4V0MA

Crystal structure of bbs1n in complex with arl6dn
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
molecule keywords ARF-LIKE SMALL GTPASE
total genus 42
structure length 166
sequence length 166
chains with identical sequence C, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0mA00
1RKBA 4P3YA 1S3SA 2OXRA 2V4ZA 1MO5A 1M7GA 2RKOA 1YZNA 1Z6AA 1ZD1A 5EUMA 1KO1A 2GBLA 1KIMA 3FOZA 3F8TA 1GM5A 4URZR 3G82C 1FQKA 2O8FA 2FJUA 3BAFA 3OEED 4KSBA 5HCIA 3LW8A 3ZVMA 2PEZA 1G8FA 2JLSA 3RANA 1AS0A 3AVWA 2Q0HA 1OYYA 1M2OB 1G7RA 2R2AA 5E3HA 2ZM5A 1T9HA 2CHGA 4IVPA 4B43A 4C2UA 4AKHA 3QXHA 1IAQA 1VYVA 5HTKA 4D81A 2RGEA 4MRVA 2EWWA 2XAUA 1EGAA 4IW3B 4LJAA 4XVRA 4MKGA 1G3UA 3DZ8A 3RYTC 1X1RA 1AIPA 1P9WA 2HLDA 4HLQB 4PFSA 1N6RA 1R10A 1XD8A 5KO2A 1W36B 4KFRA 4QL3A 1Q1EA 4AKGA 2X77A 1S8FA 1XNJA 2V7QD 3C15C 4IVRA 2Z4SA 1SVSA 4FCWA 1OKKD 4RZXA 4M21A 1M7BA 1NSTA 1U98A 2OE2A 2QTHA 3Q8XB 4F4JA 3FFAA 4GNKA 1OXVA 5DHFA 2C95A 2V1XA 2E87A 4C0JA 2GXSA 4AURA 3BFKA 4IXMA 2REXB 1DPFA 1E99A 1CTQA 2RMKA 3GLHA 3PUYA 2IBMA 1SGWA 4JL5A 5AJZA 4LBWA 2QPAA 4TTRA 3CF2A 5C46F 2W00A 4EJSB 4Y0AA 1HURA 2ZRGA 4JLPA 3X1ZA 4DVGA 1KSHA 3W9YA 2ZI4A 1KMHA 3BB1A 3X1DA 4MKHA 1N6KA 1EFRD 1R5NA 4PHTA 4EJSA 3LQQA 5BYKA 1ZRHA 5EQTA 4WZAE 2NO6A 1HE8B 1R5OA 1XZQA 4RD4A 4GPTA 3GJ0A 5J4KA 3DDCA 3MJHA 4V0OA 3J81k 2ANBA 1X3SA 3BD9A 3NXSA 4TMZA 4XWAA 2XJ4A 4CT4B 4ZKEA 2DPXA 1IJEA 5F98A 1UKVY 1ZJ6A 1ZIOA 2FEOA 1AM4D 3IHLA 3Q72A 4K46A 4ERNA 3RSOA 2A78A 2AKYA 4N0EA 4XWOA 4NTZA 1KTVA 1Z28A 5KNDA 4MRRA 4OI0A 2JIZD 2ZYUX 4NHOA 4F91B 1TF5A 4Q7KA 2NZ8A 1Z83A 4FMCF 4QM6A 3H2YA 2V8OA 1GL9B 1C1YA 3BS4A 3CX7A 1NMXA 2ZRHA 3ASYA 4FCVA 3BBPA 3P20A 4I81A 4N1AA 1AKEA 3TRFA 2I3BA 4RFSB 1W0KD 4E09A 2YWHA 4CYMA 2NMVA 2J0UA 4DLZA 1GG2A 4BLRA 1ESMA 1OLOA 1XZPA 3OHMA 4WZBE 4DBLC 4B3FX 5B30A 4I1OA 5GADl 3JVVA 5LD2B 1F2TA 2CBZA 2VP5A 8OHMA 4CEHA 5FBVB 2CL7X 3Q85A 3RWMB 4DKXA 1XP8A 2J0UB 3QBVA 4DIEA 4WA7A 4PPQA 1N5JA 5A4JA 3CUEF 5DLQC 2X19A 3AVYA 1II8B 3R7WB 4OQFA 4CEHB 2L0XA 3QKTA 3KDSE 4V0ME 1OH5A 2FSGA 1NG1A 5DISB 2YKGA 2WTUA 1IN5A 4DLTA 3FHCB 5JECA 3RWOA 1YZTA 4LSGA 3X2SA 4BZPA 4PQYA 4PPNA 1IXRC 1E4YA 3T34A 5H8WA 4HDCA 5H70A 2QE7D 1T6NA 4ZCIA 2I1QA 4B3DA 1T0HB 4C2TA 2CHQA 3MFYA 3K9HA 5EP3A 3GCGA 4BPBA 3DOFA 4P31A 4TQ9A 4CEJB 5H68A 4OJKA 2HDNB 3ZVLA 1FL9A 3IQWA 4JSTA 5CJ2A 3CPEA 3K9NA 4Q47A 2EW1A 4XSHA 4YXWA 3SN6A 4HDQB 1E2GA 3A8TA 1YRBA 4UKDA 4BASA 3DKVA 3NTUA 1XXHA 5AWFC 4B75A 4CEJA 4DB2A 1D2MA 2X1VA 2PLRA 2XB2A 1UDWA 3AVPA 4B2PA 1TX4B 5KTYA 1E9CA 2O8DA 3PCRB 2IL1A 2LKCA 3IEUA 1RVDA 2R9VA 5TMPA 1FP7A 3AKCA 1QHSA 1XXHB 1Q1QA 4ON9A 1XCPA 3I73A 3SBDA 1XTSA 5EP2A 5EE3A 1PZNA 4LBYA 4YDSA 1E2LA 4IOMA 1T3SA 2O8DB 4DHEA 1NLFA 4CRWB 1QHNA 2QTFA 3IQXA 3UWOA 2VP6A 4BZXA 5SZJA 4FIDA 1QHHB 2FA9A 1G5RA 5EE5B 4DWJA 4D0NA 3RSLA 2DB3A 4GBMA 4JKYA 1T8UA 3IEVA 1QRAA 3D8BA 4RD0A 5JEEA 4A92A 2ZSFA 4Z8XA 2VHJA 3D31A 2IS2A 1N0VC 2RHMA 4TN1A 2OEPA 3CNOA 4NMMA 5IDVA 1R0XA 4GI7A 1XJCA 4OQXA 2C5LA 1OFUX 2DWOA 4OI4A 3BC1A 3FMPB 2H18A 3SEAA 1NMYA 2CCGA 5GVSA 1G3MA 1Z0IA 2GTPA 5FI0B 1XMSA 2PMDA 4HI0E 4ACAA 4QM7A 2XZLA 1H8EA 3V4FA 4IFEA 2ERYA 3LBHA 2CLCX 4JMPA 3U2QA 1DOAA 5JZVA 4NYMQ 1UF9A 2Q9BA 5KNCA 1X8JA 1US8A 1YR6A 1OFTA 1MO3A 4OI2A 4HSEA 3IPYA 4BFVA 4D6PA 4RZUA 2ODBA 3QENA 4F4CA 1XPUA 2WWIA 1Q44A 1ZCBA 1CJMA 1NRJB 3JZMA 1P2SA 3RC3A 1DELA 5G3ZA 1GKUB 1M1YE 1GP2A 4QXAA 1Z6TA 2HCJB 2GXQA 2SHKA 5IK2A 3GJ7A 2XJ9A 1KAOA 3GLHE 4IRUB 4ARZB 1TMKA 2IXFA 3MMPA 4EQ6B 5FPKA 1GSIA 1TU4A 2Z43A 1R5BA 1IONA 4WIAA 4Q19A 3GEEA 4TSFA 4DLRA 3MWKA 2WICA 2PJZA 1BYIA 5TDHA 1W2GA 2EVWX 4DLSA 1W4AA 1W47A 2ZYVX 1CJKC 3K9LA 4KFSA 5TARA 3RS2A 3SNHA 2VIIA 2VRWA 1HA3A 1TL7C 4NDZA 5FPSA 4HAUA 3FHOA 1DVRA 1GZSA 2VL7A 1DEKA 1E2HA 1RJ9B 1W4RA 4KFUA 4A4DA 4TZ6A 5EE1A 4JLKA 2ZSDA 1AJEA 3P4XA 3CRVA 3TVDA 5KDDA 4JIMA 3U7EB 2EFHB 5LB2A 3QSYA 1RJ9A 1B23P 1UBGA 1VIAA 3W34A 4G5RA 3D6TB 2JJ1A 1ZNXA 3AB3A 4JBXA 1B0UA 2QT1A 4JLNA 4PAOA 4MA4A 4Q9JA 4EPTA 5SZHB 2ZUBA 3SQWA 1G7TA 1OXXK 2CE7A 5JBQA 2FFHA 2RAPA 3N2EA 1SXJB 2XTMA 1E2KA 3E5HA 3WMGA 1JI0A 4D2IA 4DLVA 5DYIA 3RC8A 1FOEB 4PZLA 2FZ4A 5C18A 4GT1A 2Z6VA 1MABA 1JXMA 2OO7A 2J59A 1SXJA 1P9NA 4M4SA 4YDHB 2HYDA 4HZUA 2VO1A 3VTKA 4POAA 4DSUA 5JS7A 2VBCA 2EFEB 3IHWA 3EXAA 1XX6A 3FWYA 5FBRB 2OZEA 3ZVRA 4EPYA 5IHPA 4Q7LA 2AX4A 4TWZA 2VP9A 3JZAA 2P6UA 4QG7A 3RAPR 1S96A 2FE4A 3QOFA 4HZUB 5CM8B 4KITB 1Z6YA 1CLUA 1KDTA 2GVDC 4CDGA 2WMNB 4RZ3A 2J3EA 5J4HA 4KLZA 2J46A 2VSOA 2P6RA 3U3OA 2PZGA 1VG1A 4ZCMA 621PA 1A82A 1R8SA 2V6IA 4URXR 3QE0A 1KSFX 2A30A 2GJ9A 5KU1A 5E4FA 4GDFA 1G9XA 2ZPTX 3CH4B 3I4LA 4NKRA 5JRJA 5F9HA 2IS4A 1XEWY 2G0NA 4LBZA 2I1VB 3VR1A 2CNWA 5KDOA 3QKRA 4G01B 1ZC3A 1GWNA 4PO1A 1J8MF 3HU1A 3W6OA 1NBMD 4MQBA 4S2EA 1G6HA 3QKRB 1FPMA 1YZQA 4RD3A 2ZSEA 3N70A 1E2PA 1ZNYA 2YNMA 3I5YA 3GLIA 1SULA 2QU8A 5AUNB 3M1IA 1J8YF 1I2MA 5FPTA 4PHHA 1GAJA 4IDQA 1LV7A 4JLMA 2ZE8A 4LV5B 2JEOA 1KK1A 1Z47A 4D80A 1LVGA 2HXSA 1U2RA 4DEXA 1D8TA 1K5DA 3GEIA 2GRJA 2IT1A 4PQFA 3DM5A 2ZXUA 5FUYA 4QGAA 1PVOA 2ZS8A 3BE4A 4IDOA 