4V0MA

Crystal structure of bbs1n in complex with arl6dn
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
total genus 42
structure length 166
sequence length 166
chains with identical sequence C, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0mA00
1NIPA 3D3QA 1ESMA 1KK0A 4D82A 2QEQA 5FL7A 2A3RA 1TEXA 1VCNA 2IF2A 5J4YA 4DSTA 2WICA 2I1QA 2WWWA 4M1WA 1DO2A 4F7WA 2AK3A 1XD9A 3IDQA 3TLXA 2HUPA 2V6IA 2FPLA 3A37A 5FL7D 4ESVA 1XPUA 1CF4A 3SYKA 2W2VA 2Z6VA 1G291 3FMIA 2ONKA 3CM0A 2QMUA 1JEDA 4M0LA 4B74A 4C0KA 4Q9JA 5CDFE 4J0QA 3K0FA 3WXMA 4AKGA 1T3SA 1PLKA 2VHTA 1XMVA 1VG1A 2X19A 3TNFA 4B48A 3CX6A 1LVGA 2WAYA 4HYYA 4EFMA 2EFEB 3K09A 3RC8A 1TMKA 3TQCA 1IY2A 1YRAA 4HLQB 1XPRA 2F6RA 2VA8A 3B60A 2JCSA 1KNXA 1WQ1R 1XBTA 2XNDA 2A5YB 2A5FA 3J81k 1PLLA 4DDTA 2CCGA 1WBBA 4XOIA 3GMTA 1T0JB 3AGQA 4W5HA 2XNDD 5FTNA 2WPDA 1F3OA 3K0AA 2OSBA 621PA 4QXAA 1JEEA 1OT3A 1FNNA 4B32A 4E03A 2XZOA 1IAQA 2REXB 2WPDD 2ZJAA 3NHAA 1Z07A 1OH7A 3QPVA 1VIYA 1T91A 3S1AA 1XTSA 4ZDWA 5AJXA 3Q72A 4DJTA 2NO7A 3EARA 4Q01A 5CM8B 2YWHA 4M53A 3AKCA 1T6NA 1S8FA 3FDIA 2REBA 5EUMA 4DDWA 4LBWA 1AKEA 2RHDA 1P62B 3QXJA 4KYUA 3L0IB 2VEDA 4Q9LA 3GLIE 3QNUA 4UNQA 5AJVB 2OCBA 4Q48A 3E70C 3G82C 3AP1A 2ZYUX 4MYTA 3VKGA 3WNCA 2X77A 2J59A 2EYQA 5GVRA 1YR8A 2RMKA 3PV0A 4AD8A 1Z47A 4R71A 4LYJA 1G3UA 4HZUA 1W0JA 2G77B 2OCPA 3X1ZA 1SKQA 3U3KA 2F1RA 4B3XA 2PX3A 1RRPA 2FSGA 5L3SA 1XP8A 2MMGA 2NO9A 1QHNA 1W0JD 1LV7A 1CR0A 2ZRFA 3K9NA 3RVBA 1KMQA 3NBYC 2Z5FA 1E9SA 4MITA 2O8CA 1P2VA 2CL6X 2XZPA 1MR3F 3SU8A 1UM8A 1QG2A 4V0ME 2JIZA 4WW0A 3RWOA 1KI3A 1UDWA 4B3BA 1J99A 2IEYA 3QE0A 3OZXA 4Q7LA 1LTQA 2JIZD 4XSGA 2XGJA 4DSOA 2C78A 3VU9A 5JLJA 6Q21A 4RKFA 2ZAMA 3PIRA 3RRYA 4HUQA 3WHKA 3KKNA 4P4UA 1DEKA 1MO3A 1FUKA 4PPFA 3R7WA 3HU2A 1F60A 4UJ5A 1SXJC 3CF2A 4G5GA 5CYPA 1GRQA 1GKYA 3GCGA 2FX3A 4JLPA 4A2QA 2IYUA 4PQRA 2BKEA 2XITA 4CEJB 1XJCA 4IHQA 2ZSEA 5KHOC 1TF7A 2VHJA 3SOPA 3Q8XB 3U3RA 1XXHE 3I8SA 4OHZA 5L3QA 3DZDA 2YHSA 1RW4A 4FMBB 5DSZA 3ZJYA 2V3CC 4Q4JA 4OQMA 2BCJQ 2Z4RA 4HATA 3WY9A 5EXTA 4JLMA 2KWIA 1DBSA 4LHXA 3CNOA 1S3GA 1IXZA 4R2IA 1JJVA 1M34E 2PLRA 2UZIR 4ACBA 3U7FB 3U4QB 4BRUA 2JLZA 1WP9A 3W90A 1G18A 5FOUA 2QY9A 4G5SA 3EASA 5BN5A 3I5XA 3BK7A 4D4MA 2F9LA 3L8ZA 3SI7A 2A5GA 2H8KA 1Z0JA 3DMDA 3BBPA 2QPOA 2ZTSA 3IGFA 4JLKA 4M1YA 2E9SA 2JGNA 5FTJA 4QGFA 1E69A 1S3SA 2JDIA 4LJ9A 1W2GA 1Q21A 1KSHA 3BAFA 4MQBA 2IWHA 2YINC 3ZLJA 2NQ2C 3BE4A 2QQ0A 5CK4A 2JJ2A 2CHVA 4B2PA 2WWXA 3T1TA 1C9KA 4XWOA 2D06A 1XCPA 2FPKA 4N1AA 3ZDQA 3X1DA 4B3GA 4IKEA 2HF8A 1G16A 2NO1A 3NTUA 4JBYA 4M22A 4URWR 5HCIA 3VX4A 2IHYA 2SHKA 1E6CA 1XZQA 1YR7A 3BIFA 4MGZR 4ZPXA 3SC3A 4BZPA 4LYFA 4HB2A 4A0RA 1EFHA 4NHOA 4EAQA 3BB1A 2ERXA 4US2R 2FJUA 3QVUA 1H65A 2ODBA 3SYLA 3KJGA 1TQDA 1BMFA 421PA 1J90A 4GOKA 4II7A 4CW7A 1G21E 4KFUA 5SZJA 3IUYA 4TL6A 1BKDR 2NPFA 1BMFD 1OHHD 1GIAA 4NYMR 3LO5A 1CJTC 3DM5A 1QDEA 5CLLA 1TF2A 4X8LA 4JLVA 4I1OA 1KK2A 2ASEA 2XZLA 3SR0A 3B1YA 2R2AA 3BC1A 3THWB 1K6MA 4PO1A 5DI3B 4MUAA 2CMKA 2KE5A 1B23P 1E2EA 1WBDA 3QF4A 2VSXA 2R6GA 3ZQ6A 5DYGA 3KL4A 4RSGA 1ZUNB 3BJIC 2FEMA 3QI2A 3A1VA 2AN9A 2G6BA 1I4LD 4PTLA 1CS4C 1CU1A 3RAPR 5HR5A 4HDOB 2FSHA 1KMHA 5H70A 4LSGA 2V7QA 2WZQA 4C2UA 2H7VA 4FMDB 2QP9X 2IBMA 4Q03A 3U7HB 3PEVA 4V0NA 4LC0A 2BMJA 1Z6TA 1GDDA 4HAWA 2V7QD 1NJGA 4C0JA 4KJZA 1SXJB 3E2IA 5HCNA 1K5DA 3QKSB 4AY2A 2HXYA 4FWIB 1U98A 4L8GA 2C77A 1ZYUA 2P6RA 4M1SA 1ZD8A 2JLWA 4MRNA 4Y0AA 2H18A 2GRJA 3IEVA 2ZU6A 4BECA 1WB9A 4B73A 1YZKA 1HQYE 1XD2B 4KSCA 4S35A 4A8JC 2GCPA 2QGNA 1KIMA 2Q0HA 3KXIA 4HLCA 5B30A 1YZUA 3F8TA 3EA5A 1E2MA 2W00A 1IN6A 2EVWX 3VNVA 2FFHA 2CNWA 4PPNA 1K8RA 3VFDA 1CJUC 4XJXA 4RD2A 4S2EA 2JLXA 1G3RA 1MH1A 2ZE8A 1C1YA 2FNAA 4PZLA 2WTUA 2J0UB 2GJ8A 1BYUA 3IBYA 1TU4A 1PLJA 5J4KA 5BXQC 4QBIA 3RABA 2I4IA 1PZNA 3I5YA 1WDTA 1JR3A 3QPWA 4R9UC 2JJ1A 3U2QA 2OXRA 1MABB 3U60B 3OF5A 3K9LA 1C4OA 1FOEB 1YZLA 1KI6B 3OESA 1Z63A 4C0BA 1FP7A 5K8IA 2IS6A 4MGKR 1W2HA 3C4JA 2B21A 3MCAA 2CE2X 2OBLA 5D3MB 1N6OA 2QMEA 4LOAA 4BLTA 4DCTA 4H1UA 4HEJA 2I3BA 2H17A 2O8BA 4DEXA 1X86B 3MD0A 4LPKA 4BPBA 1A5TA 4OK3A 1ZNXA 4W9MC 4IEEA 3ECCA 3NIBA 3SBDA 2OZEA 2OCYC 4Q1FA 5HE9A 3CBQA 4F4JA 1NLFA 2GZHA 2WIBA 4KHZA 1Z0IA 1NLYA 1KSGA 3LW7A 4R2HA 3TVTA 4JBWA 4FIDA 1II8B 1XNJA 2AKYA 1VYTA 5EUQB 5AWFC 1I2DA 1FNMA 1DELA 4Q00A 3M1IA 4TMVA 4ZKEA 2IC5A 4JL6A 4XWKA 3I4LA 3N70A 2OXCA 5HTKA 4MKFA 4W5WA 4AG6A 3SJZA 1E96A 4N0DA 1G17A 4EFNA 1E32A 1XB2A 4C7OB 1E4YA 1R8SA 4AIIA 1IXRC 3Q3JB 1OKKA 4DB4A 4GMXA 4XH9B 1OF1A 1A2KC 1ZNWA 3X2SA 1V43A 3QJYA 1GILA 4IOKA 4LCBA 3GEHA 4DDUA 2ZI6A 1R5OA 1OKKD 2QMHA 4Q4HA 5IT5A 3O8DA 4ZCMA 3FOZA 4B34A 4GDFA 4I1UA 3I73A 4JMPA 1RRCA 5E7MA 3P20A 3QOFA 1UBEA 4NCJA 2PJRA 4P4SA 3KTAB 4OL0A 4GT1A 4V0LA 3LA6A 4HAZA 2F7SA 1A7JA 4L9WA 4WAUA 1HT2E 4BLSA 2XTZA 2C9CA 4KITB 2FSIA 2ZS8A 4GFDA 1Q0UA 4Q47A 3SDZA 3VX3A 2PCLA 4JT2A 2CJWA 3F5FA 1S96A 2ZI7A 4Z8YA 2GILA 2H92A 3RDPA 2ZRJA 3IHWA 3LQQA 4M8NE 3GLGA 1X1SA 1L8QA 5DE3A 3BS4A 1IN7A 1KDTA 1OE0A 1DAIA 1P6XA 4BZXA 1IY0A 1GKIA 2CE7A 3QY0A 4IXMA 5KPJA 