4XCXA

Methyltransferase domain of small rna 2'-o-methyltransferase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
216
Chain Sequence
QFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGVDINEDKLRWRGDSLAPFLGDFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSGDLARFPEVVFGYLSPSMIVISTPNSEFNPLDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPGAENVGYCTQIGIFRKNQHDQHVYKAVFTTSYPSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human C1ORF59 in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Small RNA 2'-O-methyltransferase
total genus 63
structure length 216
sequence length 237
ec nomenclature ec 2.1.1.n8: Small RNA 2'-O-methyltransferase.
pdb deposition date 2014-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4xcxA00
5KVAA 5T64A 2ZZMA 2BR4A 1JSXA 3CC8A 2P3OA 2PSSA 2IIPA 4OQDA 5DRTA 3GIWA 5E9JA 1WY7A 2YXDA 1Q0TA 3ORHA 5K0LA 3G2PA 4U7TB 2YQZA 2P40A 3B3GA 5EZQA 3PVCA 5B1SA 3I64A 3UJDA 3T7SA 3BWBA 4YV0A 5CIYA 4O29A 3OU2A 1TW3A 2PX5A 2VZ9A 1YUBA 3B7PA 4KIFA 5HIJA 4E2WA 5GINE 4C03A 3OU7A 3P2EA 1DUSA 2G71A 3OCJA 5CVUA 5DRYA 5LQRA 1NW7A 5GIOE 1QYRA 1RJGA 3BXOA 3NDJA 3FYCA 1XDSA 4GC5A 5T6BA 4X60A 4OBWA 3P2KA 3K0BA 4GBED 1SKMA 3HVHA 3MCTA 1XTPA 5DXJA 3EEOA 2NXNA 3SXJA 3A27A 3MAGA 3BWYA 2JJQA 3U81A 3M6XA 3R9XB 3EMDA 3V97A 3SGLA 5KYGA 5LQCA 3A7DA 1MHTA 3AWIA 3CVOA 3GNLA 3VSEA 3ID6C 4DA4A 2I7CA 3KPUA 5DM1A 3HA7A 5EKUA 4E2YA 5E1BA 3MHTA 3FTEA 5DLYA 3C3YA 2IFTA 3THSA 4YUYA 1JG3A 3TOSA 2HMYB 2P3QA 3UFBA 4POOA 4PYNA 4C05A 3ERCA 3HVIA 3Q87B 3FRHA 4NECA 3NDIA 4FS8A 3B89A 3FUTA 2ZZNA 4HSGA 1RJFA 2B2CA 3HCFA 5LQAA 5CCXA 3I53A 5HOQA 1VE3A 3CKKA 1QZZA 5CVVA 4PGHA 1AQIA 3GRZA 4PCLA 4ZTBA 4PWYA 1VPTA 2Q41A 2ERCA 5EIWA 4DMGA 3DXZA 1N7IA 4EKIA 1AQJA 3IHTA 2BZGA 3REOA 2IDJA 1NW5A 5HFJA 3KQVA 2ZBRA 2FK8A 1NE2A 1P91A 1XCLA 3A4TA 3NTVA 2BM8A 3BKWA 5DM0A 2F8LA 5C1IA 1SVUA 2IPXA 3G5LA 3H2BA 3DH0A 1QAMA 3UJ8A 1FJXA 5EZSA 3P8ZA 5E1OA 5EIFA 3PX2A 5BP7A 2ZVJA 3KR9A 4FSDA 1FPQA 2Y1WA 4KIGA 2ZSUA 3FZGA 5D1NA 5E8RA 3SSOA 4BP1A 1YFLA 2G1PA 1NW6A 3B3JA 2CKDA 4LECA 2N47A 5DT2A 1SUIA 4GOOD 2PX8A 2GS9A 4PYIA 1JTEA 3BWMA 3DMHA 3OFJA 1O9GA 4M37A 5D1HA 2OY0A 1ORHA 2YX1A 4LG1A 4PONA 3EGVA 1EG2A 3HCBA 3GGDA 2OB2A 4C07A 1KYWA 4FR0A 3G2QA 2P1DA 3LCUA 3T7RA 4KVZA 3X0DA 2H11A 5K0GA 2GA9A 4OBXA 4E30A 3G8BA 4XCXA 4MHTA 3IV6A 3MB5A 1G8SA 5U4XA 4F84A 2VDVE 1N7JA 3EMBA 3QOWA 1R74A 3ELYA 4CXMA 3DMFA 3NJRA 5BXYA 4KW7A 2IBSA 3VC2A 2PT9A 4FSXA 1IY9A 2H1RA 4R05A 2B78A 4IV8A 3FRIA 4HRAA 5FCDA 3DXYA 3LBYA 3R0QA 4L7VA 5K0BA 4B17A 3BUSA 1P1BA 2EJUA 3BGIA 5GOZA 2AOXA 3TKYA 2NP7A 3GRRA 2AOWA 4M38A 5M5BA 1RI3A 3KPYA 4RTSA 4GC9A 2OXTA 2QM3A 4ER7A 2FYTA 5FHRA 5GM1A 1MJFA 1KIAA 1BOOA 1X1AA 2P7IA 2WK1A 4PGGA 2OYRA 4BLUA 2R6ZA 4ER3A 2EG5A 2VP3A 3AXTA 3MTIA 4PYJA 4YUVA 1EJ0A 3UJCA 4ER6A 4MQ4A 1RJEA 2DULA 5ICGA 3DUWA 2PKWA 1BHJA 1KPGA 4GOMD 3TPZA 4AZTA 3FYDA 2CMGA 5DSTA 1VP9A 3JWIA 3KPWA 5F2OA 3EEYA 3HCDA 4X41A 3FPFA 1JG2A 1V39A 2JH9A 2DPMA 4C08A 2IBTA 2JHPA 2NP6A 2QE6A 5C0OE 3B5IA 4YMHA 4CKCA 2I9KA 4BY9E 4RTKA 5K8VA 2P3LA 2P41A 2OKCA 5IH3A 1JG1A 4AZWA 8MHTA 3Q7EA 1NBHA 1Y8CA 3KQYA 3EVBA 4QDKA 3TR6A 2Y1XA 1FBNA 4YV1A 3LPMA 3OPNA 3GWZA 5DX1A 3EVFA 4PYMA 4RV9A 1WG8A 3LKZA 2IH2A 1G8AA 2V74B 3L8DA 2GPYA 3KHKA 3SSMA 4PNEA 4OA8A 4Y2HA 4F85A 4HH4A 4GQBA 5K01A 2EFJA 5ICFA 4PYKA 5C9ZA 5K05A 2C7OA 2JHCA 1SUSA 2P8JA 3P9CA 3P71T 5DPMA 2Z6AA 5EEHA 3LKDA 1I1NA 1QAQA 1R18A 4ER0A 3DXXA 3SR4A 5HIKA 4HC4A 1D2HA 1VLMA 5E8JA 3NVMB 3EVEA 4C4AA 4P7FA 4PYOA 5CVEA 1IM8A 4QVKA 3FPJA 5EPEA 5HIMA 5K03A 3MGGA 1IXKA 2ZWAA 3ER9A 3OE5A 1D2CA 3G5TA 2EJTA 2V7EA 3LGAA 1VL5A 3FPHA 3EPPA 5CCBA 1G6Q1 4ER5A 1VBFA 1QAOA 2I62A 5E1DA 2CL5A 1B42A 3P9IA 2NXCA 2O57A 4MTLA 4PIMA 2G70A 3BGDA 4OA5A 2ADMA 4RVHA 3GO4A 3DLIA 2ESRA 3T7TA 4YUXA 2ZCJA 3OU6A 4E2XA 3I9FA 4LWOA 5EOVA 2AS0A 2QRVA 4AUKA 3MQ2A 3AJDA 4P58A 5GWXA 3DR5A 5DTRA 3M33A 3KQMA 5E9QA 1R6AA 1AF7A 3CJTA 2BR5A 3SM3A 2FCAA 1XCJA 2ZLBA 4RTRA 2OPBA 5GM2A 1KPIA 4BLWA 3LSTA 4YUZA 4KRGA 1Z3CA 3OZSA 4CKEA 4P7JA 5HZMA 1PRYA 3FUUA 2PXXA 3HCEA 3QOXA 3RODA 2PJDA 3G7UA 2GLUA 4X61A 4FP9A 4QVGA 5K0CA 4RVFA 2LD4A 4CTJA 3BZBA 1ORIA 1XDZA 3HNRA 4X1OA 1JQDA 2HTEA 3UZUA 1R8YA 2A14A 3ELWA 1R8XA 2NXJA 3VC1A 5EG5A 4HGYA 2Z6UA 4QPNA 4IKPA 2BH2A 1EQAA 1NV9A 1SQGA 3ELDA 4PYLA 5CUQA 4C06A 4CTKA 5HEKA 2UYOA 1ZQ9A 1F3LA 1L3CA 2OBFA 5FHQA 4E70A 3LCVB 4RTJA 4IV0A 4YUWA 1YZ3A 3KR2A 1TPYA 2PLWA 3CJQA 5E2BA 3PT9A 4P7KA 3TMAA 1RJDA 3UBTA 1AV6A 2B3TA 2FHPA 5ICEA 1UWVA 4RSRA 3E7PA 2AVDA 4XUEA 3EGEA 2ZBPA 4RYLA 3FPGA 3KQWA 3AY0A 3O4FA 3KQQA 4U7PB 3IYLW 3KQOA 3LDFA 2B9EA 3KKZA 4OQEA 2AVNA 3E8SA 5E2AA 3P2IA 5DX8A 3UJ6A 5HILA 4RTPA 1QANA 2ZIGA 4P7GA 2I6GA 5H02A 2YTZA 4HG2A 2YR0A 4PINA 3UA3A 5G02A 4JXJA 4BP3A 3KPJA 5DX0A 5EHGA 1N2XA 3LDUA 5FWDA 5LQNA 4AZSA 5JR3A 2PX4A 3ER8A 4GOND 2O0LA 1VP3A 2ZFUA 5DTMA 3SX0A 3BKXA 4MIKA 3G88A 4YMGA 1I4WA 4MWZA 3TLJA 2OO3A 4RTOA 4OX9Y 5EMMA 4M7RA 3HVJA 4Z2YA 2C7QA 1Q0SA 4DKJA 1XVAA 1RI2A 2QYOA 1TW2A 1SQFA 2PT6A 4HTFB 5FA5A 4E33A 1L9KA 1UFKA 2AOTB 2AN4A 4HGZA 4M36A 2QY6A 1FP2A 3P9KA 4XUDA 1PJZA 4Y30A 4HTFA 