2RGGA 3CRRA 3DM9B 2XX3A 1T5LA 1G4UR 1TQ2A 1WMSA 1X6VA 3FVQA 1KI2A 2ZETA 2O0KA 5JWRA 1S3GA 4LOAA 2HT1A 2XOKA 3CWZA 4LHXA 3EZ7A 2D4HA 2ZYTX 3IDQA 3ZZ0A 4BFZA 5KPDA 4Q9IA 1U8AA 2AN9A 2F1RA 4GMXA 4IVQA 1R4AA 4Z51A 5JLJA 4BFWA 1KZGB 2VP0A 1TU3A 1CR1A 4PSVA 4LJ9A 3AVUA 3DKPA 1ZNWA 1QBKC 2OSBA 1QDEA 3T35A 5BYJA 1CEEA 5LB4A 1FQJA 1YKSA 3AUYA 4ILEA 1A1VA 1AS3A 4EFMA 1M6NA 2W2XA 1QVRA 4B3BA 4L9SA 4Z8YA 1G8GA 3WP0A 5C2JB 2V3CC 2C9CA 1GUAA 2NO1A 3K53A 3AVQA 2IEYA 3QIAA 1G8YA 2PT5A 3CX6A 4FCTA 1ZYUA 3WHLA 1WDTA 4AYXA 3UWKA 3UMRA 1ZU5A 4LHWA 1AN0A 1OIWA 3FE2A 3K09C 5E7MA 4ABYA 2CMKA 5AJYA 2AD5A 4NH0A 3VKGA 4LY6A 2LWIA 2A2ZA 2ZR7A 1OB5A 3VU9B 4JL8A 3RRNA 3CZQA 1ZC4A 4JBYA 3CKLA 5SZKB 2JLXA 2VTKA 1K5GA 4TYQA 2IEZA 4TSFD 3MGCA 3R9IA 3SZRA 3KKMA 4PTLA 4AYTA 2Q9CA 2ZAOA 5EZ6B 4YMTA 1T3LA 1GNRA 3P1JA 5FTLA 5J4LA 5EE0A 4NCIA 2R6GA 2QRNA 4TL9A 1Q3TA 1Z2CA 1VMAA 5DGXA 5K8TA 4B73A 4OYHA 4PC2A 3BH6A 1K8RA 2IYUA 2OAQ1 4LHVA 1P62B 1HE1C 2OHFA 3SJBA 4R2HA 3GLFB 4V0KA 2QTVB 2RH5A 3RRZA 2OCYC 3PITA 2ZR9A 1XMIA 1JQLB 1N6LA 1U0HC 1YVDA 4PZZA 4UXHA 4XTCS 3GLFA 3KQKA 2BM1A 2IYQA 4FINA 4K8OA 4XVQA 1EWRA 2ZI5A 3LFUA 4U00A 4PQRA 3TSWA 3TIFA 3WBKA 1P9RA 2WPDD 2PCJA 3WRYC 4OHZA 3EARA 2NO0A 4NU0A 1XU4A 1U8YA 4UXIA 3U3MA 4CIDA 1A4RA 1N5KA 4NP6A 2BMJA 2BCGY 1R0ZA 2FFBA 4JLVA 2G9NA 2OBNA 4G0NA 5FL7A 3U60B 1L4UA 3CB4A 1XB2A 4WXPA 1ZCAA 4D25A 3W5JA 1QHIA 1KO5A 1XJQA 3S1AA 3NEYA 4DLYA 1EFTA 2ZRIA 2QZ4A 2QSZA 1IY0A 1VKJA 3GQBA 4ZO4A 3ADDA 1EX7A 5AR1A 1WCV1 3E1SA 1YZKA 2RHDA 2IUUA 5IT5A 3AM1A 1IOZA 4TT3A 1Q3HA 4M1KA 2FG5A 2FFAA 2GK7A 2XITA 4TYPA 5CK5A 3B85A 3ZIAD 2R62A 5JHGB 4DUGA 3NVAA 3KFXA 2P0EA 3K0FA 4Q9KA 2IYSA 3BGWA 4XIGS 2NPIA 2J0SA 4L4UA 2HEIA 4TMKA 1I4DD 3D7MA 2BBSA 1UBEA 3L8ZA 2WWXA 3SR0A 3K0FB 3NH9A 5EZ5A 4TLAA 1A7JA 4C0LA 2LKDA 2ORIA 2FMXA 1G18A 4ZDJA 2Q3HA 3WMEA 3WMFA 3OIYA 2W6JD 4P33A 2QPOA 2GILA 3NC0C 2GCOA 4LYHA 3CLVA 3KZ1E 4P4SB 2QQEA 1E1RA 2ZR0A 1GFIA 1G4AE 2G1KA 3GD7A 4M1SA 3EZ9A 3BWDD 4RJLA 1NBME 4TTPA 5K8UA 4DRZA 2PLFA 4DZZA 1LTQA 2GHIA 4C3ZA 2OLKA 4KO8A 4R7ZA 1QHYA 2ZRAA 2WBLC 3H1TA 1JBKA 2J87A 1U81A 5EP4A 1NLZA 2AXNA 3IPXA 4F4IA 2ZS7A 2WVJA 2AD1A 2WWHA 4CW7A 2J1LA 1RRPA 5JS8A 1GVNB 2NG1A 2N1BA 2ZRNA 3LY5A 3K9GA 3GLIE 3SE0A 1E0KA 3H0KA 1E1QD 1SVIA 5JHHB 2YOFA 3TNFA 3RS0A 3K1JA 3VHXA 1OB2A 4BE7B 2BBTA 4OQLA 2YC4C 4A0FA 1J99A 3A4LA 3LBNA 1MR3F 1UJ2A 2BOVA 2F3RA 2CCKA 2WMOB 3KKPA 2IYRA 3MAAC 4QBHA 1KI7A 4TLEA 3EX7C 1EG7A 3GJ5A 2J0QA 3FPAA 3IIKA 3B6EA 4CF7A 4NL4H 3SJAA 1G3QA 1OKKA 3SHFA 1G3RA 3G5UA 2C2HA 3LXRA 3SFVA 1GITA 1KI8A 3NC1C 1NVVR 2XZPA 4Q1DA 3LWNA 3WYFA 4ZDIA 3FYHA 1S0UA 3GLGE 2ATXA 821PA 2Q9AA 4CZ2A 4KBGA 5BW8A 1ZUHA 2W0MA 4LBVA 2GJKA 3BRWD 1NN5A 1ZP6A 1ZM2A 2WIBA 2ZTSA 1IJFA 4MKIA 1HH4A 4OKSA 4UNSA 1WB9A 4URWR 3OEHD 2JLRA 4BFYA 5JJIA 3Q7QA 4DUGD 5JCZA 2PMKA 4P32A 3PIRA 1V5WA 3B1WA 4BRUA 3ZGXA 2MMCA 4TLDA 5UKDA 2JJ1D 2WHXA 2YV5A 1WA5A 2ANCA 2KB0A 3HR8A 4C4PA 3WXMA 1IN6A 2QAGB 2GF9A 3ADBA 5P21A 4Q4AA 5G53C 2ZI6A 2ONKA 1MT0A 2WZQA 4PPGA 3B9QA 1XDBA 4Q02A 4OQNA 3ZD7A 5TB5A 3AKEA 1J2JA 4JYBA 2GAAA 4PXAA 5A0FA 2JA1A 4XD7D 1W5SA 5CJPA 4AYWA 3I61A 1GNPA 2HJGA 2ZAMA 4Q7MB 5HZHA 2NOAA 2KI5A 2YC2C 3O8RA 521PA 2YWEA 2EYUA 3I8XA 1TNDA 5FOVA 4JLAA 3SYKA 3W90A 4H1UA 1W4CA 4ESHA 3CNNA 5HKKD 1RRGA 3OF5A 2OLJA 4AY2A 5JEDA 2QBYA 2RGDA 1QG2A 4EJSC 6Q21A 1CJVC 3N5CA 1AGRA 4DC9A 4LV8B 3T5DA 2W58A 1YU9A 2A5FA 4EFNA 4F7WA 1IM2A 5FBWB 1DS6A 3U44A 3VX4A 3C41J 4LUCA 4E22A 1LB1B 2QMEA 2JJ2D 4JSYA 3O8CA 4LPSA 2OFWA 1MV5A 1XPOA 4HAVA 2C03A 3QF4B 4ZCLA 1HQYE 2F9MA 4MYCA 4PSKA 4KXFB 4L9WA 4MH0R 2FEMA 1SHKA 1OJLA 3AKDA 3ZDQA 2C78A 2ZVPX 2CL6X 1EFCA 1NIJA 2JASA 2AK3A 3NIBA 1W0JD 5KNBA 2WSSA 1E9SA 3QF4A 4W9MC 4Q9LA 1N5IA 2CLDX 4NBSA 1E2NA 2O5VA 1XTRA 5L3VA 2QORA 4GZLA 2GZAA 1TUEA 4RD6A 4UNNA 5J5CA 5HZKA 2KBFA 1U8ZA 4QKQA 4TL7A 4RKFA 3ICEA 1G5TA 2KBEA 3N2IA 2GCPA 4QOSA 2RGBA 4YMWA 3LNCA 2BHRA 2C9OA 2V54A 2REOA 1W2HA 4PHFA 2B8TA 5D3QA 2O8EB 1MRNA 2VHUA 1MKYA 4HEJA 4WOPA 1EESA 3OIWA 3BB3A 4TQAA 4TQUS 4DDTA 5FFMA 3K70D 2J45A 4UJ3A 1FUKA 3C4JA 1E79A 4D4MA 2DR3A 3U5ZB 3THYB 3UG6A 2QP3A 2C99A 4BWYA 2QA5A 2VYFA 2DFLA 4C0KA 3ETLA 3VNVA 2C04A 2X2EA 5FOTA 3THYA 1CKEA 3REFA 3GLGB 1NY5A 1KOFA 4M8NE 4CEIA 3SU8A 4OQMA 2MMGA 4V0MA 3UIEA 4A2WA 3K0AB 4TTQA 3KJIA 2B8WA 5GJVC 2NIPA 1BKDR 1D6JA 2BIFA 3KUCA 4V0NA 2HV8A 2XSZD 1NL3A 1L8QA 2CE2X 3BH0A 4URYR 4FWIB 2F7SA 3VR6A 4HAXA 1IN4A 2KE5A 2O0HA 3UMFA 3TVTA 4BEBA 4RFVA 4C7OA 1SKYE 1DAKA 3NBZC 5B58C 1JPNA 3CPJB 4YQFA 4NE2A 2WWWA 2E9SA 2VLIA 1F6BA 3DPUA 1NP6A 4C0QC 1X8KA 1UFQA 2GKSA 4C7OB 2P2LA 4B47A 4E5UA 4MKFA 1EK0A 4C0BA 2ZRCA 1XXHE 1NY6A 2A5JA 2QE7A 1DTSA 4GP6A 1UEIA 1E9FA 3SS8A 1N2CE 5C4GB 2Z83A 3K0EA 2XXAB 5JSZA 1S9DA 1D5CA 3L0SA 3VMFA 3KQHA 2V1UA 5FL3A 4GP7A 2QENA 4DDVA 1JNYA 4KI0A 1P72A 4FN5A 4HAWA 4KYIB 3TE6A 2OCAA 2Z5FA 2XXAA 3CM0A 1HY3A 1PUIA 2P3SA 3Q7PA 5JWOA 2V55B 4G5QA 1NIPA 1WXQA 4NYIR 1P2VA 1DADA 2CNWD 4AKIA 3VR5A 2FF7A 2H16A 3QKSA 1KGDA 4X8LA 3GP8A 5B64A 1W44A 1N5LA 2O8BB 4JYCA 2D2EA 1JXOA 4PO8A 4Q1EA 5CLQA 