1N6NA 2HYDA 3LVQE 4A8JB 4DB2A 1S9DA 5HZHA 1W1WA 4UXHA 4FCTA 2Q9BA 1ZUHA 2HT1A 1Z8FA 1W48A 3LX8A 3NH9A 4LY6A 1W4CA 4RFSA 2OO7A 1VCIA 2PLFA 4QBHA 1RPZA 2O8EA 4YC7A 3RYTC 2NMVA 5BWMA 3OIYA 1P72A 1QHHA 3W3ZB 3CPEA 4NL4H 2ZREA 4MDFA 2V8OA 1ZNZA 1GITA 1E99A 4QJ3A 2QP3A 2AKAB 1XEFA 1FW6A 1GAJA 1GL9B 2JLQA 1E9CA 2O8FB 4GZMA 4BLRA 2BJWA 3B82A 1GRNA 4XTCS 3C16C 1ZVQA 3EXAA 3HR7A 5FBLB 3U6KA 2C8VA 3VR6A 4PAQA 5H68A 4C4PA 2J0QA 2IT1A 5L3VA 4NYIR 5G3ZA 2RGXA 3I32A 4AKIA 4G3XA 4WOPA 2ORIA 1KY3A 2JLYA 4EPVA 4JLJA 2VSOA 5CJPA 1DAMA 1HTWA 1NVVR 4IDNA 4D2IA 4EQ6B 2XXAA 1XX6A 3DKVA 4OBEA 4UJ3A 1Z0AA 3DDCA 2GBLA 4ERNA 2QT1A 2PBRA 2VHUA 2ZSBA 4LHZA 3GFOA 1CP2A 4B6FA 2A7QA 4OYHA 2GDJA 1ZIPA 3SFVA 4AYXA 1E9AA 521PA 3ZS9A 1KKMA 2FG5A 5C46F 1IBRA 4MYCA 2ZXUA 3SYNA 4HB4A 1P3JA 3L8YA 5DIFA 2ZRDA 4EFLA 2GAOA 4DEYA 2QA5A 1SQ5A 4D4KA 1R4AA 2GEUA 2WBLC 1MO6A 4GNKA 3X1YA 1YZTA 8OHMA 3FHOA 3THXB 4JJKA 1RYFA 5IK2A 3G0HA 4Q9IA 3HDTA 4LJ5A 2IW3A 1WXQA 4HZIA 2OG2A 4TQAA 1R0ZA 2GJSA 1ZM7A 3LV8A 4A4DA 5FPKA 1ZU4A 5KNBA 3TUZC 1ZM9A 1OFUX 1GNQA 2ZRHA 3LRPA 1ZW6A 3QSYA 1G8HA 2DFTA 1W5SA 2ZM5A 2GEVA 3K1JA 2HF9A 4K81B 1VG9B 4HAYA 2IUSA 3ETLA 5KDOA 3CWQA 1G8GA 3LXRA 5CM9C 2WKQA 2YJTD 3JZMA 2ZJYA 3TSZA 4TYNA 1GZSA 2Q6TA 3A1TA 3CLVA 4TT3A 5FOVA 4LV8B 4PC1A 5CK5A 1QF9A 3H1TA 1BS1A 1KAOA 1EXMA 1KNQA 1S0UA 2A78A 4XVQA 5JI3E 4QKQA 3GLIB 4M9QA 2J9RA 4TT3D 2QU8A 2DYKA 5FPHA 4NCIA 5DI9A 4GBMA 2V4ZA 4TMXA 3C15C 3QXHA 2P6UA 5TY0A 2WJIA 2ZS7A 3GFTA 2IYZA 1KHTA 5CJ2A 1CEEA 4NDZA 4IXNA 2IS1A 2JAQA 1AQYA 5FR1A 1ZMXA 5FBRB 4F38A 3KXKA 3VR5A 2YYZA 3K9GA 3IIJA 4TSFA 1NP6A 1TQ6A 3P4YA 4OHVA 1VIAA 4FCVA 5AUQA 1KDPA 1U99A 2BIFA 1CLUA 4TSFD 3W5IA 5GJVC 4D4LA 2VH5R 4IVQA 1W36C 4BE7B 4ZCLA 1MO5A 5EE3A 1W0KA 1DS6A 3T1OA 3VR3A 3SJAA 4RD4A 1D8TA 1IOZA 1SHKA 2AFHE 2ZRPA 4G5OA 5E7JA 3PUZA 4P32A 1W0KD 2DFLA 4BQSA 1OPXA 4Q1CA 3KKQA 2OLJA 5FOTA 2D2EA 4WA7A 4C0LA 2D7CA 3WP0A 3WYGA 3QXSA 821PA 5FBVB 4K46A 5EP1A 3O8RA 4B33A 3WBKA 4MGIR 3TGPA 3K70C 3NBFA 3T15A 1U0HC 1N3BA 3SQWA 3ZH9B 2ATXA 3FFBA 3NG1A 4Q9KA 4IEIA 3NWJA 1NLZA 3KX2A 2MSDB 1NMZA 2AD1A 3ONWA 3UANA 4IDPA 3D8BA 1KGDA 5JI2E 3UXMA 5C2JB 3U44A 3K8YA 1KJZA 3SQXA 4G01B 5DHFA 1OH5A 1XXHB 3M0EA 1TQ4A 3AQ4A 1ZAKA 3V00A 2ZYWX 1G20E 4NYJQ 5AUPB 2FGKA 2XOKA 1NNEA 4CGZA 4O25A 1G7RA 3P32A 3W6OA 4A1FA 1E9BA 1JNYA 2CL0X 5CIQA 2XOKD 2P5SA 3BD9A 3TAHA 1IXSB 3W34A 2J1LA 4TLAA 3HPRA 4JVNA 5LPNA 3IQXA 3BRWD 1NJFA 2GEDA 3EWAA 2ECKA 3PUYA 4XIGS 5K8TA 3LD9A 1XTRA 1US8B 4PAOA 1R2QA 4F92B 2ZITA 1KI9A 3MWLA 3U3OA 1R8QA 3N2IA 2ANBA 1BYIA 2FA9A 4WBSA 4JLBA 3MJRA 4YQFA 4OJQA 4OQNA 4QHTA 4TLDA 2Y8EA 2IA5A 1G7TA 2W0MA 4UNPA 2B7CA 3L2OB 2CLSA 3TSWA 3PR1A 3WMFA 1DVRA 4GP7A 2PT5A 2D3WA 2R6CA 1IJFA 1P75A 3RS5A 4MKGA 1Z06A 4G0NA 3QBTA 4NYJR 3NH6A 4Q21A 4IRUB 3VR1A 4UNRA 5JEDA 5JWRA 1VMAA 2DCUA 4N3NA 3TK1A 4WXPA 5EZ5A 1I4TD 1KY2A 2IYRA 4AK9A 1E1RA 2BV3A 3CNNA 3ZD7A 2R44A 5L3RA 3WMGA 4CEJA 1OFHA 1X3SA 1HE1C 2ZR0A 1E1RD 3PEUA 1ZBDA 2OAQ1 1DO0A 2GNOA 4FD2A 4JS0A 2ZSFA 5CLQA 1IN5A 1T8UA 2F3RA 3CR8A 1OXSC 3X1WA 1XZPA 2YWGA 4TTRA 3SS8A 1UBFA 1NIJA 2IF0A 3Q7QA 4TZ0A 2YOHA 1GKUB 4P4TA 4C0HA 1DAGA 3ZQJA 4TTQA 3IKJA 5JRZA 3U4QA 3ZIAA 4TL7A 3MG9A 2J41A 3AUXA 5IHPA 3B1WA 5F3WB 3EIHA 1RC8A 4URVR 2GZDA 1NN5A 1ZCAA 1Z22A 3DHWC 3ZIAD 1LS1A 4GPTA 4NE2A 3GQBA 1W36B 5G3YA 1J7KA 3QEOA 2I1VB 4KLZA 2R65A 3B1XA 4TYQA 2ZJ5A 1DOAA 1LB1B 4ITRC 5IDVA 3CW2A 4QGGA 3KQKA 4RD0A 3B2EA 3LWNA 4LJ6A 2PZFA 3GLGE 3EC2A 1R6BX 1HQCA 1XTJA 4JT4A 3K70B 4OHYA 3T35A 5EP4A 5CB8A 1U0JA 3QVVA 3RNLA 2GXUA 4DC9A 3P4XA 4YMVA 1UDXA 1E79A 1RIFA 4URYR 1E94E 1D6JA 3CF0A 1OIWA 1TX4B 2JLRA 2ZU0C 2WJYA 4C0SA 1CR1A 1RFLA 2V1XA 1FTNA 1E79D 3EPLA 1MKYA 5A0FA 3EIEA 1DARA 3NEJA 2R62A 1GL7A 4M1KA 1KOFA 2EWWA 3BFVA 4US0R 1JBKA 1M74A 3GJ8A 1E0KA 4LV5B 2QE7A 1RVDA 1OB2A 1G5TA 2O0HA 1KO7A 2P5TB 3C14C 4YXWA 2HYIC 2XJ4A 4CIDA 4ZI2A 3KXLA 4C0QC 4FI3C 2QE7D 3PJRA 4U02A 3ZVMA 2BM0A 1Z08A 4LK2A 4C3ZA 1OB5A 1HE8B 1VPLA 4QM6A 3KB1A 4A0GA 2FSFA 2E87A 4BFWA 1UKVY 2YVUA 4MDEA 1FFHA 1O3YA 2K5UA 1GSIA 4I4LA 1VDZA 5EQTA 1VHTA 4PC6A 2EWVA 2R6AA 3LFUA 1IN8A 1J2JA 1F6BA 2OE2A 1I2MA 2BEKA 4OK6A 2KJQA 1NSFA 5DI3A 3THWA 3W8NA 1QBKC 5FI0B 4DIDA 3WRYC 3P27A 5JS8A 1N0VC 1E98A 4U5XA 3AKDA 2FZ4A 3CRMA 4HDCA 4Q9HA 3B13B 3GJ5A 1G4UR 1EESA 3CH4B 4PQFA 1WE2A 2YC2C 5JMTA 3VTKA 1DPFA 3AP3A 3I3SR 2IYYA 5EP3A 1IJEA 3SJCA 1JPJA 5FPSA 2QTFA 1T9HA 2AD5A 1X8JA 4CZ2A 1KSJA 2BKUA 3UKDA 3H86A 4QHSA 4NONA 4B6EA 1SXJA 2VPPA 3OEEA 5LD2C 2FN4A 2WKRA 2OHFA 4PO8A 2AX4A 4Q18A 2EFHB 3PEYA 4JVSB 1P7CA 3AF4A 3OEED 2C99A 2GZAA 2QTHA 5JSZA 2GKSA 4ZDJA 2J45A 3SN6A 3A4LA 3GLHB 1XD2A 2BMDA 4Q19A 5FBWB 2IXFA 3WNDA 3T34A 4BASA 4UXIA 5DYIA 3U3MA 3RRMA 3ZS8A 2P67A 3FYHA 4NYMQ 3MWKA 1XDBA 2W58A 2FFBA 2DFKB 1AGPA 2JDID 3EX7C 2ZJ2A 5F2EA 4LDJA 2QQEA 2G0TA 1TTTA 1NN0A 3LNCA 2VP9A 5FTLA 1U9IC 2JJ2D 3S1AB 1W7AA 1U2RA 1W47A 1UPTA 2J0UA 2PT7A 3EZFA 2IYLD 4DLVA 5BW8A 4PSKA 2GVDC 3WMEA 2QZ4A 3TAUA 5JS7A 3FPAA 3MGCA 2R8RA 5JHHB 3QPUA 1F48A 1F5NA 2XTNA 2FV8A 2P3SA 1T0HB 1NVUQ 2O52A 2QM8A 