2G8NA 2PY6A 3C0KA 5EHIA 5BW5A 1OR8A 2AOVA 3GDHA 3MCZA 5LQKA 3JWGA 3DOUA 5DXAA 3NMUF 4EMSA 5JUWA 3KPVA 2FPOA 1NKVA 1JR4A 3SVZA 1NW3A 1P1CA 1P39A 3LCCA 4LWPA 4CWAA 1ZGJA 4CKBA 4RTNA 3LDGA 2ZIFA 2ONZA 5K0EA 2O05A 4ISCA 3EVCA 3TM5A 3CJRA 1NT2A 3GJYA 3M4XA 5GP1A 2AOUB 3C3PA 3EGIA 3R3HA 5HIIA 1JSZA 2NXEA 2YXEA 3CBGA 5CD1A 1KHHA 3TM4A 3NWEA 5EGSA 3P97A 4WXHA 1JQ3A 1BC5A 3A7EA 3G89A 4WVLA 2NNWB 4QTUB 4PIPA 1XDUA 1VQ1A 4QDJA 1UIRA 1L3BA 2AN5A 2PGXA 3FPEA 2P35A 3TFWA 5DM4A 4EKGA 1WZNA 3B3FA 3M6VA 4XUCA 5EKXA 4DM3A 2IDKA 3RW9A 5KS2A 1XXLA 5FULA 3V8VA 2VDWA 2O06A 1EJ6A 3NWBA 5EVJA 1F38A 4RX1A 2VS1A 1NBIA 2PVCA 1G55A 3I5UA 2ORED 3BWCA 3LL7A 3WSTA 4E2ZA 4G56A 1JTFA 3KQPA 1KPHA 4EVIA 1RI4A 3HVKA 3PB3A 5K0JA 5F2NA 5K09A 2CMHA 9MHTA 10MHA 3KR1A 2GAFA 1KP9A 2ZZKA 4KDCA 2WA1A 5EQJB 7MHTA 4X63A 3EVAA 4V0QA 1YF3A 2R3SA 3IEIA 1NW8A 2HV9A 3HA3A 2ZWVA 3SMQA 5FQNA 1JG4A 5FUBA 3S68A 3UJ9A 5EMLA 3HEMA 4DCMA 2ZTHA 3FTDA 4YV2A 2AOUA 1KYZA 3CGGA 1JQEA 1M6YA 2IP2A 2QRVB 3PFGA 3GXOA 2EX4A 4GOLD 1DL5A 5CVJA 2IH5A 2ZIEA 4GEKA 3GRUA 4EQZA 5DWQA 3PLAE 3UJAA 3ELUA 3T0IA 3ANXA 2YXLA 3NVKI 1YB2A 4H0NA 2OZVA 3PS9A 3PTAA 2GH1A 3D2LA 3THRA 1M0EA 2UYQA 1EAMA 5KQRA 5E9WA 2K4MA 3E05A 4RVDA 2ZW9A 4R6XA 5FQOA 3M70A 4BLVA 2C7PA 3PFHA 3VYWA 1YZHA 1X1CA 2PXAA 3KQTA 3HCAA 3FUWA 1RI5A 2Z6QA 5LQUA 2KW5A 2AR0A 2B25A 4QTTB 5KQSA 1X1DA 3GRYA 3CCFA 3OZTA 3C6KA 4RWZA 5ICCA 2IH4A 3GRVA 5LQJA 3TQSA 1BKYA 2P7HA 2WA2A 3A25A 1R00A 1U2ZA 1ZGAA 2PBFA 2XVAA 3FTCA 5P8WA 2H00A 4DZRA 2IGTA 1I9GA 1SG9A 3BGVA 5FWAA 5IKMA 4FZVA 4QQNA 4PCAA 2ZULA 4ATNA 4DCGA 2XVMA 4V0RA 3K6RA 5K0FA 1G60A 3DP7A 4PYQA 2PXCA 3DLCA 5FTWA 3TKAA 3FTFA 4QPPA 4RTQA 1VIDA 4AX8A 2CWWA 5CVDA 1NV8A 2ONYA 4DQ0A 2PWPA 2JH8A 2VDUE 4QQKA 1O54A 2BR3A 4EK9A 1HMYA 1WXWA 2NYUA 2ZBQA 1H1DA 1WS6A 1ZG3A 3JWJA 1KXZA 2XYVA 3EVZA 4R8RA 3TRKA 3UJ7A 5MHTA 2PX2A 2AZTA 1EIZA 5K0NA 2OB1A 3GCZA 2XYQA 3M6UA 3RIEA 3KU1A 4FGZA 2AN3A 3C6MA 2JHAA 3M6WA 2UZ4A 2BM9A 3DULA 5EC8A 1X1BA 3BT7A 1INLA 1WXXA 1RI1A 3KR0A 4R6WA 3HA5A 3LBFA 4FT4A 5LR6A 3PX3A 4FT2A 2AOTA 4RVGA 5DSXA 3HM2A 3R6TA 4RTMA 2GB4A 4A6DA 2HNKA 3P9NA 5E1MA 2C7RA 5EMKA 2PV0A 3DTNA 1X19A 5LSAA 1L1EA 5DTQA 3R24A 5GIPE 2XBMA 4RTLA 1HNNA 1O9HA 3FUVA 4E31A 2O07A 3G8AA 3UA4A 4UOEA 2UYCA 3HP7A 4KWCA 1FP1D 3O7WA 5ERGB 2G72A 3JWHA 3G2OA 3UWPA 1D2GA 4DF3A 3EVDA 2UYHA 2FK7A 1ZHFA 3EVGA 3ME5A 5DM2A 3UJBA 3KQSA 2E5WA 3HCCA 2XYRA 4GF5A 2JG3A 1DCTA 1T43A 4F86A 3DMGA 4C04A 4A6EA 3O31A 3E23A 4K6MA 3OE4A 4R8SA 3SSNA 4KDRA 2YUIA 5FADA 2HR1A 3MTEA 3OFKA 5FA8A 1ZKDA 3LX6A 3MERA 4IWNA 5CM2Z 3LECA 1M6EX 2FRXA 3OZRA 4AZVA 1XJ5A 3I58A 5F2KA 5T67A 3A26A 3LHDA 4E32A 3QV2A 3F4KA 1L3IA 4GUAA 2PWYA 3GU3A 2YVLA 3G2MA 1KR5A 5BW4A 3AXSA 1G38A 3HTXA 3FUXA 5EEGA 5EMJA 1YFJA 2HWKA 3NW9A
chains in the Genus database with same CATH superfamily
2K6GA 4IXWA 2GM9A 3VPBA 4LY6A 1W5SA 4CUKA 2BR4A 3EMKA 1T1SA 1TQ6A 2QTVA 2Q6VA 3TJZA 3TJMA 1AE1A 5EPUA 3AUXA 3V1LA 5C8XA 4ZREA 3VUEA 3ZCSA 2XKJE 4AY3A 2J0VA 3CB4A 2R8YA 5EZQA 4DLVA 3I64A 4DQDA 3O4JA 2VZ9A 4LZWA 5ED0A 2X7JA 4U7HA 4KQIA 2XWJI 3OIFA 2ZTVA 3B13B 1Y5LA 3AEUB 1V43A 1AO3A 3DHVA 1THMA 2I66A 3OY2A 4GC5A 1OWNA 4IDBA 4XD2A 3ZTYA 1C1DA 5EIEA 2QMYA 1T36B 2N0SA 1C9KA 3P7MA 4PM4A 2D54A 3FYUA 2AN1A 2EDAA 3W0LB 3HP1A 3WISA 1SKMA 5E0OA 1KSJA 4HPXB 3EDYA 3RK1A 5F7XA 1JLHA 2MINA 1E6LA 4HLUC 4M54A 4HAOA 2EKPA 5JU6A 3EMVA 5CITA 1P7PA 1RE0A 4WY2A 4XB2A 4D0SA 5BSMA 2Y0CA 3KAJA 3GA7A 4GI2A 3Q3HA 4ENSA 5CYGA 1P1FA 2JL1A 4IVRA 1P2SA 4IHQA 2O7NA 4P38A 4JQYA 2PUDA 2I87A 4MP3A 1MZVA 3UUEA 1LC3A 2B0JA 2CZCA 3O3CA 4OI2A 2WIDA 2AIRA 2BFFA 3T5GA 1XIVA 3X2FA 1EX6A 2QPLA 2B2CA 1NRXA 5JNLA 2DFVA 3PEEA 1ZWKA 2NUBA 4RK0A 4WN3A 1CHDA 1GCGA 5DV9A 3W6UA 4AD8A 5DGDA 3AESB 3LPAA 4BBZA 4PGHA 4YI3A 4JH0A 3WMEA 2O2CA 1IB6A 1O4VA 3JQDA 3R8FA 2CLHB 3IT0A 4Q93A 3VSBA 3IQEA 5CJPA 4WNCA 7GPBA 2O8DA 1U1EA 3A36A 4V0NA 5E6RA 1O03A 1IWBB 2BZGA 3I2IA 4UBIA 3U4AA 1AQJA 3AR2A 5SY6A 2ZBRA 1IWPB 1TL7C 4I14A 3IEKA 4XDHA 5JAIA 4Q48A 4W6QA 5KWEA 4GR9A 1Z4NA 3N39C 1TDJA 1ZH8A 4FGSA 1NDQA 4AN0A 2YJTD 1XJCA 1ZCBA 1XU9A 2HU7A 2Q1XA 3EGDA 3O47A 4G1UC 5T4FA 2FEXA 2OCYC 3L7LA 3IPAA 3OIDA 1TRKA 4NKRA 3U4DA 1U3UA 2W6QA 1H8HA 2N1MA 3AFHA 1B43A 4HXEB 1FPQA 4ZT3A 3ESYA 4KPFC 1ZUNA 4AJNA 1YFLA 4KKVA 2ZUUA 4J43A 5ALSA 1NW6A 2C7VA 3B3JA 4HTAA 3MMNA 1XZKA 2C99A 3EY9A 3VA7A 3JYNA 4MQMA 4GNKA 1NDUA 4WN9B 3FNQA 5FXMA 2R44A 1PR0A 4LSMA 4FEAA 2XZDA 3ZWYA 1S7GA 1U9IA 1E79A 1YZQA 2NYVA 4CKXA 4FCCA 4LN1A 2JS7A 5AESA 1NQAO 2FWMX 1EFTA 3CF6R 3MW8A 2I67A 2BGRA 1T4DA 2IZ6A 3ELYA 4RDHA 4YRCA 1JDVA 1E4EB 3K0CC 4CG0A 2B4TO 2H1RA 2XXBA 3RBAA 2B78A 3NTXA 1GAWA 2R1VB 3K6JA 3IL2A 2NPFA 2PWBA 4C0LA 1OH5A 1OVGA 5DCLA 2OBXA 1QG2A 2AOXA 2CLEB 4F38A 1NYLA 1Y3FE 3MWLA 4LECA 2GZDA 4Z9XA 2AQKA 3EYWA 3M34A 3WKCA 1RQPA 1AN0A 2DCUA 2WAYA 4I1VA 1MJFA 2V97A 4Q3BA 4KQCA 4RHXA 2FMUA 2ZUCA 3AM3A 4XVQA 1J21A 4U9HS 4X5OA 3OX2A 4RSHA 2PH5A 3T1VA 4ER6A 4MQ4A 3DLAA 1RZVA 3D1JA 2IC5A 3CW8X 2DM6A 1QJCA 4CG1A 3ZDBA 2PKWA 3FD8A 4JU9A 3TFQA 4TQAA 1GNSA 2WFMA 3P5SA 2CMGA 2F43A 5DK6A 4ZAWA 5GPBA 1PR6A 3CKYA 4URHA 3UBMA 2YFYA 3C1AA 