4V0MA

Crystal structure of bbs1n in complex with arl6dn
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
total genus 42
structure length 166
sequence length 166
chains with identical sequence C, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0mA00
3R20A 1BS1A 4R9UC 4U7DA 3EWAA 3CR7A 3F5FA 4PHHA 3QPUA 4TTRA 2IX3A 2J3EA 2F6RA 4PO8A 1XTQA 4Q7LA 4AYWA 3FE2A 1TF7A 4BUJA 2VP0A 1DTSA 2CCJA 3I8XA 4EPVA 2OFWA 4B3GA 4Z51A 2ZRCA 3A4MA 3SZRA 3T15A 1II0A 3W34A 5AUNB 4R2IA 1GL9B 5J4LA 1WE2A 3AGPA 1N0WA 2WAXA 4JLDA 4Q9JA 3TSWA 3KKQA 3LBIA 4EJSB 1VCIA 3QENA 3ZVRA 4QM6A 5J4KA 3FTQA 1DAMA 5JSZB 1PUJA 3B9QA 2RKOA 1GRQA 4RD6A 2AD1A 2PJZA 2WWYA 3RWOA 2Q3HA 4DHEA 4DDWA 1IQPA 1JNYA 2WSSA 4TMVA 2ODWA 1G17A 4OBEA 5EUQB 3OE7D 3TAHA 4FCVA 1XD9A 1XPRA 3N5CA 2GF0A 1P3JA 4Q5IA 2VYFA 4WAUA 4FCWA 3R8CA 4GZLA 2QSZA 4BFVA 1F2UB 1P2SA 1U0LA 3I4LA 4KV9A 3HU3A 3SJBA 4EJSC 2D62A 2QMHA 1CJVC 1P73A 2ONJA 1TQ6A 1OH7A 4K8OA 3LDAA 2ZRAA 1E2QA 5CYOA 2BC9A 1DAHA 1G8FA 3TUZC 1OXSC 2WMOB 3ZZ0A 3THYB 4JSYA 1QHYA 1US8B 2ZI5A 4DLTA 3C8UA 3IBYA 3GLIE 1E69A 1T0HB 1RJ9B 2RHDA 3AVOA 2R6FA 4NL4H 5DHAA 5SZHB 2VIIA 3FKQA 2OHFA 3R9IA 2DWQA 1CJKC 2O8DA 4Q18A 1KJWA 2JCSA 4HDQB 3R7WB 5C4MA 2OESA 1XXHA 1UKEA 1ZW6A 3HYTA 3CR8A 4IOJA 2G9NA 3NH6A 3P32A 3NG1A 4OI0A 4WXPA 1KNXA 1G4AE 3UXMA 1MRSA 2WJIA 3JZMA 5CIWA 2HJVA 2QROA 2YVUA 1ZMXA 4GZMA 2OSBA 1L8QA 3DZ8A 1KDOA 4A0HA 4BFWA 1CR0A 3T1TA 3THWA 5KHOC 1E2HA 1P2VA 1Z5ZA 3BFVA 3DOFA 2ZI4A 4CEHA 1MABA 4BZXA 1GL6A 2IF0A 2BMEA 4RY2A 2V54A 2R8RA 3I92A 4C0HA 2W2TA 2A5JA 3CX8A 3W9YA 2FWRA 4PQYA 4NONA 4B47A 5D3QA 3QE0A 1C1YA 3BB3A 2PL3A 3ZVMA 4KSCA 5FR1A 3SJZA 3K0SA 3SNHA 5KPDA 1KI8A 2J5XA 2OLKA 4MYCA 5DN6A 4DVGA 5ANRB 1AS2A 4NCJA 2O8CA 3AKEA 4D2IA 1YZLA 1NRJB 2GJ9A 3CF0A 4ZKEA 1F5NA 2QMOA 1LW7A 5FL7A 1SXJA 3ZDQA 2QY9A 2ZJAA 4L4UA 1XMVA 4LJ9A 3RS4A 421PA 4IDOA 2PBRA 1Z83A 4GOKA 1N5JA 1G16A 2QA5A 4HLCA 3GMTA 1QHGA 4CIDA 1EESA 1E1RA 2WOOA 2V3CC 3U7EB 3R9XA 2CHGA 4BLTA 1E1QA 2DFLA 4MQBA 1NMZA 4JL8A 4FW9A 4ASUD 1FMLA 1T6NA 1Z0FA 2FJUA 3AF1A 2XNDD 1E4YA 2ORWA 2QP3A 2Z4RA 1UPTA 1Q57A 4YMVA 4B74A 1G7TA 3I73A 4JMPA 4AKEA 2IEZA 1UF9A 4QBHA 3SR0A 5CLQA 3CF6R 2ZUBA 2IK8A 5BN3A 4X8HA 2R6GA 2HT6A 3GJ3A 3SEAA 1AZTA 3GLFE 2Q9AA 3IPXA 5L3QA 1WBBA 4TMXA 5AUOB 4S2EA 2IYUA 4F7WA 1RIFA 3FDIA 2UZ3A 2JDID 5B30A 3RC3A 2NIPA 1EFTA 2PCJA 2R9VA 4OI4A 2H7VA 4A1FA 4C0LA 3GJ8A 4XVUA 4QM7A 3JVUA 121PA 1T3HA 1U0JA 1T8TA 2GWHA 1OLOA 3HPQA 4LGMA 4B6EA 2C96A 5GVRA 1G5PA 3NXSA 2JLQA 4XD7D 3FB4A 1KI6B 3EIEA 1VPLA 5KSPA 2O8DB 3NC1C 2GAOA 3QKUA 1ZM4A 1Z07A 5E7JA 5F9FA 1NBMA 4BLSA 2Q9CA 3E5HA 2QL6A 2QAGA 3AVYA 3W6PA 5FTLA 4JBWA 4EIWA 4QGHA 5BN5A 4NDZA 4BFTA 5C4GB 1BOFA 1UBCA 4CEHB 2Q21A 3QUSA 1MABB 1KNQA 3VR6A 1QBKC 3B60A 3CONA 3C16C 1NLYA 3KX2A 3MWLA 4S35A 4KVAA 1P9WA 3ZS9A 1AQUA 3IEUA 1M7HA 3NBYC 3ICEA 1OH8A 1W47A 2YHSA 5AK0A 2IYLD 2HLDD 4XSHA 4D4MA 4BFYA 3RS5A 3QF4A 4G0NA 4JYCA 3ZQ6A 1R8QA 3RNLA 3GLHA 1ODFA 1KI2A 5F3WB 3QKSA 2O8CB 2WV9A 3RYTC 3X1YA 1WRBA 2F9MA 3B1WA 1BMFA 4WBSA 5JJKA 5JHGB 2G77B 3FHOA 3MCAA 1VHLA 2OAQ1 2BM0A 2ERXA 4NHOA 4WZBE 4Y0AA 5SZKB 2WPDA 2ZYTX 4A15A 4TT3A 1UFQA 2VL7A 1NI3A 1JR3E 1SXJB 4UNSA 3C5CA 1E79D 3HJNA 4HLDA 5JFGA 1GRRA 4LHVA 3WYGA 2BBOA 1NMXA 1X3SA 2FSFA 3TNFA 2IXEA 2WJGA 3OFNA 2I1QA 3PVSA 4DSTA 2DCUA 2FFQA 3I5XA 3ADCA 4OHVA 3DM5A 1NN1A 3BOSA 4F92B 1ANKA 1GTVA 4NCNA 2C9CA 3QG5A 2E87A 1W1WA 4M9XA 3BK7A 5JJIA 2QT0A 4X8OA 4ABYA 2H17A 3BE4A 3G0HA 4ZIRA 3Q7PA 5LBIA 3QXCA 4HUTA 5K8IA 1GFIA 2ZYVX 2J45A 3FKSA 4DCTA 1W4AA 2HXYA 1G8PA 3QJYA 4PAQA 3GLGE 2ZXUA 3DVLA 4M22A 1SXJC 4KHZA 4B2LA 5FOUA 4GOXA 3N2EA 1AJEA 3WNBA 1HQCA 1D9ZA 2OBMA 4IEIA 1Y3AA 5KOYA 2YOHA 4AKIA 2VHJA 3KUCA 4BRWA 1E2EA 1DVRA 1FFHA 3B2EA 2FE4A 1SVMA 5KU1A 4FMCF 1C9KA 2ZRMA 4O3MA 2W6ID 4QG7A 3SJAA 3QG1A 1D2NA 1E3MA 2GVZC 2NTYC 1Z2CA 1ZCBA 2A5DA 3GJ6A 1U81A 3ZIAA 2W0SA 2OZEA 2NGRA 4AYXA 1UBEA 3EA0A 3EPLA 2FPLA 4FINA 3KDSE 4QGGA 2DBYA 2JGNA 1CTQA 2I4IA 1YR8A 1M6NA 2YJTD 4MA4A 1M34E 4A6XA 2YWHA 2ONKA 1R5OA 2XOKA 2N1BA 3KB1A 4MYTA 4ZCLA 2WTUA 2BMJA 2G83A 4LJ4A 3K70B 3WRYC 4FMDF 2GXQA 4QC2A 1TUEA 3CPHA 3EPKA 1G3UA 4OJKA 4OI2A 1MR3F 3IDQA 1E2LA 2QAGB 1G20E 1FPMA 1F6BA 4DC9A 3WP1B 5LPNA 1LNZA 2XGJA 1U8ZA 5DGXA 2WSSD 3A1VA 4UNRA 1IXRC 4N0EA 4DIEA 1G3QA 2N46A 2IYQA 3B1YA 3DKVA 3ND9A 4HDOB 4OQMA 5CJ2A 5AR1A 3UATA 1Z6TA 1YZQA 1E9AA 4PSKA 3W8RA 1IN7A 3N70A 4PXAA 4DDUA 1Z0IA 2VHUA 3I3SR 4NCKA 1GZSA 2EFHB 3PR1A 5FBQB 1GITA 4TTPA 1G1MA 4NCHA 1P9RA 2RGBA 5KNBA 5EP2A 3EA5A 3QF4B 3RDPA 2J46A 3PIRA 1U90A 3GLHB 3QQ5A 4DEXA 3K70C 1XTIA 1OXUA 4LBVA 2OCPA 1WF3A 3FMIA 2QAGC 4IOMA 1XMSA 2CCGA 1SVLA 1YRAA 4Z54A 3EZ6A 5DISB 2P5TB 1S96A 1XEWX 1DE0A 3ECCA 4V0MA 1E2FA 2J0SA 5E4FA 1KYIA 1JEEA 1UKYA 1R4AA 2ZJ2A 1Q44A 1SULA 3KXKA 4G01B 2WWIA 2GJAA 3A4NA 4P4SA 1MOZA 3VR4A 1XNJA 2IS6A 1S3SA 5JI2E 2LKCA 2RMKA 3VQTA 4BFXA 1II8A 4UJ3A 3EG5A 3Q3JB 2O0KA 4B44A 5FI0B 2OEPA 4C0BA 3CBQA 2J0VA 1NVXQ 3BAFA 1RYFA 4ZIRB 1Z6AA 1E9RA 3CUEF 4M2LA 4TYQA 1M7BA 1L4YA 2IT1A 4DBLC 5J4YA 2FEOA 2C2HA 5JCZA 1YZTA 