3ZQJA 3BORA 4G3XA 2QY9A 3SJCA 3P27A 3BB4A 1YZGA 4HDOB 3NDPA 1E9RA 2O8BA 1CF4A 3VR2A 3GJXC 3MWLA 3HR7A 2IC5A 4RFSA 5DYGA 3LD9A 2A5GA 4OHXA 5AJVB 1JR3D 3A1WA 3ZZUA 1I4LD 3L2OB 1DBSA 3B5JA 4B34A 1M74A 3U6KA 2QPTA 4LDJA 3GEHA 1N6IA 2G88A 3KB2A 4JLOA 2QMUA 1KKLA 3TAUA 4F93B 4I1UA 4PO9A 2AKAB 2REBA 1II8A 5IK2D 2YOGA 3PFIA 1AK2A 2H1LA 1GIAA 1SXJE 1Y63A 1AZSC 1XD9A 4IOLA 4R98A 2FNAA 3NWJA 4DLUA 2PJRA 1NVUQ 1COWD 2D62A 3PUWA 4UQOA 3UMSA 4HLCA 1R6BX 1ANKA 4W7SA 4ASUD 5FR1A 3TK1A 1R8QA 5FOXA 2YZ2A 3PR1A 4QBFA 1OPXA 2JDIA 3NDBB 4QHSA 1MO6A 1KDOA 3PEVA 2AFHE 1A2BA 3KTAA 4IKEA 2HT6A 1N0WA 4IXNA 4ZIRB 4YXWD 4Q00A 4JVLA 2NGRA 2NQ2C 4M9SA 3SOPA 2N46A 1OT3A 3THWB 1G20E 4US0R 4LJ7A 5AJWA 3KTAB 3SQXA 2IUSA 3L8YA 3OZXA 4A8JB 1IXZA 2ZREA 1DO0A 2DYKA 2GF0A 1ZM7A 5L3QB 4EAQA 2ZRBA 1KY3A 4RVCA 1G17A 2JDID 3RRYA 4YMUA 3BFXA 4A8JA 3MWJA 4FD2A 1WBBA 2R6CA 2NO7A 5L3QA 4LYAA 1ZM4A 1VTKA 2ZE7A 5BWMA 5FUVA 1KI6B 2MSCB 2AFIE 2PX0A 2VQSA 3VQTA 1RRCA 1M7HA 2QG6A 2ZJBA 1HUQA 3EPKA 1D2NA 1GKYA 1E2FA 2BBWA 1BH2A 4LI0A 1QHHA 3LQRA 2F3TA 4Q18A 2ZJ2A 2MSDB 4Q1FA 4BRWA 5BN5A 1O3YA 3HJNA 4MYTA 3CR8A 1P5ZB 2V7QA 1OXUA 1XD2A 2PZEA 3V00A 4EPVA 2FPMA 1G16A 1XTJA 3F0TA 1CJTC 1Y3AA 3TSZA 3M4YA 1TF7A 1XRJA 2CL0X 4URVR 3QQ5A 4US2R 1E0AA 2D3WA 1C9KA 3TR0A 2WJGA 1W4BA 2UKDA 2WSMA 4CGZA 1DAIA 1TF2A 1FTNA 4HATA 4QFMA 4RD1A 2BVNA 2IYTA 4JKIA 4DT1A 4QJ4A 2W0SA 1Z0FA 4O0MA 1VPLA 5HE9A 4W5WA 2ZJZA 3B1VA 2RB4A 2IHYA 1ONBA 3TBKA 4N0DA 3EC2A 1XMVA 2EFDB 2BKEA 1KI4A 2B7CA 4DT1B 1E2IA 3GJ8A 4TMWA 1IXSB 5FL7D 3VR3A 4TMVA 3W8NA 4KVAA 3U61B 2XGJA 1ZUNB 1CR4A 3WNDA 1YQTA 4L8GA 4KVGA 1DAHA 1P2TA 1SVMA 1P4SA 3T61A 3I1FA 1XEXB 1VECA 1YR8A 5ELXA 2J7PD 3CW2A 3P26A 3BFVA 5JI2E 1W49A 2Q3MA 2AXPA 4PC7A 3DVLA 1DG1G 3Q5EA 3R9WA 3QBTA 5EXTA 1JQJC 1KK3A 3GMTA 3THOA 2XOKD 4EQ6A 1XEXA 4UNRA 3GFOA 3TUZC 4HB4A 1NVWQ 3ZS9A 5AUOB 4A6PA 2FWRA 2NZJA 4QNRA 3REGA 5L3RA 3FFBA 2QMHA 4AI6A 2ZU6A 4NCJA 2QAJA 1YR9A 1D2EA 1G291 4B2LA 2C98A 2Q3FA 1LF5A 2J7PA 2QM7A 1XCGB 2WKPA 2N42A 4K81B 3RS7A 2J9RA 2OFXA 1Q57A 3TQCA 4U5XA 2WJIA 2WJHA 5EE9A 3SI7A 5LPNA 3T1OA 2DCUA 4IOKA 3LLUA 1F5NA 1ZM9A 2IA5A 3HWSA 2QNRA 1DAGA 1E96A 3AV0B 1FFHA 4LV6A 3BK7A 1E2QA 4MYUA 4DCSA 4L5BA 1D9ZA 2E1RA 2ZITA 3HYTA 4EPRA 2GETA 4HYYA 1AKYA 4Q9HA 1GNQA 1XTIA 2UZIR 4M22A 2QM8A 4DCNA 4ACBA 1CS4C 2PEYA 4B6EA 4P4TA 2BEKA 4TLBA 4LC0A 1KYIA 2G3YA 3VX3A 1TAGA 2VP4A 5CIQA 4B2IA 3AVVA 3A1SA 1FX0A 1NKSA 2EU8A 1R0WA 4RCZA 3UKDA 2KSQA 2AL7A 4HZIA 4IEIA 4JS0A 1Z6GA 1GOTA 2F1HA 4BZQA 3I62A 4HAZA 1FX0B 1H8ED 3RRMA 3FB4A 1FUUA 5GJCA 1SVKA 3M6AA 4WBSA 1ZAKA 4Q4LA 5C4MA 3HPQA 5ANRB 3AF4A 2O8CA 2C96A 5KOYA 2JLWA 1MOZA 4UNQA 4XWKA 2H5EA 4M53A 1E9AA 2WIAA 3RNLA 3K09A 4D26A 2JLZA 4Y0VA 2O8CB 3KKNA 2R8RA 4BFUA 4HB3A 3PENA 2CVFA 3CF6R 1G64A 2ZSAA 2JATA 1NN1A 3C5CA 1JAIA 1GKIA 4DCTA 4A8JC 1VYTA 1GL7A 1LS6A 2CVHA 3FDIA 4QGHA 3OESA 1P2UA 2WM9B 4RY2A 1EX6A 1Z3IX 4XTRA 2IYLD 4NPHA 2B92A 2ZJ8A 4M1MA 4M1OA 1EXMA 2F43A 2ODEA 4O25A 3LW7A 2IW3A 2YWGA 4E03A 3THXB 2HF8A 4NCHA 4BECA 1ZNZA 4LHZA 4KCGA 4XSGA 3I3SR 2QT0A 3TW8B 1QG4A 5EXXA 1CP2A 3TGPA 1OFIA 3OFND 1QHGA 1HYQA 3W8RA 1UM8A 2PX3A 3QXCA 5LBIA 4R9UC 3THXA 4TYNA 4G1UC 1XJ0A 3TW4A 4Q21A 3A1UA 5KHOC 2WAXA 4BLQA 1PUJA 2ZI3A 3EPHA 5FTNA 2IK8A 1Z2AA 2ZI7A 3P32A 2RGAA 4PPFA 3GJ6A 2IYXA 3QPWA 2VSXA 2CHVA 4A2PA 4DLXA 2FPKA 4M9ZA 5GVRA 4C30A 3KXKA 1CJUC 1ZD8A 1RFLA 3MJRA 3FKQA 3A1VA 3HDTA 4I4LA 4JVNA 3M0EA 4QJ5A 1XWIA 4PAQA 1T4GA 3K0SA 1G7CA 2X2FA 3AKYA 3O47A 5DSZA 2F55A 4L16A 4QBGB 1NJGA 5G41A 3PV0A 2WKRA 2IWRA 4KBFA 5CDFA 1CRPA 2CDNA 5FTJA 1SXJD 3CZPA 2ZUCA 4A0HA 3EIEA 4FI3C 1Q0UA 4I1SA 5K8IA 4WVFA 2ZANA 3CRW1 4B74A 2ZRMA 3IUYA 3I5XA 3D3QA 4DB4A 4GL2A 1Q12A 2P5SA 1CBUA 2W83A 4OHWA 1BO6A 1KJYA 1VCOA 2BKUA 2DWPA 4C0SA 1G8PA 2HJVA 4LYFA 3SDZA 4NYMR 3CH5A 4MDEA 4MGZR 3QNUA 4F92B 5DH9A 4AKEA 2YWFA 3AF2A 3FTQA 4PSAA 3CO5A 2QI9C 3LAWA 2QL6A 3RABA 3R9XA 2GJ8A 1FTSA 2D2FA 3LVQE 2ZI9A 4P4UA 1L7VC 4LPKA 4W5JA 2W2VA 1RE0A 1P75A 1KDPA 2ZE5A 1LS1A 3BIFA 1KSJA 3I8SA 2O8FB 4B35A 4HB2A 4M1WA 4A9AA 1A5TA 3QXXA 1G21E 3A4MA 4GOKA 3DL0A 3VU9A 3W6PA 4H9GA 3ICQB 2AR7A 1GRQA 1KMQA 2XTZA 4M2LA 2ZRLA 4Z1MA 4QJ3A 3MG9A 1T5IA 1NBMA 4YMSA 2OUKA 3R20A 5DN6D 3L0PA 2GESA 4KHZA 3RLFA 4MDFA 2ONJA 2OV2A 3BXZA 3CX8A 2GVZC 3F5FA 4EPWA 4FMDB 2D7DA 3VFDA 3K70C 2ZRDA 1T3HA 1ZM3A 2BJWA 4U7DA 3IBGA 1NN0A 2ASEA 5DI9A 4YLGA 1BYUA 3NBXX 4QRHA 3RS4A 3EZ2A 3QVUA 3NEJA 5F2EA 2HCBA 3LXXA 3QVVA 3QPUA 5EP1A 1P6XA 2R65A 3EZFA 1RIFA 5BXQC 1UKYA 1UPTA 3OE7A 4A1FA 4DJTA 4QHYA 1C4OA 3WHKA 4XJXA 4DEYA 3R8FA 1G8HA 1U99A 4W5HA 2BMEA 721PA 3I72A 2IYZA 2JJ2A 3KQNA 1G6OA 1N0UA 4JJZA 4RD2A 4AWXA 2FU5C 3VAAA 1LFDB 1PV4A 3GLHB 4A15A 2FV8A 3C16C 4LJYA 4WXRA 3TSOA 2GWHA 2IYVA 4KSCA 2C77A 1HV8A 1E32A 1Z08A 4GSYA 3CWQA 1JR3E 2ATVA 3V9PA 3VKWA 3LO5A 4R71A 3HU2A 1EFUA 2QGNA 2FGKA 1ZIPA 1KMHB 4HLUC 4LGMA 3WYGA 3S1AB 2J7KA 1U9IC 2WJYA 4NYJR 1S2MA 3L0OA 2K5UA 5FTKA 3O8DA 5CM9C 3WYAA 5JWHA 1LW7A 1KI3A 5FBQB 1CULC 3EIHA 2GZHA 2P6NA 4TL6A 3LV8A 3EIQA 3CR7A 2QGZA 2OXCA 2VF7A 3EWSA 4RZ2A 4Q5IA 