1P9RA 4K5QA 2WYUA 2AX3A 5EJAA 3L6RA 4DMRA 3QK7A 1RWMA 4L8LA 2VHVA 5JJ5A 4JSTA 4BX2A 4CKCA 4MRNA 2I9KA 1U99A 3A6EA 3QVLA 1JHXA 4HYYA 3Q7EA 2QMEA 3Q9NA 4X92A 1TOAA 4MQ5A 1TMKA 1CQJA 4KSBA 1UDXA 3NOXA 3PIDA 1SCAA 2YS6A 3HJBA 4BQSA 3ZWNA 2PRKA 2BD0A 4Q4AA 1E2HA 5K6AA 5AVYA 1FDSA 1EH5A 4UARA 2XGSA 1JLKA 2JVKA 2MYPA 1NM5C 1SA0A 2W6MA 1PGPA 2G40A 1K3TA 1AZTA 1JU9A 1X1SA 3D7SA 4BKOA 3UM9A 4N41A 1X2EA 3KJIA 2ZI5A 2KB0A 2G6BA 5E8JA 1LPAB 4LI0A 4ZFNA 3LUPA 3LRXA 4UUPA 3P94A 4X20A 2E7ZA 1L7PA 4IUDS 1MQAA 4E22A 3WSWA 4BNJA 3N7AA 3W5SA 5IRCD 3X1DA 1HO3A 2Z8XA 3DVAA 2DTEA 3TDKA 5JLJA 4KIWA 3OESA 3VMFA 2Q0HA 3PXCX 5AJWA 1A04A 1Q1BA 1IDN1 3L7OA 1UXHA 3M6FA 2IT1A 2QPOA 2O0HA 3CY6A 1U7HA 4LBVA 3SS8A 1EESA 3BDAA 5DFAA 3BJMA 3O1JC 4EYQA 1SHZA 2DFPA 5K1ZA 1X15A 5CEFA 1UDBA 4LBWA 5SV2A 1YR8A 4HNUA 4L4RA 3DLHA 4FFWA 2UAGA 2X4DA 4NYMR 2V45A 1LDGA 1NXSA 4IL5A 3ZVRA 2ZIUB 1Z6GA 1KEUA 1TKCA 4PG6A 1RIIA 1TQHA 3MRVA 4P58A 3F5FA 1BG6A 3QYAA 5DTRA 2E4XA 1C8LA 1Z16A 5IZCC 1GXSA 2VCYA 1AGXA 1UC8A 3KLMX 4GM0A 2WMOB 3H9UA 4FN4A 1BCSA 2GEKA 2UDPA 1NVVR 1DB3A 1TD9A 2OPBA 4WV3A 5LL6P 2BYTA 1QU2A 2BFDA 2Y9PB 4LPSA 1PWZA 4YMUA 1ZSNA 3ADPA 2LNDA 4ZOAA 2CUKA 1PRYA 1ZAKA 3QOXA 5F4BA 4E5PA 1T10A 1NUUA 2PIDA 4RVOA 5TMDA 4NVRA 3OTOB 4RVFA 4EX6A 2DQZA 3RUPA 1ZOIA 4HQLA 1T8RA 2I6QA 4NULA 4EYEA 1L8OA 1R8XA 4FNOA 4XPZA 3AR3A 3KUUA 3KT3A 3GDOA 3EXIB 2Z6UA 1EP2B 1USKA 2ZUEA 3D43A 1KOJA 1TPZA 4Z9AA 3A9WA 1OFIA 1M7BA 4LFCB 4D4MA 3NC4A 1SCIA 3RG8A 1H2RS 2RGDA 2Z2ZA 3RB8A 5HK8A 4F92B 3CNLA 4OU4A 3VBEA 2WWRA 4CMKA 4P8RA 4RABA 4DIUA 3B5EA 3RYHB 3TMAA 4D42A 3M4YA 5L3QA 4KWTA 3O4RA 2FHPA 1SKYE 4O0MA 1HZJA 2JFWA 3SEAA 1N6LA 3L05A 1ATIA 4RYLA 4EP1A 4GMGA 3L0IB 1E4OA 1RAAA 3FMOB 4QPJC 3RVJA 2NO4A 2EFCB 1MOSA 1KP3A 2WJWA 1QANA 4ZJUA 2VJMA 3I34X 4OB8A 2RCNA 3UAZA 1MORA 2ONKA 2Q4TA 4P36A 3OEEA 4EH1A 2WLSA 5ES3A 4D3SA 2PX4A 5JR3A 2EBHX 2UXBB 1ILWA 3C5VA 3NTUA 2WHRA 4KAAA 1JI3A 4G5QA 1L7VC 2DH6A 4MHOA 3FG9A 4P9NA 1D8TA 1NW9B 5JLAA 3S28A 5TGTA 3N59A 4D99A 2AX4A 1KL7A 1GG8A 1HI9A 2IYXA 2Q1SA 2IUEA 4O4HB 7ADHA 5HR5A 4TTTS 2IHZA 2VJAA 1Y8AA 1PAUA 3A1VA 3ILYA 3NR2A 4L9RA 3OF2A 3VV2A 4XUDA 1NE7A 3CCCA 3P9KA 5JCPA 1OYYA 2PY6A 3PFNA 1M1YB 4O4HA 1KQOA 4UAGA 1OR8A 1QRSA 1YFKA 4LYDA 3L6OO 2X5NA 3DGEC 3NT2A 4GPEA 3V55A 4EMSA 1OWLA 5JYDA 2IZ0A 1A5ZA 4Q16A 2DE0X 2YY5A 2H5EA 2KYRA 1JEJA 1G5QA 2FPGA 5JZ9A 2CYCA 2MMCA 1XZJA 2WWGA 1XDBA 3UTDA 1JT9A 1NUTA 4NX2A 4CCYB 7AT1A 1QE0A 3DWEX 3QHAA 4HQFA 2YZMA 1BX0A 3IERA 3C3PA 4R1QA 4CQMD 1GZ7A 4UVGA 1FP4A 5LIRA 2O1EA 1OV4A 4RVNA 1SBYA 3H87A 3WGNA 4TKLA 2RB5A 4GI5A 1IZ9A 4U0KA 1VJDA 3ESDA 4A5OA 1QIHA 3GEIA 1PP4A 1T9KA 1XVIA 4XSVA 1VXOA 4LDRA 4YPOA 1Z75A 3K0KA 2NU9A 1C7RA 3BH6A 5DMXA 3S2YA 1T5HX 2PM8A 3BSYA 4OHBA 2XNDA 1J8YF 4LSZA 1E7SA 4TUYA 3GA0A 5D2CA 4C4ZA 3V8VA 3L4SO 1RABA 5KS2A 1GV1A 3H65A 2GN0A 3EEQA 5F1OA 1HEYA 3F6EX 4V0ME 2FG6C 4X66B 3QPBA 4IDGA 3KT8A 1H8ED 1CK4A 1NXQA 2JFPA 2WE8A 4QBFA 4RKWA 4BE7B 1VKNA 1Y8QB 3GC6A 1PZEA 4W1SA 1QM5A 3MC1A 4TV9B 3TXXA 3FMIA 3GVHA 3KJQA 5TIIA 3OLQA 3AKCA 2P3SA 4YP9A 4M1EA 1R27A 1I2ZA 3HR7A 2JLWA 2ZRCA 1RWNA 3PD1A 4EKDA 2I54A 3KCNA 2VNIA 1MB0A 3UJ9A 3W05A 1D1PA 1IHDA 1TJNA 2X9NA 1GN9A 3KEFA 2OORA 1AUVA 3FTDA 3OBBA 1GLGA 3QW2A 4ND6A 1KYZA 4P86A 1A1VA 3FDFA 1M6YA 1ADFA 1TQ4A 2I7DA 2XT0A 3TAUA 3IBGA 5BQXA 4IWXA 2A84A 4LJYA 1AB5A 1X9IA 4CKBB 2AD1A 5JSYA 5JYBA 1NF3A 2DQSA 4H3KB 4D8UA 3EIQA 2JCVA 1FS4A 5CT4A 3UJAA 4G5GA 4R8VA 1AV7A 1YHNA 4Z1MA 4ENWA 1LPSA 3PKJA 5IT5A 4KREA 4ZGGA 5JOQA 1OBFO 2AJBA 1YDHA 4EAQA 4KFTA 2HFKA 5CH5A 3WK9A 4O8ZA 3UJNA 2BFMA 1GG9A 2WJJA 2YMQA 4O2BA 3SXPA 5LJIA 3OPYB 3L06A 4K9QA 4IH1A 2ZUTA 4FE4A 3IIEA 3TZ6A 3X1KA 1QO9A 4ZO4A 4DJTA 3O73A 3S5UA 3AVVA 3GJ5A 1RYZA 1KDVA 5HZHA 3SYNA 1FMFA 4ETNA 4MP8A 2AHOA 4HWKA 4C7XA 2NZ8A 1IULA 1VSBA 2C8VA 4C7BA 3RAFC 3SC6A 1JFFB 3JPWA 4ZI2A 2GZ2A 1L5VA 3M4ZA 3IESA 1KK3A 5E6SA 5L8VA 2AN9A 2CLCX 5A71A 5CX1A 3QSGA 2Y4OA 4EABA 5K0FA 4N82A 3MGKA 2GX6A 2FOLA 2QLTA 3DLCA 3L1JA 3ODPA 4WKNA 5IAGA 5T4HA 4CCAA 3GPLA 5CVDA 2R8XA 4R41A 4ESEA 2QZ9A 3LU1A 4UREA 1Z2PX 1GD1O 4EATA 2WSYB 3WRVA 3O21A 1M54A 2C8JA 3T1QA 4DAEA 3I73A 1P17A 4MJXA 4B81A 3CH4B 5CA0F 2GTHA 2IOFK 2QSYA 3M2PA 1YTUA 4CIYA 1XWIA 5LB2A 2V55B 4UHJA 3HU5A 1IJFA 1OX4A 4RHUA 4CQJA 3B51X 3AX6A 5GONB 3PUJA 4WDRA 1Z6PA 2H2IA 2OB1A 4MUJA 1JSCA 1VMAA 3P32A 1H05A 1GU1A 2I4RA 3DS8A 1SKBA 3H1PA 4TL8A 3ZWOA 5TGZA 4GLOA 2VQSA 1ODLA 4L57A 4P3PA 5ALKA 5E2IA 3OQ1A 1T9HA 2HGSA 4AFNA 2GT1A 4FT4A 2ID7A 3OQ6A 5JBIA 1IXYA 1QU3A 3SD7A 1NBWB 2ASEA 2O7RA 2B8JA 2Z5FA 4X71A 1CIVA 1QF7A 2VPWA 1G20B 3U4MA 3R24A 4MV6A 1KOGA 4E31A 3MEQA 4EI9A 1IEXA 1X7WB 4OMFG 3JWHA 4MV9A 1H3EA 1FP7A 2QK4A 3PHBE 3CMCO 2UYHA 1QO7A 4PWZA 1RAHA 5BYJA 3WGOA 4W8GA 2P6MA 3I2GA 1YSCA 3AF4A 2QRJA 2W4MA 4HWSA 621PA 1X7ZA 1V96A 1AUXA 4V1CA 2EFYA 3U7QB 3UANA 4JGBA 4PX5A 1PQ4A 4CIBA 2Z2JA 5CXSA 2F1OA 5BYAA 2YW2A 1SXJD 3VI4B 1Q7RA 3PE3A 1DEKA 2B37A 3D2BA 4YH1A 4X7MA 3RYHA 2VWHA 3FFTA 3M4JA 5SZKB 2VNHA 2XE8A 3COSA 1XJ5A 3DFKA 2J9RA 2XF2A 4M4SA 1I5EA 1XA4A 1QF9A 3TLEA 2ZG6A 3BG5A 1Y9AA 2P6NA 3PSAA 1YFJA 3BM5A 3NW9A 4ND3A 3PYLA 