4V0MA

Crystal structure of bbs1n in complex with arl6dn
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
166
structure length
166
Chain Sequence
b'SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
total genus 42
structure length 166
sequence length 166
chains with identical sequence C, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0mA00
1W2GA 4DDVA 1N6KA 4FMDF 4LZZA 5JCZA 4KITB 5KSOA 5KUTA 4FW9A 1G291 1W5TA 1S2MA 2XX3A 1XEXB 2J59A 1LS1A 5E4FA 3VNVA 2RAPA 4NCJA 1JXMA 1HTWA 1IN4A 1F5NA 1PUJA 4MRPA 3HJNA 3EASA 4BLOA 3TKLA 3HPQA 2QTFA 4JL5A 5HPYB 4MGIR 2J45A 4NYMQ 4DCNA 3AGQA 2WSSD 1QHHB 4QM7A 2GXQA 2IYXA 1A7JA 3MRSA 4F4CA 4C7OB 4V0KA 1RW4A 4BZXA 1Q3HA 4IFEA 5EE0A 1E9BA 1W4CA 1AS3A 1MABB 4FCWA 4KFRA 4KFTA 2ANCA 5JWRA 3D7MA 2R2AA 2ZRJA 2V7QA 2Q9BA 4A2WA 1KNXA 5EE5B 1NVWQ 2RGDA 4JBWA 2REOA 3FFBA 1KK1A 2ZYWX 3U7GA 5EUQB 1Z07A 3W3AA 1LS6A 4ZKEA 4BRUA 3T1TA 3B1XA 3NEJA 1XNJA 2J7KA 3T35A 1OXSC 4BQSA 4B44A 1YZGA 2BKEA 3QSYA 1IXZA 3KQHA 2P65A 4RFSA 5FR2A 2CJWA 4A92A 1KSFX 1S4QA 1R0WA 2ECKA 1G64A 4EFNA 2GNOA 4NCKA 2RMKA 5IK2A 1XTKA 1G6HA 2BM0A 2CL7X 3OIWA 4ARZA 4CDGA 3T15A 2V55B 4UNQA 3RRYA 2HXYA 3QVUA 4URWR 1BO6A 1X3SA 4TYNA 2X1VA 3NC0C 1BKDR 2PEYA 4ZCMA 3AKEA 4QBHA 3KUDA 1UPTA 4JLOA 2RGEA 4Y0AA 1OW3B 1BIFA 4L4UA 2VHCA 4S2EA 4ZDKA 5FTLA 5DI9A 5D3MA 2OFXA 4MKFA 1IAQA 2W6JA 3U44B 5IHPA 2FOLA 4KXFB 3MFYA 2MSEB 1OB5A 1CJKC 4NYMR 2ZI4A 1NMZA 1WF3A 3EW9A 3EX7C 1IJFA 2H16A 1XTSA 4IHQA 2R62A 3H86A 3NBYC 5E7MA 2A9KA 4BLTA 5TXGA 4EQ6A 2UZIR 4OI4A 4N1AA 2ZTSA 2ZR9A 2PLRA 4RZUA 3X1ZA 2QMOA 4V0NA 3FB4A 2QBYA 2YJTD 3ZIAD 1BS1A 1W0KD 2HT6A 4AC9A 1Z28A 3BJIC 2IYVA 2G77B 2ASEA 1C1YA 4GMXA 1MH1A 3VHLB 4GI7A 4ZCIA 4NYIQ 1KAOA 2IXEA 2RB4A 1LVGA 1NL3A 3UMSA 4K8OA 3WXMA 4AKGA 3CB4A 3SFZA 3I73A 2O8BB 4EPXA 3W8NA 3RS0A 3M4YA 4EKDA 3A4MA 1WA5A 2H5EA 4GOXA 2G88A 2L0XA 1LF0A 4C0KA 2PZFA 1OE0A 4G5SA 3EARA 2R9VA 2ORVA 4L9SA 1Z29A 2D7CA 1SXJC 2ZJ2A 2QA5A 2ODNA 2Z43A 3TE6A 2O8EA 3U4QA 3B9QA 4IW3B 3RS4A 3RRNA 1YU9A 3CX7A 2OAQ1 5B64A 3FHOA 5AR1A 4URZR 2ZJ5A 1GNRA 2JIZD 4TTRA 2IX3A 2OXCA 1VECA 3LX8A 4WVFA 4YONB 3EAQA 3TK1A 2ZE5A 4V03A 3VFDA 4B3GA 5P21A 3TQCA 3P20A 2QQ0A 3CW2A 1NI3A 5J4YA 1ZUNB 3K09C 3ZH9B 3CM0A 2QTHA 3W6OA 5A4JA 5BYJA 3LVRE 2ZAMA 5L3QA 2HDNB 4NMMA 4QXAA 4N3NA 3WRXC 2QNRA 1NJGA 221PA 4PR0A 3PEWA 5DH9A 1LTQA 1TADA 1CTQA 1J8YF 1OSNA 3DDCA 3NBZC 3PG5A 4URYR 4TZ0A 2VHQA 1Q1BA 4HI0E 4NYIR 4G3XA 3SE0A 1G9XA 1GVNB 4TSFA 3FYHA 1G5RA 3IQWA 2XOKA 3CR7A 2IK8A 1OXVA 4HYYA 1T4GA 5F98A 4ZO4A 1A82A 4LPKA 2B92A 4MRVA 2DR3A 2HCBA 3P27A 3HU3A 5CYPA 4PAMA 2VYFA 3QXHA 3AVOA 2PT7A 4KU4A 1FP7A 1KO5A 4FINA 3ADCA 3EIQA 2QMHA 1E0SA 3IKJA 1NBMA 4BUJA 1GKIA 1P9RA 1SXJB 3REFA 2GK7A 2DHRA 3OIVA 4QGAA 2O8FA 3IIJA 4M1MA 3WBKA 1E9RA 4A82A 3IBGA 5IT5A 2XZPA 3I32A 1T8TA 4D0LB 421PA 2FX3A 2KI5A 1WP9A 4LYJA 3RRMA 2OCAA 4EAQA 3T5GA 4CRWB 5L3SB 3TW4A 4FCTA 4FMCB 6Q21A 3EG5A 4KLNA 2D7DA 2VTKA 4QFMA 1OHHD 1GFIA 1E4YA 4IDOA 4I1SA 4WXPA 2N42A 5J4KA 4HZIA 4LV5B 2GJAA 4BFXA 2D3WA 3H84A 2P0EA 3EPKA 3FOZA 1UJ2A 1G8HA 3AVTA 1RC8A 2E9SA 3TSOA 1UADA 1JALA 4LJ4A 4TLAA 4OJQA 3B60A 4LOAA 4RY2A 3ZDQA 4QHSA 4B33A 2AX4A 3BORA 2ODWA 3MWYW 4ITRC 3QKRA 4JLNA 3FMOB 1RRCA 3KTAB 2F43A 4GPTA 2J0UB 5DSZA 2NMVA 3LLMA 2ZS7A 2ORIA 3OZXA 3RS3A 4CEHA 2JLVA 1NIJA 2J46A 2J7PA 1TEVA 2ZRDA 4G5QA 4GBMA 1W4BA 1R5BA 4GP6A 4H1VA 4CT4B 5BN3A 2O8DB 4QHTA 3TGPA 1AKYA 4XVRA 2FGJA 5KYKA 2ODEA 2I1QA 3OEED 2WJHA 4Q4AB 1UBGA 3EZ6A 1YKSA 4YLGA 2OSBA 1G4AE 1Z3IX 3BH0A 1VG8A 3SBEA 2IA5A 2A5DA 5EP3A 1NLYA 1P75A 2VHJA 3CX6A 3V4FA 4GSYA 3MSXA 4G5OA 1NKTA 2V6IA 3SOPA 2YYZA 1P5ZB 2FPLA 2XJ9A 4IVRA 4LWZA 2ZRAA 3SNHA 2IUSA 3L43A 5C2JB 1GRRA 4M0LA 2ZJZA 1N6RA 2JJ2D 3DEFA 1NNEA 2WPDD 2ZPTX 2GJ9A 3CBQA 1FMLA 1YRAA 2ZQ5A 4TLCA 1KIMA 4KCGA 3NTUA 4LUCA 1JEDA 1X8KA 2EFDB 2JLRA 1W46A 4ZDJA 1KKLA 1X1SA 2JLYA 1P9WA 4LHXA 4JVMA 3THOA 3D3QA 3FGNA 4P4UA 1OIVA 1RZ3A 1PLKA 2JJ1A 2RKOA 3IDQA 1JECA 5BWMA 3A6PC 2WMNB 3W5IA 1Z5ZA 4CYMA 2WHXA 2HV8A 4HLUC 3SQWA 4PPQA 1JBKA 4WA7A 3JVUA 2JLWA 1NMXA 1OFHA 4Q7KA 1VCNA 1A1VA 4RD3A 2FNAA 2PL3A 4IOLA 4AK9A 2WJGA 5JHGB 2BV3A 3CR8A 4QC2A 4W5WA 4OI1A 4AYTA 2QU8A 3LWNA 1FQKA 4NE2A 4RD2A 1ZM7A 1NVXQ 1R8QA 1K5DA 1NJFA 1TMKA 1ZM4A 2G6BA 1Q21A 2VP2A 2VQSA 3L0IB 4W5HA 4NYJQ 2JCSA 4BEBA 4O3MA 4OQXA 5EQTA 3T06B 1R4AA 1OIXA 3U3MA 3KJHA 3K0FA 3N2EA 2ZVPX 2DFNA 2HF9A 2IEZA 3GMTA 4P32A 1QHIA 1N0UA 2H8KA 2R6FA 4OHWA 3V00A 5GVSA 2A2ZA 3PIRA 1UAAA 4Z1MD 2IYSA 1DAFA 1OH8A 1A4RA 1WQ1R 1OF1A 2GZAA 1NY6A 2BCJQ 2PZGA 3X1DA 3FMPB 1J8MF 2YWGA 1NIPA 1G8PA 1KI6B 1H8ED 4JBXA 4NU0A 5FBQB 5CB8A 4L8GA 4J0QA 4PSAA 4DLSA 2GESA 4DLUA 3SC3A 2A5FA 2IXGA 1GOTA 4URVR 1VCMA 2FMXA 3LLUA 1ODFA 2BDTA 3EWSA 3ECCA 4CGZA 3SJAA 5CB6A 1MOZA 2RHDA 4D25A 4JLKA 3TIFA 2O52A 2J7PD 1GILA 3SYNA 4BECA 1XXHE 2AR7A 2BIFA 2QENA 2GXAA 3C15C 1E2IA 2VHTA 4X8OA 3O8RA 1E94E 3A1WA 1Y63A 1E1RA 3AUYA 3IUYA 5E7IA 2CDNA 3EXAA 3HYTA 2BEKA 2XB2A 1DELA 3AVXA 4NYJR 2B7CA 5KSYA 2LKCA 3E5HA 2HUPA 4PHGA 1XJQA 2WJVA 3GJ5A 1YVDA 4R2HA 1SXJD 5EXPA 3GLFA 1CULC 3AVVA 