3B7GA

Human dead-box rna helicase ddx20, conserved domain i (dead) in complex with amppnp (adenosine-(beta,gamma)-imidotriphosphate)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
ADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX20
total genus 69
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b7gA00
1E2PA 1FMLA 3DKVA 5AJVB 4ON9A 4DKXA 6Q21A 3TUJC 1YZTA 3GQBA 4I1SA 5J40A 1UKEA 1R10A 1GP2A 1S8FA 1XPRA 1II8B 5BYKA 2FPLA 4GRAA 1E0JA 3AVQA 1DAHA 3CNNA 4JJZA 4PC2A 3REGA 2R6CA 5IT5A 5IRCD 3G82C 2AN9A 1II0A 2LKCA 3BORA 4MGYR 1C4OA 5HE8A 5BQ5A 3F0TA 3R8CA 4O3MA 3UG7A 2QA5A 2QRZA 3B13B 3BS4A 5AK0A 1W36B 1TQ2A 4BFXA 2F3RA 1T5IA 4OK5A 4Q01A 5DSZA 3T15A 3T34A 1IY1A 4ZKEA 4Q5IA 3FKSA 4DBLC 1TQ4A 2AKAB 5E95A 1G5TA 1P5ZB 2R44A 4J0QA 3QKRB 1GSIA 1W5SA 5L8VA 1VIYA 2PJRA 2O8CB 3C8UA 2FNAA 4IW3B 2QP3A 3K70D 1TF7A 4EJSB 5B30A 2J1LA 1M6NA 2FN4A 2R2AA 1XCPA 1LVGA 1YRBA 3SYNA 2PEZA 3ZVRA 5JI2E 2J87A 4UXJA 1X1RA 4JLDA 3GD7A 2PEYA 5AJWA 3R9WA 3EZ7A 4EFLA 1TQ6A 2CCGA 3KL4A 3QSYA 2QP4A 1OV4A 3H86A 4AYWA 4RVCA 4PO1A 4DIEA 2OAQ1 5DI3B 2ZI7A 5G3YA 3KJEA 1QF9A 3C5CA 3P20A 3CZQA 1BH2A 3CZPA 2CCKA 2BCGY 1TUIA 4GZLA 4B71A 2Z83A 4Z1MD 4D4JA 2VEDA 4G3XA 2GEUA 1MH1A 4Q1BA 3QXJA 2V54A 2HJGA 5B57C 3BE4A 3QF7A 1HY3A 4A92A 4PAQA 2YWFA 4QJ5A 2REBA 1E2LA 3SQWA 3ICEA 4C0BA 4PPQA 4Q7JB 1P6XA 3K09A 3Q8XB 4KYUA 3FYHA 3VQTA 4EPVA 1EFRA 4UNSA 5IF9A 3LAWA 1JXMA 4WBSA 3AF2A 4PC7A 3ZIAD 3GFTA 5JRJA 1KZ7B 1ETUA 4JVLA 1FL9A 1XNJA 3PUXA 4Q4JB 4BRWA 2IYVA 4P31A 1NBMD 2F1IA 3HWSA 1CJVC 1ZMXA 2VQSA 2HF9A 1XTSA 2WSMA 4ZCLA 4D0LB 1R7RA 2DFKB 1JEDA 3T5DA 3B1VA 4JLOA 4QM7A 1E94E 2EFGA 2OILA 4EUNA 5KDOA 3KUCA 3M6AA 5B58C 4DUGA 4TZ6A 1FX0A 1XMSA 4OQLA 4V02A 1TUEA 5L3SB 3F5FA 2SHKA 1XBTA 3PJRA 1MABB 5DGXA 2JLSA 4QGHA 4TLDA 2OSBA 1EXMA 1YZGA 2ASEA 5CLLA 1DAIA 2NPIA 3I32A 4AURA 4HUQB 2W6ID 3VKGA 5JEEA 4OYHA 4XJXA 3EARA 3TUZC 4B43A 2VPPA 5K8LA 4WXRA 3SBDA 3GLIA 4Q00A 2J7PA 1NL3A 4EPXA 2L0XA 1DTSA 3KJIA 3SS8A 1H65A 2BV3A 2NGRA 3AVWA 1ZM2A 1E2DA 3ADKA 1Z83A 1TF2A 1II9A 2IWRA 4D4MA 3G0HA 2G1KA 5JLJA 4G5OA 2G3YA 3M1IA 1NN0A 5GVRA 3W8RA 1VCNA 1NJFA 1ZC3A 2QG6A 2Z6VA 2B92A 3BK7A 4F93B 1W44A 3NEYA 3JVUA 4U7DA 3T1TA 4BFZA 2PCJA 3HYRA 1U8AA 3AKCA 2XNDD 4KFTA 2B8TA 5FOSA 3SYLA 1AS2A 3KFXA 3ICQB 2REXB 3RDPA 2NTYC 3CX7A 4Z54A 2ZRGA 4RD4A 1R5OA 1U99A 2BMJA 2IEYA 4PANA 5A5GA 4QNMA 3A1SA 1XMIA 4DCNA 3FE2A 2D3WA 4L16A 4XTRA 1S3GA 2BKEA 1W2HA 4EAQA 2OXRA 1OFIA 2ZRPA 2ODWA 3NH9A 4KHZA 3BAFA 1W47A 5FI1B 4PPNA 1E9FA 4K81B 2ZI4A 1OIWA 1XMJA 2JJ8A 4JS0A 1Q12A 4MUAA 2IS2A 2WM9B 2ZIAA 1G6OA 3MUFA 3UPUA 2XITA 1I4TD 2DCUA 1U0HC 3DVLA 4HUQA 1EESA 2IXGA 5AJYA 5EXTA 5EQTA 1OH5A 2ZSDA 1Z47A 2XOKA 3C4JA 1E0KA 4I1OA 1UDXA 4RSGA 1T91A 2NO9A 3B1WA 3BB3A 1YE8A 1LF5A 2JJ2D 4LHZA 5HCIA 2R65A 3BXZA 4AC9A 1XJ0A 2QAGA 4LC0A 4Q7LA 4C30A 3N70A 4ASUA 3OFNA 2ZE7A 3AQ4A 3CO5A 1XD2A 1G7RA 1Z2CA 4X8OA 2ZROA 3LFUA 3LBNA 3V00A 4DVGA 2WAXA 1IXRC 3CX6A 2AWNA 2MMCA 4JL6A 1TEXA 3VHLB 2CLSA 4F4JA 1M2OB 2NPFA 3CLVA 3SJCA 4B2PA 4DT1B 4DLXA 4LJAA 3W3ZB 3OE7A 4M1TA 1G3MA 2ECKA 3WMFA 4W5WA 1WB9A 3LW7A 3LXRA 1T8UA 2GCOB 3EPKA 1NVVQ 1UJ2A 2CL7X 3B1YA 4XVQA 1TF5A 3CM0A 4JLVA 4JSYA 1DBSA 5P21A 4BPBA 4MYCA 4D80A 3KZ1E 4G0NA 5FPHA 1FNMA 1AS0A 4NCJA 1XCGB 2V7QD 3AUXA 4DB4A 4MITA 5EJEA 4TSFA 1KK1A 1ODFA 1LS6A 2VHCA 1G3RA 3KJGA 1YU9A 521PA 1E98A 1F2UA 4C7OA 3SYKA 1Z0FA 1ZM7A 1P7CA 1QG2A 4HYYA 4KV9A 1YZQA 3GLFA 2NQ2C 2UVQA 2E1RA 4A8JC 2XSZD 2XJ4A 1CR1A 1K8RA 2BM1A 4UJ5A 3VMFA 3QXSA 2F6RA 1MOZA 2WKPA 4LV6A 2KBEA 3TAHA 3RC8A 2QI9C 2ZUCA 3LWNA 2ZRFA 3FB4A 1GKIA 3LLMA 2IYTA 3TQCA 3KQKA 3THXA 3ZQJA 4A9AA 2JLRA 3TVDA 1PJRA 1DAFA 1N3BA 3VHXA 1EX6A 1NKTA 2W58A 3EIQA 3TLXA 2YKGA 2J5XA 2PZEA 2QMHA 3RS7A 4DSNA 1P72A 4GFDA 5K8UA 3AGPA 1BKDR 4KSBA 1QZXA 1JNYA 2ZR9A 1Q22A 4YC7A 4Q1CA 2G83A 3PIRA 5KUTA 5J4LA 4OQFA 3R7WA 2KJQA 2X19A 3LV8A 4HDOB 2ZRBA 5C2JB 1RW4A 2F1JA 3GCGA 1TNDA 5C4GB 1E2EA 2UKDA 1CJMA 1V43A 2GF9A 5JJLA 1Z6TA 3Q7QA 2C5LA 3OFND 1JJVA 1DG1G 1NVXQ 1KOFA 2FG5A 3VU9B 3WBKA 2UZIR 3TSOA 4N1AA 4CT4B 4D82A 1W4AA 1Y63A 1PUJA 3ZS9A 1FUUA 2WJHA 1ZUIA 2J41A 4NPHA 2PLFA 3SQXA 2JA1A 3B6EA 1CF4A 1DG3A 4MKHA 3KKQA 1Z0KA 4B32A 2G88A 3AKEA 2R6GA 2NZ8A 2WJGA 2LKDA 5IK2D 1I2DA 1XTJA 1KKLA 4P32A 4BFUA 1UF9A 4ZO4A 4IVRA 4D26A 3KUDA 3EASA 1UBGA 2A3RA 1E1QA 3LH5A 4FWIB 4HB4A 2FH5B 3X1ZA 1EWRA 4HLUA 4LC1A 4B6EA 1T4GA 2IYZA 1MO6A 5LB2A 3F8TA 2Z4RA 2CE2X 3LVRE 3IBYA 4DLTA 2R62A 3OEHA 4KODA 4LJ9A 1RYHA 1PLLA 3NDBB 1M7HA 1JECA 1F2UB 4X8HA 4LRWA 1ZD1A 4A0RA 5L3VA 1OT3A 2QE7A 4DLVA 3FOZA 4ZKDA 3VR1A 1IN6A 1W4BA 3GEHA 