4XCXA

Methyltransferase domain of small rna 2'-o-methyltransferase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
216
Chain Sequence
QFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGVDINEDKLRWRGDSLAPFLGDFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSGDLARFPEVVFGYLSPSMIVISTPNSEFNPLDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPGAENVGYCTQIGIFRKNQHDQHVYKAVFTTSYPSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human C1ORF59 in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Small RNA 2'-O-methyltransferase
total genus 63
structure length 216
sequence length 237
ec nomenclature ec 2.1.1.n8: Small RNA 2'-O-methyltransferase.
pdb deposition date 2014-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4xcxA00
2G70A 3KR0A 3DXZA 4QVKA 2A14A 3E7PA 2OBFA 5GIPE 1Q0SA 2PXAA 2Y1XA 5EEHA 2NP6A 5C0OE 1O9GA 3MTIA 1ZHFA 3UJAA 4P7FA 4PNEA 3BKWA 3HTXA 5LQJA 4QPNA 2XYRA 3A26A 3MGGA 5LSAA 8MHTA 1Q0TA 5EZSA 3PFGA 4E2XA 2IH2A 4QVGA 2ZLBA 4LWOA 5LQUA 4WVLA 4E2YA 3PS9A 1JTFA 2ESRA 3GIWA 2YTZA 4XUDA 4QQKA 1HMYA 3TOSA 4AZWA 1KYZA 5K0GA 2AR0A 1NW3A 4HSGA 4R6XA 3RW9A 1WG8A 5JUWA 5CIYA 4A6DA 2GLUA 3G7UA 3FTFA 3HA7A 2JG3A 3BGIA 2ZBQA 1MHTA 4YMHA 3OPNA 3GXOA 2C7RA 5DX0A 2YQZA 3HCAA 3DXYA 3P9KA 2O06A 4RSRA 4U7TB 5D1NA 5HEKA 2N47A 2ERCA 3M70A 4DCMA 5GIOE 4E70A 1VP3A 1H1DA 3AXSA 3T7RA 1PJZA 1RI5A 1VLMA 3G2QA 4GC5A 4RX1A 2IBTA 1I1NA 2VDVE 1YFLA 3PLAE 3LPMA 4BLVA 4RTPA 4DKJA 3LKDA 5DM2A 1NT2A 3GRRA 1R00A 4GOND 10MHA 3DMHA 1RJGA 5E2AA 1NE2A 3BGDA 3S68A 3LKZA 3M4XA 1P1CA 1AQIA 4R05A 2YVLA 4IV8A 2HWKA 4YMGA 4RTNA 3M6UA 1G8SA 1RJEA 5GM2A 3BKXA 5DX1A 2XYQA 1NKVA 1V39A 3HA5A 4EVIA 1O54A 1OR8A 2OB1A 2AOTA 1SQGA 3SXJA 4PONA 1EJ6A 3FUTA 3EEOA 3BWBA 1DL5A 5DSTA 5K09A 3HA3A 4C06A 1RJFA 4X1OA 4DCGA 5K0LA 4HTFB 4C03A 5KVAA 3GWZA 3E23A 4OA8A 3MERA 4PYKA 5HILA 3NWBA 4RVGA 2NXNA 1SVUA 2AN4A 2CWWA 5E2BA 3UZUA 4PYOA 2BZGA 1R8XA 5CUQA 2OY0A 2PBFA 3BT7A 1R74A 2FCAA 3MB5A 3PB3A 4GOOD 5HOQA 1U2ZA 4K6MA 3BZBA 4QDJA 3EVCA 4YV1A 3AXTA 3OU2A 5ERGB 2HR1A 1RI2A 3B3FA 5E9WA 4PGHA 3FRHA 1T43A 1X1CA 4GOMD 3GNLA 2FK7A 4M36A 1SUSA 1NW7A 2LD4A 1KYWA 1YZ3A 5K03A 3KQSA 4MWZA 5FCDA 3FUUA 5F2OA 1XXLA 3O7WA 3B3JA 3GRUA 1KXZA 3LCVB 1VIDA 3NDJA 4XCXA 5U4XA 2JHCA 5E1BA 5E1OA 3TM5A 3GCZA 3UBTA 1QYRA 3SM3A 4GOLD 5DX8A 1KPHA 5GP1A 4E30A 4NECA 5CVEA 1G8AA 4P7GA 4LECA 1D2HA 3GRVA 4R8RA 2AS0A 3TKAA 1QAMA 2R3SA 3HCCA 1P39A 3FPHA 2ZBPA 5HIJA 3EGEA 5HIMA 3KQYA 4KVZA 1P1BA 5FUBA 1JQDA 3IV6A 2IDJA 1QANA 2BH2A 2PGXA 1L3BA 4HTFA 1TPYA 2UYQA 3ELDA 1EG2A 3L8DA 5BW5A 1WXWA 3EMDA 5LQKA 4BP1A 4FR0A 4EK9A 4YV2A 3KPUA 1AF7A 3ELWA 3HVIA 2P7HA 2YXLA 5JR3A 2IFTA 2WK1A 2PXXA 1YZHA 1VBFA 3REOA 3EGVA 4EMSA 2XVAA 5EHGA 3PTAA 4BY9E 2G72A 5LR6A 3M33A 2O05A 4UOEA 3LX6A 5F2NA 3O31A 4WXHA 2HTEA 4C4AA 2VDWA 3I5UA 3DOUA 3DULA 3KPYA 3KQOA 4RTLA 4RTQA 4OBWA 2QRVA 5EIFA 4AZSA 2Z6AA 5ICGA 4V0QA 2GPYA 3LGAA 2ADMA 3KQPA 4EKIA 5FULA 3I64A 3AY0A 3OFJA 3P97A 3THRA 3KQQA 3X0DA 5EOVA 2FK8A 5HIKA 2G8NA 3I9FA 3QOWA 2GAFA 5DTQA 2OXTA 4QDKA 2KW5A 4KDRA 5EIWA 2B2CA 3CCFA 3UJ7A 3PT9A 4C07A 5EKXA 4AUKA 2GB4A 2WA1A 3E8SA 3EVDA 4P7KA 3SSMA 1JQEA 4ER6A 1YFJA 1RI3A 2B78A 3G88A 2JH9A 3M6VA 4PYNA 1ORIA 2IP2A 3HNRA 3I58A 2XVMA 3LDUA 5DM0A 3KQVA 2CKDA 4CKCA 1UIRA 2GS9A 3OZTA 3KQTA 3LBYA 4YUYA 1SQFA 3KR1A 4MIKA 2XYVA 4EQZA 4RTOA 2XBMA 3I53A 3DTNA 1NBHA 3GRZA 1I4WA 3HM2A 4HC4A 5E9JA 1AQJA 2CMHA 1XDSA 5CM2Z 3OFKA 5DTRA 1X1AA 3KR9A 3MQ2A 2ZVJA 3NJRA 5EVJA 4DF3A 4F86A 4C04A 4RTSA 1G6Q1 1L3CA 1KIAA 3ID6C 3OU6A 2ZTHA 5KS2A 2EFJA 3PX2A 1TW2A 4ER7A 1MJFA 4IKPA 4E33A 3FPJA 2PV0A 1XCJA 5GWXA 3KPJA 4LWPA 4FGZA 2ZIGA 2ZIFA 3C3YA 2PXCA 1KPIA 5CVDA 2ZIEA 1QAOA 3THSA 5GOZA 1EAMA 3A7DA 3G2MA 4M37A 5EZQA 4PYJA 1BOOA 3GDHA 3R0QA 4F85A 5BP7A 1F38A 1KPGA 1N7IA 2BM9A 1SKMA 1XDZA 5T64A 4RTKA 1VPTA 2AZTA 2H1RA 2NXJA 2IDKA 3JWGA 4HG2A 4X63A 2P35A 1BKYA 2VP3A 3DMGA 4P58A 5LQRA 2F8LA 2O07A 5ICEA 1G55A 3EVEA 3EPPA 3PFHA 2G1PA 1XTPA 2PWPA 4QQNA 3OCJA 3TLJA 3MCTA 1G60A 1NBIA 5EMMA 1SG9A 3LL7A 3UWPA 4CTKA 2JHPA 2PKWA 5E1DA 4DM3A 2BR4A 3F4KA 3HCDA 2PX5A 1XDUA 1R18A 3EEYA 4RVHA 1D2CA 2ONZA 3BGVA 4E31A 2EJUA 5D1HA 1JSXA 4GC9A 3UA3A 2PX2A 2ZZNA 3FZGA 1EIZA 5FQOA 5KYGA 1M0EA 3KKZA 3CGGA 3D2LA 3HVKA 4V0RA 2OYRA 5EHIA 3PX3A 2YXDA 3HVHA 4ER3A 2YR0A 3QOXA 1KR5A 4M38A 5BW4A 1JG2A 3FUWA 3FYDA 2K4MA 3ELUA 1G38A 4RVFA 1AV6A 3G5TA 2YUIA 9MHTA 5EKUA 4E32A 7MHTA 2P8JA 3MCZA 1EJ0A 3QV2A 4HGYA 3GO4A 4FS8A 4FZVA 3UJ8A 5EEGA 2P3LA 5B1SA 4DMGA 2PT6A 2OKCA 3KR2A 5DPMA 3G2OA 5F2KA 3VC1A 5EG5A 2PWYA 3SR4A 3K0BA 3M6WA 1Y8CA 1VQ1A 3RODA 1B42A 2JH8A 1QAQA 2NYUA 1TW3A 5GM1A 4DQ0A 1YUBA 4PINA 1UFKA 4ER0A 5KQRA 1NV8A 5K05A 4YUZA 3NDIA 5E8JA 1O9HA 2EJTA 2P41A 2PX4A 3EVBA 1ZGJA 3M6XA 1ZGAA 4RWZA 3VSEA 4Y2HA 2PX8A 2NP7A 3TFWA 1I9GA 2OZVA 4X41A 3CKKA 5DXAA 2C7OA 2G71A 2ZZMA 4ISCA 2EX4A 4HRAA 4E2ZA 3T7SA 1F3LA 3EVAA 3G5LA 3B7PA 1JQ3A 4FSXA 5K0CA 2OPBA 2I7CA 3HP7A 3KQWA 2FYTA 2FRXA 4U7PB 2Z6UA 4YUVA 3TRKA 1YB2A 2PY6A 2R6ZA 3KQMA 3ORHA 4GBED 4MTLA 3V8VA 2HV9A 3H2BA 1PRYA 3E05A 1M6YA 2H11A 3OZSA 5FHQA 4FSDA 3EVZA 2AOXA 2AOUB 