4Z7JA 2XLBA 4UTPA 5ICSA 3V8PA 1G3UA 4ENVA 3HJGA 3I9V6 1M8FA 1KDYA 2PSHA 4AY4A 5KTPA 3ADDA 2HSDA 2QQGA 1A8UA 2CLFB 2Y6UA 3B3QA 3JPYA 3J81k 5ALYA 4W8HA 2BHNA 1PSDA 4RV4A 1N2HA 4B47A 2GPNA 2ODBA 5CT9A 1B0AA 1L6IA 4NV1A 3ZU2A 4Y1GA 4YPFA 3H84A 4RS4A 3PCXA 1JZQA 5FKJA 1YZFA 3CZAA 2WW8A 4KFSA 1C41A 4MS3B 4UM8B 3WXBA 1OILA 3BHMA 3BXOA 3BZUA 1YWGO 3GN2A 4S1VA 4WWHA 4GX0A 2FZVA 2IY9A 2YWJA 1DRUA 3DWGA 4MQ6A 4RV5A 1U7PA 4X60A 1SK8A 5ESDA 2PL3A 2EATA 2YIDA 2C84A 4D9KA 2NU8B 2WNIA 4WUVA 5ARBA 2M6LA 3PIRA 5K3OA 2JJQA 3DOJA 3X1XA 3PGKA 4IILA 3K8YA 3DLTA 5U1PA 5JXGA 2VUSA 3PDWA 2M6SA 3RT7A 4HAUA 3I9MA 3ZY3A 4AJ2A 3NWJA 3R5JA 5B7PA 5T6MA 4PC1A 2IFTA 4A8JA 1CJSA 1QIIA 2Q6LA 4XQ9A 3T5PA 2P3QA 2IU3A 1M75A 1HRKA 3K5HA 4GP7A 2KMLA 3PHGA 1DE0A 1LBIA 5EWMB 4RIIA 3NDIA 1PZGA 4FS8A 1OXKB 2NU6A 4QAJA 1VYHA 4C0XA 3D4IA 3RGWS 1U28C 2O20A 4A8PA 3CKKA 2XUKA 4AJEA 4ZHQB 4UXJA 4ICIA 3HXTA 3UWOA 2VNSA 4DT1B 2VHJA 4RZSA 4EA9A 3V3TA 1PHPA 1VBNA 2NW6A 3PJGA 4DDMA 3VKVA 4DLBA 1NUHA 4IQ8A 3HNPA 2YNMC 1T0PA 3TNDA 4YIHA 2QLLA 5CP8A 3RVMA 5M2QA 3T94A 3O03A 2HGZA 3A3YA 1TTQB 1PDVA 3RKUA 1Z2CA 3DL7A 4LCBA 3DZGA 4REQB 3REOA 4IY1A 3INTA 1FYDA 3KQVA 3ZGYA 1NE2A 4LA4A 2CV0A 5AH0A 5DN6D 1JKIA 2HDWA 2VHWA 2X1HA 2YWEA 4KQHA 4YTEA 1EXDA 5B30A 4ZYVA 1HE2A 2O2DA 2PS3A 2JAQA 2GJAA 4ZXFA 1H8EA 1W0KA 5E1OA 2XUQA 2ILVA 3CWCA 2LUOA 1E5XA 1YR6A 1Y7HA 1U1GA 2OXFA 4S1WA 4B6PA 2VPIA 4U2KA 4BO2A 1N5JA 1X7HA 4OSEA 4NNOA 1QUEA 1RW4A 2ZWOA 1R0ZA 4FNAA 2IZZA 4B4OA 3LF2A 1HQYE 1Z06A 3TW6A 1XD9A 2NTNA 4IMJB 4EMBA 2HA7A 2TRSB 4D3YA 2ZXFA 1YVEI 1XOIA 3G2QA 4DUPA 5ALEA 1Y5MA 3QELA 3WBFA 4M8IA 3F8SA 5FBHA 5U4XA 4QREA 2XTJA 1SZCA 4M49A 3M9WA 3TVDA 5LUBA 3HJUA 3H86A 4G8CA 3CZ4A 3K53A 4MDYA 3H05A 4MP6A 4RE5A 3VC2A 1E2LA 1A3CA 3AJEA 5AHOA 4Q05A 3IE0A 3FRIA 2Q0QA 5K8TA 2HTFA 3LBYA 4I4LA 1NQXA 5JV5A 1GUZA 2WNHA 1B41A 2W2XA 5KJCA 3GRRA 4M38A 1KETA 4I6EA 2I1WA 5JYEA 4ZCLA 4U7DA 4WY8A 1S5PA 5JFTA 2XQFA 3TGLA 2C5EA 3KLNA 5FHRA 3WGGA 4EPVA 5LOVB 3P0IA 4BFVA 2I7TA 1E2IA 2DFNA 3KOOA 4L8WB 3SZOA 1RC0A 1EBBA 2PA3A 1EJ0A 1JU3A 2FHSA 2QS9A 4PHFA 2W8ZA 4U4AA 1PJ2A 4URFA 2H8GA 2ZJ8A 3DUWA 3RTBA 2BN4A 4L4SA 5DIZA 1VPWA 3ZDDA 3QX9A 3A8TA 2NM0A 4HX9A 3FPFA 1AKNA 1JLSA 3Q40A 4PU0A 2DPMA 5FTNA 4DDWA 3HXOA 5E7IA 5HG0A 2NP6A 3GXBA 3KXKA 1NRIA 5CVCA 1KFBB 4E13A 3NBMA 4XCVA 1RAGA 1PNVA 1L4EA 2VLIA 1J8VA 2AFHA 2CLIB 3QUSA 4L6AA 1E59A 4NK5A 2LW7A 2Y1LA 3PI6A 3RLIA 3F9RA 4L8VA 1NVEA 3QVKA 3RDPA 5BN3B 1XLTC 1EKXA 5HF9A 2NUTB 2REQB 1TKAA 3K35A 1AMNA 2BIFA 1YRYE 4NCBA 3G9QA 1Y3DE 4LE0A 1GZ5A 2IYYA 4ZDWA 4M0MA 3ROEA 3T5BA 4CN9A 4ZCMA 1T6XA 1TZMA 4O63O 1OH7A 4ZYZA 3URKA 4Z4EA 1YNSA 4ZV9A 1BW9A 4DNPA 4A5SA 3KOYA 2J67A 3U3RA 5LMZA 5EEHA 2FN8A 1C3JA 1I1NA 4JBXA 1M34A 3AKEA 5HIKA 2YKGA 4MW0A 1J97A 1H2EA 1DJQA 2ZAGA 1N6KA 1H93A 1TO2E 3IDQA 1QS0B 3E2MA 3NVMB 3CIFA 5CVEA 5C35A 2BDUA 5I4KA 1FMTA 2ZIAA 3QVGA 4IFBA 2GD0A 4I9UA 1BSVA 2PG3A 2WP0A 4WPGA 3AM1A 4CQLA 2ON6A 1J1UA 2I62A 1WMDA 4R1MA 1KDOA 1H6BA 2NXCA 2NN3C 2O57A 1VBMA 3DVSX 3IVAA 4O02B 3E9QA 1JEAA 4PX2A 3T1HB 1K8ZB 2DH5A 3WMFA 1KR2A 1OU4A 2AYYA 3IXMA 3GVXA 4PVDA 4HDSB 4KXYA 3DR5A 3HO1A 4JXZA 1E0KA 1K6EA 2IW3A 1TEZA 1SD5A 5DJ5A 4IMIB 4DUGA 2FEPA 4M99A 5LLDA 4EBBA 1G5TA 3R41A 5AW8A 1A88A 4UMDA 1FLVA 2CHGA 3OZSA 3RRYA 2B7BA 4BLSA 4PO8A 4N9QA 2GLUA 4QVGA 1F8GA 3AI7A 1XO1A 3QG1A 3FAZA 4H6PA 3MFQA 1UXGA 5BOSB 5SZJA 3NTLA 4CV1A 4A8JC 2Z3ZA 4AQDA 4FBLA 2C95A 3MWJA 1OFUX 3ZNPA 4ID3A 2ZU0C 4C06A 3C6QA 2XGOA 4GOKA 1ZQ9A 3SQXA 1TK3A 4J0KA 1XVUA 1QX4A 2W58A 1YZ3A 2R4TA 3I9KA 1QB8A 1HYEA 1CFJA 1XCMA 2BUAA 4ZV7A 1JKMA 4TSFD 4WFJA 5DP1A 3SHOA 8OHMA 5ICEA 1W25A 1EK6A 1Z35A 1XTQA 3FDXA 3LH5A 2OVFA 4RKRA 3MOGA 2C5AA 3ICWA 3K9QO 3C14C 3RQSA 4CI0B 4V1CI 2R6CA 3OJFA 5ABPA 3D4BA 3GEMA 2OG1A 1Z17A 4F11A 2AI3A 1T5DX 2COEA 1IHUA 3P2JA 3H5LA 4Z3DA 1RXWA 1KNQA 1UEXC 3H99A 2I6GA 1U31A 1N57A 3B20A 3AR9A 2CZGA 4HP8A 3UFXB 1DT3A 5G02A 3UA3A 1KEZA 4CLHA 4DLWA 1TZJA 2GZ1A 1MV8A 1N8TA 5L95A 1C9DB 2RH5A 3BF8A 3UK0A 4DMUB 5JWRA 3T0FA 1CUCA 4GRAA 4OJQA 1RKVA 1S7CA 3GT4A 1E4VA 1V25A 3IPYA 4R83A 2Z5LA 5CURA 3PP8A 4YMGA 3O9MA 3IHLA 4PBSA 3AYZB 1BXZA 4YFYA 1U0HC 4MYUA 1YQQA 2J9ZB 3JQ8A 1R2QA 4II2A 3MUEA 4M7RA 4BQQA 3AUKA 1KFKB 3LUCA 4QHSA 3U44B 1K6IA 2HSEA 1MJHA 2FY8A 4D4KA 1XPUA 4HGZA 2BH2A 1XAJA 5TQ0B 4YBZA 3LCJA 3QU7A 1ZI6A 2VXYA 4JUCA 2ZGVA 3JWGA 4KLZA 4MNTA 4RKFA 4YJ3A 5DXAA 4DPKA 5FV4A 2YFKA 4M1YA 5B36A 3VPXA 3MD0A 5IJWA 2R85A 1GKYA 3A37A 3WZMA 4CKBA 2E1PA 3MHPA 1G5PA 4IX1A 5AKGA 5ALQA 5E6UA 5T4BA 4GYKA 5KVVA 5A3SA 5K0EA 1T5TA 1D03A 3F7MA 1W5TA 3MJ4A 2GF0A 1UT5A 3O94A 4LDAA 3F49S 3W6OA 1B8UA 1ZJJA 3OMLA 3ZDZB 1U2EA 3ND7A 4FTWA 3TM4A 2OBYA 4B0OA 2P4SA 1PT9A 1DAGA 1P1JA 1P44A 2Z8YA 1EGQA 3LWDA 3M9LA 2ATCA 2QAJA 1GN8A 2IXDA 2PSEA 4QDOA 2NNWB 4KPUB 5ERXA 5G0UA 2H2WA 1B15A 3B1VA 3W8NA 3KXPA 5JQGA 1K68A 3DCYA 2JJ2A 4FZJA 1XZMA 3M6VA 1C1XB 3SP1A 4HLUA 2X4GA 4DIFA 1S8AA 2SBTA 4JOSA 1YI8A 4LE2A 4S12A 4A0GA 1IPEA 1CUAA 1XXLA 3D9QX 4LGVA 1LJUA 1AS2A 4OXRA 1FF9A 1Y3BE 5AHRA 4MICA 2ZAMA 5ADHA 3CNHA 3WMRA 1QH8B 3A2MA 3W5DA 4K2HA 4E2ZA 1YBMA 4BFSA 3F5SA 4B2YA 1Z6YA 