3L43A 4ESVA 3CH4B 1J2JA 3P32A 3PV0A 1VDZA 1OH6A 1ESMA 2Q3MA 1XDBA 5EZ5A 2NO6A 2YV5A 3B85A 4RCYA 5L3QA 2O8EA 2V7QA 4TWZA 4LV5B 3KXKA 4EPTA 4TL6A 1IBRA 4IVQA 4ASUD 1Z0AA 4M21A 4V0ME 1IY0A 4ZCIA 3RS4A 1U0LA 4ILEA 3QBTA 1E32A 2JJ2A 4PX9A 1SVMA 2NZJA 2BOVA 1C1YA 1OIVA 3PCRB 2QN6A 2EYUA 4LOAA 5IDVA 2HUPA 4IXNA 4CVNA 4B75A 2D7CA 2DWPA 5JEDA 721PA 1W48A 4QBHA 1G7TA 2WJVA 1EK0A 1S3SA 3IBGA 5FTNA 1YZNA 4D6PA 4BFSA 2O8DA 1G8GA 4CT5A 3K9HA 4R9UC 2GZDA 3I1FA 1KI6B 3BH6A 3CR7A 3X1WA 3UIEA 1P62B 1E2FA 2QM7A 2CEAA 1KK0A 1HUQA 1Z8FA 3LQRA 5CK5A 1F48A 4DLYA 4E22A 2KSQA 2YOHA 5G41A 1CR4A 4BECA 2Q0HA 5C18A 2JJ1D 5D3MB 1NG1A 2C9YA 2GCPA 3IHWA 1GTVA 3CX8A 2RH5A 1JQJC 3H1TA 2ZSFA 3QF4A 4TLCA 4R7ZA 3EPLA 2VSXA 1ZIOA 4GOXA 5FOXA 2FOLA 3THOA 4WZBE 4EQ6A 2HXSA 4DDTA 3DPUA 3K0FB 4Q4HA 5FUXA 5DIFA 3FDIA 4TTQA 5JSZA 4Q4AB 2BJVA 4N0EA 3HYTA 4UNNA 3OAAD 1OH8A 4BLPA 1ZNXA 1Q3TA 2ZRHA 1RFLA 4TLEA 1ZYUA 4PHTA 2C99A 1U90A 4JT2A 1G8YA 4V0OA 4QGFA 4PO9A 2Z43A 2ZEJA 1SVLA 2A5JA 4QHSA 3O8CA 1FP7A 4E09A 2VHUA 4Q7MB 1KMHB 3K9LA 5DE3A 1IQPA 4M22A 2PLRA 1AJEA 2LCFA 2EFEB 1KAGA 1KDPA 5G53C 3ZD7A 2J7PD 1W4RA 2YINC 4KU4A 2JJ1A 2KWIA 4RD2A 4D4KA 4GOKA 3SN6A 2VYFA 4BFYA 5JWRA 1KI3A 2QP9X 2VP5A 3WRYC 3GLHA 4A82A 3ASYA 2X1VA 1XEXB 2HCBA 2D06A 1R8QA 3CRVA 3MLEA 3U3MA 4D4LA 5CJPA 4FMCF 3ZD6A 1QDEA 1ZC4A 2ZRAA 2Y8EA 1U8YA 1NN1A 3N5CA 5FTJA 3BJIC 5FPTA 3C15C 2RGCA 4Y0VA 2IWHA 2HF8A 2XTZA 3HU3A 1JR3A 1UPTA 4URYR 1OIXA 3BD9A 2FZ4A 1ELOA 3L0PA 1DAKA 3NWJA 4MRNA 4P4SB 2PMKA 4LHYA 3L2OB 4ZV4A 1E69A 1II8A 4JLAA 4A0HA 1KJZA 3DMDA 4V0KA 3ECCA 4FW9A 3QF4B 3ZIAA 3W8NA 4QFMA 2CDNA 1Q57A 2QAJA 3U6BA 1G8HA 2CMKA 1VCOA 3BIFA 5FR1A 3RSLA 3K0CC 1FTNA 1ZNZA 3I92A 2KI5A 1YHNA 4IEEA 1E79D 2BMEA 2FA9A 1A2KC 4UNPA 4US0R 1KSGA 2PX3A 3HR8A 5KNCA 2YVUA 4B3BA 3I61A 4LHXA 2C96A 4Q19A 3H84A 4Q03A 5BYJA 1GUAA 4A2PA 5HR5A 2FJUA 2CL0X 1U8ZA 1RVDA 1KY3A 5J4HA 4ITRC 4AG6A 3TKLA 3WRXC 1G4UR 1OXSC 4US2R 4DLRA 4RFSB 4B34A 2P6RA 4MDFA 1N5IA 3GJ0A 2QY9A 2V8OA 4QKQA 4DDWA 1E4YA 4ACAA 1J70A 1GG2A 3K9NA 3NHBA 1GRRA 4EPYA 3EPHA 5J47A 2G9NA 2QPAA 2V4ZA 1CLUA 1RIFA 2DFLA 2ATVA 4M8NE 5JZVA 4TTRA 3Q7PA 1ANKA 3LD9A 2ZS7A 3GEEA 1XEXA 4IJMA 3LDAA 2PBRA 2FSIA 4KVAA 1IONA 1L4YA 4OJQA 4AKHA 4Z8XA 4ZI3A 3VR5A 4Q1EA 4NYJR 3IO3A 4IHQA 4LUCA 4C3ZA 2ZU6A 2A5GA 4PSKA 3RLFA 2PZFA 2B21A 3EAQA 5J4KA 1VCIA 2YOFA 4HSEA 4P4SA 1Y3AA 1N25A 5L3RA 1BIFA 3U3RA 1W49A 1VYVA 3IILA 2AKYA 5E7IA 2BBWA 2OM2A 4EJSC 1E9BA 2WIBA 1ZU4A 3D7MA 1E96A 1NIPA 1UAAA 2IS1A 1LV7A 1XEWY 2V1XA 4FMDF 1OXUA 5EXSA 2BEKA 3W6PA 3WMGA 1R0XA 1KO1A 5TB5A 4CW7A 2ODEA 3PENA 3S1AA 4MRVA 2J0UB 3R9IA 1OB5A 2OO7A 4Z8YA 3HP1A 5JHHB 5JFGA 5BN4A 1GRQA 4FI3C 1D2MA 3W90A 5FOWA 2ZM5A 4CEIA 3A1UA 2ZI5A 1Z6AA 1A7JA 1RRPA 1DARA 1XFAA 3QEJA 1SXJB 4LJ7A 3GLIB 1ZJ6A 3PUWA 3AF0A 4BLQA 1G291 2R9VA 3RRNA 3F3YA 3NIBA 2WVJA 3MG9A 4Q1AA 3QKTA 1T0HB 1GKUB 1KJYA 2OE2A 1W0KA 3PG5A 3WNDA 4ARZB 2CJWB 4G5GA 4MRPA 5CIQA 2XXAB 3FPAA 2F9LA 3EC2A 2J59A 4AYTA 2G0TA 1DELA 4PSVA 1OXXK 1IXSB 3QOFA 2ZI3A 5FI0B 3MWLA 4JLJA 2F43B 1XD9A 4TLBA 2HXYA 3T35A 1OFTA 4A6XA 2GXSA 1OJLA 3IIKA 3CH5A 1UKVY 3I62A 4TSFD 1HURA 3MMPA 4X8MA 4B2IA 2WBLC 4HLCA 1TU3A 3K70C 3EG5A 2ZI6A 3A58B 4DIDA 4URWR 4NP6A 2GK6A 2ZE8A 4V03A 3UATA 4D2IA 4XTCS 1ZIPA 5JS8A 1VHTA 5EUQB 3RAPR 1A5TA 1N6RA 1E6CA 2OT3B 4GMXA 5FL3A 1DAMA 2JIZA 4LYHA 3SC3A 2VRWA 2N1BA 3VFDA 4HAXA 3T61A 3TJZA 4OL0A 2EFCB 3IIJA 3TR0A 2O52A 3P1JA 2ZXUA 2ZREA 3X2SA 4II7A 3ZVMA 1XD8A 3NBXX 4B6FA 4BWYA 3SE0A 3SNHA 3IQXA 2IT1A 1D5CA 1XJCA 4OQNA 1OF1A 1G17A 1LW7A 2CLDX 5D3QA 1CJTC 4A8JA 3QKSB 1E1RD 4QBIA 4AKIA 1G3QA 4OK3A 4LYJA 3QG1A 4PQYA 2IC5A 2GVDC 3UKDA 1KI9A 4JLKA 5F2EA 2RGBA 5EP3A 3TSZA 1SXJA 3W9YA 2WTUA 4DCTA 1N6HA 3GJ7A 1P4SA 4K8OA 1J99A 3PVSA 2ZJZA 3K0CA 3A4NA 1LNZA 1RRFA 4JMPA 2Z5FA 1JAHA 3E5HA 2BMDA 4IDHA 4B74A 1H8HA 4YMSA 5JI3E 2GJ9A 3IPYA 1F6BA 2FSHA 3QKRA 3MWJA 4JVSB 3FHTA 3IEVA 2QROA 2D4HA 3A8TA 2BVNA 1W7AA 2YYZA 2I4IA 4C7OB 1XP8A 3K8YA 3MGCA 2GJSA 1QVAA 4TL8A 2GESA 4K46A 2GXQA 4H1UA 1W46A 4V0LA 2O8BA 4A15A 1QHHA 1YZUA 1GL7A 3VR3A 4TZ0A 4CEHA 4PZYA 3IIMA 4KXFB 4YDHB 4IDOA 5BN3A 3LBHA 3EC1A 1E99A 3O8RA 4PPFA 1M7BA 2RGGA 4KJZA 2ONKA 4TMTA 4PC6A 1E4VA 2FWRA 2OCBA 1KGDA 3SU8A 2YOGA 2CNWA 4A0FA 2FEMA 1DO0A 2NOAA 1NY6A 1KYIA 2HT6A 2BEJA 2JCSA 3DOFA 4CEJB 5IK2A 3P4YA 3T5GA 1FQKA 4AKGA 4DWJA 2ZTSA 3WHLA 1XTIA 3R7WB 5FPYA 2YC4C 3I5YA 2O8CA 1OSNA 4QHTA 4W9MC 1YZLA 1JQLB 2H1LA 5TXGA 3U3KA 2GF0A 5B2ZA 1KDRA 3RS2A 5C1BA 2OV2A 2X2FA 5SZHB 5LD2C 5CM8B 3SDZA 1CU1A 3K70B 3NC0C 2JLQA 3MWKA 1WBBA 3KXLA 1HA3A 3X1DA 4XWOA 3RVBA 2C04A 