3LECA 5DM4A 1RI1A 3A27A 3DMFA 2ZBRA 1FPQA 2EG5A 5P8WA 1M6EX 2BR3A 2I62A 3FTDA 4PIPA 5K0BA 3ANXA 5K0NA 4KW7A 4KWCA 5IKMA 4CXMA 3A7EA 5CVJA 1N7JA 4RTRA 5EC8A 5DLYA 1FP2A 5LQNA 2OO3A 2QY6A 4QTTB 3JWHA 5K0FA 2Y1WA 4QPPA 3LBFA 3LDGA 4PCLA 3TMAA 5HZMA 4MQ4A 4OQDA 3DXXA 3HEMA 4KRGA 4BP3A 3OU7A 2UYOA 4PCAA 1WXXA 1IM8A 2JJQA 4M7RA 3CJTA 2ZCJA 4BLUA 2P7IA 5K0EA 5CVVA 3A25A 4A6EA 3B89A 3GJYA 3KHKA 3HCFA 3KU1A 3R3HA 1DUSA 3HVJA 2QRVB 5FTWA 4FP9A 2P3OA 2FPOA 4Z2YA 1WY7A 2VS1A 3IYLW 3KPWA 3UFBA 3UA4A 4DA4A 4GQBA 3LDFA 3ERCA 5FADA 1JG3A 2WA2A 2B25A 4BLWA 4JXJA 4E2WA 4IV0A 3V97A 5EMKA 2QYOA 3T0IA 3MTEA 4HH4A 3FPGA 5K0JA 2I6GA 4P7JA 1RI4A 1SUIA 3UJBA 4RTJA 3CBGA 5FWAA 5EMJA 3SMQA 2NNWB 3OE5A 3RIEA 5DTMA 5T67A 3CJRA 3FRIA 4IWNA 3UJDA 2IIPA 1ORHA 3AJDA 4R6WA 2P1DA 4QTUB 5FA5A 3TQSA 2CL5A 1NW8A 2P3QA 4CKBA 3P2KA 4RYLA 5C9ZA 2BM8A 2UZ4A 2ZFUA 2VZ9A 3SGLA 3VYWA 2DPMA 3HCEA 1KP9A 1XVAA 3WSTA 2AVNA 3UJCA 5FHRA 4PYMA 4OBXA 5EMLA 5ICFA 5BXYA 5LQCA 5K01A 2AOWA 1XCLA 2C7PA 2Z6QA 2AN5A 5HIIA 3BWMA 4KDCA 4L7VA 3T7TA 5MHTA 3CJQA 3VC2A 5C1IA 2PLWA 4PIMA 3ME5A 3EVFA 4KIGA 2IBSA 2AOTB 4PWYA 2GA9A 3TPZA 2ZWAA 1L1EA 5CCXA 1QZZA 3PVCA 3IEIA 4R8SA 1WS6A 3TKYA 2ONYA 1ZG3A 3Q7EA 3UJ9A 1FJXA 2ZW9A 4X60A 2HNKA 2ORED 3K6RA 3OZRA 1YF3A 3U81A 1X1BA 3CC8A 2ZWVA 3GU3A 3FTCA 3IHTA 3P2IA 5DRYA 5H02A 2AVDA 3UJ6A 1Z3CA 2E5WA 4AZVA 1NW6A 2BR5A 5K8VA 3JWJA 1P91A 4LG1A 4B17A 5G02A 3NW9A 3DH0A 5DRTA 5E1MA 3C6KA 5EPEA 4H0NA 2Q41A 3A4TA 1VL5A 2UYHA 1JG4A 1JTEA 3FYCA 3BUSA 5E8RA 5EQJB 3R6TA 1EQAA 2O57A 4AZTA 5M5BA 2YX1A 4GF5A 4GUAA 4PGGA 3NVKI 3SSNA 3P9NA 1KHHA 1JSZA 1ZQ9A 2CMGA 3LSTA 3P8ZA 5DM1A 2HMYB 1NW5A 1JG1A 5CVUA 3C3PA 3MHTA 1FP1D 2B3TA 2IH4A 2P40A 3B3GA 3SX0A 5E9QA 3TM4A 4EKGA 2GH1A 1XJ5A 3DLCA 1IY9A 3EMBA 4OX9Y 4YV0A 1NV9A 1N2XA 2H00A 5DT2A 3CVOA 2UYCA 4GEKA 3DLIA 4Y30A 5CD1A 2AOUA 2ZSUA 4AX8A 4ER5A 2B9EA 1UWVA 4ZTBA 5CCBA 2VDUE 3B5IA 3DP7A 5T6BA 5FQNA 3BXOA 1VE3A 3EGIA 4FT4A 2PT9A 1VP9A 3AWIA 2ZULA 3P2EA 3FUVA 4G56A 1L9KA 3BWYA 2NXEA 5ICCA 3GRYA 1BC5A 4CWAA 5FA8A 5LQAA 2PSSA 1WZNA 3G8AA 3FUXA 3FTEA 4YUXA 2IH5A 4PYLA 5GINE 5KQSA 3ELYA 1X1DA 2I9KA 3G2PA 2C7QA 3G89A 4POOA 3P9CA 5FWDA 2PJDA 2PVCA 1D2GA 4KIFA 4RV9A 3SSOA 3DUWA 3R24A 4RTMA 1L3IA 3Q87B 3LCUA 3GGDA 1HNNA 2V74B 3FPFA 3HCBA 4XUEA 1IXKA 2QE6A 2AN3A 2QM3A 1ZKDA 3OE4A 4RVDA 4O29A 1JR4A 2IPXA 3EVGA 3NVMB 4OA5A 2AOVA 3NWEA 5EGSA 4ATNA 4PYIA 4HGZA 4X61A 3KPVA 2DULA 2V7EA 3C6MA 3BWCA 5HFJA 3R9XB 5DSXA 3ER9A 2YXEA 1DCTA 3LHDA 3DR5A 3O4FA 3ER8A 2ZZKA 1X19A 4XUCA 4MHTA 4C08A 3LCCA 1R8YA 2IGTA 2FHPA 3G8BA 5IH3A 1INLA 1R6AA 2JHAA 2O0LA 2NXCA 3JWIA 3P71T 1BHJA 4PYQA 3TR6A 3C0KA 3P9IA 1FBNA 4DZRA 4CTJA 3FPEA 1RJDA 3MAGA 5DWQA 3NMUF 4FT2A 3NTVA 3SVZA 4YUWA 4C05A 4F84A 5DXJA 4CKEA 2OB2A 4OQEA
chains in the Genus database with same CATH superfamily
1M5TA 2VP4A 4MINA 4BNHA 4QVKA 1ESZA 2BFEB 2DBVO 4CEHA 1O97D 5AVJA 1IY1A 2G04A 4LGCA 3F4LA 4UNRA 1P0PA 3MTIA 3O8LA 1KH3A 5KSPA 1W25A 1ZHFA 4WRRA 2WWVD 3UJAA 1C3OA 5ED0A 4ZQEA 5DISB 4KFSA 3GAFA 1NQVA 1Z88A 1PR9A 2OCLA 2PQ0A 2VDNB 4MVJM 5KOJB 2Z04A 1NXVA 2J08A 1NWHA 5BPFA 5KWEA 1J20A 2C9YA 4MHOA 2PBZA 1P9NA 1SBHA 4CQMB 2A8YA 1XXHB 3SX2A 2VHQA 3FTPA 4YAGA 3NUGA 3LA6A 4I1SA 4IHQA 5G1NA 2GLUA 1QCCA 5FBVB 1U3CA 1UDXA 1Y4UA 3L7YA 4ZRDA 5GQSA 1XV5A 3KC2A 4JL5A 3SIRA 4WNAA 3RG2A 2BONA 2AYXA 1YI1A 4LDQA 3AEYA 4OGFA 2CW5A 2WT4A 3A3YA 2WY2D 4OB7A 2QTCA 1JDVA 2HPAA 3IV7A 2O52A 1U9JA 1SAYA 5IZ4A 1Q14A 2BGLA 4KODA 1ENYA 3PLAE 2NYRA 4DHWA 4I55F 3ZWNA 3WWEA 1M1YA 1V3QE 4X3OA 4EMBA 3KKEA 2JL1A 1I1HA 1DLIA 2LDXA 5L3ZA 3DAFA 3WLOA 4EHIA 5KNLA 4HAIA 4EBFA 3LKZA 2SBTA 1W73A 4RU1A 3UWDA 4YMGA 1LLFA 1GPYA 2AI2A 5NULA 2J30A 1ZUHA 1R1DA 2WKSA 3T12A 5BSKA 2EFEB 2ZRNA 5EUBA 4HDRA 1V39A 3HA5A 3NWJA 4MH0R 2Z3WA 3CX8A 2QA5A 3AU9A 4UHBA 3UMSA 1YL5A 2CT8A 3WHPA 2J32A 3FUTA 3SR3A 2IHVA 2OSVA 4PQFA 3M1IA 4R2JA 3RVLA 1WD7A 1U3GA 4HTFB 4CT5A 4I50A 3E23A 1WW2A 3IIKA 3TTYA 4A4DA 4CGZA 2Y2VA 4DJ5X 1WB5A 2JBWA 5C46F 3QELA 3A2MA 2OGUA 3CNLA 4L85A 4AWAA 4LBZA 3O0DA 2R25B 3TZEA 3Q1LA 2QX8A 1X2BA 2ZAIA 3I2YX 4IJ5A 4LXXA 5EINA 5E7IA 2A7QA 4EW6A 1VA4A 4PN7A 2W2OA 3TCKA 1D5WA 3HHPA 3GN1A 4DCTA 8ATCA 1JMVA 3K72B 3S7ZA 1UZUA 1BMDA 3BTSA 4EO9A 1UBRS 1ZU4A 3C2QA 3O7WA 3GRUA 3F1LA 4FEYA 1P7WA 2O4UX 2Z98A 2LWIA 3H86A 1HG1A 1BD4A 3RHZA 3UAXA 3SM3A 4HS4A 1Y4SA 4MULA 5KSWB 1P4RA 3G6WA 3GRKA 1NA5A 4IR7A 5LMNB 4MRMA 4QDXA 2PKQP 3V1UA 4MRPA 2OWEA 1BJRE 1G8AA 3PICA 5F1YA 5CK5A 4S0ZA 3RC2A 4KWHA 5LD2B 4E2FA 1RYEA 5KWJA 1Q83A 2DWUA 2XCRB 4RLQA 2A0UA 3H9QA 2FUCA 3Q7SA 4JJ8A 4U9HS 2QQGA 1M34A 3P45A 1R9GA 3P4XA 4YXFA 2XZOA 3K53A 1R8SA 3F97A 3JQ7A 3IP7A 1PJAA 2JK0A 2IXEA 1U04A 1PL7A 3H1GA 2OT3B 3KWJA 4NU8X 3PKZA 3AVXA 1QC5A 5DTEA 3RVPA 2W2QA 3O7MA 1E9SA 2GESA 2IGBA 4KPGA 1AF7A 1P6UA 5CNIA 1V95A 3VVMA 3WYBA 3DEKA 5EJ2A 2OKGA 3IBTA 1UT8A 2JNWA 3O8NA 3VYUB 1BFDA 3WRWA 1RZRD 2XVAA 1BX1A 2HEGA 5AH0A 1BHQ1 4PLZA 1NC3A 3RYIA 3S6JA 5KOHA 2Q9BA 3G1TA 4MAFA 5TQ2B 5LCXA 4Y6PA 2ST1A 4JLSA 3RRZA 1LK0A 4B8YA 5A9SA 2Y8EA 3AVWA 4WX2B 1MC4A 1WCXA 3E1KA 4OGGA 3RWMB 1JJAA 5ECDA 4QUGA 4U2FA 1HE2A 1CB0A 1S3GA 