4XCXA

Methyltransferase domain of small rna 2'-o-methyltransferase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
216
Chain Sequence
QFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGVDINEDKLRWRGDSLAPFLGDFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSGDLARFPEVVFGYLSPSMIVISTPNSEFNPLDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPGAENVGYCTQIGIFRKNQHDQHVYKAVFTTSYPSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small RNA 2'-O-methyltransferase
publication title Crystal structure of human C1ORF59 in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 216
sequence length 237
ec nomenclature ec 2.1.1.n8: Small RNA 2'-O-methyltransferase.
pdb deposition date 2014-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4xcxA00
4OA8A 1XDZA 2AZTA 4OX9Y 4PYOA 4JXJA 4QVGA 4GC5A 1RI4A 2OKCA 2XYQA 2PX2A 4RTJA 3UWPA 1VL5A 2AOUA 4IWNA 5LQUA 4EVIA 1JQ3A 4LECA 4YMGA 3I53A 4KDCA 3HCDA 3PB3A 1SVUA 5EEGA 5P8WA 2WA1A 3DP7A 3HCCA 3PTAA 3TM4A 3O31A 3P8ZA 3IHTA 3ORHA 2JH9A 5EGSA 4PNEA 1XDUA 1KYZA 2YUIA 3P2IA 5GWXA 2H11A 3TOSA 4KW7A 3DMGA 2QRVA 4HSGA 4RTMA 5MHTA 2YVLA 3C6MA 3QOWA 4HC4A 5KYGA 3DLCA 1UWVA 3GGDA 2IH4A 2BM8A 2I9KA 4DF3A 4DZRA 4FS8A 1O9GA 3FZGA 1RJDA 3SGLA 1AQJA 1XCLA 2IH5A 2P35A 3LCUA 1WG8A 3WSTA 3C3YA 3TPZA 3PS9A 2G70A 2UYHA 2VP3A 3HCAA 4X63A 4F86A 4LWPA 2PBFA 2UYQA 3H2BA 3KR1A 3REOA 5EKXA 5EMKA 2HWKA 3SXJA 4EQZA 2B78A 1P39A 3DH0A 4C05A 3TKAA 4E70A 4QTUB 4DCGA 1G60A 3DXXA 3EMBA 3GJYA 3GRUA 3UJ6A 4QQNA 1O54A 3OZRA 4GQBA 4FGZA 4BP1A 4PONA 1N7IA 5LQAA 2ZULA 3M33A 4RVGA 1EQAA 1ZHFA 2G72A 4PGHA 4PIPA 3HVKA 10MHA 2P41A 4RTOA 3DXYA 3LDFA 5DTRA 5EEHA 3EVAA 3FYCA 2AOTB 2GAFA 2R3SA 5T67A 3UFBA 1KIAA 5DM0A 5GM2A 3G89A 3KR0A 4NECA 3RODA 3L8DA 2HTEA 3HTXA 4QPPA 3IEIA 3CJQA 1EAMA 3M6VA 1RJFA 4OBXA 1KPHA 3R0QA 4DCMA 1KPIA 2NXEA 3UJDA 5BW5A 2Y1XA 3G5LA 5DSTA 5BW4A 2AN3A 4YUVA 4MIKA 3EEYA 3UA4A 1NW8A 3I58A 1L3BA 3ANXA 4RTQA 3A25A 1XDSA 3BZBA 3LDUA 5T6BA 1L9KA 1TW2A 4AZSA 4YUYA 5DX0A 2ZVJA 3B7PA 5EHGA 2NP6A 2FPOA 3HCEA 3BGDA 4CXMA 2ZW9A 2ZSUA 4X61A 4FP9A 5FWDA 3MGGA 4G56A 3G5TA 4XUDA 1F3LA 2NXNA 3OCJA 2CL5A 5F2NA 1Q0SA 4FSDA 4HH4A 3SSMA 5B1SA 2ZIGA 3OU7A 2ZCJA 2GLUA 1SQGA 1UFKA 2BR3A 2HV9A 3T7TA 4C4AA 4DQ0A 5CVVA 3UA3A 1KHHA 5FA8A 3DOUA 2ZBQA 1AQIA 3G2OA 3OFKA 1X19A 1ZQ9A 3AXTA 2A14A 3AXSA 3DMHA 5DPMA 4ER7A 1JQEA 1KXZA 1L3IA 3P9IA 2EFJA 2EG5A 5EPEA 2O06A 4RTRA 2AVDA 3NWEA 1QANA 5CM2Z 2ZBPA 2PV0A 5C1IA 2XVAA 4RTLA 4PIMA 3EEOA 2NXJA 1IY9A 3EVZA 5CCBA 4KDRA 3B3FA 2IFTA 5FQNA 3BWBA 5EQJB 3B3GA 3HM2A 3JWJA 1R00A 2OB1A 3V8VA 3BWCA 3FTCA 3S68A 4C04A 2OB2A 5C9ZA 3MB5A 3KQVA 1QYRA 3SVZA 2FCAA 1JQDA 1RI3A 5DRYA 3CBGA 1YZHA 2IBTA 3LCVB 3EVBA 5LR6A 4U7PB 4PYKA 1L3CA 5EHIA 5FHQA 4QPNA 3P2KA 4GUAA 5G02A 7MHTA 3EVGA 1RI1A 3TLJA 2OXTA 4F84A 1KYWA 5EC8A 5HOQA 2IH2A 4M38A 5EG5A 5FADA 1YB2A 1XXLA 1G8SA 4ER6A 1WZNA 3Q7EA 4DKJA 1MHTA 1WY7A 2IDJA 1VBFA 2QM3A 3G2MA 3GRZA 4ZTBA 4PYIA 2PJDA 3EPPA 1T43A 2AOTA 3G88A 5CVEA 2P3LA 1JSXA 3T7RA 4EKIA 1M0EA 1VE3A 1JTFA 3T0IA 4A6EA 4AZTA 3G8BA 4GEKA 3GNLA 1VQ1A 5E9WA 2BR5A 3EVDA 1DL5A 5K0FA 1JSZA 2B9EA 3KQOA 5HIJA 5FA5A 4PCLA 3HP7A 2V7EA 5GIOE 2PKWA 3KU1A 3MTEA 3ER9A 4PYLA 3P2EA 3FTEA 3VSEA 4AZWA 1NV8A 3BT7A 3OPNA 1HNNA 1ZGJA 1JG1A 2P8JA 3CGGA 1VIDA 2P40A 3E8SA 3P9KA 4C03A 4RVDA 5IKMA 2Z6QA 1XJ5A 3G8AA 3FYDA 3FRHA 4QDJA 3KQQA 5GIPE 5K0BA 4CKCA 5GINE 5CIYA 1NBHA 5ICFA 4LG1A 3MERA 3GCZA 2P7HA 2R6ZA 1NT2A 2PX4A 4E2WA 4POOA 3HA5A 5ERGB 3G7UA 3QV2A 2BZGA 3CC8A 2JHAA 3TRKA 1NW7A 3HVJA 4P7JA 2AN4A 2EJUA 4ISCA 2PT6A 5DWQA 3BXOA 4V0RA 1XVAA 5EIFA 2PXCA 5DRTA 3MAGA 3OE5A 2PT9A 3BUSA 3LSTA 3OFJA 5CVJA 1NKVA 4R8RA 2PWYA 5HILA 2Y1WA 1G8AA 5EVJA 3C6KA 5LSAA 4BP3A 4CTJA 2WA2A 4PCAA 1L1EA 3LKDA 4XUEA 2C7PA 4C06A 3TM5A 3X0DA 3TFWA 3DLIA 3NVKI 3M4XA 4RV9A 3HCBA 2HMYB 5E2AA 1EG2A 3ERCA 1JG4A 2ONZA 3MCZA 1JTEA 4P7FA 3LECA 5K0CA 1WXXA 4CKEA 5K05A 3B3JA 2AVNA 3CJRA 3T7SA 4OA5A 4RTPA 2K4MA 5GOZA 3R24A 4MWZA 2OO3A 4RSRA 4O29A 3B89A 2IDKA 5DX8A 1KP9A 4KWCA 2YQZA 2HNKA 5KQSA 2GH1A 5CCXA 1EJ0A 3ID6C 1SG9A 1YUBA 2V74B 3FTFA 4BLVA 2IP2A 4RVFA 3OZTA 2UYCA 3FUWA 4BY9E 3GXOA 5DTMA 5E1DA 3KPWA 2ZZKA 3JWHA 3RIEA 1F38A 3FTDA 3LL7A 3BGIA 3HVHA 4MTLA 2P1DA 2QY6A 4MQ4A 4E31A 3GRRA 3HCFA 3LBFA 4XUCA 3NJRA 3FPJA 4HGZA 3UZUA 2GS9A 3B5IA 4YMHA 5E1OA 5HIMA 2Z6AA 4P7KA 5K03A 3P9CA 3UJ8A 5K01A 5DT2A 2P3OA 3UJBA 2PXXA 3R6TA 1VP9A 5DM4A 3UJCA 3O4FA 5BP7A 1X1CA 3G2PA 4C08A 1RJGA 2JHCA 4YUWA 3P71T 3M6XA 2BM9A 3VC2A 5CUQA 5H02A 2PVCA 2F8LA 3FPHA 2NNWB 1I1NA 4KIFA 4E32A 4RTKA 2ESRA 1INLA 2ZWAA 2CKDA 1ORIA 3A7DA 4RYLA 5CVUA 3RW9A 1NV9A 5LQRA 1P1CA 1PJZA 1NBIA 3I5UA 1PRYA 4OQEA 3SSNA 2ZTHA 4KIGA 4GBED 4PGGA 4X60A 2I7CA 4RTSA 4GOMD 1ORHA 3SMQA 4H0NA 5DM1A 4E2ZA 1X1BA 1R8YA 2IIPA 3KPYA 4FR0A 8MHTA 4M36A 2ONYA 1D2HA 2PY6A 4PYNA 1U2ZA 1V39A 1KPGA 4CTKA 2O05A 3C0KA 3CCFA 3NTVA 2KW5A 5F2OA 5K0JA 3EVCA 2ZLBA 2AOWA 4GC9A 5EZSA 4R6WA 4WVLA 3BKXA 3K0BA 3SR4A 4OQDA 3NWBA 3GO4A 4BLWA 1P91A 2B2CA 2VDVE 2ZWVA 2C7OA 2ORED 4DM3A 1FBNA 2YXEA 2I62A 5EZQA 3LGAA 2H00A 5FTWA 1G38A 2OPBA 1IM8A 3AY0A 1RI5A 1RI2A 3NVMB 