 1N9GB 1XRNA 4QPDA 2YWJA 1BA2A 3S4YA 3O3NB 4EL0A 3WDSA 3OLQA 2C1ZA 2BI8A 3QHAA 1L4YA 3PITA 5AJWA 4IOKA 3O5AA 2ANCA 4GP9A 4YCAA 1BFUA 1TU0A 2M6RA 2CJWA 3WLRA 1YRLA 4MYHA 2F00A 3HHEA 5IXYA 1TX4B 4PZCA 4CM5A 5FI3A 1S4MA 4RVGA 1K9VF 4YJ2B 4HPXB 2M98A 3U5TA 4ZAZA 5BSTA 1N1GA 4MNTA 1OJLA 5CGZA 5F1PA 1U0BB 1KP2A 4U00A 1JX6A 2VN8A 3BWMA 2OQVA 3PENA 5I9BA 3QY9A 4ZJYA 1M0EA 3R5HA 4F86A 1Z35A 1Z4KA 3NHZA 4M9XA 3HB0A 5IBCA 1HBJA 4UBLA 5B2ZA 2FP4B 1F1BA 1KYZA 5BY2A 3HKBA 4FGKA 3T7IA 4UUOA 3O0DA 1L4KA 2WU3A 5FOWA 1J33A 4DANA 4XD7A 3VDRA 1DEAA 4JKOA 3R0ZA 5ELXA 1V1MB 5BSEA 1Z8DA 5IW8A 3KVNA 1SKYB 3BXEA 1A3CA 2ALJA 4QX6A 4HVCA 4R1MA 1Z62A 5EQJB 4WLEA 3AFOA 4WCVA 2DKOA 4DPKA 1C3LA 1A2BA 3GA7A 4FWIB 4WBNA 3HXOA 1NMXA 4YAOA 4AO7A 5KOIA 3P71T 4YRZA 3U09A 2BC9A 5A4AA 1QTIA 2NO1A 3N8KA 4JJGA 1YDFA 4UBNA 1APBA 1E6CA 4GM0A 3VZBA 4MP8A 2OBYA 1NASA 3TECE 3A6EA 4GYYA 4YFYA 1XAJA 2GM9A 3B6JA 3C6MA 4B7ZA 1D09A 4GBMA 2AT1A 2EG9A 3AB3A 4ZU3A 1A5ZA 1F1JA 1L8LA 3RS3A 3CW9A 2P8JA 2PUWA 3AU9A 3QXCA 2FHPA 3VR2D 4YJ3F 1SVLA 1QHGA 1W581 1WCYA 1E0AA 1VPDA 2DAPA 3QUAA 5ITVA 5IVKA 4HF7A 3R9WA 3FUUA 4NBRA 1KZYC 4J9VA 5HM8A 4KBGA 1I33A 3WGKA 1OXMA 3L05A 4LF9B 3CRMA 1EP1B 3OZVA 1J00A 1V1MA 4G85A 1E3WA 3RTBA 2XGOA 1Z08A 4CKYA 2FSIA 1MX9A 3DF7A 3DFFA 1N5IA 3BGVA 5BUZA 4KKXB 1PUIA 1LI4A 3GT3A 4XGQA 4IDCA 1H8HD 4OIFA 1CNFA 1W6UA 5CURA 2D5LA 2JLRA 3QJYA 3R0JA 4HEJA 3L8GA 1N5OX 2GPJA 5CBKA 2H9AA 1XALA 1RAAA 3KSDO 3LMKA 2VPPA 1Y9DA 1U9YA 5TDHA 2ZTLA 4UHBA 1NLYA 2P68A 5CFQA 4IDPA 5LZ4A 2B98A 2CUNA 4UOZA 5CVCA 1NN1A 2BJWA 4ACBA 4TZ0A 4E03A 4QOJA 2H8GA 1DDOA 1TB4A 8LDHA 2QVBA 3FWNA 5EINA 4CV1A 1Q91A 1J9EA 3DMPA 3NLLA 2BEWB 1TM1E 2R68A 2R66A 1KZ7B 4IW3B 4PNZA 2P75A 2VH1A 3BWEA 4F4JA 1ACJA 1PJ4A 1N0UA 3L6BA 4GZ5A 3ZWDA 1W59A 2AMJA 3IIKA 5FPHA 4BASA 4O2AF 5LZ8A 1E79A 5K3DA 5KX5B 5LZ9A 1AV6A 4FYYA 1P72A 3L02A 1KQOA 2QMZA 3LIPA 1HDGO 1MV5A 1QAQA 3UCXA 4DABA 4EGSA 2DWQA 3H5IA 2VYCA 5KOJB 1PJAA 5DI3A 3T1OA 3S68A 1C1DA 5ED0A 3PE3A 5DBEX 3C6YA 5C3UA 3JD1A 4FE4A 4LQCA 1XMQB 2G63A 3LL4A 4DRYA 4NSNA 2JLSA 1FX1A 1M1YE 3PNKA 4K9MA 4JIMA 4LIPD 2RAPA 4Z4EA 4U2GA 3UH1A 1NV8A 4WXEA 3U80A 1J7KA 2YZ7A 2G7MC 4H4DA 3KJEA 4NYJQ 5JCOA 4BC0A 4BNDA 4IDNA 4P3PA 3RS8A 5L8VA 4C3OB 4TWRA 1KP9A 5E3JA 