4ZKDA 4G1UC 1FZQA 2BJVA 1XD2A 2PCLA 3LV8A 1FW6A 5FOUA 3AVYA 4DEYA 5CK4A 3GCGA 4US1R 3M0EA 3B1WA 3AKDA 3BGWA 5F2EA 1G19A 1CS4C 3AV0B 3BB4A 2CBZA 4B3XA 2XNDD 3OFNA 2DFTA 4PSVA 2J3EA 5SZKB 5AUNB 1XF9A 2XNSA 4C0SA 3GLFE 4PX9A 2QZ4A 3PR1A 4W5JA 1DPFA 5FPYA 1KSJA 3LAWA 1DAGA 5FPSA 1ZW6A 4AKEA 2QN6A 3B8HA 4ZDIA 3WHLA 2OAP1 2NPFA 1T5IA 5TDHA 3BK7A 1D2MA 1GRQA 4JLDA 2C03A 1YQTA 1CR2A 3N70A 4PQRA 4HATA 1NKSA 2ATXA 3SI7A 3MGCA 4Q1CA 1JJVA 3TLXA 2P3SA 4DWJA 1U0LA 3A1UA 3QXXA 2BBTA 2ZREA 3EC1A 2BKUA 4MKIA 3DM5A 4C0LA 4L5BA 4IDQA 1KAGA 1OXUA 1NP6A 2WAYA 1D5CA 3BFXA 3GLIB 5EXSA 1G5TA 4M21A 4DCVA 1KDTA 1XTJA 2C95A 5KPDA 1SKYB 3F5FA 5JFGA 3MCAA 4QG7A 1WBDA 1XCPA 4QGGA 4HSEA 1CEEA 2D2EA 2VO1A 2I4IA 2OV2A 4IDNA 2F3TA 1MRSA 2VP4A 4IEIA 2J0QA 2RGNA 2ZI6A 1U81A 1DVRA 3A4NA 3KL4A 2VRWA 4ACAA 1J70A 1SVMA 4BPBA 1QVAA 3LY5A 2WBLC 1N2CE 1DAKA 2ERXA 3E2IA 3Q7QA 3ZYCA 3AVPA 4C3ZA 3ADBA 4AY2A 2OFWA 2HYIC 1EFCA 5D3QA 1TQ2A 2ZYTX 1KI9A 2IS1A 2REXB 1KI1A 1N25A 1TNDA 3C4JA 2W0MA 3VTKA 2DWOA 2EYQA 4HLCA 3DZDA 4P4SB 2B7BA 3BC1A 5E95A 1BOFA 4ESHA 3K0CA 4TYWA 2G83A 1VYTA 4G0NA 4L9WA 2ZUCA 5KO2A 3AEZA 2FFAA 4X8HA 4XTCS 2GCOA 1ZD1A 3CRQA 4GT1A 4QHYA 4Q4LA 4RCYA 3TNFA 1J7KA 2IUUA 5J47A 1SHZA 1DOAA 2FN4A 3BB1A 2VEDA 1N5JA 2Y8EA 3EZ2A 4JKIA 3RLFA 2C04A 1E9SA 1T9HA 2B6HA 1A2BA 2MMCA 1XDBA 1QG2A 3ZD7A 3ADDA 3EPJA 4ZIRA 3DKVA 3LBHA 3ZS9A 1IN5A 4AWXA 1W4RA 1VG0B 1KMHA 2WKRA 4AIIA 4AKIA 1EFRD 1VCIA 3FTQA 4PPGA 3ZD6A 1NN1A 2ANBA 1NG9A 2HCJB 4LV8B 3BRWD 3GQBA 3B9PA 1T8UA 4CEIB 1ZM9A 1AIPA 1IQPA 3H0KA 3O8DA 4TT3D 1ZBDA 5FBRB 2UZ3A 4RVCA 2E1RA 5FPHA 5LPNA 5JBQA 3I1FA 3K9NA 2P2LA 1GM5A 3OIUA 3M1IA 3ETLA 2XB4A 3EA5A 2ZRHA 4GMDA 4MUAA 1C4OA 1F60A 2G1JA 5EZ6B 1W2HA 3KJEA 4BFWA 3R9XA 2WWIA 5FH9A 4I81A 4MGYR 3D31A 4TL6A 4LGMA 4DSOA 2NTYC 3G0HA 4DUGD 1RRPA 3RSOA 3TSWA 1E2KA 1F2TB 3M6AA 1HH4A 2CVHA 2IF2A 2QI9C 2WAXA 3CX8A 3KQNA 1GNPA 4TMTA 2F6RA 3FMFA 4TWZA 5FPTA 4C2TA 5FFMA 1XJCA 1H8HD 3I8XA 2CXXA 3K1JA 4QJ5A 5IF9A 1GG2A 5M04A 1E2GA 3CONA 3QPUA 4P33A 1SVIA 1X1RA 4HZUB 5F9HA 3JVVA 2PH1A 4X8MA 4F38A 5JCPA 2WVJA 1TF5A 2EFHB 2NZJA 2DBYA 2Z0MA 3KDSE 1SVLA 2CMKA 3QKSA 5H1YA 1N6PA 4B47A 4DLRA 4DDWA 4RD0A 4AI6A 3EC2A 5L3RA 2BEJA 2IL1A 4KYUA 2PCJA 3RDPA 1EG7A 1YZQA 3W5JA 2V1XA 2ZYVX 1OLOA 1DADA 1P2TA 2RGAA 4B6FA 1XX6A 3DVLA 1VHTA 4DCSA 5J40A 1BMFA 1EK0A 2OEPA 3QI2A 4Q66C 5F9FA 2H18A 1IY1A 2ZI9A 2FA9A 2YOGA 2ZJYA 3DPUA 1R2QA 4A2PA 2XZLA 2JASA 1KY2A 4R7ZA 1MR3F 4AURA 1QHNA 4RFSB 1Z83A 2G0TA 5C46F 3I92A 4XH9B 1KYIA 1E9DA 1RFLA 5JEEA 4ASUA 1JR3A 1FPMA 4A8JA 1TUIA 1AS2A 1D2NA 2WJJA 3G5UA 1GRNA 3U3KA 4B71A 1EESA 1IXSB 4NKRA 5GJWC 5KNDA 1PZNA 3CH5A 1LNZA 4JKYA 2GJSA 2WMOB 1KSGA 1W0JD 5DE3A 1UBFA 4RD1A 3U60B 1T91A 3BB3A 3KXIA 3VNUA 4PQFA 1GKYA 1OXXK 3WMGA 2HJGA 1MKYA 1JR3E 2KWIA 1A5TA 2QAGA 5D3MB 3VR5A 5KNBA 2QORA 4A4DA 1F2UA 4YC7A 2AN9A 4BLRA 2BMDA 4I1OA 3C41J 4MA4A 2OCPA 1E9AA 1JAHA 3GLHA 1YZNA 3K0EA 4DIEA 3R9IA 1IM2A 2J5XA 4KYIB 1MV5A 4W9MC 4YXWA 3LO5A 1U90A 4IEEA 3AVQA 4B3FX 2WWXA 1MO6A 2QBYB 2EYUA 3B1ZA 3NEYA 4BE7B 3U3JA 1NG1A 3K53A 1XP8A 2P5TB 4JVLA 2F9LA 4RJLA 3REGA 5FOXA 2Q3HA 2W00A 3U7HB 3GLHE 4A2QA 3ZS8A 5JI3E 2BWJA 5TV2A 4B35A 2ZS8A 3U61B 1SZPA 1QZXA 2GXUA 3HU2A 2SHKA 3B85A 3BBPA 4HAXA 4PZYA 2FJUA 2ZUDA 1E9CA 1ZCBA 1D9ZA 3MJHA 3UG7A 2REBA 4M9SA 3KB1A 1G17A 2B21A 2V9PA 3MLEA 3IIKA 1T3LA 2AD5A 1Z6AA 1GNQA 4I99A 3WP0A 1L8QA 2ZRKA 4MYCA 4QM6A 4DDTA 3PV0A 4MYHA 1DE0A 5G41A 1AK2A 2O8EB 3U4QB 3QXCA 2V54A 4LX0A 4R71A 4DSTA 3SFVA 2NG1A 4KLZA 1S1MA 4IOJA 5CM8B 3TJZA 3UXMA 3KQLA 5DYGA 2C9OA 2J9RA 2VL7A 4GOJA 2W58A 4LCBA 4URUR 3U6KA 2Q6TA 4EFMA 3PEYA 1FQJA 2GBLA 1OPXA 3NH6A 3D8BA 2QRNA 2DPXA 2YV5A 4DJTA 1G1MA 2ZRFA 1AS0A 4Q18A 4Z8YA 3SR0A 1Z0IA 4Z54A 2ZU6A 5KPJA 5L3QB 5ANRB 2QT0A 1HYQA 1Q12A 2TMKA 5BN5A 1FMJA 2YWEA 2J41A 1QBKC 1E96A 3AP1A 3VR2A 3VR4A 2C99A 3CF2A 3LNCA 4DHEA 1G3QA 4BFTA 3WMFA 1KJYA 2FU5C 3THWB 2XITA 3AP2A 3RSLA 4LJYA 2Q21A 4KI0A 1OYWA 3D6TB 3RABA 1JEEA 1W48A 3WNBA 4Q1AA 3ICEA 1CJMA 1H65A 4MQBA 4XOIA 2AFIE 3GD7A 4BZPA 2QPTA 1JNYA 4Q48A 4A36A 1M7BA 4UJ3A 4FXPA 4LBYA 3DOFA 1VYUA 3RHFA 3TVTA 4B2PA 5HE8A 4CIDA 4S35A 2EU8A 1G3MA 3R8FA 2QP9X 2WWHA 2PEZA 4M1KA 2GCNA 2KJQA 4Q9LA 4AYXA 2AK2A 3PENA 4Q01A 1U8ZA 3ZQJA 3FHTA 3H1TA 2V4ZA 5DGXA 3PVSA 4DT1B 2B8WA 1OH7A 1HE1C 4D0GA 3L0SA 1SVOA 1QHYA 1GDDA 4BFVA 2GWHA 2ZRGA 2KSQA 2P6NA 1WCV1 4OK6A 1OB2A 4M8NE 5LDDC 2FDCA 1L2TA 3BH7A 1ZD9A 5HZHA 2O0HA 2FF7A 1ZINA 4MDFA 1Q44A 3A58B 4MRRA 1L7VC 5EE9A 2AKYA 1KO1A 3A1TA 3AGPA 4V0MA 1U2RA 2HF8A 3AF3A 1BYIA 1VIAA 2QY9A 5L3VA 4IKEA 2P5SA 4BFSA 1KOFA 1XZQA 5CIWA 2VP5A 1G3UA 4B3DA 2OG2A 5KHOC 3IBYA 1U98A 2V7QD 3EIEA 4NCHA 1E4VA 2QE7A 2CK3A 4LJ6A 5SZIA 4D82A 1AZSC 4V0ME 5JJKA 3K9HA 1U0HC 3ADKA 3C7KA 3U44A 2NIPA 2D2FA 2VP0A 1E6CA 3Q85A 4WZ6A 5TVKA 4D4KA 4NPHA 5FUWA 1YRBA 5BW8A 2WKQA 2FPKA 3QKRB 2OM2A 5AJYA 4F4JA 1S3GA 1YHNA 3KXLA 3K0SA 2JEOA 5IK2D 3R9WA 2JLSA 2E87A 2FFQA 2HLDA 5B58C 4KV9A 4QBFA 4TTQA 1NF3A 4B48A 2J1LA 2PJRA 3VR6A 5EJEA 2IYLD 2QAJA 1OFIA 5AJWA 1UDXA 4Q7LA 2GHIA 3SZRA 4JMPA 2FV8A 2EFCB 