2D74A 3PG5A 1G7SA 1LNZA 1VYUA 3K0CC 1NF3A 2G6BA 1E0SA 2W6JA 3HYRA 5IF9A 3C7KA 2GEDA 2DWQA 1KAGA 4LJ5A 3W5IA 4AG6A 3UANA 2EQBA 2IXEA 3SHWA 3ZLJA 3UPUA 5KDLA 2FN4A 4NZYA 1FMLA 5DIFA 3T1VA 3ZQ6A 3AQ4A 3ZH9B 1AZTA 1UDXA 1WQ1R 2QN6A 4Q66C 1ZU4A 1ETUA 5FR2A 1PJRA 2HLDD 4ZI2A 1AS2A 3U3KA 3LRPA 1TEXA 1E2MA 5DN6A 1ZBDA 3U7GA 1UBFA 2F1IA 2IUTA 4P4SA 4JBWA 5D3MA 3AVTA 1I2DA 2DBYA 5CK4A 4TL8A 4AD8A 1W48A 3EWAA 1F2TB 3K0CA 1E1QA 1R0YA 1Z0JA 5D3MB 5AUQA 1N25A 4KV9A 2AHOA 3B60A 1N6OA 3L82B 4PZYA 4C0HA 1CR0A 3PUXA 3TMKA 1Q20A 2ZUDA 1S1MA 3T15A 1SXJC 1BIFA 1HEIA 4A6XA 5LDDC 3R7WA 5E7JA 3A36A 1YHNA 4NONA 2CJWB 2TMKA 4QBIA 1WBDA 4A82A 1KKMA 2JGNA 5CDFE 2X8AA 2ZJ5A 2HYIC 2WKQA 1F2UB 1EFRA 4BLPA 1ZW6A 2EWVA 2JAQA 2CJWA 2XNSA 4X8OA 3NHAA 3BERA 2QMOA 2ZSBA 3CBQA 3KJGA 5FI1B 3A6PC 4FMCB 4IDPA 4HB0A 1YZUA 4DSTA 2FFQA 1NNEA 1F2UA 3X1WA 4GZMA 3VHLB 3IILA 4BLTA 3T1TA 1CR2A 5EUQB 2FGJA 1E6CA 1KJWA 2KJQA 1Q21A 2GXAA 1QVAA 1BMFA 1JEEA 4M0LA 2I4IA 3KQUA 2ECKA 3W3ZB 4TYWA 1IQPA 4R2IA 5HCNA 5HE8A 1GRNA 2BMDA 2ZE6A 1XFAA 4PANA 2V9PA 4MYHA 2H17A 4Z1MD 4B33A 2ZROA 2C9YA 1KK0A 1W5TA 3W6NA 1KI9A 3LVRE 4MUAA 4ZDWA 3RHFA 1S1CA 3ZIAA 4JLBA 4EDHA 3TQFA 1K6MA 4YC7A 4QNMA 1W0KA 4QC2A 4PC1A 5DO9A 1FP6A 2QAGA 1MRSA 2VHTA 5FPHA 4OK6A 2FX3A 4LK2A 1E98A 1GILA 2EFGA 5E95A 4GOXA 4Q1AA 2PL3A 2DHRA 4IDNA 3L43A 3QJYA 1YE8A 5L3SA 1XF9A 4D4KA 3LDAA 3C5HA 1GDDA 1TQ6A 3LA6A 1Z8FA 3DEFA 4ASUA 1YZLA 4MUBA 5TY0A 4EUNA 4Z54A 3OAAD 1E9EA 1OXSC 2IYYA 3QG1A 4EKDA 5L3SB 1AA9A 3Q9LA 2H8KA 1VCNA 2ERXA 4QHTA 2H57A 5BN3A 2WPDA 3K70B 1VHTA 2WJVA 2ZYWX 2OESA 2QAGC 1OIVA 1J90A 4OJQA 4Q48A 1E9BA 1KI1A 3CRMA 2OILA 2C8VA 3K8YA 1PLKA 5DE3A 3O8BA 3R8CA 1Z6XA 3KKQA 4H1VA 1US8B 3PUZA 3L0IB 1E0JA 2NPFA 2VA8A 3AUXA 2XSZA 3A1TA 3HPRA 1UKEA 5FH9A 3DHWC 3OAAA 4CVNA 2BDTA 5KSPA 2GJSA 2XZOA 3TR5A 4AK9A 1WRBA 1XEWX 3EAQA 3GJ3A 4HLUA 4M1YA 3KQLA 1Q22A 2QQ0A 3B82A 2BBOA 2HF9A 2GK6A 2QP4A 2ZQ5A 4UJ5A 4LJ8A 2D7CA 2GEUA 2CXXA 2FSFA 4ARZA 3IKJA 4B6FA 1NVXQ 1M8PA 2EFCB 3AGPA 4LZZA 2W2TA 2PBRA 2O52A 1DE0A 3UK6A 3B8HA 2VF8A 3PEWA 4ESVA 1X1SA 5EXPA 3SFZA 1JPJA 4MGIR 5DNYB 2UZ3A 3PXGA 4GMDA 3B7GA 4Q03A 2BMFA 3GFTA 5B57C 1JALA 1OYWA 1ZMXA 1DAFA 3NH6A 1VG8A 2ZS9A 4PHGA 2O8EA 2OM2A 4JL6A 2FSHA 4DIDA 4ITRC 1ZVQA 5AK0A 2GNOA 3EA0A 4NCNA 1KK2A 4US1R 2HUPA 2QP9X 1VIYA 4M9QA 1W7AA 4TMXA 4DLWA 3PEUA 2A9KA 2WWFA 2JIZA 5IRCD 5TVKA 2FZLA 1JECA 1H65A 2XEXA 4Q4JB 5J47A 4ZKDA 3ADKA 4BFSA 3LX8A 4DDWA 5KSYA 2RGXA 3ONWA 1U90A 3H84A 4XD7A 5JI3E 3MUFA 1N6PA 3IIMA 5J4VA 1H8HA 5CITA 3GLGA 4CEIB 4Q4JA 4AG5A 2ZJYA 3K0AA 3KFVA 1CIPA 1E2DA 2ZJOA 3X1XA 2IYWA 1SZPA 2IF2A 3SBEA 1Z0DA 4OHYA 1L2TA 1KO8A 1P7CA 1KY2A 2B21A 3CNLA 1D9XA 2ZRPA 1XTKA 5KPJA 1KNQA 2ODNA 3ZZTA 5GJWC 2BCJQ 1Z5ZA 1AGPA 1MABB 4PC6A 5BN4A 3EPJA 5KSOA 4KODA 3MSXA 5HKKA 4LHYA 3FKSD 3RS5A 221PA 2OCBA 1W1WA 4KAXA 5FUWA 1NN3A 1NLYA 4MGKR 4JJKA 1OHHA 1UKZA 2BEJA 4HUTA 2F9LA 1J70A 1FMJA 5B2ZA 3P4YA 4B3CA 2YVUA 3T5GA 5JSZB 4A2QA 3MRSA 2AWOA 2QRZA 4PR0A 3KUDA 3PVSA 3TAHA 1HT1E 4OL0A 2B7BA 3TUIC 2P67A 2VP2A 3QXSA 4LJ4A 4Q7JB 3VKHA 2R6FA 421PA 2QUZA 3I32A 3CRQA 1SVOA 3GFPA 1GL6A 5G40A 2G0TA 4GFDA 1DG3A 1XBTA 3KXIA 4JZKA 2O0JA 2FDCA 5JMTA 3QEJA 2A5YB 2CCJA 3QKSB 3H86A 5KSZA 2LCFA 3QKUA 1T8TA 3MD0A 2DFNA 2BC9A 4RCYA 4IJMA 4Q4HB 2G83A 3FMIA 1IY2A 2ODWA 4B76A 3PQCA 5CB6A 3A37A 4D0GA 2RCNA 4V0LA 5G3YA 4CT5A 5AJXA 3X1YA 2YYZA 1OFHA 1FNMA 4Q4HA 1OF1A 4ZPXA 4JT4A 1KSGA 4C9BA 3GLIB 1TQDA 2WV9A 1SVLA 3ECCA 4MRNA 1EWQA 4GRAA 1P60A 3OEEA 2PCLA 1MH1A 4TMTA 3ZS8A 4DDUA 2GJAA 3AF3A 4BUJA 1VCIA 3ZYCA 4V03A 1NJFA 4B71A 5DI3A 2IS6A 5C1BA 3T12A 1E1RD 1TADA 2OAP1 1OV4A 3AH8A 1HTWA 3WRXC 3BOSA 1JB1A 3TJZA 2BV3A 1EFHA 2ZIAA 4LCBA 5FOUA 4BLSA 3BH7A 5JJLA 5JCPA 2JLYA 1KO4A 2ZVQX 4MRSA 5DI3B 2ZJAA 2GEVA 3ASZA 2XB4A 1ZINA 2BM0A 4OI1A 5KYKA 1E3MA 1NVVQ 4HLDA 1Q1ZA 2GCNA 4II7A 3WNBA 4FMDF 2EYQA 3E2IA 1JJVA 3U3RA 4DXAA 1P61B 2ZRKA 1IHUA 3AF0A 4XOIA 3AP3A 4N3NA 1S4QA 1PLLA 2R6DA 3ND8A 4IEEA 2MSEB 2Z0MA 3MCAA 3CF0A 1LY1A 3Q3JB 5FOWA 5JFGA 2GAOA 2J0VA 5AUPB 4Q1BA 4ZIRA 4KFTA 5HR5A 2XNDD 3T1QA 3DOEA 1AQUA 3OIUA 5F3WB 2PZFA 4NYJQ 3HP1A 3THWA 4DCUA 3UATA 4QGFA 1KJZA 2P65A 3KKOA 1G3IA 4IOJA 4ZDKA 4Q01A 3ZVNA 1Q1BA 4MGYR 4HAYA 4M1TA 3IO5A 4XH9B 2Q21A 3ND9A 2QEQA 4P0TA 2R44A 1FW6A 2H92A 2CEAA 3W3AA 1J7KA 1KI6A 1E2JA 3B1ZA 4RSGA 3TUJC 3SYNA 3AEZA 3OIVA 3EA5A 3LLMA 4KYUA 4RKEA 2XTNA 1FZQA 1E94E 2RGCA 1OIXA 1G5PA 4X8MA 4A36A 4FW9A 1X8LA 3CONA 2QROA 4EIWA 1WP9A 2VSFA 1H8HD 4MRPA 1VHLA 1OE0A 1XD2B 1X86B 4OK5A 4L15A 5KUTA 2UVQA 1OH6A 1R7RA 121PA 1LF0A 4EFLA 1NMZA 2ZEJA 4IDHA 4FWTA 2GDJA 5CIWA 1VDZA 5H1YA 1WF3A 1OW3B 3ZJYA 1RPZA 4AIIA 4C0AC 2PT7A 5FOSA 3QF7A 3NBYC 5DHAA 5FPYA 3U3JA 3FKSA 3WNCA 1U0LA 3ADCA 4KLNA 1IBRA 2GA8A 3DMDA 4O3MA 4KJZA 1DO2A 1M34E 4MITA 1IN8A 2W6ID 4DCVA 1COWA 1DARA 1S9HA 4X8HA 5GJBA 1JR6A 1E69A 2WOOA 5CYOA 2B6HA 4D4LA 5JJKA 2G77B 3QY0A 2XNDA 2J5XA 1JEDA 1NG9A 4EPXA 1JAHA 1R2QA 4LC1A 3NBFA 1T91A 4IFBA 3QUSA 4URUR 3FMFA 1RW4A 1XMJA 3Q5DA 3QEOA 1UEJA 3KJEA 3IO3A 2KWIA 4PX9A 1CRQA 4JLJA 2GXUA 5SZIA 