4PHFA 1E2DA 3ZZ0A 1MABA 1P5ZB 4Q1DA 2F3TA 1OXUA 1KI6A 5D3QA 2EFGA 4PHTA 1QHYA 1ZM3A 4DUGA 3MWJA 2ZEJA 3EC1A 2Q3MA 1XMSA 4PC7A 5FOSA 4HAVA 4EJSC 3KZ1E 2ZVPX 4DUGD 4AKEA 3WYFA 4AURA 4HZUB 4QBGB 1UBCA 1Y63A 2GWHA 3M6AA 4EDHA 2FOLA 3KKOA 1LW7A 1J8YF 4PFSA 3RS2A 5L3SB 1W4BA 3MLEA 4CEHB 1L7VC 4KCGA 1P60A 2C5LA 4URXR 4L4UA 1Q1ZA 3PEWA 1G41A 2O8DB 4ESHA 4PC2A 3G5UA 2JLVA 2ZRGA 1II8A 3O8CA 3ZD6A 3KUDA 4GRAA 4CT4B 5FUYA 1E2LA 1FMJA 4QNMA 5KDLA 3GFPA 3BORA 3P26A 4TLBA 1YZGA 4FWTA 3VU9B 3OIVA 4C7OA 3RRZA 3CPHA 5BYJA 2FFQA 3GLFE 4HUQB 2HT6A 4HB0A 2WJJA 3CZPA 3K0CA 2QPAA 2RGNA 2ZUBA 3CIOA 3TR0A 3GJ0A 2OFXA 1N0WA 4RCYA 4UXJA 5AJZA 2QMOA 2IX3A 5FH9A 2G88A 1O87A 2F1IA 3CKLA 3R8FA 1HV8A 1E0JA 3JVVA 4EIWA 2W2XA 5B64A 4D25A 3RS3A 1FUUA 3U5ZB 2L0XA 4AI6A 3FFAA 3KTAA 2GXQA 2ZE5A 1JR6A 1UFQA 1AZTA 1EGAA 2KI5A 1N0UA 2X2FA 4Q1BA 4JLAA 3L0PA 1N6LA 3SE0A 2EFCB 3KQUA 1FZQA 3AVVA 4URZR 3LLUA 2YNMA 1T3LA 2FF7A 2G1KA 5LD2B 2BVNA 4JYCA 3HU1A 2YZ2A 2CNWD 3QIAA 1WRBA 2XNSA 121PA 4P33A 2QUZA 1L4UA 2JLUA 3W3AA 3AF1A 2B8TA 1G1MA 3AM1A 4PPQA 5TB5A 4A8JA 5SZKB 3AB3A 3A36A 1Q1BA 3V4FA 3GEIA 1JR3D 3D7MA 2JJ1D 4LBZA 5DHAA 5CITA 3Q5DA 1YR9A 4B2LA 1Z0DA 2J5XA 3L82B 5DLQC 3TJZA 1PUJA 3I61A 4HUTA 5J4HA 4V0KA 2WJHA 1M8PA 1T5IA 1KO5A 3DPUA 4EPRA 2X1VA 2VP5A 1BO6A 4E09A 2REOA 2IUUA 4OI0A 3FKQA 5ANRB 2ZYTX 1E2PA 1YVDA 2JASA 2ZR9A 3SHFA 2ORVA 1Q1EA 2C96A 1F2TB 3B78A 2KBFA 3FB4A 4BFVA 2BHRA 4FINA 2XAUA 3EIQA 1YZNA 2VP4A 1FX0B 1VYUA 4XD7A 4XTRA 2EU8A 4B3FX 1W4AA 4EJSB 5F9FA 2ONJA 2D4HA 4XD7D 3UK6A 2J3EA 2PEZA 4QGHA 1G64A 3WHLA 4MKHA 5BN3A 2WOJA 3ND9A 4EQ6A 1UKYA 5JECA 2AL7A 1JECA 1XEWX 4KU4A 1VHLA 1CJMA 1ZC4A 2BM1A 1FPMA 4PO9A 2H5EA 4G1UC 3AKEA 1BH2A 4IVRA 5IF9A 3RHFA 3UG7A 1ODFA 3VMFA 1WF3A 1X8LA 2FZLA 4TMKA 5C1BA 5CDFA 4DT1B 2OBNA 5KSOA 1NMYA 1RYHA 4LJAA 1YJ5A 4IW3B 2PMDA 1XEXB 2GAAA 2D74A 4BEJA 2WHXA 3KKMA 3WBJA 2HJGA 3EPHA 2Q9AA 3L0SA 1LF5A 5EE0A 3T5DA 3A1SA 2FGJA 2JA1A 4BLPA 2NIPA 4CYMA 4ARZA 3BB4A 3IO5A 4M9SA 5BYKA 1DADA 2VP6A 4HLUC 2DR3A 2QSYA 1OXVA 1AA9A 4U7DA 3CZQA 4TN1A 1SGWA 1Q57A 2F9MA 4PSVA 4ZO4A 5TMPA 3IO3A 3QENA 1AM4D 3VR2A 1GWNA 4PPGA 4ASUA 4I1SA 5FPTA 2G1JA 3CB4A 3ND8A 4NYIQ 4ZCIA 5G41A 1Q3HA 4RD1A 3IIKA 4ASUD 1HYQA 1R10A 3IEUA 1NVVQ 4GI7A 3A4MA 4RFVA 2VIIA 3RWMB 1IHUA 1QVAA 4KFRA 1TL7C 2OILA 3HJNA 5DH9A 2DBYA 4RKEA 1GTVA 4V03A 2CLDX 1CBUA 4IDQA 3AVTA 4DCVA 3AVWA 1NG9A 1G8PA 3CR7A 4OJKA 2D2FA 4NKRA 3LBIA 4KVAA 1SVIA 1TUIA 1HH4A 5E4FA 1OFTA 1VG0B 4CDGA 3RSOA 1DAHA 4A92A 1TU3A 4HSEA 1YQTA 4WZBE 1PVOA 2RCNA 3E5HA 4QJ5A 5AK0A 4KBFA 4NCNA 5KSYA 3VKHA 2CCJA 1RE0A 2R6FA 3HWSA 4JYBA 4DZZA 3NXSA 4TL8A 4B75A 1KDOA 4IDHA 3AH8A 2RGAA 1NKSA 5BQ5A 2VYFA 4AC9A 3NC0C 2PH1A 5AJYA 1TEVA 2Z4SA 2ZRMA 2C9OA 2ZS9A 1U90A 5HKKA 2F43A 1H8EA 4ABYA 3PQCA 1W44A 2NTYC 2QRZA 3DVLA 1RJ9B 4HB3A 4QRHA 2ZI5A 3IQWA 4V0MA 4RZ2A 5KO2A 4L9SA 1H8ED 4ACAA 4ZV4A 2UKDA 1KK1A 2VRWA 2QGZA 3AUYA 4E07A 3T1QA 3UMFA 4L15A 1MOZA 2UZ3A 2QP4A 3PXGA 5KTYA 1OJLA 4FW9A 3ZVLA 2ZIAA 3I8XA 4BEBA 2WSSA 3I92A 4A36A 2ZUDA 4OHWA 4G5QA 2UVQA 1T3HA 4V02A 5FL3A 3TSOA 1ZINA 2ZRKA 4YLGA 4WXRA 2IYVA 2J0VA 1F2UB 2WSSD 4LUCA 1EG7A 1OYYA 1TADA 2ZQ5A 4M2LA 3BFKA 4QC2A 1E2GA 1Z3IX 2XX3A 4RJLA 4BFYA 5C4MA 5J47A 1XXHA 2GTPA 3CX8A 1CJKC 1NMXA 1YRBA 4QOSA 4B47A 3CO5A 4HAXA 3KQNA 1XD8A 4MH0R 3SNHA 2B8WA 3VNUA 3REGA 1ZRHA 5TVKA 5IK2D 2GCOB 4IDOA 3HP1A 4LWZA 1XMIA 2QBYB 2WAXA 3W6NA 1KZGB 3ADBA 2P0EA 2IXEA 3N5CA 3N2EA 2F1HA 4E5UA 1QG4A 4JL8A 3KKPA 4L16A 3ADKA 1US8A 3D31A 1NI3A 1E2QA 2VL7A 2B6HA 3CPJB 2Q9CA 4JSYA 3QKRB 3UWOA 1GNPA 3OIWA 5JCZA 1G8YA 2QENA 3DEFA 3TKLA 3GP8A 1EWQA 1OFIA 2CDNA 1E9EA 2D62A 1KI1A 3GLGB 3Q9LA 1UF9A 4TLCA 2VO1A 3E1SA 1OXXK 4KXFB 4OKSA 5SZHB 1JI0A 2QNRA 3THYB 1QHXA 3NKVA 5FOXA 5KNDA 1NN3A 4PQYA 1E2HA 4RZXA 4IOJA 4C2TA 4H1VA 3CF6R 2QORA 1TF5A 4M1TA 1DG1G 4GOJA 4Q1AA 5JFGA 1EX7A 2V6JA 3I62A 4GSYA 4RFSB 1WCV1 4NH0A 4A6PA 4BFZA 4YMUA 1UADA 3V9PA 4DKXA 3HR8A 1U94A 4QM7A 3K0EA 2IUTA 2ZJOA 3QXCA 4RCZA 1JQLB 1YU9A 2Z0MA 2LWIA 2XEXA 4D81A 1DAEA 3MAAC 1ZU5A 2RGGA 3TW8B 1R0XA 1QRAA 3EA0A 1Z5ZA 3OHMA 2J0SA 2ZAOA 4NCKA 4DCSA 4D26A 1XF9A 1YE8A 2QG6A 3AGPA 2OCAA 4LJ4A 4BFSA 3RS7A 4A9AA 3DO6A 3CWZA 2GF9A 2RB4A 2IYSA 1SVMA 1W46A 4PHGA 1J8MF 3EWSA 3BH6A 2CK3A 2W83A 1W5TA 3LY5A 3MFYA 3B6EA 1E2KA 1XRJA 5HZKA 3T12A 4KYIB 3M4YA 3THOA 2WMOB 2CK3D 4Q7MB 1TPZA 2PX0A 4JVLA 4JLNA 3NDBB 4DWJA 1IM2A 4NZYA 2QAGC 3WNBA 4ZIRB 3B5JA 3OAAA 4ZDIA 3AVXA 1S4QA 2QL6A 5JWOA 2Q21A 4NBSA 1P4SA 2GXSA 5EE5B 5FUXA 5KPDA 2BC9A 2ZETA 3CNLA 3OAAD 4XVRA 3C7KA 1JR3E 4JLDA 2RHMA 1IY1A 3I1FA 4IFEA 1CRPA 2XTMA 4Y0VA 1MT0A 3MJHA 2WWGA 2CHGA 1YKSA 4URUR 3TR5A 4BLQA 4DLSA 2HDNB 2TMKA 2P6NA 2IXGA 3NVAA 2AK2A 2KB0A 2N42A 3CH5A 2GVZC 1Q3TA 3R9IA 4IFBA 4NMMA 1OV4A 1OYWA 5CIWA 1GFIA 2CL7X 1ZM2A 2KSQA 3VAAA 4KVGA 4IOLA 2NZ8A 2CBZA 1Z6YA 2IEZA 4Q02A 2Z83A 5FBQB 3B7GA 2ERYA 1N25A 4UQOA 3UIEA 2NO6A 1UKEA 4OK5A 3B9QA 2WSMA 3O47A 1N6KA 1KTVA 1OIXA 1ZD9A 1CIPA 2PMKA 4QHYA 4DLRA 4LBYA 1II9A 3TQFA 4EUNA 2WV9A 1KI2A 1P2UA 2PL3A 3LVRE 1AS2A 2C95A 2WIAA 4AYTA 