5EOVA 5JATA 1T5LA 2FRDA 3ESQA 3QOWA 3VJLA 2FFHA 2FF5A 2AXEA 3JD4A 2OXTA 2X0FA 1Q21A 3CCFA 3QPUA 5GMOA 5H9VA 2DFVA 4FX2A 2Y4NA 5T4BA 3W06A 4N5HX 4US2R 4CCYA 3M6VA 2AG6A 2JH9A 5LKAA 3TZCA 3IVRA 3UF0A 5JLJA 4GQAA 1T34A 3U6BA 2O0JA 1X9GA 3B9PA 1NOKA 2AE1A 4O4IF 1PX2A 3QHPA 5DHPA 3TUJC 3U48A 1XLTC 2XLCA 4XVQA 4C6HA 1E32A 1NLMA 1TNDA 1XWIA 4H7EA 4NK5A 3AM4A 5JSUA 5JS1A 2VDJA 2DETA 2ISCA 3PEWA 4BXOB 2A9PA 4ZV7A 1VRWA 3HR8A 3VPSA 2GN2A 4D99A 4ZHQB 5JNSA 2Q6LA 5CFRA 2PE5A 3A58B 1XTBA 3AINA 4GZLA 1V2GA 4KCGA 2OV6A 5JZOA 2BHSA 4DCSA 3JAWB 4IDPA 4O5OA 5DYIA 1JHUA 5CYOA 4YY3B 1Y82A 4CMEC 4IHJF 3AHDA 4U00A 4H15A 3EOAI 2EZTA 3CO0S 4WZZA 2VFAA 2YNMC 5GOZA 4TSRA 5AJXA 5IT5A 5KYWB 4XIYA 5AVOA 4Q4HB 2H57A 3W05A 4PFSA 5ESXA 4EABA 4AY2A 1VI2A 3E81A 4YRDA 3E5HA 1GRQA 3KYCA 5JVDF 1X9HA 3EQ7A 4HG2A 5F1KA 4X1IB 1BKYA 1GYQA 1DX6A 1JR3A 2F43B 2F9FA 2VLIA 3MAAC 3RV4A 3I9JA 2IW3A 2HU7A 1FRQA 3HXPA 4JKIA 5K3DA 2QVYX 3MCTA 1CUIA 4TQGA 2W48A 4YRAA 2Q27A 1ISGA 4V0OA 1L7DA 1C1YA 1YFZA 2B30A 2H7YA 1JNYA 2WZBA 3E4CA 2X7HA 4OBEA 5A5GA 1JR6A 2CVPA 2G28A 4IUYA 5KU1A 2L18A 1VBNA 1HRDA 3I9V1 4W6ZA 2LCFA 3WA7A 4FYMA 3OQOA 2XBUA 3U9TA 3PX7A 1NSYA 3ZKAA 2IYNA 1GL7A 2VTBB 2JANA 4M89A 5D3MB 3T06B 2YBDA 4C29A 4KPFC 4PHCA 3S0JA 1VPVA 4KXYA 1C1XA 1NE7A 3GUCA 4QBIA 1E2QA 5AKHA 2G09A 5EIOA 3QH4A 4IIJA 1LZKA 1L8OA 1WD5A 3ELUA 4J7XA 4JU8A 4RVFA 3SU8A 7REQB 5EKUA 5AVVA 3NRCA 1GAQA 4IGFA 4ARVA 5CB0A 4AD8A 4EUSA 2PD6A 2VBGA 3B9BA 1PZEA 1DCFA 4DWOA 4DXDA 3ICOA 4QPCA 2DFDA 1OQAA 3T4EA 2W2KA 4I6EA 3N0TA 2Y9PB 3G2OA 4N0MA 1DKOA 5KCMA 1WPGA 2O1EA 3KOWA 2IE8A 4CPDA 4RSMA 4LJ4A 3HNOA 1B42A 5DP1A 3VR5A 4J7UA 4WPGA 3R9KA 1N5LA 3O94A 2J07A 4UDOA 5DMHA 1KO1A 1N8KA 3OQHA 4WSOA 1II0A 1P6QA 3DDUA 3N2GB 4AY4A 4XGKA 5LWHA 1GYRA 4PAQA 3VNAA 1CF2O 4US1R 5IEBA 4PHGA 4X41A 1M8KA 2Y71A 3CKKA 2BD0A 4HAXA 3HFGA 1QHNA 1Z6YA 2B1GA 2Y27A 4PQGA 2H08A 5BSHA 5JCJD 3BRQA 1F3LA 3PIRA 5FNVF 5SYAA 1QRRA 5F52A 1H3FA 1ONBA 3TRKA 3JQAB 1GOTA 2P5TB 4D25A 1P77A 3DEIA 4OREX 5TC4A 1FOEB 1OILA 2XD9A 1LI4A 3SNKA 2J5RA 2QTRA 3U44B 3GCWA 3D8NA 4OLHA 4LX8A 3A27A 5INTA 1X39A 2H9IA 1P62B 2XMZA 2ACKA 1ORTA 5CXXA 3D6UA 3KJIA 3PCXA 4Z0TA 2ZUTA 3R74A 4Q4DA 1VRVA 5HBRA 3FCOA 5LQNA 5B4VA 2XHZA 3H2HA 4C7JA 5K8CA 1YD7A 3B78A 1QIGA 2QE7D 1K4YA 1SO8A 3DJFA 1XTRA 1XEWY 2D0PB 3EIQA 1HC7A 5FBKA 3HEMA 2C4TA 4RSHA 1X7XB 1XMXA 4G4SO 5AOAA 1WXXA 3LFHA 4CL8A 1J49A 3QIVA 3ZOKA 4EB8A 5LMCA 2YWCA 1LK5A 2P7IA 2DUJA 3OIYA 3PTLA 5F7OA 1E2IA 2I99A 4GD3Q 3GJYA 4W6QA 1MQ9A 3U17A 4L8LA 3OD5A 3UFBA 3AFMA 1CUSA 2FPOA 3HMKA 2W5UA 2CJYA 1JJFA 1GNQA 1PAUA 2GYYA 3D0RA 3ETDA 4FCWA 4GQBA 4HGNA 4RULA 1V4BA 1WL8A 5I5EA 1JLRA 2ZRMA 3AVPA 2NPFA 4C1NA 4FEEA 3IP1A 3EXG2 4QYMA 1JYSA 4TV9B 4EL5A 3VH2A 5FTMA 2QZ9A 2ZSHA 2WVAA 2XTAA 5HS6A 1FS6A 4N0DA 1R6VA 3GRPA 1ZCBA 5DBIA 3EW7A 4U9IS 1QCYA 5ALGA 3PCTA 4DR3B 1XQWA 1OAOC 3TGLA 1V41E 2WF5A 1SK9A 2I3BA 1SXQA 5MFZA 5TIIA 1JIXA 2JI8A 4TN5A 2GASA 2WSMA 1QH0A 4OUDB 4YFYA 2ID9A 1UXHA 3BCSA 4UZSA 3T7DA 4MVJE 4EUEA 3RYCA 5BWBA 1L1QA 1E99A 4V2IA 1SJ9A 2I3AA 3W1EA 3OMLA 3ASVA 3F5SA 3WP0A 1R7RA 1U0LA 2D00A 3HCEA 1XRJA 3QW2A 4OHMA 1D1SA 2IDMA 2YJGA 2H2DA 5C8VA 3QUSA 5DH9A 4ARIA 5K3EA 1CHNA 3D3NA 4A10A 1QFJA 2BI7A 3DO5A 1YC2A 2Y05A 4AUNA 4EGFA 2ZYIA 1KR2A 1E6KA 3QPBA 1CU1A 3CJQA 5IJ9A 1A7KA 4IJ6A 1K1EA 4JIMA 5DBHX 2QQ5A 2OC4A 5MF6A 2EW2A 4WY8A 4DZZA 2PKXA 1Z38A 4FDTA 1WIWA 4PGAA 2YYAA 1XRQA 2FOXA 1KE1A 1DMSA 1SIWA 4DUGD 4FILA 4NJOA 1M2JA 3BGWA 3C3XA 3IAAA 1HLGA 6PFKA 3UXMA 4P4UA 4QT0A 3U81A 5H1YA 2QN8A 7GPBA 1XK7A 1ZJ5A 3PHCA 3TQOA 2J45A 3I83A 3PNSA 1IZ8A 2FPIB 2DJIA 3RC3A 3H42B 2NO7A 1PZGA 5KOIA 1PFWA 1CNMA 2Q49A 1TPZA 2ZYAA 3BXXA 2G8LA 3OZ7A 5JC8A 2WPDA 9GPBA 1YVPA 1QIDA 3HYLA 4M49A 4WQMA 3EZ9A 3ZVNA 3AF1A 2OZEA 2C4MA 4HQLA 2B8TA 1D6NA 5BOSA 2O8NA 1FS4A 2W2VA 1JHRA 2CMGA 1D5CA 1PK8A 4RADA 5IK2A 5DBOA 4YRSA 3IQHX 4WZBB 5BV7A 3IOEA 3EXFB 2W2LD 3WDKA 1WSWA 4TMWA 5TF4A 2C78A 4TMVA 4G0XA 5E9QA 3TRIA 4QGHA 3M0EA 2C3UA 2EV9A 3KFVA 2DXIA 3OAAD 1EX7A 1N0UA 1E5DA 1U8AA 3Q6IA 5BO5A 3ZVRA 3IJRA 3JWEA 4AG3A 5I8WA 2AEJA 5CCDA 4MJ7A 3FWYA 3GLUA 2VHTA 4R1UA 4IIGA 4UASA 1CUEA 3FROA 1Z36A 4AX8A 2WICA 4WY5A 2ZE8A 3QU5A 2EWVA 5DKFA 5JC1A 2VDUE 1GAXA 1GEGA 2KBEA 4O1MA 3A14A 3EGIA 2P0AA 3ON5A 2PT9A 3I0MA 4MUGA 1VP9A 4U5XA 1O94D 2WF7A 3FUVA 1I1QB 1MQ8B 1NJSA 2F62A 3DDHA 4FNAA 3GRYA 4NU6A 2AC2A 4M1ZA 4Q93A 4JVOA 4R7TA 3WL6A 4B6JA 5AHKA 5LQAA 4INJA 5JVDA 1X13A 4MS3A 3L8HA 1Y7LA 4P4LA 3G2PA 5BURA 1CEXA 4O08A 4TUYB 1P7ZA 2B8JA 3E3AA 1IATA 1E9BA 4HP8A 1QIEA 3TD9A 3LY9A 1Z7EA 4QOGA 1KI9A 2GZ1A 2ZIXB 4DLNA 3L3BA 2QE6A 1JMYA 1WXHA 4XVUA 3GGOA 1JFFA 1ZESA 4JENA 4OHFA 3ED1A 4UPEA 4HYQA 4DADA 4BX8A 4HAUA 4PYIA 2R4UA 5DYWA 3W78A 5AQEA 3W2IA 3TTVA 1N5DA 1HKHA 4ZOLF 4HX9A 2DHEA 3RSQA 1H69A 4BATA 4L8WB 4EX7A 2ZYGA 5F9FA 4C0JA 1CZOA 4WFKA 4ZC1A 5JNRA 3MD0A 1T8UA 4XWAA 3WKBA 1YDMA 4G0QA 4RJTA 1BYUA 2BHLA 2Q5FA 3HBMA 3HCNA 4RCYA 3TAUA 2LNDA 2RIRA 4QNRA 3VHLB 5EZYA 3W5DA 4N3AA 1FBNA 2C9CA 3AEQB 4M87A 4NJMB 5G4KB 3UXEA 4ZO6A 4DZRA 4ZV4A 1KI3A 3NMUF 2IYQA 2C61A 2VP5A 3R1IA 5AM0A 3AU8A 1A9ZA 4L73A 2CGEA 5KX5B 5EJ5A 