1KDRA 1ODFA 1UAAA 2JLVA 3CIOA 3FGNA 4LYJA 2IWHA 2ZRJA 1N3BA 3OEHA 4B3XA 4D0LB 4TYYA 5J40A 2WWGA 1N6NA 1NI3A 1UADA 1Z06A 4O2RA 3GLFE 4J0QA 2VPPA 1YR7A 4Q1CA 1L4YA 2J41A 4F38A 1CU1A 2RGNC 5BQ5A 4GOJA 3MWYW 3DO6A 4TT3D 2D06A 1HT2E 2ZRFA 1SQ5A 5CLLA 4U02A 1W36C 2H7VA 4B44A 4BQSA 3IGFA 1TTTA 3ZD6A 1GTVA 2VH5R 2GCOB 2GZDA 3WBJA 2PH1A 4PC3A 1WE2A 3SC3A 1U0JA 1HQCA 2CLSA 2P5TB 5A5GA 1JR3A 1XEFA 3B1XA 4A0GA 2YINC 5CB8A 2BWJA 3NG1A 4OBEA 4G5SA 4BFTA 5JRZA 2DY1A 4A0RA 4FXPA 3UG7A 1KZ7B 1QZXA 2BJVA 2RGNA 2Z4RA 2YOHA 3TLXA 4D82A 3U6BA 1E4VA 2JLQA 4BGDA 1BOFA 1U94A 2A5DA 2OCPA 3EASA 1QHXA 1XCMA 2Q6TA 2OFOA 1Z0KA 2NO9A 2VEDA 3GJ4A 5J4YA 1I4TD 3KB1A 1DAMA 2A7QA 5TXGA 4I99A 4WZ6A 1NSFA 3VNUA 2ZU0C 5L8VA 2IHBA 1SHZA 1SKYB 1TEVA 3U7HB 3A58B 1II9A 3RVBA 3SYLA 3EG5A 4TZ0A 3KX2A 2YHSA 4KU4A 4NYIQ 4UNPA 3TKLA 1XPRA 1ZUIA 4LRWA 4YMVA 3F3YA 1G1MA 3KXLA 4XVUA 5FTMA 3WP1B 1W0JA 1SVWA 2OT3B 2JLUA 4JLDA 2V6JA 1VG9B 2VHCA 3A4NA 3VR4A 3U7FB 3EZ6A 1U9IA 1CXZA 3DZDA 3B2EA 4TLCA 1A2KC 3QXJA 4QGGA 1YJ5A 3G0HA 3RDPA 3V4RA 3CPHA 3I92A 2FPLA 1KNXA 3B1YA 1Z0AA 3B78A 2HXYA 5F9FA 1W46A 2QSYA 4G5GA 4S35A 5FUXA 4O2LA 4JT2A 3SJZA 1IN7A 1RYFA 1G41A 3KJHA 2F43B 3QPVA 5FBLB 4LJ6A 1F48A 2OBLA 2JJ8A 4DSNA 1G19A 3OFNA 2JCSA 1W36D 5EXSA 3WY9A 3QI2A 3AF1A 4Q4AB 5LD2C 3PJRA 3C14C 3HU3A 2WJJA 4D4JA 3B13B 1E79D 4JVSB 2FOLA 4M9XA 1OH7A 2R6AA 1II0A 1OSNA 1E9DA 3B9PA 1P3JA 1T0JB 2WWYA 4DSOA 1BS1A 2FH5B 2WOJA 3H4MA 2VHQA 2IXGA 3RS3A 1V43A 2FSIA 3AP1A 1ZD9A 2Y8EA 3DMNA 2F1JA 3PEYA 3AVXA 3UXMA 3EC1A 4LWZA 3E70C 1O87A 4OHVA 4ZI3A 3LH5A 1XTQA 3FMOB 4JVMA 5CYPA 1Z63A 1TQ4A 3AP2A 1JJ7A 4WAUA 1IY1A 4YONB 2NTYC 1P73A 1RZ3A 1TUIA 1AQYA 4BLOA 1KHTA 2W6IA 1UBCA 2DFKB 2ORVA 3JVUA 4LX0A 2YJTD 1F3OA 3TH5A 2IF0A 1E2EA 4BFXA 5HPYB 1OXTA 3U4QB 2A3RA 1OHHD 3IIJA 4HUQB 4I1VA 4NCKA 2CK3D 3T06B 4ZV4A 2QBYB 1VCMA 1RYHA 3FHTA 3OE7D 1ESNA 1MO4A 4E07A 1Z29A 2WSSD 3NHBA 5EJEA 1VG0B 4FMBB 1RC8A 4B3GA 4PAMA 4AC9A 1SKQA 3U4QA 4HUQA 2AWNA 1YRAA 2GBLC 4IHQA 1GRRA 2WAYA 3QG5A 4V02A 3U44B 2IS1A 1Z22A 3MLEA 1BMFD 1PLJA 1F60A 2OBMA 4BEJA 3EPLA 2CK3A 2F6RA 2AK2A 2OG2A 3C8UA 5E7IA 2IX3A 3EW9A 3LX5A 3NKVA 2ORWA 3AGQA 3PUVA 5M04A 1Z07A 3AVOA 4UXJA 1OH8A 1ELOA 1RRFA 2DFTA 4WW0A 5TV2A 1N6HA 1KO7A 1FNNA 3IBYA 1TPZA 4OK3A 1QF9A 4G5OA 1NKTA 2G1JA 4B32A 3BJIC 1DAEA 3KL4A 3LBIA 4B48A 3GPLA 5K8LA
chains in the Genus database with same CATH superfamily
5EHQA 3VU1A 2N1MA 1U5AA 5FEUA 4ODIA 2YWRA 4EELA 1ZFNA 2OXRA 2V4ZA 4RK1A 1QH0A 3FDFA 1QNFA 4RX1A 4JC4A 4F2PA 1IWBB 1JBQA 1KO1A 1BE8A 2GBLA 2I65A 3ZDEA 3F8TA 4MI3A 2NV6A 4NEQA 3GJSA 1NAHA 2PZLA 3E7DA 2PEZA 3RSQA 4L6CA 1AS0A 3SIRA 2Q0HA 4XW2A 2AUMA 1PE0A 3K20A 5D86A 2XQFA 1Q0QA 2ZM5A 4ECEA 2J0EA 2CHGA 4PHCA 2L18A 4AKHA 3DB2A 1ZI9A 1HFWA 2Q49A 3CEAA 5HTKA 4DMCA 4BYMA 3MCVA 2XAUA 3O31A 3COYA 1RAGA 1WPQA 2GYUA 2O2GA 3CLKA 5A06A 3IHKA 5EHNA 1U7DA 1JAYA 5EG5A 2FR1A 2QRVA 4WKPA 4HYEA 5KO2A 4HLQB 1XD8A 3LCJA 1BH6A 1A4IA 3DDOA 4YCJA 1HC7A 2FP3A 4EW6A 4REMA 3MS7A 2XCLA 1XU7A 5E7QA 3ZKWB 2V7QD 2VHZA 3C15C 4IVRA 3HL4A 4ZU6X 5G0WA 3VKUA 1KYTA 2OE2A 1U98A 4F4JA 4LCEA 2DBZA 1XV5A 3N2ZB 4K9OA 2FMUA 3USCS 1VIVA 2C95A 2BELA 1TVMA 3PGLA 1CX9B 2O8VA 4C3OB 1A2OA 4I9GA 2REXB 4UTPA 4CIWA 5DLEA 1E99A 5E0KB 2DBVO 2D3TA 2RMKA 2C2ZA 2Q7OE 3FOWA 5ISMA 3LXMA 1CF2O 4KMMA 2AZDA 1QP0A 1ACMA 4K03A 4TV8B 4JL5A 1VIDA 2QZSA 4L57A 2W00A 4QDOA 4Y0AA 1E20A 2GZ1A 3DOUA 2SKCA 2ZRGA 3GGCA 1Q19A 4Q0MA 4JLPA 1XA3A 4CMBA 1WXIA 3EH1A 1CUIA 1WXHA 1Z4LA 1IVSA 4LOKA 3KB6A 3IP6A 4MA5A 1I14A 4Y6QA 4BKOA 3ROFA 4B3RB 3JARA 1EK1A 5BYKA 1ZRHA 3VDMA 2A9JA 4MQ6A 5TQ0B 2X5OA 1XZQA 4FJ2A 4E94A 1MAWA 1DEHA 3GJ0A 5J4KA 3DDCA 4MVYA 1RBQA 1FMCA 2XMCA 4BRZA 3FJOA 4X92A 3NXSA 4TMZA 3JQPA 4JMLA 3H05A 4XWAA 5BMVA 5DP2A 5CVEA 7MHTA 2ZSHA 2B8EA 2C2GA 2QS9A 2ZB4A 5F98A 2CC2A 1Y1SA 4XUDA 1ZJ6A 4YN3A 1JMVA 5H9WA 1XVLA 1AM4D 2ES4A 1U7OA 4ZU3A 5T3YA 4ERNA 4KXYA 3MWFA 2XA2A 4NHEA 3WLJA 4C4TA 3M34A 3RD5A 4J0EA 3IL2A 1NHGA 4MRRA 1MEEA 4OI0A 3NT4A 4DMRA 2PA3A 3RSZA 4EX6A 3D4PA 2ZYUX 1TA9A 3AZQA 4NHOA 4TVKA 5E3JA 3OTOB 1TF5A 2V97A 3PFWO 5JH7B 5DNCA 4FMCF 1YC5A 1Y34E 2X23A 2YYSA 4EL5A 2WVGA 4UZEA 1C1YA 1LDNA 1NMXA 2ZRHA 3ASYA 4NWIA 5DM2A 4D8VA 2JGMA 1O7JA 3T9BA 1HG0A 2HPVA 1A9SA 3DDUA 4JHLA 4B17A 1XROA 2YWHA 5BV8A 2J0UA 2J4DA 2OGUA 3EF1A 3L49A 4N03A 4DLZA 3L1HA 4WZBE 3TL2A 3VPXA 3I9JA 3Q2KA 2GD1O 3JVVA 4EGSA 1PT9A 3VKFA 1CUUA 4CEHA 1CEYA 1E3DA 2CL7X 3GBVA 4CL8A 4J43A 1GQSA 1VFPA 3DONA 2BF7A 3NDIA 1R15A 4I19A 7ADHA 1UWCA 4Q3AA 2VCYA 5COAA 4KSYA 4DIEA 1N8TA 3GXBA 3KU4A 1XCOA 3Q2OA 4R3WA 4PPQA 3DCYA 2DLCX 1TM2A 3AVYA 1RQPA 3NBUA 3NLLA 4YAOA 2L0XA 3QKTA 1YNSA 2VYCA 4K2HA 2VH2A 3AEQB 3M89A 4NQRA 3QVSA 4NABA 4H7KA 1Z7GA 5EUCA 3PKZA 2YKGA 4WFQA 4DLTA 4YJGA 5CA0B 1YZTA 2VTEA 3GFQA 4LSGA 3OBIA 2YDXA 3QKIA 4PQYA 4PPNA 3AOEA 4OYLA 4Y2HA 4F2WA 1KU6A 2BLLA 1T0HB 1C8LA 5AM0A 4C2TA 3F98A 2RHRA 4ZA2A 3K9HA 4QGSA 3JD2A 4R7TA 4YJGB 3QSGA 3SS7X 3GCGA 4UE2A 3DOFA 5EZYB 2FOXA 4CEJB 3ZVLA 3AI2A 1UP7A 4MWTA 4BFLA 2A9FA 2QD3A 2GK4A 3AEUA 1PHPA 5AKGA 5A4KA 5KINB 