2OAP1 3B8HA 2ZSEA 1P61B 3SFVA 2ZRNA 2QL6A 2RAPA 3RS5A 1MABA 5AJXA 3OAAA 1R5BA 5JHGB 1WCV1 4JYBA 1US8A 3W5IA 2BBOA 4KFSA 3BB4A 2C8VA 3I8XA 4H9GA 4WVFA 4MKFA 3TW4A 2MMGA 5TARA 2Q21A 2V9PA 2QM8A 5FH9A 2BHRA 2EQBA 2ZUDA 4QBFA 3LRPA 3BFXA 2RB4A 2G0NA 2O5VA 1IN7A 4ACBA 1SZPA 3CUEF 2P5SA 3GJ4A 4HUTA 3KJHA 3SJZA 4NKRA 4P4UA 3U4QA 1M8PA 4L4UA 1DS6A 5FBLB 2FFQA 3SI7A 3OIVA 2CBZA 4LK2A 4GNKA 1SQ5A 2DR3A 1UEIA 1BMFD 1ONBA 5KNBA 2QMUA 1J90A 1W0JA 1TU4A 2JDIA 3WMEA 3FGNA 3CNOA 2H18A 1RRCA 3V4FA 4MH0R 4OHVA 4PSAA 2JGNA 4YONB 3V9PA 1AZTA 4DZZA 2JLUA 1VMAA 4B33A 2OLJA 1B0UA 1T3SA 3GJ6A 3D31A 3VNVA 4M9XA 1P2TA 2GCNA 1N0UA 2OESA 1KDOA 1QHIA 3GJ5A 5SZIA 2ORVA 5DYIA 3THWB 3T06B 5JECA 3OIUA 3CBQA 1J8MF 3GMTA 2DWOA 5JS7A 1DAGA 1DO2A 4JBWA 3LO5A 5EXXA 2OBNA 1OB2A 1R6BX 3QIAA 2IYSA 1YZKA 5HZHA 1G41A 4Q47A 5ELXA 3C41J 2O8DB 4KBFA 2QQ0A 3DM9B 5DHAA 2RGAA 2ZJ2A 3LVQE 4G01B 4HEJA 4P3YA 3QKUA 2OZEA 3OEHD 3BWDD 1UBFA 4FCVA 2AD1A 3TH5A 3I73A 3DL0A 3QY0A 4TT3A 4PQFA 1NJGA 4DJTA 2FEOA 1G18A 1G9XA 4E03A 3AVVA 5LDDC 3NBZC 3Q5DA 1Z3IX 2GNOA 1RE0A 4FCWA 2IS6A 4M0LA 5F3WB 1JJ7A 2D2EA 4TYPA 5AWFC 1BYIA 5AJZA 2VLIA 1M7GA 3G5UA 1SVOA 3IUYA 1AIPA 4B48A 3ADCA 1BMFA 2ZAMA 1KI2A 3DMNA 2R6FA 3TK1A 1ZM4A 2QAGC 2IYWA 3WNBA 3FMFA 1MT0A 2LWIA 3CPEA 3SFZA 1XZPA 2YWGA 1E0AA 5AUQA 2YWEA 4DXAA 3K0AB 1AA9A 2Q3FA 2ZR7A 2JLWA 2ORIA 1TMKA 2CK3A 1ZNYA 3I8SA 3KDSE 4B73A 3PR1A 3ZGXA 4AKEA 3OIYA 2K5UA 4RY2A 3ZQ6A 1CS4C 4LZZA 4U00A 2QORA 4HAZA 2VA8A 1SGWA 3Q9LA 3MRSA 1XD2B 4QXAA 4KFUA 2EFDB 2FSGA 1G1MA 2ZYTX 3TAUA 4GP7A 2HYDA 3GEIA 1E2IA 2IS4A 1RYFA 3O8BA 1M34E 1NP6A 3AEZA 3EZ9A 3UWKA 5H8WA 2QQEA 3HU1A 3ETLA 2ZU0C 2VP9A 4FN5A 1Z6GA 3A36A 4MUBA 4LBVA 2YJTD 4ZDWA 3T1VA 2QTFA 1XB2A 3RWOA 3QQ5A 1YKSA 1Z0IA 3C7KA 4JBYA 2ZS9A 1MRNA 1NNEA 1X8LA 3PUYA 3VX3A 1CEEA 5EP4A 4BFWA 5GJBA 1CRQA 4X8LA 2PZGA 2IK8A 3GLGB 4LY6A 1P9RA 5EE0A 3U7FB 2AWOA 3RHFA 3U60B 2XJ9A 5HPYB 2ZITA 4LPSA 2XSZA 2XTNA 5KO2A 3LLUA 4RCZA 1OKKA 1P2UA 5EZ6B 3LBIA 5LPNA 3GJXC 1E2GA 3RWMB 2GBLA 3VR4A 4NYMQ 4GPTA 4UKDA 4MYHA 3ND9A 4WA7A 3B5JA 4DHEA 2Q6TA 4Q9HA 1R2QA 1GZSA 1NLYA 3QVVA 3ZVNA 4HATA 2MSCB 4TL9A 4HAWA 3K1JA 5CK4A 2AXPA 1Z6YA 3ND8A 2WWFA 5KSZA 1OXTA 4LBYA 3ZZTA 4HZUB 4NONA 1MO5A 1Z63A 5E7JA 1UM8A 4Q4JA 3W6OA 4CF7A 4F4IA 2QEQA 4MA4A 4EFNA 5KDLA 2KB0A 1PZNA 1ZM9A 5F9HA 2F3TA 3BH7A 4Q7KA 2PMDA 2IBMA 1VG9B 2IYRA 421PA 4CZ2A 4JBXA 2F1RA 2P6NA 3QG5A 3ZDQA 1FX0B 3P26A 4IDPA 4M2LA 1T8TA 221PA 1AS3A 1XXHB 4L9SA 3Q72A 5HCNA 4NE2A 4RD6A 4RD0A 4C0JA 2RHMA 3CRRA 3RRYA 3K0EA 3JVVA 5EP2A 1R8SA 4YMUA 4B3GA 3BGWA 2HT1A 3NBFA 2QNRA 2W83A 5HE9A 4EPWA 1NSFA 2WJIA 4R2HA 4RJLA 2J45A 2ZYVX 2IHYA 4AIIA 5FBVB 5J5CA 4XIGS 4BGDA 5CM9C 3A6PC 1SXJD 2GAAA 2YWHA 4DB2A 3H2YA 1NG9A 1GRNA 1YR8A 3JZAA 4XSGA 1P2SA 4FINA 1CXZA 2NMVA 4PZLA 2ZSAA 4TQUS 4M1WA 1G8PA 1JR3D 2QBYB 1NRJB 1YQTA 2UZ3A 5UKDA 4Q18A 1HYQA 1SXJE 3TSWA 4MQBA 2ODNA 5GJWC 4FXPA 4MDEA 2O8EB 1U2RA 4DCSA 5FTLA 3TRFA 1S96A 1U98A 1SVKA 2DPXA 1S0UA 3DHWC 3HR7A 5DH9A 1CP2A 1TQDA 1RZ3A 4Q4LA 5GVSA 1GILA 2WMOB 4NTZA 4A2QA 5FL7D 3KKPA 2ERYA 3FMOB 2IX3A 2H17A 2W0SA 3BOSA 4EQ6B 1KSFX 4C0HA 3A1VA 3L0OA 3W34A 4GOJA 2GKSA 1NMYA 4I4LA 4IRUB 3A4MA 4Q1DA 1XU4A 2GRJA 2J46A 1T0JB 2GEDA 4GZMA 3NHAA 1G5PA 1NY5A 1T9HA 4PHFA 2Z0MA 4WZAE 1NLZA 2ANCA 1OHHA 2W6JD 4TLAA 5EE5B 2XGJA 4PFSA 2BIFA 2H16A 4EJSA 1KI7A 1ZBDA 3EWSA 2VHTA 1D8TA 3C16C 3DKPA 1SHKA 2CK3D 4WZ6A 1Q1EA 1L4UA 2BKUA 1L2TA 5KDDA 3UMRA 5AUPB 3RRMA 2W6IA 3AF1A 1WRBA 3TVTA 4OI2A 3EA0A 3QXXA 3A1WA 3GPLA 1HEIA 4I99A 1F3OA 2PL3A 2XXAA 1A82A 2CHVA 3LX5A 2JAQA 2OBLA 5KYKA 1KK3A 3OESA 2ZI9A 4PTLA 5FBWB 1GL9B 1N6KA 2AHOA 2Q3HA 4L15A 5A4JA 1P9NA 2QT0A 2O0HA 1KK2A 1ZP6A 2HLDA 5EUMA 2BCJQ 5J4VA 4C4PA 4D0GA 1QHGA 1KI6A 4P33A 2BWJA 5DN6D 3IGFA 2KBFA 4ZIRA 1Q0UA 2PJZA 3L0SA 4IEIA 2YC2C 2BC9A 2IYQA 1F60A 4NHOA 1VG0B 2P3SA 1IN8A 1GAJA 1XTKA 5KSOA 1IY2A 4CRWB 1E9AA 3DO6A 3ZZ0A 1CKEA 2WWYA 2DB3A 1X3SA 4Q48A 2IF0A 3LA6A 2J0VA 1ZW6A 2OCPA 2Q9CA 2V6IA 1JI0A 3H4MA 1GM5A 1MRSA 2I1QA 1AK2A 1KSHA 3IPXA 3QENA 5DN6A 1FP6A 1OE0A 1OPXA 1SXJC 5CITA 1COWA 4YQFA 4ABYA 3KQUA 3WYGA 1G16A 4JKIA 4KLZA 4L8GA 4PR0A 2VHQA 2ODBA 5DLQC 2JDID 3ZJYA 5AUNB 4S2EA 4O25A 1X8KA 1W2GA 1V5WA 2FPKA 5JJIA 4NYJQ 2QMOA 5CDFA 1GWNA 3UANA 3MAAC 2DWQA 3CRQA 4AWXA 1GNQA 1SKQA 4R2IA 3T1QA 4TYNA 1AQYA 1QHHB 5LB4A 1KNXA 2CCJA 1IN4A 2FZLA 2CE7A 2W2XA 3U7GA 2CVHA 4AY2A 1HT1E 2WJYA 5FFMA 2FFBA 2PX0A 4KO8A 3KQLA 4XSHA 2QMEA 1H8EA 1RJ9B 2NO7A 2QPOA 2XOKD 1EFUA 1E2MA 4PXAA 4PO8A 2GHIA 4WOPA 2OG2A 1TL7C 4NCKA 2ERXA 3GLHB 3VX4A 1A1VA 4L9WA 2IXEA 1U94A 4G5RA 2KE5A 2FX3A 