3R6LA 2Y27A 2PKYX 2MR5A 1N2CA 2ZYAA 5CPFA 3BCUA 1W44A 2FEMA 2XHZA 3FCAA 4WESA 3FKQA 3ZLUA 1GQSA 3DMYA 4KDCA 3G2NA 4CDNA 3L2OB 2H5LA 1BX1A 2NZ2A 4ZZ3A 4EPRA 2QXTA 1BVYF 4OATA 4V0QA 1TZBA 2RI1A 3ZIAD 5JDCA 1SHKA 2R3SA 2WKSA 2QZJA 3EG9B 3OY7A 5DTJA 5BSEA 4ETWA 5MFZA 4NXMB 5ANRB 5FUBA 1ZGBA 5ALHA 3E3MA 4EX7A 1SVKA 1PIWA 3EZNA 3R3WA 2ZSDA 4F7WA 1OWMA 2JIOA 2QGNA 1P4GA 1YONA 2IS2A 2PDAA 3PFGA 1V3QE 3SZGA 4MW1A 4HRXA 4JBHA 3MJDA 1MXFA 3C3AA 5CAEB 4EUNA 4BV3A 3I2HA 2IY7A 2WAOA 1JX6A 2IH5A 5AQEA 2X0FA 3CSDA 4B6SA 1KTVA 1YCFA 5EGNA 2JLXA 1QIGA 2HQRA 3H1TA 4IHJF 1MW8X 1RKXA 1WU8A 3TCNA 3GLQA 3VAAA 1O94D 3TIXB 1MRNA 2IPAB 4XVRA 1I10A 4UVHA 1GSOA 2QTZA 3IP8A 1FYWA 2VDLB 3KKMA 4ZEVA 2A58A 5LZ9A 1IONA 4ND8A 4E5VA 1L5MA 1L5RA 2H7YA 3HEAA 3PUZA 1UBOS 3M70A 1CJVC 1SIUA 1KE1A 3BD8A 4FR5A 3ZY6A 3KAPA 2PMEA 3HXPA 2G9QA 3QV1A 4QU5A 5HKLA 1X1DA 4RWZA 4DS3A 5J9FA 1WSWA 3GRVA 2P7HA 3S2ZA 4AXXA 4YRQA 4BMZA 5DLQC 3ESAA 3K9HA 3U09A 3DWIA 2C57A 4ZICA 2HSZA 1C30A 2EJCA 2FAXA 2IYZA 1IMOA 3DV2A 3L6CA 3OUTA 1NMEA 4OQPA 4RBNA 4XEUA 5BQ5A 1TTTA 1Z5OA 1TE2A 4LHZA 2R6R1 1TVKA 2RBKA 3PFKA 4QO7A 1XAGA 4DUZB 1JTVA 1FQOA 2BBTA 4US2R 3HKEB 1VI5A 1LQTA 2BV3A 2OGUA 2PT7A 3FPLA 1Y8RA 3UGJA 2HJHA 3Q5EA 4KO4S 4DQ0A 4ECAA 4N54A 2BEUB 3U0BA 4BGEA 1GCIA 1JG7A 1M3SA 4KQKA 2QX7A 2X4IA 1ZCFA 3GLIA 3DTTA 3SJAA 4TMVA 5JD3A 3TRKA 1M34E 3UT5A 1CULC 3CEPB 3HYCA 4KRXA 4NFHA 3J81A 3D81A 3UV6A 3M6UA 4RHCA 2FFAA 4X9XA 3DP9A 3KOWA 4MWBA 1SU7A 1X7XB 1US8A 3ND9A 3NIFB 3URMA 1O2DA 1Y7IA 3QQPA 4J29A 1ZRHA 2MJLA 1N6RA 4XE5A 2XT9A 3VH3A 4B3MB 3IURA 3Q3JB 3QGMA 1COZA 4B32A 3LBFA 2IYSA 3OUZA 1YHZA 1I5OA 4ZQBA 5JSZB 2D6FA 4NPHA 3ISTA 1ADJA 3M89A 2EQBA 3OZBA 4HDNA 2G9VA 2IY8A 3AFOA 4KMOA 1LTQA 4PSUA 2B8EA 4BBAA 1V71A 3A4NA 2JGLA 1UQRA 2RHDA 3AETB 4Q3AA 4W7HA 3VJMA 5BY2A 3G8AA 3ONVA 4TL9A 3NONA 3LO5A 5TT0A 3FLEA 4ZMRA 1D2RA 2CJPA 1LFAA 3LC0A 1PHRA 3CCBA 1TIKA 1QHIA 4URUR 4UTOA 2FK7A 3IJRA 3UH1A 2Q3BA 3A1NA 3PC2A 3LQ1A 4J90A 5F9HA 2J8ZA 4GD3Q 4U63A 2PT5A 1IXRC 2QAGC 5EXPA 1JR3E 2QAIA 4X84A 1PQPA 2H85A 1SKYB 1VHJA 4MB6A 2D8AA 4WXPA 1EJ2A 3RGGA 5AIBA 1I14A 2WQ7A 4BO5A 4XR4A 1WU7A 3HXLA 3JD3A 4WY5A 3QI7A 3DE2X 1ISMA 2FPIA 3IP3A 5CLIA 3PI7A 4BMXA 2O8BA 2A7QA 3ZQUA 3K30A 5KVAA 1I6KA 2BKXA 2HL6A 4N0PA 3TW4A 3OCYA 3W7VA 5AVTA 1WPXA 1V35A 2FZ4A 2GF9A 3PTLA 3CX4A 5BSVA 4B6OA 4QQRA 4QTZA 4GXQA 4TT3A 1CSEE 2WWVD 3QIVA 5JXIA 2O3JA 1O9BA 1Z45A 2F9FA 4PHHA 1AO0A 4OLHA 3HTXA 5EEGA 2B4RO 4L3WA 3IOBA 3ZGLA 3OTQA 3UW3A 1BE1A 3EOBI 4ZRDA 4ZU6X 1GQRA 3PWSA 1H9CA 1Z7YA 2CNKA 5H9WA 3QTTA 1Q1ZA 1I36A 3AEZA 3B1WA 2VO1A 4FDVA 2F3PA 3OH8A 4NQZA 2PL9A 4XWWA 3L6DA 3DB1A 3VPSA 2IPOA 3CNBA 4P4LA 3HXMA 4JYAB 4RMGA 4XEHA 2WEKA 4BO4A 4GYJA 1UPUA 2OBNA 4MZDA 4DPLA 4JEHA 2H4WA 4XWAA 1UP7A 5GADl 1OAOA 3OU2A 4F6RB 3FJ1A 3PNKA 1VG8A 1JSRA 1T4BA 4JVLA 3RHSA 2HXSA 2JGDA 3OAAD 4NCXA 1SXJE 4TZ0A 1DUSA 2ZBDA 3PUVA 4HSEA 2E6KA 3ED1A 2OGZA 2G0AA 1KYIA 2QGFA 5COQA 3JYOA 2DSTA 5M29A 2GD6A 3C7TA 2XDWA 1IUPA 2EX0A 2J6BA 2J9GA 4F5WA 3D0QA 3DBIA 1AUQA 1Z63A 4XA8A 1OC2A 1EMDA 1G98A 1HDCA 5FPTA 1XQYA 2XF8A 3ABOB 4FILA 3H0CA 5JC8A 1NJ2A 3HVHA 1PJ4A 2D8MA 5IJ9A 2BM0A 4NCHA 3MAGA 2R8OA 5KYKA 1E9CA 2H3EA 2JK1A 1T0JB 1IY1A 1NFFA 1CVLA 1UJCA 3CUYA 4KN6A 4J0CA 3V9AA 1VDMA 3FTEA 4UU7A 1FVHA 1I6WA 1EM8A 4PAMA 4OFBA 3C3YA 3UB4A 1S9HA 3EXEB 3D6AA 3SU8A 3VNRA 3GD5A 3NEYA 3O90A 3RRNA 1OXMA 2VRCA 4LVCA 1LKZA 4LUCA 1OH8A 4QE3A 4M88A 3FHCB 1QQ7A 4JLKA 5CCXA 2I3GA 2R6AA 5B1HA 3BX1A 3C2QA 3E9EA 3OIGA 1G3QA 1YRLA 5JMPA 5HUJA 2X4LA 1IY0A 4WZ6A 1ULUA 3TL3A 3GLHB 3TR5A 5A0TA 1ANKA 1DEOA 3TK1A 1EFHA 3JD0A 2JLVA 3KSDO 1DRJA 3C3CA 2ZJBA 3ZY5A 2JIDA 2AQHA 3FSJX 4E5UA 3KL4A 1GITA 1LK7A 3I5YA 1BD3A 1RYBA 3N58A 5EWLB 3PNLA 1P7YA 4LAFA 4XM0A 4L9AA 1WKCA 2D5AA 1FS5A 1W6UA 4QSHA 5LYYA 4A23A 2Q7XA 1SOVA 3SCZA 1RTKA 3U56A 2ZRFA 4BNDA 2J85A 1QAMA 1WCV1 2VT7A 4K9DA 1MX5A 2ETXA 1AC5A 5F21A 3KFVA 3EGDB 3QH4A 4C6TB 4FSDA 5JAPA 2G1PA 2D5LA 1GRCA 2G8LA 3Q7TA 2AEJA 5C7OO 2F6RA 5HS4A 4LGCA 1KI6A 4IQGA 4X1KB 2YQ5A 4PYIA 4XYLA 1T8UA 5I4CA 4J0GA 1Z34A 2H18A 1E3MA 1A9SA 1NVGA 4OMDA 3DZBA 4PONA 4NFYA 1BVRA 4PX9A 4HDMA 3T7DA 3EXHB 1EWKA 2O2JA 1GTJ1 2OO5C 3MB5A 3AY3A 4Y6RA 4DLAA 1UEJA 5C1BA 2EGUA 2DGDA 3K3PA 4MGZR 4M89A 1NM5A 2IEAA 2ZXEA 1OFTA 4MPPA 4OYHA 4ZI3A 2Z1MA 3FUCA 2PT9A 3AV3A 3HB4X 4I3GA 4LPKA 3FDZB 5C18A 4NI5A 3QUCA 4HBZA 4R05A 4IV8A 4LSWA 4BN5A 1GPLA 1KZ9A 1ZD9A 1DUIA 2HLDD 4X6XA 1I4TD 3K94A 4DG9A 5JANA 1DARA 1E62A 1QZUA 4H77A 4O2AA 1DDOA 2QJTA 4CM9A 2F00A 1U7DA 4DV5B 1EU1A 1V8PA 3PGVA 3MRXA 1Z8NA 2NSLA 5GM1A 1I32A 4IRUB 3HJCA 4PGGA 4NR0A 2Q62A 2XA2A 1LUAA 1WDMA 2EG5A 3IOMA 4PYJA 3BFPA 2YY7A 2VAMA 5JSKA 1K5HA 2UUPA 4HLCA 4A9AA 4D4HA 4G5FA 3BFKA 1G3RA 5CW2A 5I8ZA 3VSCA 2IQIA 1UKCA 2XR1A 2RHGB 3QE3A 4OQNA 3X2SA 3RS2A 1PEDA 3E8MA 1HMPA 1V39A 3D8RA 2BFNA 2AFIB 3RU9A 3TX2A 1PTJC 3AB7A 2IBTA 3CF0A 4JYMA 3UT5B 4R7TA 3H75A 4MVJP 3KYCA 3KE9A 3VVLA 4AZWA 1H2WA 4LVOA 2WD7A 1R8JA 2C5FA 3FGZA 5DNCA 1TM7E 3GLFA 4UPEA 1W96A 2R8BA 1KZ6A 1KBZA 3RS9A 3JQGA 4JJ8A 5IHPA 1PFQA 2WD7B 2AE2A 4XIIA 2IELA 3B1ZA 1G21E 1UBLS 2JLBA 4NYMQ 4X8LA 3RVKA 3W1VA 