3TSZA 2W6JD 2QP3A 1CLUA 1WMSA 2WJYA 3A1VA 3ND9A 2AXPA 3RYTC 2WKPA 3P4YA 1Z6GA 5LB4A 3ZVNA 1WXQA 4Y0VA 2O5VA 1ZMXA 1OXTA 3SEAA 5FTMA 3AKCA 1E2LA 1D9XA 3AH8A 1L4YA 4IVQA 1G8FA 3KXKA 3FPAA 2ZAOA 3F8TA 1SGWA 3Q9LA 3RC3A 2V1UA 3HDTA 1KTVA 5CIQA 1B23P 3LD9A 4JT4A 4R98A 3T34A 3T5DA 4RZ3A 1S96A 1N6HA 3FHCB 3HU1A 4IVPA 3ZQ6A 5GADl 5CDFE 3SYKA 3QF4A 1FUKA 1L4UA 1N0VC 2BMEA 4M9XA 4YDHB 3RWOA 4B76A 2GJ8A 4DSNA 1ZAKA 2ZRMA 3VMFA 1HT1E 1W36D 1N6LA 2W2TA 2CHVA 4NDZA 3PXGA 2GJKA 4EPRA 3LDAA 3K0AA 4B74A 4DRZA 4ZV4A 2R6GA 1M6NA 1VHLA 3OHMA 1CKEA 4BEJA 3UG6A 2DB3A 2H17A 4HEJA 4FMBB 2MMGA 1G7CA 2P6RA 2OCBA 1KI7A 2BHRA 5EP4A 1KDOA 2YOFA 4Q4HB 2FE4A 1G3IA 5EXTA 5C1BA 4Z8XA 1TEXA 4D2IA 2ZRNA 4OHVA 5KDOA 4PZLA 4LRWA 1RYHA 2QGNA 1MO3A 2F9MA 4JL6A 4JZKA 1HA3A 2N1BA 1N5IA 4M1WA 4GL2A 3CPHA 4FMCF 1G6OA 1GSIA 1E9FA 2YOHA 3K0FB 3QJYA 3Q5EA 5JWOA 3AP3A 1YR8A 3O8BA 1TU3A 4JLAA 3NKVA 4B75A 2ZUBA 1E69A 4KBFA 1BYUA 3LBNA 3UMFA 2IWRA 2XXAA 2XGJA 1E0KA 1YE8A 1R0YA 3WHKA 3K9GA 3CRVA 2W2VA 2J0SA 1V43A 2PJZA 4NHOA 5FL7A 1ZC4A 1KI2A 1P62B 3DMNA 4KSCA 1GL6A 1DBSA 3A1SA 1KKMA 2FEMA 4LYFA 4OJKA 3WYAA 4D26A 4W7SA 1II8A 4R9UC 1UEIA 4TQ9A 4TSFD 1ETUA 1W47A 5F3WB 2XOKD 2BMJA 4DVGA 1ESNA 2PT5A 2O8CA 1II0A 2QT1A 1D6JA 1E2PA 4LJ9A 3TMKA 2BBWA 1E0AA 3DKPA 2CCJA 2GZDA 2AK3A 2IYUA 5C18A 3CWQA 5GJVC 4V0LA 521PA 2Z4RA 1ZP6A 4FIDA 1Z8FA 4WW0A 2IUTA 3LXXA 4A1FA 2GF9A 3S1AB 4BFUA 5K8LA 2PMDA 1ZU4A 2RGGA 3KKPA 1P2UA 3QBVA 3VKGA 2GEDA 2C98A 4ABYA 4EPYA 2CNWA 1M2OB 2EWVA 1NBMD 4IOKA 4KFSA 1DEKA 4Q9HA 4ON9A 1N3BA 1DO2A 4TN1A 3EWAA 3GLFB 5FOSA 4P4TA 1XD2B 1M74A 5DI3B 4B73A 1Q22A 5J4HA 1UBEA 3AF2A 5AWFC 1C9KA 1OH5A 2X2EA 4HUQB 4HB4A 1IBRA 2XJ4A 1R0ZA 4F7WA 4JIMA 3AQ4A 1S9HA 3K0CC 4L16A 4O2LA 1G5PA 2VIIA 2YVUA 3I72A 5DISB 3KTAA 2JLXA 3IEVA 2A78A 2J0UA 2P6UA 1GUAA 3KKQA 1E1QA 4JBYA 3RWMB 2QPOA 4ZDWA 3H4MA 2OXRA 1SKQA 1R5NA 4TMVA 5DN6A 4D6PA 5C4GB 2ONKA 2NQ2C 1MO5A 4DCUA 2OE2A 3GJ7A 4FN5A 3GLGB 2QUZA 5KTYA 1WRBA 4PSKA 1RKBA 3FE2A 3QUSA 3MUFA 4UNNA 4Q4AA 1XXHA 3BS4A 1QG4A 2GXSA 1ZNWA 2WSMA 1J2JA 4I1UA 2NOAA 4U00A 2CHGA 5KSZA 4Q00A 3TUZC 2Q3FA 1CJTC 1XMSA 3BWDD 3JZAA 2IBMA 2PMKA 2ZEJA 4HLDA 3T12A 4AD8A 2KE5A 5G3YA 1EFTA 3AF4A 1KI3A 2QROA 4CEJB 1IN6A 4JLMA 3LXRA 3ZGXA 4Z51A 3QF7A 5G53C 2WOJA 1EX7A 3A4LA 5ELXA 2FSFA 1FP6A 1E2QA 1AKEA 4IXMA 4LHYA 2ZSEA 1I4LD 5HKKA 4BRWA 4JYCA 4DLZA 2JLUA 5FBLB 1OKKA 3WP1B 4BZQA 1AZTA 5HE9A 1SVSA 3WNCA 4KSBA 3BE4A 2ZSAA 4L15A 2ZXUA 3RC8A 4CVNA 4LBWA 2PZEA 2AL7A 5FR1A 2NO7A 5FL7D 4F91B 3NDPA 2LCFA 5JSZA 3U6BA 2IYTA 3PCRB 4MUBA 1WE2A 4TLDA 4HDQB 1DAEA 1MT0A 1TQ4A 1US8A 3GJXC 1AN0A 1Q57A 4A6PA 1IHUA 3E70C 3GJ3A 5BXQC 3CRW1 2ERYA 2QPAA 2WWYA 3C5CA 2IEYA 4KVAA 4XWAA 3W6PA 1NVUQ 4HLQB 4PAOA 1DAHA 1JPJA 2GCOB 3IHLA 4LBZA 2Q9CA 3P1JA 3CH4B 3LQRA 2IHYA 2JJ1D 4ERNA 2DWQA 821PA 1BH2A 3BAFA 2QMEA 3AF0A 3I8SA 1YR7A 4YQFA 4ZIRB 1AA9A 3TVDA 1DG3A 2EWWA 2BBOA 3TQFA 2F1RA 3LVQE 4Q9KA 4D81A 3NBXX 3PUVA 2IF0A 5H8WA 3L8ZA 1KMHB 4OK5A 3NG1A 3NBFA 5B57C 2QMUA 3PQCA 3AVWA 1CR4A 1K6MA 3AB3A 1KNQA 1P6XA 3LX5A 3CRRA 4LJ7A 4EPWA 2PX0A 2WWGA 1KI6A 3THXB 1TX4B 4A8JC 3QNUA 4UJ5A 2WV9A 4JYBA 4IRUB 1GL9B 3IO5A 1W5SA 4EJSA 3OAAA 2FZLA 2W6IA 3BOSA 3GFPA 4MGKR 4A0FA 4C0AC 5BYKA 3OEHA 3W9YA 3QPWA 2QGZA 1JPNA 3ZLJA 2WICA 4PPNA 1G8YA 1VDZA 2CLCX 1RIFA 1ZM2A 4PTLA 4JS0A 5EE3A 2GZHA 2HJVA 2Q0HA 2ZR0A 4OHXA 2DWPA 1EX6A 5JRJA 1W4AA 4C0QC 1E79A 2H7VA 2FZ4A 3W3ZB 4A9AA 2JATA 4LV6A 3ASYA 4BGDA 1PLJA 1YZTA 1PUIA 2UVQA 3C14C 4HLUA 4JLBA 1JQJC 4LYHA 2A5YB 1CU1A 4NZYA 4Q9IA 1G4UR 3MWJA 4UNRA 2CE2X 4QNRA 2ZVQX 2Z6VA 1NN3A 3MMPA 3QBTA 4CF7A 1G7SA 1UF9A 3GPLA 3F0TA 4X8LA 3Q8XB 4NH0A 4CT5A 1UEJA 4DLYA 5K8IA 1RPZA 3GJ8A 1VCOA 3EA0A 4RFVA 1A2KC 1K5GA 4ACBA 1UM8A 1E1RD 4QL3A 1XD8A 1KZ7B 4Q4JA 3KB2A 1IOZA 1R5OA 4ILEA 5CYOA 3KZ1E 3E1SA 2QSYA 4GNKA 4M1OA 1HY3A 1ZNZA 1G16A 3HR7A 1KJZA 4BWYA 1SULA 1JXOA 2BM1A 5FUXA 1ZVQA 3QXSA 1IY0A 1Z0FA 4JJKA 1S1CA 2ZSFA 3ONWA 2BVNA 2N46A 1P72A 1VKJA 3MAAC 4LPSA 1CRPA 4Q02A 1FTSA 4FCVA 4DC9A 2BC9A 4UXHA 4A8JB 4TYYA 1QDEA 4OI2A 4JVSB 2F1IA 3SJZA 2ORWA 3WY9A 3WRYC 3OFND 2WSSA 1T3SA 3NHBA 2WTUA 2RCNA 2GBLC 3O47A 4XSHA 4PC7A 3VHXA 1WB9A 1NSFA 2C5LA 2YNMA 4KO8A 4NP6A 2YINC 5GJCA 3AKYA 2AWOA 2PLFA 1FX0A 2F1HA 1F2UB 1E9EA 2GTPA 1XB2A 2Z83A 3FKQA 4LSGA 4MKHA 3V4RA 1XEWY 5EZ5A 1AM4D 2WOOA 3GLHB 5DHFA 2QRZA 3GLIE 2OUKA 3UPUA 2FG5A 1JI0A 1KI4A 2KBEA 2ZIAA 4IOMA 1SKYE 3MWLA 1II9A 2ZRCA 4MKGA 5EE1A 5TARA 3WYGA 1P4SA 4G01B 3IHWA 3CRMA 1CJVC 5BQ5A 5LB2A 2B8TA 4ZI2A 3THYA 1CR0A 3QPVA 4C9BA 4Q5IA 2PX3A 5EP1A 2C96A 2ZE8A 1W36C 1ZJ6A 1E2EA 5AUQA 1AJEA 2AWNA 2QG6A 2G9NA 4D0NA 1TU4A 2XSZA 4BLPA 4Q19A 1YR6A 1ZRHA 3CNNA 5HR5A 3EPHA 4PO1A 5G3ZA 1P73A 3FDIA 1VG1A 3AM1A 3T1QA 3NDBB 1K8RA 1LFDB 2CJWB 4NCNA 4M9QA 1Y3AA 4IDPA 1UBCA 3T1OA 1E2FA 2ZRPA 3GEIA 5KNCA 2LKDA 2ZI7A 1G7TA 3B13B 4DZZA 1XRJA 2WIBA 1Z47A 4ARZB 3BERA 3VU9A 1JR6A 1X8LA 4JLPA 3OF5A 1IN7A 1LV7A 3B6EA 4PO8A 1F3OA 3QEOA 4PHTA 3SS8A 1W0KA 4CEIA 3AVUA 2OBMA 2BOVA 2OBLA 1XTRA 5AJXA 2C2HA 3QEJA 4PO9A 2C8VA 4YMWA 1HEIA 2J0VA 2YWHA 3CF6R 3DHWC 