4BZQA 1N6RA 1JXMA 2IL1A 4RD6A 3VHXA 2LKCA 3LLMA 1M7HA 4IVPA 5J4LA 3K09C 2AWOA 1XJ0A 5E3HA 1P2TA 2ANCA 3H84A 3CRVA 2A30A 5CB6A 1AKYA 3T06B 2V1UA 3IPXA 1XFAA 2HJVA 5DN6A 4Q4AB 3EAQA 1T4GA 2IYQA 1ESNA 2ZSDA 2VHCA 5DN6D 4LBVA 5TARA 3K0SA 3AKYA 2WVJA 1E3MA 5JJKA 4B76A 2JLSA 5EXSA 2PJZA 5KNCA 2BOVA 4M21A 4W5JA 4A2WA 4B3DA 2A9KA 2QAJA 4BFXA 5M04A 3L43A 1N6IA 4MA4A 4RZUA 3UPUA 2VHQA 4MRSA 1EFUA 2QM7A 3H4MA 3IBGA 1VTKA 4LRWA 4IOMA 3GLHA 2NG1A 3TW4A 4CEIB 4ON9A 3FWYA 2QT0A 4GZLA 5EXXA 1AS0A 1N6PA 2DHRA 2W6IA 3FTQA 2VP2A 1ZC3A 1Z0FA 4FMCB 4ILEA 2HXSA 1G6OA 3GLFB 1XTIA 4PC3A 4R98A 1NN1A 2W6ID 1Z28A 4WIAA 2IK8A 1NBMA 2WOOA 3AVUA 1GL6A 2FWRA 4CT5A 4KLNA 5GVSA 4LJ7A 1SKYE 2N1BA 3AP2A 1NBMD 1SHZA 2QROA 1Q44A 3W5JA 3U44B 1FQKA 1S1MA 2A5DA 4BUJA 2X8AA 3IILA 2G3YA 2ODEA 2QAGB 2GJAA 2ZRCA 3BFXA 4PAMA 2WWIA 1XTKA 4P0TA 1Z0KA 4HLDA 3RS0A 2ODWA 1AS3A 3GJXC 4B2IA 1LY1A 4MRRA 4BGDA 3OE7A 1U81A 1CTQA 1D9XA 2OESA 3TUIC 2AFIE 4YXWD 2DY1A 3OE7D 4D0LB 2PZEA 3QG1A 1R5BA 1SVWA 4JL5A 3R9XA 4LC1A 4CEHA 1N2CE 1XMJA 5GJWC 3ZYCA 2ZI4A 3UMSA 5SZIA 3ADCA 2D7DA 1KI8A 2QI9C 1XTQA 2O8DA 4DBLC 1TNDA 1M7BA 4Z54A 1WA5A 3TVDA 5AJWA 2AR7A 5ELXA 5FFMA 1YZQA 3GJ7A 4MUBA 4M4SA 2B7BA 3VHLB 3GD7A 3A4NA 3B8HA 2B92A 3FGNA 1X1RA 4LHWA 1J70A 1JXOA 3B85A 2DWQA 4Z8XA 3ZVNA 1AK2A 2ZI3A 4CVNA 2GHIA 3OFNA 5B57C 4ZKDA 4F91B 1D2MA 3K0FB 5GADl 4B71A 5KU1A 3SBEA 3DM9B 3HPQA 1ZIOA 1I4DD 3O8BA 2X2EA 3RSLA 5G53C 1A4RA 3OFND 1G4AE 2ZRIA 5DGXA 1LNZA 2ZJ8A 3PUVA 2OEPA 3QKSA 3TUJC 4BLOA 4BRWA 2CXXA 1G3IA 3DOFA 3NBXX 4DLYA 2GXAA 1DAFA 2BBWA 1SXJD 1KO8A 2KBEA 1GUAA 3BOSA 3VR4A 3FHCB 4RVCA 2MSCB 3MWYW 2EQBA 3PENA 2PEYA 1N5LA 1Q1QA 1XCMA 2ZVQX 5TV2A 3SFZA 4DLUA 3VKWA 3TMKA 2ZE6A 3LX5A 5EXPA 1U8YA 5K8UA 2CEAA 1D9ZA 2W0SA 4OI1A 4KBGA 1S9HA 4R7ZA 4A0FA 3K0AB 3TRFA 3NC1C 4XVUA 1JB1A 5FUWA 3BB3A 4C30A 2ZJZA 2CCKA 3LDAA 2WWHA 2GA8A 3W9YA 4ZI3A 1HURA 4L5BA 4WVFA 2WM9B 3T1VA 1CR2A 4HAUA 4DLTA 5KSZA 2FDCA 2XB2A 2DFNA 2NGRA 4LYAA 2VF7A 3RRNA 1EWRA 4KO8A 3SJBA 1KO1A 4Q4LA 5FTKA 2IHBA 4JSTA 4MYHA 4Q7KA 1XCGB 1P2SA 4PR0A 1NY6A 4NP6A 1E0AA 1HUQA 3PITA 1E0SA 3CUEF 1TAGA 2LCFA 3DZ8A 1G5RA 1VCOA 2YOGA 3OIUA 3W8RA 4XSHA 3JZAA 4EPWA 4N0EA 1YHNA 1B0UA 2RH5A 3BWDD 1M2OB 5JEEA 3ASYA 1E2IA 4TQ9A 1U9IA 2RGCA 5D3MA 3I72A 3PCRB 2ATVA 2QN6A 3C8UA 4MGYR 3RANA 3LBNA 1G7CA 1M7GA 1SVOA 1JJ7A 3DMNA 3AF0A 4BFUA 4PANA 3L0OA 5FPYA 5L8VA 2J46A 4TMWA 3A1WA 3T5GA 2IS2A 5JRJA 3ICQB 2FH5B 1D5CA 1DE0A 2HLDA 2NOAA 1E2NA 3VQTA 3A8TA 3C41J 3GJ4A 1F2TA 3BERA 1Q20A 3KFXA 2HLDD 3CRQA 2O8CB 5LB4A 2AXPA 2OLKA 3WYAA 1X6VA 1SVKA 1OHHA 2O5VA 1E2FA 2AWNA 3NHBA 3GJ3A 2QRNA 4LHVA 1FX0A 1R5NA 5FOWA 2BBOA 4EJSA 2GK7A 5AR1A 4TYYA 3GEEA 1UEIA 3CX7A 3HYTA 2WJGA 1MV5A 3Q5EA 2P2LA 1KYIA 2G83A 4I81A 1NY5A 2GJ9A 1ZM4A 1AGRA 3K0CC 4F93B 4XWAA 2F55A 2OM2A 2RGNC 4M9ZA 3R7WB 1ZJ6A 2YC4C 5GJBA 1N5IA 1BOFA 1AQUA 3T61A 1LS6A 3R8CA 4DT1A 4KAXA 2DB3A 3KJIA 3DKPA 4I99A 1P61B 4UNSA 1KK3A 1XEXA 4DCNA 2DWOA 1MRNA 2V54A 1ZCBA 5L3QB 4EPXA 2H57A 1L4YA 5JHGB 4Z51A 1R0WA 4Q4JB 1GRRA 1JQJC 4GL2A 3IHLA 1ZNYA 1OSNA 4X8MA 5DO9A 3KDSE 1Q12A 1PV4A 1IQPA 3EZ7A 1A1VA 5KOYA 3Q7PA 2BMEA 4PX9A 4M1OA 4WZAE 1N5JA 1MRSA 1X8KA 2RGBA 1CULC 5GJCA 1ETUA 4MYUA 3Q85A 1JAIA 3FKSA 1ELOA 3QEJA 3HU3A 2HEIA 4YMWA 2YWEA 2BEJA 5E7IA 3FKSD 5JSZB 1E2JA 4B35A 1HT1E 2N46A 3K53A 5H1YA 5B2ZA 1COWA 1BIFA 4AWXA 2VF8A 2OT3B 3A6PC 4OI2A 1NF3A 2ZROA 4DLZA 2P65A 5A5GA 3ICEA 3EZ2A 3QUSA 1NVXQ 1COWD 1G19A 5A4JA 1ZD1A 4V0OA 3TE6A 2EYUA 3GPLA 1S1CA 2GETA 2IYXA 4U00A 3ZZUA 4DCUA 1D2EA 1XEWY 5JBQA 1VYVA 2FMXA 5FR2A 3NBZC 3MMPA 4G5RA 3SHWA 4TYPA 3GJ6A 4PXAA 4TMZA 5HE8A 5P21A 2Z43A 5TDHA 3H0KA 5JZVA 1EK0A 1VCMA 3QQ5A 1UBGA 3HYRA 3ZVRA 4LJ8A 3QF7A 3U3JA 1CKEA 1KAGA 2BWJA 2C98A 3C5HA 4O2RA 5IRCD 3EPKA 2O8FA 4F4CA 4MRPA 4HI0E 2FFAA 3PUWA 2G9NA 3B1VA 5H8WA 4TYWA 4POAA 2ZRAA 3QXXA 4QFMA 4DXAA 2XB4A 5F9HA 1QHSA 2ODNA 4QG7A 3LH5A 1RJ9A 1RRFA 1E1QA 3EZ9A 1KDRA 4D80A 2R6DA 2VTKA 1HY3A 5UKDA 1FTSA 1DG3A 2BBSA 1E1QD 4M1MA 1GNRA 3ZZTA 3QF4B 4AYWA 1Y3AA 3CONA 2J7KA 2ZR7A 3GLHE 5J40A 1Z83A 2ZSAA 4H9GA 3NDPA 3LQRA 4FMCF 2QPTA 1KI7A 3AF3A 1WMSA 4D0NA 4YMTA 2C2HA 1KMHB 4O0MA 1F2UA 4LPSA 2WWYA 2AHOA 4Z1MA 4YDHB 1VG8A 3MUFA 3BH0A 1JAHA 2CHQA 3DOEA 1AJEA 1SVSA 2BBTA 1RZ3A 3THXA 1NBME 2RGEA 3LBHA 3RS4A 3X1XA 4Z1MD 1GOTA 2DPXA 2ZRLA 4X8HA 1XU4A 2GCOA 4A0HA 4TTPA 1LF0A 1A2BA 2QBYA 3DL0A 4OHXA 4TLEA 4TZ6A 5KYKA 2QSZA 4KI0A 2JEOA 4M9XA 2VP0A 1G8FA 1KJWA 3U6BA 3B9PA 5TXGA 2VSFA 2MMCA 1G9XA 2E1RA 1FMLA 1M1YE 4EPYA 1FP6A 3K9HA 3QKRA 4B44A 3TIFA 2C04A 5LB2A 5CYOA 2ZPTX 3JVUA 4DDVA 4PSAA 4HLUA 4LI0A 3R9WA 3AVOA 1V5WA 1Z2AA 4JIMA 4JLOA 3GLIA 3R20A 4K8OA 2OUKA 4O2LA 4FN5A 3KJEA 4TMTA 3ASZA 1FQJA 1T8TA 3MRSA 4JKIA 5DNYB 3THYA 1GP2A 1Z29A 5B58C 1NSTA 4OQXA 1CXZA 5FI1B 4JBXA 2XJ9A 4TWZA 2F1JA 4JZKA 3FMOB 1P9NA 1U8ZA 3F0TA 2C9YA 5BN4A 4KFTA 4KFSA 4TQUS 2MSEB 4PZZA 3ADDA 3D6TB 3MSXA 2QTVB 3RLFA 4E22A 1R0YA 4BFTA 2O8BB 5JJIA 2A5JA 3TBKA 4MKIA 4B3CA 4WZ6A 3CRW1 2RAPA 4LX0A 5EZ6B 5E95A 1L2TA 1OXTA 4RD3A 1RRGA 3KFVA 1SXJE 5HKKD 5JWHA 