4C22A 3PSHA 1MTZA 1NNI1 2BFPA 3DOCA 4JQZA 3SBEA 2IWHA 1S01A 5I7UA 3GH1A 3S8EA 2OMKA 1U2SA 3H2JA 4M98A 4DHEA 2AMJA 1IQ0A 4DFDA 2OFXA 1JEQA 5CDSA 2Z6AA 1NVVQ 1P0MA 1AHHA 3JQFC 5G3ZA 4TKUA 3DXXA 1AOXA 1DBQA 3QEMB 5AW5A 4R16A 3VOAA 4AF6A 1ZUIA 3BD6A 1ZUWA 4L4XA 3HUTA 4MIEA 4YWHA 5REQA 4WOCA 3MGGA 1PGJA 2DOKA 1EWRA 4WL0A 3DMRA 1A4XA 4JB2A 3FCSB 2FEWB 1DOHA 2VUTA 3A14A 4M0DA 4MVJA 2I4IA 1KC3A 3QNUA 4OYLA 1CUIA 2BJHA 3N8KA 4LOHA 3BGWA 5H7XA 2C5BA 4IZHA 3SE0A 3PD0A 3P9IA 1Y81A 4MTLA 4QNMA 1KA9H 3PNQA 5F4ZA 2RGCA 1W5EA 1V8ZA 5CDUA 2XZLA 1QTQA 1GP2A 1VA5A 1G291 2W43A 4RVHA 1SR8A 4XB1A 3S0JA 2XUZA 4D25A 4HV4A 3ESXA 1YB5A 3NIBA 2ZE8A 2FG5A 5IUJC 3D1LA 4N76A 1U2QA 4V0OA 3KOUA 2HDOA 5IM4F 4AO6A 1PQYA 3COJA 3EZ9A 4IICA 2O8VA 2JDID 3DNPA 4HAYA 4YDSA 1AK2A 2GESA 2HA6A 1FSPA 1H1LB 1SZDA 5LPNA 1J56A 1QIEA 1Z3CA 2GFHA 2HCJB 1M2HA 1WJGA 2HX1A 1OE0A 2QG6A 2WD8A 3HCEA 4FDMA 3BTOA 2PZBA 2V0NA 1U1CA 1DTSA 4GO1A 3VHXA 5L3SB 2HHHB 2KE5A 1YZUA 4KSCA 5CPBA 1LDNA 3DE0X 1NAIA 4YJ2A 1XNHA 2A14A 3JY6A 1UZMA 1O6GA 1SIWA 3HVUA 3R5HA 5ER9A 5IHXA 2PUHA 2W00A 2H2HA 4FMBB 2P67A 4R8LA 3DT8A 1TADA 1RRMA 1T4GA 1BW9B 4IV0A 4YUWA 3KR2A 4U0JA 2IXEA 2R7AA 1C1XA 1UPCA 1CR4A 1BDMA 4J0HA 1RXEA 1Z56C 3DHEA 4TMTA 3EZGA 4L3OA 2PFSA 2HJSA 4FFBA 4H7DA 4UEQA 4XUEA 4ZQGA 4CIDA 1P5HA 4MIOA 4MKHA 1G0NA 2B2XA 3KL2A 5JD4A 4B9AA 1N5RA 3O4IA 3E27A 5HJEA 1AGYA 2VJBA 3LNTA 2XKAA 1G17A 2B69A 4QPCA 3RVPA 5DX8A 2O0KA 4KZKA 2X14A 2VBIA 2H57A 1BXGB 1SCKA 3MUOA 3K6SB 1JFSA 1BZYA 4NZMA 3OX3A 3ZV7A 1GHTA 4IS3A 3RASA 4NABA 5BV2P 1QQAA 1A8IA 4AO7A 4OMUA 2J5XA 3V8BA 5HIAA 4DV4B 3ZYCA 4ZT5A 1DEHA 4U2GA 3G0OA 1CU1A 3I2FA 1WKBA 2ATVA 4LZAA 3SYLA 3T4XA 1HL7A 4JKIA 3O9ZA 2EFDB 2J33A 3P9SA 4MA4A 4BMOB 4EM6A 4YCNA 2C7QA 2OCXA 1EFLA 4DV0B 3X1YA 1T2UA 1ZJ6A 3O0TA 5ULLA 5KTSA 1ML3A 3DXFA 1I7SB 2RGRA 1LSUA 4QUHA 2YYSA 4B31A 1PTJA 3K71B 1GEGA 1GCOA 3UKDA 4AMBA 2AOVA 1G21B 4XW2A 1ZBDA 4B3RB 1PSWA 2NADA 1VIVA 1I24A 3EEIA 1NKVA 2QRLA 4MQUA 1UM9A 2AEMA 4YFVA 3I12A 1BKDR 1LSOA 2I78A 5CK4A 3ZJVA 2P9ZA 4B8YA 1JA0A 1U9ZA 1SC1A 4K1LA 3H16A 4KI7A 3W9BA 3A3PA 4RLFA 2A5LA 1CG6A 4KOAA 2ZPTX 5JQGF 3NGXA 2NACA 1QGOA 4ILKA 1JQBA 4N5IX 4Q1CA 3R9WA 4L16A 2AR7A 2OLEA 1JIXA 5H59A 1T1EA 1QMPA 2ADOA 1OIXA 3Q1KA 3B3AA 2XQKA 1MOZA 1MJNA 2W6CX 1BMFD 3DAGA 1ZK1A 1IU9A 4PIPA 3FF1A 2WILA 1PJRA 4QDJA 1U0FA 2GN9A 3OP4A 4F93B 4FEYA 1UBGA 3KZCA 3A9UA 1SUDA 1CY4A 3O2QB 5DNDA 3WQHA 1P74A 1USIA 1I7DA 5FJIA 2VRBA 2VHYA 4EPYA 3R6WA 2O06A 1RBQA 3ILHA 5HKKD 5JZOA 4F4JA 1ZOLA 4AS1A 5FI3A 4AG3A 3R3JA 1U3CA 4V3CA 2HPVA 2OV1A 4AS3A 1FCJA 1U5CA 4MQEB 5CB0A 2FLVA 2WWFA 4ALJA 3FTPA 5KQLA 8ADHA 2JD2A 2A9KA 2BMDA 2IYNA 4OQZA 3GHHA 1QKIA 4NE2A 4FMCB 5BOSA 1NONA 5LZ4A 4LF4B 5DVZA 2FPIB 4LXHA 2JGKA 3G9UA 1E98A 1VE6A 1YF3A 2VP6A 2UVDA 4N4AA 2G9RA 4S3MA 3HA3A 3H17A 5GMOA 3H2ZA 5KZMB 1DXHA 1CY8A 3NEPX 3SJUA 5A03A 5LD2B 3T9AA 4RIFA 3NALA 2AW5A 3WRXA 2XB6A 2H2FA 4MW4A 3RSQA 1MO3A 1TNDA 2NU6B 2P68A 4FNGA 1JBQA 1VG0B 1PJBA 1EK0A 1JECA 4MV3A 3MUNA 1I7QB 3FDIA 3PICA 3PF8A 2BSQA 2NV0A 1UKEA 3ZV4A 3L1VA 3COVA 421PA 2CNOA 3ZD8A 4EQZA 4YAKA 2DWQA 2OILA 1M8KA 4KN9S 2OP0A 5FTLA 2YW9A 5DNYB 5JCOC 2HK8A 4Q47A 1RACA 1R0YA 3WKDA 2OZVA 5ALPA 4I5DA 4DR2B 1HOTA 4F8YA 2VQ3A 2WTXA 4FHCA 3LCMA 3ZR4B 4WLUA 2NTVA 1WZEA 5KSWB 1E8DA 1V2HE 4MVCA 3QVJA 3VDXA 4OJTA 4BO7A 3NFYA 4JLWA 3FUWA 1OF1A 1P19A 2NZYA 1EB8A 3QMPA 4PQRA 4UEWA 1ENOA 2D5IA 2FA9A 2VSQA 4JYBA 3LQQA 4OJNA 2O5EA 2RK6A 3M6MD 4CU5A 2R6GA 2GYYA 4MWDA 1CUEA 4W9RA 4P3KA 3S99A 1CWUA 1PKXA 4MSUA 3FTCA 2EYQA 4OGLA 5MF6A 1SCJA 4UCXA 4OX9B 1EUDB 4KO3S 2FWIA 5M3BA 2IODA 2J59A 6REQB 2W2MA 3B2EA 1RWVA 1LK0A 1KTIA 3M81A 3DP7A 4ZYXA 4YNBA 2O2YA 3KB2A 3HKEA 4LGMA 4I4TA 2ONYA 2F48A 4G24A 4D8VA 1O54A 2JVIA 3A0UA 5BNTA 3W5BA 1P62B 1U6IA 1UZNA 2NYUA 1C50A 1LF5A 2WWXA 1R5BA 3CLVA 4OFWA 1X92A 3NGMA 3I6YA 3ZI0A 4EJ6A 3F90A 121PA 3IAHA 4O6VA 1ONPA 2H4ZA 4QJ4A 3QIAA 4J2OA 2YV1A 1K08A 3GCZA 3V1TC 4J7UA 1DX6A 2AN3A 4JKYA 1U3WA 1TUIA 5K3CA 1SXIA 3BXGA 2LE0A 3EA4A 1YQTA 2Q50A 3PWZA 3D7NA 3O83A 1C81A 3QQ5A 4ZANA 1ID1A 2H1HA 4E32A 3GQBB 4JR2A 3VOSA 1UF9A 2IGBA 3KJNA 4CTMA 3PC3A 1ISIA 1Z2OX 3BQ9A 4LJ9A 1AQUA 1Q14A 1L4UA 3IMEA 3ONEA 5EVCA 4DLKA 2ERYA 5CB4B 1PJLA 4KR2A 4NG5A 4EG4A 2A9FA 4Q9NA 1KRHA 3SF0A 1SRQA 1OXTA 4R01A 1CJUC 3A6JA 4I1PA 1WY5A 2BFAA 5K51A 2G82A 5A5VA 3C6ZA 5AJHA 5EESA 4MUNA 2BGUA 2ZM5A 5KWSA 3EVDA 5GJBA 2GM5A 4BE4A 1VI6A 2ZRGA 3EVGA 5JS2A 4CL8A 2JG3A 2CN1A 2VR1A 5I9BA 4HLQB 1FNBA 2VBCA 2BJWA 4JI5B 1G59A 2PKQO 2RJ3A 1G19A 2JRCA 3OD5A 3PQ4A 2BF4A 3E18A 4LHWA 2YUIA 3A1EA 2BM1A 1E1RA 3ZVMA 4BWGA 1R37A 3OOHA 5EIBD 1HDEA 2TECE 4U5QA 3F4BA 4Y6OA 3LLMA 4CE6A 4FVTA 2PLRA 2CGEA 1B8VA 5DE3A 5F2KA 4EELA 1EZZA 4M1TA 2O1XA 2YVAA 4C2AA 4EFMA 1JILA 1RRVA 1UAYA 2YC4C 1UJBA 1XQ9A 1SZJG 5A9SB 1Y6FA 3DMPA 1RPZA 1SVLA 4ES6A 4HZGA 3KE8A 1VHDA 1A50B 1OPXA 3HCNA 3HB1A 3GFQA 4CLOA 1ZX1A 3NXSA 4M0EA 3X2EA 4TPKA 2IIPA 1W48A 1WDLA 5HS6A 3S2SA 2F1RA 3H97A 3RBXA 3FWYA 3SJZA 1MIOA 1OXUA 5B1SA 3W9UA 5B64A 5TX7A 1V7QA 4O29A 4Z4FA 1TW3A 2H65A 2KI5A 1HK7A 1V45E 2JBWA 4I8XA 4ZYLA 2WOOA 5IMSA 5AK0A 1Z0AA 4RM2A 