2E9SA 1KMQA 3L8YA 4LX0A 3K0SA 4BFVA 3IKJA 1WF3A 3QXHA 3SZRA 3DM5A 4P0TA 4CEJA 2F55A 3OF5A 3RS0A 3U7EB 1KI1A 3GJ3A 1UADA 3CF2A 3NC1C 1EG7A 2RGXA 1QHXA 4BLRA 3U6KA 4O0MA 2A7QA 1U9IA 2ZE6A 3FMIA 1IXZA 2OFOA 1ZU5A 1UBCA 2QZ4A 2VP2A 4B47A 4JSTA 3VKWA 5DNYB 3UK6A 4PAMA 2QU8A 1KI8A 4DSOA 1U9IC 2H5EA 3TNFA 4B2LA 4QHYA 4DDVA 3EWAA 1BOFA 4YMWA 5GADl 2ZRJA 4M1SA 2GJ8A 2ZJAA 5C46F 2G6BA 1OFHA 1R0YA 1VIAA 2WPDA 2ZVQX 1Z0JA 4URVR 3KTAA 4TMZA 3AVUA 1D9XA 2YZ2A 1R0ZA 2GTPA 2HDNB 3PQCA 3Q3JB 3VR6A 2JLYA 3R8FA 4UQOA 3IEUA 4Y0AA 1QHNA 2RHDA 4LYAA 1US8B 4IKEA 1D2EA 2DHRA 4PHGA 4KCGA 5KTYA 1N6LA 4HLDA 5J4YA 1KDTA 5JWHA 5FUVA 1I2MA 4JIMA 5CB6A 3ADBA 5TY0A 2VSFA 1TAGA 1ZAKA 2ZJYA 1NKSA 4YMVA 1MV5A 1RRGA 2D2FA 4POAA 4M1KA 4BLTA 2RGEA 2A78A 4JLPA 2ORWA 3OZXA 4ZCMA 4DLSA 3GLHE 3X1YA 1K6MA 2XZLA 1Z07A 1RJ9A 1E2HA 3T12A 1FUKA 2WSSA 3HU2A 3GJ8A 3REFA 3ASZA 1IOZA 1SHZA 5JRZA 4FD2A 4D81A 5BWMA 3CWQA 5SZKB 1XF9A 2XAUA 1TTTA 3BERA 3MWYW 2D74A 2Q9BA 1G3IA 4DEXA 2WKQA 2C98A 4HB3A 2IF2A 1EFCA 2QSYA 4DT1A 4CGZA 1XPUA 2CNWD 4KLNA 5FPKA 1H8HD 1TPZA 1HQCA 4C0QC 1A2BA 1K5DA 3VTKA 4PZZA 2WWWA 3AF4A 2VIIA 1HE8B 1VG1A 2H57A 1G7SA 3NKVA 3O47A 2REOA 2IXFA 3LNCA 1ZINA 2ZJ5A 3M0EA 4CDGA 3TE6A 3CR8A 4NCIA 5TDHA 2EFHB 4ARZA 4UNRA 4Q9KA 4I81A 1KHTA 1SVSA 3ADDA 1E1RA 3C5HA 4IFBA 4LJ8A 1HE1C 1W5TA 3CPJB 4W7SA 1Q1BA 1Q1ZA 2CLCX 4JLBA 4ZDKA 4URUR 2WICA 3GLFB 3ZZUA 1R4AA 2GZAA 3BFKA 4A8JB 2B7BA 3U3JA 1X8JA 4G5QA 1W36D 2X8AA 1D9ZA 1OW3B 3AP1A 1FFHA 1P9WA 1UKZA 1VYTA 1KO5A 1KAOA 4LJ5A 2F1HA 1XX6A 5M04A 4TTPA 1R0WA 2CHQA 2ZRDA 4CEIB 1JB1A 2AFIE 4JYCA 4DC9A 1AN0A 1ZD9A 1FW6A 4XWAA 4Q4HB 2BMFA 3M4YA 4C2TA 4XOIA 1DPFA 1P73A 1N6IA 3CNLA 3BFVA 5JWOA 1QVRA 4NCHA 3VNUA 1DADA 3U2QA 5G3ZA 3THYB 1OFUX 1XMVA 1Z22A 4AD8A 4R71A 4WW0A 1NMZA 4V0NA 1FTSA 2Z4SA 3AVYA 5JBQA 1CIPA 3RNLA 2VP4A 2WMNB 1Z08A 2WPDD 5EP1A 3N2EA 4QL3A 3KB1A 1S9DA 2IL1A 3PXGA 621PA 3U7HB 3FKSD 1E2NA 4AYXA 3CKLA 4OKSA 4TMKA 4CEHB 2ZAOA 2ZUBA 2QTVB 4OQXA 2J7KA 3K0AA 4Q02A 1JR3E 3H0KA 1XXHE 4G1UC 2JATA 1GNPA 1ESNA 5F98A 3KB2A 4CIDA 1VCMA 4B44A 1PUIA 1ZD8A 1FQJA 4JL8A 2FU5C 2V1UA 1E9SA 3FFAA 1G20E 1Z06A 2VL7A 4L5BA 3RABA 1IHUA 2OBMA 3GLGE 2ZRIA 2EWWA 3PFIA 2QT1A 3BC1A 1GL6A 4LDJA 3QI2A 4LSGA 2ZPTX 2IUUA 1GOTA 1WBDA 1NVUQ 1AKYA 2G1JA 1MKYA 4RKFA 1KY2A 1LS1A 1NF3A 1OYWA 1UDWA 1JPJA 2R6DA 3IQWA 4IOLA 4KAXA 3ZVLA 3KQHA 4QJ3A 2J0QA 1BYUA 4B3XA 4BZXA 4IDQA 3Q5EA 4BE7B 3PEVA 5FOVA 1COWD 2P65A 3VR2A 2FE4A 1G5RA 4ZPXA 4FMBB 1HV8A 3J81k 2DY1A 3NDPA 1ZCAA 2RGNA 2O0KA 2HV8A 2W00A 2JASA 5FL7A 2FSFA 2MSDB 4NDZA 3IHLA 4EIWA 1NI3A 2XEXA 1ZNWA 4OK6A 3K9GA 1EGAA 1WDTA 2GXAA 1F5NA 3AB3A 3AP2A 1S1CA 2QUZA 4EPRA 4GT1A 1LFDB 1QBKC 3CF6R 2ANBA 4IFEA 3THYA 5KOYA 1E2KA 2C78A 1FZQA 2XX3A 4AK9A 2IYXA 3GFOA 2EVWX 1XEFA 2OXCA 3QEOA 5FUYA 3MSXA 3GFPA 1SVWA 2GBLC 1AKEA 4RFSA 4Q9JA 4CYMA 1PV4A 2RCNA 1DVRA 1NBMA 5BW8A 1X86B 5L3QB 1KI4A 2WOJA 2J0SA 2VP0A 2QAGB 1TADA 3PEUA 4P4TA 1M1YE 3D8BA 4FMDB 4Z51A 4DLUA 1AGRA 1SKYE 2GILA 4QG7A 2YNMA 1FOEB 3GLGA 3VKHA 4UJ3A 3DZDA 1E9CA 2HLDD 4FIDA 4R98A 5HTKA 2EWVA 1NLFA 5CJ2A 3A4LA 4XD7A 1G8FA 1Q44A 3E70C 1XPOA 3E1SA 4BLSA 4I1VA 3EA5A 2A2ZA 2ZQ5A 2ZRLA 4V0MA 1PLJA 2ZE5A 2FF7A 4BFTA 3B9QA 1NMXA 1E2QA 5B64A 3OEED 1IJEA 5CYPA 2GETA 1E3MA 4HI0E 1GDDA 4JZKA 2TMKA 1GIAA 3CPHA 4GL2A 2GZHA 4KBGA 2C95A 4Q66C 4NCNA 4HLQB 1NN3A 4XVRA 2B6HA 1WA5A 4D0NA 3KKOA 3U44B 3U61B 2CXXA 2IUSA 4OHWA 2ZJ8A 2GK7A 4HAYA 2D7DA 4YXWA 2IHBA 1R5NA 3LW8A 4M1YA 2P6UA 1G4AE 2A9KA 3EIEA 3PITA 4Q21A 4UNQA 3FWYA 2WJJA 2XZOA 1OXVA 4YDSA 4NZYA 1U0JA 2FPMA 4LJYA 1TEVA 5EXPA 4JT4A 3TGPA 3EXAA 3QBVA 4TMXA 2GEVA 2P5TB 4TYQA 3UMFA 1EWQA 1JAIA 5FBRB 1L8QA 1OKKD 1Q1QA 1XWIA 5IHPA 4RD3A 1N5KA 4WIAA 1FMJA 1PLKA 2GVZC 1N6PA 3EZ6A 4OHZA 2A5DA 4FCTA 4MGIR 4TQ9A 2N46A 3SEAA 1YRAA 3PEWA 4EKDA 4DRZA 3CW2A 4BZQA 1Q21A 3I5XA 2CHGA 3NBYC 2GJAA 821PA 4BLOA 4ZDIA 3AKDA 2BDTA 5DI3A 4ZI2A 3SBEA 3RRZA 3TIFA 1DAEA 4FWTA 2C9OA 1QRAA 4GMDA 5LBIA 3U3OA 1Z2AA 1XCMA 5AUOB 2WV9A 2X2EA 1G3UA 1N6NA 5DI9A 1YR7A 4DLZA 2QBYA 4H1VA 3V4RA 4OI1A 3E2IA 3ZLJA 3QPUA 1WE2A 2P2LA 2AK2A 2AR7A 4LGMA 1P60A 3SOPA 3KKNA 1G19A 1VECA 4C2UA 5KHOC 2A5FA 2IUTA 4HDCA 3UMSA 2F9MA 2I3BA 2AXNA 2VP6A 2GDJA 2YHSA 4M53A 4GI7A 4N3NA 4IOJA 5JCPA 5H1YA 1NN5A 3U44A 4MGKR 2FFHA 4NMMA 4LPKA 4ESHA 3L8ZA 4QGAA 3WYAA 2GJKA 4DCUA 1G21E 2VF8A 1T3HA 2FDCA 4C0KA 2ZRMA 121PA 1ZUHA 3FTQA 3KFVA 3OEEA 2V3CC 2OCYC 4M9ZA 5EE3A 3NTUA 2AK3A 3MJHA 5L3SA 2AFHE 4IOKA 3SHFA 2JLZA 3BH0A 2XTMA 2OLKA 3WY9A 2ZANA 3B1XA 4PAOA 3RYTC 1S1MA 4QRHA 4GSYA 1NBME 3C14C 4MGZR 3D3QA 3LX8A 3QKSA 5DO9A 1YVDA 