3QSGA 3HJBA 3G8CA 4PS0A 1U2GC 2ZRBA 4ZC8A 1E1QA 2BV3A 4IFBA 5ADUS 5CJJA 3RRFA 2FQWA 4HNVA 5D5QA 2NM0A 4YAFA 4I3HA 2X8JA 3PLRA 4LHWA 4Z1OA 3GPIA 1DRUA 2XYRA 3HDVA 1O4VA 3MGGA 5ESDA 4N9QA 2H1FA 3PFGA 2IH2A 2H7VA 4CV2A 1JS1X 1QIFA 2XQVA 4UARA 1XVTA 3F90A 2M1ZA 3PENA 3VGJA 2PU5A 3AESB 4EUHA 3A1SA 4XUDA 4ZAYA 2XITA 5K0GA 1KY4A 4LHYA 1P2GA 5AK5A 2AK3A 1S3FA 1PGJA 2O2ZA 3TTWA 1EP9A 1H2ZA 3HA7A 2QRHA 4LRQA 1W94A 4R69A 1EUCB 2E4VA 4B43A 2QBYB 4NFHA 4H0CA 3GXOA 4BNDA 4B5LA 3DUFA 1ML3A 1T8WA 5EWJB 1K7EB 5C8YB 1AH2A 3PFWO 1GQYA 2FKAA 4L15A 1A4IA 2OXCA 1FVXA 3FIUA 4JI8B 1E6LA 1HE1C 1X6VA 3NGLA 1L5ZA 4LE0A 1JJVA 4LF4B 1YQQA 4Y1RA 1ZL0A 3TW0A 3TG8A 5DM2A 4KXWA 4OXIA 5FFNA 1JDTA 1CUCA 5DHRA 1R00A 3TCNA 1UADA 1KOGA 1TMGE 5J2UF 2FMTA 2N75A 3BICA 5E2AA 4J0KA 4B7XA 3F73A 1OV4A 1MPTA 2D62A 2JLQA 4BDSA 4YJ3A 4LEIA 3EIEA 2VWPA 2QENA 4LV6A 3M6UA 1KOLA 4B3CA 5ILGA 5KSZA 3WNQA 3W8DA 5TY0A 2YHIA 1GY8A 4FUTA 4LC1A 2DPLA 2X1MA 3KYDB 1JAHA 2O3RA 2IEAA 5JTTA 5A6SB 2FPGB 1MA3A 3NGXA 1NY6A 1DFHA 3DFKA 4MQUA 1U0FA 5IXYA 5DSTA 1J4AA 4C0XA 2QI9C 4TTRA 1T5DX 3EAFA 1MABA 4X65B 3Q2OA 4MVXA 4YXWA 1G7CA 2XUKA 3LSYA 2QXUA 3F2IA 4R1LA 3K0EA 4CF7A 2O14A 2ONCA 3AQ4A 1GTMA 1T6YA 1U90A 2J0UB 2J3HA 2PBFA 2V7GA 3IB6A 3MB8A 4HLUA 5TQ0A 1TZCA 1HE8B 4J29A 4JEUA 3V1KA 4P84A 1QPZA 3LQ2A 1KFBB 1PWYE 3PXUA 2P6MA 3E2PA 1I7PA 3YASA 1V71A 4OFZA 1G8GA 2V7XA 4ZRMA 5FJIA 4A5OA 2DX7A 1EE1A 4IZHA 1JQBA 3AEUB 5KKCA 5CB4B 2I34A 3LCVB 2HXGA 1H1LA 1SD1A 3ILXA 4IJKA 3HXOA 2WTMA 3C24A 3LH5A 3V7UA 2IXFA 1JJ7A 1TFRA 2ZVPX 3QE0A 1MRZA 1Z25A 3GBVA 1CIPA 2G4VA 4EMTA 1P33A 4HSEA 3CM0A 4NX2A 4GXNA 3VH3A 1MU0A 1SUEA 2PLRA 5E6RA 2CNOA 3WLEA 4A8JB 2QXYA 4QPDA 4U1RA 5DNCA 3PUXA 3H1AA 3UCFA 2O8CB 1NVAA 1GR1A 3OX2A 2OILA 2BUBA 3AL3A 2P91A 3HG7A 2BZSA 4LFBB 3INNA 1W30A 4KVZA 3TW4A 1IOVA 4V0MA 4OHYA 4WK6A 1E9RA 1B8VA 1GKYA 4U8HA 4D98A 4ZI3A 3MWEA 1J8MF 1PWHA 2IYXA 4UHDA 3SS7X 4ICIA 5F7ZA 2NU8A 2YXLA 1MH1A 4V3BA 1D6SA 4TRNA 4B1FA 1VSQA 6REQB 1MVLA 1YR2A 3RUFA 1KBOA 2AFHB 3LDAA 1RC8A 1SHJA 2PZMA 4MYHA 3H19A 2EGHA 5I4CA 4KRXA 3ZWKA 1TZ2A 1XQ1A 4IRXA 1NYRA 3A6KA 1YAJA 3N53A 2HTEA 1F4VA 4NZZA 4RACA 5IH7A 2W11A 1J0AA 4OBWA 3OVMA 3K6KA 4S1VA 1MORA 2Q1YA 3BVPA 2A3RA 4GMGA 3MGCA 1U3UA 2AB0A 1UM8A 4HEJA 1CVRA 1Z4IA 3I64A 3FCYA 1XJ0A 1YIOA 1WBDA 3FDJA 4MTCA 1J9ZA 3V1MA 3ZJ4A 3LBIA 4AULA 1I94B 4P93A 4R1PA 3PHLA 5IHPA 2R8ZA 2REBA 4RKFA 4RGQA 4NE2A 4RIIA 1ECBA 4S2EA 4QDUA 4ZREA 4BZWA 4ER6A 2TMYA 4Z4GA 1KMMA 3WZLA 2V58A 4MVJH 3G2IA 1ZRNA 3ND7A 4H59A 1GZ5A 5EY5B 1KVSA 1RDFA 3QVGA 3ASUA 3KQVA 3W1VA 1RD4A 1M6HA 4XB2A 5HMLA 2VPWA 1IN7A 3ZU4A 2W8BA 1DRKA 2E4AA 1P19A 2X8LA 3BH0A 1ZA2A 3NEAA 1ZMRA 3NRJA 3Q2KA 4FMCB 3HJUA 4IZOA 4ZEVA 3M4JA 3K1ZA 3TZQA 4HQNA 1EFTA 2XYVA 2ISQA 4Y9SA 2IV7A 4F9GA 4M54A 2GEDA 2OV4A 3GRZA 5LNK6 1UK7A 2H4JA 1MNQA 1E1CB 1K5HA 3MQ2A 3CVVA 2ZVJA 1RSZA 2IH4A 4BKRA 1W36C 5C32A 4LCJA 1NHWA 3TPFA 3PYLA 1EXMA 4BV2A 1CIJA 2G83A 3ZGOA 4MDFA 1G7RA 4P4NA 2JAOA 4EG8A 3TZBA 1VHJA 4HWOA 5EJGA 4EO4A 2ODPA 5EWMB 4XWWA 1I1OA 1KTVA 1YK1A 3CLVA 3K70C 1L4LA 3H8SA 4XW2A 2VC2B 3G2MA 1BFKA 2Y1LA 4LPSA 3B7GA 2RGAA 4I9NA 3EDOA 2OV1A 4XM1A 4UPDA 3TL6A 2CSXA 1YASA 2PRSA 1T6ZA 1IH8A 1CZLA 5JZ9A 1KPGA 1M54A 3ZDXB 4KX5A 4D57A 2QP3A 3G2NA 2IHZA 4RTKA 4XKJA 1WA5A 3PR2B 1N9ZA 1KGSA 2NXJA 3RBXA 4N8DA 5BQOA 4CQLB 2IYVA 2JAUA 5ALFA 2JFBA 3OPXA 3UANA 3TJMA 1PU2A 3DMGA 2H7CA 2RB5A 1NSFA 5C1BA 2DFPA 1ZJ4A 1QGOA 2XODA 2JLZA 2G1PA 1X1TA 3UKOA 3ZWDA 2R60A 1G60A 1BRTA 1O08A 4B3RB 3FYHA 1OPRA 2J9ZB 4WFIA 5KJ1A 2NQ8A 4EY8A 2P2ZA 1YRQA 4WZAA 2B82A 3MXTA 4N54A 1P0MA 1JSXA 4JX9A 1S2LA 4P38A 2PIAA 3EH2A 1PJLA 4HPJB 3U0VA 3EUEA 4LPKA 4DRXA 4XB1A 4FWTA 3KXLA 4V0RA 1NBAA 2QROA 3BX1A 3CVJA 4RLHA 5G40A 3ZBQA 5E6UA 5LYJA 4Q47A 5LM3A 4DLTA 2PL9A 3IMEA 4K9MA 4X44A 1A69A 3AG6A 3B13B 4ZKDA 1OI7A 1N2IA 4LYFA 3L1HA 5KSYA 2YUIA 1XEAA 3FWPA 1SIUA 1LLDA 1T0IA 4NJEA 5SYNA 1Z82A 2O2CA 1CUXA 4IQFA 1F4PA 2WKQA 1NG9A 1NUPA 2Z2XA 1TEZA 1YZNA 3WWCA 1L5SA 1P9LA 4U6QA 4Y0NA 5KNCH 1GPAA 5B3LA 1JX6A 3BMOA 3I5AA 1GTG1 2W8BB 3H5OA 4UE6A 3TW8A 5EIEA 3ZOZA 1C2YA 4L74A 2PLNA 4CIBA 2JH8A 2GPSA 5HQTA 4O02B 2ZM6B 9LDTA 2WJ3A 3DEJA 4OQYA 4AN1A 3N74A 5K05A 4CTNA 2CHGA 2PGIA 1FMLA 1X92A 3CRQA 2O8BB 5IMBA 4X5OA 3M6XA 5CBKA 2ZUBA 5LP6A 2VTDA 2W6ID 1ZSYA 3IEUA 3MC1A 4HJRA 2ZYTX 4NYJQ 3TD6A 5ALMA 4DSTA 2RH4A 4ND5A 2QVGA 4AZ3A 2VYVD 1A5TA 3KZNA 2DQ4A 4OSEA 1J0EA 3DYIA 5D6OA 5DLDA 4F9FA 4URVR 3B7PA 2YY5A 5HKKD 1WXQA 3RRMA 1TL7C 2R79A 2V54A 1EI9A 3B1KA 1FVHA 3PPIA 1QH1A 3LRPA 4DA7A 3IDFA 3V8PA 1WCYA 3HV0A 1GL3A 1F0YA 1MDFA 4ZJYA 2QU7A 1KZ7B 1M6YA 4IIJB 4ZCLA 5AK3A 2GN9A 6ABPA 3WJAA 1E9DA 4OGKA 2I62A 1F6BA 3C43A 1FDIA 2QNRA 4BRWA 4I8XA 3B6KA 1MFPA 5TMEA 3PXBA 4EY4A 2R5FA 3E8MA 3C16C 3EC7A 5JMOA 4WUTA 4O63O 3W5CA 1Y8RB 2X14A 2CSUA 4QPPA 1LFDB 2H2AA 2HSJA 1B3RA 4HUJA 4PAOA 5HZMA 4EA9A 1TJNA 3G68A 5EERA 1ULHA 3RYTC 1IM8A 1A9PA 5BN1A 3SC2A 2YMLA 5BSRA 1AKUA 2QTGA 2H1SA 2P65A 1U0EA 3O4GA 4HUQB 4CKXA 1UKZA 1E61A 6GPBA 4MQEA 5FBQB 4BBJA 1NN3A 1IY8A 5GONB 3BD9A 2ZWOA 5KCZA 1EH5A 3JQEA 4DA4A 5ERXA 1KZHA 1AK2A 3MBIA 3HR4A 3IDQA 3AP1A 4PTZA 