2DYKA 2YINC 2JLUA 1A82A 4HLQB 1COWD 1JEDA 4PHGA 4NCIA 4DT1A 2DFKB 2AKYA 3X1XA 4LY6A 1D8TA 4NP6A 5JHHB 5SZIA 2VSFA 3RRYA 2L0XA 3QPVA 1DAIA 1S8FA 4PPNA 2WJVA 1Z6YA 3PV0A 4M53A 2D3WA 1XZQA 3CPJB 2W83A 1CP2A 4MUAA 4RKEA 2XX3A 4GI7A 1WB9A 4F38A 3RS2A 2CVFA 1D2MA 3U3JA 4CEIB 1BH2A 5JJLA 3F0TA 4MKFA 1YVDA 2ZETA 5HCNA 1IOZA 4JVNA 4TLDA 1K5DA 3CRRA 2B7CA 2HF8A 1AN0A 1OV4A 5D3MA 4Q1FA 2A5FA 2WJYA 2JA1A 3NKVA 3TIFA 5J47A 2X77A 3IEVA 1E1RD 4XH9B 3I5YA 1E1QD 3WHKA 5FTJA 3K9GA 5FUVA 2IUUA 4HI0E 4QXAA 4TSFA 5A0FA 4B75A 5C1BA 5K8UA 4CRWB 2GXSA 4C0SA 1XTRA 1OB2A 4BZPA 5CITA 1KMHB 1TQ4A 1UDWA 1B23P 1OT3A 2CNWA 4LC0A 5F9HA 1OPXA 4DDVA 4NH0A 4ASUA 1Q12A 1W46A 3HR8A 2A7QA 4YDSA 1AGPA 3L0OA 4DLZA 1RRGA 1ESMA 1OXTA 1NSTA 2VO1A 1KDRA 5CM9C 1DOAA 1W2HA 4C3ZA 2Z4SA 4JLJA 1N6LA 5FR2A 2HF9A 3WYAA 2H5EA 5CLLA 1MT0A 3BORA 4BLQA 1E32A 1OHHA 4O25A 2ZUCA 3C41J 4Q7MB 1BYUA 3M1IA 3NBXX 5GJCA 5TY0A 4D81A 1OFUX 4RCZA 4QGFA 2ZI9A 4J0QA 2GK6A 1KSHA 2FH5B 2A5YB 1E0SA 1XPOA 4O0MA 1TEVA 1AA9A 1Y63A 3QSYA 4JKYA 4POAA 1NIPA 1VIAA 2IW3A 2DY1A 1E9FA 2VBCA 4WOPA 1E2KA 5C2JB 2AHOA 4PO9A 1NBMD 3IHLA 4XTRA 4F4JA 4P4SB 3WHLA 2BMDA 2GXAA 2KB0A 4LRWA 4G3XA 4XD7A 4A9AA 2GAAA 3KJHA 3TH5A 2ZYWX 1II8B 2R2AA 5DIFA 2JLYA 4KAXA 1BIFA 2OUKA 1UJ2A 1N6NA 2F1JA 2ZU0C 5FTKA 4RJLA 3T34A 3TMKA 2BCGY 2GA8A 2GCNA 1G19A 1X1RA 1GKYA 5EXSA 3PEVA 3NBZC 3KQNA 4V0LA 2ZQ5A 3BIFA 2ZR7A 4PANA 2HEIA 3OIVA 3VR5A 3BBPA 1WCV1 1IAQA 2HV8A 3ZH9B 4XWOA 4KSBA 2ZR0A 4OL0A 1UADA 2QENA 3SYNA 3S1AA 2IUSA 2A30A 3TR5A 3VKHA 1NJGA 2B7BA 2PLRA 5JBQA 1JXOA 2VHTA 1BMFD 1CJTC 2ERYA 4XVRA 1CLUA 2XJ9A 1XEFA 1EFUA 4TT3D 4NYMQ 1FL9A 3V4FA 4KXFB 1LB1B 1P2TA 2WZQA 2ZRIA 1XEXA 2QM7A 4ZV4A 1OYYA 2ZJ5A 3QEOA 1G18A 2B92A 2WKRA 3GFTA 4W9MC 1U99A 4ACAA 5D3MB 4LZZA 3B1VA 2B8WA 4HLUA 5J40A 3TQFA 5AWFC 2QP4A 3B78A 1ZD1A 3OFND 2XJ4A 4TL7A 3P20A 3K9NA 1YHNA 3CNLA 4EAQA 2J59A 4ZO4A 4TQUS 4JT2A 4BGDA 1OF1A 1EFCA 1MV5A 2KBEA 3OF5A 2DWOA 5TDHA 5JEEA 2ZUDA 1ZRHA 5JWHA 621PA 1MRNA 2AD5A 1KO1A 2PJRA 5JS8A 1ZNXA 1R0YA 2BEKA 3PENA 4KO8A 4TZ0A 5TV2A 2ZIAA 1N5KA 4OHZA 2X19A 4OK6A 4MGKR 2BKEA 1ZM2A 1ELOA 2QTVB 5L3RA 4C4PA 4KCGA 5F2EA 3TVDA 3TW4A 2G6BA 3GPLA 4LYHA 1L2TA 1IN6A 1GSIA 2GZHA 3TQCA 1SKQA 4EPRA 3U4QA 2GZAA 3L8YA 4Q03A 1KY2A 1ZIPA 2WOJA 4QNMA 4UNQA 2QUZA 1N0UA 5GADl 2BJWA 3QBTA 3ZLJA 3LX8A 1R5BA 2WWFA 3MGCA 4PAMA 3U60B 1X6VA 3BH0A 3BGWA 1UAAA 1AQYA 5UKDA 3LWNA 3QKRA 2EYQA 2NG1A 2W6IA 1QVAA 3RS7A 1W2GA 3Q85A 4E09A 2V7QA 4FCTA 2CL7X 5E95A 5DNYB 2GETA 3MD0A 1W48A 4P32A 3W6OA 2XOKD 1XFAA 2GEDA 4V0OA 1CKEA 3LBHA 4HAWA 1KK0A 2AN9A 3NIBA 5DI3A 5H8WA 1KI7A 1Z0KA 1I2MA 2JJ1D 1HURA 1GILA 1ZBDA 2IXFA 3LNCA 3FMFA 2JLVA 1DBSA 4WZAE 2D4HA 2FDCA 4GNKA 3UG7A 3A6PC 3GEIA 1GVNB 4A6PA 4DCUA 1CJUC 2LWIA 1YU9A 3AVVA 1U8YA 1DAGA 3CW2A 5HTKA 2Z43A 4KFUA 1KTVA 2VRWA 3CZPA 4CF7A 2RAPA 3QF7A 1Z6GA 1NY6A 2AK3A 3RS0A 1CIPA 3H86A 4OQFA 3LX5A 1JECA 1YZKA 4QNRA 4DLRA 3S1AB 1W49A 1NN0A 5BW8A 2ZAMA 4N3NA 5KO2A 1NG1A 3N2IA 4RD2A 4NYMR 2F43A 2YWFA 3GJXC 3BERA 4M9ZA 2JLWA 3W5IA 5IK2D 5IDVA 4D4JA 4B32A 3L8ZA 4I1VA 4WZ6A 3PEUA 3T06B 1XEXB 1SGWA 3EPHA 1G7RA 1KZ7B 2LCFA 3OEHD 4TN1A 1IN4A 2FZ4A 3ZZTA 4GL2A 3QPWA 1ZM9A 3A1TA 5FOVA 2CXXA 3IIJA 2FX3A 4RFSA 4MGIR 3FFAA 3QY0A 4PHFA 5EE1A 1RFLA 2ZR9A 4KLZA 1YKSA 2AX4A 1KKLA 1Z0DA 2QPOA 5DLQC 1R0XA 3Q5EA 6Q21A 2ZRGA 4AK9A 3OAAA 3QXXA 1VMAA 5G3ZA 4M1TA 1XCPA 3MJRA 4I1UA 1KSJA 4L15A 4QHSA 5GJVC 2XTMA 2YWEA 5KPJA 1ZD9A 3FMPB 2PEYA 1QRAA 4AG6A 4LJAA 3KQHA 4ILEA 1Q1ZA 3A4LA 4KBFA 4M21A 4TYYA 1Z08A 4JBXA 4TZ6A 4MYUA 2BMFA 4QBFA 4LJ7A 2O8BA 3DHWC 2IWHA 3LY5A 4TMTA 4Z8XA 4A2WA 4TLAA 2OXCA 1U2RA 2MSCB 4D82A 3U4QB 4HLUC 1D5CA 5AUQA 2F1RA 1SXJE 3SHFA 3KXLA 1COWA 1XD8A 3KKPA 4DB2A 1NVUQ 3IKJA 4RD4A 4V02A 1TX4B 1VTKA 2NMVA 3OIYA 4OHXA 4B34A 1XZPA 2OLJA 3GJ0A 4MH0R 2C99A 1DARA 4DLYA 2X8AA 2QM8A 2WIBA 1PV4A 3SHWA 3HDTA 4MKHA 2JASA 1TPZA 3QKRB 3DKPA 3D8BA 3OZXA 3B7GA 1QG4A 1W0KA 2VLIA 4I81A 3TVTA 1N5LA 1JR6A 3HR7A 5TMPA 1T3SA 1RE0A 2IUTA 2SHKA 4GMXA 3CZQA 3Q72A 3AKDA 1SVIA 1NY5A 5EP3A 3VMFA 1CR2A 3FHTA 2ZRKA 4E5UA 3B5JA 2WBLC 4AKGA 1G7SA 2PH1A 2JJ2D 4FN5A 2XZPA 4IFBA 4TSFD 4Q9LA 1OIVA 5KSZA 3EWSA 2MSDB 2QGZA 3KKNA 5DI3B 4WA7A 3PUZA 5JLJA 4AI6A 4R71A 4GMDA 2ANBA 5KNCA 4RCYA 3REFA 4V0KA 2CNWD 2A2ZA 3GCGA 3UANA 3AVPA 1YRBA 1KY3A 4M1KA 5FFMA 4JLBA 2AK2A 4NMMA 2AFHE 1XF9A 4CZ2A 3EC2A 1E4VA 2ZS9A 5DSZA 4ZPXA 2OILA 2QTHA 5EZ5A 2AXPA 1S2MA 2ZTSA 1G3IA 3D6TB 1ZD8A 2F3TA 4F91B 4RKFA 5E7MA 4IRUB 3U5ZB 4JJKA 2RHMA 1TMKA 1OHHD 4MDFA 4UXJA 3VTKA 1VCNA 1HE1C 4MKGA 2F43B 2HJGA 2EQBA 1JQLB 1HTWA 1RVDA 2CEAA 2PCLA 3EIQA 4TQAA 3DM9B 1N3BA 2QAJA 3TAUA 3Q8XB 2PX0A 3NBFA 3EIHA 4C0JA 2XB4A 1S1MA 1LY1A 1N6OA 2ZRLA 5KDOA 2V1XA 3HWSA 1BO6A 1R6BX 5J4HA 4CYMA 2W6JA 4C0AC 2ZRDA 1SKYB 4CGZA 1J7KA 4HAXA 2ZREA 3U6KA 1SVWA 2QEQA 3MMPA 4DIDA 2G1KA 1KOFA 4UKDA 2W2XA 1KI1A 3VR1A 1W4CA 1XXHB 1QDEA 5EXTA 1BKDR 3QIAA 3CX7A 2BVNA 3KB2A 3MWJA 5FH9A 4JLVA 4A2QA 2GKSA 3GLHE 1H8HD 4KU4A 1KO4A 3LRPA 4Q1BA 4WIAA 2V1UA 1Z0AA 2E9SA 2QG6A 1AK2A 5BWMA 3THWB 2PT5A 2O8BB 2R44A 