1Z0DA 3FHOA 1JALA 4URZR 5JCZA 3O8DA 1CULC 2WSSD 5H68A 1H8ED 4W5JA 4Q9LA 4KYIB 1X1SA 4WAUA 1T3LA 4ZIRB 3N2IA 3AVPA 2ZETA 2IYUA 4PC1A 3FFBA 4IDNA 4A1FA 1CTQA 1W1WA 3EIHA 2J3EA 4I1UA 4NL4H 5AR1A 4AG5A 3VU9A 2C9CA 3CONA 1A4RA 3OIWA 4M4SA 3P27A 4PC3A 4LI0A 4GDFA 1QG4A 5K8TA 5K8IA 1JR6A 3AVOA 4C0SA 4F91B 1Q3HA 1HH4A 2QSZA 4D25A 2WHXA 3B7GA 3AUYA 4B35A 4TYYA 4RZ3A 4HAUA 3B60A 3ONWA 3CB4A 4QM6A 4NYMR 3DEFA 3MJRA 3PUVA 4URXR 4OI4A 1Z5ZA 4A2WA 2JIZD 3B9PA 4KVGA 1NVVR 2MSEB 2IYYA 2XNSA 1PVOA 2JLXA 4LYFA 4HZUA 4A6PA 2ZSBA 4RD1A 4BZPA 5A0FA 4LWZA 4RZUA 2OUKA 5TMPA 5KNDA 2BBSA 2H8KA 4LHVA 2CVFA 4O2RA 2DBYA 2EYQA 3D6TB 1I4LD 1C9KA 5FTKA 5KSYA 4OQMA 1XXHA 3ZH9B 4US1R 2QE7D 4NBSA 4Z1MA 1KTVA 2NIPA 2GXUA 3QVUA 2XZPA 1CBUA 3KQNA 2PH1A 4YMTA 1YJ5A 4RZ2A 2VSOA 3RANA 1MR3F 5HKKA 4LJ6A 1KSJA 2AD5A 3TUIC 4TYWA 2PT7A 4Q1FA 3JZMA 3HDTA 5JMTA 5FUWA 4LJ4A 1XZQA 1VYUA 1GITA 3K0FA 1DOAA 3FVQA 4TT3D 5BN5A 5HKKD 3FMPB 1EFTA 4OHXA 4JL5A 1FPMA 2AL7A 5E4FA 4UXIA 3NXSA 4ERNA 4MRSA 1WMSA 3WXMA 1RKBA 4QNRA 2WAYA 3TMKA 4JVMA 4B3FX 3Q85A 3KTAB 3WHKA 2C03A 3QPVA 4JLMA 3RSOA 2PT5A 3L82B 2PCLA 3EPJA 5JJKA 4F92B 1VPLA 2F43A 3MCAA 1KNQA 1X6VA 2OEPA 3WYFA 2BM0A 2WIAA 3SHWA 4EDHA 4OI0A 1JPNA 8OHMA 3DDCA 2X77A 2WWIA 3W6NA 3QPWA 4LV8B 3L0IB 3X1XA 1T5LA 1ZVQA 2WOOA 3AP3A 4WXPA 3AF3A 1EFRD 5D3MA 1CJKC 3MD0A 3KKMA 5FOUA 1JBKA 3HJNA 4RFVA 3CF0A 5FR2A 2ZRKA 3DZ8A 3AGQA 4M1MA 1BS1A 1OH7A 1UBEA 2QENA 3I4LA 3TBKA 3UXMA 2OFXA 4U02A 3K53A 4IOMA 3LY5A 5GJVC 4KFRA 5E3HA 1AZSC 5CIWA 4Q4AA 2VF7A 1UFQA 4JJKA 3QJYA 4MRRA 4NH0A 4IVPA 1T6NA 3A1TA 4PPGA 2ZYUX 1RC8A 2VBCA 4O2LA 4E5UA 1B23P 1E0SA 1O3YA 2FGJA 1HQYE 1NIJA 4YLGA 5EE9A 1D6JA 4BASA 1G7CA 3CRW1 2F7SA 2GCOA 1LY1A 1AGPA 3R20A 4MKIA 4XH9B 3WP0A 2QPTA 2JLVA 2O0JA 1VG8A 1KJWA 3I3SR 1VTKA 4NYIQ 1LTQA 3NH6A 1E1QD 5TVKA 3CWZA 2E87A 1SULA 2BBTA 4HB0A 2OCAA 3FKQA 1P3JA 4MKGA 2OFWA 2ZYWX 3CRMA 2B7CA 2W0MA 1J8YF 2RGNC 4GP6A 2WZQA 1IN5A 4MYTA 5CLQA 4F4CA 2EU8A 1O87A 1S9HA 4GBMA 2DFTA 3VAAA 1CRPA 3FHCB 4A4DA 5CYOA 1QHYA 2C77A 1UEJA 3DOEA 3GP8A 4OBEA 1Z6XA 3NEJA 4ZDJA 1XTQA 4DEYA 1LF0A 4DCVA 2AX4A 4AI6A 3BBPA 1E79A 3HPQA 4NYIR 3AH8A 1Q20A 3EZ2A 4RZXA 4W5HA 2IW3A 4DSUA 4Q9IA 3WNCA 4QBGB 3GLFE 4XWKA 1KO4A 3WBJA 4PHHA 1KMHA 1NSTA 1E2JA 2ZRCA 4N0DA 2WWHA 4QGGA 1P75A 4JLNA 1FNNA 3THXB 4U5XA 3LXXA 4A36A 5C4MA 2P0EA 1GNRA 4HAVA 3B2EA 5KSPA 1KO7A 5BXQC 2H92A 1I4DD 5KU1A 3B1ZA 3TW8B 4HZIA 2C2HA 4KITB 1XJQA 4HB2A 2GA8A 4G5SA 1AQUA 3KX2A 1GKYA 1G6HA 4B3CA 1OYYA 4IXMA 4EFMA 3AVXA 3NVAA 1W4CA 1MO3A 5F9FA 2QTHA 5SZJA 3RS3A 3SJBA 1E9RA 3NG1A 3A37A 1S4QA 2RMKA 3PEYA 2H7VA 2VO1A 3OHMA 1DE0A 1NVWQ 4HLUC 3P4XA 3BRWD 2O8FA 3IO5A 3QXCA 1XRJA 4E07A 1KO8A 4BQSA 2HYIC 1LB1B 4M1OA 2RGDA 3QE0A 4C0LA 1GFIA 1SVIA 4BUJA 3EZFA 1N0VC 5LD2B 1IJFA 5HZKA 4JVNA 3B78A 4LCBA 1U81A 4TQAA 2HCJB 2IA5A 2XNDA 3PUZA 4DSTA 4F38A 3S1AB 4C9BA 4C0AC 4JKYA 1WXQA 2OHFA 2BJWA 4QOSA 4TL7A 2D62A 2FGKA 3R9XA 1N5JA 3SJAA 1EX7A 1K5GA 1WQ1R 5KPDA 3BB1A 2G77B 1JEEA 1G64A 1IAQA 5E7MA 3HPRA 5CDFE 1HT2E 4M9QA 2DFNA 1W0KD 2WKRA 2FMXA 1S2MA 4YXWD 1E9EA 1N5LA 3T1OA 2EW1A 2NO1A 1QHSA 4B76A 3EX7C 2NG1A 2FFAA 2GAOA 4M9SA 1YR9A 2QGZA 4LBWA 4TN1A 3RC3A 2RKOA 5FBQB 3WP1B 2GWHA 3CIOA 2ZVPX 3B82A 3OE7D 4TMVA 3U4QB 2N42A 4TMWA 1IM2A 2V55B 4KSCA 1D2NA 1XEWX 2R8RA 3AKYA 4DDUA 2IYLD 2CL6X 1N6OA 1VKJA 4RKEA 4S35A 5ANRB 2W2TA 2W2VA 4NU0A 2VHJA 2ZJOA 5DISB 4F7WA 1SKYB 1F2TA 5GJCA 2J9RA 2J0UA 3U5ZB 3TQFA 2P67A 4DUGD 4MYUA 1KIMA 5G40A 4XD7D 1OLOA 1YR6A 4B3DA 3AM1A 1E9DA 1WP9A 3K09C 3IDQA 4OJKA 3I72A 4BEJA 2Q9AA 1ZCBA 1CR2A 5TV2A 1VHLA 4LHWA 5KPJA 2ZS8A 2HEIA 3EW9A 3SR0A 3ZYCA 2VH5R 4QJ4A 3UWOA 1L7VC 2ONJA 3THWA 5H70A 2A30A 3UG6A 1M74A 1N0WA 1DEKA 4DLWA 1J7KA 2QRNA 5DHFA 1CR0A 5DYGA 4OHYA 1EFHA 3GLIE 4KI0A 1KZGB 1Z28A 4PQRA 3QNUA 4XVUA 1KKMA 3AV0B 5EE1A 1ZUNB 1CJUC 1MO4A 2WWXA 2IEZA 2ZJBA 2XB2A 4BRUA 1N2CE 1RPZA 2R6AA 2I1VB 3TR5A 1HTWA 2O8FB 3ZS8A 2DYKA 2ZR0A 3AVTA 1UKYA 4HDQB 2HJVA 4FMCB 2QGNA 2A5YB 1W36C 2XB4A 3LQQA 5CB8A 1GVNB 1ZM3A 2V6JA 3KXIA 1XTRA 4UXHA 3W5JA 5JSZB 3W3AA 2FV8A 4A0GA 2B8WA 2JEOA 2CJWA 1JXOA 3MFYA 1OHHD 2W6JA 4QC2A 4LBZA 5FPSA 2ATXA 1Z29A 4BEBA 1F2TB 1AM4D 1BO6A 5FTMA 2VTKA 5FOTA 1W0JD 2NO0A 1P2VA 2WWGA 1ZRHA 1TX4B 3QUSA 2O8BB
chains in the Genus database with same CATH superfamily