3WI7A 1DAFA 3DL2A 3EQ8A 3G1TA 4LIPD 4CU2A 1QNFA 1XRLA 2E9SA 1PKEA 3DKPA 4GP6A 3F73A 1EK5A 5CVUA 4I50F 5DRYA 3QBTA 2VDNB 4WERA 5CFZA 2YJNA 1Q1AA 1ICEA 1K8RA 5KI6A 3ET4A 3FYCA 3BZWA 4MV8A 1TJ5A 4TYPA 1OA0A 4KK3A 4M0LA 4O4IF 5B6IA 3I1YA 2ZI9A 3W5JA 1UM9B 4H7JA 1KI4A 1P1KA 4E03A 3RIGA 3HZZA 3K0BA 4F4UA 4GQIA 3KBOA 1MGOA 1ODCA 3EXFB 4EARA 1MGPA 5KHOC 1XFDA 3H83A 4PR3A 5I9IA 5DNWA 2DPHA 3NHLA 4R0MA 3R9XA 3V97A 1F0PA 1MUUA 2G0TA 4FMCF 3RC9A 4ENQA 1EP9A 2Y67A 3E4CA 4ZVSA 1RWQA 1HE4A 1ZYUA 1YZYA 3PENA 2JEYA 5DM1A 3T35A 1PU2A 2VHEA 3FF4A 3H3XA 4PLYA 2WHXA 2C8KA 2HMYB 2ZR0A 2HK7A 1C9YA 1TQ2A 1YCGA 2WIKA 4I9HA 2I2DA 5F12A 4DCSA 2JBHA 2R6FA 4MX8A 2JGRA 1VJTA 4I8IA 6NULA 4CUJA 5A1TA 4CLDA 2P2SA 1V4NA 4BQOA 1WVGA 2HJRA 3PRYA 3CXUA 5EKDA 3BQNB 3C8MA 1RPAA 4B7XA 3GJXC 2NT4A 3V4PB 1BE6A 2FPPB 5G53C 4BIMA 1AB6A 1VKZA 2PH1A 3V1KA 1ZRMA 1KJYA 2OLJA 1AG9A 3EQZA 3B6MA 2XSZA 3UENA 4JY7A 3U49A 4X45A 3WHPA 1TM2A 1KGDA 2PWZA 4JSYA 4BB9A 1DBRA 2F3TA 1F2UA 5HFJA 2G5PA 5C80A 5KWVA 2CUNA 2ZAIA 4MTCA 3WRYA 1OGJA 5TT1A 2NYRA 4WA8A 1PL8A 1XPJA 2QIOA 4W8OA 1PCXA 3N05A 1QRDA 1SIOA 1GADO 2JZOA 1GZ4A 3CZCA 5EIFA 1P6QA 3AF2A 2Y1WA 2Z2KA 2Z2YA 3QY0A 4V02A 4YMVA 3NHUA 4MYSA 3AHGA 1KC1A 1U8XX 1KJ9A 3KEGA 3RTCA 2W2KB 3RBVA 5AOCA 2YQ4A 3NPMA 4OO3A 3K16A 5D1HA 4LG1A 1M2FA 1K8XB 3CRW1 2VCEA 2R84A 4I5EA 1OROA 2P1DA 4KAFA 4E30A 1VKJA 5JCJD 1ECBA 1TU0A 1QFZA 4WZAB 3ZUGA 1ABFA 3VJRA 3IT1A 3R7WB 1N7JA 4IYRA 4S24A 4BMCA 4JK3A 3ICPA 1ZNQO 4KW7A 1I3OA 4GKBA 4K26A 3CMMA 3E15A 4J9UE 4A16A 2C3OA 1GPBA 3RVNA 4NRDA 2F1HA 1RRPA 4B17A 2BTEA 4HH0A 2J30A 3OTHA 3TD6A 4L27A 4QZVA 2PR2A 3TKYA 3W4IA 2AOWA 5M5BA 2ZTUA 3AW8A 3LZCA 5KNLA 1NMSA 1UKZA 3VR6H 2D2IA 1RM4A 4QASA 4RCYA 5DEOA 4YP5A 3PEWA 3QEAZ 2LRHA 2GBIA 4CVNA 3V1YA 4ER3A 1X1AA 4OF4A 1XHFA 2I6UA 3ACDA 4KXMA 5DISB 5EXDA 3BCRA 3ZV5A 4IM7A 5ALXA 4X44A 2PUAA 5AHWA 3UJCA 3BAZA 3AR5A 3UWKA 4E21A 5J2TF 3AB3A 3CW2A 1OIWA 2O4UX 3JQAB 5I7RA 3TPZA 1G0OA 1LBSA 5CFPA 3QEMA 1EFAA 3U19A 2QTHA 3MINA 3HM9A 4KR7A 1GGHA 4MULA 4M1ZA 2OT3B 1S89A 1NF9A 2BUCA 3JQPA 1Z7GA 5FYDA 5IXSA 2I7XA 1U65A 3ZXIA 4LE1A 1PEKE 4DIEA 1CERA 2AZ4A 1AHPA 3VYTB 3I6IA 1Q0QA 2OKCA 3PRKE 3F4LA 4Z54A 5KU7A 2P9HA 1Y8CA 1I8TA 4DANA 5K8CA 1E58A 3UO8B 1FBNA 3E9RA 4R51A 4WADA 5DOZA 1ZHOA 2IHYA 2B5WA 4J7AA 4CIWA 4M0FA 4NZPA 4S05A 1ZMXA 3LC7O 4Q3KA 3YASA 5JNWA 3R74A 4KJZA 1HNZB 5ILQA 1OKKA 4J1QA 1XROA 3NJ4A 1AT1A 2HRQA 5JRJA 3OIVA 3EIHA 3VJKA 2O8EB 4PZCA 4CQMB 1PT7A 5EJEA 5IFLA 2ZRHA 4XLLA 2PKQP 1OI4A 13PKA 4B35A 5ITZB 4UZSA 4C0KA 1CUWA 2UVQA 3N75A 3OZAA 5IVHA 1BHO1 4WCFA 5DGXA 4BMVA 2NTEA 4C4AA 4ZMBA 4N5NA 5IF3A 3DT6A 5EIOA 5K03A 5TVKA 1ODFA 5HIMA 3V7UA 2WVHA 1OAKA 3UPTA 2C92A 4J0QA 4B3BA 1D2CA 2ABWA 1ISJA 3HKCB 5LOVA 1I3LA 1NBEA 3F6BX 4FOOA 5G40A 4B7CA 3EFBA 1MVLA 1XDGA 3QVVA 1KI9A 1XZPA 3BXZA 2VDQB 3FNBA 2CBZA 2P2ZA 1QCYA 2GPAA 2DWUA 4BQNA 1GPWB 4WJLA 3A6LA 2FPLA 3WIUA 5AM3A 4L0DA 3K15A 3WTCA 3LXXA 3P2OA 4UXIA 1YBAA 4X95A 1EK1A 1CR6A 2G04A 2L69A 2A78A 4MKXA 5IDYA 2ZB8A 2W70A 1MP0A 3AHHA 3LQFA 2WR8A 3QWHA 3VO1A 4U2BA 3E1KA 4JLUA 2IHJA 3MCVA 2AZMA 1UWCA 2PZEA 3A1SA 3DVQX 3ED5A 3GYGA 4MLCA 4NBKA 4PZZA 2ZSHA 3ONDA 4Q9HA 4G41A 1R6AA 1H22A 2BR5A 2IU6A 5CRIA 5HVNA 3HCWA 3QELB 1IZ8A 3P4YA 4KI0A 4MGKR 3UMCA 1I3NA 3KJEA 3TLGA 1XZEA 3AETA 4CLRA 1UK6A 3C1TA 4HHEA 3LSTA 4HDMB 4Z4IA 1NT4A 2O2SA 1GPJA 3ND6A 4I1OA 3HDGA 2A0YA 4BDTA 4YDQA 1NUAA 5HZMA 2EWVA 4BO6A 2PXXA 1DX4A 1I1QB 5LKAA 2V7WA 1E2FA 5K3SA 5C8YB 1K7CA 2Z04A 4CBVA 1CRLA 2PLFA 2ZB7A 3ZX5A 2A6PA 2IQ5A 1ORIA 4QUJA 3MPOA 2AXEA 1C0KA 1EDOA 3UZUA 1SOAA 3AI1A 5FUMA 5KTKA 1X7XA 4X94A 2C97A 3ESRA 5A4IS 2UUAB 1EFPB 2YJGA 3GAAA 3PXDA 3QPUA 5CLGA 4CTKA 4E70A 3MWYW 2NTJA 4OVKA 5AVRA 1UDWA 5TMBA 3WDSA 4RTJA 5G3YA 4G0VA 4XCQA 2O8EA 1P72A 1XZGA 4DLRA 1L6RA 3ENWA 4H3VA 1Z2DA 2YVQA 1UWVA 3DPUA 4RSRA 5AM2A 2VP4A 4MRSA 5F7ZA 4L15A 4NSNA 1DBVO 2ZBPA 1B1AA 1V3VA 3AY0A 2AC2A 1OYOA 2PEYA 5AKLA 3LVQE 3LKBA 4GZ6A 1GSAA 2ANBA 2AYXA 2C07A 2VPYA 4S1NA 1WBJB 5HILA 1CBUA 3QPCA 1L4YA 4DMFA 1SCBA 1YJBA 3HH8A 3I39X 3AFNA 1Y4AE 1YR7A 2HCTA 3VPFA 1DJLA 4AYWA 5B57C 5T57A 3JD1A 4WJKB 2FPXA 1X1TA 1ISSA 4BQRA 1XZBA 4GOND 3RNLA 4CHGA 5CNMA 2M6RA 3LP5A 4WEOA 3AUTA 4Y9UA 3NYRA 2AF3C 3F74A 1MG5A 3LT0A 2G25A 3FNRA 3P96A 3F6PA 1NBOA 2VXOA 4PSDA 4RCVA 3ZJYA 2B2NA 1FIUA 4OX9Y 4ESOA 3TTXA 1E1MA 1J06A 2L0XA 2OBMA 3ABRB 4OHKA 1NQUA 5L4LA 1PVVA 2QYHA 4YV0A 2AN4A 4R2XA 1GY8A 1C7EA 1ULHA 1F0KA 4N3CA 4BCDA 4KMMA 1DC6A 4UUAA 3D3KA 1C2YA 2GBPA 3FSEA 4GM4A 4IKEA 4D96A 3TG8A 1QPBA 3GLVA 3PDUA 1W4LA 2QTTA 3KPVA 2AW3A 1RCFA 2O2GA 3MMXA 3SVZA 1SAYA 1Y6JA 3ASVA 2P6PA 4B0PA 2YHUA 4YPVA 2F1IA 4QRHA 5CT6A 3D54D 4NONA 4GMKA 1KBQA 1OT3A 3AHEA 4J1NA 3LDGA 4M1KA 1LBTA 3WC4A 4YJKA 3TM5A 1RHKA 3AIOA 3CZRA 1JJAA 2X3UA 3KHSA 4IOLA 3Q3VA 2NQ2C 3MWDB 3RT1A 1XJWA 3X1WA 2G17A 1DI0A 2WZBA 4QHTA 2ZRQA 3NWEA 5EGSA 3B6IA 3P97A 4WXHA 1KYTA 1E6CA 4OAOA 1OLUB 1UJ2A 1WPRA 2ZUBA 1QZXA 1MC1A 4HQ0A 1JDJA 3WYAA 1Z4IA 2ZATA 4DBLC 3L02A 2PUEA 1UT6A 3S55A 2J3LA 2N1BA 3DBHB 3SKVA 3V6LA 1KVRA 2ZUVA 3SFTA 4KQ9A 4B3GA 5DF1A 5E3JA 1JNYA 1QH8A 2OXRA 3STHA 3HBLA 5TGDA 