3GFFA 4BPBA 3J7AC 4J0DA 1G16A 1QONA 3I8SA 4KVFA 2V03A 1H8EA 3SHVA 3LOQA 1G1AA 3DVAB 1FXWF 1Y1LA 4HLNA 5BUZA 2O8DB 2NV0A 1G3IA 3CRNA 1TEHA 4B6OA 5LLTA 2YIJA 1NVFA 3ZWCA 3ROKA 3L8CA 3W7BA 1RI4A 2C04A 3DDNA 4UHEA 3S7TA 4XYBA 4A0SA 3MUEA 3OT4A 4OL0A 4I5IA 3BB3A 1IWOA 1E7MA 3MFQA 5KTYA 3WGMA 2P9QA 1I30A 2XTMA 1IPHA 3AP3A 2OLKA 4XWYA 4ND6A 4JC0A 5JNWA 1JXMA 3G0OA 2QTWB 3KVOA 3NDRA 3ZHBA 1V16A 1NRXA 2V6FA 1H5QA 2UZ4A 3DBOB 2C99A 5LXTA 2V0NA 2OC9A 1XF1A 4Q1AA 1D4AA 2QF7A 5FHRA 2GZAA 4KUEA 4QGFA 4C76A 4MYDA 4Q1BA 1P6XA 4NOLA 1DHTA 3EIWA 2A57A 1HE4A 4MUBA 4OBXA 4XTRA 2AOWA 1GLVA 1YDEA 4YCDA 3ND6A 4J4TA 3K96A 4MGHA 1COWD 2NACA 2QTAA 2ZUUA 3GFTA 3OQVA 3PSHA 4FHCA 1GV0A 2RGUA 1DJOA 2VG8A 5HX7A 4AVYA 3OQIA 2YCLA 1KJ9A 2H85A 2YHAA 4IX1A 3LI2A 1L1EA 2GJ4A 3HCWA 1JDBB 4HVAA 3CZAA 3N5CA 1A2QA 2HU8A 1AMOA 3GZTB 5L95A 2WHPA 2JC3A 4MQBA 3WGQA 4X8LA 1E60A 4Y98A 1N4AA 1U2DC 2ZSAA 3GJ7A 1ZD3A 4GRAA 2RIPA 1KI8A 2H1IA 2VK2A 3PUZA 4NP6A 4IY1A 3U3ZA 5LKRA 4XD7A 1WKBA 4IWYA 5CDFA 4PFQA 5LU8A 1MX9A 4G0WA 5FFFA 2ONJA 5K8VA 1MX3A 1XDGA 2P9BA 1SQ6A 4B6QA 1PV2A 1ZNZA 2BCGY 2EFDB 3JQDA 2DQKA 3O9MA 1YDGA 2X0DA 4ZN6A 4GZ6A 1BVRA 1E2HA 1OC4A 1L5VA 5AK0A 5FOWA 1JTEA 1XBTA 1PFVA 2IT1A 4Q9LA 1TD1A 1TJPB 2IPLA 3P9NA 2JJ8A 2JFQA 2O20A 4AAYA 3P8ZA 3FDZB 4HL6A 4UATA 1W2GA 1TMYA 2FAXA 2ZTSA 3GDFA 5EJ6A 1GILA 3KZXA 4FGJA 4M9SA 2EX0A 5JJKA 3KEGA 1YKSA 4K5QA 2EFCB 3EQ6A 3HM9A 5EWMA 1H9BA 1CNEA 3V9AA 1XNQB 3C3DA 4DR2B 1KAMA 3FMIA 2Q5HA 4ZO8A 3ZU6A 4YP9A 4E1AA 5EHZA 3LUDA 2BVNA 3QK7A 1UM9B 2PZFA 3TR5A 3L0YA 4I55A 2AOUA 5CD1A 1AG9A 2ZXFA 4GECA 4K9RA 1IUPA 3H9GA 4NWIA 1VJ5A 4OJKA 3W2FA 4MR8A 2OHJA 1JDJA 1JIKA 2H6EA 5C31A 1RZVA 1X1EA 3ZK7A 1UKEA 1W4CA 2XUAA 3IBCA 3PXDA 1Y5IA 3U4HA 3BZUA 2JH3A 4PQEA 3I4CA 1GUZA 2IXGA 4DMRA 2WSBA 4RK5A 1VJCA 4ZU6X 5HZKA 3IPCA 4H4CA 3KWMA 5F76A 1GUAA 2R86A 4X66B 3AR2A 4LY9A 1L4MA 2APJA 4BVJA 4OXRA 2MTBA 2VO1A 1HE5A 2VN8A 2PVCA 3ADKA 3KLBA 4RV9A 4HFMA 4B48A 3DUWA 1W85A 5TT0A 1TA4A 4C4OA 3EXFA 3PLNA 3TQCA 1Z2CA 2QZSA 2V74B 2FW1A 2QD3A 3FPFA 1R0CA 4DT1B 4HUTA 2O2EA 3CPSA 1OU4A 1HETA 2AN3A 2GN0A 2OSBA 4UNSA 1DXQA 1KFJB 4V03A 2IV3A 1JR4A 3E9MA 1CUJA 1SB8A 2ZB3A 3GLHB 3H9EO 3PP8A 5EGSA 4C2AA 2AJTA 3BWCA 3S2EA 4J43A 4BLOA 2I1QA 1UBUS 1RTKA 2IXBA 4B3HA 4FMPA 2GM4A 2BLNA 2I4LA 1QF7A 2IZOA 5CU7A 3VGPA 5IG2A 1GGNA 3LGSA 3OJXA 4BLRA 5IULC 4HFNA 5KSOA 4FU0A 4Z4EA 1K6XA 1R8YA 3UT0A 5KNDH 3Q3IA 1OV6A 4F91B 1CQWA 4WCFB 3D8UA 4DRXB 4EJSC 4QEKA 1SKQA 1CJBA 4J90A 5TGTA 5L3SA 3AVUA 4FW9A 4R2IA 4UMDA 2CLHB 3RUIA 5CAEA 3DQPA 2WSSA 3NLLA 3IPXA 3R3XA 2W70A 4IOKA 3MWKA 3BQNB 4FFPA 2LCIA 4Q9KA 1ML4A 3WNBA 3IMKA 5IJZA 5LP6B 1O9GA 3QXCA 4QQRA 1HKUA 1VKNA 3DZBA 4JI0B 1G63A 4ENVA 5LQJA 4X54A 2PLFA 1XZKA 5CIQA 4LJ6A 4LN1A 1DSSG 4BB6A 2PS9A 1JTFA 5I6DA 1XMIA 2AA3A 3Q2IA 4N1AA 1M9NA 1ZVQA 1CR2A 1WKVA 1XD2A 3IP3A 1LI5A 4O2BA 1JAIA 1PV4A 1JR3D 2NZJA 3HXMA 4MP6A 3DXYA 3F74A 1MTZA 1CY4A 4K3UA 1K8ZB 5DNDA 4YB8A 1ZN2A 1ZW6A 3KTAA 5HKBA 2IYLD 4NEQA 4YC7A 4GL2A 1JAZA 1SUFA 1TTQB 2CK3D 2E48A 1I1NA 2WVJA 4PF1A 2C77A 1KKMA 3TRDA 1CRQA 4IOJA 1NNSA 2G0AA 3KKOA 4O4JB 2C58A 2CNWA 4XQGA 3B2EA 4M55A 5AKLA 1M74A 3FNBA 4DB4A 2WINI 4NG5A 3J81k 5DGTA 1LNZA 4OI1A 3VX4A 1HNWB 3L06A 1E9AA 4RTNA 4BFSA 1TDJA 4ND7A 2X5JO 3QU9A 5FBZA 3WJ7A 3IO5A 3ZQJA 4ZHQF 4B2LA 1ZEMA 3WLPA 4DYDA 3T3PB 1K63A 4G5SA 4NZMA 3ZCRA 1DIHA 5ISMA 2E37A 5FTLA 5AW0A 3B85A 4ILEA 4EHKA 5HJEA 1CULC 2FFQA 3V2GA 1ZLXA 4BGIA 1E2FA 3AONB 3NKLA 3SQWA 5ITZA 3O03A 1IY2A 1XXHA 2XGSA 1T2CA 3DBHB 4QLBA 4I2VA 3A1DA 3IAM1 3KRTA 3IGFA 3EF1A 4J8PA 2MSWA 2OOSA 4QO7A 1Z62A 3FHTA 2I6FA 3P2JA 2FDCA 3OKPA 2VHUA 1T8SA 5HBGA 5L4NA 4PPGA 1NBOA 1U2ZA 2F4NA 2QUBA 3GZ4A 4P86A 4AP5A 4XRRA 1WQ3A 1LQUA 1N6IA 2XUGA 3FBWA 3NBAA 4OUDA 3UK2A 4ES6A 3LC7O 2OL4A 1UQTA 4GOMD 5D84A 4EOGA 1KYWA 2FW8A 2W6JD 1NNLA 3OEEA 3GFSA 1A9SA 3LXMA 2DOKA 2HREA 4BO3A 5BMVF 4GG1A 3I32A 1EX9A 5DBFA 4OU5A 3GCZA 2ZI4A 2ZRFA 4YUAA 3COZA 1USKA 2VPXA 3K2QA 2EG9A 2A5JA 1NFRA 3V1NA 4LYYA 1LDBA 5CT8A 2KLBA 3OCWA 4W7HA 4D9GA 3CU5A 2WHPB 3HCCA 2CMDA 3PHIA 3FPHA 4CMIB 4C7OA 3CEJA 3EGEA 4JDPA 2R1TB 4YWHA 4D42A 3L1JA 4L4SA 2HJVA 3GFPA 4DSNA 2J3JA 2BH2A 1P72A 4XIIA 3UK6A 5CDYA 1PNTA 3Q9UA 1HDGO 2F1IA 1O8BA 1SUAA 1N0VC 2W2NA 3AL2A 1RP7A 3SIPA 3RSFA 3TVTA 1XP8A 1IM2A 1KNQA 1YUMA 2IEBA 5HOEA 3QELB 2ZIWB 2VHYA 5B58C 4A3SA 4UREA 2ASEA 1W6UA 1TUGA 1FTGA 1EFVB 1NOIA 2RG1A 3EWSA 3QLTA 5M2QA 2G72A 7YASA 2VHCA 3DBRB 1GSOA 1Z8NA 2JFYA 4DIFA 5KNCD 1X8XA 1V16B 2Q8PA 4TL8A 4WXHA 4EIWA 2D3TA 3D7RA 3KQOA 1UANA 1JT2A 2H48A 1KDTA 1SCBA 2QTMA 3FLAA 4RTLA 5KYKA 1WSAA 5IC6A 4LYJA 1SHKA 3QXJA 4DJTA 5I7EA 3H1EA 1ZGZA 3ZWQA 2VJMB 1JLKA 3QVMA 4BQSA 1M33A 4MI1A 1U1IA 1JE0A 3OM8A 2IA5A 5CPBA 5DM60 4BC0A 4L5YA 5C5IA 3FSGA 4Y2UA 3ZW8A 4DMKA 3DBIA 4RV5A 2XWBF 1L7RA 3LDHA 3NATA 3ZE0B 4DQXA 3PEYA 4MUXA 3WZMA 2YNMA 3HY3A 4RMHA 3CNOA 3VX3A 1WDMA 2B4KA 1WDKA 4TMZA 3QEOA 4DLVA 3R6GA 4HOYA 3LRTA 4UBJA 4BUJA 4LYDA 2RHDA 1WF3A 2EVWX 4RIGA 3PC8A 1BHSA 3PGVA 1GNRA 3AEQA 1VSBA 3I53A 3ZJUA 1KP2A 2VJQA 8OHMA 1NURA 2LIPA 2XCLA 2XDYA 3OTIA 2CMHA 1COZA 4HN9A 3SFTA 3OFKA 4GE0A 4CL2A 1U2SA 