2UYYA 1E2PA 2HA6A 3HACA 6Q21A 1LDYA 4D96A 4I1SA 4UARA 2XWPA 1M2FA 1NMQA 2XKAA 3KQYA 1S8FA 1GP2A 1XCLA 2VAMA 1PKEA 1II8B 2R7LA 3DV0B 4GRAA 1SQ6A 2FSVC 3CNNA 2B2CA 4PC2A 4TKVA 3BYZA 1M1UA 3L4EA 3GGPA 4FDLA 5IT5A 2BLNA 2VJOA 1M34B 3QMMA 1OWNA 4GGMX 1ZLYA 4HK4A 3R8CA 5IRCD 3F0TA 1SBHA 1AQLA 4LE0A 3B13B 3BIOA 4NCAA 2JW5A 2PIDA 1OAOA 3BS4A 4BFXA 1W36B 4MAFA 1TEHA 1T5IA 2D0OB 2F3RA 4OK5A 4Q01A 4BCDA 2L18A 4LCEA 4ZKEA 3IAFA 1V8PA 1RHQA 2J6CA 5D00A 4GI1A 4P7GA 2C4HA 2NQ8A 5E95A 3GGJA 5BYAA 4CETA 1G5TA 1P5ZB 4FFVA 3OM8A 4JX9A 5LC1A 4MVJH 2PMEA 4Y2TA 1QH8A 3FFXA 4F8JA 4G5FA 3E48A 3ZJ4A 4ESEA 3H05A 3OH8A 2B61A 1VIYA 2H5LA 1RQPA 2AUMA 3CEPB 5LZ4A 2FNAA 5E4YA 5H3LA 2AE1A 1N78A 3K70D 4C89A 3ESXA 5JG7A 4B3SB 3HFGA 4QECA 3D8UA 3RJZA 2D54A 2LCQA 3EEIA 1SC4A 1QZTA 3S8YA 2PEZA 3ZVRA 1Y7TA 2IQIA 2WIDA 4LX8A 1KETA 1WNFA 3DF7A 3I76A 4EO7A 2KLHA 1ETHA 2P4QA 3CIFA 5AJWA 1YK1A 3EZ7A 1TQ6A 4EFLA 3R9WA 2BCEA 3S5UA 2JBAA 3EVAA 1A50B 4AYWA 4HVCA 5DI3B 4UQLA 3KJEA 3AUKA 1ODSA 2GN8A 4KDFA 3ZWBA 2I4MA 2MINB 1Q7CA 1Z8NA 2CCKA 1MH9A 5EMJA 4DLLA 2Z83A 4NU8X 1N8SA 4Q93A 4QUJA 2PE5A 1I7SB 3OZEA 3WAKA 5BOSB 4RLHA 3H6HA 1ABFA 1N1DA 2VK4A 4YCMA 4O2BB 1PD1A 3R3JA 3BE4A 2FETA 3QF7A 2O2XA 1THZA 2D0PB 4A92A 2XUAA 5MGBA 2YWFA 1E5VA 2WJZB 3W3AD 3T1HB 1E2LA 2G80A 3A9SA 3NFYA 2HWYA 3L6EA 3ND5A 4X84A 1NTOA 4Q7JB 2B5WA 1ZEJA 3NBUA 4HFNA 4CM4B 1K1EA 1XCJA 2B78A 2PKRA 3IA2A 3P97A 3VQTA 3NPMA 4UNSA 2VQFB 1QJ4A 2CF5A 3DFMA 2ISQA 3UJBA 1Y1SA 3BXEA 1X9IA 5KX5B 1FYEA 1CJVC 1ZMXA 4P82A 1YZVA 1H6CA 3AU8A 1JIIA 4Y8VA 3TSCA 2WE8A 2Z2IA 3A6DA 3NNNA 4ZCLA 5EEGA 4D0LB 1R7RA 4WZBB 1JEDA 2Z1MA 5HDBB 3JATA 4AJKA 1U5BA 4N82A 4QDTA 1AUOA 2Q3DA 3OCUA 3QU5A 4AMYA 3HUFA 5JSHA 1GTJ1 3KVVA 4OQLA 4V02A 2C2OA 4O4LB 2HSJA 2Y68A 3F5FA 3ZG6A 1XBTA 1MABB 3SEFA 5LP6A 5JE8A 1EXMA 1DAIA 3D5TA 3TSAA 3G3EA 3VKGA 1VGQA 2GN6A 5JEEA 1XT6A 2ZBDA 4CM8B 4K9NA 2DY0A 5LIRA 5HS6A 4OYHA 4OLHA 2FSSA 4XJXA 1RYDA 5I3CA 1B8PA 3HJAA 4K9DA 4NC9A 3JXEA 4U2FA 3ANTA 4B43A 2VPPA 1M34A 3IP3A 3QZUA 4F8EA 2NT3A 1QCYA 1EGHA 3O4JA 1A4IA 5GZ1A 4Q00A 2J7PA 1NL3A 3TRHA 2L0XA 3WQBA 4KVFA 3SS8A 3MS2A 3WL6A 2DAPA 1W4ZA 2OB1A 1H65A 1USVA 4ILKA 2E37A 2JHCA 5DNDA 3TBFA 3ZE1B 3SC2B 4C4AA 1RQLA 1EHCA 2VS1A 4ATNA 1XZ8A 3FROA 3GFFA 1AURA 2J3QA 4E30A 2XGGA 3QIVA 2IWRA 3VR6H 3G0HA 1AKRA 1CJCA 3DDOA 1RJWA 3L6CA 3RR2A 3DXZA 5JLJA 2I78A 2OV4A 3H7AA 2XAAA 4NZMA 4YAWA 1FZTA 2PZMA 1VCNA 2J3MA 3NOQA 5H9VA 1HLPA 1S7GA 2Z6VA 1X7YA 3N0TA 3QYPA 1M2OA 3JWHA 1E1KA 4U7DA 5AXBA 2MR5A 5KTMA 4BX8A 3HYRA 3EH2A 5CURA 1XOIA 4KN5A 2X0FA 4PAGA 2B8TA 1WD7A 1N2GA 3COZA 3KFXA 3DDSA 2HFKA 2REXB 5FLKA 3RDPA 2BM8A 2NTYC 2QF7A 5KU7A 4Z54A 2ZRGA 4QXRA 2B9EA 1JBEA 3BIXA 4H08A 4QNMA 3PC8A 4CCYB 3CINA 5BUCA 3WR5A 4AMVA 1MORA 3STVA 4YGXB 5ALKA 4JYZA 3FOAA 2AG8A 5BSEA 3V4LA 1W2HA 5M34A 2H4ZA 2ODWA 4FHGA 1U0BB 1USUA 1N7IA 1ZVMA 1RM3A 4KHZA 4OMDA 4P80A 3RW9A 5FI1B 3VHXB 4K81B 1SJ9A 5FKJA 2ZI4A 2R0QC 2AH5A 2VYVD 4TVOA 2PS1A 4JS0A 5IWAB 3DO5A 4Y2XA 3PE6A 1ZN2A 3FSGD 5AOAA 1V8OA 3LK7A 4KG7A 2ZIAA 3MUFA 1U8UA 1IBKB 2ZCUA 3L7LA 1JDUA 4BFCA 2VKTA 3JZDA 2ZCJA 3QX3A 1P17A 4G0WA 3RBZA 2ZTLA 1NR7A 3DVLA 1W0CA 3DE2X 1XZKA 1YD7A 3A14A 4BNFA 2XOKA 4HNGA 4Q4CA 5A02A 4I1PA 1UDXA 5EFOA 3CNBA 1TQ8A 5F3RA 3RYHA 4BO6A 1HSZA 5JR3A 2FWNA 1GZ5A 4TKUB 4BNYA 2EFJA 1UMDB 2VN8A 1XJ0A 2AOUB 3IB3A 3WGKA 3VKFA 1O0CA 3RUIA 4C30A 5T41A 3L0CA 4MVJM 5LQMA 3AY6A 4FWBA 2AVNA 1ZICA 3PTLA 4ASUA 2ZE7A 4AMZA 4DIUA 1XD2A 3I6IA 1MW9X 1FE8A 3NWPA 3VOSA 5FOQA 1XVVA 1MQ9A 3CZAA 3LBNA 2AQKA 4FYPA 2R7KA 3CX6A 1ZGJA 2O3SA 2MMCA 4KWEA 4KIWA 3W5CA 2HNKA 3MCZA 4EUHA 1U7UA 3N2ZB 3LKVA 2AG5A 4P8RA 4Y2HA 4B2PA 4I4NA 1IDOA 1O57A 5JCJD 2F9FA 1TYZA 4R1LA 2X9VA 4OXRA 4IS3A 4ZVQA 1SCUB 1M72A 1YZ3A 2ECKA 4MUNA 4F5EA 1WB9A 1ADFA 3TB6A 1A69A 2X9GA 4IXWA 4MDHA 3T0GA 3E3LA 2WU4A 4R2KA 1TT5A 4Y2JA 3BGIA 4GM1A 3CM0A 4XVQA 4DW8A 3I6YA 1OX5A 4JLVA 5LMCA 4JI7B 1DBSA 4K9MA 5P21A 5IZCC 3KZ1E 3NHZA 1XZBA 1J0AA 1D4ZA 1NZFA 2FXVA 3R5KA 4OGGA 3ITEA 1PL6A 1RTTA 1V4NA 2W2LA 4DXDA 2QNBA 3NAQA 2PN1A 3KELA 1G3RA 2ZBRA 2Q6IA 2DHCA 4J03A 5CRIA 1E98A 3WWOA 5IBQA 1J2RA 3H99A 2YRFA 1P7CA 1GDHA 5KINB 4KV9A 1EDZA 1YZQA 2V5UA 2OECA 1LLCA 2PGDA 2P9ZA 4NZOA 4JODA 2E1RA 4IUBS 3EDCA 1CR1A 2X0RA 3CF4A 3N58A 5IMBA 3U9SA 1IHXA 2WU1A 3OC6A 3HM9A 4YJKA 2YZKA 3IBFA 3K0HA 2GN1A 3FTNA 1EG2A 1CF9A 3DLHA 2ZUCA 3EVGA 2XWQA 3OG9A 3QBDA 5CTAA 3PCTA 3Q6MA 4MUYA 3KQKA 1D4AA 2FMKA 2ACVA 3A1EA 3E2PA 2QTLA 4Z7QB 1N3BA 3VHXA 1EX6A 3ANLA 4DNOA 1NKTA 2W58A 3EIQA 2XMDA 5T64A 1MXFA 2EX1A 2QLLA 4V0RA 3D6AA 3OE1A 1P72A 2QSJA 1MNQA 3TPZA 1QKKA 4RANA 5E9WA 3UMVA 1QZXA 3SVTA 3KSMA 3OCVA 3OLXA 5ECGC 3V4SA 1RPTA 4ZAGA 4R8MA 4YR9A 1A7AA 2BI4A 1M73E 1OWMA 1K06A 1V47A 3A04A 4OQFA 1IIRA 2X19A 3SIRA 1EK2A 1UPFA 2ZRBA 3O3OB 2WNSA 3F90A 4TM8A 3K5WA 3ZZMA 5CYGA 3S2IA 3OJ0A 2C3MA 2FUG6 3OKFA 1IVYA 1E2EA 2UKDA 1KEVA 4WNCA 2WLSA 2GF9A 