4PPFA 1ZD8A 2ZITA 2AFHE 2QTVB 4B3BA 3IGFA 1OFTA 3IILA 1NLZA 4LY6A 3SU8A 1T3HA 1ZUHA 4D4MA 1G21E 4DLXA 2W2XA 4A0HA 4EQ6B 4JLJA 3MD0A 3QG1A 3B78A 1G18A 2FPMA 1UDWA 4DEXA 3PEUA 1F2TA 3MJRA 4OHYA 1RJ9A 5TMPA 3CKLA 2WZQA 2A5GA 1XMVA 2OLJA 2QQEA 4G5GA 3FFAA 3L8YA 4D80A 3QG5A 4UNSA 4EDHA 2JIZA 5JJLA 1W44A 2UKDA 2A30A 1D2EA 3BXZA 1J90A 4MYUA 4A0GA 1LW7A 1RE0A 4HZUA 4UNPA 3CPJB 3J81k 1W36B 5FOTA 4V02A 5FBWB 1NSTA 1KK2A 1PVOA 2D4HA 4O2RA 5G40A 5C4MA 1V5WA 5JRZA 3KKOA 1Z6TA 4OHZA 1RYFA 3A36A 1M34E 1IONA 1U9IA 3I5YA 4KAXA 2V3CC 4M53A 3BFKA 3SJBA 4N0DA 2BMFA 2XTMA 2ZI3A 4QBIA 4Q1FA 4M1TA 3TR0A 1IXRC 2IT1A 2WJIA 4PAQA 4NTZA 2DY1A 2F7SA 4RZXA 2FFBA 5UKDA 5DLQC 1QRAA 4M2LA 3WBJA 1FTNA 1UKZA 4F93B 4LC1A 1Q1EA 4BFZA 2R6AA 3R7WA 1XFAA 3K9LA 2IYRA 2GA8A 4PHFA 4BLQA 1T0HB 5DO9A 1P61B 3Q72A 5HCIA 3U7FB 1M8PA 4YMSA 2KB0A 1JAIA 4LHZA 4DXAA 3X1WA 2I1VB 3VX4A 3PJRA 2C9YA 1VIYA 5A0FA 4E5UA 1QHXA 2Z4SA 2XSZD 4U7DA 1BMFD 1JQLB 2MSDB 3BD9A 1WBBA 4DSUA 1XEXA 5JLJA 3ZVMA 1PLLA 4TLBA 3RS2A 5IRCD 1XZPA 1OYYA 2CLDX 3KFVA 4EUNA 2OLKA 4CZ2A 3CO5A 1IN8A 4Q1BA 4Q1EA 3LW8A 1NY5A 1LB1B 2KBFA 3NHAA 5JZVA 1ANKA 1E2NA 4ASUD 1JR3D 1ZIOA 2FGKA 4RSGA 4TMWA 4GZLA 3CPEA 2NO9A 3K70D 3W8RA 4ZCLA 1CXZA 1KDPA 1FL9A 4ESVA 4Q21A 2BCGY 1QHHA 4QKQA 1G3RA 2ZRBA 2CE7A 3DZ8A 4TL7A 4C7OA 4I1VA 3NIBA 5FUYA 1TAGA 2IS6A 4LJ5A 2DFKB 1ZNYA 2ZRLA 3PUXA 1OHHA 1MABA 2OHFA 4A0RA 3KJIA 1NVVQ 1J99A 4PZZA 4BASA 4N0EA 4P0TA 2OZEA 5JEDA 4LBVA 1HUQA 4TMKA 5CLQA 4F4IA 1Z0DA 2O8FB 2CEAA 4DLVA 1HT2E 1O87A 1EFUA 4LDJA 2F55A 5CJPA 3ICQB 3PFIA 1N6OA 4JSYA 4C0BA 3B1VA 3KQKA 1R8SA 1AQUA 4YXWD 4QGHA 2VSFA 4Q1DA 2GAOA 3ND8A 1E32A 1E2HA 4MH0R 2AXNA 1KY3A 2GKSA 4P3YA 4RD4A 4FWIB 1AQYA 3Q5DA 2F3RA 3FWYA 3QXJA 4AG6A 3KQUA 5FOVA 3SQXA 721PA 2GEUA 3CUEF 5AJZA 4UQOA 2GILA 4OQMA 2AKAB 2W0SA 1I4TD 5JS8A 1IY2A 1GTVA 3L2OB 2RGBA 2YKGA 3HYRA 4YMTA 1F6BA 1YZLA 1P7CA 2RHMA 3IO3A 3IIMA 3ZVRA 3QF4B 1XTIA 4CW7A 1U99A 1YZKA 3AF1A 3OEEA 1G7RA 4PFSA 4EFLA 2YC4C 4M22A 2OFOA 4YDSA 5EUMA 2GETA 5DHAA 2GVZC 3RRZA 4LYAA 1T0JB 1ZUIA 3TUJC 4XWKA 1U8AA 4POAA 1ZNXA 3K0AB 2PBRA 2CL0X 2ZJAA 5FI0B 4KBGA 5IDVA 2P67A 3MWKA 4Q7MB 4UXIA 2F43B 2R65A 3UK6A 3N5CA 4D4JA 3C5HA 1DG1G 4CEHB 2JJ2A 1U94A 1NVVR 4R2IA 2WPDA 5FL3A 2FSGA 3FKSA 5GVRA 3THWA 3QOFA 2VSOA 1EGAA 4XIGS 5J4LA 3DO6A 1KO4A 1DAIA 3CNLA 3IPYA 2VBCA 3TUIC 2OT3B 3VKHA 4HUTA 1ZU5A 2IYWA 2RGCA 3OIYA 3U3RA 2IC5A 4P31A 3IPXA 4IFBA 3AUXA 1Q1QA 5JI2E 3GP8A 2CVFA 2H57A 1IJEA 1TQDA 4LHWA 4OQLA 2XXAB 1CR1A 2G3YA 5CDFA 3TW8B 2GK6A 2O8BA 2ZSDA 2RGXA 4GDFA 2IYZA 4LJ8A 2WWWA 4B2LA 3ASZA 4TYPA 4HDOB 3X1XA 3PUYA 121PA 1XJ0A 1Z6XA 1CF4A 2NGRA 1Z0KA 5EP2A 2D62A 1Z6YA 2CL6X 2O0JA 3CZPA 1VPLA 3EZ7A 1FOEB 1II8B 1ZCAA 3VR1A 4U5XA 5FI1B 4DT1A 1HQCA 4GFDA 1DARA 2CCKA 4AKHA 3GFTA 2O8CB 2GF0A 4OBEA 1Z2CA 3U7EB 3QKTA 4DB2A 1Q3TA 1PJRA 4HB0A 4KFUA 1GAJA 1LY1A 2JLZA 4WAUA 2HT1A 1P2SA 3EIHA 1Z22A 2MSCB 1QF9A 1U8YA 2NPIA 4U02A 1NBME 4JVNA 4M9ZA 1XCMA 4TYQA 3KX2A 5AUOB 4Z1MA 3LA6A 2IHBA 4HAVA 4DLWA 5BN4A 4DLTA 4E03A 5JJIA 1YR9A 3B82A 4TL8A 3ZVLA 3RS5A 2ZANA 2QSZA 1EWRA 3SYLA 1CRQA 3QVVA 3SHFA 3EZFA 4MDEA 1Q1ZA 1H8EA 5L8VA 1ZC3A 3L0OA 3F3YA 4H9GA 1X8JA 4JJZA 4XVUA 4B43A 1NN0A 4DB4A 1NN5A 4Q7JB 4G5RA 4NONA 5H68A 2JGNA 2EVWX 1G20E 1I2DA 4AYWA 2I3BA 4A15A 3W90A 4IXNA 5FPKA 4HAUA 3ZZUA 2GCPA 5KDLA 3WNDA 4V0OA 2G1KA 1M7HA 2D74A 3B2EA 4B2IA 1QHSA 4FI3C 3HP1A 3WYFA 3RNLA 1XTQA 3PUZA 3LQQA 4D4LA 2QE7D 2LWIA 2CHQA 3PUWA 1X86B 2CK3D 2ZR7A 1UKEA 2FSIA 3CLVA 2IWHA 2ZM5A 1I2MA 4ZPXA 1XXHB 4B6EA 1FNNA 1Z06A 3NWJA 2VF7A 4XWOA 1EWQA 3UWOA 1GITA 5HCNA 4PC1A 1SXJA 2EFGA 1EXMA 1E98A 2A3RA 2ZJOA 3QE0A 4LC0A 4OL0A 3TRFA 1E3MA 2XAUA 4MYTA 4IJMA 3I4LA 4LK2A 4OYHA 5LBIA 4KHZA 3GJ6A 3MG9A 3CF0A 4QNMA 3DOEA 2IXFA 2NO6A 3GJ4A 3NXSA 3UKDA 5LD2C 2HLDD 4DCTA 3LRPA 4EJSC 1VG9B 5L3SA 5K8TA 3H2YA 2XNDA 3FKSD 1QHGA 1Z2AA 1SXJE 4HAZA 2HEIA 2RGNC 4PANA 5A5GA 1Z0JA 3BH6A 3GEEA 4I4LA 1XU4A 1UKVY 2NO0A 3K09A 2AHOA 3LBIA 3UATA 1DO0A 1N0WA 4A6XA 1U0JA 1DS6A 4HDCA 1XBTA 4JSTA 2VA8A 5JHHB 4HB3A 2H1LA 1XPUA 5AK0A 4F92B 1E0JA 1SHKA 3HWSA 4RD6A 3VKWA 5SZHB 1E2DA 5CK5A 5JSZB 2XTNA 2W83A 3VAAA 1US8B 1KO8A 4UXJA 2FFHA 1HV8A 5CJ2A 2ODBA 1XEFA 1S3SA 3I62A 1W49A 1E2JA 1COWA 5JS7A 1GIAA 2ZRIA 1RRGA 3VQTA 4Q4HA 4QBGB 4B32A 1FUUA 1KK3A 4RKFA 5DIFA 4ZI3A 4WZAE 2O8DA 5GJBA 3EZ9A 3QY0A 2VP6A 3CZQA 3C8UA 2QEQA 4O0MA 2YZ2A 2RH5A 3QENA 3ZZTA 2VSXA 2ZROA 3X2SA 4C0JA 2GDJA 2BBSA 3IEUA 1YJ5A 4EPTA 3UIEA 2ZE6A 2ZU0C 4FWTA 2R44A 5B30A 2V8OA 4IDHA 3UWKA 4DKXA 2ZYUX 5DNYB 3U5ZB 2GAAA 4H1UA 3KKNA 3TAUA 1OJLA 2EW1A 3FMIA 5JMTA 4JT2A 3I3SR 4JLVA 4M1YA 3X1YA 4TLEA 5K8UA 5KOYA 3NVAA 1OFUX 1E2MA 2FSHA 4WZBE 1P60A 4PC6A 3SN6A 3KUCA 4XTRA 4OI0A 4AG5A 2NO1A 5LD2B 2IS4A 4EJSB 5KSPA 2JDIA 4II7A 5DYIA 4LHVA 2X19A 3R20A 3I61A 2Q3MA 1UKYA 1F48A 4MGZR 1GZSA 4BFYA 4TQUS 1PV4A 1XMIA 3PEVA 4MITA 4OK3A 4QGFA 2K5UA 3B1YA 4PQYA 4WBSA 3N2IA 3NH9A 3LFUA 1YZUA 1P9NA 5FTJA 3FVQA 3S1AA 2WM9B 3T1VA 2C77A 3HPRA 2AD1A 2FH5B 1EFRA 1P2VA 2VPPA 3CWZA 1NLFA 5FTKA 1ONBA 4DBLC 2ONJA 2HXSA 4DDUA 2JAQA 