3MTIA 4DMGA 3UBTA 1N7JA 2B3TA 5K0LA 1WS6A 2PLWA 5EMMA 5GM1A 5E9JA 4Y2HA 3K6RA 2PXAA 1AF7A 3EGEA 3LDGA 2QYOA 3QOXA 2YXLA 5K0GA 3ELWA 1D2GA 1EIZA 1QZZA 2ZZNA 4HGYA 5HFJA 3PT9A 4X1OA 4XCXA 3KQPA 1NW3A 5E8JA 4Z2YA 1JR4A 4P58A 3OU6A 5DLYA 3TQSA 4GOOD 2XVMA 3DTNA 3I9FA 5LQNA 3SM3A 4IKPA 4IV0A 1NE2A 1TW3A 3HEMA 2ZFUA 4GF5A 4GOLD 3ELYA 1EJ6A 4EK9A 4YV2A 3KHKA 4RWZA 3DMFA 4QDKA 3A27A 4WXHA 3KKZA 3FUUA 5IH3A 3ER8A 2FYTA 4CWAA 2IBSA 1VPTA 1VP3A 2VDUE 2VS1A 4B17A 3PVCA 2JJQA 1R74A 1FJXA 1Y8CA 4IV8A 5EKUA 1YFLA 3DXZA 3EVFA 3IV6A 3LBYA 3TKYA 3NMUF 3EMDA 4OBWA 3AWIA 3UJAA 4E2YA 3GDHA 4PINA 5LQKA 3KQMA 3MQ2A 3KPJA 5M5BA 2GA9A 1AV6A 5LQCA 3E23A 3AJDA 5DM2A 4F85A 4EMSA 5HZMA 1M6EX 2YTZA 1G6Q1 2VDWA 1JG2A 5FUBA 3UJ7A 1BOOA 1DUSA 2XBMA 2NXCA 3CKKA 3G2QA 3M6UA 2CMGA 2PSSA 1R18A 2G71A 3BWYA 1TPYA 5FHRA 3LX6A 3M70A 5U4XA 3SX0A 2G1PA 3P9NA 3R9XB 2ZBRA 3NDIA 1WXWA 3E7PA 3BKWA 1XCJA 3EVEA 3MCTA 2FK8A 4BLUA 2O57A 2PGXA 3O7WA 5JUWA 3D2LA 3U81A 3HNRA 3PFHA 5E8RA 2UYOA 1YZ3A 2OY0A 5FCDA 4YV1A 3EGVA 4KRGA 1DCTA 1SUSA 3KR2A 3HA7A 5EMJA 2XYVA 4PWYA 4RX1A 2B25A 3KPUA 2NYUA 2O0LA 1YFJA 3DR5A 4C07A 3DULA 5KS2A 1Q0TA 3R3HA 1BC5A 4HTFB 5E9QA 5F2KA 3NDJA 3KQYA 1FPQA 5ICCA 1YF3A 1MJFA 5KQRA 1KR5A 2PWPA 5ICGA 1VLMA 1BHJA 2FHPA 3HA3A 3PX3A 5T64A 1R6AA 1SKMA 3PLAE 3OE4A 4ER0A 2ADMA 5KVAA 2DPMA 2OYRA 3THSA 2AR0A 2ZIFA 3FRIA 4HG2A 3M6WA 5FULA 3FPEA 3EGIA 5EOVA 2LD4A 3ELUA 4QTTB 9MHTA 3C3PA 2VZ9A 5K8VA 1M6YA 5HEKA 3P97A 4YUZA 4FSXA 4FZVA 5EMLA 5BXYA 1BKYA 5K09A 5E2BA 5HIIA 3A7EA 5K0EA 3KR9A 2BH2A 1I4WA 4CKBA 4RTNA 4YUXA 1NW5A 4FT2A 3UJ9A 1OR8A 2DULA 2OZVA 3TR6A 2I6GA 3LPMA 2G8NA 2JH8A 1R8XA 2P7IA 3JWIA 5D1NA 4E33A 3I64A 5CD1A 2AN5A 3JWGA 3LHDA 5EIWA 1N2XA 1FP2A 2AOUB 2GB4A 3GWZA 2IGTA 4HRAA 4A6DA 4ER3A 4ATNA 2H1RA 1B42A 1H1DA 3KPVA 4R05A 2C7QA 4M7RA 3LCCA 4PYQA 2YR0A 4E30A 3BGVA 1P1BA 2AOVA 3V97A 4AUKA 4UOEA 5E1MA 2Q41A 4EKGA 2E5WA 3F4KA 4KVZA 1XTPA 3CJTA 5FWAA 4DA4A 3ME5A 2N47A 4L7VA 2QRVB 1ZKDA 1ZG3A 5DXAA 2XYRA 4RVHA 3OZSA 1D2CA 3HVIA 1X1AA 1I9GA 3SSOA 3KQTA 3A4TA 5GP1A 3GRVA 2JG3A 5FQOA 3KQWA 1IXKA 4Y30A 2QE6A 5LQJA 3IYLW 1G55A 3OU2A 1ZGAA 2JHPA 2UZ4A 3PFGA 5DSXA 1JG3A 4ER5A 4GOND 5DX1A 2YX1A 4YV0A 4AZVA 2Z6UA 4MHTA 1QAQA 3LKZA 4PYMA 2AS0A 2GPYA 3NW9A 5CVDA 5DTQA 3E05A 1QAMA 4HTFA 2ZIEA 1RJEA 3VYWA 4PYJA 3KQSA 1UIRA 3A26A 4K6MA 2YXDA 5HIKA 2BR4A 1SQFA 1X1DA 3GRYA 2CWWA 3PX2A 2EX4A 3FUTA 1Z3CA 1QAOA 2FK7A 2PX8A 3CVOA 4FT4A 3FUVA 2OBFA 4R6XA 4X41A 5K0NA 4LWOA 2ZZMA 3FPFA 3FPGA 3TMAA 2FRXA 3BWMA 1O9HA 4QQKA 3THRA 3GIWA 3DUWA 2O07A 2EJTA 4M37A 1FP1D 5C0OE 4U7TB 4P7GA 5E1BA 2PX5A 4E2XA 1SUIA 1NW6A 2IPXA 3VC1A 5JR3A 3GU3A 2AOXA 2WK1A 3Q87B 2NP7A 5D1HA 2P3QA 4V0QA 2ERCA 4AX8A 5ICEA 3FUXA 2HR1A 4R8SA 3ELDA 5DXJA 2CMHA 3MHTA 1HMYA 2C7RA 4QVKA
chains in the Genus database with same CATH superfamily
1PT9A 4TMZA 2WD9A 3NRJA 5HK8A 2GVZC 4QVGA 5DNCA 2VZLA 4INZA 3T7CA 2FRVA 2I3DA 4WBNF 2DWOA 3WV4A 3NYWA 1VL5A 1RLIA 4JP1A 4P3OA 4UE6A 3CNHA 1KYYA 2CSXA 1NTRA 4R1SA 1KZGB 1KFEB 3BMCB 2GN9A 4RMNA 3ZCRA 1WXDA 2BOVA 3HE3A 1G20A 2ZRLA 3EJ6A 1M76A 3ETGA 3FZNA 2WLSA 3HGQA 1ZISA 5CA1B 3O31A 3QLEA 3OJWA 4WSOA 1PWEA 2AEMA 1C4OA 2V4ZA 4IVRA 3WP0A 3P2IA 4Z8YA 5FBWB 3L0CA 4BWVA 4EPRA 4JXKA 1AY0A 3FKSA 1DX4A 4OF4A 1W94A 1LC3A 1XZBA 2GBPA 2BPOA 2I6FA 4I1IA 2LP4Y 1GKYA 2CW5A 3H1TA 4GMFA 4N3GA 2BC9A 1FDTA 1RJDA 1X8JA 2R751 3CEMA 3G2HA 4U5XA 4B5KA 4CQJA 3SZGA 4MMZB 3PF8A 3R77A 1NWCA 5LD2B 1C1DA 2YWDA 3K9QO 3KR1A 3O93A 4X95A 5LDHA 5IM4A 3VH1A 2Q0XA 2XUAA 5EKXA 4BIIA 1DMSA 2PAAA 2V6BA 3BB3A 3DCJA 4D3ZA 5DOVA 1T4BA 4B79A 1JQBA 3KT0A 3O94A 4WOJA 3K09C 3WGMA 5AW6A 2ZULA 1SKUA 4FILA 1T4CA 4MWBA 4S04A 4PGHA 5CHYA 2ZBGA 1JIJA 2WWWA 3AV0B 8OHMA 1KIAA 2FAXA 5ALZA 1Z63A 3MMXA 4WL0A 1E98A 2YJ6A 3OCZA 3KKPA 3U17A 2YUTA 3OE7A 3JVUA 1N5IA 1QBKC 2BL4A 2YDXA 4Q21A 3MWJA 2Y4OA 2Y1XA 1UZLA 2PS0A 3NGXA 1A9QA 4IEEA 4ALJA 4E22A 4R84A 3ZCQA 3FRJA 1QC5B 3CE6A 1CUIA 5FOXA 1QE0A 5AOVA 2ZSBA 1DAMA 1TYDE 4YUYA 4TTAA 2C9BA 1NIPA 4GKAA 3BMXA 3FCAA 3FYUA 4D42A 4JT2A 5CYFA 2H4JA 4Q1CA 1ZD1A 4CXMA 4CKCB 2V7BA 4NEHB 1BDIA 4E1AA 3L0PA 2C1EA 1N7GA 1DBQA 4FP9A 4C78A 4EY3A 1AT1A 4DA8A 1F3LA 5EUCA 1R0KA 3JPYA 2GAIA 4IOLA 3O8LA 3GC6A 5FFNA 4YPOA 2HQRA 3FPSA 1W59A 2OHOA 4L15A 4TMWA 5HMLA 2G77B 4HWKA 2B2NA 2VSOA 4N7JA 3MRVA 3C1OA 4WZZA 5CTAA 2ACVA 2ZBQA 3G2OA 2ZIXA 1PQWA 4R40A 4ER7A 3H99A 3TTWA 5ERYA 4UBLA 1X8LA 1CUBA 2RHCA 3WQHA 1NUAA 2ASEA 4AQYB 1CKEA 1VG9B 3VNQA 3OLQA 1Z6TA 4PIMA 3Q0TA 3R7AA 4JU9A 1KOFA 3B3FA 1Z0FA 3FYUC 2FZ5A 4Y6GB 5EQJB 3B3GA 4QZVA 1XB2A 5F64A 4HLNA 5ESRA 3OIFA 3X1JA 1I4LD 1M2EA 2J0VA 4S35A 3PXXA 1G41A 1OX5A 1TCUA 1OI3A 3E3OA 2Z3ZA 4KMSA 3L7JA 3LLCA 3D1JA 1ZI6A 5F9MA 1D6JA 4NYMQ 1GKIA 5HG0A 1ST2A 1WB5A 2CK3A 2CNLA 2GARA 3Q7EA 3V1LA 2EJVA 2JFYA 4MQEB 4ZTBA 4BO2A 3G2MA 4YCSA 2PRIA 5FTMA 3DM9B 2ZEJA 3A6KA 1OXBB 3P20A 1JKJB 1I6MA 2JLRA 2XRFA 3GDOA 1CEQA 2VP6A 2VHEA 1RS0A 3OVMA 4KBGA 4QUDA 3UATA 4DEYA 3ZV6A 2CHUA 3CNNA 2GO7A 1S2IA 3C70A 3DVLA 3UEOA 1ADCA 1DL5A 3GWGA 3QKTA 4MK4A 3WLIA 4CGZA 2OCYC 3WJ2A 2BUBA 3V4FA 2AJBA 3DFKA 4M87A 4J0JA 4JQOA 1TZ2A 2M6SA 1DRJA 