3TH5A 4LHYA 3RC3A 1UAAA 2V55B 5AUOB 3KJHA 4QNRA 4A15A 4PHHA 3UATA 1TQ2A 2GBLC 1N5KA 2DWPA 4NU0A 2J7PA 3KQLA 221PA 4LYHA 3FMPB 1U0LA 2G0NA 1Z2CA 3LW8A 5FUVA 4MRVA 2J7PD 1UEJA 2V9PA 4FXPA 1QHIA 4YMSA 2NPIA 1IN4A 4P31A 4LZZA 1N6HA 2NZJA 3IPYA 4QL3A 4GOXA 2ZI9A 4DSNA 1Z6AA 4LGMA 2CVHA 3EZ6A 1KO4A 1KSFX 4Q7JB 1OLOA 1G3QA 3LAWA 2ZE7A 4DHEA 1OW3B 1W49A 1UJ2A 1SULA 2ZRBA 3QKUA 4JKYA 4ZIRA 2OFWA 3CRRA 5K8LA 4D4JA 2ZANA 4Q4HB 4I1VA 721PA 1G7SA 1II0A 1FL9A 2PCJA 3WP1B 3V4RA 1P9RA 4A2PA 1RKBA 2YV5A 1P73A 1KKLA 1XWIA 1SVLA 3A1UA 2O0KA 4P4SB 3SZRA 4C9BA 1CRQA 1QHGA 3AF2A 1KZ7B 2YOFA 2Q3HA 4QJ4A 1QVRA 2R9VA 2WWFA 3OEHA 5EP2A 3U61B 2H1LA 1U8AA 1Z6XA 3EW9A 3FE2A 4ARZB 4Q1EA 1HA3A 2FE4A 1PJRA 3OEHD 4QBFA 2CJWB 1OH8A 4EKDA 1ZP6A 3C5CA 1JPNA 1DAKA 4NPHA 4RY2A 4A6XA 1UKZA 2O0JA 4YONB 2IWRA 2OV2A 5KDDA 5JCPA 3EG5A 1OIVA 1HEIA 5EE9A 1JALA 4NCHA 1K5GA 1A82A 2ZUCA 4JVMA 3QBVA 4FCWA 2VQSA 3EPJA 1SKYB 1EFRA 5G40A 2FEOA 1AZSC 2AXNA 1ANKA 1S2MA 2OAP1 2Q3FA 4GMDA 4KSBA 1GVNB 2GCNA 2W2TA 2H16A 1P9WA 1EFRD 2NO0A 2ZYVX 2O8EB 2PZGA 3KB2A 1G6HA 2YKGA 1LFDB 3BH7A 1QHHB 2GJKA 1NL3A 4A82A 5KSPA 3PG5A 3KUCA 3ZGXA 2J87A 2BCGY 3BGWA 4P3YA 4D0GA 4OQLA 1OH6A 2IS4A 2WMNB 2RGDA 4F4IA 1EFCA 2BDTA 2C03A 1G3MA 1ONBA 1H8HA 4LJYA 2IYTA 1E4VA 3AV0B 2GF0A 4Q4AA 5EJEA 3FHTA 3P1JA 1T5LA 2LKDA 2WKPA 2EW1A 1M6NA 4Q5IA 4FMDF 1Q22A 1H8HD 2YWFA 3H2YA 4C0AC 4O3MA 2VLIA 1YR6A 3B1ZA 3QKTA 2GESA 3AVQA 1TUEA 4NTZA 3AVPA 2JATA 1CJVC 4QGAA 4DLWA 1EX6A 2F43B 4KODA 1XPOA 2IYWA 1QZXA 1Z6GA 3W6PA 4B43A 1DTSA 4LV6A 4AKHA 2XXAB 4D6PA 1W4RA 4ZDKA 4CEIA 1NVWQ 2CVFA 2EFDB 4IJMA 4DVGA 4CF7A 1XJQA 3KQHA 1W36D 2HCJB 2GK6A 4W7SA 1G5PA 1E9DA 2FPMA 3QG5A 3A58B 1E9RA 3IIMA 1MO4A 2HV8A 4US1R 3GLFA 4BWYA 5AUNB 2VBCA 3AVYA 2A2ZA 1NRJB 1D2NA 3NEYA 2FU5C 5C18A 1GM5A 2BJVA 4DLXA 1IONA 3K70D 4OI4A 1E9FA 1VECA 1AN0A 4Q66C 3U7EB 4DSUA 1GG2A 3BXZA 1EFTA 1KJYA 4AG5A 2CLCX 2BMFA 1SZPA 5LBIA 5C4GB 2ORWA 4EPTA 5F98A 4RZ3A 1NG1A 2RKOA 3REFA 2WJVA 3PUXA 5JJLA 3UG6A 4PZYA 2QAGA 4TL9A 4GP6A 3SEAA 2ZRNA 4HDQB 5FTMA 3LXXA 2W6JA 4YDSA 3F3YA 5J4VA 5DISB 4KV9A 4UNNA 4UKDA 4DRZA 5KUTA 3U7GA 3PVSA 1KI4A 2W6JD 2JJ8A 5J5CA 3WRXC 4X8OA 4OQFA 1NKTA 4JJZA 2ZJBA 4CRWB 2OFOA 2XSZA 3UMRA 2OBMA 3FMFA 1AIPA 1R7RA 1ZUIA 3UWKA 5EE1A 4DIEA 5LDDC 2HCBA 3PFIA 3FVQA 1CR4A 1VKJA 2XSZD 1PUIA 5HPYB 3AEZA
chains in the Genus database with same CATH superfamily
3D3QA 1ESMA 4KIJA 3PQFA 2XQKA 3GDOA 2QEQA 5FL7A 3AT1A 4EW2A 5LQMA 2A3RA 1TEXA 3Q88A 2I1QA 2WWWA 4Y6SA 2CC2A 3VPXA 2AK3A 3ZJUA 1XPUA 1GR1A 2V6IA 3VJMA 2QDKA 1J07A 4EHNA 1IFXA 3BRSA 1EVEA 2FF5A 4P58A 2Y76A 4AZ3A 2VTDA 4OUDA 2OCGA 3WGVA 5K45A 3FMIA 4HZGA 4CLOB 2ONKA 5LR6A 3H5AA 4KQEA 1UFOA 2QMUA 1JEDA 3F6YA 1FDTA 1LDNA 3KQOA 1DLJA 4L07A 4J0QA 4M0LA 5IC6A 3WXMA 3HMQA 3GC6A 4IIXA 1T3SA 2Q6OA 4JJIA 1JQ5A 4J43A 5MFPA 2VHTA 2HRZA 4MW7A 4U7PB 4BNXA 1VG1A 2O2SA 3GVPA 5BV2P 5JMOA 1Y9AA 4IJWA 2ZQYA 5TIIA 1T4CB 2WAYA 3QLVA 3UGKA 2PLWA 2HA2A 2R5NA 4HYYA 4EFMA 2EFEB 5CXSA 4P53A 3KQVA 3W3AH 4B2YA 3K2BA 3D7SA 4OXNA 4C0BA 5KX5B 4HD8A 2VJDA 1JFTA 3DW1X 4KE7A 3TCKA 4CIYA 4KJXA 2JCSA 5G4KB 5H4HA 3NFRA 1XBTA 3RV4A 2LBPA 3W77A 4KQXA 3BXOA 4DJAA 1C3LA 1ZHHA 2A5FA 4K0KB 2CCGA 3LCCA 5LMNB 1WBBA 4FQ8A 1KTIA 1YRQA 3FHLA 4W5HA 2XNDD 5K6AC 5K0TA 5K2OA 4ZVOA 2LW7A 2NU6A 4EVQA 3MHTA 1F3OA 4EB8A 4YJHA 4HQFA 4OA5A 1T0UA 2IU0A 4UMVA 3ZX4A 4E03A 2ZJAA 1CUEA 2WPDD 3KQWA 1Z07A 1OH7A 3TXYA 1VIYA 4NS1A 5GOZA 1FDOA 2J5RA 3S1AA 2AC7A 3OEYA 3Q72A 4DJTA 2NO7A 4W9NA 4NH4A 2BGMA 3KR9A 5CTAA 1JE1A 1K7FB 1SNYA 4R0VA 1YCHA 3SVZA 4WN3A 3EOAI 4OXQA 2OVFA 5EQJB 1T6NA 2G40A 2VZLA 4B4KA 1OGIA 4KFCA 1NYLA 3A11A 4JJFA 4PLWA 3SLKA 4YUYA 4IIVA 1U9ZA 1NW6A 4BN5A 3U4DA 3QKIA 1T9KA 3QNUA 2OCBA 3DE0X 3KOYA 1Q7TA 4CFZA 1NQAO 2OZLB 2ZYUX 4B85A 4XSVA 3IAEA 2HL6A 5ESRA 3TEJA 3VKGA 2AMFA 1IOVA 3KKEA 3PC8A 5ALYA 3V9AA 2VT2A 3RV3A 1VIVA 1HLFA 3TCNA 1YR8A 3PNPA 2IPXA 4R71A 1IYZA 3H2HA 1E3QA 1A71A 1G3UA 2Q1TA 2YRXA 4GPAA 4MUXA 4OMFG 3UHJA 4MIYA 1X77A 4U1RA 3U3KA 2B4QA 4C2TA 3TGWA 2CXNA 3WL8A 2FSGA 4M37A 3NLLA 3L1JA 3ZDFA 2CJFA 4CCAA 4CMCA 1QHNA 1W0JD 1LV7A 5JZBA 1KU0A 2ZRFA 3ZR4B 1E66A 2XZDA 5DX1A 2F67A 1FQWA 3FYUA 5FAXA 5HILA 3E9CA 4D9KA 3LPCA 4TRNA 4MR8B 2HM7A 3PEYA 1QG2A 1V6CA 1JDSA 1V4BA 4C89A 2PUFA 3MWDB 2IYNA 5AQ1A 4PGFA 3TEFA 3RTGA 3VVMA 1RWNA 2IEYA 3QE0A 3F6BX 4W4TA 4KN6A 1LTQA 3MMSA 4C05A 1PJBA 2DT8A 4G0VA 2JIZD 2A0YA 3CLSD 5ITZA 3VU9A 1VL6A 4R2KA 4JASB 4LX8A 3X2FA 3QGMA 3WI7A 3V4OA 4G6ZA 2EW2A 2NUPA 3WHKA 3KKNA 4JCOA 4B6OA 5B6JA 2PU7A 3VSEA 1WUKS 3ZDRA 1AUXA 5JXJA 4KR2A 2JBAA 3J7TA 1GRQA 3FPKA 4UASA 4M60A 1GKYA 2HGSA 3TF5A 1M2NA 2I2FA 3BHIA 2IYUA 1L8OA 4BO0A 2XITA 2X4LA 1ZUD1 2ZSEA 4HVAA 3K73O 1UL1X 2IHKA 4FM9A 1M2VB 1B0ZA 3BMQA 3Q8XB 3I8SA 2RHRA 4OHZA 1Z5VA 1Q1AA 5DSZA 3UJCA 2B35A 5BSKA 1KDVA 4GZ3A 1XF1A 2Z4RA 3WY9A 2CLHB 4DUZB 5BVHA 4YPVA 2KWIA 5JAIA 1DBSA 1P0FA 1VL1A 2RGWA 4MW5A 1S3GA 1QZTA 1RM5A 1IXZA 1QMGA 4XKJA 4DIKA 2RJ3A 1JJVA 4PZ9A 4DADA 5JSQA 2UZIR 4N5IX 5SY9A 3U7FB 2ZWOA 2JLZA 1YACA 2VZ9A 3W90A 4CM9A 3IAXA 4NZ9A 2ZIEA 