4PSCA 4RLSA 4RV4A 3NTOA 4WWHA 4QVGA 5B3JA 2C5LA 4ALIA 3NFRA 3O8OB 1HO3A 5TVGA 2JI9A 3A25A 4KQ9A 1V71A 2YMQA 1DUIA 4ZCQA 1EBBA 3G7SA 2I6GA 1FFGA 3VU9B 1M5RA 1R27A 2G04A 3D3KA 1PUJA 2JAOA 1ZK2A 3BIWA 3BPSA 2VYNA 3FHLA 2QLTA 1LK5A 2PLFA 4FYIA 4X24A 1X42A 3PQ8A 4JJ8A 2NZXA 5HYVA 2PXXA 4G86A 5B4UA 2D1QA 4MKHA 1EVQA 1I32A 2G88A 1Z0KA 3NTQA 2SBTA 2Q3LA 2ZBEA 3I39X 2R6GA 2GERA 5FXMA 3WLMA 2LKDA 1J8QA 2F8MA 1ZGAA 2X40A 5EHZA 2P9FA 5A05A 1KKLA 2VJCA 2X5KO 3UHAA 1FRZA 1RWVA 1X9HA 4C0WA 1YB1A 4LE1A 1SZDA 1YDWA 1LKZA 3KUDA 4E6PA 3EASA 5BSFA 2A3RA 1E1QA 2QJWA 1WR8A 2YS6A 1YRYE 5IT9A 1N36B 1N75A 1EWRA 5JS1A 2GGSA 4PS0A 1JLLA 1T4GA 2JIDA 2QU7A 1MJGM 3JYOA 1DXYA 5F7JA 2PRZA 3LVRE 3U13A 1WKVA 2F8SA 1P5RA 5EZYA 3EBPA 1TK3A 2OD2A 3SEQA 2WMYA 4H6PA 4BMOB 4H0FA 5JH7A 2P77A 2NXCA 3FAKA 2KW5A 1T35A 3FYUC 1P7PA 3E82A 1WWKA 3Q0TA 3IBCA 4X20B 3AR3A 4LOHA 2GTIA 1LFAA 5HQJA 1ULTA 3UJDA 3K05A 2I34A 1D1QA 1PL0A 3FGZA 3L43A 1JZTA 4U4AA 1HDIA 1ZIDA 2GPNA 3P32A 3RH0A 4DZTA 1ESMA 2H4HA 5TLSA 1CY6A 3PKIA 2A94A 4JENA 4Y2QA 1JPVA 4U7HA 3B85A 1I3KA 4D5EA 3DTNA 1PS8A 1FFXA 2PS3A 3C8DA 2QRLA 1IBRA 1KBQA 3PF8A 4MV0A 4TWAA 1NFFA 3Q1LA 7ADHA 4ASUD 1VPEA 3FOWA 2TYSB 3SQMA 1JSRA 3H6KA 2XB9A 3RS4A 3ZXXA 5CCXA 1U0LA 4UDNA 5EWJB 1LK7A 5JD5A 4PX9A 4AN1A 5JCOC 3M5CA 3IXLA 1SUDA 5D6NA 1TJ5A 1CUWA 1OIVA 3ANSA 1CV2A 4D98A 4IV0A 4LOAA 4ZRDA 5IDVA 5CMLA 4HYQA 4EHFA 5FA5A 3I6BA 2XVAA 4CVNA 2DWPA 4L72A 1T5DX 1W48A 2EKZA 2DR2A 4ZEWA 1JJBA 4D6PA 1OWOA 1IG3A 2O2IA 1YZNA 3C7TA 1PQWA 3GOQA 3SHOA 3GCWA 3RIEA 2CV0A 1TIPA 1WPGA 3BH6A 2HU8A 1P62B 1DJOA 2IZZA 4CLRA 5CK5A 2AN1A 4E22A 3LQRA 2GO7A 3QVGA 4EUEA 1V4VA 3O8QA 1CR4A 3NATA 1W8IA 2JJ1D 2KYRA 3IHWA 1WBJB 3RFFA 1SR8A 4PE5B 2RH5A 3H1TA 1GTL1 1P4AA 3BCHA 3FWZA 3WIUA 1EHYA 1E8NA 3BXOA 3O2JA 4KQ1A 2QRPA 5FOXA 1D2GA 3BIJA 4F6LA 4Z6KA 3FWKA 2RHLA 1MB4A 2VJMB 2JARA 5AW9A 2VHVA 3PFHA 4F5ZA 1E3JA 1STOA 4KXQA 4X91A 5D84A 3AR8A 5DM2A 3HYTA 4G84A 1OH8A 3L6UA 1ZNXA 1Q3TA 1HBJA 3M6IA 4V0QA 4ZVUA 5J9FA 1D2CA 3OUUA 2OTCA 4JT2A 5DP1A 2RBKA 4KPFC 3ED1A 7YASA 4QGFA 3D7SA 3KE9A 4BNUA 1C2YA 3W2EA 1T5SA 2JHPA 2XCQA 3RJTA 2I4NA 1ZQ1A 1EUYA 1FP7A 2ZSUA 1ULUA 3BILA 3I9JA 4K9RA 3K9LA 4Q7MB 5B3JC 3QUAA 2QTVA 1ZJJA 2LCFA 3K73O 3PPVA 4FZ5A 4WLUA 4EJMA 3ZD7A 2J7PD 1W4RA 4KU4A 1W30A 4UZFA 2CUNA 3IV6A 4BNHA 1F1BA 4EX7A 4GOKA 2QD3A 3QEKA 3SN6A 2WUGA 1M0TA 2CDCA 3EQ7A 2YXPX 3NTRA 1URPA 2QP9X 4FS8A 2HIGA 4UE2A 1L5NA 2H6EA 5JNWA 3PVZA 3SGLA 2D06A 1R8QA 5LM3A 9MHTA 3ZD6A 4DOMA 3AI1A 1A9TA 4UUMA 5CJPA 1UJ6A 1ZC4A 1NN1A 1OV6A 2ID7A 1DLIA 4H0NA 1PQ4A 3UW3A 1N32B 3HKDB 4DANA 5LDGA 4C06A 1P2DA 1OIXA 2FZ4A 1ELOA 3KSDO 4G25A 5G0WA 3HCBA 1DAKA 4MRNA 2PMKA 4DY6A 5A9RA 1MHPA 1E89A 5FAXA 1J49A 1E69A 1GZ3A 1ZJZA 3TNYA 3U7QA 1PYDA 2VZ0A 3DBHA 4FZ3A 1KJZA 3VOAA 3C6ZA 1BVRA 1U9CA 3DMDA 3QWFA 1SCDA 2HBZA 5LOVF 4BNJA 5BSVA 3EQ6A 5TQ0B 4N5HX 2R7MA 3RKSA 1A7UA 5ISMA 2QAJA 2CMKA 2P3OA 4ZGBA 2BPOA 3RSLA 1ZX1A 3K0CC 1FTNA 3L01A 2GSDA 3PTZA 4DQVA 1O03A 2CVPA 4KQCA 1XRSB 2RIPA 3JTEA 5HUQA 1E79D 4UNPA 1UBSB 4QLOA 1D1PA 1QK5A 3HB9A 4BFLA 2R66A 3OHSX 5KNCA 5T6MA 2YVUA 3BK2A 3C24A 5DP2A 5B1DA 3ZBPA 5K20A 3H84A 4YP9A 1NRIA 3TNDA 1HNXB 1BH6A 2BI8A 2FJUA 3GDHA 3KV3O 4IIVA 4QAQA 4RUKA 5FQOA 4D3DA 1PNRA 2HZBA 3QWHA 4ITRC 5FTWA 1W8DA 3WRXC 1OXSC 4FBMA 4AG6A 2G8NA 4QOFA 1YS9A 4B34A 4LFCB 2I2FA 3JWEA 2P6RA 5E6RB 3GJ0A 5LYJF 5LXTF 4RHEA 5AI0A 4BO8A 5LCXA 4QKQA 2WUEA 1E4YA 4ZAXA 1GG2A 2AFHB 4MVCA 4JR2A 5JZMA 4K0KB 1GGVA 3MINA 2FPIA 2WMDA 1RZUA 2GHRA 2HMTA 1AGYA 4BP1A 5LSAA 1CLUA 2IZ5A 3THRA 3FVRA 4ZGGA 2RHCA 3ZGZA 1N2XA 1G4HA 3IXMA 2WDZA 1SCKA 1M2GA 2C97A 3OOYA 1ANKA 3LD9A 4LZNA 4REMA 3GEEA 4J07A 4YPOA 4GWLA 4RENA 4HADA 5LXTB 2X14A 2X0NA 3DVQX 1DC7A 2PBRA 3IUPA 4ZQHA 3HG7A 3CBGA 4KVAA 3RU3A 1OMOA 4D4IA 3FUCA 4AKHA 4ZI3A 4OB7A 5JANA 4LRXA 1Z75A 4IHQA 3O03A 4LUCA 4R1PA 4C3ZA 4E4TA 2ZU6A 1AV6A 3V8PA 3N2KA 2ZB2A 3A3YA 4O4JB 3BE6A 5EPEA 1Q15A 2GZ2A 3RLFA 1YAJA 4K6CA 2UZ4A 5JS2A 3JQGB 2GKOA 3TRIA 4Z1OA 3ZY2A 4BYMA 3EZLA 1W49A 5HJ5A 3BMCB 2PXHA 5AW0A 3ELDA 5AHOA 4G4GA 1X15A 3VHRA 4S04A 4G1VA 2Y1XA 3BF7A 1NIPA 2PO7A 1UAAA 4OJNA 3PNQA 5K3EA 3CO0S 3G79A 4OQ4A 4BMXA 3RB8A 2ZJ3A 4TXMA 4I4TF 2WQ7A 2H2FA 1ZL2A 4XYGA 4BN5A 1MTOA 2CDAA 4WASA 1OR8A 2PD3A 1QV6A 2BEKA 1QYCA 3RTBA 4ZRNA 3HDYA 1RC1A 5HKBA 5ITVA 3W6PA 2HBYA 2P9GA 4XIFA 1P0CA 4GH5A 3S1AA 4KIFA 4QO8A 2V7XA 3UXEA 3WLJA 3E9NA 4YECA 5KIAA 3M82A 4M54A 3FBTA 3L6OO 3PZBA 4EW3A 1JHDA 3A3PA 2OV8A 2PVCA 4KYVA 3HP1A 3S2SA 1JHQA 5A4FS 3DE3X 1U0NA 3IOEA 5C31A 5EQFA 4YIHA 1CQJA 4MCHA 3AB7A 5BN4A 5ALMA 1RM4A 1SUAA 2ZM5A 4X1OA 