1KOJA 3IQWA 5CJ2A 3K9NA 1W59A 4ILKA 1T5BA 3A25A 3HEBA 1Y7TA 1YRBA 4Z1OA 3RBVA 3DKVA 5AQ1A 1XWWA 4G5XA 4BV8A 2J30A 4CL2A 4CEJA 4C4XA 3I9MA 4RIIA 3W5UA 1O9HA 1TX4B 4B2PA 1P4AA 4C7KA 3FM9A 5B6IA 4CKEB 3PCRB 5FF9A 1I3KA 1GQFA 2LKCA 3UAVA 1TD1A 3IEUA 4INJA 5TMPA 1FP7A 1B6SA 3AKCA 1QHSA 3LFTA 4HTFB 5EN4A 1DRWA 3T0IA 5FAKA 1IFXA 3QFHA 2JCBA 3TYXA 3AR7A 4JLSA 2V74B 4QECA 1MC8A 3CLRC 1T3SA 4IOMA 1LI5A 5D5QA 3A6JA 1NLFA 5KI6A 3UEOA 4CKEA 1E3WB 4XIIA 4CRWB 4E2ZA 1QHNA 2KPOA 4RF2A 2QTFA 5D6OA 3IQXA 3WLNA 4E5MA 2I6UA 5BUSA 2W6CX 2VP6A 3IBCA 4MQEB 4X66B 3UC9A 5LP6F 4BZXA 1CEXA 1IC6A 3WI7A 2HDHA 2B5WA 4D3XA 5ENZA 5EE5B 3D3NA 4TV8F 5FFFA 4L2IB 3PLRA 3W5DA 2FKAA 4MQEA 2B1GA 7AT1A 3IEVA 4RD0A 5HJEA 3QHPA 1BQEA 5IM5A 4A92A 4Z8XA 3OKCA 5AESA 1F8XA 4C20A 3S29A 2I4RA 4TN1A 3E0QA 5FHQA 4LFCB 5KYNA 5CB4F 3CNOA 4NMMA 3EQ9A 2P9ZA 2YNMD 3X3HA 3ZK8A 3DE5X 4OQXA 4HAIA 4OLHA 1TT5A 2ZZNA 3W4IA 1H2AS 1LRJA 3PC8C 2CMGA 4JH0A 4AX4A 2CCGA 3DFIA 2G7MC 3RRFA 2E55A 3IALA 5F5XA 5GVSA 3WNVA 1BS2A 1BXGA 2WT9A 1JG1A 4HI0E 4IFEA 1AKTA 3UOWA 1DOAA 2FXVA 2JD2A 1P6UA 1UF9A 1TTPB 4LY9A 3VR4H 3QU9A 2XA1A 2HW8A 2V7VA 1QJCA 3C0KA 1H3NA 3T7SA 3TLYA 1QCYA 1UJBA 3IPYA 3ZUGA 2P6OA 1UC5B 2GPSA 5H3CA 3SSNA 1XPUA 2CVOA 5M29A 2GCGA 4PGAA 5EPEA 1J9GA 1RPNA 1CJMA 3PQ4A 1Z6QA 1DKNA 2J3MA 3GZNA 4DYDA 2Y0PA 2UDPA 3PNPA 1JT2A 4HG2A 2W43A 3WGHA 4ZOCA 4BN5A 4G1VA 4MB0A 4MUMA 2OXTA 4KPUB 3AW9A 1E6WA 4J2HA 1J8VA 1GLNA 1WD7A 3GJ7A 3UFXB 4DM3A 3D4BA 3CISA 2VT2A 2YXLA 3HMQA 3ON5A 3RVKA 1VJ5A 3L7CA 5FPKA 1GSIA 4H6PA 4WIAA 4DUPA 5JO9A 3KSAC 4L3OA 1Z12A 2RHHA 3MWKA 1BYIA 3ZV6A 4WGGA 4DG9A 1JVSA 4IIVA 1W47A 3MTEA 1EQUA 5EZSA 4GMFA 4N6NA 3T12A 1JFLA 1FYFA 1QGUA 1HA3A 2FCAA 1QLJA 1DKUA 2VJQA 3GRPA 3LC1O 5FPSA 1JFSA 1IBCA 3A9UA 1RAEA 4N0MA 3L02A 3F73A 3R3SA 2Q1WA 4P5EA 3JSAA 4BATA 1P1BA 1DEKA 5AMXA 4PZUA 4XGKA 4Z7NB 1FTYA 2CF5A 1JEOA 1VKNA 4M0PA 4A4DA 7GPBA 4JLKA 4Y9RA 2IZOA 3FPJA 1NATA 4LN1A 1Q1AA 2A9VA 4Q34A 5IWAB 4RNCA 3INGA 1ADBA 1G8AA 3ESCA 3AIKA 1UKCA 3CRVA 3IJEB 2WU3A 2AG8A 3NRCA 3OO1A 1WS6A 2PAAA 4FNAA 5LB2A 4LF6B 2XXJA 3FBWA 3K9BA 4LA4A 3FR8A 1O6CA 3WDLA 3T4EA 3VPGA 2V0GA 2X40A 3F3MA 1F14A 1TVKB 4XVHA 4BVGA 3AB3A 4EW1A 4UTRA 1QRUA 3HJTA 4KGZA 3REQB 5LBUA 3EJWA 3LUHA 4MA4A 2WJWA 1FS5A 2J48A 1U2EA 4JWTA 4EPTA 2HWYA 2ZKLA 3TXAA 2ZUBA 1TVKA 1DX6A 1JLLA 3AL2A 2WU0A 3KELA 2NVBA 2WLSA 2FFHA 2RAPA 2VXBA 3UCFA 1B26A 2YYYA 5JBQA 3I6MA 1L5FA 1XZJA 1K75A 1SD5A 3C2QA 3E5HA 5D3ZA 1V25A 2OVBA 3D1VA 3MLBA 4H3KB 5AKIA 3W9SA 3N3BC 4CM7A 4LWQA 3ZGYA 1KPGA 3F78A 4KMSA 4KRXA 3BTSA 4YV7A 3NOXA 2Z6VA 4ZAFA 3M3PA 4ZYWA 4KDEA 4AM8A 4F3RA 2VK8A 4NS4A 2OO7A 5BN4B 3EH2A 4M4SA 1O9GA 4G26A 1VPEA 4CHTA 4POAA 3T3OA 1ZGJA 2X3UA 4CM1A 2YV2A 2EFEB 3NETA 1GDHA 3IHWA 3FYUA 3BE5A 5K6TA 4N47A 3OPVA 4DSAA 1WJGA 2AX4A 3O8QB 3JZAA 3RAPR 2YYAA 2EKPA 4F21A 3G5LA 5CD9A 1VI2A 4QOJA 4ENRA 2WMNB 4CM6A 3JAKA 5CLGA 3RAJA 3ANLA 3DZKA 3GRCA 3FYUB 3LY8A 4BMNA 2P6RA 3L8CA 1TEZA 3FOBA 4ZYLA 3I30X 3O8QA 4JASB 1I3NA 3GT3A 3QE0A 3VOSA 1KSFX 5BV0A 3WAKA 3KEMA 3K8ZA 4GDFA 2Z5LA 3ME5A 4H0NA 5FO1A 3HR4A 5HEKA 4YY3B 4J49A 4I3GA 1EUDB 4NKRA 5KYGA 4FPXA 2OD9A 4E15A 1MEJA 1ZVVA 3C39A 3KSBC 4PG7A 4LBZA 1VKHA 4YCBA 4DRYA 3WIEA 1K2VN 1BHSA 2DUMA 2V6MA 5BSHA 5E6SA 3M9LA 1XR3A 2H1VA 3QKRA 1V1JA 4G01B 1ZC3A 2IOYA 1SC3A 2AFHA 2A1TS 2V59A 4PO1A 5FDFA 4J75A 4XYBA 4FTWA 3WJ2A 5JCJD 3C43A 3WKCA 4MQBA 3LBAA 2N3ZA 1G6HA 2Q1XA 2D1SA 2RG7A 1H2RS 1F9EA 1HYHA 2O6LA 3BE6A 5E6SB 5LMNB 3HDGA 3QKRB 1FPMA 2J33A 3T38A 1LX7A 1HDGO 2ZSEA 3L6UA 4PCVA 3W3AH 5JS6A 5CVJA 3AK4A 3GLIA 3S70A 1SULA 1TZBA 2QYHA 2IU4A 3M1IA 2NUTA 2DX7A 4A0SA 5I8WA 1XOIA 3N28A 4C4YA 1Q0ZA 5JCOA 1SBHA 3DKRA 3LQYA 3HZHA 1I6MA 1GPJA 1KK1A 3MAJA 2VNIA 1LVGA 1U2RA 4F6CA 1QPZA 5FUQA 3QWHA 3GEIA 2IT1A 4Z53A 3BMNB 4PQFA 3OC0A 2PGJA 4Q24A 2FW7A 3ZDAA 2A9PA 4DY4A 1GUFA 4WKNA 5LN1A 4RL4A 2C0PA 4QLBA 1I1NA 1L5KA 1Q83A 2R47A 2DH5A 3NP9A 3UJPA 1CUXA 1VLQA 5EZYF 1ZVMA 3W4KA 3C4QA 3FVQA 2O8NA 4YA6A 4IIJB 1N2BA 2XA9A 3WC4A 1HBJA 2ZETA 1S3GA 4LOAA 1LLDA 2C1ZA 3CWZA 5CCEA 1BDJA 1BGXT 2D4HA 4ALLA 4PXYA 1T3GA 3CT4A 4M8KA 2PSJA 4GPEA 1XKXA 4PVCA 4TSKA 5FO0A 5IEBA 3ROMA 5JTTA 3UMVA 4BN4A 1PS8A 2XKBA 1RWPA 5A62A 1PZMA 1OWOA 2F1KA 1P0QA 2EKBA 4R81A 5IM4A 2PZMA 1HE5A 5LZ5A 5HF5A 1T10A 2XMZA 1QQ6A 3QUAA 5LOVA 5BMOA 3GGOA 5CT8A 3B89A 2ZUTA 1DB3A 4CM4A 3UN1A 1DIBA 3WXBA 2P2ZA 3CTMA 5BYJA 1YKSA 3LUBA 4R2XA 3OM0A 1G42A 5ALUA 5G2OA 2V4MA 3VPAA 4EFMA 3EVEA 3ADOA 1M6NA 1GGNA 4MUGA 5EERA 5D84A 4MI9A 4L9SA 3V4LA 4CM4B 2G82A 2V7EA 4PONA 1GUAA 1QKIA 2PT5A 2IPLA 3CX6A 3E61A 3L0CA 1AV6A 4AYXA 5KKAA 1ZU5A 4KACA 1EJ0A 2W6NA 5CLHA 4HRVA 1OIWA 4RKRA 2G80A 5CYFA 1A9PA 1RLOA 4ABYA 1QGDA 3V4VB 3HHPA 1DDGA 1CLEA 2CVPA 4IIBA 4R2MA 3T5BA 5AVSA 3E9DA 3ZKAA 3RRNA 1E7WA 1RE1A 3TKAA 3L3BA 1AVTA 5FA6A 3M6XA 5HQTA 5IARA 2FSVA 1E8MA 3RYCA 5KJFA 1CD5A 3NBAA 4HD8A 4JJIA 1C0LA 3HRIA 1WPRA 1K92A 3QHQA 1IPFA 3KKMA 4AKSA 4AYTA 2Q9CA 1T3LA 2HCTA 1GNRA 1NBEA 2JGKA 4MMYB 1DBIA 1M8KA 4NCIA 1ZI6A 2QRNA 1HT0A 1Q3TA 2YWJA 1YRHA 3B9RA 4HMOA 4TOIA 3O0DA 