4HAWA 2FEOA 2D06A 1G41A 4XSGA 2YHSA 5JWHA 4QOSA 3VX3A 5DI3A 1I4DD 4TT3A 4C4PA 4NL4H 4EPVA 2X8AA 4OQNA 5FTNA 4HUQA 4US2R 3ZZ0A 1HQYE 1G8GA 1M1YE 2GVDC 3C16C 4Q9JA 1N6IA 4YMVA 1D8TA 2CCGA 4JL8A 1Z63A 1S8FA 4Q4JB 3VR3A 3T61A 4RCZA 2BJWA 4C2UA 1E99A 2C9CA 3I5XA 5E3HA 4DUGA 2CNWD 3P4XA 4NCIA 3JZMA 3QKUA 4UKDA 1JJ7A 3GLGA 1OV4A 8OHMA 1WDTA 3RVBA 2ZS9A 1Z08A 4HB2A 2DCUA 3V9PA 4E09A 2Z5FA 4M4SA 5H70A 2VP9A 5EXXA 4C30A 1H8HA 3K70C 3CNOA 3Q7PA 1KJWA 1SVKA 3ZJYA 2R6DA 2OILA 4WXRA 5FUVA 2DFLA 2A7QA 2XEXA 3GJ0A 3KFXA 1COWD 3GLGE 4MRSA 1E1QD 1TF7A 4CEJA 1M7GA 3A37A 2QAGC 2ZSBA 4US0R 1ZM3A 5DN6D 5AJVB 4C0HA 3DL0A 1RVDA 3DMDA 1KMQA 1CBUA 3BIFA 1ZYUA 2VHUA 1FX0B 1KI8A 1XD9A 2IS2A 1SVWA 4KODA 1HURA 2JLQA 1KK0A 1Q0UA 3SBDA 1AGRA 2ATVA 4XD7A 3RS7A 1XWIA 1ESMA 3UMRA 4XVQA 1TTTA 3OE7A 1OT3A 2QL6A 1ZIPA 2ZI5A 4PHHA 1CIPA 5HTKA 621PA 1TUEA 4GRAA 5JECA 4TL9A 3QKSB 1LF5A 4TMZA 2V6JA 3W6NA 1W1WA 2XTZA 1ELOA 4URXR 5CLLA 2QP4A 4FD2A 3LW7A 1R10A 4WIAA 1XMJA 1NMYA 1RRFA 2YC2C 4PC3A 4KVGA 4M1SA 3THYB 1VMAA 5FBVB 3RANA 1W0JA 1N6NA 3PITA 1P3JA 3W34A 1AGPA 2JDID 5HKKD 4LI0A 4DIDA 4KJZA 2FWRA 4TQAA 1T5LA 5KDDA 2QM7A 1FFHA 1OKKD 2R8RA 4BLSA 3EPLA 1R0XA 4YMUA 2HYDA 3WMEA 2OCYC 3TH5A 2OESA 4QJ4A 2VLIA 1TPZA 4HAYA 2R6CA 1Q20A 1T6NA 2G0NA 2YWFA 3O8CA 1MO4A 2O0KA 3KJGA 1U9IC 4QJ3A 1EFHA 3A8TA 4O25A 3K70B 3VU9B 1Z0AA 1R7RA 2IYYA 2JA1A 3OESA 1R6BX 1XEWX 1S0UA 2VF8A 2JJ8A 3GLIA 1GL7A 5CM9C 3TR5A 2EQBA 5SZJA 3GEHA 4GZMA 4GOKA 1XPOA 3QQ5A 1CP2A 1XCGB 1KZGB 3THXA 5J5CA 3HR8A 2IW3A 2QAGB 1N5LA 4K46A 4Q03A 4WOPA 3GFOA 3U2QA 1JB1A 4TTPA 3L82B 1XPRA 2GEVA 4OKSA 3QIAA 3R8CA 2J87A 5B2ZA 2XZOA 1OH6A 2OBNA 3K8YA 1HE8B 1TF2A 2ZJ8A 1TQ6A 4Q47A 3RAPR 2X77A 3G82C 1KHTA 1NRJB 2IYQA 3Q3JB 4TZ6A 1SQ5A 3P32A 1RJ9B 1QVRA 4OQFA 3BFVA 2ZE7A 1W7AA 3IQXA 2H92A 5KU1A 5TB5A 1S9DA 4P4SA 1GWNA 3KKMA 5E7JA 3OAAD 1UFQA 2VH5R 4E07A 2W6ID 3SDZA 3SJCA 2C78A 4NBSA 2DYKA 2QM8A 4FMDB 4GP7A 3OEHD 1KDRA 3P26A 3TAHA 4K81B 1DTSA 1KSHA 2WWFA 2GRJA 1FNMA 5FOWA 2Q9AA 4XJXA 1B0UA 1VYVA 4MRNA 1DAMA 1GKUB 2WIAA 2ZETA 4RZ2A 2F1JA 1MRNA 3B5JA 3LH5A 3U3OA 2ZJBA 4E22A 3L0PA 4B34A 4RKEA 5J4VA 5AUPB 1CJUC 1E79D 1TL7C 2OO7A 4PXAA 3NC1C 3UANA 1KO7A 1N5KA 4XD7D 3SHWA 4PC2A 3ZIAA 5HZKA 4EIWA 4QRHA 3OE7D 1OIWA 2NZ8A 3DM9B 2CLSA 2A5JA 3CIOA 5TY0A 2EFEB 4B3CA 1KGDA 1O3YA 3B7GA 5CITA 4LJAA 4TMXA 3R7WB 1VTKA 3TBKA 1GP2A 1X6VA 2X2FA
chains in the Genus database with same CATH superfamily
3UKOA 1VSBA 1W2GA 3HB5X 3TCKA 3WSVA 3UK1A 4LZZA 4JROA 2OZLA 2XIJA 4FW9A 2K87A 1PFVA 5KEIA 4BFCA 4HS9A 1FQOA 4JJGA 2J9FB 4DMKA 1KKUA 4C6TB 4X45A 1OBHA 2OB2A 1GZ6A 3VNVA 1C30B 4XXHA 1HTWA 1MAAA 5EYPA 2HH9A 1F5NA 3I2JA 2XDWA 3NM4A 4TX1A 4TLMB 4J29A 4Z9XA 3RFUA 3EASA 2QX4A 4BLOA 1N36B 2PSEA 1Z34A 4EATA 2R5FA 1GGVA 3FVRA 4TS1A 2J45A 4NYMQ 3UTCA 3NHLA 5JXIA 4QM7A 2GXQA 3I53A 4QTZA 4BMCA 2WU0A 4YH1A 4AZ3B 4V0KA 3QZUA 1RKVA 3KEFA 3IPAA 1E9BA 2VAMA 3TSYA 3W6UA 5CLHA 2OV4A 4FCWA 5H0IA 2ANCA 2HNBA 3C6QA 2PLWA 2NACA 3WNZA 4DWOA 3O95A 2A4KA 4J3NA 3F3KA 2V7QA 3NDJA 1WOYA 1KNXA 5F5XA 3PQ8A 2AQIA 2RGDA 4MAAA 5EE5B 5EN4A 4JBWA 1QRSA 4LOHA 4IIFA 4WCFA 3U3DA 3KYDA 1KK1A 3Q3VA 5EUQB 4G26A 1T29A 3OTQA 4KO2S 4OX9B 4YQYA 4F3RA 2J7KA 1XIVA 3NX4A 3T35A 4GMGA 1RI2A 4BQSA 1K8QA 4C3UA 1YZGA 4XDZA 3RCBA 2Q50A 2DQYA 2GAFA 3MMNA 4XEUA 5H81A 4U0JA 3AU8A 2UVPB 1PTJA 5KNCH 3KHKA 2DF8A 3ND7A 4IO0A 1G64A 2Y77A 4KZPA 2GNOA 5DHUA 1D1QA 1XTKA 1G6HA 3SF8B 4HWPA 3ZWKA 1EGHA 4PONA 1TYEB 2JFVA 1XK7A 3R0IA 1P1JA 2HXYA 3QVUA 1BO6A 4U7PB 2XHZA 4DRXA 1BROA 4WOCA 1BKDR 4QBHA 3GCXA 3WNQA 4JLOA 3WRYA 4E33A 5JSYA 2I4RA 1VKOA 2ISQA 2RHCA 3DBRA 2PRZA 3H16A 1EHYA 4Y0AA 2AFVA 3WKEA 4S2EA 3ES9A 1O08A 3VR5H 4HH3C 2HJWA 4MKFA 5KTPA 2X40A 3PR2B 3YASA 1PWZA 2FOLA 2P9FA 4KXFB 2MSEB 1OB5A 4YAKA 1WF3A 2Z2XA 4L9AA 2HIAA 3V97A 1UMBA 1IJFA 2VQ3A 2GO1A 4X3OA 3JAKA 2G67A 2CVZA 5I5GA 3V8QA 3D1JA 2R47A 4QODA 1QS0B 4J1SA 3N8IA 5TXGA 4N1AA 3UUEA 1W4ZA 3GPBA 2PMEA 3X1ZA 2QMOA 3EXG2 4XR9A 1O03A 1E3JA 2I2FA 2YJTD 5K3BA 1PTKA 4NVRA 4OOFA 1B42A 2HT6A 3MMZA 4AC9A 1Z28A 1GU1A 1X0VA 1T0UA 3N75A 4EI9A 4MPRA 3WKAA 2IEDA 5FYQA 3WLAA 4GMXA 3W2HA 4DYHA 2DGDA 2CFTA 3IA2A 3PUIA 4FGJA 1BQEA 3I37X 1KAOA 5DXJA 4IUBS 4P5PA 5J2TF 1LVGA 1NL3A 3SPXA 4HNQA 3R74A 4MUNA 3L5OA 4RF3A 3RVRA 3CB4A 3QE2A 1ZSVA 2RHOA 4BX8A 3F71A 3W8NA 2AT1A 2POCA 4I1YA 3B6IA 3DO8A 4GOXA 2L0XA 4C01A 3FCUB 3PNBA 3T1YB 1GCIA 4P9NA 3JWHA 5I9TA 1L5HA 4QG3A 3W1VA 3BE6A 3C3KA 1C3LA 1PFYA 4JLUA 3A6HA 1TA4A 4UFNA 2Q4OA 5ERXA 4RA9B 4AJPA 3ZYZA 2ODNA 3AETB 1A69A 3D8RA 3E27A 3VHRA 2NYRA 4CLXA 5E9WA 5JSHA 3U4QA 1Q84A 4IW3B 5ALIA 3TRJA 4CNBA 5JY1A 3A70A 1YU9A 2OAQ1 4D9BA 2HPZA 3DH0A 4H3KB 1SKBA 2I8CA 4TTVA 3H8VA 1H4SA 4RM3A 1N57A 2VKQA 5IC6A 1RWMA 2IX3A 3F6BX 5IAAA 4WVFA 3A26A 1JEAA 3FYUB 3TK1A 4QU9A 4B3GA 1K1EA 1JT9A 1RXYA 2C4MA 4XB6B 3MLAA 2IU3A 2CDBA 3G8YA 4D8WA 4X94A 1C29B 3CW2A 5BPFA 1ZUNB 2M2IA 3PNLA 1ZRSA 5IDXA 1KC3A 1GDTA 1E5TA 1M6WA 4Q3CA 2QTHA 3LC7O 1FRFS 3LVRE 1NMSA 2ZAMA 5GPBA 2QY6A 2K2QB 3WA6A 1QK3A 3WRXC 2PG3A 4RF4A 3Q7RA 4OSEA 2R5NA 1GY8A 2WD9A 2Q6IA 