4HDRB 4C0SA 2LWIA 2BSQA 4TRRA 3P2EA 2BCGY 4YCBA 4F3YA 1WM1A 1NUPA 5KWJA 5C1BA 1YL7A 4PC2A 1YL6A 4Z53A 3EQ9A 4OI4A 1TAUA 4Q1DA 4RM3A 2ZCUA 4B9AA 4RIHA 3QW4B 3DR3A 2EG9A 1ACLA 3OIGA 2MT9A 5IN4A 4G0VA 2BEUA 2PX4A 3THYB 3D8TA 1EE9A 3U4IA 3ET5A 3P2YA 4JI3B 2LDBA 5C37A 1OIXA 1HA3A 1NW7A 3FDZA 3AHEA 1SHZA 2BEWB 1OF1A 3QH4A 4I6GA 4QAQA 4YYEA 5EJEA 4MCHA 1FMJA 1M2GA 4QUAA 3I05A 4R1LA 4UXIA 4IRXA 2QRLA 4LYFA 1AKRA 1GILA 2D59A 2MWMA 3USCS 3KFXA 4YJHA 4ECAA 5G0WA 1OY1A 4G4SP 5IBRA 3B38A 3JALB 2ZI7A 1EZZA 3TX2A 4BNKA 4DLKA 2X5JO 5GGYA 4EHKA 1Q77A 2IWHA 4J07A 2PRKA 4WDQA 1LW7A 1OROA 2F1HA 4NJEA 2X0EA 4C06A 6REQA 2P2SA 1Z0JA 3C45A 3G0CA 3I6YA 4GECA 4GXNA 4EABA 4PAGA 1DC4A 2HMYB 3WI7A 1GTZA 3BMOA 1H0KA 4UUNA 4CCYB 4E15A 3I2HA 1ZH4A 3N2NA 1PGOA 4FC6A 1LC0A 3HU2A 4WZAE 3FZYA 3DBHB 2QWXA 4ZVNA 3KLPX 2AVNA 1S2DA 4OIMA 4D9KA 5KWEA 1H8HD 1ZHOA 1MPTA 4EMBA 1CE8B 4WY5A 3P4UA 1I0IA 3MFQA 1YQXA 1J56A 1ZVKA 1SG9A 1W73A 1YUBA 2C2KA 3BX1A 1R37A 1K6JA 2EBUA 3Q7PA 1ZBDA 2FG5A 2B1RA 3IFSA 3VH2A 3ZZNA 1VE5A 3NNNA 1U3TA 1W25A 3AO0B 4CV3A 4WZBA 3QELA 2IX9A 2LUOA 1JLRA 4BZPA 4ZEWA 4OI1A 1CWUA 3K9NA 4LV5B 1JSLA 3ESZA 2HSZA 3G7NA 4B8YA 3KJFA 1HEYA 3R3UA 5JCZA 2CXNA 2APJA 3O83A 1YDMA 3U3ZA 4D56A 4Y6QA 3QX7A 1N3IA 1S8OA 5HIMA 1PGPA 2OWEA 4KFUA 4EHFA 1XWFA 2ORIA 4XFDA 5AW3A 1L4NA 2I8LA 2J3KA 2PXXA 1VP9A 3LX8A 2IVFA 3IH5A 1KFCB 1ATIA 1T3GA 4F8JA 1HGXA 3S2ZA 2IZZA 1EVJA 1GR0A 2Q4RA 4ENQA 5U4QA 3GCWA 3IAEA 3PYMA 1ZA1A 4H1UA 3RT7A 1H2RS 3QHQA 4AU1A 4D9MA 1RYEA 2CHQA 1SVNA 2M1XA 1CNEA 1DBVO 1W0JD 3L7YA 1GNLA 1FYFA 3EGXA 1E1MA 2VDWB 1LDBA 3A28A 4ID3A 2JLCA 5EHZA 1YRWA 2ZTHA 3DEAA 4IUDS 1N5JA 4L4SA 4UTXA 5HDBB 2MYTA 5KI6A 2XITA 1VL2A 4Q4DA 5AHRA 2JCVA 2VYND 5B30A 2YYAA 1X1BA 1CQIB 1MOZA 2CDRA 3OPYI 1HFWA 2VPQA 1N6LA 2ONYA 3AQIA 2G07A 2PGLA 1II8B 4WFJA 2PY6A 4WN9A 4YGXB 1X70A 4DXDA 5F2OA 3ZS8A 3DTVB 2O48X 5K0JA 2IV7A 2AOWA 5WRFA 2CT8A 3OHPA 4J0KA 1PCXA 1RVV1 1VI6A 4QSHA 4MW0A 3DCYA 2YXEA 3F6EX 5L8VA 3CQ9A 3MA0A 2OO5A 4JUIA 3RABA 4KGZA 2ONJA 1VGRA 3MAJA 3NVMB 3KSAC 3SC6A 2IYXA 5K0LA 1J21A 4HPXB 3AHDA 5KJ6A 3EXAA 5B6JA 3NM4A 4RA9A 2W0MA 1BG6A 3EGEA 3Q15C 3RWBA 3ELWA 1P7VA 2F1KA 3DLPX 5IW8A 1AGPA 3CRW1 3VPAA 3EBPA 3FHTA 1XI2A 2BTQB 2MINA 4FNAA 2WIDA 4W6ZA 1VZ2A 1TYAE 2FZWA 3LUBA 3RWOA 1QCDA 4QHSA 1N2EA 3C3CA 5E6RB 1L4EA 4L4RA 5LZ4A 1Z6PA 4COOA 4R0NA 1EJ6A 5C8YA 4YJFA 1E62A 2BSXA 5IJ0B 3QE9Y 1L5ZA 4RIGA 4R5HA 1N92A 1N5MA 4N82A 5T7BA 2OO5C 1EFKA 3R41A 4YP0A 1LLDA 5EJFA 3MCAA 4YUAA 1P9WA 1JP7A 1I2DA 3FZEA 2NIPA 4BX0A 4DV6B 1V4BA 4OFXA 4FDTA 5EN4A 1MKYA 4M0UA 4DMRA 2FOLA 4OBBA 2OHGA 2QSUA 4WJLA 3IDFA 1JVSA 2FPIB 3IX7A 4X1YB 2OECA 4HQLA 4CI0B 1NVEA 2QGFA 5IFLA 1ZRMA 1G5FA 2I2DA 3LBYA 4MEBA 4AF6A 3ZTTA 3NMUF 3EDRA 3O8OB 5JAZA 2A86A 1QB8A 2ANBA 1ZIPA 3ROXA 1P29A 3A4VA 1YQ9A 1IVNA 2H4HA 1PZMA 2EKBA 3FPAA 3K1JA 4IQ8A 4Q24A 1VI5A 3MS2A 4KPUB 3PPIA 5DYWA 3R9KA 3WGHA 1Q7CA 1JF8A 4WCDA 4M46A 1GA4A 1N3BA 3ZCSA 5EJ8A 1AV6A 5D51S 2GI4A 2YTZA 2C0QA 3BQNB 3A8TA 1N3LA 5I9TA 1XZAA 1DUSA 1HF3A 3I0ZA 4I0WB 1G19A 3EZ6A 1LVUA 4NC9A 3IB3A 4WOPA 5TPWB 1OBCA 5C46F 5H4GA 5FHRA 1GR1A 3R9XB 2FMXA 4F3CA 2F17A 5AI0A 1ORTA 2FK8A 1TCBA 3QG1A 4DTIA 5K6RA 1NMSA 3GXBA 1FSFA 1CJBA 2KJQA 2XMSA 4Z4EA 4IGAA 1GFWA 3H3XA 4BZZA 4DYVA 5E3JA 3SZRA 3FLBA 4GI1A 4F5WA 4BP8A 3V4VB 1GCIA 3EF0A 2JK0A 4S2UA 2HQ1A 2XMBA 3IIKA 1DEAA 2BGKA 1UKAA 3P2OA 3M34A 2I03A 3PK0A 3D1VA 4ZDKA 2EVWX 1MGOA 3QEOA 4YRZA 4PLPA 1EHIA 4ETMA 3OZEA 4J94A 4KR6A 3EVTA 1MC1A 1XROA 1LNSA 1ADGA 2Y3IA 2OD9A 1TI7A 2WSIA 4LXQA 5EE9A 1L4YA 4RY9A 5DGCA 3V4OA 1QO9A 1QG2A 1QM5A 5CPBA 2O3UA 5FULA 5KSZA 2XWJI 4QELA 3IRVA 4KODA 3VPHA 3W79A 5K8VA 3L04A 3Q5GA 4L73A 4NJMB 4Y2RA 3RYCA 5B2EA 3HHPA 2Q5OA 2XUDA 3AEYA 3QVJA 4K05A 2FLVA 3HACA 1E9DA 4Q1VA 3SYRA 5BXYA 5HIIA 4C7VA 1ZCJA 4CVNA 2WILA 1UC9A 4PLHA 4QYSA 1GL3A 1RWPA 2ZRBA 5IBCA 2BH2A 1QHSA 4LZLA 3KHTA 2P91A 1QVRA 4BBJA 2CDCA 1Y5IA 5EZ6B 2JDID 1AS2A 3BG5A 3LI2A 4ZHQA 1IFXA 1RHMA 4H59A 1GGJA 2HCRA 3F49S 3K5HA 4OYRA 4X7RA 1PFUA 1Y98A 1HFEL 1PT5A 2WHYA 2Q3FA 4NMMA 3U09A 2X3FA 1HZZA 2A1TR 3M49A 1B42A 3R9WA 3BCUA 3W3ZB 1JMYA 2B8NA 2AG1A 3L8ZA 1J8VA 3KV3O 4C0HA 4ZHSA 1Y7PA 3VX3A 2P90A 4HBGA 4OYHA 2HQSA 3ZWAA 4KQIA 3LF2A 3T9EA 3NHRA 3ZV4A 1SXJB 4UZSA 3C97A 1NU6A 2WZQA 1YFZA 1QGOA 4B09A 4PGAA 4JUAA 3OQVA 5JSZA 3ULKA 5JXJA 2ZJFA 3HV0A 3SSOA 1JYSA 2PKQP 3DLBA 1NFQA 2NWQA 4JK3A 4TTQA 2JFQA 1I1HA 3L1VA 3X2FA 3BA6A 4MYSA 4DSOA 1QDEA 2R7AA 5JH7F 1ZICA 2A7QA 2G36A 2VK1A 1HZZC 3C5HA 1OI2A 4NIMA 4KAJA 1E3TA 2QQ5A 4MW4A 4ZOLA 4ER5A 1WDTA 1EBFA 5IVPA 5BSMA 2DB3A 2DCUA 3WIOA 3WGTA 2YXBA 1V16A 4LRQA 5CVDA 2EZ4A 5EHQA 3NW9A 2Z30A 5DTQA 5F7ZA 4OK5A 4BNJA 4F5ZA 2NQ2C 4Z3KA 4XA8A 5F7JA 1V3QE 1AE1A 1KI6A 4M0KA 3O8BA 3ESDA 4KZPA 1M1NB 2WDZA 4Q9JA 1MLDA 4ES6A 5CRIA 2ZKLA 2I2XB 3RRNA 3ZCXA 2FK7A 2ZRFA 1O6FA 4KDEA 4L5YA 1MAAA 2QN8A 3DWEX 3E27A 1GLNA 2M6LA 3TSZA 2CMDA 2X8JB 1NR7A 4OLFA 4CR6A 1C4WA 1IK6A 2N3ZA 2FQXA 1H3EA 2C7BA 2PK3A 5FBLB 2BFFB 2V7QD 4L95C 3S5JA 2TECE 1U1FA 2H51A 4DRYA 1KS2A 3FMIA 1OUMA 5HJ2A 5INTA 1N0UA 3IXQA 1WD7A 3D8NA 1WMFA 2ZSDA 2F62A 3HUUA 1T34A 2G0AA 3TJZA 3WB0A 