3KR9A 5EVJA 1ZKMA 2XDAA 1AXRA 1N0HA 2WTBA 2AUNA 2ZR9A 4F11A 3KD2A 5JAUA 5JXIA 2W6ZA 5SY9A 4WCDA 3TXYA 2C7BA 2HV8A 3R0XA 3ZXYA 3ET5A 1G8KA 1FDOA 2OO7A 2PV0A 5JSFA 1T5SA 1O6GA 4QUIA 5TPWA 5CA0A 2EHJA 4EY5A 2K7FA 4Q16A 3D3KA 1QU3A 2X3UA 5AHXA 4B2IA 5TGZA 1QAOA 4PV7A 3P2YA 5C5CA 1AB6A 3H7AA 4R8VA 2AD5A 3FPAA 1EAMA 1T2EA 3EHEA 1F4LA 4LRYA 3DCJA 4YRCA 3WG9A 5FUMA 2IVFA 1L1RA 1FL9A 3B70A 5K0ZA 5KVVA 1F38A 3H8WA 3U4DA 2VF7A 3JYHA 5T64A 3CMMA 2QRQA 4JJ4A 4KAJA 3JWGA 2XGJA 5LMUB 4RD4A 3K35A 4B6GA 3ZJTA 5JS7A 4JI1B 4L8GA 3IMGA 4D6XA 3AY6A 1MF7A 2F43A 4XI9A 2VPTA 3WIBA 4UU1A 4ZCRA 2JHPA 2PKWA 3QUCA 4YJGB 5IAKA 4GR9A 4OQ4A 3L6BA 4I6GA 1R18A 1XELA 2X41A 2XUQA 1E6MA 2P2LA 1P8JA 3G0DA 3KXKA 1NM5A 3QFSA 1QCDA 2CXTA 1HYHA 2YMMA 2F3PA 4BS9A 4WW0A 2ZZNA 2YFKA 5CLLA 1SC1A 1G6KA 2X9VA 4QKQA 3T1YB 1VGRA 2X4GA 2YUTA 1TIKA 1YKFA 4G85A 4J94A 2YIDA 2FWBA 1QG4A 2IYTA 3SICE 2YXDA 4J0IA 3ZJ5A 4LC9A 2IHJA 3M6LA 4R01A 4C4YA 4OB8A 3DFUA 2D5CA 1OTXA 3FYDA 3HBLA 4HFRA 1DBRA 1RKQA 3VYRB 2PVPA 3ETCA 4F9TA 4WI1A 4BGUA 3H3FA 4RH1A 2Z8YM 1DV1A 1M72A 1SOMA 1EZ4A 1ZJWA 1SU4A 1K7FB 4HGOA 2HEIA 1QLJA 3T34A 2VDLB 1UOQA 3JQ7B 3FMFA 1JKJB 4AJIA 3I01M 1C9KA 4IMRA 1FNNA 4EG0A 5LUAA 4PINA 2WABA 3UV6A 4H31A 4INZA 3M7IA 3UHPA 4HXEB 3AJ9A 4Q4CA 4FPXA 3UPTA 2Z5LA 2XY4A 3AETA 1J5XA 4BX0A 2EJTA 5AKXA 1RRGA 1LF5A 3HKEA 5DW3A 1UUFA 3C5WP 4DXHA 3TFWA 3RAPR 3PXAA 1CIVA 1YA8A 3AUSA 3NHZA 3RSLA 3PKIA 2ANBA 4YCJA 1PX0A 4JK3A 3DOJA 1W88A 2OPBA 3F4BA 4JC4A 5ALQA 5T7BA 2Z6UA 3HSKA 3ZHZA 1ISJA 4C30A 3MUFA 1BQ4A 2F3SA 3QEJA 3CG0A 1ITZA 2HK8A 3RJTA 3RRNA 1N1EA 1GSAA 1A1SA 3H2BA 4WK0B 3OLYA 1NR7A 2WIFA 2R1ZA 4ABYA 3P20A 4WOCA 1DT3A 4ZQBA 4CMAA 4YPVA 2K87A 3HWWA 1LVUA 3STWA 4F0JA 1XQYA 4PIPA 4Z9XA 3TRJA 1K98A 3L7NA 1QHSA 3MNFA 3U3MA 4EMUA 4YCSA 2RSLA 3HDGA 4BQRA 3EG9B 3AY3A 3DZJA 1N6HA 2H06A 3IP8A 5HHTA 1XEFA 4MIEA 3B1VA 1UPBA 2FNAA 5KDDA 3ONWA 3A3NA 1KI4A 1ZMTA 5TEVA 3ISJA 2XX3A 3ZHCA 4U2BA 3QPAA 4TTTS 1E62A 2EZ4A 3KUKA 4LRWA 5K0EA 3VR4H 1B8UA 4N8EA 5ARDA 5JTUA 3MLAA 4G1FA 2RJ3A 2VSFA 4H3HB 5CB6A 1CB7A 1NSTA 1UBKS 1Z2DA 4RK4A 4J03A 4WY2A 5IJ0B 5IUNC 1WY7A 2Q4DA 4DCVA 4HATA 1C0KA 4D0RA 3K9FC 5DU2A 1G9SA 3RU2A 2D5LA 3KAPA 5FP0A 1Y8QA 3MMXA 3OIFA 2WA2A 1TCUA 4DMFA 3I39X 1C3VA 2YV3A 3JZMA 3KOMA 4GT1A 5P21A 2JK1A 2HDNB 2CYAA 3B36A 5HJ2A 4J9VA 1X1QA 3FPGA 3I2GA 5ITZB 1O3YA 1FFSA 3BJZA 2D54A 5B4UA 1I24A 3CO5A 3FAZA 3E53A 2CUKA 5AM1A 4GP6A 4FOPA 1NBMA 1BEZA 2Z1MA 4BZQA 3TR0A 5K2MA 3OZCA 3UJDA 4QFCA 2SHKA 4MGIR 1F14A 2L17A 3HLTA 3PC8C 2P1DA 3DOCA 1ZI9A 2PUTA 2P3QA 4CKBA 3I4LA 4CVNA 5AKYA 4TTIA 5ABPA 2W6CX 2P2CA 2W2XA 4IXWA 4WZBA 3DLAA 3WSTA 5K51A 3H13A 2A3NA 4HUQA 2POQX 3UJCA 1UBCA 1XVUA 3L4BC 1SWWA 5F5XA 1Z5VA 1RM5A 4MQFA 1SCKA 4N4AA 4QFDA 2EX1A 3VTAA 4UCXA 2E89A 4C2TA 1F51E 2ZB8A 1DO2A 1ECCA 4GZMA 1AVTA 3GT3A 3NHFA 4B3DA 2B3DA 4FFBB 4IUDS 4G0OA 2IBSA 4M1SA 1XF9A 1YI0A 2W6PA 4RIEA 1R64A 4R84A 3QNMA 4GGPA 1QZZA 4HWPA 3RHFA 3U7QA 3OT1A 1A5ZA 4LGMA 3FUCA 1SCJA 3GELA 3AMVA 4D8TA 4MLDA 1GQ2A 2ONYA 5F64A 4KN9S 2IWHA 3IAXA 3C5EA 4IYJA 4OHCA 3QTBA 2CDCA 1RRKA 3SF8A 2HHHB 4NCAA 3IR5A 5KZMB 2X19A 3GGSA 1QP7A 4BKPA 3D2CA 3D7SA 1IHPA 4HX2A 1IQPA 4GBGA 4X3PA 1QO7A 4UAGA 3C6KA 3GVXA 2J5XA 2P90A 5TJHA 1RQXA 3FGZA 4ZI7F 1JG4A 3JQGB 3PWSA 2OENG 2ZRCA 4MB0A 1LC3A 3I8OA 1T3SA 4WUVA 4XOIA 3RS3A 3U5ZB 5BN4A 4JP2A 2QTTA 1JDNA 1A71A 3PFCA 3EDMA 1R3UA 4LUCA 1DG1G 5CFQA 3PFIA 2ODTX 4A8HA 3ANMA 3C3EA 2PRZA 3JAKB 4MAAA 2QTVB 2FU5C 4B31A 3OSUA 4IO0A 1HT0A 5AJTA 5HPYB 3QVVA 3WGTA 1P0FA 1VIYA 3A9CA 3WSVA 3CW9A 5BW8A 4Q3KA 4DARA 1XU7A 2Y6UA 3E27A 3E35A 4G86A 1ORVA 2JIZD 3DTTA 4G09A 5C7IO 5T5QA 1SELA 2RH9B 4PG6A 4KLCA 4BVBA 1TTPB 5EIBD 2ZUFA 1ZIPA 2D7DA 4ZJPA 2R4QA 4X64B 1OAAA 3GP8A 2REOA 1FXWA 3THYB 3AI1A 4Y1FA 1KTIA 2K5UA 2ZULA 3MCWA 1GUYA 1O5OA 4DILA 4DXAA 4YJ2B 4IGAA 3BQMB 1U31A 2Q5JA 5AW7A 4WJZA 2GCGA 2RBGA 3G8AA 3TMYA 2ZP1A 5ENVA 1E3DA 3K0AA 4IVPA 2JLVA 3DTVB 4JZKA 2P4SA 1KY5A 3LX5A 4I4CA 4TMXA 3RBVA 1W85B 2AX4A 4PRLA 3S27A 4IDCA 2JBHA 3NYWA 4AM8A 4EQ6A 3KJQA 2GEFA 1ZM3A 1C30A 2MU1A 3LCUA 4UMFA 3U62A 1VL8A 4Y7CA 1SA0A 5CDTA 2ZYDA 4QAQA 3DMPA 4Q18A 3Q0TA 2PGLA 3U4GA 2E18A 1JB1A 2KM1A 3KL4A 3RB8A 1GT6A 2E6UX 3NVMB 5BV8A 5DIZA 4XRGA 3BXEA 4JYZA 1KRXA 1RBMA 2XNDD 4BMNA 3THWB 2WB4A 3PNVA 5KNBD 2HFKA 1KH2A 4X1KA 1T0HB 3BMNA 2C4VA 1K7CA 4MUJA 4BRUA 4X62B 3UVEA 4BEJA 1AKEA 3C7DB 5DIFA 5EP3A 3ROQA 1F2UA 3FBTA 1VHDA 3RYHB 3UPDA 2FXVA 5KKAA 1UEJA 4D8VA 2YVKA 4RHCA 1YJXA 4GMKA 3RM3A 3MT7A 4MKRA 1KJIA 4AKIA 2JRCA 1RJDA 5DWQA 3RRBA 2ACVA 2ZRIA 3I6YA 4F6LA 4MVJA 2Q3FA 4BMXA 3Q7IA 3BZWA 4UJ5A 2AIRA 9LDBA 3ICWA 1IE3A 1ADFA 3TN7A 3AETB 3IILA 4JI4B 3PQ8A 4KYVA 3ADDA 2ZSDA 4YASA 2BFBA 4EATA 3U3DA 5HNKA 1M0SA 3PHGA 4BNXA 2HBYA 4I5GA 1BMTA 1CK4A 2NTNA 3QLEA 4IFTA 2ZQ5A 2YS6A 4P7FA 1CG6A 2A5DA 1YUNA 1ZVMA 5K7SA 2FDRA 4MKXA 1I4LD 4QVGA 3T3NA 4RO0A 1RHMA 4K3VA 1QKIA 4ZANA 5HUJA 1RKBA 2DH6A 2YTZA 3G5MA 1IK6A 1YZKA 2KHZA 3GUYA 2FV8A 1IRXA 2R7AA 1VJGA 1P18A 2FRVA 3NHAA 2R7KA 3OCZA 2VYCA 4KR9A 1F9AA 2CUNA 3ZCQA 3G7UA 1LD3A 3OTGA 5J2UA 1DKMA 1FPMA 3OPNA 1DI0A 4K28A 4Q9NA 3HCAA 3PL1A 4JB3A 