4CF6A 1OSNA 2O57A 3NBZC 3O90A 4MQEA 1GUZA 2VPWA 1PBNA 2Z09A 1Q1BA 3BJMA 5A4KA 4QOHA 4GC9A 1VZ3A 3SE0A 1VPEA 4EM6A 3SICE 3NVKI 4TSFA 3IYLW 3KT6A 3IQWA 1G5RA 1R88A 4MX8A 4O1MA 4YHHB 2Z9CA 3CR7A 2IKSA 3NHKA 3GFQA 4F6LA 3BXFA 4GI1A 1FNDA 5F98A 4E4RA 3IDAA 1A82A 2G07A 2P41A 4LPKA 3TCNA 4CV2A 1NJ5A 1AVTA 3RUEA 3C1TA 4R2LA 2NXEA 2HCBA 1THTA 4PVDA 3P27A 1OPRA 3G2MA 3H0CA 4UASA 5CYPA 3CLRD 1XZKA 2XTAA 4JP3A 4PG6A 4WBNF 3E3AA 3F96A 3QXHA 5ER9A 3NU1A 2O14A 1FP7A 1KO5A 2UZ1B 4WGGA 1F3LA 4FINA 3BMOA 3VKFA 4CMGA 2PJDA 3EIQA 4AS1A 4X60A 5B3LA 2QUKA 2QMHA 1E0SA 3FI0A 4KMOA 4YGYA 4CMEC 2HPHA 4U4AA 5GINE 1G8AA 2Y67A 4FGSA 2FWBA 5HF5A 2Y0BA 3OUZA 2VDQB 3GT7A 3NP9A 4DTIA 2CUNA 4BNMA 2DBRA 3TPCA 2OQRA 4ZARA 1EK2A 2NUBA 2O8FA 2W4IA 1AQJA 1YQEA 2WJWA 4K6GA 2CD7A 4A82A 5IT5A 1L9XA 1SELA 1YR3A 1T8TA 2RDMA 3IEPA 1K0FA 2FX3A 1XRSB 2REQB 3HO6A 1QGOA 2OCAA 4DV0B 2NNWB 2J4CA 4CKEA 5L3SB 1B1AA 3BSFA 3CH6A 4R41A 4ZOAA 3Q6NA 1LDNA 3ACBA 1R18A 3EG5A 4NULA 2R5WA 5LWQA 1GTSA 4H59A 2VTKA 2D7DA 1ST2A 3KQYA 3ACCA 1OHHD 5F12A 4WJKB 1ACLA 1NNUA 3HKEA 1HL7A 2FG7C 1KRHA 2X5OA 3I34X 5LLTA 1L7NA 2C42A 5J4KA 5J58A 4CXMA 3DE2X 1GARA 2JFFA 3M6IA 2GJAA 4Y2HA 2D3WA 1GZUA 4G0YA 4P5EA 1E4EB 1FFDA 1G8HA 2E9SA 2I66A 2GUGA 2J5BA 3DDSA 1SKUA 3QY9A 4WINA 3O1JC 3TSOA 1WMDA 3SWWA 4PN3A 2GN0A 1YQGA 1RWBA 4RY2A 5IF3A 4H0CA 5T64A 5KJEA 4KIFA 4QULA 5KYWB 1D0SA 2V5VA 1WZUA 4GPTA 2J0UB 4D57A 5DSZA 3KQMA 3D8TA 1D3AA 2ZS7A 1G2QA 3E3NA 3EH2A 1S01A 3M2TA 3OZXA 4UQLA 3I5MA 4CLHA 4MWCA 1TEVA 2HCTA 4GP6A 5B58T 1LPPA 2O8DB 4BP1A 2UXDB 3PE3A 4IH9A 3TGPA 4B4WA 4YAGA 3TW0A 5IBCA 2FGJA 2D7JA 2Q4RA 3TIVA 8ADHA 5JVDA 1XEAA 2I1QA 3DMTA 2GN8A 1SNYA 4KXQA 1MJHA 5AIAA 3ZE0B 2H00A 5KJFA 4WK2B 1G6Q1 1UBGA 1VSQA 2F67A 3EZ6A 3G23A 3ZTTA 2JC3A 2Y0PA 4KX3A 4WZBB 4YLGA 1PQWA 3HP7A 1WW8A 3H7AA 4FDMA 5BNFA 2R1TA 2WJ6A 3AU9A 1UPCA 3KKZA 3TOVA 3SZ3A 2A5DA 2EHJA 3A6KA 3FZYA 3I64A 3DB2A 3TF5A 5GIPE 1CQWA 1UPBA 1SY7A 3ZDEA 3IUJA 5M34A 4F2DA 2O2ZA 1NKTA 5LZ2A 1CY6A 4RZQA 2OQVA 1P5ZB 4IVRA 4CV1A 1QV9A 2IUSA 5LQCA 3E7XA 1FUEA 3EVEA 5C32A 1Y5LA 2AYZA 4X64B 2CZGA 3BIOA 1EVEA 2XUKA 4K9DA 3SDSA 3TQQA 2IH5A 5HQ3A 3HJBA 1N2IA 4NZZA 2NU9B 4F8JA 4W5OA 1LVUA 2EFDB 2JLRA 4RWEA 1B41A 3TZBA 1O5TA 5IMBA 1P9WA 4FUTA 4EHDA 3N9IA 1EXNA 4JVMA 5MHTA 4R51A 1OIVA 3UYLA 1PLKA 2RKOA 3HB4X 3HBLA 4IIJB 3KZOA 5BWMA 5CA1A 1FFYA 1GQSA 1ULAA 5JIBA 3TNYA 2C9MA 1Z5ZA 3U26A 5MN5A 2ZYSA 4YJ3B 1KQ3A 4ZO9A 4QU5A 3TOCA 2Y1LA 9LDTA 2WHXA 1T5OA 2HV8A 3RK4A 5AKHA 3BQMB 2DR0A 1JBKA 1EJBA 1PSDA 3RJ5A 3B9BA 4KQFA 3KLNA 3JVUA 1KBQA 4WA7A 5TGTA 3HNOA 4YJ2A 1NMXA 5EKDA 5TMEA 4Q7KA 2WJ3A 3WVNA 1A1VA 5B1IA 3QEMA 1KBOA 4RD3A 3TZCA 4IOLA 2PZJA 5ITVA 1PVDA 2WJGA 3WFZA 2BMWA 2ZT6A 1V7CA 2FWIA 4QC2A 3FCCA 2W6ZA 4OI1A 6NULA 2QU8A 3LWNA 4XB2A 4KOEC 2C4HA 3OZTA 1G5QA 3ANNA 3E3OA 4QAQA 3GLTA 1P74A 2DQSA 2VP2A 2VQSA 2HX1A 2C97A 4LCEA 4MR7B 3L6CA 5A9SB 2PUEA 4PXYA 3T06B 1N5OX 4E4YA 5THQA 1UXKA 3UHJA 3N2EA 4BZWA 1QM5A 3DDZX 2O5EA 1OGIA 1LC0A 3KLPX 2ZVPX 3ELBA 2HF9A 3JQ8B 2IEZA 3H0EA 3M9XA 3THSA 2PKYX 5FA6A 3NYQA 5BQXA 2E5FA 2LDBA 4HDSA 1N0UA 1PHRA 4GI5A 3B3JA 4OHWA 4RC9A 1R6UA 4YCAA 3V00A 3PIRA 2WMDA 3T9DA 1UAAA 1RWKA 1YJAA 1Z4QA 2O2HA 1ST3A 2FPGB 3QUQA 1DAFA 2IU6A 1JHQA 4ID9A 3RSHA 1OH8A 4GOLD 1PIWA 1CVLA 1ESZA 1B43A 1UFKA 2DP4E 3QVMA 2PZGA 1TLFA 3FMPB 4HYTA 1WTCA 1C9JA 3RIHA 1J42A 3W5BA 5M2QA 2M6KA 3GRAA 3GW8A 3JQAA 1A9TA 1H8ED 3X1KA 5FBQB 1PX0A 4KR7A 1FUIA 4L8GA 3EA4A 4LWPA 4PSAA 4EYOA 2XXBA 1T0PA 5I7WA 4BBPA 3N1UA 1H0SA 5EOVA 2IXGA 3VC1A 4FN4A 4TTSA 3NCTA 4CIVA 4JKOA 4P34A 4LE0A 3OU6A 5C5CA 5BV8A 2GAJA 4X7MA 4LYDA 2ZXEA 3UF0A 2P2YA 4IIVA 2PNFA 3EWSA 5KTRA 1J9ZA 3N74A 2PGJA 5GM2A 4NQRA 3SJAA 1IPEA 1RYYA 2BDEA 4JLKA 3TIFA 3C98A 1GILA 3SYNA 1XXHE 2EQ5A 1VQ1A 1E2IA 3VJMA 4RVFA 4ZI7B 1UMDA 4M0EA 3PLNA 3TMYA 3PHLA 1KBZA 4Q4CA 1ZH2A 1EUDB 5E7IA 4G1VA 2CDNA 3EXAA 1U2EA 2VDNB 2PUVA 2XB2A 4GOMD 1OD6A 4C4RA 3AVXA 4NYJR 2B7CA 4CODB 1QAOA 2HK9A 3VO1A 2FWNA 2HUPA 4FZRA 1U2DC 4S24A 7GPBA 5L4LA 1YVDA 3OQNA 2FLWA 4ZQEA 1YF3A 4ZKDA 3H65A 3HKDA 4HT3B 3CSSA 3P2EA 4PSCA 3AVYA 1HNNA 1XQ6A 3T94A 1AKRA 4DEYA 3DDWA 1XZJA 4YRCA 1IUNA 3NXKA 3OIFA 3ZE2B 3B1WA 3M6WA 1QFZA 3U19A 1G19A 2OCIA 4MUMA 1J2YA 1PX2A 2VTDA 2JI6A 4HGZA 2CBZA 4W8GA 4Y6SA 1TD9A 2XNDD 1FUYB 3OFNA 4TKMA 4CR8A 2J3EA 2WF9A 1XF9A 2XNSA 3MUEA 4BQEA 5K0JA 2Z6AA 1P44A 3E3LA 1CDZA 3VU1A 2WTNA 1DAGA 5FPSA 3C3MA 3WXBA 4A1OA 4NNJA 5DGTA 5BSFA 2JK0A 4JJFA 3GY0A 3RVPA 3PXUA 4PLPA 3CTMA 3IXQA 2PKRA 1N5RA 3OCYA 2C7PA 2G70A 3FH0A 2WSYB 2XMGA 1PI3A 4XIYA 2BN4A 3RVJA 1YQTA 1CR2A 3DEHA 5H4GA 1CUDA 2FXIA 3T9CA 1OX4B 3COYA 3M5PA 4HATA 3O9VA 4DCJA 1N9GB 3BTOA 3MGCA 3NAQA 4L3VA 4Q1CA 3TTWA 3D1VA 3UBMA 4BKOA 3R3UA 2FLVA 3OETA 3WGOA 4C4OA 2RG1A 1DV2A 1U0LA 3A1UA 1U6IA 3A7EA 2VHVA 1O54A 5HG0A 3VMMA 3PC4A 1U8UA 1U0OC 1YWGO 4IUDS 4NBRA 1T5HX 3RG2A 4CM1A 1BJKA 4IDQA 5CEEA 4LGVA 4GG1A 3S2SA 4DM3A 4DNXA 3IVXA 4YRKA 5FA8A 1CHNA 5E4YA 4TKZA 1G5TA 4EO7A 2I8LA 4QIHA 3LI2A 3VDNB 4UULA 2JI9A 2C95A 2VHXA 2AJ8A 5AVYA 4X97A 2YV3A 3MCAA 5G0UA 1WBDA 3WGNA 