4HB4A 5SZJA 4D80A 3MLEA 1I4LD 2PMKA 2O52A 3HU1A 5M04A 3KQLA 2F55A 4Q9HA 2QT1A 3OEED 3U61B 4QKQA 3UPUA 3LV8A 2NPIA 4HYYA 4CDGA 4HAVA 5BN4A 1XX6A 2ZE7A 1T0JB 1E94E 3CPEA 1XMIA 2RH5A 4BEJA 1D9XA 5FPTA 2ZVQX 2C98A 2D2EA 1A7JA 1NSFA 2FZLA 1TF5A 2X1VA 1W44A 2FG5A 2W58A 1FNMA 3PEWA 2R6DA 5G40A 2VP2A 4DCNA 1UEJA 1KO5A 3K0EA 4BRUA 1TF2A 2CJWA 2EFCB 2WJHA 3LW7A 4EFNA 2ZS7A 5B58C 4QJ3A 3C4JA 4OQXA 2UKDA 3H1TA 3DMNA 2IBMA 3LQQA 4HB3A 2QGNA 4IXMA 1T9HA 3OIUA 4RD1A 5EP4A 4URYR 4YMSA 4HAZA 2CLCX 4HB0A 3MFYA 4URWR 3IPYA 1U8AA 4PPFA 1ZU4A 2DR3A 4QBIA 521PA 4M1YA 4HATA 4I99A 2WVJA 2P67A 2XTNA 3P4YA 4H1VA 4NU0A 1AS3A 4IDHA 4JYBA 2KJQA 3AF0A 3OHMA 4BLRA 4BFSA 2VSOA 4EFLA 2FFAA 1O3YA 5FBVB 1UBFA 5F98A 2IS2A 1MO6A 2IL1A 5EZ6B 2P5SA 4OQLA 2WHXA 5L3QB 2CE2X 3AP1A 1GNQA 1FP6A 2Z6VA 4LBYA 2OV2A 2V7QD 3QI2A 1IBRA 1Q3TA 4US0R 4A4DA 4LV8B 1HT2E 2YNMA 3EX7C 4OJQA 3CO5A 5CYPA 2FSGA 5EJEA 2GEVA 2ZEJA 4K81B 2CBZA 2WICA 2ZI7A 4QHTA 2FPKA 4IVRA 3WNCA 4EFMA 3AGQA 1TADA 1DAEA 1H8ED 3KQUA 3U3RA 3UMRA 3J81k 2QPAA 5EXXA 1FUUA 2RGCA 4US1R 4KLNA 1NL3A 4P4UA 4TYPA 3I72A 2CHQA 3I8SA 1IY2A 1P62B 3AVQA 3W6NA 4CEJA 5LD2B 3BWDD 1TU3A 2HDNB 3EARA 3TR0A 4EPYA 4LBWA 5FUWA 4AG5A 2XZLA 1S9HA 4B73A 2JJ1A 1JXMA 3W8NA 4TMWA 3GLGA 1E2JA 1LS6A 4M8NE 1FNNA 1KDTA 2KWIA 3L43A 3THXA 1HY3A 2ZE5A 4C2TA 1M2OB 3P1JA 4NTZA 4V0ME 1RRPA 3QXSA 3WMEA 3V4RA 1E98A 4K46A 3RWMB 4LX0A 2K5UA 2Q3MA 4TL9A 3M0EA 2JLXA 2E1RA 2NO0A 4DXAA 2NO7A 4ZI3A 4M9SA 3T5GA 1DELA 2ZSFA 2OAP1 4LHYA 3FOZA 4HAYA 3QKSB 5HPYB 4KFRA 5FOXA 3FYHA 5LD2C 4DLSA 2EWWA 5TXGA 1G7CA 5IK2A 3U3MA 4YC7A 3TGPA 3P26A 4G5QA 3CKLA 5FOTA 3TJZA 1Q1EA 2MMCA 1G8HA 2CJWB 2ZSAA 2GF9A 3OAAD 4B3BA 1RRCA 3OEHA 5EQTA 3A1UA 3H4MA 2QMEA 1PLLA 3AVWA 2CDNA 1ESNA 1KO8A 1DG1G 2VPPA 3ONWA 1TL7C 1XTSA 2R65A 1M74A 2VF8A 2BKUA 2YC4C 4BFZA 2ATVA 4HDCA 4KFTA 3H0KA 4Q1DA 4B3CA 1XB2A 2X2FA 1QHXA 3BH7A 1BYIA 1HA3A 1LVGA 4JZKA 3RLFA 1E0JA 4FMBB 1EK0A 1FMJA 1FUKA 4QL3A 1XTKA 3LLUA 2EVWX 1T5LA 2Z5FA 4NYIQ 5FTNA 3I32A 4FXPA 4RZ3A 4L16A 5JS7A 5HE8A 4LCBA 4Q00A 2NZJA 2ZI6A 2YV5A 4P31A 2XB2A 4FIDA 3SYLA 2FA9A 2AL7A 4GRAA 1GNRA 3B13B 2RGNA 1UEIA 2XZOA 2JIZA 1HH4A 1CEEA 4A8JA 1E0KA 5G3YA 1W0KD 3GJ4A 2WWXA 5EP1A 2D7DA 3ZD7A 1XPUA 3WXMA 721PA 3KKOA 3QOFA 3VAAA 3REGA 5J4VA 4R98A 5KSOA 1XBTA 4DUGD 2EFDB 4WVFA 1J90A 1W36B 4Y0VA 2JLRA 4EPWA 4TLBA 5FBLB 4ARZA 1FP7A 1R5NA 2WSMA 4GT1A 4B3DA 3AVXA 2REBA 4CT4B 1HEIA 4ESVA 1A2BA 3VX3A 5L3VA 2BHRA 5HZKA 2NO1A 2G3YA 1UKZA 5AJWA 2GILA 2H92A 3DL0A 2B21A 3L82B 1I4TD 2JJ2A 4MRVA 1R7RA 1GM5A 1FW6A 4CEJB 1P60A 5H68A 5B2ZA 1VCMA 3X1DA 2G1JA 2R62A 4M4SA 3T35A 1GP2A 3RRMA 5CDFE 1MH1A 4C2UA 2A9KA 3AUYA 4DLXA 5GVSA 3THXB 5K8LA 2J87A 2TMKA 2BDTA 1IHUA 4OI1A 1QVRA 2IYYA 3IIKA 1PLJA 4C30A 4B3XA 1RYHA 1W36C 1CXZA 2R6AA 1E9EA 2O8FA 1ZNZA 2ZANA 3PUWA 2REXB 2VEDA 2VTKA 2QORA 1XMJA 1ZU5A 3GQBA 4JSTA 2P65A 4BWYA 4IEEA 1WP9A 3VU9A 4DEYA 4G5OA 1QG2A 3U7FB 1LS1A 3BD9A 3BJIC 5FPHA 4JLPA 4D6PA 2ZRJA 3CM0A 3NDPA 1LV7A 1RC8A 2AFIE 1WXQA 2W6JD 2P6RA 2FF7A 3CNNA 4Q7JB 3T12A 3U44A 3K9HA 1GRNA 2VP6A 1VG8A 1CJMA 4MUBA 3SDZA 3SBEA 4FWTA 2OFXA 3GJ7A 1FQJA 4XJXA 2WMNB 1I2DA 3PFIA 4Q4JA 1DPFA 2ANCA 1P61B 2F7SA 4GPTA 2EFEB 4RVCA 3SJCA 5HR5A 4BPBA 2J0QA 4Q1EA 4UNPA 4AIIA 3GD7A 4QGAA 3WBJA 1W4RA 4AYTA 1KKMA 1G8GA 4B33A 3NEJA 4IDNA 1WBDA 1Q22A 4U5XA 1A1VA 2F3RA 4PQRA 3NH9A 3EC1A 1YR7A 1ONBA 2IWRA 1FX0A 2YZ2A 1NN3A 3O8DA 4W7SA 2C9YA 2GEUA 5JCPA 4M1MA 4M1OA 4NE2A 4IHQA 3CB4A 2PMDA 2BM1A 1H8HA 3AF4A 1Q3HA 2BV3A 4DT1B 3M4YA 2JATA 2XSZA 4PSAA 4D4KA 5CK4A 3U3KA 2ZITA 4MKIA 4QHYA 1SQ5A 3WMGA 1ZC4A 2ZVPX 3D31A 2QQ0A 1PJRA 2Q9BA 3UK6A 4F4IA 4DSOA 4IXNA 3ETLA 4A8JB 2UVQA 3OEEA 4ZCIA 4B3FX 3G82C 5BXQC 2MMGA 5B64A 1A5TA 3WNDA 4PHTA 4NYJQ 3TUIC 1S4QA 1ZJ6A 2GVDC 2V6JA 3LD9A 5FPKA 2ORIA 4Q4HA 4RFVA 4B48A 4HEJA 2GRJA 1NVVQ 3QVVA 4TYNA 4A92A 2A78A 4ARZB 1AGRA 1VYUA 2ZSBA 3K1JA 1X8JA 4MRRA 5AJZA 2J7PA 3BS4A 2CLDX 3PG5A 4IKEA 4JBYA 5DYIA 1N6KA 3RSOA 1AZSC 1XD2A 3NVAA 1X8LA 1P2UA 4PTLA 2RGNC 3E2IA 1KHTA 5DYGA 4IDQA 3DDCA 1TQ2A 2VHQA 3FGNA 1ETUA 3IQWA 1D2EA 4PR0A 5IRCD 4A8JC 2ZU6A 1JALA 5EE5B 3ZJYA 4YQFA 4MGYR 1C4OA 1KSGA 4E07A 3KZ1E 2OM2A 4NPHA 3AB3A 1IN5A 3CWQA 1US8A 3LXRA 3ZQJA 1WMSA 2ZS8A 2OBNA 4DSUA 4Q19A 1XWIA 3QKTA 4JJZA 4N0DA 5FBRB 1MO3A 4A0RA 2O8FB 2NPFA 4MRSA 2NQ2C 4Q02A 4EKDA 4L9WA 4PPGA 3WY9A 4B35A 4B2PA 4P0TA 4TWZA 5LDDC 3ADBA 2RGDA 5JZVA 1HE8B 3CRVA 1DADA 2PT7A 3B82A 3R7WA 3X1WA 5IF9A 5CM8B 4AKHA 3W3ZB 2G88A 1ZUNB 1Z47A 1FTSA 1K6MA 3B9PA 5E7IA 2IS4A 1OJLA 4Z8YA 2WKQA 4DKXA 4F93B 1CS4C 3C14C 1XEWY 2QI9C 3WMFA 1J8MF 1YZUA 2KI5A 3BFKA 4URVR 1W36D 2OO7A 2V6IA 3MAAC 4RZ2A 3SOPA 2CL6X 4II7A 4B71A 3VKWA 3EPJA 2ZJBA 1OB5A 1P5ZB 4DJTA 2GNOA 1NG9A 5KUTA 2HYDA 1NP6A 4DLVA 1E9DA 1JAIA 2EU8A 4PC7A 1KK3A 1JJ7A 1ZAKA 4KBGA 2GCOA 2F9LA 2QNRA 5CB8A 3B1ZA 3ZVLA 1H8EA 3NHBA 3QVUA 4W5JA 3QXJA 2H57A 3KTAA 5JRZA 2EW1A 2FFBA 1R0WA 1FX0B 1KSFX 2W2VA 3IHWA 2V55B 4KFSA 2CHVA 1KJYA 1Z29A 3QBVA 4JLNA 4EQ6A 2HCBA 5L3SA 3NWJA 4V0NA 4Q9KA 2ZSEA 4LHWA 2PX3A 1B0UA 3DOEA 5KYKA 1P6XA 1X1SA 