4KE8A 4JUFA 2VDPB 2W6PA 3QUAA 2Q5HA 3KTAB 4P35A 2Q4RA 3FGPA 4LXIA 4HY3A 1MQ8B 3DV9A 4U6QA 1WNTA 2CMHA 3I42A 1F2UB 2GAFA 1G64A 3B5JA 5IF9A 2QM0A 4JA2A 2WA1A 3OZCA 3DHYA 5F78A 5A4FS 4X1YA 4UDXX 4X63A 5LMUB 3CPEA 4CQNA 2ORIA 1D1TA 3C15C 3ET5A 3GUHA 2JZNA 3JQAD 1K7YA 3BK1A 3D5QA 5J2TA 1JG4A 2OA0A 3H18A 4AKEA 5A2GA 1XNRB 3EK2A 5AR1A 1XXHE 2JIMA 2GK6A 4OV6B 4Z4QA 5JNSA 5FI5A 1XTBA 7REQB 2GARA 3E9YA 1ZW6A 3EHDA 1YJCA 2RGAA 2D2XA 3GXOA 1DLIA 1JYSA 4MKGA 3K9WA 4I3HA 3G6WA 4UOQA 3S2UA 4EGJA 1CNFA 4K9RA 1NNUA 1FU7A 5ISMA 4QUGA 2CB9A 1H94A 4LDQA 3U4HA 2QVZX 5CCDA 1UBUS 3TINA 3TD2A 3GJSA 4HLNA 2W2OA 1E0JA 5GV7A 1PO7A 3FKJA 3SLKA 5ILGA 4UJ3A 5JY6A 1M0EA 3W34A 2R751 3VTFA 1YB6A 1M2VA 4C87A 2CNLA 2J87A 1XVLA 3MTQA 4NDAA 2ETVA 3VR2A 4G81A 1L7AA 3K09A 3SFVA 3NOVA 3S29A 2FWBA 3OC0A 3ZY2A 2MSCB 3T38A 5ED4A 5A62A 5F73A 4L4ZA 1X8JA 1BDBA 2G36A 2D1SA 2H51A 4RD2A 3HFSA 3RS3A 2ZYHA 1W0JA 4UQLA 2FZGA 1RHQA 4DADA 3BGVA 5HJ7A 3FR8A 5C3MA 5HRUA 4F5YA 1GPKA 4C5AA 1USWA 4BNMA 4UNIA 3K6RA 4V0RA 1CETA 2XZPA 3B1JA 4ALKA 3SBDA 5LOVF 2X0NA 2BEUA 2NO5A 2QRKA 1U4NA 3QWBA 1VIDA 1YJQA 1PYOA 4IS2A 2PRYA 3HPQA 3ZCVA 1ZH4A 1YZVA 3KKKA 1ISRA 1D04A 2AKAB 2G08A 2QMUA 3E9ZA 4L2IB 4PSCA 5IBQA 2FP3A 3OPYI 1S4QA 2CJWA 4C7JA 2OUIA 2QPAA 4ZD6A 3UJ7A 5EFOA 5B3JC 4M6WB 1WAMA 2WKWA 3C85A 1D1QA 2O2IA 2Q2VA 5K0NA 1Y1SA 1YQEA 4NJEB 3RTAA 4DA9A 5IH7A 1RQXA 2EZUA 1U2DC 3OPYA 3EF1A 1UPTA 1VL2A 3VR4H 5CYOA 1W5AA 4D9IA 3KJZA 1Q11A 3R75A 3TTTA 3OZGA 2BKAA 4IW3B 1QGZA 2F7SA 1XQWA 4DVGA 5BV0A 4PN3A 5J5AA 1IWOA 3HM2A 2OO5A 2GB4A 1XPOA 1K3FA 3JCZA 3DE4X 3HU3A 4NU0A 4QU0A 3RUIA 4DG8A 1NUQA 1L1EA 1NHGA 4MMZB 2R7KA 4YQEA 3SDZA 5B7GA 5AIAA 2HPAA 1FUKA 2VDRB 1E3IA 4G0QA 4UCFA 5KJFA 3UA4A 1BMTA 1FX0A 1FP1D 3OBIA 4UQPA 2JHFA 2D0IA 4H7HA 2XY4A 3QVUA 1YHYA 1NTRA 3FMVA 1JVSA 4BVAA 1IK4A 1HQDA 4TYMA 4U3JB 5FYQA 4F4FA 4W9MC 1XMSA 2XUOA 2NXWA 1VRCA 2FE4A 3OX4A 5L6MB 4NLLA 4F7DA 1KZ4A 4ZCIA 1G42A 4U7WA 4DRXA 5ERYA 3UWSA 2QRUA 4X1YB 4FXPA 5F9FA 1UJ4A 4P08A 3PFIA 3NEAA 4YQYA 4BAZA 1K9SA 5EMNA 5HPYB 2EKZA 1HDGO 3H4VA 3V4OA 3FCCA 3GFSA 5HF5A 1FYEA 1SCUB 4BKPA 2IZ1A 3LHDA 3HY3A 3LX5A 3R3SA 4KG7A 5IVIA 3KJGA 1IN1A 4H1VA 2R5NA 5A1JA 3KKLA 4MVYA 4NP6A 3AXSA 5HM8A 1V11B 4PX3A 2CL0X 1SXHA 5FTJA 3WK7A 2HWKA 1IXZA 3SJCA 4Z9BA 4CHTA 2CK3A 1Z4QA 4JVNA 5EIAA 2ZKLA 4CM7A 1Z13A 1W85B 2FETA 2RIPA 4ZC1A 5DRTA 3G0CA 1QYIA 1UP6A 3FYSA 2EXXA 2GVZC 4I66A 2REQA 3G3EA 4G89A 2FPUA 1P7ZA 5BYBA 4E2WA 2O4CA 1HPLA 1GRNA 4MRRA 2RHLA 3L0CA 3QY9A 3REQA 5K99A 1E89A 1QGDA 1V6AA 3A1UA 3P2EA 1J42A 1BE8A 1YGYA 3E7XA 4Q03A 4BJ6A 4KR9A 3GA5A 1ZN9A 5C8VA 4K1XA 1DUVG 4MI9A 4P31A 3JWPA 1FRVA 3VAYA 3IA2A 1IFXA 2R4QA 1TRHA 2LDXA 4QT0A 2WKQA 4WCFC 1ECJA 3EIUA 3KG2A 2G4LA 4LK3A 1ABEA 1I6LA 2XUFA 4WGGA 1K5PA 2V5UA 2C4HA 3EEOA 5HP4A 1H3NA 4W5NA 3SZLA 3LQYA 2W48A 5KEIA 2O8NA 2MDTA 2YV4A 3OECA 4G86A 3EMDA 4CDGA 1JAHA 4U7JA 5IJ9B 1XNJA 4JB8A 3GROA 2H59A 1VLJA 4WKBA 2Q6IA 4BATA 3ID6C 3CUSA 1JPUA 2VSOA 2BT4A 3NDBB 5AICA 3JZIA 3VR5A 4HMOA 5G4LA 4YCSA 1P8JA 2PMCA 1E66A 2I03A 4LI3X 5T3YA 2QQEA 4HDRB 3H9QA 4UJ5A 4G36A 4LX8A 1A5AB 3W8DA 2KJQA 2PSDA 2PZ8A 4EFLA 1RJ9A 1B76A 2ORVA 3K9NA 2A33A 3MK31 5FLYA 3KBBA 1CEXA 4Z3KA 1L8AA 4X8MA 4FDUA 4IJWA 2QV7A 4QWMA 3I53A 4YJHB 1CXZA 5ALRA 5HOQA 2BGJA 3QJ5A 3U40A 5KX5A 3CEAA 3GP5A 3WIDA 4KYVA 4K6OA 1VI2A 1E1LA 2PVPA 2QI9C 2R00A 4IGAA 4G1EB 4YQZA 5PNTA 1S3FA 3GJ0A 4JYCA 5CYPA 1UBSB 3M5PA 1YE8A 3L4BC 2HQOA 2C2GA 2A35A 3IHTA 2I3ZA 4D26A 1OFUA 2IDJA 1E2GA 1EI9A 1C7ZA 1OD6A 3N0VA 3S4YA 2MSWA 3GJ3A 4LJ4A 4PICA 4PZDA 4CLOB 1BWSA 3W79A 1XG5A 1K7FB 2O7SA 1MVNA 3VZSA 2AF4C 4I46A 1EFPA 2G4CA 4YAOA 2YV3A 4MUGA 1YK1A 3A3KA 3M9XA 4I9FA 4DMMA 4CEJB 1BGVA 1R4ZA 1VCHA 4BYGA 3ZS8A 2N3ZA 4TMYA 3T9BA 4QT4A 3QKSB 3D2AA 5JZSA 1S1CA 4OHPA 5JBNA 3KXIA 5KKAA 2CXNA 4PTZA 2VJDA 1I4OA 4NHEA 4C5CA 2PD3A 4LDPA 2LCFA 4H15A 5FDFA 4R8MA 3G82C 4PLHA 3EGVA 1BU5A 1LBHA 1HKUA 3GJ4A 2XXAB 1C8VB 3WK5A 2I71A 4O4JB 4C0AC 2HYIC 2GK3A 3T7RA 3V1MA 1WMAA 1CZNA 2GA9A 3X3HA 3VU9B 5B7NA 1O77A 2LXNA 1LW7A 5AO9A 3R76A 4Z51A 3NBQA 1G8SA 1KMMA 4EA6A 3TL6A 2HF2A 2PBRA 1LVHA 2R47A 3CKLA 2I3AA 4M60A 1TCBA 1XAIA 1JIKA 3ZJ4A 1C29B 3Q15C 3RC2A 2W9XA 4HVLA 3HS3A 3ENKA 2VPPA 4EYKA 3A32A 3IBYA 3D5TA 3PNVA 1WP4A 5CJJA 4CYMA 2EJUA 3QF4A 1T5OA 2HLHA 1ZJ4A 5JS1A 2LV8A 1Y9DA 2J3KA 1RI3A 2ZIXA 1UPXA 2L19A 2OCKA 3HMQA 1L5HB 1YBVA 3LTEA 1DHRA 4GC9A 1MB4A 4ETMA 4K9SA 3GJ6A 2O2EA 2RHHA 4IKOA 3AXTA 5DGCA 2GJSA 4YUVA 3OM8A 3PRHA 2NU8A 1P2BA 2H9AA 2W0SA 1HZZA 2EKQA 2Q21A 1JAIA 3ANTA 1J8MF 1XUOA 2BFEA 2DSNA 2PUJA 3KB8A 4Y2VA 3UT6A 1JPNA 4AZTA 4EGCB 5DCUA 1UDCA 4LYGA 2FUNB 4RLHA 4Q21A 4ROTA 1UH5A 1Z12A 1AN9A 4OGFA 3RYCA 3RC3A 1P5JA 1Y82A 2FLKA 4PRZA 3WJAA 3P19A 4GL2A 3M1LA 3B5IA 3L0BA 4F97A 6Q21A 2POQX 3H6KA 1Y1QA 4TLLB 4BHTA 5HZGA 2ZROA 5IH3A 4DV3B 3DYIA 4R4JA 3OT1B 5BVHB 2GHRA 2V98A 3LLSA 5EJ4A 2PN1A 1ZU4A 2RGUA 3TR6A 5BW8A 1XD2A 1A71A 5E9AA 1R88A 3AFGA 3LVBA 4KGVA 3G8DA 3BIXA 5EJ6A 3R8XA 4AP9A 2V74B 3UMSA 1F7UA 3F6CA 2DY0A 4ZYWA 1FXSA 5LQDA 2FRVA 3F97A 1IXSB 3DE3X 5K8JB 5MFPA 4TX1A 1IC6A 4UUQA 3ZTTA 2D4HA 3ZXXA 2R0QC 1FTSA 4ZQHA 1Y48E