3P9NA 4DR7B 2BGRA 4P53A 1CEEA 3VO2A 2VO1A 3DOUA 1YBHA 3O4GA 2PA3A 2OV2A 4IDNA 3L6EA 4PAGA 2W70A 4D8TA 1Z0ZA 2VP4A 4IEIA 3WIEA 1JVNA 3MRXA 2DHEA 3IUNA 4ZVSA 2Y6UA 2CLLB 2I3ZA 2PH5A 3HXPA 4RNDB 3G79A 1K6JA 3A4NA 3HBJA 4GECA 4U3JA 1J70A 4E30A 1RJGA 3AI2A 3LY5A 2WBLC 4LRSB 4M36A 1TI7A 3K2IA 5BWCA 4KAFA 2L69A 2HYIC 1R4NB 2F1KA 1TQ2A 2O06A 1YA8A 4IHJB 4TRMA 2IS1A 2REXB 1XA3A 3CZ9A 1F6DA 1AC5A 4HVTA 3C4JA 5CVDA 3PFBA 5IAGA 4F56A 4HLCA 5TQ2B 3DZDA 5DLDA 5JNVA 1MX9A 4ANFA 1M8KA 5I8ZA 1HG0A 3BC1A 1BOFA 4X1KB 4ESHA 1V6CA 1MJNA 1JFLA 2LNDA 2IUFA 3NOVA 3OZIA 5EQDA 4C0WA 4DIFA 5KO2A 3AEZA 2VJPA 2FFAA 4XTCS 3W77A 1A9OA 1WB4A 4JDPA 3PF8A 4K0KB 3EZ2A 3H9CA 3IBFA 3RLFA 1A88A 3PPVA 1E9SA 3UGQA 4J2HA 1DKPA 3ORSA 3TQSA 2QLBA 2WYOA 2VS1A 4QELA 4AZ0B 3EPJA 5KTOA 2CKDA 4YAWA 3CVVA 4J07A 2X4LA 2YFHA 4TZTA 3ZS9A 1ZN7A 3SFTA 4J4HA 4HNTA 4AWXA 2RE8A 3BL5A 3G1WA 1KMHA 3OOEA 3B36A 1VCIA 3KRTA 5SY4A 3KELA 3ZD6A 4HXFB 4YRZA 5EIEA 2IHVA 2Y0CA 2HCJB 1M5UA 4LV8B 1MO2A 1NBIA 3BRWD 1CUWA 4UUMA 1E7YA 1YS7A 4PNHA 1VXOA 1QAMA 1ZM9A 1IQPA 3IBSA 4RKQA 1X7GA 4UOZA 1Q0RA 1KAEA 5LQDA 2UZ3A 3KQSA 3WK9A 4RVCA 5JANA 4MCHA 4MP6A 5JBQA 1VA5A 5HFJA 4CM4B 2P2LA 3OIUA 2YY5A 1L3CA 3MPOA 1RKUA 1TXGA 3AUUA 1KJ9A 4MUAA 4NEGA 2YYYA 5E2IA 5IVIA 2G5PA 3KJEA 5HKBA 5K09A 2WWIA 3WIOA 2IDMA 2P4EA 4UPVA 1Z8NA 5A4AA 2NTYC 3T99A 1F20A 3FR8A 2BTEA 1VLMA 3FNRA 3NAGA 3RSOA 3UVEA 3PI7A 5KC9A 3REQA 1HH4A 2IF2A 2QI9C 3UMMA 1HSZA 4UOEA 1JZQA 1TC1A 3H5OA 3I52A 3HRIA 3R7SA 2F6RA 2Q6OA 5FPTA 5K4HA 5LDGA 3VZPA 5FFMA 7MDHA 5KKCA 1ZVKA 1YXMA 5TF0A 2CJPA 3RC7A 3SQNA 1XZFA 3B51X 3QPUA 4AAYA 1TAHA 2W48A 3O92A 3PDUA 2XMQA 1X0XA 1X13A 3JVVA 3GXOA 2PH1A 3B6KA 1NYLA 3AR4A 4YP7A 3TRHA 4RXMA 1I4WA 1QZZA 2EFHB 3DMRA 2Z0MA 5H1YA 1SVLA 4B47A 4DLRA 1S2LA 4DDWA 1UQRA 1MAWA 4RD0A 2B35A 3EC2A 4AI6A 5L3RA 3RLIA 1IBCA 1CNMA 2NVOA 3BF7A 2PCJA 1YZYA 4UC0A 5EZYF 1EG7A 3S2IA 3UT5A 3W5JA 1UC9A 2YXNA 2ZYVX 1I7LA 1RAFA 2VCEA 1VC2A 3I0ZA 4JX8A 5E8JA 2RGAA 5EKXA 3NHJA 4O2BA 4JP2A 3VC7A 2QMQA 4X93A 2H1RA 5J40A 2YIVX 3EPPA 3KYDB 2ICAA 3VZSA 2Z2IA 4Q66C 3NJRA 2H18A 1R64A 3TLKA 5EJGA 4WJZA 3DPUA 1DC4A 1U0BB 1R2QA 4HYQA 4A2PA 2I7XA 1W29A 2JASA 1KY2A 4AURA 2JI8A 4XH9B 3U16A 2QN3A 1OFVA 3F7NA 4TXHA 4L4ZA 4O4IF 5F1PA 1G2IA 3DE0X 1SUEA 2EW8A 1LDMA 3V8NA 4B6SA 2C7QA 1D2NA 1RABA 3M6MD 5FWXA 2BHSA 4NKRA 1PZNA 1WULS 3TRKA 3WDMA 2GJSA 3SYRA 4G81A 4LTNA 4DRXB 1JHDA 1YNOA 2XKJE 4RD1A 3VZCA 4RHCA 1GT6A 2AJTA 3KXIA 1U4SA 2OUIA 3DBRB 4RFLA 3TPFA 3VNUA 4PQFA 4NV3A 1OXXK 3Q2IA 3OKAA 3T5AA 2OGWA 1PEKE 5IC5A 2AI3A 3E84A 2QAGA 1SHTX 1IEXA 4K9OA 2QORA 1EVYA 4XKJA 3AJ8A 5TJ9A 1X1CA 2BMDA 3JX9A 4I1OA 4N9QA 3BK2A 1JAHA 4OKNA 3K0EA 4DIEA 3ROGA 1DBWA 1PWYE 2NTVA 4O6VA 1TVEA 4DM4A 3RC8A 5U9CA 1R6AA 4KQKA 4OVKA 2NNLD 3K16A 1SBYA 3FBWA 1U90A 3AVQA 2WWXA 2J3LA 3QLVC 4RVUA 2BGGA 1RPJA 3HC7A 3Q9NA 4DQUA 1F4PA 2GGSA 3JZIA 4C03A 4TVKA 3MBKA 3ELUA 4INJA 3U80A 4JVLA 3UGJA 4QQNA 5DULA 2G82A 4BIMA 4X54A 2XOXA 5FOXA 2Q3HA 3HEBA 2X6QA 3I9NA 4XDHA 1W76A 2HOQA 2ZDQA 2IVFA 1K89A 2WUWE 1X1BA 3U61B 4NS4A 1LSSA 2SHKA 2W37A 1EINA 3B85A 4PZYA 1RI5A 1XAHA 2H1HA 2ZUDA 3AIKA 4L0MA 1R15A 4FC7A 1IDN1 4LKRA 1PJ2A 1BDBA 3X2FA 1ZRMA 2HSEA 4CE6A 3TOSA 4W5TA 2L17A 4A27A 1L5HB 3DCJA 1H5UA 1Z6AA 1GNQA 3KD2A 4PBTA 3IMKA 1XDZA 1BMTA 4HDRA 1PL6A 1DE0A 1T2AA 4R1SA 1UAYA 4G0WA 4CM6A 3U4QB 2I6SA 4FOLA 3LPDA 3RYHA 4E08A 4F97A 3C8ZA 4R71A 3SFVA 1P31A 2PSDA 2OC4A 2WDZA 4C06A 1NNLA 1J9GA 2GBGA 2VRNA 2WFZA 3SEZA 1DPGA 3TJZA 3HO1A 2GEJA 3KQLA 4ZD6A 3ZDXB 4URUR 4I4TF 1JH8A 2QTGA 4TT8A 4IWXA 3R3SA 4XCXA 4OYYA 1CQXA 1H6CA 2F59A 1HRKA 2YV5A 2LBPA 4EITA 3UQZA 1G1MA 2ZRFA 4Q18A 4J90A 1Z0IA 4HEA1 2QTVA 3F5DA 3KEMA 3KZNA 1U7XA 2IV2X 4CQJA 4F3YA 2OHJA 1MJFA 2VJBA 5ANRB 1XMQB 2AFIA 2HDWA 4D9FA 1KAQA 4EF5A 1Q1AA 2J41A 2PBLA 1Y1PA 4OXKA 3VR4A 3D7SA 5JQGA 3CF2A 3LNCA 4GXRA 3SSAA 1JIUA 1G3QA 4MQEB 3ODPA 2ZB4A 4QO7A 3NRBA 4L6IA 1HTBA 3MLBA 3HA2A 4B6PA 2XITA 4DCMA 2PUHA 2HLNA 1C1XA 1PCXA 2WKSA 4R4JA 3DL7A 4I3GA 5EGNA 3IHKA 3U4GA 2CYBA 2XVXA 4DHWA 5HNKA 4LQDA 3ICEA 5C9ZA 1H65A 2FP3A 1LUAA 2AFIE 3MCUA 2B4AA 4BZPA 3UY4A 1CZHA 4DNFA 4A36A 2PE5A 4M1EA 4GICA 3PGKA 1Z88A 3ZU3A 1I9CA 1NDHA 4B2PA 5IT9A 1KVRA 1QUEA 1Y6RA 1E5VA 3QM1A 1ZOPA 1YFLA 4J1QA 4CIDA 2A59A 4DUYB 4PICA 2J3HA 3V80A 4M46A 3R8FA 1XDWA 2BF4A 3QUBA 4Z9AA 4QATA 3ZCXA 2WWHA 1Y8CA 2EFYA 2GCNA 1MH9A 4Q9LA 2LE0A 4AYXA 1CYDA 1VI6A 4KP7A 1U8ZA 4Q01A 3M1AA 3ZQJA 3JAMA 3FHTA 5DGXA 2FPXA 3DDNA 3L8CA 4D0GA 4QQRA 5AVVA 4IUCS 3WIBA 1THMA 5KKNB 1U11A 3F9IA 2P6NA 4B2YA 2Z2ZA 1FSZA 4IIEA 2JFPA 3ZE6A 5I7VA 2E49A 1W85B 3FGPA 4WT7A 3O4IA 3A58B 5C8YA 4YRAA 4MRRA 1BWPA 2FB9A 3A1TA 1S3IA 3DFUA 1KEVA 4GQIA 3ELWA 1BYIA 1HPLA 2QZJA 1P39A 1WUJS 2DBQA 1BXRA 5CVCA 1UPFA 3EDCA 3I9FA 3LDHA 5JCXA 3QWBA 1G20B 4D41A 3HKEB 3QMWA 4EZBA 5FNVA 5CA0B 1YIDA 2PSFA 1C3JA 1Z5OA 1CIVA 1KEZA 1M1NA 3ESBA 3H1AA 1YK0A 4P80A 4GYJA 5KHOC 3GBVA 4EP1A 4PBRA 4PZ0A 2RKWA 2NUAA 2ZB2A 1JU9A 1ILEA 1U80A 3LHFA 3KD3A 3W3AD 1RHQA 1Y6JA 5JJKA 1RYDA 3GA0A 4TS9A 3ADKA 5DBEX 3U44A 3MS7A 3UB3A 2NIPA 2VP0A 1DTWA 