4OYHA 4PC2A 4B73A 3Q8LA 1REQA 5E38A 1K8RA 1HE1C 1Q6YA 2AJBA 2C20A 2G28A 2V98A 4FR2A 4CDMA 3QKWA 2GHRA 3B3JA 5KOIA 3I83A 3ZCUA 2QTVB 4LF8B 1O6ZA 3KQQA 3PITA 2ZR9A 2XQGA 1RC0A 1H2WA 2DKOA 1CNMA 1U0HC 1JMYA 5MDHA 1YVDA 2BLNA 1S8OA 1QFJA 4KXLA 3HJAA 4WQMA 4XTCS 1QCDA 3VVLA 1AKQA 1H2XA 3FTPA 5E4YA 3PHLA 4GM0A 4XVQA 1KC3A 5ALYA 3TGWA 5GIPE 1N8SA 4U00A 2VXCA 3T5PA 3TSWA 3A2NA 3LK6A 4AJ2A 4UTNA 2BAGA 4V3CA 3TL6A 3JYOA 3QBDA 4L07A 3RGWS 1SXGA 2NO0A 1BMTA 1UM9B 3GRVA 4UU8A 1TQHA 4YB8A 4UXIA 1GA6A 4AXBA 4NP6A 1KIFA 1JHOA 1SPXA 4KP7A 5NULA 1R0ZA 4G0XA 2VXOA 2VSQA 2VPXA 3EXG2 3FDZB 3GK3A 3KKZA 1J9ZA 6GPBA 3WYCA 5FLXA 1BVRA 1L4UA 4G5HA 3AHCA 1NW7A 2JAHA 4N7BA 4IGFA 4D25A 2AB0A 1NVEA 1SG9A 3CCCA 3GUHA 3NOQA 4HF7A 1N2EA 2ZRIA 3RT7A 1V1MA 4UE3S 3JY6A 4YH1A 3D7RA 3HM9A 1ICIA 4B1FA 3ADDA 4PZPA 3H1PA 1FF9A 1EX7A 1OX4B 1WCV1 1WG8A 2W8BA 2QZZA 1YZKA 1WUJS 4O2BA 5FNVB 3WGKA 1IOZA 3WIBA 5IC4A 4TT3A 1B74A 1Q3HA 4FSXA 1WPGA 3WDSA 1XWFA 2QSUA 1O77A 1EMDA 2JFUA 4R8MA 1DCMA 3B85A 4CQMA 3ZIAD 2R62A 1MAHA 5AK3A 2WSIA 1LBSA 3IAEA 1VXRA 3NVAA 3UCEA 5CPFA 4DUGA 3KZCA 3BGWA 3VSAA 1P4RA 4TV9A 1QO0A 2HU7A 3WIDA 1K3TA 5DOVA 3OQIA 3RTDA 3AJ9A 4D0RA 4TMKA 3HFSA 5AW9A 3STVA 3L8ZA 1N33B 4UOQA 2V5UA 3COWA 3P8ZA 4NESA 1KDZA 3HC7A 4GYWA 3PC8A 5FBZA 4BLOA 1JG6A 1T2UA 1A7JA 2BGMA 2V45A 3BXEA 1E0DA 4M8SA 2ORIA 1LPSA 4K0RA 4ZDJA 3KALA 1F0PA 1L7OA 3VYTB 3NHUA 4HGPA 5FYDA 1CY6A 3DUWA 3GRZA 3LE8A 3CLVA 4P83A 3OZDA 1T9KA 4O1IA 3WK6A 4P4SB 1RXCA 2K7ZA 3DBLB 1ZD5A 4DZTA 3IJ5A 2COEA 2ZR0A 1SC1A 4FT2A 3VRHA 1AHHA 3GD7A 4M1SA 3EZ9A 3BWDD 1QQBA 4IF6A 2Z8YA 2QN2A 2PLFA 3ABQB 4C3ZA 3OLZA 1DCTA 3RV3A 3SF0A 4D4HA 3WGGA 1QYDA 3F47A 2H1OA 3H1TA 1U6KA 1NMEA 2AXNA 3GFRA 4FJ0A 2ZS7A 2WVJA 4ZT6A 2D0IA 4MKXA 3RBZA 2NG1A 4RMGA 3ZX5A 3K9GA 2ZKIA 3UGTA 4LG1A 3GLIE 3GDWA 1HNWB 3JQDA 4BO2A 1E0KA 2R3SA 1LPAB 1LPOA 3H2ZA 3LDFA 3PHBE 1AD2A 1IG3A 1GGMA 1JQDA 3FLMA 4Y67A 5U1PA 3K1JA 2R96A 3VHXA 3VNSA 4M88A 5I4BA 2BBTA 4OQLA 4EWLA 3ZI4A 1JILA 1PVDA 3LBNA 3KCNA 1UJ2A 3AIIA 4EJ6A 4Q39A 4REOA 3ODGA 1YRYE 4OG2A 2WNIA 4TPKA 4QBHA 5EIEA 3QWAA 3I42A 4HRAA 4JN6B 1DOZA 1RQRA 4AY6A 1AKMA 3IT2A 3IIKA 3KZOA 3E9ZA 5CNMA 4R0MA 3OCCA 3SJAA 3CZ5A 3G5UA 2LVBA 3BXPA 4J6FA 1KI8A 2ISSD 4D02A 2XZPA 1HRKA 4ZDIA 3BSWA 4UDXX 4EG4A 821PA 1Z0UA 3PQ3A 1U2DC 4DFDA 5HW0A 3E9NA 4YMIA 3ZUPA 3ZY3A 3LGSA 3PDHA 3WGJA 3KLPX 5DNVA 4ON9A 4EYGA 2I80A 3AM5A 1U9ZA 4ALIA 1WB5A 1ZNQO 5LLDA 4DIUA 3IP8A 4MKIA 3E9EA 4UM5A 4UVDA 1HH4A 4IF4A 4O3FA 2O7QA 1U4NA 1QKJA 4I0WB 4UNSA 2H1IA 1V16A 5GOZA 4URWR 3PGXA 1DIAA 4YV2A 1LBHA 2PMKA 2NSLA 5E2AA 3BBLA 5LJLA 2DR2A 4BRUA 3O2SB 4JV5B 1C3OB 1XIVA 2MMCA 2PS9A 1E89A 5UKDA 2WHXA 1RJEA 2ANCA 1QM5A 1BXRA 2HBRA 4IJ6A 1BHQ1 3DT8A 4R0VA 4YCSA 3PTLA 4MWZA 1ORTA 1GEEA 2R1VB 1QKKA 2D4AA 2GUWA 4O4JB 3VR0A 4PG6A 2HGSA 2GK3A 4IP0A 3B9QA 1T34A 4FZVA 3U26A 2A86A 2DHDA 3AKEA 3L07A 4EK9A 4EG8A 3GELA 1IK6A 1J2JA 3E7PA 4JYBA 2GAAA 1YZVA 1H2ZA 3ZZMA 1A8IA 3TRKA 1P31A 2VQ3A 4XD7D 1YZFA 4QDZA 1DXOA 2R1VA 3FIUA 3GLSA 1NR1A 4O5OA 1JDBB 3NBQA 1I6WA 4RDHA 1NVAA 4KX3A 3RS8A 3H2JA 3WLSA 5HZHA 1GDTA 2C54A 2PS3A 3K6RA 1IIBA 1AQNA 3CLRD 1V8ZA 1TLTA 1TNDA 4R1MA 3W90A 2QY6A 2ZSJA 1WW2A 2VBIA 3L92A 3OF5A 3T5MA 4ESHA 2YJ3A 2Y1EA 5HKKD 5KTSA 1WB4A 3MXOA 4HBGA 4MS3A 1EFLA 3HCAA 4FFOA 5F7XA 4WXYB 3CWCA 4W5NA 4DW8A 1L7BA 3L0YA 2GN6A 2ODPA 2QTMA 3N5CA 4BX3A 2ECOA 2RAFA 3DTTA 1KMIY 1M0TA 2XGGA 4WKGA 1LJ8A 4JIGA 3CYFA 2Q0QA 2QRUA 3E0XA 4F7WA 2MSKA 4MS3B 4OBXA 1XK7A 1K2WA 3I23A 1BD3A 3E3LA 4X94A 1DS6A 4DBLE 2VCEA 1FFCA 1T3ZA 5B3JC 3C6XA 3MHTA 1MTOA 1QH8B 1G5FA 4LNUA 4E22A 2AZMA 3HCEA 4K1LA 2H6EA 2QJRA 2H51A 5BYBA 3I04A 3EHDA 3K6KA 4I36A 4MIKA 4CF5A 3D7NA 4DNOA 4LF9B 2W2KA 1A9YA 2O48X 2Y05A 4V0SA 5K3FA 2GRAA 4EG0A 1QRSA 1H2BA 2G25A 4DPKA 1NI4B 3WFIA 1L3BA 4TLMB 3SFTA 1ZZEA 1OTXA 3PJDA 7MDHA 2W2KB 5KNBA 1O94D 1Z34A 3I6IA 3MZ0A 3AW8A 1E2NA 4YFVA 2D1YA 3TSYA 4FNMA 4ND7A 4BCBA 2C7OA 4OFWA 2WT8A 2D2VA 3L77A 1DWQA 1U8ZA 2Y0DA 3UMBA 5AHRA 4QKQA 4TL7A 3T5TA 4NFSA 2Q5JA 3OZUA 3F6SA 4YMWA 2V54A 3P71T 1VE9A 3ITDA 4KN5A 1DBQA 4L4RA 5FWXA 1MKYA 3ETEA 2WDPA 3GLRA 4HEJA 2P4SA 1U0TA 1F1JA 4ROTA 1EESA 1T36A 5FFMA 1AURA 3K70D 4WK4B 1JHQA 1BVYF 4BNYA 1SC4A 3JD4A 4C07A 2WHYA 3THYB 2GD6A 1L5WA 3UG6A 3F4BA 2QRVB 4IQ8A 4L75A 5K51A 2QA5A 2ZWIA 2CFOA 2QV0A 4RCVA 2V9CA 4Z9BA 2XBUA 5KYVA 5L95A 2D1RA 2OO5C 1T4MA 2R5WA 4RTLA 1IDN1 4ZT5A 1M2VB 2LIVA 2VP3A 2C04A 3G1TA 1CJSA 3THYA 1CYEA 4CEIA 3R3XA 4M8NE 1OAKA 2P9QA 3A9TA 3A3YA 1MRZA 1YVRA 2C5AA 3HZZA 1XZ8A 2YFHA 5CJJA 3JWPA 3KJIA 4LQDA 4QPPA 4EJFA 1BKDR 2NP6A 1UBJS 3BJZA 1N5DA 2HV8A 4FZRA 2J67A 4URYR 4FWIB 1GARA 4KQ2A 3VR6A 2ILTA 1IN4A 2JGFA 2YV1A 3M8KA 2O0HA 5EMJA 5BT9A 3X1MA 2JBHA 1V39A 5B1DA 1SKYE 4AULA 1JKMA 2O2IA 3OX4A 2IOFK 1PR0A 4CPDA 4RETA 4CDRA 4E21A 1AHPA 2Q0XA 3T5AA 2YNMC 2G8NA 1V47A 4BWVA 3HUDA 1D0IA 2DHEA 4MCIA 3IEKA 4FMPA 1R0SA 4RMNA 4C0QC 1UFQA 4CGYA 2GKSA 4F72A 4Z49A 2P9EA 2XIJA 2XWSA 4CR6A 4B47A 1K6EA 1U2SA 5DXAA 2ZRCA 5EY5B 1Q7BA 1Y7LA 1JHZA 1UP6A 3Q3HA 4WNAB 1KWKA 1E9FA 1N2CE 1DEOA 2FUCA 5I8ZA 