4H35A 3TSAA 1SWVA 4TL7A 4YAKA 2PD4A 2O2JA 1WVIA 1OJLA 2HSGA 3PRJA 3KBBA 3TL2A 3WICA 3ZTTA 4GGOA 1XIVA 1SUPA 1HQCA 1PNOA 3O1JC 4H7HA 2TRSB 5K3SA 3REFA 3SDZA 1JFVA 4J4BA 4RX1A 4QIHA 3VNVA 3NWOA 4GI2A 4PHTA 4CM8B 4KNYA 4W5QA 4BLVA 4RTPA 1YACA 5AI9A 4G3XA 4XJVA 4QU9A 1Y8AA 4WKNA 1JIUA 4DCNA 4ESOA 5HM6A 2PGNA 4N8SA 3F6CA 5FBWB 1E2LA 2GBIA 2IZ1A 4TTQA 3QFHA 1QTQA 4QYTA 2RFLA 3BGDA 4GMHA 1H0SA 2DTDA 4RVSA 3TQRA 3L46A 4N9WA 5CXQA 3LTNC 4L0QA 3L6DA 1EPUA 3BF7A 1Q20A 3M9LA 1FSSA 1LJUA 3M5CA 1RJEA 1WMDA 2Q6VA 4DQVA 2BYTA 4BLQA 2MINA 4P81A 3SBEA 4ALLA 4KFRA 1MJNA 1N8NA 1GAEO 2NLOA 2YZMA 5JT1A 1ZCJA 3HCPA 2IUYA 2O0HA 1ZK2A 5ITWA 1VLQA 2ENUA 4PONA 4CLOB 5B3KA 2YWBA 3RHTA 5K09A 1PHRA 1Q95A 1MV5A 2WWRA 3GWZA 5G0TA 1U3FA 1TE2A 3DMNA 2UXBB 4PC7A 4EI2A 2QUZA 4G0MA 4WZ6A 5JHGB 3EDCA 4Q9AA 3QEBZ 2AMFA 1DAGA 1HI9A 2ID7A 2WHRA 3FYUB 4MUMA 4RESA 1A7AA 4C21A 2KS6A 2XMSA 1JWAB 5BT9A 4D9CA 2W6QA 1MC5A 4HDMA 5JMWA 5IW8A 4C4ZA 1EDEA 1EMDA 1V3VA 3ADPA 2ZWPA 2IJGX 4GH5A 4OYHA 3H87A 3MMSA 4RJJA 4X6UA 2JZOA 3EXHC 4URUR 1Z8DA 1APBA 4LOKA 2ZSIA 3I6BA 3N8HA 4R9VA 2WT8A 1VIDA 1SCDA 2ZDHA 1GCIA 1U28A 3QKIA 1CF4A 1WHTB 4XXHA 1NT4A 4A91A 5DX8A 4JP5A 1KK2A 2R2GA 1BE8A 1CY0A 1LLUA 1KHTA 4ZCIA 2PT5A 1J1ZA 2PNFA 4LMRA 2W4QA 4GZ3A 4NECA 4P7GA 5I9TA 1CQJB 4A9AA 1YR6A 1XNHA 2ZB7A 2D4AA 2IYAA 3GRVA 2C42A 4H1HA 4NJEB 3HJFA 1E0KA 2COUA 1UXGA 1D0IA 2R3SA 1QGZA 3O4IA 2W98A 5IAJA 3HADA 2QSZA 3ROFA 2WJHA 5B3JC 1PJ3A 1SVWA 3B60A 1B1AA 5FUWA 5HIJA 3KQKA 4AL4A 3HFJA 4FFSA 2BFCB 4MDHA 4CCYB 1WSDA 2ZKIA 1LRLA 4LVUA 1AZSC 4UAVA 4HPXB 5C4GB 3L8DA 2IZ5A 4CT0A 4FKBA 1IPFA 1BQ3A 4BIMA 4E22A 3HWSA 3KPUA 3HVIA 2JJYA 2GHRA 1GQFA 4LTMA 3DZDA 1FX0A 4B3SB 4J1SA 2EP8A 3DBRA 5EQDA 5A3VA 2I54A 3TRHA 2XTZA 4I14A 1IM5A 4NMXB 4S0XA 1Q0QA 1Z56C 3IQFA 3L93A 4LCBA 3EFHA 1C29B 1AKQA 1DBPA 4HGRA 5FR2A 3EGCA 1SVOA 1FTNA 4A26A 4DNFA 5JJ5A 4L78A 4C5CA 2EJCA 4RTQA 5KOHB 4PRKA 4BMCA 1ZCAA 1LPAB 2YL2A 2R87A 4GX5A 2WYOA 3QWFA 2NZ8A 4ID9A 3GOQA 3THRA 2AJBA 1Y1TA 2QZZA 1IBSA 1VCIA 2YDXA 3DYBA 4BO9A 5HIKA 1N6LA 4J6FA 2GAFA 3FHJA 4DS3A 1Q77A 1EU1A 1WXEA 3I76A 4YIKA 3PHJA 2GB4A 1K08A 3NIDB 1JQEA 4DSZA 2O5RA 1T1IA 3DKKA 1OE0A 3CNQS 2PZEA 3LUHA 1OZ0A 1NDQA 2FB9A 4QJBA 1UKCA 2DPYA 2JGAA 3ZNQA 3L02A 1SCQA 3CNNA 5EQFA 4EF4A 1QP0A 4YUYA 4KK4A 1PWEA 2BTOA 5GJBA 2EBUA 2YV1A 2VSQA 4F3YA 4M7OA 3CLHA 4D9MA 1CD5A 2YFYA 3N0XA 2SECE 1U9IC 1XDSA 2BEWB 4AMVA 3CVXA 4RTSA 3U3JA 1KOFA 2XNJA 3LZ6A 3V3TA 3A1UA 2I78A 1Y34E 3DEAA 3HUUA 2IX9A 4BMOB 4YLGA 4DSUA 1XCJA 2Q1UA 4AJPA 3DVRX 3E2IA 1ZJZA 3SZ3A 3JZIA 1AUPA 2Y0CA 3PQ4A 4OQQA 4YAIA 5HWSA 2GD2A 1E4YA 1EUZA 1GA1A 1CE8B 2FWAA 2XMPA 4EG4A 1DO0A 3BL8A 3D6AA 3M1LA 3DEYX 4Z86A 1EVEA 5I4IA 4KH0A 2VH1A 1HNZB 5BWNA 2ZI5A 4XARA 3EDYA 1SU7A 1HEUA 5J4VA 4Z5XA 4U4AA 1M6WA 3DJYA 3PDHA 4IEIA 3FVWA 3U4AA 4DTCA 1XPUA 1OBFO 4TKVB 2UUOA 1XGKA 4M4SA 5AHRA 1MGOA 1KQNA 3MSCA 4BFXA 2RHBA 3B82A 5C8YA 3NC4A 4JODA 1IRIA 1K2VN 2M32A 5FI3A 1V96A 4BLPA 2AC7A 4D3XA 4QT4A 1MEEA 4GO1A 1OI3A 1QS0B 1NGSA 4D9KA 2AI1A 3AFIA 3H1BA 3R7LA 2OFXA 1WX1A 4D1YA 2OAEA 3UMGA 1Z7YA 2X0KA 2BGJA 1IEVA 2PPLA 2A67A 3BGVA 2I3GA 3CIOA 3DFZA 5DN6A 3VMFA 4TROA 4GAEA 2XXAB 1UP4A 3NIBA 1DEOA 3FHCB 4BV8A 3EPKA 2G17A 2M1XA 4YCMA 4CKWA 3G17A 3IRVA 3H5VA 2PRIA 3CGGA 4QATA 1C7JA 2ZSKA 2PTHA 2PTGA 3TMKA 4B6EA 1PR2A 2E5FA 2PK3A 1U8TA 3RHSA 1EESA 1T1RA 1ABBA 2E4ZA 1K5DA 2C84A 1YI8A 3ZHRA 3MJCA 1YQWA 3L84A 2VAMA 3U80A 2NYVA 1XZAA 1NDUA 3IKLA 2VF4X 4RMGA 4ZT5A 3C3WA 2R5NA 1NR5A 4AKHA 5GOTA 3AM3A 3PD7A 4WMLA 4NH0A 4HGYA 4JOSA 2HLDA 4X3CA 1RQLA 4EELA 2HWWA 3DOOA 5IAEA 1A82A 1AY0A 4Q3AA 4CLHA 2PQ2A 2PT6A 3FG9A 4JYMA 4YLYA 3WAJA 3EZXA 3AV3A 4MR8B 4EARA 4EFMA 2GK6A 1CQXA 3N39C 2BLLA 4Q1VA 4Y2VA 4GXQA 1EVKA 1A9RA 2NSHA 5ARCA 4B32A 3E9DA 1S2NA 3A3OA 1TW3A 2DG2A 3FB4A 3ILYA 5GM1A 5BW6B 1UFKA 2FMUA 3CCBA 3ZHSA 4PSDA 2P78A 4JUCA 1XZEA 1EWKA 4QOFA 1L5HB 2X4LA 2D2FA 4RQUA 5BNIA 1YFKA 4BXOA 2O2XA 1NI4B 2AFHA 1N2GA 5EXEA 1S3SA 1UR5A 2C0CA 1KE2A 4D8WA 4JBLA 5ICMA 2LZ0A 3LQQA 2Q3JA 4GYJA 3WYCA 3RVQA 5IT4A 1FFYA 1YDFA 4MMXB 1U7OA 3CNBA 3ANLA 2YRXA 1JKFA 3IDAA 2UYGA 1L5NA 1XEXA 3QGMA 4OQLA 2MSKA 4HRAA 4Q4JB 4G4JA 3G5LA 3T7SA 3N8DA 1VLZA 4U7JA 4G23A 2IQIA 1KA9H 4U7PB 2Z09A 3CLRC 3WLQA 1X8JA 1LFAA 2P79A 1R4AA 3MPOA 2Q28A 2JI6A 5DF1A 2QX7A 2WBLC 3DF7A 1QVAA 3GG2A 4MTLA 5IZCA 5ICSA 4UBNA 5IRCD 2ZBVA 4UUAA 1E9EA 1SZDA 2VXBA 3LP8A 2VT6A 1IDN1 2C5EA 3B6IA 3UMVA 3ABZA 5EUCA 3LD9A 2HYIC 5ENDA 3UGJA 2VZ0A 2Z2IA 3OWXA 3EEFA 2XCSB 3TIIA 3JPYA 1N7JA 3F6PA 4JP8A 3SD7A 5JQGB 3N2KA 2A5GA 2I6QA 3PDJA 2N9UA 3I04A 4IYRA 1VXOA 3OOSA 4GSYA 1U0RA 1DIGA 3NAGA 2QT9A 4LWZA 3ROGA 3BAZA 4B35A 5L51A 1GZVA 4IKEA 3DPUA 5IKEA 2JJQA 2CLKB 3GA5A 1NUUA 4YP6A 4OHKA 2OGSA 4KBGA 1FYFA 1Y4DE 2NSYA 3ADCA 2PZKA 4M1MA 2XUPA 5B4TA 2PUBA 4YP7A 1IN6A 2M98A 2NWQA 3HVJA 1QH9A 2J1LA 2VS1A 1KEPA 3E22B 1JT9A 3IYLW 3LLCA 3R76A 1DWPA 2C95A 4Q39A 4DG8A 3CUKA 3VJMA 2WD8A 3H2SA 2BDTA 2MIIA 3D1VA 3ZV4A 2VSYA 4PLVA 1B0ZA 2X0IA 2QK4A 2N3ZA 3WAGA 2V9PA 3QOFA 4J91A 1TM1E 5CVCA 1OLUB 4L8FA 2I4MA 4KR3A 2JIQA 1CEYA 1K0UA 1I9CA 1R37A 2CJWA 2I2DA 3EG5A 4FE3A 5AUNB 