5FOUA 4C1BA 3PGXA 1CEQA 2J3HA 2AG6A 5BN5A 3QMVA 4KO3S 1YDEA 2PPLA 2F9LA 3KHKA 3DEHA 1LQTA 3SI7A 2A5GA 5FD8A 5BWOA 3FOWA 3DMDA 4JLKA 3U1VA 4ETNA 3N1UA 3WWCA 2JGNA 5FTJA 1J9GA 1PWXA 1HE5A 1E69A 1NP3A 4CQJA 4MO9A 4IRMA 2JDIA 4LJ9A 3ZE1B 1W2GA 2XB9A 5HDQA 4MQBA 2IWHA 3ZLJA 2YINC 2WNHA 2NQ2C 3KTOA 1CQPA 1E1DA 3GGSA 3QELB 3KJXA 1T6ZA 3SM9A 1NVGA 1YOVB 2PM8A 3BBLA 1LJ8A 2C5HA 2OCKA 2WWXA 1OXKB 2HKIA 2VZ8A 3Q12A 5BRJA 1QQAA 1VA4A 5ECYA 1K4MA 3WDLA 4BEWA 5TNXA 4UUNA 1H5NA 2C9ZA 3LKVA 4W7HA 3ZNNA 5AKLA 4CV1A 2VDOB 3SVTA 1VM6A 4MDYA 1DFIA 4IXDA 2BT4A 3SSAA 4N82A 3AKZA 2HF8A 4I14A 2JJYA 1CD5A 4JBYA 2NO1A 4URWR 3IX7A 2NNLD 2RK4A 2SHKA 4MGZR 3SC3A 4D8XA 5MHTA 2HIAA 3NBUA 3EMKA 3TQIA 4LK3A 4ZTUB 3PDUA 5DWDA 1V7QA 4LRYA 4KO2S 1NOJA 4N9QA 2FJUA 2WK1A 2FWAA 3GLVA 4G26A 2Q8NA 4WL0A 1I7QB 2I2AA 3TECE 2WM2A 3PD7A 3OU2A 4DA6A 5BQPA 4L7VA 3PFWO 4IICA 3ZWVA 1CY1A 2AS0A 2QTTA 5AMXA 4II7A 3KTFA 3RIEA 4L4ZA 1J1ZA 2WINI 4LKOA 1ZWKA 3IUYA 1BKDR 2GBCA 4MYDA 3U62A 5DASA 5I8ZA 4JR0A 5L40A 3IQGX 1M9NA 4HTAA 2BFBB 1YT5A 3QNMA 1X39A 2P6PA 5JSKA 5JE8A 2OGZA 3R9XB 1YJBA 1PR5A 4X8LA 1FBNA 3BUSA 1RQNA 4I1OA 2ASEA 5K0EA 2IHZA 2ZIWB 4HNUA 1XCJA 4TXHA 1JFVA 1N4DA 1M1ZA 1K6MA 3THWB 1ZW1A 4TKVB 2PL9A 4QTZA 2CMKA 2EF0A 1G8SA 6ADHA 1QX4A 2RBKA 1E2EA 4NV3A 2VSXA 2R6GA 4F06A 1LJUA 4L8YA 4RSGA 1LWNA 1ZUNB 1FFGA 1H1LB 4YJFB 3GDGA 3BJIC 2FEMA 1PT8A 2C4TA 3A1VA 2G6BA 4UDYX 4BV2A 4EI8A 3AHEA 4EH1A 4XVCA 1E9VA 2OR3A 1CS4C 5A4KA 1CDZA 4LECA 3EAGA 1CU1A 1IBCA 3KWMA 4HDOB 5ECGC 1VSBA 5HR5A 3OZCA 1WF6A 3L8CA 4UPVA 4XOUA 2QP9X 4FFRA 2EOAA 4V0NA 3X2EA 4LC0A 5DM2A 2P2GA 1Z6TA 3MUOA 4S1NA 2V7QD 1WBJB 5LZ7A 5LOVF 2DSTA 4KJZA 2YNMC 4WECA 3VKVA 5HCNA 3QKSB 5BNTA 4FWIB 3N75A 3DDUA 2OWEA 4MVWA 5C5CA 3CA8A 2FWBA 1TYAE 2C77A 4YP6A 3UT6A 3R3VA 2VPYA 1TT7A 4UZFA 3HBJA 1ZD8A 3F9CA 3RM3A 4Q4CA 2H18A 1K3UB 2GRJA 4IJVA 4WLUA 4DV5B 4W5QA 2GCPA 1GZHB 2HU8A 1S6YA 2NTEA 1ORDA 1YZUA 3GNSA 1DP4A 2E3JA 4KE6A 4UD2A 1AB6A 5IAEA 3EIXA 1E2MA 4YAGA 1I3KA 1IN6A 2Q5JA 5B1EA 2I91A 3OUTA 3EXFB 1KEWA 4UMFA 1K89A 1SB9A 2RG1A 3LRTA 2JLXA 2VYQA 2WP8J 1RHQA 1XAIA 4TV8A 4MSUA 1DBPA 1U3CA 2JC3A 2PWYA 2I62A 3H1PA 4Z5XA 3JQGB 3FBGA 2GJ8A 3TL6A 3EG9B 3FUVA 5KQSA 1VC2A 3DMGA 3PYMA 1LLCA 5BXQC 1VE3A 2I2XB 5E1MA 2QD4A 1NYTA 1OBHA 4W1PA 5BSHA 1UDCA 1WDTA 3NASA 4YT4A 4AG3A 3KG2A 1WHSA 1JZTA 2WNSA 4JBGA 4JNKA 5GONA 1NC1A 2DBVO 1K8ZB 2E18A 4FLMA 4OQZA 3ZIUA 5EA2A 5LU9A 1MABB 3ZU4A 3GJQA 4MUFA 3U60B 3VNSA 3RF7A 3RPEA 1JDJA 5L7WA 3PEFA 2VUSA 2ZJ3A 1WHTB 3HB1A 5JD4A 3ZJVA 1GZ6A 1OFVA 5AHOA 2BGKA 5AVWA 2IS6A 3M3PA 1MX5A 3DL4A 1B26A 3A6DA 2CFTA 3R5JA 1YGPA 2Q07A 2FRDC 2QMEA 3W2EA 4HEJA 5DBEX 2O8BA 4DEXA 3DXZA 1A5TA 1FNSA 2PG3A 3CW8X 2EDAA 4FFOA 4IGEA 1XZFA 4OK3A 1EA5A 5JANA 4W9MC 3LF1A 3ECCA 3WO0A 4QPNA 3RUFA 3SBDA 3VKUA 3EMVA 2OCYC 4Q1FA 3CBQA 1L7RA 2WIBA 4GGOA 1Z0IA 4RA9A 1KSGA 4TN5A 5HRCA 4LZNA 2Q4BA 3L7NA 3TVTA 5L4NA 2V6GA 1VYTA 5EUQB 5IC5A 2CFOA 3OQNA 1FNMA 2O0LA 3JQBC 3M1IA 2P9QA 4EG6A 1UPCA 2PANA 5TS2A 3UB4A 2IC5A 5LP6F 3GJRA 1TRHA 2Y71A 1VE1A 3QMMA 1C8KA 1H6CA 4GH5A 4JEHA 4N0MA 1LRKA 1YDFA 3GGPA 4U7WA 4MKFA 5HTKA 1G5IA 3FWPA 3GROA 4GQBA 2CLLB 2FE1A 4EG3A 5B4UA 1HRKA 3WGKA 2A9JA 1IXRC 3Q3JB 1QQ5A 3V2HA 4DB4A 4UEQA 1TCVA 3X2SA 1GZDA 4Q4DA 3LFTA 2YWCA 3S6JA 4BGVA 3K16A 1SUCA 3GEHA 4FYWA 3KOWA 2QMHA 5IT5A 1CC1S 4WN9A 3RVNA 1Z18A 3P20A 1TYZA 3DEAA 4NCJA 5BNFA 4DA4A 2PJRA 4ZT7A 1JDNA 5GV8A 3C43A 3K96A 4JXJA 3Q7EA 5LQUA 5IHXA 5KMGB 2CVOA 2Y1EA 3HXPA 1XLTC 4BB9A 1N2BA 2FW6A 1FSZA 2HZBA 3MGKA 3O26A 4QRIA 4HAZA 2F7SA 1A7JA 1QZZA 2DMRA 3NOQA 4WAUA 1WCWA 2C9CA 4MICA 2ZS8A 3EIWA 5DK6A 4HGRA 3VX3A 1KMIY 2XHEA 3TNYA 1E7YA 2PCLA 1FFAA 3L1IA 1IZ8A 2AN5A 3BFPA 4E5DA 1BDJA 1K7CA 3EXHB 1HO3A 1LU9A 3ZGYA 2DX7A 2GILA 5LQSA 2XT9A 3IHWA 2P2CA 3LQQA 2F3UA 5DKFA 3VZPA 4UTXA 3AMVA 4YN3A 2I6UA 3BS4A 1AK9A 1BX0A 1IN7A 1KDTA 1W1IA 1ZEJA 2CYBA 1P6XA 2TMDA 3FG9A 5KPJA 4IXMA 4BO7A 4A8JB 3WKBA 1KWKA 2IPNA 4H31A 3T7AA 5FI3A 4JU8A 3BWEA 4AP6A 4HXGA 4LRQA 4PZUA 4BAUA 2B3TA 2PKCA 3COJA 1KYVA 4MUKA 4KNYA 5AM0A 2H63A 4UVEA 4R1OA 4YJGA 1VCIA 1G9SA 4MK4A 4RS4A 4B81A 3ZWAA 1Y3HA 3KOOA 5I7EA 2D54A 1ZXXA 2JB9A 1B1AA 1P72A 1QHHA 5JASA 1PYGA 3SC6A 3AFIA 1PX2A 2Y3IA 2C2GA 1DSSG 2QLMA 2PH7A 3I9FA 3QFRA 5DYWA 5EJ7A 3MF4A 1Z34A 1GITA 4MGEA 3UKJA 2VG8A 4QJ3A 3K6JA 5ADVA 4LGCA 2AKAB 3GR6A 1QAQA 3L8EA 2ACKA 1GAJA 4DC0A 4ZO6A 4ZGBA 7REQB 2O8FB 3GA5A 4QEDA 2FUKA 4YP0A 1GRNA 2HF2A 2I55A 3C16C 1ZVQA 3MJSA 1RMTA 2X1HA 3ANSA 3C6BA 4UUPA 2IIPA 2G8LA 2X0JA 2VJOA 3COYA 3LPNA 4FHDA 1RJGA 4RQTA 1QAMA 1VL2A 2B5VA 3A9TA 3AHGA 4MEBA 4RCVA 1RQXA 1D4FA 3UT5B 3NP7A 1CDOA 1P0PA 2IT1A 3G85A 4MP3A 3DL2A 2AOWA 5DP2A 5L3VA 4ED9A 1V1JA 2PZKA 3D6UA 4AKIA 3VO9A 4K9DA 1ES9A 2PL1A 5HMMA 4EZBA 5BN3B 1JAZA 2VSOA 1DAMA 1HTWA 4D2IA 1RLJA 4KVZA 5C8YA 1F1BA 1XX6A 2HA0A 3FD8A 4I5FA 1QVWA 3I28A 2DPMA 5F7JA 3D0RA 4C01A 5KOHA 2IEGA 3DDCA 4U7HA 1O94C 2ZZKA 4LHZA 2VHUA 4CM5A 3KE9A 2VK2A 4D9FA 4OHKA 4YWJA 1TJYA 3F73A 4PLZA 3RTAA 3QJ5A 3ESBA 3HB5X 1I4EB 2ZG6A 3TCXB 4AYXA 3EOBI 2NV6A 1QRTA 