4BNNA 3TW6A 1RI3A 1D5CA 4Q3CA 4N7MA 3A6FA 4ARVA 5CCBA 1M6VA 5FL3A 3FNRA 1X1TA 2QR2A 5ICMA 1JNYA 2A33A 2R25B 4I50F 4KI0A 2YXDA 4TKZA 4FN5A 1WZEA 1DU4A 3PRJA 1PUIA 2P3SA 3PA6A 5J1SB 4UUQA 3OX2A 2BMWA 5KVVA 2V55B 1WXQA 3ELYA 1P2VA 4D4IA 2JGRA 1ZH8A 4PSUA 4PLFA 1N0HA 1R6XA 3UPDA 2PKYX 3I4FA 3QKSA 9LDBA 5F5LA 1W44A 1N5LA 4P1ZA 4MZDA 1MJHA 3OE5A 3DA8A 2LPMA 1PR5A 4RLFA 1VHWA 1IY9A 2NYRA 2X3FA 4G3XA 4H7EA 3SJCA 1EBFA 3P27A 4MXDA 2KLBA 3QXGA 2DQYA 1JJIA 4XDYA 4YCCA 1TEHA 1XFDA 4BKPA 4MO2A 1FS4A 2MYTA 1QZ3A 4ZO6A 5EWJA 3MWLA 3L0DA 5IMBA 3T7KA 4EHAA 3N86A 1NXSA 5DYGA 4D8XA 4KXNA 5AXAA 3PA8A 3O7MA 5AJVB 3COSA 2LXNA 3X2FA 3WBFA 1GQ2A 2HREA 1JR3D 2DKNA 3A1WA 4A03A 3D9QX 2FK8A 3BGVA 3L8GA 2AI3A 2EATA 5TS2A 4B34A 3U6KA 1D2HA 2QPTA 3DHYA 2I3DA 4K6KA 4X84A 1U3UA 3IURA 5IASA 1ZOLA 2G88A 3UJNA 3JQQA 4OX9Y 1V5EA 1O94C 3MTBA 5LQUA 3TAUA 2QD2A 3G2JA 3D8HA 3V2IA 4PO9A 2VBGA 3CH6A 1K9SA 2GMWA 1SOUA 4FFVA 3W2HA 5CAEA 4INAA 1TAHA 4MV7A 5IK2D 2G9QA 2YOGA 5FBHA 1NUPA 3RU9A 5M2QA 3HO6A 4IS3A 4XKJA 3WLAA 5FT9A 4RTMA 1AZSC 1IQRA 2Y92A 3C7AA 4R98A 3NWJA 4M86A 3RVQA 3UMSA 3T94A 5L7YA 1ANKA 1N3YA 3O4GA 5FR1A 2CJXA 5EKSA 4QBFA 1FYVA 4W1SA 1PR6A 1OPXA 5H3HA 5AFSA 4QHSA 1RM4A 1T4CB 5IKEA 3RR2A 1XVAA 1A2BA 3KJQA 4OQ4A 2ZZMA 1N0WA 1NJ2A 4YXWD 3SHVA 2EF1A 3GPIA 3FR7A 4JVLA 4EI9A 4ZAWA 2NGRA 5FOQA 5IT0A 1OR8A 2PSEA 1G2IA 5ALNA 2C5FA 2N46A 4DIOA 5HXAA 3THWB 4US0R 3PCTA 3JAMA 2CV0A 1RTKA 3BTUA 4PBSA 3GUYA 3OZXA 2FG7C 2ZREA 4L1KA 4JYAB 3NHFA 5L3QB 4UBMA 4E6PA 1R8XA 3M70A 3CVVA 4OJMX 1SCDA 4K9RA 4BYGA 1KY3A 1M6WA 1G17A 3CKYA 4RVCA 3TDMA 4DLNA 3ZWKA 4C6SA 1HDYA 3QNMA 4B40A 1TOAA 3H4IA 3MWJA 3M33A 3LPMA 5L3QA 3RNOA 4EYSA 4FZ5A 1H4VB 1NDUA 3DTVD 1O1YA 4RVOA 2HK7A 3UQZA 4RPLA 1E3WA 3Q3IA 2EC5A 4MV9A 4AJ4A 3P97A 4X6YA 3TJMA 2B5OA 1EE1A 1GKYA 1E2FA 1NW6A 1OBCA 1RHQA 3CZAA 3M9WA 4N9QA 4HXYA 2WHPA 4HNHA 3V42A 6LDHA 2QZ9A 3FTFA 4YPFA 5KHAA 1BROA 1OZHA 3V3KA 1NVFA 4BO8A 3FIJA 4QEKA 3QE9Y 4QPDA 5ALOA 4D7AA 3B6IA 2VHEA 1DCKA 3ABZA 2IU6A 3VDNB 1LK0A 4AL4A 2YXEA 1CUVA 3Q0EA 1P5ZB 4OXYA 2V7QA 4D4GA 1O89A 1GG5A 2PZEA 4U2KA 1EP1B 2IZ6A 2ZB7A 3F0TA 3BRCA 5EHIA 4M8IA 2VS1A 4GZ3A 1N4AA 4N3GA 1JU9A 3M4YA 5GY7A 3SHQA 3TTYA 1TT5B 3VR3D 2F3UA 4US2R 5FHRA 2D3WA 4C04A 4Y2GA 1C9KA 3FFWA 1AF4A 4JC0A 1K68A 5TQ2B 1XA0A 1B8PA 5FV7A 1DAIA 3G8AA 1UXOA 3A9VA 1BXGB 1RMTA 4QPZA 4QFMA 3ZW7A 2OV4A 1GPMA 3UH0A 4DT1A 3G7SA 4QJ4A 8GPBA 2BGLA 3QU4A 1CG6A 2VWHA 1ODCA 4W5WA 1X0VA 2Q27A 4CU5A 2H2FA 4RSMA 3TBKA 5DXJA 1GU0A 3VTZA 1ZUNA 2C1EA 2VA9A 4N0DA 3EC2A 4FDVA 1XMVA 5IP5A 2B7CA 2PD6A 2WYVA 4BVEA 3G6KA 4DNPA 1E2IA 4GWKA 4DT1B 2PSHA 3B1JA 2BFOA 3EW7A 4TMWA 5FL7D 3VR3A 4TMVA 3U81A 5A3QA 1WUHS 3KEGA 3N76A 3PEFA 2I4OA 3RRJA 4UHFA 1TGVA 5FORA 3T7CA 5DPMA 4E30A 1HTBA 1P2TA 2R7KA 2GVNA 2PKXA 2F64A 3FFXA 5CHYA 2YR0A 4IMRA 3E48A 5AK6A 1VECA 4GXNA 2DULA 2AF3C 2XCQA 3CW2A 1R37A 2JKVA 4E7OA 3P26A 4R54A 2EERA 3K15A 3WJ1A 2Q3MA 1I5RA 2AXPA 3OQ1A 4D3SA 1PKXA 1DG1G 2Y67A 1P74A 2AG6A 2WSYB 1Y8AA 1KK3A 1MA0A 3THOA 4B7UA 1XEXA 4EQ6A 4S12A 1W6RA 4BNUA 1ABBA 1TM5E 4QPCA 1Q7GA 3CN7A 4RM2A 3PFHA 5E1MA 5AUOB 5CDYA 1O9BA 4GBGA 2FN9A 4JT9A 1DKLA 2F2TA 2NZJA 2WD7B 2GFIA 3FFBA 1U3WA 4NCJA 3O94A 1G291 2AF4C 2CLLB 3ONDA 1NQOA 1LF5A 3I01M 4MAMA 2XHEA 3KOYA 2J7PA 4IJWA 3TQCA 3NNDA 2N42A 2WD7A 2QW0X 2J9RA 2OFXA 3CQ9A 4HVTA 4LGVA 1PO7A 5G0TA 5EE9A 1MOQA 2GZ2A 2J6BA 2ZAYA 3SI7A 3T1OA 4BX2A 4IOKA 4LYGA 3K72B 4QUIA 1B76A 4MV1A 4W7IA 4NZPA 3O38A 2ZBUA 2ARKA 1E2QA 3AY7A 1FDRA 3DMGA 3OZTA 1D9ZA 4GRIA 4NARA 3CR3C 3HYTA 3WGNA 2D2IA 2DP4E 2GETA 4HFMA 4HYYA 5JC1A 4Q9HA 5HNKA 2WF5A 1ISHA 1HL7A 1GNQA 1NURA 1XTIA 2EG9A 2O07A 2QM8A 4M22A 4ACBA 4WNIA 4AJHA 3V48A 3AF6A 2W42A 3NYRA 2JEYA 1B6RA 2G1UA 2WUEA 3W7AA 2VAWA 5IYZB 3ND5A 4FZ3A 1V8BA 4AUEA 4NG5A 3GFBA 3UXEA 2P9HA 4G8BA 5TC4A 4CG2A 3PI6A 2TYSB 3FJYA 2COKA 3KVVA 2FWIA 3QEAZ 3PHIA 4BQEA 3CZ9A 4MJLA 4YUXA 3BEOA 5JPDA 2O19A 2C82A 3E9RA 3H2SA 2EU8A 3Q8KA 1NM5A 5E6UA 4HZIA 1M75A 2AL7A 4IEIA 3SR4A 3EXHC 4JS0A 1DJMA 1NVDA 3SE7A 2NSHA 3O2JA 1FJXA 4BZQA 3R8XA 3OP1A 1RI5A 4HAZA 4RWZA 3R6TA 2R00C 3H17A 4MUNA 3GWZA 3NW9A 3RRMA 2IOHA 4BNXA 3F8SA 4CF3A 1O08A 1S01A 2IZ0A 3WX0A 1GR1A 4WBSA 1J5XA 1GL3A 1JKJB 4UTZA 2O8CA 3MC1A 2UYOA 5EMLA 1I3OA 1NFFA 3AHDA 5C7YA 2B99A 3SICE 1H69A 4BP8A 5BWOA 1I36A 4XWKA 2WQ6A 1E9AA 1XZCA 2WIAA 5FFNA 3B5IA 1LI4A 1UK8A 4UEOA 4XDGA 5AJUA 1Z0SA 2JFGA 4Y0VA 3IBSA 3KKNA 5C7OO 2QLFA 3STUA 1U3CA 3UJ7A 4KLAA 1VPDA 2CVFA 2ON6A 2AH5A 2VOJA 2Q8QA 4X6UA 1THGA 3OM1A 1MUUA 5CNIA 3PIDA 4TMFA 2ZSAA 1L7XA 3KZNA 5JAUA 4YAEA 1ETHA 3KZVA 2WD9A 2RAVA 4RDCA 3KYDA 1JAIA 2O2HA 3TTWA 1EUDA 3WKBA 4FYHA 1GL7A 1V3QE 3TLAA 4QGHA 3W1WA 1FVOA 2YMLA 5B1YA 4KRFA 1ZGBA 4WA8A 2C3UA 1EX6A 2GJ4A 5HIJA 4XTRA 4E88A 3PXDA 2QJWA 4BNGA 3IVMA 1XKQA 4OXXA 4HDAA 1EXMA 5BSFA 3WGIA 2OHOA 3ADPA 5C8ZA 3LW7A 4P6VF 5JVDF 3Q9UA 3GLUA 2D0PB 2HF8A 3D0QA 3N2KB 5JATA 5BURA 2C57A 3I3SR 1OJ7A 4IDDA 2FZKA 2WVAA 2PE5A 1V8OA 1CP2A 3W8RA 1RYEA 1UM8A 1KETA 1CUBA 2NUTB 1TLLA 5C31A 5LBIA 4R9UC 4KE7A 4DQKA 5A2GA 4G1UC 1XJ0A 4R84A 4Q21