1C7EA 1X38A 1RE1A 3MWEA 3MT9A 1DAEA 3BVPA 4N5IX 3N7AA 1JWAB 3UG7A 4EZIA 1M34A 5HYVA 5H82A 2OILA 3COPA 2HO5A 4LECA 1HEUA 2BLNA 1RLMA 4PZYA 3HCDA 3RVNA 3H9CA 3ZG6A 4RL6A 1IBCA 4TUYF 3HXLA 1EUCB 1H2EA 1HG1A 1LA2A 4X84A 4LJ8A 3TM4A 4HDMB 4DDVA 2E85A 2QTRA 3ESYA 3H17A 2IU0A 3DZGA 4CEHB 2QE7A 1BE1A 3TDKA 4O2AB 3KTAA 1Q1AA 3K9HA 3SY8A 1B6TA 2QVXX 3R5TA 5K3FB 4J7AA 4YQFA 3DM5A 1AO0A 2PUGA 1IM2A 4E5DA 4TYMA 4GXTA 1IOLA 1EP9A 2QV7A 3NBKA 4N6NA 5A0FA 3MJVA 2BM8A 3RS7A 3PNLA 3THWA 4C01A 2BMDA 3EZLA 1E6EA 3LCMA 4MV9A 1KJ9A 2P35A 2ZUBA 1E3QA 2X86A 3FH0A 4K86A 5H3LA 3S5UA 2E4XA 2G70A 1NLFA 3M5PA 3TTYA 2V7UA 4EKYA 4G26A 1XPUA 2XMZA 4CKWA 1OXMA 3O6VA 5DLEA 2H4YA 4IDNA 1UMCB 3FVQA 5K3DA 3O9MA 1XQWA 3RC1A 4JYAB 5D87A 2QIPA 1TK3A 3MTAA 1QO0A 4CGYA 1UZNA 4PNPA 3BS4A 5IDYA 3B1FA 3M33A 3RJ9A 2D5LA 2E18A 1EQAA 2JH3A 2X8BA 4YASA 3NHAA 4EH1A 10MHA 3GFBA 4RHCA 4RTOA 1O94A 1ADFA 1PFQA 3OC0A 4RFSB 1N2CA 1AMUA 2C9DA 4HX2A 3PEWA 4KX3A 5DM0A 1GYRA 1XVVA 4IMPA 1XD2B 4TX1A 4EZBA 3LQ2A 3GJ3A 4OHMA 4DSNA 3OQJA 5BSFA 4JC0A 4QPDA 4OHOA 2X0NA 5B3AA 1RJFA 4Y2VA 2H6EA 4MP6A 4OUDB 1VL8A 4KBFA 2HD4A 4BRZA 2W2PA 4MQ6A 1KO1A 1XCPA 2AW3A 3VUFA 3E9DA 2C3PA 4RETA 4F45A 1G3QA 1CP2A 1PNVA 2BE7A 1UKVY 1I7NA 1U8TA 2IQIA 1YRQA 3EEYA 1S3FA 3VBCA 1TEXA 1WD5A 2Q0SA 4Z4HA 3AKZA 5BYBA 1R10A 3B7PA 1OJLA 1UAGA 2JIQA 2EAUA 4IV5A 1OPRA 2GEBA 3ZVRA 1E7YA 3PF9A 4FCVA 5AM3A 5HP4A 2ZSUA 4WT7A 1O94C 1QYXA 2HSJA 1WHSB 4FDVA 4C29A 2WI8A 3IAAA 3WLTA 1C9NA 3OCJA 2OPHA 4F8EA 4EYKA 4U2FA 3IV7A 3A04A 1GGHA 2QL9A 3KLOA 3ZNPA 4D8TA 1Z0AA 3SQNA 3FN4A 4LHXA 2QYHA 5KO2A 3S2IA 3V1KA 3V8RA 3FSGA 2H52A 1U31A 4FBLA 4RJKA 2HUNA 3OH8A 2IZ0A 1T15A 3DMHA 3WX0A 3QBVA 1NI4A 1RBYA 1ZK1A 2O06A 2AE1A 5FEMA 4BGVA 4ARCA 2PFSA 3L8YA 2KM1A 3KX2A 2IEAA 1HDZA 4G2TA 4RLFA 3AERA 4P5DA 1P9LA 1RFLA 1L7NA 4IIJA 4Y0AA 1KWKA 4OHYA 3VAAA 2W2LA 2SKEA 1K3FA 1I30A 4ROTA 4FHEA 3I2IA 2HEIA 2XUJA 1IZYA 2JEZA 1P62B 2FP4B 3GLRA 2DY0A 5J59A 3IDQA 2JARA 4LDJA 4Z3DA 2PUCA 3HJNA 3DZ8A 4RACA 3ZXUB 2CXPA 4WCFA 2H57A 4QPNA 5FHQA 3W5BA 5FLEX 2E37A 1RI1A 4IICA 4DLXA 3NBXX 3ZZUA 4BO7A 1FUEA 1JU9A 1X8KA 3ZIAA 3DZIA 5BUSA 5LA6B 1EYZA 4D3FA 3ZDBA 1EVLA 1BHSA 4N76A 3I6QA 1QH1A 3PQ8A 4K2AA 4MR8B 4TKLA 4K6CA 5IK2D 4EHNA 1BNCA 1GUZA 2FMFA 3GA5A 3LC1O 3R40A 4G85A 3T5TA 1UQUA 2QMHA 5AKLA 2W9XA 2VCHA 3PUXA 2R1VA 4MKRA 1O95D 1MJNA 2RGUA 1C0PA 5KDOA 5KYTA 1C7QA 1ECFA 3HP4A 5D7BA 1IRXA 2V7EA 1P73A 3HP1A 4WCFC 1OBVA 4JLOA 1AXEA 4NHEA 3EQ8A 4HJXA 5FORA 1T6NA 5HVNA 4H77A 1DLIA 1I0ZA 3I6MA 5IKMA 1RRPA 2A30A 2G9QA 2INGX 2WVHA 1OXUA 5EXSA 3EPLA 3GGJA 1DJOA 4QDJA 4LYJA 1RZ3A 4CQMD 5GIPE 1NBAA 4GYWA 1J0DA 2YWRA 1BD3A 1E5DA 2P7HA 3TE7A 1M9NA 3G2KA 1C30B 1T4GA 3OEHA 4DB2A 3NWOA 2XZLA 3O4GA 4KAFA 4ZWNA 2BFMA 3BTOA 3GAAA 3QV2A 5ALIA 3IOBA 2GPJA 3DE6X 2WTEA 4BMPB 2REBA 2P65A 3QBJA 2QEQA 3Q85A 1RBMA 1KKMA 2CLFB 2HCTA 2IUSA 1PJSA 2QAIA 1JPNA 3NANA 4O6VA 5EIFA 4Z1MA 3ROQA 4CETA 1E1YA 4UUQA 4R8RA 3I34X 3VNRA 2O3QA 4CTNA 2RGYA 3FDJA 4TV8B 3ZTWA 4BPRA 4EG1A 3LUDA 2QR2A 1C3OA 4NH4A 3AVPA 3H5AA 2XUKA 5L3VA 1JE0A 2QTHA 3T1VA 4DR3B 3IBFA 4YROA 5ALWA 4K5QA 4N6GA 5KBYA 3BD8A 1CETA 1DWUA 4ZAGA 1PR0A 5LNK1 4UEWA 3M4XA 5KNDA 3HYTA 5LYJB 5I7AA 8LDHA 3A36A 3UC5A 4GQIA 3CMMA 5ALUA 1GQQA 2OORA 3QVGA 3K2IA 5IM5A 4RDIA 3VU8A 4RD0A 3HDVA 2COKA 3JATA 3P0JA 3T8YA 8ABPA 3KXPA 4MI9A 4NL4H 3OCWA 4NZYA 1M2JA 2F1IA 3OY7A 1QF7A 4JJEA 4RD4A 5GOZA 3W9UA 2JLUA 2XNHA 3JD2A 5DI3A 2V54A 5TEWA 1Z2EA 3IUJA 5H7XA 1EJ0A 2HT1A 1KU0A 2V74B 3PRHA 3LPAA 1V95A 1M8JA 3OZFA 3BB1A 1TQHA 1W9MA 2OG1A 1HXHA 2FUNB 3BK2A 3BRSA 4HX9A 4BMSA 4KR7A 5ESDA 1X80B 4K26A 1YNOA 1AKUA 1DC8A 4OQYA 1FFBA 1M10A 1CS0B 2QQGA 5LWQA 3EWNA 3CN7A 1E1CA 1F0NA 1SCNE 3I8OA 1XZIA 1O0CA 3D6UA 4EYGA 2OORC 4Q3CA 2YHUA 4UEJA 3I23A 4KLCA 1ZN2A 3HCFA 4A8JA 1AD2A 2CV0A 3RRZA 2Z6AA 5JXGA 1RADA 3M3DA 2HHHB 3BORA 1YBMA 3R6TA 1WLSA 4D6YA 3UMJA 1K4YA 1C9MA 1G9XA 4JEUA 3ZY2A 4ZEOA 1GTMA 3K92A 1A76A 4HXGA 1ZM9A 5DFAA 4C76A 1W1UA 1BH6A 4CNBA 4DV0B 2FW0A 4TQUS 4I46A 3N2ZB 1MDFA 4G1UC 3FG9A 4D98A 3DL4A 4K3UA 4JIMA 2DTEA 2G1KA 2WVJA 2QL6A 3BTVA 1ZAKA 4P84A 5EHXA 5IKEA 4O0MA 4Y2PA 3BM5A 4A8JC 4J7CA 4MRRA 1ORVA 4X1IB 5I7FA 4IOKA 1K7SN 1K1EA 4OQQA 1C5KA 1R6TA 1J8YF 4N7RA 5DTEA 5REQB 3VYVA 2EWWA 1R8YA 2IIPA 2QP4A 2WIAA 1FTYA 2AFIB 3QF4A 1KDRA 4M36A 4QE3A 4YMIA 1Z2OX 5BVHB 4QPCA 5JJLA 5F1YA 3WBFA 5C18A 2W83A 1NBWB 2OXFA 4U63A 3WKCA 3OQMA 1FA9A 2EFDB 2ZUVA 1K5PA 3W90A 2PRJA 3F7OA 5A9TA 3H0EA 3ZLVA 3HABA 2C7OA 4LF8B 4GXRA 2PL1A 2FQWA 4FD3A 3BICA 4ARSA 5JEEA 5ECDA 2E4WA 3TAUA 3MMPA 1FXWA 1M33A 3B6KA 3BJRA 1Y1RA 1UPXA 1HLPA 2PYZA 3DEZA 1ICIA 3NB0A 1JU3A 4P31A 4M89A 4ZCTA 3Q6NA 3LT2A 2XTMA 3EGDA 4DQLA 1BE6A 2G1AA 3DQQA 4ZI7B 3P9QA 3ILHA 3TGPA 4U5QA 4UD2A 4KNWA 3PT9A 3HXQA 2GHIA 4B3FX 1ETUA 3ZD9A 2HQBA 1MAHA 1JAZA 5TF0A 4KWTA 5DLYA 1T1JA 3QQ5A 3R7NA 3CUTA 3VAZA 4D5GA 2PZBA 2GLXA 1JJVA 3DB1A 1FNBA 1XTVA 3RTBA 3TB4A 5KOHA 3AUUA 2QUHA 4K1XA 1P7PA 4M6WA 2JIDA 2PX0A 3ELYA 5ADWA 5LXTA 1BAPA 1G64A 3DBLB 3PA8A 2NVUB 4Z0TA 3T3DA 4NQZA 3OQOA 5JLJA 3CRZA 5JFGA 2FSSA 4CWAA 5HM6A 1Z74A 5DBIA 2GK6A 4DIDA 3O5AA 1G98A 5T57A 