3LLMA 1GL7A 2ZRPA 1SKYE 1V5WA 4D0NA 3KJEA 1W0JA 4BEBA 3WYFA 4F4CA 4PC3A 1FQKA 1WDTA 1OXXK 4NYJR 2DFNA 5EE9A 1EGAA 2GTPA 1XXHE 4YLGA 5HE9A 1T5IA 5TVKA 3FWYA 2RGAA 5DHFA 3EASA 2YYZA 4YXWD 1NVVR 2JAQA 5DO9A 1E0AA 4Q4HB 1N6IA 3TKLA 4UXHA 4M1WA 3LFUA 1YZGA 5TB5A 3KJIA 2BEJA 3T1VA 4CW7A 2EFGA 4LYJA 4D25A 3AV0B 1NLFA 1P4SA 1HYQA 2ZJOA 1P72A 4IOKA 1XD2B 2O8EA 1OW3B 3E70C 4C0QC 1PUIA 4OK5A 3TW8B 4QJ5A 4GFDA 4C7OA 1RW4A 3K8YA 1Z0JA 2J7KA 3TRFA 1DAKA 1E99A 1XJ0A 3MRSA 3NDBB 2XEXA 1J2JA 1JI0A 1H65A 1R0ZA 3CF2A 1LF5A 4EPXA 1GWNA 4X8LA 1N0VC 4LJ8A 4TYWA 4FI3C 4FWIB 3AQ4A 3AEZA 1NF3A 4YONB 4IW3B 1E9CA 1OFHA 2FEMA 1OXVA 1FZQA 4Q48A 2C78A 1KI6A 3TK1A 2JIZD 4TLCA 3IBGA 1G6HA 3QNUA 1OFTA 5CIQA 3FMOB 1YJ5A 1F3OA 4Q4AA 2QE7A 2D74A 4MITA 4LJ5A 1K5GA 2ZSDA 2GCPA 4LDJA 4M9QA 5JECA 3DPUA 3BC1A 4P3YA 5JI3E 2C5LA 2H16A 4JLOA 3GEHA 1U94A 5CJPA 1ZM7A 2PLFA 2KSQA 3BH6A 4Q01A 1OKKD 4JLAA 3GLIA 4TL8A 3EZ9A 4LPSA 1W7AA 3GEEA 3Q9LA 1TU4A 1GIAA 1JB1A 4IDPA 1HV8A 4WXRA 221PA 2GESA 2Z0MA 3SYKA 4O2LA 1Z8FA 3TLXA 4DUGA 3K9LA 3UMSA 3RC8A 4QRHA 2OCBA 3SBDA 2IEYA 4D0GA 2VQSA 2GCOB 1CRQA 1GNPA 4AURA 2Z83A 3MSXA 4LV6A 4CT5A 4DSNA 4DZZA 1VYVA 5DE3A 3SU8A 4A82A 2GHIA 2GDJA 1A2KC 2IYTA 2OG2A 4PPQA 4TQ9A 4UQOA 1NLZA 3KTAB 3T1OA 3CWZA 4Q1AA 1ZM3A 1VCOA 4R7ZA 3WP0A 1S9DA 3CH5A 1YQTA 1OIXA 4B76A 1KAOA 1R2QA 4PZYA 2FV8A 4EQ6B 1UDXA 5L3SB 1G5TA 2WIAA 1G291 2C9OA 1EWRA 2I3BA 4BASA 2AWNA 2CMKA 2W0MA 3K09A 4JL6A 2JLSA 4KVGA 4ERNA 2OBLA 3KKMA 4JVSB 4TMZA 3UWOA 1DO0A 1JAHA 4MDEA 1A4RA 3T5DA 4QJ4A 2IHBA 4G1UC 4JT4A 3FPAA 2Q3FA 3KL4A 1Z06A 2IYSA 3GFOA 4G5RA 4XSGA 2ODEA 1NIJA 4LBZA 3Q5DA 3AUXA 1NBME 2GJ8A 5GJBA 3AKCA 4U00A 4XOIA 1F60A 2YC2C 1SHKA 2CVHA 3PUYA 1AM4D 1GKIA 3L0PA 3HU2A 4ZDIA 3KXIA 3IO3A 2A5GA 2J41A 3AVTA 3B1XA 3P27A 2YKGA 1SVSA 3ICQB 3K0CA 1WA5A 3CX6A 5JWRA 3B6EA 3CH4B 4RFSB 4MYHA 3O47A 1XP8A 2UZIR 4GDFA 2QPTA 5IT5A 2RGGA 4HZUA 4YMUA 2O8EB 3W3AA 3PJRA 2FSIA 1XJQA 4C7OB 1EX6A 2KE5A 1E2GA 2JLZA 4BLPA 1EFHA 2ATXA 3BRWD 2ZRFA 3EAQA 3OESA 2I1VB 4BECA 3LVRE 2HUPA 4HB2A 2A3RA 2FN4A 4L9SA 3AP3A 1EXMA 1J8YF 4PO1A 4FD2A 2GJSA 1E2DA 4BE7B 1GUAA 1EX7A 3H84A 4EPTA 2XSZD 4OHWA 4KI0A 4WW0A 3A37A 2GBLA 5AJVB 3U6BA 4M0LA 2ZE8A 1Q21A 3UMFA 5FPSA 1E2IA 1PZNA 5BQ5A 2W00A 1IY0A 4LYAA 4PQFA 2VHCA 2ODBA 3KUDA 3TBKA 4JL5A 3GLFA 3PUXA 1PLKA 4Q4AB 3ZD6A 821PA 1V43A 5KSYA 1CF4A 3PCRB 2IC5A 3L0SA 1JQJC 1TAGA 2WKPA 4G5SA 1G9XA 1ZNYA 1G21E 5FPYA 3W5JA 3H2YA 3SS8A 3MWYW 4AY2A 1W5TA 3L0IB 1N5IA 4TLEA 1M1YE 2CK3A 1CU1A 2J0UA 3GLIB 2ZPTX 2N42A 1NMYA 4YMTA 2CLSA 4PZLA 2J7PD 3R8FA 3SN6A 2BBSA 1QHHA 3X2SA 2HYIC 1VG0B 1T4GA 2HXSA 1PVOA 3TE6A 2WWWA 3AKYA 3JZAA 3NEYA 4ZDKA 1AIPA 2ZJ8A 2CCKA 1R10A 5C46F 3SQWA 1TEXA 2QSYA 5JMTA 3QEJA 4ZDWA 2V4ZA 1YE8A 1N6RA 3ADKA 4RZUA 2J1LA 3PXGA 4LJ6A 3RANA 3UWKA 4A0FA 1J99A 1N25A 4Z1MA 3SFZA 1G8YA 3LXXA 3AP2A 5FTMA 2XITA 1E2NA 2XTZA 2NOAA 3M6AA 4LUCA 1LFDB 3A36A 2Q6TA 1ZNWA 4RD0A 1NJFA 1DEKA 4US2R 1Z63A 2FGKA 1KI9A 2B6HA 2ZRNA 2FU5C 2IYWA 5IHPA 4A36A 1II9A 4OK3A 1KZGB 1G6OA 8OHMA 3U7HB 1E9SA 3VNVA 2IYXA 3R9WA 1G3MA 3LA6A 3NHAA 5JWOA 3FHCB 3CNOA 1SHZA 4OQNA 5HKKA 1Z22A 1OH5A 4L5BA 4V03A 5HZHA 5FBWB 3U3OA 2C04A 1JR3A 3V00A 3NTUA 1MO5A 5FUXA 1KIMA 1Z3IX 4H9GA 4JIMA 1M8PA 3K0AA 5HCIA 1TQDA 1X86B 5L8VA 1Q0UA 3CRW1 5J5CA 3K09C 1XU4A 3ZZUA 1O87A 2BBTA 3QXHA 3Q7QA 4BFUA 4URXR 3ZVNA 4HZUB 3ADDA 2ZE6A 1EFRA 2JJ8A 3RAPR 3A58B 2P6NA 1UM8A 2VP4A 2IYZA 4Q9IA 2QTFA 1XCGB 2OXRA 3V9PA 1Z28A 5JEDA 2RGEA 2VSXA 3DZDA 4PFSA 1XRJA 3HP1A 3IGFA 1EWQA 4CEIA 3EXAA 4I1OA 2VP5A 4DB4A 3GJ5A 5B57C 1U9IA 1AKYA 4PX9A 3IO5A 1W0JD 1ZP6A 2D2FA 1Q1QA 2RB4A 2ZROA 3EZFA 4XVQA 3K0CC 1QF9A 1VG9B 2ECKA 3O8BA 2IHYA 1E2MA 3I61A 3GLFB 2ZJYA 4XWAA 2ZM5A 3K0FA 1XTJA 3KJGA 2FGJA 2PEZA 1T91A 3LBNA 4KITB 3KQKA 1G5RA 3LO5A 2XXAA 2GJKA 2BJVA 1TNDA 3LVQE 2PZFA 5E3HA 4TL6A 3ZGXA 1P7CA 1CR1A 1IJFA 4OHYA 1KMHA 2IA5A 2J9RA 4B6FA 2HT1A 3OIWA 1XJCA 4P33A 4W5HA 2J0UB 4Q1CA 4RZXA 4B2IA 2IYVA 4KYIB 3VR2A 1SZPA 3NC0C 2WWGA 1IN8A 1QHHB 4YXWA 1F48A 1YR6A 4ITRC 4E22A 5C18A 2GBLC 4ZKDA 4YDHB 3IILA 3W90A 4KYUA 4R2HA 3O8RA 4GSYA 4Q21A 4LOAA 4FMCB 3A8TA 4W5WA 3C15C 3I1FA 4DCSA 1MO4A 1ZC3A 1W5SA 3OE7A 2ORVA 3C5HA 2HCJB 1HT1E 4Q66C 4X8MA 1N2CE 1CBUA 4LHZA 5EUMA 2FPMA 4XWKA 2H18A 5H1YA 1OE0A 2WAYA 3BB1A 1AS0A 2O0HA 4N1AA 4MGZR 4O2RA 5H70A 4GBMA 2P2LA 1VKJA 1E96A 1KK1A 1NVWQ 2GXUA 4PC6A 1OSNA 3FFBA 3SI7A 4JKIA 2YWGA 3GFPA 4EDHA 1Z2AA 4LV5B 1KO7A 1QHIA 1JPNA 1KK2A 2FNAA 4FMDB 1RPZA 1CRPA 3IQXA 2MSEB 4KODA 2BWJA 4GOJA 4A0GA 4AWXA 5KDDA 3AF3A 2QE7D 2KBFA 4GP7A 2CE7A 3KFXA 5EE0A 4I1SA 2X2EA 4AD8A 2PZEA 1L4UA 4JVMA 1E9BA 3ASZA 4D26A 2BBWA 5EXPA 3O8CA 3AH8A 3D7MA 4ON9A 4U02A 4EUNA 3EZ7A 1YZNA 3A1WA 4HUQA 4PAOA 2FSHA 1GAJA 1I4DD 2QBYA 2XAUA 3PQCA 2O0JA 4ESHA 1CR4A 3C7KA 1TTTA 3P4XA 3PITA 4KJZA 3HYRA 1T3LA 5FL3A 3U2QA 4CVNA 3K0AB 1E2PA 3F8TA 2XNSA 1UKVY 1VDZA 3TUJC 5K8TA 1XCMA 4Q7KA 5FI1B 3GP8A 1OKKA 1NKSA 5LB4A 3I62A 2ODNA 2B8TA 3D3QA 1OH6A 1KMQA 3CLVA 3TSOA 1KI4A 2WM9B 2OE2A 3WBKA 1IONA 2QQEA 5KTYA 5DN6D 1ZVQA 3SC3A 2V8OA 