4KO3S 5CIWA 4LF9B 2QM0A 3PR3A 4L4UA 4YDRA 5DTMA 2I6TA 4KWIA 2BGKA 2VZLA 4KITB 4O4IB 3I92A 3S2UA 2QMOA 4Q1EA 5SZKB 4P9NA 4PC2A 4L5JA 2C3YA 4QTUB 3IE2A 2LKCA 1ZS9A 4Q1CA 4EF6A 3ZVKA 1MX5A 3VYWA 2XWSA 3G7SA 1XVAA 2XW6A 1KAHA 2EFHB 3D8BA 1N7GA 3P1JA 1TFUA 4FXPA 4H08A 3UMMA 1JG7A 2RJNA 1EFDN 5JXHA 5AM5A 4BNTA 2HPHA 3ECCA 5BXYA 1AXGA 5FPKA 4W82A 4XYMA 4RS3A 1IHYA 3LL4A 2A5LA 4GLFA 3N6RA 5A71A 1Y1RA 4UTOA 2LIVA 1CQZA 2P6PA 3IL2A 5YASA 1Q1ZA 1RS0A 1Z9BA 5BN3B 1KAEA 4PWYA 3R8FA 5EIHA 2JKYA 3QKWA 1P4AA 4BN5A 2A1UB 4M0FA 5CCXA 1JB9A 5JASA 1ZN8A 4MVWA 3W34A 2VRCD 1IXSB 5E4JA 5IT9A 4MRRA 4RL6A 3CX4A 4HDQB 3H5LA 4G24A 4TT3A 3TB4A 4AICA 3NTLA 1DKPA 1TQ8A 3RVBA 4HGPA 1X80A 3LPDA 3IFSA 1V3UA 3I1FA 1QMPA 3BRCA 3IHTA 1MD9A 1QRTA 2ZRQA 3C3MA 4NAVA 3KZKA 5CFLA 5PGMA 3QLJA 3W1WA 1XK6A 4DR7B 3DH0A 1YVRA 5KREA 3I05A 2R5WA 1VZ2A 5JVDB 3ISVA 4O59O 2X4DA 3O0TA 1YCHA 4FKMA 5C53B 1RFLA 4GF5A 3RIXA 3AB8A 4UM8B 1FLDA 3OZUA 1DWOA 1JSZA 3QE2A 2VRWA 2ZJ7A 4OXQA 4M88A 3H9JA 4R3WA 5TDHA 1FA9A 2GO1A 3IQDB 3ZHOA 1GQOA 1JEQA 2FZKA 4PZPA 1N2JA 2B3TA 3NBKA 1WEKA 2CNLA 3SX0A 3OQPA 3PWKA 3AUAA 1H2HA 1G41A 4TS3A 1C9EA 5CFNA 5CM9C 5I4KA 3ENWA 5FV7A 2PKYX 4EUFA 1VL0A 3STVA 3EFOA 5H4HA 5BR1A 4EWLA 4ZYLA 3OOWA 2NO9A 1E7YA 1N8SA 1QYWA 3NC0C 1S7CA 1W4LA 1FJHA 3QXXA 4PANA 2ECQA 3BYZA 3D2AA 4M8IA 2VHEA 2GSDA 5H5JA 1ZIXA 3MF4A 2ZK7A 3GPDG 2FZEA 3BPSA 3BE4A 4WFQA 4CUZA 2ZBDA 5KTMA 1CV2A 2M6SA 1U94A 4U02A 1D2NA 4HAVA 5KYTA 2V7UA 3VPDA 5D2CA 3W5UA 1K88A 3PUVA 3DGEC 4YMLA 3TINA 2QTHA 4D41A 1G5QA 1V11B 3JD3A 3ZCTA 1ZXLA 2FA9A 3RSGA 4MUYA 1OAOA 1MAVA 2WD7B 2HCBA 3OLXA 3PPWA 4H7FA 1PS9A 3WLKX 5L3QA 1YR9A 1PQ4A 1EK5A 1UAYA 2FJPA 4NDAA 5M04A 3OE4A 3GZJA 2NO0A 1LC0A 3NEYA 3ZYCA 1Q3TA 2IYEA 3BEOA 4IMIB 4POAA 4DB2A 4MQLA 3AB7A 2Z9BA 4W5HA 4ERXA 1CDEA 2RAVA 3INYA 3HJAA 4HJXA 4AJNA 3LHDA 4LJRA 1AHNA 5AW4A 2HT1A 3DE2X 4EI7A 4XUCA 4R68A 2RBKA 1RPZA 2ZUSA 5KVQA 1IJKA 4HRXA 4MVJG 2Y0BA 3O8OA 4REQB 1IXYA 2OBNA 1I3OA 2N1BA 2OUKA 2IUFA 4C43A 1KP3A 1WMBA 5BQ3A 2DBQA 2QR3A 1ZR2A 3AKYA 4LTNA 4HXYA 3WI7A 4I1IA 1W36D 2GD1O 2HRRA 4KI7A 5D8DA 4CKEA 4H9GA 2NUPB 3MWFA 5F1OA 3HYCA 3H0KA 2L19A 2VF8A 1CY8A 5DN6D 3E58A 1PQUA 4MB6A 4P4SA 1UP6A 2YYZA 4FFVA 1GPKA 5KYXA 5B57C 4FMDB 2VDWB 4GOKA 3RAJA 5ERYA 3GGPA 4DL9A 1C1DB 3EY9A 3H16A 3ZS9A 3EXIA 4XDYA 3FNRA 3L7CA 4NICA 4GICA 2C2WA 1AGRA 1LNQA 4CMBA 2G9QA 3FGPA 2XCQA 4UMEA 3SXPA 5AVYA 3M89A 5LOVA 2XRFA 4II2A 1ISHA 3PS9A 2FZCA 3BHIA 1RNLA 1FMCA 1UWKA 5BN5B 4E46A 1ECGA 5AXCA 4IILA 1QE0A 3SF0A 1RPAA 3A70A 3DAOA 3UW3A 1M1NA 1BO6A 1NVKA 4UFNA 3RF7A 2FN4A 1K92A 4NPAA 2ZJ0A 5BVHB 2HLPA 1MHTA 4GWLA 3RROA 4QGGA 4Z2AA 4QUHA 1BCRA 3RVJA 3WIOA 4EW3A 2I4IA 5DOVA 3JATA 1YGPA 2LPMA 3V7YA 1JN0A 5FXMA 1XJQA 4Y8VA 4MYUA 2OCXA 4J3FA 2ZT7A 4U0JA 3DQZA 3SY8A 1Q50A 4YRMA 1X7XA 1WXIA 4HDNB 4NATA 3LPMA 4FEGA 2V1XA 2OEPA 3R9IA 4TWRA 1HT2E 3WGUA 4ALJA 3ETHA 2IIBA 3GEMA 3F78A 4EP1A 4G0NA 5DYGA 3DMHA 2VYNA 1HO3A 3K4QA 4LCEA 4U5QA 3IPRA 5LLSA 3R5HA 4DJFC 2J4FA 1P1CA 2WVGA 4TOIA 3TPCA 3W3AD 4KRFA 2ATXA 5CH8A 2FPWA 1BSVA 3OECA 3TLMA 2J5KA 3A3KA 3Q10A 3ZS8A 4JIGA 3PEUA 4P31A 5EFOA 1DXHA 2WUWE 3LYAA 1IQRA 3NUQA 1I01A 4JP3A 4KV9A 3HFRA 5EXXA 5A0VA 2J0VA 5AJWA 5F3RA 4IIDA 3PJGA 4EBBA 4LS3A 5FWNA 3GYBA 4URHA 1DL5A 5BYKA 3SQMA 1PW5A 3EIUA 3OZWA 1UODA 3RUDA 1ZJJA 3UOAB 3T54A 1G3MA 4KTVE 3VO9A 4DUGA 2NXNA 3Q3JB 1W35A 1T10A 3PFBA 3OLVA 3VUFA 3RKRA 3WLAA 4G5GA 1QVRA 5AKJA 3WIEA 1ZDMA 4TMFA 1DAIA 1XZGA 4HNRA 3MB5A 2FGJA 2WF8A 3OH8A 2FE4A 3QYFA 3CLSD 5DN9A 3V48A 4F3CA 4LBYA 2SICE 1VC2A 3SJUA 4UCFA 4L75A 5IDYA 2A33A 3WFJA 2NPIA 3GT7A 4C7VA 5A9RA 1QIKA 2XB2A 4RFVA 1M5UA 3FUUA 5BSGA 3B3JA 2YOFA 4ZI7A 1JU3A 2JHCA 1S8FA 2P9ZA 3TDKA 5DT9A 4RDIA 1H1LB 2GF2A 2ZPAA 3RJ9A 2HF7A 1QBKC 4E4TA 5AUOB 4JI5B 4DC1A 1UKVY 1KI6B 2W00A 4Y2QA 3G0BA 5GP1A 2G77B 3L1KA 3UK0A 2NQTA 3MK31 3CTMA 4R8RA 5EE0A 1BW9B 3OAAA 1M1YE 3ESRA 3KAKA 3PVZA 2J3MA 2RHTA 1IPEA 3DEZA 3MMPA 4CI9A 1QK4A 2WFAA 1H8ED 2RGXA 2GEJA 1YOVB 2WFMA 3C1TA 1PFGA 1C0LA 4R3UC 4M76B 2P4QA 2RMKA 1T5IA 2GVZC 1VCOA 2H54A 1BTOA 5JOQA 4FR0A 1GRVA 4YPFA 3G79A 2VUHB 3GJ5A 2OK8A 1ORDA 3NAZA 4Y6SA 1EWYA 1U7WA 4J3JA 2FN8A 4I2NA 1ZOIA 5L6LB 3ZGXA 3HEBA 3QMVA 1H0KA 1SUCA 3CWCA 4DGQA 2A9QA 1WUJS 2GRUA 4R0MA 4ND8B 1B2RA 4XYEA 6LDHA 2AFIE 3WNDA 1XL1A 4UOEA 5F2NA 5BQPA 4FNMA 2Y76A 4HDAA 4OQMA 1OB5A 4Q19A 3EC1A 1PN3A 4V3CA 1V26A 5CDSA 1CS4C 2UVQA 4YRJA 2FSVC 4P3XA 2HA7A 2H4XA 2PCJA 4PLTA 4EKIA 3IT3A 2RHJA 3P9QA 1R16A 1JEAA 1EE9A 2PFGA 3L2OB 3OY2A 2R6AA 3FXAA 1F2VA 4OBBA 3IVMA 5E3IA 3ZWVA 1G3UA 1F1JA 1VLVA 3KCQA 3R9XA 4TUYF 4Q5IA 2I9PA 4B84A 1D6MA 4AWXA 1UAAA 3FF1A 4NYMQ 4JMLA 5GV7A 3WBJA 3K71B 1RZ3A 4PZZA 4RY0A 2Q6KA 3F67A 3GPCA 2QZJA 2PUVA 3SLGA 2CLSA 1ORIA 2IP2A 5D51S 1U1EA 3A9WA 1ADJA 1MUUA 5CFOA 1PGQA 5F77A 3TOXA 1UIRA 1KS9A 2GS9A 4P3KA 4ZDWA 1ZJ6A 2EYQA 3C14C 1EXWA 1SC4A 3NIFB 4OP2A 1AA9A 1PJSA 3AFHA 4DC9A 3N59A 3OPYB 3K7EA 2EW1A 3M81A 4RDHA 3VU9A 4ZMRA 5FL7D 2QTZA 3QLUC 1L7MA 4LJSA 3FCXA 2FPIA 2VNHA 4ZHSA 3KTDA 1M2FA 1MB9A 2GHTA 3G2JA 1C0PA 1MN6A 1LK7A 1D0VA 4GBJA 4OOFA 1GITA 1LGYA 3B12A 3PZBA 1BNCA 5EP1A 1KIFA 2CY0A