4XD7D 1Q22A 2VHTA 3PNBA 4QO7A 5JJIA 3GY0A 1RHKA 5HPYB 3DXZA 4KJZA 1NKSA 4TRMA 2HA4A 3LUKA 4JJGA 1IZ7A 1TAQA 2ATEA 4G1EB 5F52A 5JSFA 3T5DA 4LI3X 4CT0A 4RQTA 2WT9A 5J2UF 2EDCA 4YCDA 2R7NA 1AHNA 3FWKA 3G02A 4BTEA 4B75A 3GFVA 1GAXA 2WJ4A 1BHQ1 1IXSB 1JRLA 3KJGA 3ECCA 1T3HA 5JWOA 1DCFA 2OMKA 4NATA 2DGDA 1JG2A 2V59A 2O7QA 2VSXA 3IALA 4N9WA 4OH1A 3ND5A 4F93B 1EZ4A 2PSSA 2ZIUB 4KFTA 4MVJH 4AY3A 1EAYA 4G5GA 3SX0A 3ADOA 1DOZA 1VFPA 1JR6A 3HUEA 3RI3A 5ELLA 2Z9BA 2G9UA 4B4VA 1VCHA 3BXFA 3L7OA 4UHCA 5BMVB 3V1UA 1YHNA 2QMZA 3AJ9A 3JAMA 3RR2A 4NS1A 2JD0A 3ZE8A 2W2VA 4KKXB 2OBMA 5DYGA 4JSYA 1W30A 2BKEA 3PZRA 3SQWA 1FNNA 1PDOA 1CQWA 3HA7A 4QICA 4R7TA 4C2UA 2OCXA 4PWYA 4BE9A 4IH4A 2A0KA 3R3HA 1BC5A 1GCAA 3TLGA 1YF3A 5IUNC 3U13A 1FUKA 3DE5X 2PMKA 4RESA 3I1IA 4UZFA 1P1RA 4K9DA 4MZXA 2JD1A 2X23A 4HDAA 4GPZA 4QDUA 3LY7A 4DC0A 1EFLA 2P5UA 5EZ5A 1G20E 1DC7A 2JGJA 4UBJA 3U49A 5A5VA 1YRAA 3THSA 1NVFA 2J4DA 1WJGA 4CEJA 3AVVA 1UJMA 1VG0B 2EEPA 2LD4A 3ELUA 3IP7A 3O82A 4TWRA 3FPCA 2Q2OA 1M6YA 4N0QA 2FMIA 3K5PA 3B82A 1H65A 5DBGA 4YUZA 2FY8A 3HYLA 3KZXA 3F6PA 1YVPA 1BKYA 4PC6A 5DNDA 4EJ2A 1YAJA 1I4DD 3PGVA 3W2FA 1ULUA 2CD9A 2MSEB 3DNFA 4EGQA 1EP2B 1CV2A 2VJOA 5IJXA 4D8VA 5CD1A 1EVYA 5KTNA 1T9GS 3QVTA 1DBIA 2NSLA 4R2HA 1ZNYA 1KMHA 2H17A 3FBGA 4R05A 5D85A 2LZ0A 2VBFA 1WW2A 1Y8ZA 3UPUA 4TKVB 4LNHA 5CCDA 1EVIA 1GTL1 1URPA 1UZUA 3IAM6 4G41A 4QGFA 3U4MA 4GMXA 3OO0A 5HF5A 1AKVA 2GJ4A 1WNFA 5K3OA 1B2LA 1CJMA 1J39A 4D9HA 3KWMA 5ENVA 1N2BA 3Q3CA 2GRJA 2EFYA 3QGMA 4C0BA 4EFDA 2JLWA 4ZAFA 1QIMA 5JDIA 1CZLA 1LDNA 1Z45A 4Q7MB 5CCEA 3WJ7A 4I9GA 4EEZA 4BZWA 4PPGA 1UPTA 3RROA 3MUFA 4ZVQA 4HXYA 3HCOA 1PEDA 2WFLA 4UAGA 2WIKA 1P2TA 2I7XA 1EK0A 3FMVA 3QFFA 5I5GA 4AURA 4ERXA 1SG0A 3PFGA 2BFBA 2J3LA 3O7MA 1XEWX 4AF8A 3M2PA 3HB9A 2NLOA 5JI3E 2VJQA 4RY8A 1NZDA 2K5UA 2WQZA 3A2LA 3GJTA 3VYWA 1P5RA 3U80A 1OB5A 4MYRA 1L5GB 3E0XA 3RM3A 5BSVA 2VBIA 4PO9A 5BWNA 5JDIC 1N1GA 2RB4A 4PRYA 5I7HA 2EX4A 4O2AF 1PGQA 1Z3CA 3E2MA 4G8DA 4P86A 3DC2A 3FUVA 1LD3A 3A9RA 3NP9A 3VR5D 4LWOA 4C3OB 3G0HA 3OQHA 3U56A 1O9HA 4JUDX 1CY1A 4RMHA 3GIWA 2RSLA 1NQVA 3DUWA 1PV2A 1U8AA 1W85B 2VEDA 2GVDC 3AR4A 1CP3A 4FLEA 4V0KA 4W5JA 4RK0A 1M73E 1U0GA 4PX3A 2G6TA 2R66A 2PL5A 4HQRA 3VC3A 3A37A 5GONB 2VPXA 3Q87B 3G9TA 1OVMA 1R0YA 4QYIB 3T0FA 1C3JA 1I0LA 2ERCA 3PLRA 4AX8A 5M04A 1ZNXA 2JAPA 4KJXA 4XVRA 1E96A 2CMHA 4MS4A 3BB4A 3U3JA 2ZWOA 1VYTA 4RZQA 2XVYA 1YB6A 1TPZA 2XGGA 3ISTA 4PYOA 3C87A 4EFMA 3WYNA 4XEUA 3NHYA 5ALVA 4GC5A 1E6KA 2ZTUA 1K7YA 1GRCA 2QZ4A 3HWRA 3CPJB 3ZU5A 1JLHA 3I39X 3LE8A 4TS1A 1Y7TA 1WUIS 4C88A 2V6JA 1MXHA 3REFA 4LXHA 4S3MA 1E2QA 2O14A 2R44A 2E48A 4UMEA 3T0GA 3BERA 2UV8A 3GFOA 2Z57A 3PBKA 4Q03A 2LE0A 4EW3A 4R8VA 1LU9A 1V96A 2IYEA 2REXB 3IP8A 4ZAXA 4I8IA 4PQGA 2X4LA 3ZK7A 4FN5A 2IPNA 4I55B 3VKVA 1ML3A 2GPSA 3O38A 1KAGA 5FPKA 4NG4A 1V25A 2P5SA 2WVGA 2P6MA 1IDOA 1EFDN 2ZT6A 4EMUA 4DWJA 2I4MA 2YW9A 2NU9B 4E5YA 3ZWVA 4UOZA 2D62A 4A6XA 5B57C 2KBFA 2I9KA 1Q7BA 1JILA 2CJFA 1EINA 1NT4A 1GAWA 4FS8A 4NZPA 3JSXA 3WAJA 2AFHE 1XJ0A 1N0IA 2XVZA 5FAXA 5KNCA 1LW6E 4F86A 2PBFA 3H2BA 4I3FA 2WMYA 3OJCA 2TRSB 3RHFA 1OGYA 4ALKA 4ZT7A 4DDKA 1NLZA 1REQB 2B78A 4HDKB 1KJZA 4UU8A 5CEJA 5FWNA 2CFTA 4E70A 5KWIA 1XNRB 4UHHA 1EE2A 2JAWA 3LX5A 3Q7IA 2OV6A 5I8PA 4WKGA 3VTFA 5FOVA 3U9LA 1OT3A 2QLJA 1G291 3EBOA 1UXJA 2PFKA 1JFTA 4DE5A 1SD1A 1THZA 2B35A 1TT5B 4B7UA 2O9JA 4G0ZA 3MJRA 4IIEA 2CC2A 2GAFA 5CW2A 4S24A 3TLCA 1LJ8A 1YFKA 5GY7A 3R7BA 3T5GA 4AXXA 5AK6A 4Y2JA 2WC1A 3CN9A 4LA4A 3NUQA 1WE2A 1XP5A 3WTCA 1EFUA 3QE3A 3AR3A 3RVDA 3Q7QA 2ZBEA 3PPWA 2WF9A 3VPCA 3GZTB 3KB6A 5T3UA 1NAIA 4BVJA 2ZSFA 3I09A 4HLCA 5JBNA 1R15A 2WTBA 3B7GA 3DZHA 4HMPA 2QKYA 1J2TA 4OGKA 3L8EA 3RT1A 3CV3A 1D4OA 1PR3A 3HHEA 5HRAA 5BYAA 3VHXA 5T6BA 1C0EA 2EKQA 2VAXA 2TSYB 5JAIA 5DX0A 2A88A 1IIBA 3EZ2A 1TMOA 4OQPA 2V9PA 4EUFA 4S0ZA 4EI7A 1N7HA 4HADA 4BE7B 4F2WA 4E5PA 2C42A 2ACKA 1YS9A 2DP4E 3CWCA 3VU0A 2R2GA 2Z2XA 2ZXFA 4OG2A 1WA5A 2M1ZA 2YJNA 4WY2A 5E0OA 2D7DA 2ZIGA 3OU7A 4LJAA 3NZEA 1WKBA 3IUPA 4ZVOA 4KO2S 1TUIA 1PJAA 5ALEA 3DOUA 2ZDHA 2TMKA 3Q1LA 2P68A 3RQIA 1XTTA 1ZK4A 1E2NA 3C7DB 4AJEA 4D45A 3ND7A 2OA0A 4YRGA 3BFVA 4BNGA 2EU8A 2ZBPA 3OQ6A 2WM3A 4L85A 3BL5A 2JIMA 4FONA 1ESEA 2NXJA 4TYQA 4WZBE 4KDRA 4BFVA 3ABOB 4LY9A 3SK0A 2CLMB 3H8SA 3FFTA 3OIWA 4FQ8A 5A4AA 1P7WA 3E0QA 4GRDA 4K8OA 3PNQA 3HM9A 4XGNA 7AT1A 3LLVA 2FCAA 4PZ0A 5BR8B 5L51A 2ZYRA 2BGWA 1EGVB 2N75A 1G17A 3CNEA 4I2VA 3ACDA 3TLJA 2QP9X 2NUAA 1IY0A 2IH2A 3LT1A 1X14A 3FDXA 4JKYA 3ZPXA 3AUXA 4TWJA 4NCBA 1FU7A 5FBRB 1YI8A 2VL7A 3KEGA 4URYR 5I3ZA 1JPVA 1US8B 2O19A 4HZGA 3UHOA 3ROPA 3QI7A 4AULA 1Q92A 1NY6A 2Z8YA 5CNMA 1OJ7A 4RLHA 5A7GA 2L0XA 1H66A 1HE8B 1CQJB 2D1SA 3MPOA 4DV2B 4KYVA 3ROFA 4XVCA 5AKXA 4W9NA 2VAVA 1LTKA 1A8PA 1P81A 1QVAA 1THMA 4IX1A 1X1RA 4TL9A 4A8TA 3PRKE 4KPEC 4KZKA 1VLHA 1PI3A 1CVLA 4EO4A 3IPRA 2GESA 5DIFA 5BSKA 4HH0A 4FDLA 4DCTA 5C2JB 4CQMB 1L4LA 1P9OA 4DMLA 1JG1A 3PICA 3BT7A 4JQZA 1QNLA 5DEIA 3PNVA 2X4DA 4LOHA 3FRHA 2DU8A 2IITA 1G4UR 1Y9EA 2NU6A 4Y2UA 3FVRA 2OFFA 3I0NA 2HR1A 2Q2VA 1H94A 1SNYA 1ZP6A 3OQIA 4HQFA 4POOA 2ZM6B 2IHYA 2FPXA 