2IF2A 2ZYUX 5BYKA 1SVKA 2PZGA 1G64A 3DO6A 1NNEA 1IM2A 3RABA 1QZXA 2IXGA 1EG7A 5KDLA 2BIFA 2G0NA 4DWJA 4QBGB 2CL0X 1SXJD 5FL7D 4B43A 3GLGB 1ZINA 4IFEA 3EZ2A 1QHNA 2EWVA 3F3YA 2FOLA 1G3RA 2NZ8A 3CRMA 3LW8A 3G5UA 1J70A 4D4LA 1U0HC 1F2TA 3RVBA 5CB6A 1RKBA 3K0FB 1Q20A 5FOWA 4D0LB 1OYWA 2Q0HA 2OT3B 2YOFA 2WJJA 3VFDA 3AF2A 1JJVA 2FFHA 1DS6A 2XXAB 1HUQA 2P6UA 3K53A 1IJEA 1X8KA 3UKDA 1E6CA 2LKDA 3A1SA 3B85A 3THOA 1RRFA 4UNNA 4QOSA 1OIWA 1U98A 3ZYCA 2OCYC 2G0TA 4LI0A 3CIOA 2DWPA 4TMKA 1KGDA 1ZCAA 4LPKA 1RZ3A 4PC1A 2VP9A 1OFIA 2AKAB 2WWHA 1UBGA 1SVOA 2EYUA 2XNDA 3BFXA 4P4TA 3VX4A 4DRZA 4PSVA 5AUPB 1U9IC 1VYTA 4YMWA 3SQXA 4LWZA 5AJXA 4DLUA 3VKGA 2ZRHA 1DAFA 1KI3A 2NO6A 1ZYUA 4LSGA 2OFOA 3U7GA 3AM1A 2F1HA 1YR9A 2ZI3A 2GK7A 3ZS8A 3FVQA 3WRXC 2DHRA 2OCAA 4AC9A 4JVLA 4UXIA 1IXZA 3LH5A 1NKTA 5FOSA 4URUR 1G41A 4JLMA 1N6PA 5CDFA 3LQRA 1L7VC 1D6JA 4IVQA 5G53C 2JDIA 3PUVA 2C95A 4NYIR 5ELXA 1JPJA 2IYRA 1AKEA 1IY1A 4Q4LA 2ZJZA 4IVPA 2P3SA 2O5VA 3VHLB 4OYHA 1N6HA 3K70D 1NN5A 3ASYA 3MG9A 5LB2A 4ZI2A 4C0KA 2AWOA 3PEYA 2Y8EA 1GOTA 4A2PA 4C9BA 3RS3A 1KJZA 4NBSA 2VF7A 3SFVA 3LAWA 4JLKA 4EJSA 3T1QA 4BZQA 5TARA 4HUQB 1VECA 2CK3D 2D7CA 2QBYB 2BOVA 3CRQA 1DG3A 1G4UR 1VHTA 5JRJA 5JSZA 2QRNA 1M7GA 2YOGA 3X1ZA 2QMUA 2ZAOA 3JVVA 4XIGS 5A4JA 4QFMA 3BB4A 1DO2A 3EW9A 1QHSA 3TSZA 4MRNA 1HQYE 3E1SA 1S3GA 4IJMA 5AJYA 2QP9X 4LC1A 3DMDA 1W4BA 4UJ5A 2ASEA 1S0UA 3DEFA 4L8GA 4OKSA 4GP6A 4H1UA 5A5GA 2IS1A 5FUYA 4ACBA 4URZR 1CULC 2QRZA 4G5GA 3SE0A 4M1SA 4RD3A 3T61A 4DLWA 1S1CA 1F2UA 2R6CA 4Z1MD 3VNUA 2RGXA 5EE3A 2AXNA 5G41A 2HLDA 2WPDD 1GDDA 4NKRA 3IUYA 4RSGA 2V9PA 1ZUIA 2F1IA 4XTCS 4NZYA 3IIMA 3VR3A 3THYA 2VA8A 1Q1BA 2NO9A 3RHFA 4LJYA 3UIEA 1F2TB 3HPRA 3RRNA 1KDPA 1GG2A 1RJ9A 4LK2A 3ND8A 3L2OB 4IOLA 5DI9A 1E79A 5BYJA 2BCJQ 2H8KA 3VHXA 4DCVA 4HAUA 3VU9B 2DPXA 1LF0A 2ZRBA 1ZUHA 5HKKD 4ZDJA 1ZIOA 3B8HA 1K8RA 3FKSD 1VIYA 4I4LA 1P75A 1GKUB 3KFVA 4HSEA 1JR3D 4PZZA 1XDBA 2DFTA 1P9NA 2H1LA 2RCNA 2REOA 3MUFA 2JEOA 1T8UA 3U44B 4PC2A 1Z6XA 3UG6A 2C8VA 2GZDA 2QU8A 1WQ1R 1FTNA 2QN6A 1IXSB 4E03A 3BXZA 2C77A 2C03A 4LYFA 1EFRD 3MJHA 3MWKA 4LHXA 1R8SA 4Q4JB 2QZ4A 1KAGA 1MKYA 3RRZA 4DDTA 5P21A 2D06A 3RSLA 4TTQA 5CK5A 2FMXA 4Q47A 4HZIA 1TUIA 2DB3A 1LTQA 1VG1A 5KNDA 2VH5R 4MRPA 2P0EA 3ZIAD 5GJWC 4ZCMA 3AVUA 5DH9A 1JBKA 4JS0A 4BLOA 1FOEB 4BQSA 2AR7A
chains in the Genus database with same CATH superfamily
5LJIA 3R20A 1BS1A 4DL9A 2DBVO 4XQEA 2FEPA 2IW1A 1EUCB 3TOZA 3QPUA 1F4VA 1RC1A 2J3EA 3OEWA 2IX3A 1WMBA 4MCAA 2HBQA 2VAMA 3EEFA 5DHQA 1K3UB 2WABA 3HR4A 5A4AA 2HSEA 2BHSA 5ENZA 4GI3A 1DTSA 2NADA 4HQKA 4IH1A 5DU2A 5EJMA 2Z6AA 3I8XA 2OFWA 3F2VA 2R5NA 1EDZA 2P9TA 3W34A 5AUNB 2FPIB 2QMYA 4EJSB 4TS9A 4EEZA 2AQ8A 2B3TA 1VCIA 2IDKA 2WTMA 4OXRA 3NT2A 4G0ZA 1K8XB 5J4KA 1ESZA 1N9GB 3B9QA 1GGJA 4PYQA 5SY4A 5ULLA 4D8XA 1EXNA 1YHYA 1W9MA 3F6EX 4CFZA 2WVGA 3TI9A 3RWOA 3NT4A 4ZYWA 3DGFC 1CUGA 3ENZA 4TRJA 1C8BA 1YE3A 2VNJA 2XA1A 4X6LA 3WGVA 2NZWA 2BTQB 3WNZA 1Y7HA 2JHCA 4NOLA 2QS9A 3L1IA 4OBEA 5A4FS 1ISHA 2BFEB 3CEJA 1KQOA 3OC6A 2HQBA 4YAEA 5E1DA 3N5CA 1UKCA 3OPXA 4ZCRA 4HKTA 3NPAA 4Q5IA 4CCAA 4WAUA 4FCWA 4HXGA 1TTHA 1UIRA 3AU8A 4O4JB 3A3NA 3S2YA 2VAVA 2Y1CA 3G2LA 3I4LA 1IJBA 3M5PA 4W1QA 3BMQB 4MR9B 1KE1A 4OSPA 4WZAA 3K3PA 5AHWA 1FE8A 1HK7A 1K98A 1QFMA 2QMHA 3ELBA 3BVPA 1P73A 4ZICA 5C8XA 4EA9A 1AMUA 3F7TA 1HG1A 4C5AA 1GKKA 1N3YA 4P22A 4ZK2A 2GPYA 3PPIA 5HS4A 1PK9A 1DAHA 1G8FA 1R6XA 4DGQA 3HJTA 1H2YA 1CUFA 3E7WA 3LC7O 4JSYA 4E1VA 1QHYA 3BTUA 4LXIA 4PXSA 3SD7A 3C8UA 4DLTA 3GJSA 3EXG1 4YJFA 5IMSA 1JLKA 2WJAA 3BZBA 1BRMA 3R8XA 3ZJVA 1SZJG 4TWAA 5DHAA 3G23A 3W5UA 1ORRA 4CKEB 3R9IA 1CJKC 1VPEA 2XVAA 2YYSA 2JCSA 3Q87B 4HDQB 2WWVD 3R7WB 3RBVA 3CLRC 3CR8A 2J48A 3ECAA 2X0EA 4E2ZA 3IDZA 5BWCA 2FZGA 3N1UA 1AVTA 2FKNA 3N2LA 2R1TB 4IOJA 3S2GA 4BECA 3P32A 5CP8A 5B7PA 4OI0A 2Q28A 3LI2A 3VNAA 1G4AE 5BR4A 3UM9A 5IBPA 1MRSA 3BKWA 5JAZA 4MMYB 1Q0QA 3C3AA 2AYZA 4MV4A 3OFJA 3B89A 4A0HA 1L8QA 1RM3A 5LP6F 1UWKA 2JGKA 1CR0A 1L7EA 4DY6A 4W6QA 1DLJA 1P2VA 4CEHA 3BFVA 3DOFA 2ZI4A 4M8IA 1GZHB 5HZGA 1R64A 3LX4A 5KVQA 5IEBA 4DLPA 4GZ3A 4B17A 1ABBA 4UTXA 2BMEA 2NVOA 4EKYA 2V54A 1LPMA 3W8EA 3VPBA 3I92A 3F6PA 1FDTA 4C4RA 1K9SA 3KR2A 2A5JA 3CX8A 4PQYA 5TPWA 2OXTA 4NBTA 4X60A 4PLYA 3QE0A 4P7KA 2QRGA 1Z5PA 3DBVO 2HSDA 3JPWA 1ECFA 1V7CA 3CSUA 3NRBA 5DKFA 4ZAFA 5IVIA 1UP7A 3QLUA 3PQEA 3DTVB 4JJ4A 3SNHA 5KPDA 1ECLA 3W5HA 4MWSA 2GB4A 1AS2A 5ANRB 3F6CA 4ZVQA 1YZLA 2EGUA 5DYWA 4OREX 1FYFA 1DJNA 1OI3A 4HGNA 5EEHA 2GJ9A 4Q3CA 3W5BA 4ZKEA 3CIFA 1F5NA 4FKMA 2QMOA 1LW7A 5FL7A 2G9RA 4CR7A 1VMKA 2QY9A 2C5BA 421PA 4X1KB 5AHOA 4RHXA 3W2FA 2ZYAA 4GOKA 5FQNA 3DFKA 1N5JA 2BI4A 3MJDA 3CZMA 5C4IA 4OMFG 3WDLA 4CIDA 4YUWA 4AQ7A 3FUUA 4GPD1 4A0QA 3CYFA 5CRIA 5CXSA 1Q7CA 3HKEB 3K1ZA 5KYYB 2EIHA 3QX3A 4GYJA 1NMZA 3GRCA 5A06A 2JEZA 2R7LA 1N75A 4QU8A 5CA1A 2XHEA 2RGWA 2SECE 3NYRA 1UUFA 2XNDD 5E6SB 2ORWA 3SEFA 4CKWB 4Z3OA 3HCCA 1CZKA 2NWQA 3IQIX 4IVNA 2OPBA 1M75A 2OCKA 1KAMA 4YMVA 2PUDA 5AW7A 2G28A 3AUUA 3DWGA 5CTAA 4RTMA 2FOIA 1AE1A 1UF9A 3K1AA 3MMSA 