521PA 5DMHA 1EUCB 5JFTA 1CY2A 3HCDA 4MVJI 1KKMA 4MYCA 2LXNA 1GVHA 1HFJA 3L05A 3MA0A 1IHYA 4REQB 3PGVA 1Y6FA 4DQXA 1P3JA 5DIFA 2GAOA 2QA5A 2R8ZA 3EBOA 4WXHA 5BSGA 4WKOA 4J9UE 3FUUA 4U0JA 4IIYA 3STTA 2M98A 1UMDA 3KS9A 2DJIA 2G71A 3FHOA 3THXB 5IK2A 5SYAA 1VI5A 3IP6A 1SC6A 1K66A 4WINA 1SY7A 3V8RA 1P8AA 2JIDA 2VAPA 5ENDA 2A3NA 3FRHA 4P7BA 1ZM7A 1E7QA 3IB3A 1XTBA 3HRHA 3NC4A 3IOMA 2CZCA 4WXEA 3VHRA 5ITVA 5KNBA 4BQIA 1KQOA 1ZJYA 3JAKB 1WOMA 3W1VA 2ZRHA 5EAIA 1ZW6A 4X63A 2DSNA 1YCFA 2GEVA 4Y1RA 5FFFA 4G2NA 2C7VA 3TNJA 3JAWA 4I4TB 2WABA 3R40A 2OFPA 3FLAA 1HKHA 4UQLA 3FJ1A 3JZMA 2JFGA 4NZMA 4RF2A 1OA0A 1SAYA 1QIKA 1XA3A 3EVGA 3A1TA 1E5QA 4TT3A 4C4OA 4F0JA 4E21A 4PC1A 1H3FA 2C4NA 2R7MA 1QF9A 5CK5A 4UE2A 1KNQA 1EXMA 1KQ3A 2JA2A 4XVQA 1ZI6A 4YHBA 2QKYA 1JIQA 3U9LA 5BNZA 4HDMB 3FUTA 1MENA 3VR4H 1K7XB 3L8FA 4Q12A 2B5WA 3MHPA 1PR3A 3LT2A 4DMHA 3LUFA 3EHDA 2C1XA 2IYZA 2V7PA 1KHTA 3MBIA 5CJ2A 3MNFA 1XVUA 4IXNA 1ZRNA 4RF5A 3U9TA 1E89A 3VZSA 1AQYA 5JH7A 3RHZA 2UYQA 4MVJG 5E6SA 2GPBA 1X9HA 3E7PA 4W6ZA 5B5SA 4XYLA 3ICCA 4HQOA 3I52A 3NETA 1PEYA 4TSFA 2AVDA 2AR0A 1NXXA 5C1DA 3SR4A 4AJ4A 4OSEA 1TLLA 4OHVA 1BWRA 6GPBA 2R96A 1N8TA 4R7GA 4AO7A 3F6SA 3KVYA 1CLUA 2CLMB 3GJTA 2NUAA 5GJVC 4D4LA 4BE7B 4M55A 2V3VA 5FTWA 4Y2RA 1DS6A 2MSWA 3E58A 2C7OA 4RAQA 1TIKA 4RD4A 1D8TA 2IHJA 3D5TA 2HRCA 4FKMA 3H97A 4IIUA 4UCQA 3R3JA 4DA8A 4ECAA 1ZR2A 1NUAA 4HEA1 3FH0A 4AMUA 3QFSA 4I19A 4G0UA 3KYCB 4BQSA 2ODPA 1SC9A 1PCXA 4LHSA 4U7JA 5FOTA 2H07A 5H83A 3ZHZA 4C0LA 4EJMA 2H31A 3ND6A 3WP0A 3I2KA 4DAEA 5FBVB 5DLPA 5EP1A 4RTOA 2FZKA 2Q3EA 4B33A 2F8LA 2RONA 3K70C 2LE0A 1A27A 4B3JA 1MZPA 2I7TA 4H7KA 3FFBA 4BB0A 2DPLA 1B93A 5EKUA 4WY5A 4KC0A 3DZHA 3CU5A 3R1IA 5EIEA 2QUKA 4IZIA 3FIUA 3TIIA 2AD1A 3E2MA 3NTLA 4IDPA 4F9FA 3G6KA 5AKEA 4KPEC 1QJ4A 1LSJA 1T26A 3MRVA 3KOXA 3OP1A 3B3AA 3ROKA 1Y89A 4ENQA 3U37A 5DZSA 3BILA 1YQDA 2GN9A 5ICEA 1TQ4A 4ARIA 1QK3A 3EISA 1PAUA 5HYVA 5AUPB 2ZGVA 5GMOA 1KQFA 1L8AA 1SK9A 2J4CA 2WHQA 4GS5A 1G7RA 1U6JA 3GD5A 1CUWA 1BHJA 2IY7A 4N6GA 1TT5A 4OB7A 4RO0A 3RYIA 1IZ7A 1ZQ9A 1TPYA 2ORED 3ENNA 3JATB 4W82A 5CIQA 5KI6A 4WZAA 3V4PB 1TCCA 3W34A 2J1LA 3HPRA 3IDOA 3E4CA 3SX4A 2IV3A 1Y48E 1NJFA 1ZH6A 1UBNA 3PUYA 2ECKA 1NW9B 2O2IA 4XIGS 4C21A 1HI9A 2WIGA 3BA1A 3LD9A 4PGGA 2LVBA 1T5TA 4PAOA 5EZQA 5H59A 3WQSB 5FJJA 4EBFA 1P2FA 4F92B 3RAFC 3IEIA 1B73A 3I9JA 3IQEA 3MMXA 5JQGF 2WYWA 1JKFA 3MWLA 1UT5A 3MW8A 1R8QA 2R85A 4J0FA 3U3OA 3VZQA 1SG6A 4S12A 2I1LA 3ZN2A 3AJ9A 3DFUA 4XJVA 2IP1A 3MJRA 4GX5A 2DLDA 2ZRQA 2H7CA 1CV2A 1I2AA 1LRJA 3ITKA 4KXLA 4PG4A 1T0PA 3W04A 4ZT4A 3E27A 2A59A 5DHTA 2D7JA 1TXGA 4WCFA 2B7CA 5D51S 3WRXA 1IEVA 4KQ2A 1VRCA 4GP7A 4TWAA 4GE0A 3TTYA 3BXGA 3RS5A 2EJBA 3PC3A 4AX4A 2I2DA 1M6VB 4MA5A 5BMVF 2HIMA 3NKLA 3JQRA 3D4NA 3QBTA 4NYJR 1ODCA 3E81A 3U4IA 4IRUB 1LCIA 2DCUA 2NUTB 4MW9A 1P4AA 1ZKDA 4NBWA 3HO1A 4WXPA 3I2JA 1I4TD 1L4BA 3VZRA 5FWYB 1TIPA 3LX4A 1E1RA 1I51A 3CTMA 1V8BA 4LMPA 1U5BB 2R44A 5L3RA 5AVZA 1NM5C 1X3SA 1HE1C 1W5BA 4K9LA 1Z6PA 3MCVA 3HFSA 3RIXA 5A5VA 2Y1XA 1ZBDA 4FD2A 4GAEA 3TQOA 5FLYA 4YPFA 4QT4A 2XYQA 5CLQA 2VJKA 1T8UA 3HCEA 3AESB 5F7OA 1B16A 1IIRA 3ZXIA 1QOZA 1XZPA 2AOVA 2RHLA 3SS8A 1C4WA 3TQTA 3U4AA 1DC4A 1XMPA 4P4TA 1OBCA 2FKNA 5ALSA 5B2EA 5A02A 3K6KA 2JGFA 4TTQA 5F35A 2D1QA 3QEMA 2FHPA 4MVXA 4TL7A 3MB5A 3MG9A 2Q6KA 1G9TA 1ZMOA 3FPLA 1RC8A 5HWSA 2V59A 1AQIA 2GZDA 4XYGA 1NN5A 3GH3A 4J0CA 2CBGA 2H00A 3NATA 4Y9UA 1LS1A 2Q4TA 4GPTA 4Y2XA 3ZIAD 2HREA 3DB2A 5M34A 3A6KA 1W36B 2QXYA 3LX6A 1XR3A 5G3YA 2XWSA 1W2WB 1J7KA 2I1VB 1DAOA 2JFUA 3WLPA 5T6BA 3TFOA 1CS0A 2GHTA 3K0HA 3MVEA 2YCLA 1ZJWA 4G84A 1C1XB 1ONPA 4ITRC 3L7YA 5DCWA 2BRUA 2ILVA 4K2HA 4MIOA 4B9EA 2H1IA 3H04A 3VTZA 1QIMA 3ZCRA 2GASA 3B6MA 1O95C 3F78A 1HRDA 1XTJA 4EKNB 4B7UA 5LXTB 5CB8A 5EESA 2A94A 1U0JA 1USVA 2ZBQA 3QTTA 2Q4OA 5AT1A 2OBYA 4RLSA 1Z2OX 4DC9A 4YMVA 1YOBA 4URYR 4ETMA 1D6JA 3GT0A 3OCYA 2JLRA 4DABA 3FYDA 1BMDA 1BXGA 1RFLA 3Q7SA 1S5PA 4XWGA 4D74A 2GF2A 1B7GO 1P1RA 4RA6B 5G0VA 1E3TA 4CTJA 1GL7A 3BSYA 3U7IA 2EWWA 4US0R 1NXOA 2V98A 3O8OA 4MHSA 1VRVA 2Q28A 1U7DA 2FPIB 4F9EA 2WQZA 3P0RA 1CRZA 2O0HA 2RHWA 4XCQA 4CFYA 2P5TB 4YXWA 4RIFA 3T7EA 4R8MA 1TA9A 1O6BA 3V32A 4R7TA 4FI3C 3UHFA 4C0QC 4DDHA 3PJRA 5EEHA 4LK2A 1Z08A 1ZOOA 4DIMA 1HZZA 1GKLA 4LF8B 2JGDB 1NYRA 3FM9A 4A0GA 2VTBA 1PT7A 2O7QA 5ADUS 1UKVY 2GSWA 3D02A 4RFLA 1WZUA 4MDEA 2WVGA 4GOMD 4FFVA 4JFAA 4BJ3A 1GSIA 2XMZA 2BGUA 1QFJA 1QP0A 4PC6A 2EWVA 2ZAIA 2ZYAA 4ZOLF 3LFUA 1VLLA 4J1TA 5DHAA 5TF4A 2BEKA 2KJQA 1NSFA 3KALA 2DQYA 2BZSA 3ESCA 5DI3A 5F7ZA 1P9OA 3VHXB 1QBKC 1L5KA 5FI0B 2R25B 1NXPA 1VP3A 3BMCB 3P27A 3WYBA 3P19A 3MWEA 1GFSA 3GEGA 2A0WA 1R12A 1U3FA 3CRMA 1Z4OA 3C6XA 3GJ5A 3LOUA 3LPLA 1V0JA 4EHDA 4IMJB 3RARA 4PWZA 4IM7A 4RTLA 1UBLS 2AB0A 3WB1A 4ALIA 4HGYA 5AXCA 1IJEA 1JPJA 2XRZA 5FPSA 2AD5A 3UM9A 1BXRA 1PR9A 4X0EA 1C9YA 3WIOA 3H86A 5FHQA 5LNK1 1QBGA 1QE3A 1CY4A 1P80A 4QOJA 3HVRA 5BW8A 2HTEA 3OEEA 5LD2C 4M38A 2FN4A 3WLHA 2UYHA 2FI1A 2WKRA 3BEDA 3JPYA 4PO8A 4Q18A 2NXJA 3GWZA 1YFKA 3T3EA 5A0VA 4CHGA 3HXMA 1TK2A 