2P30A 2ZWPA 1J2JA 4OYYA 3J80A 1D9XA 5JMWA 3C8DA 4W9NC 2DAPA 3FNFA 3K0AA 4MAMA 3WC4A 3ZE0B 3DDHA 3OE5A 3ILXA 5JYEA 1BDJA 1MZPA 1NZFA 1DJQA 4LE2A 1I1OA 3UUFA 3MWDA 1LPAB 4K9KA 5KQGA 3C6KA 4BP3A 3ZZ0A 4G86A 5I7EA 5HZHA 2Z2KA 3WSWA 3LXXA 2J07A 1JEOA 2KHZA 3GLQA 3GRKA 3LKDA 2WSYB 2PFGA 4NZOA 1CRPA 2DHQA 4IOMA 3EDMA 3CRMA 3CO5A 3SXUA 2VI5A 4MB6A 2A9FA 3QSYA 4TXJA 4AMZA 4BX8A 4EI9A 3UMMA 3VR2A 2QW1A 4CUJA 3KFVA 4FMPA 5LJIA 1OWOA 1SBTA 4OK6A 4NWIA 5HE8A 1SIWA 2CFOA 1TD9A 2OAP1 3DB2A 3NQ41 4IY1A 2K4MA 3PFIA 3I04M 4MWZA 3OQBA 2FH5B 1HKHA 2P0AA 2YQZA 3AEXA 4UVHA 1M2OA 3P26A 4FUQA 3PJDA 4LOJA 2IP2A 4DUGD 1XC7A 2J6HA 1UJ6A 3WLLA 1U8ZA 3LVQE 1TZMA 2FB9A 1TM7E 4ZODA 3HS3A 1LH0A 4LHWA 5T8KA 3RIEA 4JSTA 2E0IA 1NVMB 3B8EA 3AR8A 1ZIXA 2HU8A 4LRUA 1H5NA 1YKFA 2AYZA 4XIJA 3KXDA 4KMMA 3U7JA 2P1DA 1SIBE 2RD2A 5F98A 1VL6A 1GLGA 2R5WA 3I1JA 4OSEA 2I6QA 3D4PA 4R3NA 4HGZA 1QPGA 4YO8A 4DS3A 3DKKA 5F73A 2A67A 2DX7A 3QY0A 4Z9XA 5KPJA 3KT3A 1DIGA 1TTQB 2D1RA 4RE6A 1B0PA 4TTVA 4XDGA 3RE1A 2Q9CA 5AJWA 5CG1A 2JIZA 4IH1A 3NHJA 2VATA 4I66A 3GJ4A 4JD5A 3IHWA 3WGGA 1RJGA 4YMUA 3PHLA 1FBTA 1YQUA 3VU9A 2B4QA 3EHDA 1LSOA 3ND8A 3NM6B 4P83A 2ZDGA 3M83A 1NVWQ 1WQ3A 2ASVA 4JHLA 4ZZ2A 4B84A 4AQ7A 3IQWA 3LW7A 4ZV4A 2FCRA 2ZJ6A 5CDHA 3L02A 4XWKA 3ZS9A 4HGNA 4KIFA 2HF7A 5T8KC 4MUNA 4RTKA 1W48A 4FX5A 5IKXA 3A7DA 1NV9A 1K7CA 1TJ3A 4OQEA 1E79D 4K9NA 4MV1A 3RK4A 1J9GA 4BBPA 2DQ4A 1ORHA 2G5TA 3L1JA 1WP9A 2C03A 7MDHA 2OZEA 1HSZA 2JFHA 3INTA 1CDOA 4O4JA 1KTIA 2WHPB 5JQGA 2OCIA 4MQUA 3SFZA 4DQXA 4X20A 3D4LA 5EJGA 4O3MA 1CLUA 1LPSA 3AFHA 4CTKA 1YBFA 1ZIDA 2QAGA 4Y1RB 1KI7A 1V7CA 5EZSA 2H2HA 2BDEA 2WVAA 2O2YA 3VO9A 3VYUB 5CFZA 4H4EA 3NWBA 1MUUA 4NYIQ 4ARBA 2H0AA 4E5NA 3H5NA 4K6KA 3C3XA 1P3JA 5LB2A 3TZEA 5DHSA 1G38A 1U8CB 1JEQA 3DHYA 1T9HA 3IR7A 1C3LA 5DBHX 4BE4A 3CNLA 1BW9B 2XQJA 3FWYA 3TW8A 1G6OA 2NN3C 2HNBA 2PLWA 5FV4A 4EL0A 1HX7A 2Z83A 1QQAA 1M72A 1XVIA 2ZB2A 3K6RA 1G7RA 3O0DA 4JSRA 3ZGNA 2I2WA 4JT9A 4C4XA 4NAHA 5JJKA 3D02A 1DKOA 1A95A 1NQ5A 1PF7E 4CU2A 2RGEA 3B5EA 1UOEA 3B6IA 1YCHA 5IVDA 1GRVA 2FWPA 2QV0A 2Q4OA 1DKQA 2QAGC 4XXHA 1GRQA 1NJSA 2D2IA 3SJ7A 1NW4A 2BEVB 3LUPA 1YS6A 5A1JA 1NMYA 1HV8A 2HXSA 3RREA 5CEFA 1BEUB 1OBOA 1I24A 4GKKB 4WOCA 3T9FA 1E7RA 1G1MA 1ONSA 1BCRA 2PMDA 3PQFA 3OBBA 3I62A 1YR8A 1BWQA 1MENA 4BJ3A 4LBYA 3ER8A 1RLJA 3ZLBA 3OT4A 2LRHA 1ZCFA 3OOSA 5F2EA 1RYYA 1PK9A 3WAKA 3PVCA 5A3RA 4FINA 3B60A 3DC7A 2ZP1A 2UVPA 4AYTA 1BQ3A 1RHQA 1H0SA 4WNAA 1NJ8A 1EK5A 1B7GO 3FOZA 2IIQA 1NOIA 221PA 1E7QA 1G7TA 1SG6A 3K8ZA 3GGGA 4J90A 4XLZA 3UMRA 4DIEA 1JIUA 2JS7A 3EMDA 3GFTA 4N7BA 2AZDA 4CM6A 2G09A 4BDTA 4F2DA 2J1LA 1NP3A 1DAPA 2NQ8A 4QXPA 1D4ZA 1YXMA 5KX5A 4QOEA 4L5IA 3ETDA 5M5BA 1RYHA 4KQ9A 5FXMA 5IABA 3AJDA 3EUFA 4EMSA 4H7EA 5FUBA 4TLDA 4L02A 1QHYA 2CXSA 1E59A 1PFVA 1MGPA 2A5GA 3G2QA 2QD2A 3UMSA 4CYMA 2GZHA 1YRBA 2OFXA 2ZB7A 3S8YA 1NPYA 1I2MA 1R8JA 1Y4DE 2QRHA 1AH2A 1NVAA 3ZGOA 2VBGA 3QLUA 4EHDA 4IIFA 1TO6A 1EUDA 4KXUA 5TQVA 1XCJA 3GJ6A 1PR9A 3OM1A 3VR3A 4ALMA 4BLUA 3OCUA 1J00A 2Q46A 1U11A 3O7WA 3D2LA 2XJ4A 1KK2A 2H29A 3ZHYA 4ZQBA 3A4NA 2VJLA 5JZVA 2QR3A 4KQXA 4Q3BA 5MGNA 3I6ZA 2DHCA 4A16A 1CR0A 2G1UA 1W581 1TMYA 3OIVA 3ZK9A 1THGA 3B20A 3DVSX 1FDUA 3SZOA 4J0HA 2ZJYA 3NXSA 1TVMA 3MC1A 3P0EA 5IBQA 1WUJS 2WU1A 1E64A 1MIOA 5K9ZA 1WHTA 3CLVA 1M66A 3PDIB 3P96A 4DGQA 4BNXA 3Q9LA 1SVSA 4IG9A 4GLJA 3QXCA 3PHGA 2CNWA 5AJUA 2HGSA 3QLUC 4JJ6A 2DPMA 3E9EA 2H06A 4MJ7A 2VSYA 4P92A 4YFYA 2AR0A 3N6VA 5A3VA 1C7JA 5AW9A 4AWBA 3M6FA 2IXDA 2YMPA 1RAGA 2DLDA 2C5FA 4MV0A 4C3UA 1A7AA 3AR6A 3KXLA 1Q83A 3MTDA 4H6WA 4F2HA 1BFDA 4FFWA 4DQKA 1G9SA 5K09A 1IZ0A 3AB8A 3RS5A 4IXDA 2JZNA 3TZKA 2BI7A 5B1DA 2G1PA 1FP4B 2FWIA 2QRMA 2VF2A 1NNI1 5I01A 3RFVA 7MHTA 4RF2A 1TKAA 2E4UA 4LZOA 3E03A 3UC9A 3TO5A 3CGWA 2J7PD 2JFNA 5AJHA 1E2GA 1UZMA 3BOSA 3IVAA 5TJ9A 4FMCB 2CY0A 2QAJA 1ZI9A 1OWNA 4XASA 1V35A 5ER6A 3ISVA 1CSEE 1UP4A 3W7AA 5EJ5A 2B4RO 1F2TB 2C07A 2P77A 4J91A 4OHWA 5DTJA 4F4JA 3U16A 4P0QB 5EE1A 2Z5LA 4I9HA 3BE8A 3O4RA 2CNNA 1HK7A 3EC1A 4JQCA 5I6DA 1QE3A 1QSGA 4B31A 2PN1A 5AKYA 1DAIA 4YP6A 5JVDA 5CBPB 1J0CA 3ME5A 1GV0A 3DFFA 2Y76A 2B4AA 2ZB3A 3R6GA 3CTMA 2X2EA 3AGPA 4KP7A 2Q27A 5F3RA 1X7WB 5IVIA 2QZ9A 2W2KB 4KPYA 1ZD8A 3QWIA 4X93A 1JDZA 2I71A 4RVHA 4BO0A 3DDCA 2GXUA 4I4TF 1KFKB 2O8CA 1GPWB 4C7MA 5A6SB 1SOUA 2QJOA 4M88A 5CH3A 1OHHD 1DINA 2VH2A 1SBHA 2P5TB 3A4TA 3KQTA 5K2MA 5BQOA 2JG3A 4YAOA 5HS6A 2YVAA 3CEAA 5PGMA 2WD8A 1RCUA 3I5YA 5FB3A 3E3AA 4HZUA 3QKWA 2HHCA 1FMCA 3O2NA 3OU2A 3X1ZA 2JHPA 3ZWQA 4XJSA 2CE2X 7ADHA 2XJ9A 1VKZA 5T5QA 5DX1A 3KJEA 1SM4A 2X8AA 2Z1NA 1ZC3A 1FNSA 4O02B 5HHTA 4N18A 4FHCA 1PSDA 3TLZA 3BHMA 3V7WA 1AZTA 3VDXA 3C3KA 2B98A 1AQ6A 3IUMA 5DYYA 3TXXA 3I5MA 1RZUA 3OPMA 1VDZA 2HM7A 2V4MA 2OLJA 4TN1A 2WKWA 1ABBA 3AZPA 1TJ5A 1KYIA 2R4UA 2NVBA 1SR8A 3C3MA 1NN1A 3FPFA 4MYDA 2FRXA 3TMAA 5BPFA 1E2MA 2Y9MB 4AAYA 5LVAA 2ZBFA 4NDAA 3MD9A 1ELOA 4P7GA 4KSCA 4U7TB 1NPDA 3GQBB 3IPYA 3TLAA 1HT2E 1LTHR 1ULHA 3FPLA 4DJTA 2QI9C 1SBCA 1IN7A 3WLJA 4EA6A 3M5CA 1DIOB 1GWNA 1UMBB 2PKEA 2ZRAA 3FUXA 4G63A 2NT3A 5HR5A 4EB6B 3W5VA 5D3QA 1HMYA 2QJFA 3KSZO 4DM7A 