4ER7A 1OWNA 3I9KA 4X62B 5BV1A 4IMPA 4U3JB 1HSZA 1I0IA 1U2PA 1ZD4A 2ZUBA 3HM2A 1PJZA 4CKYA 2HWXA 5BN3A 3EVEA 2HA7A 3HSSA 3IBFA 1ATZA 4X8HA 5H02A 5JTUA 1JYFA 3HJGA 4G0XA 1XZCA 3WIVA 2R85A 1YCDA 3FRJA 1T26A 3RYIB 2IYUA 1RIFA 3UNXA 3FF1A 4QE3A 3AWDA 2QMZA 4H2DA 1HZZA 5A3QA 2NIPA 2X0NA 1TCCA 4BVAA 2PCJA 5IEJA 1N33B 2Q5EA 2H7VA 3CUKA 1P31A 3H5IA 4OI4A 3PXAA 1E3LA 1KQ3A 4C0LA 4F9TA 4XVUA 3E58A 2VOEA 4KEAA 3R6TA 2J3JA 2GWHA 2GEKA 1T0PA 2VDMB 4B6EA 1HDZA 1BH6A 1AGNA 2C96A 2D8AA 3LUGA 3MINA 3PD1A 4HNAA 1R37A 3FB4A 3H5NA 4GKJB 1PZMA 2AJLI 5D00A 1AKUA 1N9ZA 3D5QA 1DHTA 1MVNA 4EARA 4EF4A 5IABA 1Z8HA 1YIAA 2Y1WA 3QKUA 4GI1A 3BDIA 5CEJA 1Z07A 2ZSKA 5E7JA 3LPMA 2Q7XA 4BLSA 1OY1A 4B79A 1SUPA 4RXUA 3NM4A 3H9GA 2DXIA 3T3HA 4NCXA 1A69A 1BC5A 3PTLA 4UM5A 2NUTB 4EIWA 2FZEA 1JYEA 3LLVA 1H69A 1Y82A 4MPJA 4QIHA 4YROA 4BQRA 4CU5A 5BN5A 4XDGA 2QLMA 3GPBA 1FFDA 2OWEA 3N39C 4PZPA 2Q21A 3QUSA 4TTIA 2IUEA 3RC1A 5DYTA 1KNQA 3TD2A 5INTA 3VR6A 3NASA 3TZEA 3MCTA 5HNKA 2H1VA 3KVNA 4XFJA 1LQUA 3TZCA 1YJAA 2DKOA 4S35A 5DCUA 5H59A 3TLYA 1P9WA 2YY5A 3NI2A 4GGPA 1FZTA 2Y93A 4RTQA 4KVZA 5LBTA 1UZUA 1O95C 3G5TA 2HHCA 1OH8A 2K4MA 2X41A 2MTBA 2YHSA 3HCWA 4NNOA 4ZYXA 5AK0A 3V5NA 2E4ZA 5CFRA 1XQWA 1P19A 3OE5A 1EUDB 4G0NA 1LBEA 3HEMA 2H5IA 4JYCA 4CDRA 1NAIA 3COPA 6AT1A 3RNLA 2H06A 1TE2A 3MELA 2IIPA 3BCSA 3S44A 3G59A 2AMYA 2FB9A 3QKSA 3TQIA 3WLNA 3O8OB 3WGQA 5LIRA 3OTOB 3B12A 1IIBA 4KJXA 1WRBA 4IICA 2J6BA 1BMFA 2JFYA 3AL3A 3B1WA 3L9XA 1U8UA 1HL3A 3KQWA 3LQ4A 2R60A 4HH0A 2B94A 3GUZA 2BM0A 1IYZA 3N6XA 2WPDA 3ZXUB 4Y2GA 3T9FA 3PYXA 4UNSA 3RU3A 1E79D 3MQ4A 5JFGA 3OZ7A 4K9MA 1DV2A 5EC8A 2FXVA 3WYGA 2BZ1A 4HAIA 2IXEA 5G1NA 4IDGA 1PK8A 3F4BA 4DSTA 1NBHA 1SZDA 1CQPA 1LSJA 1TZCA 1M5UA 2AUTA 4RZSA 3WLEA 3ZOZA 2X5OA 3ADCA 1CUUA 1NN1A 4R40A 1ANKA 1GTVA 3QG5A 3LDHA 3DEKA 4M9XA 4Q37A 2H7YA 4F5EA 1GGVA 2PLNA 1Q11A 4IUDS 5JJIA 4E4RA 1JAZA 1EP3B 2VDRB 3G0HA 4YRTA 3QXCA 1A9ZA 1GFIA 2ZYVX 2J45A 2Z3VA 5J2UB 3S2UA 1SCIA 1J9GA 2M9MA 4GKVA 5IJAA 2YWCA 3CVVA 3RROA 4EFKA 1NW4A 4YBRA 4BGVA 3ZVKA 3JRWA 1P8AA 2DH5A 1NQUA 4AZ3A 4KHZA 1P0CA 4R31A 3MS4A 3KSBC 4AJEA 1HQCA 4J0HA 3Q9SA 4IEIA 2C5EA 3TDKA 3JD2A 1T5BA 2Y0PA 3L4JA 1DVRA 3IODA 1I24A 3HZOA 4R81A 4AMVA 1SVMA 4BY9E 4L4YA 3MOGA 5AKXA 4O3MA 1WKCA 4IMIB 1ZOOA 4QG7A 3SJAA 2BI8A 2P2GA 4CIXA 2GN1A 2AFHB 3NBMA 1W88B 3FRHA 4RPCA 3MQFA 1JQBA 3KQSA 5BW4A 4JI0B 1XWWA 1P4RA 4LC9A 2W0SA 3D0QA 2H2IA 2EQAA 2NGRA 1IBLB 3VC1A 4HDMB 4J8PA 2FPLA 4D3DA 5AM0A 3KDSE 3V6MA 5CURA 2JGNA 4F4UA 1U5AA 4JJ6A 3ZTYA 5LSAA 5DHTA 1YR8A 2I4IA 3H9JA 4MA4A 3S28A 1YVRA 2AFRA 3P94A 3ZX4A 4R1PA 4U2FA 1MGPA 3KB1A 1MB2A 3KVYA 4ZCLA 2G83A 2P5YA 4LJ4A 2POCA 3H0CA 1XVAA 3IUBA 4XUEA 4E4YA 3JVEA 1MP0A 4OJKA 4OI2A 1M72A 3DEZA 3IDQA 3VO2A 1E2LA 1YB2A 4HPWA 4BVGA 1T9AA 3LRXA 4Y6PA 1G8MA 1ONSA 4A5SA 4DR1B 4JB2A 4UREA 1JLRA 3WP1B 5IVKA 2ZIZA 5LPNA 2XGJA 1U8ZA 1MOSA 3D1LA 1LDBA 3HO6A 3IP3A 4MV7A 1IXRC 4H0NA 4DIEA 1QIMA 1BS9A 1T5DX 1I4WA 4UNRA 5LXTB 1CV2A 2Q2NA 2ZBEA 4L57A 4RAQA 2VN8A 3A3PA 5D6NA 4DM7A 3KAJA 5G0TA 1GQSA 1MPXA 4XJVA 1IN7A 4DDUA 2UVDA 1AUOA 4NCKA 2ZT6A 3WWZA 3GMDA 1DAOA 1T36A 1SC4A 3LS2A 2FUNB 5DWDA 3T5TA 4D4IA 1C7ZA 1PKEA 5FBQB 3PKIA 3QVOA 1G1MA 4QEDA 1QH8B 3RARA 5KNBA 1UODA 3EA5A 3QF4B 1ZFNA 1RWXA 2HMUA 2OKCA 3AM3A 2DP4E 3D3WB 4ODIA 4YK7A 3QQ5A 5HMLA 3AC0A 1N8NA 3C6YA 4O29A 5LMUB 5DV9A 3AUKA 4UATA 2QAGC 4RL4A 4MINA 3GP5A 4RX1A 1WXGA 2NAFA 2P5TB 5I01A 3QEMB 4WNCA 1XEWX 3ROXA 2O54A 4B87A 3WLRA 5C7LO 2BE9A 2PK3A 3A2KA 1KYIA 1UKYA 1E7MA 3AONB 2HJSA 1DDIA 2ONCA 5T8KC 5JQGB 2ZJ2A 4CKXA 1SULA 1UZNA 4GVPA 4G01B 3A27A 2W2QA 2YXBA 4JZYA 4EP1A 4IJ6A 1AKNA 3L7MA 4IYRA 1MOZA 1X94A 5DLYA 4EKGA 2IS6A 1NVGA 1S3SA 1SQFA 2Q3BA 2AYXA 3DQPA 4YTEA 4CMHA 5JI2E 2RMKA 2RH4A 5LA6F 4KQ1A 4BFXA 4G09A 4U2DA 4J0FA 4MR7A 2O0KA 1C4KA 3ESRA 4B44A 3U4MA 1XCOA 1O89A 1JWBB 2J0VA 4PZUA 4PFQA 2WHPB 3CUEF 1E9RA 2CDAA 1M7BA 1U1FA 2DPMA 2IT1A 2PUJA 3HKDB 4DBLC 2F90A 4YQEA 1GTJ1 4ND1A 2KX7A 2V03A 2YINC 4NMLA 4MAAA 4HLQB 1JEDA 4PHGA 3Q1LA 4DT1A 3X1XA 5KJFA 4IR7A 1ADBA 5IG2A 1XVVA 3TM5A 5JHHB 1T8SA 1ECGA 1IZ0A 3AINA 3UJPA 4TKVB 3RRYA 3H5VA 3LWDA 4UBOA 4A26A 2L0XA 3QPVA 4JUFA 1V8FA 2F3SA 1DAIA 1S8FA 3ZE9A 2X9LA 3MTDA 4PPNA 5D84A 1EDDA 4H6PA 2KM1A 3I01M 2CL5A 3PDIB 5AVZA 2W83A 5M3BA 2QW8A 3PD0A 1SUSA 4HH3C 4QXPA 4GI7A 5CDHA 3RS2A 3V4ZA 2CVFA 2Y99A 3FWPA 3U3JA 1NUSA 2WINI 3NOXA 4R8SA 4LJKA 1VJRA 1IC6A 1UDAA 1DTWB 2M98A 2RIRA 3GXOA 5DCYA 5A7GA 3CRRA 2B7CA 5IASA 4BMXA 3RU2A 3ABZA 5A4IS 4TKUB 3DZBA 3N05A 1EWVA 2FX2A 3TIFA 4E46A 1CUJA 2X77A 3RUDA 1Z3CA 3OX2A 3U3ZA 4MS3A 2WAAA 1PWXA 2DBQA 1WCWA 2OB2A 3JYOA 3L6CA 3V34A 4CMIA 1AUPA 1KJJA 8ADHA 1XOIA 2RHHA 5FTJA 3WHKA 1ZUWA 2C2YA 3G9UA 1QYXA 2XXBA 3BCUA 4QXAA 4A6EA 6CHYA 5A0FA 5KYWA 1V39A 4TWBA 3W5DA 5K8UA 3OH8A 3E18A 1IN1A 1XTRA 4BZPA 2WQZA 5DLEA 3ABSB 4E5SA 2NXWA 1RVV1 1OT3A 1PBTA 1EH5A 1TZMA 3L92A 1UP6A 4QUHA 4WGGA 4ASUA 1Q12A 4YDSA 3RAFC 4WGFA 1DEOA 3OPVA 2WILA 3L0OA 3HNOA 4UDOA 1ESMA 1OXTA 4Q3AA 1NSTA 1QANA 2VO1A 4RTPA 2WG0A 2Y0EA 1K92A 4JLJA 3PGXA 