1P7CA 1R6XA 1HORA 2QTHA 3DL7A 1P33A 2UZ0A 4ZDJA 1VXRA 3ZVKA 3NT2A 2F90A 3GLHB 4Q19A 3WNDA 5YASA 3T34A 3QVOA 3HDQA 2C2ZA 2I78A 2R97A 3KYBA 4K5QA 2GBFA 5LDGA 3CEJA 4CPDA 4XWKA 2I8CA 3MWKA 1AU9A 3CSSA 1DDGA 2G76A 3GRZA 2PAFA 4ZEMA 2FFBA 2DFKB 1AGPA 2YIVX 2BGNA 2JDID 3MGBA 4LOHA 5F2EA 4G1EB 5K0CA 4TROA 3V8VA 3ED1A 5DM60 1FNCA 1NN0A 1P19A 5IU6A 5FBKA 4ESOA 1U9IC 5DPMA 1U2RA 1W47A 3IDAA 2FYTA 1AUQA 2G07A 1NU6A 3G8BA 3L18A 2QTCA 2GVDC 3QV1A 4JOBA 5EJFA 1H0RA 3TLCA 3G8CA 2QZ4A 4ME6A 3H9BA 3TAUA 3ABIA 3DNMA 1FVXA 1HL3A 2O8NA 2OC9A 4W63A 1QLWA 4AKTA 4PG7A 3WL5A 4D8YA 1NTRA 2YZ7A 4YFYA 2NVWA 1R0KA 4IQ8A 5GQSA 3D7NA 1PTKA 1M2EA 3N0TA 2PBLA 2QM8A 1RXSA 3N9IA 1E2DA 3PVCA 4N7JA 4U6SA 1F4VA 3C3XA 2X3FA 1YL7A 1UXJA 2WQ7A 2IU4A 1MAAA 2F3TA 1X7ZA 1MRZA 1SG9A 5JAQA 4MR7B 1LX7A 5E6RA 2Z6QA 3ONNA 5FOSA 2Q3MA 4OA8A 3SXPA 1G5HA 1NVFA 1R15A 1A50B 1M2WA 3QW4B 4TXMA 3L4KA 1RKUA 4PG6A 3KZ1E 2ZVPX 3B1KA 1EVLA 3H05A 3IOCA 3HO8A 4OM8A 1E61A 1VJCA 1UZUA 4RMHA 5AM3A 1FJHA 1KWGA 4PY2A 4OY3A 4AURA 1VLZA 4KRXA 1GQOA 5M7EA 3WL7A 4ZOAA 2HWKA 1UBCA 4MVJF 1WUJS 3M6AA 4IPTA 3WK5A 2XCTB 1F51E 1JEYA 5L3SB 3PF8A 1L7VC 5CXXA 4GC9A 1P60A 1A95A 3H1GA 1PIWA 1RZVA 3LLVA 1Q1ZA 4Q7QA 3PEWA 1VQ1A 2AC4A 1IH8A 2BEUA 3PQEA 5BSUA 4S1OA 3O8CA 4QE3A 1QH1A 4PN7A 4ROTA 3DFZA 3QTBA 3PGLA 2BGWA 4GRAA 3D54D 4MDHA 4Y2GA 3RWBA 4YDQA 1E2LA 4QNMA 3W8EA 3G8AA 1WY5A 3ROMA 1G2QA 5HJ5A 5K05A 2OGWA 3BORA 4FSHA 3OMWA 4XCVA 2WFAA 3REQA 5DBGA 5KJEA 3OIVA 4E2YA 4EHFA 4C7OA 5LYJB 2G8NA 4H35A 2H5JA 2NYRA 1SBNE 2X22A 3QBDA 3WHPA 1TJPB 2AE1A 2GKOA 2LRHA 2WU3A 4DMUB 3CZPA 4EI2A 2WT8A 3A6LA 1DEAA 3ORYA 3SIPA 1T3ZA 1FMTA 1KYXA 1T2UA 3NIGB 4Y2YA 2XT0A 3NT4A 2AG0A 1SCNE 2J85A 4BBZA 5FH9A 1GTRA 1X80B 1ISFA 3W1WA 1HV8A 3HQ4O 5L45A 1E0JA 1MC1A 3JVVA 3CINA 2W2XA 3L7OA 4G5FA 4RHYA 2L0XA 1Y5MA 4Y6GB 3TRKA 4H7HA 1RI2A 2R5FA 3IESA 1HC7A 1Y8CA 1BVRA 4H0NA 3FTNA 1CUZA 4FE7A 4MB6A 3SE0A 4D9IA 3O1JC 3AVVA 4JJ8A 1JIIA 3TZ6A 4URZR 1P4JA 1NPYA 4N5MA 1DJLA 1F8UA 1V41E 2CMGA 2VDUE 2VTEA 3G3EA 1FXWF 3OJWA 1QORA 5EWJA 1FPQA 4UEKA 1KY5A 2YZ2A 1WRBA 4EUEA 5I01A 1L4UA 2YNMD 4BO8A 4YRNA 2O1EA 2B8TA 5I9IA 3CKMA 1G1MA 3Q8KA 2FUCA 3ZDAA 4KNWA 4M7OA 1L3IA 1Z0SA 2X5JO 4DLAA 4LZLA 3NPAA 3QVGB 3JARB 3A36A 3WMWA 1YL5A 3VU8A 2IY8A 2GHRA 5J2UF 5EN4A 4O5OA 1PVVA 4PONA 1E5DA 5D84A 1CVRA 3QRWA 5CVUA 2VBFA 1MC5A 4LBZA 4WESB 5L4SA 1XMOB 2H4XA 4YRPA 5IANA 5HRUA 1YR9A 2PFSA 1Z0DA 3M70A 3LRXA 1PUJA 4CMJA 4HUTA 3I61A 4HNTA 1HLDA 2FFRA 2WJHA 1M8PA 1UFKA 3FSGA 4MPTA 4MQEB 4QUAA 3VAZA 3DOJA 1BO6A 1X92A 4BQEA 1QFMA 5DNAA 3FKQA 1W87A 3HUDA 1RT9A 5ANRB 1YVDA 3HUTA 4YQEA 1RTKA 3SHFA 2UUBB 2WFMA 4FBMA 4NZPA 5AW9A 3FB4A 1V6SA 1LVHA 2OQ2A 2XAUA 4HPWA 2I6QA 3H9JA 2Y2UA 4XD7A 3E5RA 5ALKA 3PPVA 4EJSB 4RHFA 2D0OB 1KR5A 3D6HA 1CUXA 1I7NA 2ONJA 4MQ5A 1T1EA 2Q5LA 4MCJA 3CSDA 1WY7A 3FF1A 1G64A 4QGHA 4YWHA 2WOJA 3FNEA 3LQ2A 2NVUB 1UKYA 3IERA 1U8FO 4EQ6A 1JECA 3KHUA 3WGJA 2FAXA 4F2HA 4EF4A 4ZYUA 2ZB8A 2VXCA 4DPMA 2MR6A 3L0YA 2BM1A 5K8JB 3ZDCA 1T8YA 4PO9A 4G1UC 1NUHA 4IVRA 3GXOA 4MJ7A 1QPZA 1CPYA 3ER8A 3A6GA 4PFJA 2G04A 3IUSA 5HFAA 3UG7A 1P0IA 3VMFA 2MU1A 1PDVA 2OBNA 4MEAA 3OCJA 4XX0A 4DT1B 1PFWA 3CH7A 4QPPA 3L7BA 1ZI8A 1YJ5A 3ANTA 1WV1A 3NV7A 4FEGA 3GIWA 1CK4A 1XEXB 4NCAA 1XNHA 4HC4A 4CMGA 4BWGA 2WHXA 3GPBA 3VPDA 3ZH2A 4YRAA 4GLFA 5ALWA 4YECA 1DBQA 4X44A 2I4OA 3PNMA 1LF5A 2BFWA 4F56A 2BFCB 1ZIYA 2FGJA 4QYTA 1QR6A 2W2KB 2VWPA 2WFLA 1HL7A 2LP4Y 1EGVB 4KSYA 4CUZA 4FB5A 4IGIA 3R6TA 4ZVTA 4X64B 1E6WA 3ZV7A 4EECA 4ARZA 3DTTA 3OZWA 4MUYA 4QAQA 5AKGA 1ORWA 1DADA 4ZZIA 1H4QA 2HLNA 3C8HA 1QCCA 2DR3A 4JC5A 4XR9A 3PPWA 1RSZA 1JVNA 3CZQA 1Y1TA 1TCUA 2F9MA 5JALA 3IP3A 3OCVA 1QX3A 3C3CA 1C14A 5DYYA 5JVDF 1TGVA 5B3JC 1Q15A 3RRFA 2XUQA 1GWNA 1I14A 4LTMA 4FOSA 2VA9A 4HDNB 5FPTA 2ONZA 4BKUA 4BN4A 1N1MA 2OZKA 3ESDA 4ZA2A 4BRZA 5K0ZA 3NZEA 5G41A 1Q3HA 2P4HX 3GRAA 3IIKA 1JMYA 4ND6A 1R10A 5TQ0B 3V97A 3IEUA 5IDQA 1NVVQ 4GI7A 4A8HA 3A4MA 2IH5A 2VIIA 4PLGA 3WLSA 3LKZA 3I9KA 4F3YA 4DZRA 4NFLA 4ZYZA 1B42A 1IHUA 4W6QA 1XYVA 4DA0A 3HJNA 3NHRA 3SSNA 2P4EA 4MPRA 4JBLA 2EP8A 3BE5A 2CLDX 1G60A 4QTTB 4DR1B 3AVWA 3H18A 1YVPA 3EK2A 4N8DA 3UMYA 2EX0A 4KVAA 2JHCA 3GY0A 4UOZA 5JNTA 5IKEA 2NXWA 1OFTA 4I5EA 3IODA 4X3PA 2WVAA 5DMXA 3WX0A 4GXQA 1DAHA 3UC9A 5HA5A 3QY9A 1J2UA 1GG8A 3IBTA 1YQTA 4DMKA 2RCNA 4QJ5A 5AK0A 4KBFA 4LOIA 4ZAGA 2FW8A 3KU4A 4IFIA 4TUYB 1RE0A 4K8RB 2VH2A 4D3XA 4JYBA 4PRZA 4PSDA 4Q3LA 1Z38A 3BJRA 2D1TA 5ECWA 2ZT6A 4NAUA 3VISA 5BQ5A 3W7AA 3T1HB 1RP1A 3C1AA 3TNDA 4RLHA 5FPPA 2HMSA 2PH1A 1L4MA 4N7MA 4CLEA 3HDGA 2FQQA 2C9OA 2HFKA 4E5KA 1SXIA 3AHDA 1PHRA 2NTYC 3R9KA 5HIMA 4QRHA 5FYDA 4AULA 1XRSB 5LQKA 1NGSA 4A8TA 4DTCA 1FNBA 4DLLA 3OURA 5K1ZA 4L9SA 1H8ED 4RX1A 1RYMA 3HXKA 3DR3A 1MG5A 1BJKA 2FOXA 2O7SA 3JQEA 4Y2JA 5DLEA 3AUYA 1O0SA 3G7UA 3STYA 3ZGNA 4L15A 4Q82A 4FYVA 1WDLA 4X1IB 3ZCTA 2X9QA 5K01A 3WSTA 4QARA 5BV8A 2ZIAA 1X7XB 4BEBA 4FZRA 4IF6A 1OBFO 1C7QA 5KVAA 1IPEA 4DIUA 3U7QA 4G2TA 4LY0A 3TSOA 4EJFA 4I5IA 3NBAA 2E4WA 1BZYA 4HK4A 3LUDA 1TTQB 1VLVA 2ZZMA 1GAXA 2LIPA 4JWTA