3A6EA 1XN1A 2FQYA 2ZE7A 2PUHA 3HXOA 3O47A 1NJ1A 3WIDA 3DOEA 4OLJA 1XDGA 4PTYA 4AP9A 1SC3A 1L5RA 4ZZ3A 1RAFA 3IMKA 2A0UA 1P74A 2AUNA 1U0FA 1GPMA 2AOUA 2IEYA 4IS2A 4IWNA 3DE7X 5EIBD 5HK9A 3H2HA 5BO5A 1C7ZA 4FQ5A 5P8WA 3RBAA 3N2KA 3D5QA 1YUNA 1YRYE 3KE8A 2JBAA 5J58A 3RUEA 3AVOA 4LF6B 3N39C 4CM4A 2JH9A 3V1MA 1K63A 5DCYA 3HFGA 5ECGC 3L0DA 4BVHA 1S8FA 3U4GA 1X39A 3Q40A 4HUQA 1Z83A 3LYAA 1DBPA 4ND5A 6LDHA 4RTMA 3ZWPA 3G1TA 4L22A 2JFXA 3NDBB 1RQGA 1TQ6A 1KZHA 2WIFA 3T7IA 4EUHA 3T41A 4HDCA 1KY2A 1MFZA 4LNUA 4BQIA 1XTQA 2YWEA 5LMZA 2Q45A 4DNOA 2XE6A 2N1BA 3PS9A 1DAOA 4WEOA 2PGAA 4H27A 2OGSA 4QQ8A 1I13A 1JQ5A 1ZINA 5C8VA 2I2CA 2QSZA 5D84A 5KNBA 4MI6A 1ACJA 3PJGA 4XI9A 2WWRA 1ARZA 3R74A 2ZITA 3RLIA 4C05A 4GNRA 4DM4A 2QVBA 1G60A 2BJWA 3COVA 3DZBA 3G1UA 1ZK3A 3KKLA 5BNIA 2K7ZA 1XL0A 2ZYTX 1N2IA 3IQXA 3ADCA 4PONA 2JVKA 4Q00A 1P75A 4J1NA 1BA2A 4DZZA 3DD1A 1Z3IX 3BULA 4ZVUA 4L4XA 2P41A 1D1TA 2XGMA 5HKKD 1NNLA 3G59A 1KJJA 1XNQB 3W5HA 3TUJC 4OHCA 4P4TA 3RODA 3R23A 4X92A 1RVDA 1UWLA 3K2EA 4WH0A 3WLFA 4C7JA 1XA4A 2RHOA 3NFYA 1DQPA 4LJYA 4KWHA 4DREA 2WFZA 3HVUA 1CBUA 3P52A 4BWGA 3T95A 1M8PA 3B1KA 2NXEA 1LJUA 2HJWA 4NCXA 4NQRA 5DSTA 1X92A 4ECEA 3GMTA 5K8LA 2EKLA 2F6RA 4BNTA 4O4HB 1BFUA 2ATXA 1T2AA 5LUAA 2N1MA 4G1MB 3HDYA 4G6ZA 5JNRA 2XDWA 5K2OA 2OGZA 3L6BA 2ZW9A 1NNSA 3J7AC 5C34B 2VDNB 2NVOA 4JR1A 1SH7A 2D0PB 1CF9A 4MJ3A 3UWSA 5LOVF 4L57A 1NUSA 2P9TA 4BEJA 2LGJA 4HH4A 1H6DA 2R7LA 5BN4B 3UOAB 5ELXA 4CFZA 2E82A 1G6KA 2R8RA 2YIDA 2UUOA 1S7CA 1XKXA 3GNSA 4ZT3A 4ZEMA 4ZTZB 1L3IA 2J9ZB 3WKDA 2HPZA 3FMPB 4CN9A 4PQYA 2AX4A 4KWEA 3DL7A 2ICAA 5BN1A 1MG0A 3U3MA 2YY7A 2WJVA 5KYYB 1JE1A 5FQNA 1P1KA 4FWTA 1GKLA 2DMRA 4PCUA 3OLCX 2O0HA 1IUOA 5JJCA 3WRYA 4XGKA 2WYIA 1QYRA 1PHRA 1F8FA 1DFIA 3HK2A 1LVHA 1FSSA 5AW4A 3FCYA 4YRSA 4MAAA 1DAFA 4C3ZA 1Y6QA 2Z3WA 3L0ZA 1D04A 1T8TA 3MGKA 2H92A 4RD1A 3BSYA 1WPGA 4ZOEA 1WBJB 4X7BA 4C6TB 1XVLA 4QT0A 1FTWA 3DFUA 4LYHA 4NVRA 2ZRHA 5CLHA 4NCIA 4EB3A 1UF9A 1G66A 1H8HA 4BNVA 4RKQA 1CCWA 1E5XA 2VPYA 1GZ7A 1LZKA 1GGMA 2VP4A 2P2NA 4DKJA 1GKKA 1RKQA 5EWLB 3VDMA 3T1HB 5CVEA 1K66A 2ZI6A 3B12A 1Z73A 1JTFA 4QARA 2F4VB 2QTVA 2WJJA 3GNLA 4ZC8A 3GCDA 3FZQA 4NENB 1D07A 3IDSA 2CVOA 2UZAA 2I33A 1SBQA 2IZOA 1ZW6A 3TXAA 3WRYC 4OOEA 4DAEA 1UKCA 4L6CA 4ZXFA 3L4EA 4H9GA 1OBHA 4KQGA 4YLYA 1S7GA 5CX4A 1HUQA 1J2RA 2XOKA 3QOYA 1WVGA 1NI5A 3MOIA 4RPKA 3DOJA 4U39A 5KU7A 2QUAA 3WGYA 4C03A 3RHSA 1M0TA 2I3AA 1GT91 3GJ0A 3ZQ6A 4EJSA 2AYXA 1IEXA 2WYWA 2XNKA 4YRPA 4M49A 1JIIA 2QX4A 5EIXA 1RLTA 4UHDA 1JFSA 1JHMA 1VSUA 1E66A 2O50A 3EA0A 2VWHA 3LPCA 2X7HA 5FUVA 1ZRNA 2MYPA 2PUTA 1WZCA 4B1FA 3L9WA 2FSIA 1PSWA 4F7WA 4EM6A 1GUAA 2GTHA 4O4IF 2WT4A 1W0JA 4AMGA 4MV3A 5CVJA 4Z7JA 3MOSA 1DUIA 2PU5A 1EFHA 2PWYA 3KVNA 2OFPA 1IVSA 1G59A 1VHDA 4G01B 4MMYB 1GTVA 1DIHA 2PU7A 1L2TA 1UM9A 2JBHA 4U0JA 2ZJZA 3BILA 2WA2A 5E6UB 4BMCA 4DSAA 4HNGA 4Z7NB 4QM6A 1JHUA 1L4FA 4EJSC 3U7FB 4LMPA 4NYMR 3OTQA 3FWHA 3MJDA 1YMUA 4RV9A 3WIUA 5KC9A 1KGDA 1PD1A 3QFSA 2RAFA 3HUDA 3AJRA 3PPVA 4IIHA 5B3LA 5G41A 2Q8NA 4QU5A 1UBEA 1CIVA 3KVVA 3DWIA 1TK2A 3HCPA 4PW0A 1AHHA 2JVIA 3R24A 5DP1A 3OT1A 1ZMXA 1R50A 3OC6A 4KWCA 5LKAA 1JEYA 4FFVA 1W75A 1Y8QB 2MYUA 1NQOA 1UBOS 1Y8RA 1YDEA 2IE0A 3C3AA 3DDNA 3K5WA 1KI3A 4R2WA 2CVHA 5A1TA 1TU0A 2H1WA 3MGBA 4MR7B 1GFSA 2H1HA 4R83A 5AVOA 2CXXA 3RFTA 4L8YA 2QLMA 3FJ1A 2H08A 3ZCPA 1SKBA 2RC5A 1JL3A 4MWEA 1K6MA 3JWHA 3E1SA 1A9TA 4W8GA 4ZVRA 5ADUS 3HNOA 1RQLA 5DHPA 4BBZA 2MMGA 1X42A 2YYYA 4DXAA 2QGZA 2DKNA 2HDOA 5KTRA 1GCUA 3IO5A 3LUCA 2X5XA 2ZRNA 1RYNA 1Z62A 3LBFA 1C3XA 4Q3OA 4AN1A 3MQ4A 1MPXA 4HAIA 3HFSA 1RXUA 4YMHA 1JH8A 1Z36A 2GN8A 3BAFA 4PO3X 2JJ1D 5DTIA 1SWWA 2D2XA 1CR2A 2YZ7A 1TUBA 3A70A 2IXBA 3O21A 1UPFA 2ZIVB 2D1TA 3PEEA 1PFGA 3LQQA 3IULA 3W1VA 1PSZA 3OAAA 5BVGA 3K1YA 4EG8A 4RGYA 1W6RA 3L0IB 1OWMA 4G84A 3S1AA 1W5BA 4M8LA 4HF7A 3ZVKA 3MT0A 1QPZA 3ACCA 2VHQA 5I4KA 1N9GB 3K6JA 4CIDA 4ARVA 3K70B 2XMDA 4LOLA 2ESRA 2QZPA 2VWGA 3C24A 3R7WA 2YNMA 3O4HA 2NU7A 3T3OA 3BXEA 3A11A 4UBKA 6YASA 4JI0B 2GBGA 1UK6A 4DG8A 4OU5A 1WCXA 4HAOA 4KU4A 1IL0A 3N8HA 4WDRA 1Q7TA 2J0UB 2QQFA 3PWKA 3S2GA 4XJVA 3MCUA 1OLXA 4MS1B 3ZQ4A 2DLCX 3GL9A 4LMRA 2FFBA 5CNJA 4ZK6A 2PYIA 1ENYA 1IXZA 4JLVA 4PYNA 1AOXA 2BFDB 3RS9A 2AH5A 3BC1A 4MWOA 4ZOBA 4OK3A 3BMNB 3EW9A 1RJ9A 4JOSA 1RPZA 2BHRA 1HM5A 4NBSA 4WBNA 5JMTA 1CUAA 4E5MA 2H00A 3OJFA 5HW0A 4YRQA 2FHSA 5HRCA 1O03A 1R16A 2XNSA 2M6RA 2YNMC 2VJMA 5DLPA 1ZOLA 4RPJA 2YIVX 4N3BA 1CR4A 2JGDB 4HLUA 1PK7A 3MIIA 2Y27A 4LZWA 3SEAA 5HGXA 3U1BA 1T25A 2A84A 4CKXA 1Z5GA 4MKHA 5KYUA 3N7UA 1BROA 4AJPA 1JFVA 3TIIA 4KO4S 4XIYA 1QV6A 4LC1A 4U2CA 1B43A 1SULA 1KNXA 2CLHB 4FUTA 2FW7A 2UZ1B 3ANMA 1QZ3A 1KEKA 1DFHA 2XI4A 3VU1A 2OOSA 4L3VA 1HL7A 3WWYA 3E61A 3PUIA 1GTSA 4RWZA 4TT3A 4ZYVA 5H16A 3QVSA 5ALMA 3B9RA 3PNKA 3FUUA 4GRAA 4KG7A 3U7QB 3WVNA 4ASUD 3Q8MA 5FF9A 3LSYA 3GRAA 5CT5A 3W6NA 2R1TA 4ESVA 4Y7DA 4FJ1A 4A4DA 3DZFA 5ED4A 4ETNA 4HLUC 3PQEA 1LSUA 4I1YA 1G3IA 1A77A 1GA6A 3TIXB 2BJVA 4W1RA 4CFSA 3L1HA 5KYXB 4PZUA 3V6MA 2EJWA 4UUBA 3C3DA 5BOSA 1IOVA 3WAGA 1YL5A 3C7KA 4OHPA 1CRQA 1B74A 3ESQA 2HIMA 3T52A 3NKLA 