4DR3B 2PU7A 5K9ZA 2HF9A 3CUUA 1PGJA 2ZXFA 5AKKA 1VA4A 3E8XA 2EZUA 1E32A 1ZUNA 4GI2A 4MIOA 4O25A 4OGWA 4RYDA 1JQ5A 6REQB 3SKVA 3A1NA 4Q7MB 4D81A 1XKXA 2FHSA 5IVPA 1C0IA 3IBCA 2HSWA 4REQA 2ZI9A 1WBJB 1RSZA 1TVEA 1NFRA 1RXYA 2XRZA 2GMWA 3D81A 1KSHA 1SBIA 2DGDA 2FH5B 4P38A 3J81A 1AN9A 1JKJA 4EQZA 4OHPA 2J5QA 4BQPA 1E7RA 1E9FA 1Z7WA 4WOPA 2J4DA 3II6X 5LDGA 2V0NA 2B4KA 4PO9A 4TYMA 3NVKI 1RPJA 4BV8A 1VPDA 2GXAA 2C7RA 1CJCA 2KB0A 4DYDA 4G3XA 1P1HA 1UBKS 2GAAA 4AICA 1CZOA 2PN1A 2Z2YA 1II8B 1XQ1A 1S3IA 3WE7A 4Z99A 3RQSA 1ZN7A 1W85A 1ZL0A 2AFIA 1TA0A 2ODTX 2I6TA 4HX9A 3H5WA 3VR6D 2P9ZA 3CRNA 3ETCA 4XX0B 2JGLA 2X0KA 1NQAO 4DIMA 3A10A 3E22A 4V0LA 2O50A 1A96A 3LHSA 2QLBA 3QNMA 4E5YA 2NU8B 3UHPA 5HS6A 4GXRA 1GLGA 2X7JA 2H1SA 1LWNA 3VR5A 5EVCA 1N92A 3PUIA 3R23A 3BBPA 4WXHA 4KR3A 3ZH9B 1ODIA 1E5LA 3ZHBA 4MMXB 4AFNA 4CKCA 1FXSA 3HC7A 3SYNA 1YQQA 4U0KA 2A30A 4O3FA 3VKHA 5F9MA 1UMBB 1S01A 4JELA 4YUZA 1BMFD 4QPCA 5HF9A 2ERYA 4JR0A 3T3NA 1G6KA 3ZDBA 3BXPA 4XM0A 3H2SA 2EAUA 3T6KA 1FL9A 3V4FA 4KXFB 1BQ3A 2WZQA 2ZRIA 4YALA 1DMSA 5AKJA 2ZJ5A 4ZV4A 1BKYA 3OT5A 3GFTA 3RM3A 3OEYA 3S70A 5I7AA 4W9MC 5D3MB 3UEOA 4URHA 1J1IA 2EZ8A 2L2QA 4ECEA 3HB7A 4TL7A 2MSNA 5AHRA 1PTJC 3QFSA 1Y5LA 3K9NA 3P20A 4BNFA 3IELA 1PP4A 4EAQA 4YUYA 2D13A 3FW1A 1QGDA 4JD5A 1Q84A 1U65A 3OF5A 4JKOA 1ETHA 4KXVA 4UQPA 2DFPA 1EBFA 1ZRHA 3KUXA 2H07A 1H9AA 1MRNA 3I9LA 4FYXA 4BTVA 4MHTA 1ZNXA 3C3MA 1X9HA 2BEKA 5EMNA 3RFVA 5TV2A 2O3QA 1AUQA 2ZIAA 3FYSA 4AUKA 4YV0A 4OK6A 4H3KB 4K6GA 2BKEA 4ER6A 5EJ9A 2A9JA 1ZM2A 2VF2A 2QUIA 1ELOA 2QTVB 3BMNA 3IEIA 3K9BA 4MPTA 3WI7A 3DZIA 3I6QA 3OQHA 5JNTA 4N0PA 5CH8A 1KQGA 1JHDA 2Q7DA 1V1RA 1YRYE 2KLBA 3GPLA 2G6BA 1CDDA 1L2TA 3T9AA 1IN6A 1TVKB 3TQCA 2BSQA 1SKQA 2FMTA 4B3MB 2GZAA 2PSEA 3M2PA 1ZIPA 2WOJA 1GUZA 2YV4A 4I36A 4P80A 3RU7A 1Q0HA 3Q5GA 2RG1A 3TW0A 2O1WA 2DQSA 3ND5A 1R5BA 1FDIA 3KHKA 1C8KA 2KPOA 1E8NA 1W73A 2WWFA 5AO9A 4ME6A 3DKIA 3U60B 4K7JA 2I76A 1GPH1 3HB1A 4WN3A 1X6VA 1V9CA 1CY1A 3OCUA 3WJ7A 2IGBA 3I6IA 2RKBA 2XCUA 3LWNA 3QKRA 3SQMA 2EYQA 2X5XA 3T4XA 1QK3A 2W6IA 3HZRA 3SF0A 1NQ5A 3CHYA 4MLCA 3P9RA 5EJ2A 1ZGBA 4DIUA 2GETA 4ZEWA 1W48A 4ARVA 5ALUA 2HQOA 1PNTA 2WTAA 5CTJA 2HV9A 2ZIFA 5A62A 3K6KA 1VGRA 4UMDA 5IT5A 2UUBB 1XFAA 2GN0A 4J07A 1GADO 3DDHA 1H4VB 5EZSA 5DNEA 4F97A 4FJ1A 1KK0A 2O20A 3OU2A 2ZB2A 1USWA 4ZN6A 1O94A 1O6CA 1MFZA 2C61A 4ZU3A 2AN9A 1PR3A 4FR0A 5EAIA 5K0EA 4HVAA 5LIPA 4MI6A 4OP1A 1Z0KA 3UVEA 4KNWA 3IAEA 5E6UB 3O90A 2P62A 1R8JA 4B84A 1NBOA 3FMFA 2JLVA 1DBSA 4WZAE 2D4HA 1H0HA 3SKYA 3MUOA 5KMGA 3HXKA 3WYNA 3A6PC 1GVNB 4DCUA 4C04A 1PJTA 4FZ3A 4R16A 5EPOA 1DRUA 3HK2A 4U39A 4DUPA 1X13A 1DAGA 5HTKA 1KTVA 5DTEA 3CZPA 3SP1A 4CF7A 2WAOA 1Z6GA 3ONEA 1KL7A 3H86A 4OQFA 1SKMA 3LX5A 1EFLA 4QNRA 4MUXA 4NBKA 2JHGA 4W8HA 2AE2A 5B37A 3ZLVA 5KO2A 4BQQA 1KAHA 1Z4JA 1H1LB 1T6YA 2Q29A 2HR1A 4QYIA 4MWZA 3W5IA 2VJQA 3DEIA 3V4VB 1GTL1 4AJLA 4DKJA 2A0WA 2W37A 2DU8A 3LA8A 3R5XA 4NNJA 4D4JA 3ZGNA 1RAAA 1E3WA 4EUHA 3T06B 2CXQA 3O38A 3ABIA 3FOWA 1G7RA 1NDQA 2FSPA 2ADMA 1G6Q1 3N75A 1YIDA 3OEHD 4ND8A 3SXUB 3V6LA 2O4UX 3IRVA 4TN1A 4CPDA 4DJDC 4D9GA 4BRUA 5GIOE 1QP4A 3IIJA 4RFSA 3EA4A 2FWNA 1TW3A 5AW0A 1XLTC 1Q0TA 2APJA 1SU7A 1RBQA 2QPOA 1YQXA 5JZ9A 5TPZD 3DHYA 4F45A 2H3EA 4AK9A 3OAAA 2X8WA 1X7YB 2JBAB 2WIJA 3DDZX 5G3ZA 4I1UA 4QUAA 1OWLA 3G5LA 4L15A 1Q0ZA 1JEQB 4BQOA 3NYWA 2NV0A 4ZXFA 4PN7A 2HT1A 4RETA 1RZVA 2VZ9A 1J0AA 1QRAA 2FCRA 1WM1A 3I37X 2HIGA 1KOJA 2X86A 2FLVA 1Q1ZA 3A4LA 1CUEA 3GY0A 4ILEA 4KBFA 4OJNA 2Z9CA 3LWBA 5A7HA 3UAYA 3UJ3X 2J32A 1XCJA 3KOMA 1K2VN 4K3VA 1E1MA 2J3QA 1BDBA 4QBFA 4TZ6A 2GCEA 3EGXB 1U2RA 2MSCB 3KPUA 4HTAA 3P97A 3KS9A 4HLUC 4RK7A 3TE7A 3UHAA 3U4QB 4PQEA 1A50B 3T9DA 3HXOA 2R8EA 1JHUA 4BVLA 1LNQA 2X1HA 2ZUFA 3OQOA 3F97A 3W5SA 4E6PA 3DW1X 4LJRA 4V02A 3LKZA 1TX4B 2AC7A 5GINE 1Z4KA 4OHXA 2FETA 3PLNA 3K5PA 2C99A 1OLUB 2XDYA 1JHRA 2X8AA 1NXSA 1RD4A 1TK2A 1XYGA 2QM8A 2VRNA 3GXBA 4P54A 4OAPA 4EUFA 1WUYA 5C8YB 4U2GA 1FMFA 3JQ8A 1MDBA 3AJ8A 4RORA 2VG8A 5HIMA 1OBOA 1TPZA 1UJMA 1SO8A 2JASA 3DKPA 2RHJA 3D8BA 3GELA 4UM7A 5EJFA 3SYRA 3V1MA 1CVLA 3OZXA 3B7GA 5GV8A 1VL5A 2J9GA 1GAQA 1U31A 5JH7B 3ZE6A 1CJSA 4C5BA 1M10A 1YL7A 1QFJA 4PYIA 1SU8A 3Q72A 1SVIA 2BEWA 5EP3A 1BCRA 1CR2A 1MX1A 4W1PA 2H31A 3VMFA 4ZYYA 2GLUA 3FHTA 5CUQA 3V7FA 2GM3A 2FJPA 2DULA 1DPGA 1YDGA 2QZJA 5T67A 3T3MB 1FSGA 4Z9YA 3LQKA 4FN5A 4RPJA 1Q0PA 1V8OA 4EZEA 5JT1A 2XOXA 1RZUA 4Q9LA 4XW2A 5KSZA 3EWSA 4WA7A 2HRQA 2Z8YA 3RBZA 5DM70 3MOSA 1E7QA 2HQ1A 3PUZA 5C1IA 5JLJA 3L6UA 2HNAA 3HO8A 5DB4A 5M2QA 2ANBA 2HA3A 1L5QA 1RXUA 3REFA 5HBRA 3GCGA 3UANA 3D8NA 1NW8A 3AVPA 3TRDA 4BWVA 1CQJA 4RY9A 4ZARA 4ECAA 4C7XA 2AK2A 5A0TA 1NHGA 2WUGA 2Z3WA 1XF9A 3GDGA 3EC2A 1E4VA 2ZS9A 1EK6A 2JGEA 3G3EA 5EOVA 3KIPA 2AXPA 3H2GA 5KINB 6ADHA 5LM3A 1PS8A 3IEKA 5E4YA 2FQXA 2Z5GA 3N58A 5IP5A 2D3TA 1NONA 4LI3X 4LQLA 1KQFA 2EDCA 4GX2A 3T3IA 3U5ZB 4V1CB 1O0BA 1XDUA 4IMRA 1DGQA 3DOOA 4JEIA 3VTKA 1IHPA 3SHVA 3ZNOA 1Z4QA 2YXLA 2Z5VA 1QORA 3PK0A 4JNCA 4CCWA 5A5FA 4MKGA 4I8XA 2F43B 2HJGA 3LT1A 1JQLB 4MWDA 1RVDA 