1E6CA 4D4KA 4UHBA 3PHIA 3RIMA 1LBEA 1SCJA 1YRBA 1JIVA 1WBJB 5IAEA 2AH5A 4F4JA 3NJ8A 1HZZC 1S3GA 5CLFA 3HNPA 2JEOA 2XUQA 1PN3A 1WPGA 2ZJ7A 4MUHA 3UJ7A 2QLMA 4L95C 1VZ2A 4JOBA 4KV9A 2CHEA 4RSMA 3F97A 2F00A 1L4HA 1NF3A 2AUNA 2J1LA 1A9XB 3C6BA 5F76A 4YXWD 4CG3A 5CDSA 1IYZA 2W22A 1CF2O 3G49A 5L7TA 1FVOA 3FIJA 4NNPA 3U1VA 3STWA 5AJWA 4ZU6X 2O1WA 2VDJA 5IG2A 4ZT3A 5HKAA 5DV9A 4JMPA 5EY5B 3TLCA 4IQ8A 3CVWA 1IVSA 1IFXA 1X2EA 2EFCB 4TQGA 2R1TB 5FAKA 1CLUA 2V7XA 2HWXA 1KZ6A 3ND9A 2AXPA 3G7UA 4IGKA 4PAWA 1IQRA 4WKNA 2QQ5A 4JEMA 3JQRA 5LB4A 4Y0VA 2VWGA 2PSJA 3ET4A 3H8SA 5BMVA 2Y0DA 1KIAA 3AEKA 1H05A 1E1CA 2AR9A 3AKCA 4MVJI 2MT9A 1L4YA 1M2VA 1G8FA 4IIGA 4YFYA 5JH7F 5K6TA 5C52B 1ABBA 1YBAA 4F1JA 2UYOA 3PE4A 2QIOA 2X6TA 3F8TA 1MB4A 4QPDA 4A73A 4ALJA 4ZRDA 1B23P 3KXPA 4UHDA 1U7TA 5I9LA 2WV7A 1BXKA 3PQ4A 3RASA 3VSEA 2J3DA 1V9CA 5EWJA 3FHCB 2WD8A 3LXUX 4J9VA 3HU1A 1MX1A 4RPJA 3LT2A 4COKA 5GADl 3T4EA 4FEGA 1GPBA 1F5SA 2OP1A 3JQFA 3QFHA 3ZIDA 5CDFE 3CF4A 3QWFA 2JH9A 5JW6A 3Q8KA 2Z3ZA 1N0VC 4KQGA 3WI7A 4KJXA 3RWOA 1ZH6A 3K6KA 2VNSA 1KXJA 1PJLA 1YA4A 1ZAKA 5CA1B 5HTOA 3IRVA 3C3JA 5E3JA 5K0SA 2JJMA 4LVOA 4WZAB 2X0EA 3SXJA 1HT1E 4NOLA 2P1ZA 2HSWA 4AP9A 5I47A 1N6LA 3AG6A 3ZK7A 3K0AA 3JD2A 2DQ4A 2R6GA 3OHMA 1H2EA 4KN9S 1J8QA 1K97A 2NO4A 2GZRA 3U0BA 3QEMB 2Q62A 5E1BA 3UG6A 1BWSA 3VDXA 2DB3A 6AT1A 5LQKA 1CETA 1XQYA 3N07A 5F77A 1G7CA 2P6RA 2BHRA 5DNWA 2YOFA 1Y4SA 1W35A 2Q2QA 1YUBA 3ASVA 2IZOA 2O2SA 1G3IA 5EKUA 1LQTA 3IPRA 1EK6A 3AHJA 3LT5A 1TCUA 5C1BA 2GYVA 1B0PA 3JZDA 4D2IA 5M5BA 5KDOA 5J2UF 3GEGA 4LRWA 1RP1A 2HJHA 2WU4A 3DP7A 1HA3A 2N1BA 3O3OB 4JL6A 4JZKA 5ALQA 1ODSA 2WWTA 3BHNA 1G6OA 1GSIA 1E59A 3Q5EA 3AP3A 4ZVNA 2XWJI 1YR8A 3Q2OA 1EGVB 1GUYA 1TU3A 4JLAA 4W6QA 3N2GA 3RH0A 3ZWYA 4HDSB 3LBNA 2DLNA 3UMFA 2QRQA 3PIDA 2FPUA 2VK8A 3TW8A 3QU4A 2EGGA 4CUZA 3GNSA 3K9GA 3QSGA 3CRVA 2W2VA 3KXDA 3SJ7A 1SKAA 3NPAA 2JH8A 2PWAA 2W6QA 3DUWA 4HJXA 4KE7A 2A57A 2NTNA 1ZC4A 2H06A 4C4TA 5LA6F 5I5EA 1GQ2A 3HRKA 3DV0A 3FFXA 4YJHB 3A1SA 1KKMA 4HX9A 3CUUA 4LYFA 4JBLA 2H9IA 3OPYI 1R0CA 3WYAA 4D96A 5C5IA 1HKUA 3A6LA 2Q0XA 4GKAA 4R9UC 1UEIA 2JF0A 1KXZA 4HH1A 4TQ9A 5ALHA 1M2JA 3S55A 4Z6KA 4K2AA 1JV2B 3SXUA 2YRFA 3V2UA 5F3WB 3N3AC 4CG2A 1UBTS 4BNHA 4DVGA 2QUIA 1NXOA 2QT1A 1TZCA 3LC0A 4RADA 5FULA 3QLEA 3E2MA 4BX3A 2BBWA 3FMGA 3LY7A 4ZVTA 2GZDA 2X8JA 1IHOA 1WXEA 1Z36A 3GB9A 2IYUA 3G2NA 3TNJA 2ZUWA 1VKNA 4ZMBA 5C18A 3ZV7A 5KQLA 3ROPA 4RHYA 4XZ3A 2YZGA 1E3IA 2WRZA 3L7NA 4A1FA 3LXXA 4E2WA 1WPQA 3S1AB 4INZA 3TTXA 4B3HA 5MFPA 2J9ZB 1AKMA 2OECA 3C87A 3K4HA 3RC2A 2BP7A 1ISMA 1P2UA 1W34A 1IOLA 3AUTA 3IDFA 2GEDA 5TRTA 3VKGA 4HBGA 5BT9A 1NBMD 4IOKA 4Q9HA 1U8EA 4MCIA 1Z56C 3AO0B 1N3BA 3HSSA 2YMLA 4TN1A 4WLEA 4CIAA 2PQ6A 3LBAA 1DHTA 3WQBA 3HKDB 2WKWA 1F8YA 1SBTA 1L5KA 3MEQA 5EFZA 2B4YA 1LNQA 1DBRA 2WE7A 4MR9B 3AF2A 3L7KA 5FLYA 5AWFC 3VU8A 2ADFA 5CT5A 1O97C 2YVAA 4YHBA 5E9AA 1L6IA 4RDCA 4ZHSA 4HUQB 1YE3A 4HB4A 3CEAA 1N0IA 2XJ4A 3QVLA 4KUEA 1T0IA 3RK0A 6LDHA 1S9HA 2B8JA 2YJGA 3CG4A 4CMJA 1JDNA 1G5PA 3CLSC 3NZEA 2JLXA 2QYOA 3KTAA 3KOMA 3IUMA 4AMYA 2BFMA 1GUAA 3KB6A 4D98A 3ONFA 4J0FA 5DX0A 5AYVA 5CXQA 4TMVA 4P7JA 5C4GB 4BNUA 4FP9A 4DCUA 1X1TA 3IUBA 2OE2A 3RB8A 5H16A 2P9GA 2J09A 3G5TA 1I51A 1RKBA 5KCMA 3QUSA 3MUFA 1WW2A 1PEDA 3GRPA 3CMMA 1G9TA 4LE1A 3Q9SA 1ZNWA 4M9CA 5AM4A 1PW5A 1J2JA 1MC5A 3Q40A 4CFZA 4KDRA 4U00A 1N2GA 2CMDA 2YYSA 1Z68A 2CXHA 5HQTA 2M32A 3GJQA 2Q3FA 3BWDD 1NYRA 2V59A 3GT4A 2PMKA 1K8YB 1Q50A 1X7ZA 2K6GA 4G1EB 3L9WA 3D0RA 5G3YA 3LJKA 1C0LA 1PL7A 1MJGM 3PRHA 3AF4A 2FQWA 5CDGA 4OJTA 3AR2A 3SLGA 1KVTA 2R1ZA 4JLMA 3LXRA 3SZUA 3G0OA 4IG9A 5IULC 2DETA 2GHQA 4AVYA 1ZISA 4M98A 4N48A 1K7FB 5H82A 2PUWA 2ILVA 1UFOA 1UQTA 2EBUA 2OHIA 4UAUA 4D9JA 4DUZB 1YOVB 5SY6A 3A0RB 1WUHS 4JYAB 4LSWA 2Z6UA 3WP1B 3N2YA 4RLFA 4XUEA 3P2JA 1SVSA 4KSBA 2LP4Y 4L8LA 5FI3A 1EHCA 4U3JB 2ZSAA 2YZ7A 5LM3A 4RAQA 1USKA 1C14A 4HDAA 3DT8A 3HY3A 2BFOA 4LBWA 3ZWBA 4CVNA 1GPDG 1X7YA 2NO7A 4N82A 3TEMA 4HRAA 4D9MA 3NDPA 4B3TB 3DEYX 3U6BA 4MUBA 3IAS1 4TLDA 2XGSA 1TQ4A 4G2NA 1Q57A 4OX9Y 3STXA 1J09A 1IHUA 3GJ3A 4ZAGA 3WKCA 4FD3A 4COOA 3PZBA 2F3UA 2QPAA 3ZKWA 3DE4X 4OXNA 1RM5A 4WKBA 3DBLA 2HA7A 4CGYA 1Y48E 1S89A 4IH4A 3PTLA 4K9SA 1W9MA 2NU7A 1HKHA 1G1AA 3QLUA 4HXYA 3E0QA 3IHLA 2CXQA 1UJ6A 3UQYS 4WK0B 3DB1A 1JHXA 5HEKA 2QMEA 3I8SA 5KHAA 2VQ6A 2BKVA 4RBNA 1IMJA 2A9RA 2FX5A 1AA9A 4ZOEA 2DH6A 2R96A 5D7NA 1NP7A 1A9RA 4H4CA 2F1RA 1UOEA 4O33A 1K6IA 3MC1A 3NBXX 2QRUA 4FFMA 3D64A 1AQLA 1KMHB 1E18A 1ORTA 1OGYA 1WLYA 2ZSKA 3HA5A 2CLHB 5CLGA 5C8ZA 1JHVA 2QMUA 4M8LA 2WI8A 3AVWA 3L7CA 3NKFA 4L74A 3AB3A 2JFYA 4OXXA 5FKJA 5BR8B 5KX5B 4K6KA 2FEXA 4X84A 1QH0A 2NX2A 3QNMA 4KRYA 3W5CA 2WG1A 2OV6A 4NZNA 3S99A 3ZN2A 2PX0A 3WDLA 4EG4A 1TX4B 1LRLA 3CCFA 2VJQA 4JD5A 2XD9A 1GL9B 4JNKA 3PC7A 1JKMA 4ENPA 3MAJA 4R3WA 3WS7A 4P58A 1WW3A 4C0AC 5BSKA 1NXPA 2V7GA 4NABA 2HCFA 2V45A 3SZOA 5JYDA 4ENWA 5K45A 3W2IA 3LQFA 1Y8QA 1Y37A 2VPZA 2QD4A 4V3BA 5IP5A 4A0QA 1G0NA 3VBCA 1YK1A 4KDEA 4E88A 1G8YA 1NZFA 1ZM2A 2Q0HA 4YUXA 3JVEA 3A9VA 4IDFA 2IPNA 1EX6A 2QDXA