5JSUA 2UYCA 4OTZA 1C8BA 1T9ZA 3LH5A 3Q0IA 1OT5A 1CB0A 4PZDA 1B16A 3Q41A 4EHBA 2B8JA 4F12A 2EKZA 2PIDA 5HUHA 5CT9A 5LDGA 4MUEA 4DR7B 1W8DA 2GNPA 3G79A 5GVRA 3UF0A 1TPYA 2OXRA 1SOAA 3CW8X 1OLSA 5J43A 4ROSA 1T0PA 3ORQA 2UUCB 4XH9B 2FF7A 3DL2A 1YS1X 3J81A 1W5FA 3WIVA 5CFPA 4BAUA 4XIFA 1T0HB 5TARA 2W2QA 2EZ8A 1T2FA 2XMRA 3CF4A 1DTWB 3D3EA 5KMGA 2I9PA 3Q98A 4U8GA 2C54A 1M2VA 4HNVA 4JC5A 3AWDA 4FR2A 2DVMA 5I48A 3KTFA 1C9YA 2YFHA 3NDJA 4YDSA 1LK0A 1TU4A 5E9QA 1TYBE 5EJIA 2F3RA 3EZGA 2PVPA 3FXAA 4I1OA 2LCQA 1BCSA 1UFRA 3PX3A 1NW9B 1I5RA 3IUQA 5DNAA 2QTGA 5I45A 3AL3A 2VNIA 3AZQA 4KQKA 2RHLA 4OB6A 4D0GA 5JATA 3CUSA 3WK5A 3U9SA 5MN5A 2ZBVA 3L7NA 1WETA 4IX9A 5AI8A 3RUAA 1MOQA 3P9ZA 3GRFA 3QU2A 5ESWA 3DAPA 4RU1A 2NAPA 5C1PA 1JLLB 3RGGA 3N2LA 4L1KA 3UYKA 1E6UA 1TF7A 1BQEA 5L3RA 1FS6A 3AP3A 4YR7A 5JC1A 2J3MA 2HFKA 3A7EA 3HO6A 2Q3LA 2FQQA 4HPJB 4QDXA 1ID8A 5FBHA 4EDHA 1XL1A 3CUYA 2PJUA 1MDBA 1QDLB 3WFZA 5C3UA 1CUJA 2K87A 2X3YA 3O1HB 2SCUB 3AMVA 5E6SA 4AK9A 1XR3A 2WAMA 2QYTA 3V00A 5BURA 2GB4A 3KXIA 2UVQA 2GMWA 3MF4A 2XWBF 4NICA 3HR8A 4FFRA 2QSJA 3JQ7B 1LRLA 1H1LB 2H4WA 1WKCA 1I32A 1PJQA 3FOWA 2O8DB 3U6KA 2NZVG 3PUJA 3HEAA 1E9RA 2YR0A 3VH4A 4EPWA 4P22A 3D7MA 4FMDF 3RYIA 5F9FA 3NLLA 1PE0A 4HL6A 4YB8A 5AK4A 5BMOA 4WOKA 1M6WA 2NTEA 4L7VA 1OZAA 2XKAA 1YR6A 3EIFA 4KN9S 1ZKDA 2EF1A 5TS3A 4RJTA 1VOTA 2ISCA 2VNAA 4O2RA 5KHLB 4FD2A 2J9XB 3H6KA 4OI2A 1DIRA 2WT8A 2X15A 2YHAA 2YWFA 4IXNA 4O2BB 3VVCA 4AKEA 1NQTA 1DX9A 4AT1A 3JX9A 3FKSD 2R8OA 5F1OA 3WA7A 2ERYA 2R6DA 4M9QA 3TCNA 3WE7A 1YUMA 2DWUA 5CGZA 1DV1A 1U7UA 4H7DA 4LSWA 2RGDA 1XLTA 1T2EA 2PSJA 5J3JA 3NBQA 3CKLA 3OUZA 2QSYA 4HN2A 5D86A 1I6WA 2JL1A 2WDPA 4AICA 3DBIA 4YV0A 2ZUCA 4KXXA 4XWAA 3U4AA 2C1XA 4CQNA 1KOGA 1JMVA 1GQRA 4QGHA 3K71B 5C80A 1MT0A 2PTGA 1JSRA 4B4OA 3VHQA 3A26A 2GZRA 2IPAB 3LVFO 5KAPA 3TMYA 1WCV1 3ODPA 3NBMA 1MZVA 4KNVA 4B40A 5BT8A 3TW0A 1VMDA 1W4BA 4R6XA 2V1XA 1SUPA 1E7MA 2ZZMA 1QIKA 5B7NA 5FRDA 2X5KO 2GUGA 3CG0A 4KQCA 5L7YA 1GNSA 3T1TA 4IDDA 4L28A 4AZ3A 1GUDA 3VKFA 2PQMA 1G8MA 1FFGA 4H7JA 4U7WA 2W43A 5TGDA 3SZLA 1U9JA 4DRXB 1Q95A 3TTXA 4D9IA 4G23A 2NSHA 1XLTC 3LXMA 2B6NA 5FOUA 3OE7D 2GZMA 1X7DA 5ETJA 5DCUA 5J23A 4TL6A 4X6LA 1OYOA 4AG3A 3E58A 5J4YA 4H3HB 5IYZF 2BBWA 2A9RA 2X58A 4JAVC 5K8CA 1E9FA 2JF0A 3EOZA 5LIRA 1BX1A 1JHRA 4NPCA 1WXQA 2C4UA 3TTVA 3BJZA 5AKJA 4KK3A 3G3EA 4B4WA 3PPXA 3RT9A 2OV2A 1RAAA 3IURA 3WQRA 5DK4A 1QH0A 1PGNA 1TE2A 4FEEA 4KDCA 4YMGA 5BV8A 4CF6A 1FRNA 3DP7A 4WK0B 2B4YA 4H6PA 2R47A 1AN0A 1OFGA 2Q62A 2ECPA 1FY2A 2G5PA 3SYTA 4OJNA 3ORHA 5IT4A 4X54A 3WHPA 3JAWA 1A04A 2II6A 1T0UA 2VRCA 3PGLA 3MJ4A 1JXOA 4LXIA 5ITVA 3A9WA 3A0UA 5FEUA 2PQ2A 3BFJA 5BNFA 1MT3A 3HRKA 3DSRA 3KUXA 4II7A 3QA3E 4RE5A 5BQ5A 1QU2A 1JSCA 1VCOA 3F6RA 3SGLA 4B3JA 4KV9A 5IH7A 1DWOA 2NZYA 4GQAA 1E3SA 1Y9ZA 4A27A 5CB4F 2ZJ0A 4CQLA 2F9MA 4CR7A 3UMYA 1GPBA 4TZTA 4A0FA 1NF3A 3SYKA 2YICA 2GXSA 4G1FA 3RRXA 1DO2A 3S2SA 2D00A 5CLIA 1G1AA 3IHKA 4KH0A 3R0VA 3PHBE 3LBIA 3KEOA 4RHXA 2VQSA 3Q7TA 2WP0A 4RKEA 1E4YA 4FIDA 3DYVA 3G0OA 4WLVA 3TXYA 4W8OA 1IJFA 1EGHA 2J3HA 3GFQA 1J8DA 2NO9A 3FBWA 1MV8A 2OHVA 2F43A 4C0AC 5DH9A 2XKBA 4YAWA 1II9A 1WX1A 4GNKA 3G9XA 2CK3D 2FR8A 3RIYA 4MA0A 4OXNA 3M6LA 4H3SA 3FHLA 4UCQA 3OD1A 5FH9A 4KUGA 1C81A 3DV2A 1B2RA 3T54A 2AFVA 3HTXA 3RH0A 4Q7KA 7GPBA 3CJQA 1YJ8A 3SDBA 3U19A 2DBRA 3P0HA 4RGQA 2A2ZA 3G17A 5CB0A 5CA0B 3L92A 4WRRA 2BEJA 4P4SA 4BNHA 1T4DA 4J4BA 1MO3A 2R8ZA 5JTUA 4OJKA 2DEUA 3HDQA 4JYMA 4BEVA 3I58A 3ANXA 3ORFA 3L4BA 4CV0A 1Y1SA 1R88A 5NULA 3V80A 1KGSA 1M1UA 2Q8PA 2YVUA 3DLAA 2JC3A 2NP6A 2DH6A 3HCEA 4H15A 5ALGA 5JNLA 3RS4A 1FNMA 1PFYA 3DKIA 4CCWA 2RJNA 4EGSA 2OV1A 2RAUA 4X61A 2FR8C 3F7TA 4N1AA 2OD7A 1RRVA 2MDTA 4G56A 1EEXB 4K6HA 5FWXB 1GNPA 3V8EA 4DV4B 3NOXA 1M6NA 5JADA 4WKCA 1SN7A 5A7FA 4ND6A 2JA2A 2KWIA 5H9WA 3CVUA 3EFOB 4II2A 2Y0DA 4JGIA 4MLCA 4PPYA 3W5SA 2RBKA 1JQEA 1BDMA 3M2TA 1EP3B 2ZSJA 3P9IA 4O08A 5F4BA 1KIMA 3BSWA 3RS2A 3EEQA 1CPYA 2IYOA 2XV1A 3WP1B 3L4BC 3ZY3A 2AMVA 3ASUA 1EBBA 1AKYA 4QGAA 5CCBA 4FE4A 2AI3A 3U61B 4C7OB 4JB0A 2SNIE 1YB4A 3JWJA 3KDPA 4IDCA 2X0KA 5SZIA 3V8QA 2BP7B 3QPUA 1QRDA 4PVCA 2HIHA 4TWAA 2BW0A 3RVBA 2COEA 5A4KA 1W76A 4W6QA 3ZDRA 1ZK2A 2IUEA 1CVRA 2WTXA 3CBGA 1YZHA 4MPDA 3REQA 1IBLB 2V4UA 1CIJA 2H3HA 3OSUA 2JRCA 4QULA 1MJGM 1OX4B 5JFTA 2CUTA 4MVJF 1GN8A 1HDRA 1Q7RA 3MGAA 4RA6B 2XUGA 4FEYA 2IK8A 3IGFA 1T9DA 4ITRC 1JDBB 4ABYA 5FOWA 1UBGA 3F6YA 1XXLA 2FPWA 3T4EA 4X64B 3W5JA 1KAOA 4KRXA 3U7GA 1WY7A 1OD6A 4P3KA 4TSKA 4YBZA 4D4KA 1I7PA 3GNTA 4EKNB 1ABEA 1T9KA 2FI1A 1JG6A 2ORWA 3H1PA 1OH7A 3F7MA 3NJ8A 3N87A 2PD4A 2ZSEA 3ENWA 3QIVA 1U2PA 4KQ1A 2J4CA 4AM8A 4O25A 5IU6A 4JJIA 3FPBA 2BISA 4KIWA 5DE3A 1DKUA 1S01A 2C9CA 2WU0A 2XNCA 1UP7A 2FEWB 4OM7A 1IB0A 3BXPA 4RUKA 1HFKA 4WXRA 5IUJC 3PFKA 4LBVA 2P6OA 4Y2TA 3B48A 5KHAA 3T3NA 1A7UA 3EMVA 5DMHA 3A1TA 1LPOA 3S2UA 3A1DA 4ZREA 3C8UA 2P67A 1HNXB 4NFSA 4OMFG 4QFCA 2IYYA 2Z6QA 1Z4JA 2C5SA 5DO9A 1L0BA 1WMBA 2X22A 5LP6F 1ETHA 2EDAA 2Q5CA 3LY9A 1W88A 3NH9A 4IM7A 5GTDA 3O92A 1E4EB 3DF9A 1Z37A 4KTVE 3G7UA 4B3RB 3D2BA 2PUEA 1YZQA 1T5LA 4A7PA 4R8KA 3C6QA 3FAZA 1J1ZA