2CEAA 4B7UA 5LZ9A 2ZCJA 2QAJA 3LZCA 1FS4A 2PX0A 3NBFA 1R74A 4RANA 3JWHA 5AI4A 3AX6A 2DT8A 3FLBA 3ZDEA 4FFBA 3JZFA 1N6OA 3SZGA 3DBLB 4RF3A 1BO6A 1VLHA 5J4HA 3WLSA 4CYMA 2W6JA 1TUBA 5AKIA 2ZRDA 5FHQA 2ZQYA 1IWBB 1SBHA 5E4JA 2QM0A 2V7BA 3IAXA 4PLFA 1E7WA 1Z5GA 3GRZA 3WLQA 4PLZA 4L76A 4QXQA 2G1KA 1KOFA 1JFTA 4LOJA 5LNK1 1W581 2RAVA 3T1HB 1TM1E 3BG5A 2YASA 5KYTA 1KYVA 2XWQA 2CV1A 1XXHB 3H6HA 4JC4A 2FVYA 1SC3A 4R8VA 1T4BA 4FYYA 3QHAA 4MVJH 2XODA 1I5EA 2WIGA 4OU5A 1T9BA 4CM6A 2MSWA 5FH9A 3V55A 4A2QA 4WCDA 1UBTS 4KU4A 1STOA 1T4DA 2AR0A 3DSRA 1C0PA 4J75A 3ABOB 4L4RA 1KO4A 2WZBA 1NHWA 2J6IA 1Z0AA 1B0PA 2PRSA 1AK2A 1OU0A 2PT5A 2R44A 2ZJ4A 5SZJA 4D3SA 5CA1F 4AKSA 3VR5D 4RJJA 1LBHA 2PMKA 4G65A 1H05A 2H4XA 3OICA 2O52A 3IE2A 3T4PA 2XCQA 2N3ZA 4ZCSA 3FJYA 4JDUA 4Q9HA 4QYWA 2RK3A 4RJ2A 1KRHA 2NPIA 5EIWA 1SQ6A 2I7CA 4O33A 2GK4A 1MDFA 4M0UA 4Y2XA 2Y92A 1YBHA 1KYXA 4BV3A 3NJ8A 5JMPA 3URMA 2RAUA 3EZGA 3JXEA 5BN4A 3WNVA 4DXDA 2IOFA 1EB9A 3QA3E 4E1BA 4F12A 1ZISA 1MQ8B 1N2SA 2P8JA 4BQEA 4BEJA 4DUYB 3KD2A 1D9XA 1YMUA 2PS1A 5EHIA 2ZVQX 4I4CA 2B69A 2LPMA 5A3RA 3ODGA 3L3BA 2I4NA 2IYAA 4L6AA 2FZLA 2X1VA 3SEQA 3S5JA 4NAUA 4CKBB 2LP4Y 4CL2A 2NM0A 4N7MA 3ZJ5A 3R6LA 2VP2A 1KO5A 3TOCA 2EG5A 4RH0A 3LO8A 1TF2A 2CJWA 2O1EA 4TQGA 4EFNA 4OX9B 3HTXA 3ZGZA 2PRYA 4QJ3A 6YASA 4DA4A 5AVJA 1QWOA 2FI1A 3DMNA 3H1TA 4U4AA 3NPMA 5DJ5A 4AROA 1G55A 1IEVA 1TZJA 3R9XB 1NLMA 3LQQA 1LLCA 4RVGA 2IH2A 1VL0A 1SRQA 2NZUG 4N7JA 3NIDB 3B6JA 5T6BA 1PT6A 4FSHA 2O2XA 3OIUA 4RD1A 1VE7A 5EP4A 5CAEB 4EGQA 1M1YA 2PZBA 1QIFA 4HB0A 4URWR 1W2WB 5FAXA 1U8AA 3OU7A 2KS6A 2XI4A 2FWAA 3C4QA 4NJOA 2DR3A 4QBIA 5KYUB 1HFWA 3W4JA 1PV1A 2IUFA 1AHIA 1J4AA 1LDYA 2P67A 4YAFA 5AK4A 2XTNA 2AQKA 4LWOA 2KJQA 1NM5A 1KC1A 2ZYHA 3VO8A 2VSOA 3LPCA 2H48A 4BLRA 4X71A 2RBKA 3GEGA 3OOEA 1UBFA 3TKAA 5F98A 4JT9A 4RY8A 3PHBE 1FVFA 3PGKA 4XCXA 2P30A 2BMAA 4XQCA 4BO4A 4UTZA 5L3QB 2HI0A 4DRYA 3TFWA 2PSDA 2QUJA 4JBLA 4MZDA 3T3DA 1ZJ5A 3CG4A 1JDNA 2MYTA 3H4IA 1N8TA 2OV2A 3LU1A 5F1OA 1J6UA 4WZBA 4B7ZA 1KWGA 1C2TA 4MS4A 4RJKA 4RH3A 4NFSA 4US0R 1J97A 4EYEA 4KMRA 3EX7C 5E6RA 1GPNA 3CO5A 3OLQA 1M1UA 1M9NA 2FSGA 4NE7A 5CYPA 3WKEA 1T2EA 1L8AA 1XZBA 4YWJA 1PE0A 1K8YB 3N28A 4K81B 2WICA 1ORTA 1C29B 1A8QA 2HDHA 3H5RA 4QHTA 1E2BA 2I4LA 1A9QA 1U0GA 3AGQA 3GF4A 4RGBA 4EVSA 1O94D 2WTEA 3U3RA 1X7GA 4OXIA 3UMRA 3J81k 1KDYA 3GLVA 4EX6A 3JX9A 4N5MA 1S7GA 7AT1A 2RGCA 1U0NA 4CCYB 4CQMB 1ZONA 3U39A 2Q41A 4KLNA 1WQ4A 4QUDA 1NL3A 4P4UA 4TYPA 2DUUA 1CUCA 1M2NA 1SCAA 2HWKA 1N57A 1PL6A 4IUYA 3AVQA 1LDEA 4GGOA 4TS4A 5C9ZA 1P0QA 1PJ8A 3D7LA 4CEJA 5KYGA 3BWDD 1C14A 2HLPA 4Y6OA 3KQMA 4HRVA 2XZLA 4M0PA 1EFPB 1QCDA 2CMDA 2E4AA 2JJ1A 1JXMA 3W8NA 4B73A 1RQ2A 1I8TA 1E2JA 1LS6A 1Q50A 3TLGA 2FMHA 2QVLA 1JKXA 3KWLA 3L43A 3QBJA 2BFAA 2I78A 2OZKA 4P83A 1RLTA 3MMZA 3THXA 1F2VA 4B80A 2NSDA 1M2OB 4FDMA 4NTZA 4HMOA 1RRPA 1P17A 3ZU2A 1JH9A 1CW2B 2JD0A 3VJMA 3C7AA 3ER6A 3SSAA 4LX0A 1DKUA 2HWWA 2PSFA 4DV5B 1WJGA 2Q3MA 2YIMA 3G88A 3KYCB 4LXYA 4XQGA 3SG0A 4ETMA 4TL9A 3WFJA 1NVBA 1TM2A 1MRZA 4IS3A 2NO0A 4D02A 2HK9A 2CBXA 2VJKA 4M87A 3RHSA 3P9ZA 2I3ZA 2W9XA 2C2KA 5CU7A 1DELA 5DM4A 1HBJA 1W7AA 1E7YA 4RAOA 4FK8A 5BQFA 3QI7A 4ZOQI 2GSDA 2XQFA 1Z73A 2EWWA 1G7CA 2C5FA 1CJBA 3C3EA 4IG4A 5IK2A 3TTUA 5BSUA 3AEQA 1YR1A 3IQGX 3P26A 5DFAA 3H75A 3CKLA 4BXOA 2WPNA 1W30A 1Q1EA 2Z8ZA 1BHJA 3TJZA 1O4WA 4XSVA 3C45A 3ZI4A 2Z6UA 5DF1A 1B7GO 5I9TA 3IULA 4GBJA 4QWMA 3OAAD 3C6KA 4B3BA 2BD0A 4OV6B 5ITZB 2C97A 1Z68A 4JQCA 3L6DA 3VUFA 2VT6A 2O8BA 4NEQA 3GIDA 3UAWA 1SXGA 4BS9A 4Z2AA 3RFUA 3CLUC 1PCXA 2EX0A 3HXTA 3EVDA 4K2HA 4EJ6A 3LUAA 1M74A 1NW6A 2IYOA 2PWPA 2VF8A 2YC4C 1RCTE 2W8ZA 1Z0SA 3G2QA 4Q1DA 3ZCUA 1Y7TA 3F5DA 3FM9A 4HFJA 3R5HA 1QHXA 2X9VA 2ZB8A 4JZKA 3HE3A 1E0JA 1H2FA 2Q2WA 1FUKA 3D0RA 2IHVA 1K9VF 3MJVA 2ENUA 4N18A 4Q3EA 1DBRA 2Z5FA 5CH3A 5FTNA 4FXPA 1ADCA 1VKNA 5JS7A 1ZCZA 5HE8A 2NZJA 1B2LA 2Q1WA 1E4EB 2VJPA 3GAFA 3HBAA 1HDXA 2VTVA 2GYYA 3NETA 3HDHA 4QT4A 4X66B 3NM5A 3PWZA 1A5ZA 3RIHA 3OZFA 3UAVA 2QD1A 4EHHA 2XZOA 1HH4A 4TMFA 3DGEC 1E0KA 4MCHA 5G3YA 4AB1A 4CM7A 4J1QA 4YJDA 3TIGA 1EIWA 1F0YA 3HRHA 4HVTA 3T7IA 5DK6A 2YQ4A 1BX1A 2Q2VA 3KKOA 1T1SA 3VAAA 5AHXA 3L77A 4YV1A 2B9EA 4RVNA 4CTKA 4FYKA 1XR3A 2EFDB 3G8AA 3OU6A 3PL5A 1SB8A 1JFRA 3Q6IA 1XCBA 1GZUA 1X0VA 3D02A 4URFA 4EPWA 2Z57A 2GGSA 2OZVA 3D1VA 3UJAA 3KSDO 4WV3A 4CG3A 2ZDGA 4ARZA 3HZZA 4GT1A 1QUFA 1GPMA 2DLNA 4OB8A 4XUDA 1IZYA 4TS1A 4TMYA 4ESVA 1FC0A 4DN6A 3VX3A 5L3VA 2BHRA 5HZKA 4E11A 2G3YA 4NZNA 5AJWA 2J9FB 4F8YA 2UU9B 3MK31 3DL0A 3KZKA 1I4TD 2JJ2A 1V4VA 1R7RA 1GM5A 5B2ZA 2FR1A 2WU4A 3M4XA 3TG8A 4UUPA 2WT8A 4M4SA 4XLTA 3W6UA 1WWKA 1GP2A 4A27A 2ST1A 3W2GA 5IH3A 3AUYA 5IYZA 3EXEA 1UIMA 5F2KA 5FUQA 2J87A 4AKGA 4V0RA 2TMKA 1D1SA 5ICEA 7ABPA 4B3XA 1IHUA 4FJ0A 1PLJA 2VDWB 4WLOA 1F0KA 1S6YA 1W36C 1CS0A 1VZ3A 4K5QA 4PNPA 1E9EA 2FMFA 1G8JA 1ZNZA 4TQAA 3PUWA 2VPIA 1N0HA 1PT8A 2VTKA 2O8FA 1UOEA 4IBOA 4KZPA 1C81A 3I6MA 3OMXA 4OJYA 4BWYA 2PYZA 1V6AA 1QTIA 4WT7A 4H0FA 3WDMA 5HUJA 1QG2A 4MSUA 5JSKA 3WKBA 3ZUPA 4Q4CA 3BD9A 3D7SA