4BNUA 2OPHA 2OWDA 1NBME 3S27A 4YHHB 3QLUA 3HCFA 1SUBA 1XP5A 1BWSA 1M76A 1ZQ9A 3M34A 1RLJA 1A9SA 1SZPA 3KEQA 4J43A 4TLAA 3M0EA 5E7IA 2C83A 1WF6A 4YT4A 3DUFB 3BGIA 4UW9A 4EAAA 5A02A 4K86A 2AKAB 2BEWA 2VSFA 3F6YA 1VMAA 3NORA 2MMGA 3JQRA 4PG5A 4WV3A 4ZVUA 3NMUF 1N2ZA 2C4UA 3JQQA 5B3AA 2BZSA 2EJVA 4WERA 4N7JA 1MDBA 2PBRA 1I6WA 4ZYTA 1ZC3A 5KX5A 2I9KA 1UPBA 5A7HA 5KNDH 1NX6A 1U8UA 3PUIA 4YAJA 2I6XA 2WFZA 4PIMA 2C0QA 4TS9A 4HB4A 5KOJA 1VLJA 2D2FA 2JCVA 3EF0A 3ENKA 3KV1A 3PUYA 3LLVA 4DR7B 3X1KA 5DM2A 3OZCA 3U4IA 2IHNA 4C0XA 5JASA 1MT0A 4XM0A 2C82A 2OP0A 3JQBA 4GNKA 5CNIA 4ZYYA 3RS5A 4D5EA 1TD9A 1E2KA 4ND4A 5SICE 3TRDA 4E5VA 2O6LA 2ZJBA 4OL0A 1LFDB 4G97A 3L7LA 1I4OA 3GPLA 5CDGA 2GFQA 4F97A 5BUCA 3PKZA 3L8HA 1H2EA 2QR3A 3UN1A 2RBGA 3NG1A 4MYUA 4ZDKA 4F9FA 2I34A 2RB4A 2SNIE 2R60A 4M1YA 3KALA 3ROGA 2ETXA 2OZKA 4MUNA 1VBKA 3DUFA 1X8LA 1ZR4A 3V2UA 2B4AA 4PSCA 4ZP1A 4IZHA 2BGJA 3G1WA 4RKFA 2M1XA 3TQFA 3TNFA 4ZZIA 2BTOA 3DE5X 3NALA 1H6DA 1ZWLA 3G85A 3MRVA 2O8CA 1Y8RB 5ENVA 4PWZA 2HU8A 4EZBA 4FN4A 2QDKA 4FGWA 3U2QA 2HNBA 3CJQA 2Z6AA 1TDJA 3H2GA 2XYVA 3DLTA 3FROA 3K05A 3EZXA 4KIJA 1VJDA 3TYXA 3NEJA 2QA5A 5DRYA 3SJCA 2OMEA 3U9TA 4E08A 1XNJA 4K7JA 4F9GA 5AW8A 4YMUA 5HOEA 3R0VA 4JX9A 3IE0A 4E32A 3M70A 5CB6A 1FNMA 5TXGA 4FS8A 3GFFA 2QUHA 1SURA 3IMGA 2Q07A 1JHVA 3FMFA 2HN9A 1UBEA 1GPUA 1BFKA 4FXPA 4CGZA 4BBJA 1B0PA 3L6CA 1LPSA 1Q14A 2IYQA 1H4TA 1VCIA 4TVOA 4KLNA 1BGWA 3KD2A 2W4IA 4JJKA 3AMVA 5AUNB 2GBFA 5JEEA 4MQ6A 4KPYA 2XTNA 1P1KA 4XWTA 4YDQA 4FLMA 1ZESA 1YV9A 2AC7A 4MLDA 2JVKA 4XPIA 3TQSA 3WBFA 1U0SY 1WQ4A 1X7GA 2I8LA 4RA6B 1FFXB 2O2YA 1EHCA 5E4TA 4E3ZA 1KQ3A 1VLHA 4ZXPA 1KAGA 4ARSA 3U39A 3I42A 2P79A 2QRZA 5ADUS 3QNMA 2CMGA 1B0AA 1D7AA 2NYAA 1SUPA 4P3OA 2XCTB 2NP7A 3ZNPA 4R8MA 3FRIA 2FAXA 3NXKA 2Z2YA 5EIBC 5BWLA 3O94A 5JDCC 3KYDA 2FSHA 3PHLA 2VPYA 2CXOA 2G1JA 4RSGA 2YHAA 4UVEA 3O2QB 4GWKA 3VR2A 3TUZC 4JB0A 5AOVA 1GYRA 1UR5A 2O2SA 4YP1A 4OXNA 3EWIA 2PAFA 4QODA 3T0IA 1P7ZA 5B4UA 3TGPA 2YWGA 2ZJFA 1QH8A 4L2IB 1Y81A 1HFJA 4A4DA 4N03A 5TVKA 2OO3A 3GWZA 3FN4A 4BO0A 3IB3A 4WRRA 3GARA 4BKPA 2RGEA 2YWFA 3R5JA 4D9CA 1PZHA 1IBSA 2X5XA 2XWSA 1T9DA 3BRCA 1GGFA 5AI0A 3STUA 4C7MA 1ENYA 4EO9A 1F7VA 3O8OA 3C3JA 4M0FA 3NHJA 2VF8A 1OXKB 3C3DA 1KAQA 1T8UA 2CL6