4HFMA 2ZI5A 2JGEA 3KSAC 1GV1A 3QEJA 3O83A 3A0RB 3SFTA 4QYIA 3QE4A 5I51A 3MT0A 5J3JA 3ISJA 2V5AA 4BLQA 1G291 1R8YA 2R9VA 3RRNA 2VJQA 3O38A 1KR5A 4PYQA 5F2KA 4NFHA 2WVJA 2P2GA 1ZNQO 3WO1A 3OKCA 2VBGA 2NSJA 2OE2A 3AHIA 1W0KA 3PG5A 1AXRA 2XUFA 4D9NA 3IUNA 4MRPA 2GM3A 5TPZD 3LUHA 1I80A 5CFRA 3NJ4A 5CB4B 3KJFA 3DC2A 2DBRA 2ZI3A 1B43A 3G85A 3PB3A 5K0BA 1YMQA 1K98A 4JLJA 4CQMD 1FJXA 3HY4A 3T35A 1OFTA 4Y2RA 2QYHA 4GX1A 1EYZA 3EUAA 3LY9A 4TSFD 3LKBA 3MMPA 4ZVRA 3EY9A 2QG4A 3K70C 2X8LA 1MJFA 2ZI6A 3I05A 3UJAA 4DIDA 3QVOA 2TMYA 4URWR 2EWMA 2Y3IA 1FDVA 4V03A 3C0KA 4XTCS 3SVLA 1ZIPA 3EXIB 4NJEB 3WWDA 1VHTA 2CD7A 4QVKA 1Y89A 2AXQA 3PS9A 5FL3A 2JIZA 3L8EA 3SC3A 2VRWA 3B51X 3SHQA 3VFDA 2BISA 1JNXX 4WLVA 2PLAA 4OL0A 2EFCB 1SD1A 4IO0A 3TR0A 4D8XA 3P1JA 4LFAB 2ZXUA 2ZREA 4L4SA 3NBXX 4LHSA 3SNHA 4HYTA 4U2KA 2QLJA 4YY3B 1WHTA 1MTZA 4C4RA 3V6LA 1J0DA 4W7HA 1C7QA 2D1FA 2NTVA 2WABA 4MQFB 4D56A 1G38A 3L3BA 2WDPA 1T5TA 1LBQA 2IC5A 2HD4A 4FC6A 2FPSA 1JEOA 1TZCA 4PQYA 3IESA 3UMCA 1WMAA 4D6YA 4JLKA 5F2EA 1A97A 3AEXA 3LZDA 3EDYA 1SXJA 2FUG1 3LUFA 4DCTA 1NLUA 4K8OA 2NT4A 2IBSA 4U7PB 3PVSA 4WNAB 2WD7B 3VR2D 2ZJZA 4IYRA 2F3SA 4L22A 1XEAA 3G2PA 4EO4A 1G8SA 2X5JO 5LBUA 1V16B 4E2WA 1A96A 3VNAA 2Y71A 5IM5A 1HYGA 1WD5A 1D07A 5FNZA 3VNQA 2C42A 4X7BA 1UPAA 5I4KA 2PMWB 3QKRA 2BUBA 2V8BA 3R7BA 3AIMA 3GRYA 1PS0A 2EBFX 3H6GA 2OC9A 1ARZA 4YA6A 2IOQA 4ZT5A 5IAAA 4ZO6A 1X1CA 5EHXA 2GXQA 4KR6A 4CTNA 1W46A 1TCAA 3ABIA 2Y1WA 3E8XA 1VB5A 3R7LA 4Z7NB 3K6SA 4QPNA 4DLNA 1IZZA 4GI2A 4IZIA 4TZ0A 3DB1A 3IL2A 5BN3A 4IDOA 2O2YA 4YJ2F 2AN5A 1Y98A 2O9JA 4PPFA 2R60A 2NNWB 2RGGA 4WOCA 2E5LB 3ZNOA 3E22A 5C37A 3FI0A 3I09A 4PC6A 1Y5MA 3LXMA 3QE3A 3MOSA 2FWRA 2FN3A 4GL4A 3FJYA 2YOGA 1RAGA 4NULA 2FQXA 2FEMA 4NAHA 7GPBA 3AETA 4JFAA 1NNLA 3ZW7A 3WIEA 1CUCA 4AS2A 4ZYYA 3X1JA 2I76A 4ND5A 5CB4A 3WQQA 3VR4D 2XYRA 3JQ8B 1K8XB 1PR3A 2HT6A 3FGPA 3DOFA 3WMRA 5IK2A 1SUIA 3P4YA 1KTIA 4FFRA 2XUJA 1UANA 4BDTA 2R2GA 4DAOA 3WHLA 2X41A 2I03A 4W5NA 4KLAA 2VJPA 4YQYA 3OBBA 4KRFA 2OYSA 2EL9A 3L1VA 4OLJA 1Y6GA 5IN5A 4W9MC 1DC6A 3KR9A 5LU8A 4NNOA 2L69A 4WLFA 3PKJA 3H0EA 3U3KA 1WPXA 3Q2IA 1LWOA 3RIMA 4B87A 5J5VA 4ALJA 4E1BA 4HGOA 5EYPA 1CU1A 3AR9A 2YMPA 4UAUA 1FDTA 1X77A 4GBJA 4XWOA 2PS9A 5EIHA 3HI6A 4MLCA 3RUPA 3K6KA 2OAP1 5F1OA 4II2A 3PJFA 3ZE0B 1V3QE 2K2QB 1BCRB 3W3AH 1VM6A 3K30A 4FFLA 5A5VA 3RS5A 4ZA2A 3T3HA 5EIXA 4PYNA 4UHFA 3CH6A 3R7SA 1G5QA 4EZIA 1ACLA 1PBTA 1US8A 2CSUA 3BB4A 2C8VA 4WVFA 5EMLA 2MSKA 4WINA 5CGZA 4QUEA 4IKOA 4O4HF 2Q1XA 1XHLA 1Y8RA 3KYDB 4UCXA 5K51A 2DERA 5JMOA 4ZOLB 5ALEA 4QBFA 1ZSNA 3WOVA 4OX9Y 3PHLA 4RBNA 1IN7A 3HBLA 1SZPA 3H2HA 2ZYAA 4B6QA 3M4XA 4HUTA 2ZATA 3SJZA 2X22A 4NKRA 5NULA 2F4VB 2YL2A 2IP1A 2FEKA 4L4UA 4IDFA 1NVBA 5KMGB 1X0XA 2BF4A 1U0SY 3SI7A 4QPPA 3F1LA 2B8NA 2Y0EA 3INGA 3M49A 2XLCA 3A2NA 3BICA 2NO5A 2QMUA 5KTTA 2ZZKA 1J90A 3ONVA 1W0JA 2G09A 3FZNA 1ZWKA 3FY4A 3KM0A 4ENWA 2ZULA 3WMEA 4AZ0A 4F7DA 3IV9A 3CNOA 1W581 1A5ZA 2E89A 2I4TA 2ZB7A 3BL5A 4D3ZA 1LDEA 2QV7A 3GRAA 4HDAA 4HR7A 3V4FA 4Z4HA 5BNZA 2ZLBA 1C0KA 1UXOA 1YVEI 2R6HA 2YZGA 3EE6A 1AZTA 5F1KA 4D9KA 1E62A 2XUHA 4CFSA 2YJZA 4WKOA 1MD9A 3AERA 3GJ6A 3BT7A 4M9XA 1IFXA 5K0TA 2DEUA 5SZIA 3C1AA 1KDOA 3FCCA 4KN6A 4F4UA 4OCZA 3WXBA 3T06B 3OEYA 4MA0A 4U6SA 3CBQA 1J8MF 2DWOA 2HPHA 4MQMA 5JQGB 2RHGB 1DO2A 1BXKA 2CFRA 4LIPD 5EWLB 3WLAA 3LO5A 4PLWA 2BR3A 1R9GA 2YJGA 5E7QA 5EXXA 1YXMA 1DTWB 2XYHA 1D6NA 1OB2A 5EKTA 5FCDA 3QIAA 3DULA 5HZHA 2RI6A 4Q47A 4PV7A 1FXWA 2PVSA 3NBKA 3BQ9A 4L74A 4U3JA 5I9SA 1X80A 1XU7A 3DM9B 3QI7A 4RGQA 1V5IA 2RGAA 3M5PA 4JBGA 1QU3A 3T5MA 3TCXB 2ZJ0A 1CZRA 1H23A 2H2AA 3NDIA 2QVBA 3BWDD 5BR4A 4FCVA 3EAGA 3ETHA 1VSBA 1W9HA 3I73A 3QY0A 1B6TA 1RI1A 3GJTA 3GUCA 5E3JA 1R74A 3U9LA 4ZVLA 2YBEA 3KK0A 4K6MA 4C88A 2FEOA 1G18A 2XUQA 4I50A 2KMLA 1DRUA 1WDMA 1XLTA 1N2IA 1Z2EA 1Z3IX 3NBZC 3RVOA 1ZD3A 4BNWA 5LDDC 1RE0A 3JQ9C 3HLKA 1IBCA 4FCWA 5ECWA 1DRWA 1EUZA 3LQ2A 5AWFC 2TS1A 5FFNA 2GRUA 4O1IA 5A6VA 3B48A 1QCCA 3G5UA 1EZ4A 3JTMA 3ADCA 1AKUA 4RHFA 3VPAA 1E1YA 5AKHA 2BGTA 2ZAMA 1I51A 4ND1A 1J6UA 3P0EA 3BHJA 4NI5A 4Z7JA 3QWIA 2Q3EA 1Y8RB 4QYWA 2FKAA 2QAGC 2FWPA 4P92A 5CG1A 3FMFA 2FHPA 4DBVO 3FPSA 4DAEA 1TM2A 2LWIA 1XZPA 2YWGA 5TGDA 1LRKA 2L82A 2ZR7A 3E7DA 2ZUVA 4IGIA 4LZOA 4PXYA 4BO9A 1M8KA 1NQTA 1VRWA 1ZNYA 2CK3A 3PWKA 4DDHA 4E5SA 1JEQA 1KEKA 5ADUS 2Y05A 3UHPA 1T2NA 1VMKA 4P5EA 4RY2A 1ZHOA 3KQQA 3ZQ6A 4YLEA 4QGSA 4GEGA 5K6TA 4U00A 4NIMA 3V32A 3ZD8A 1ZIXA 5I5EA 2BDUA 2VA8A 3Q9LA 2VQEB 3PCXA 4KPUA 3OURA 3P9ZA 3VSEA 1IRXA 1P74A 5EWLA 2HYDA 3QELB 4M87A 3EVTA 4J7XA 3O8BA 4MSUA 3V1NA 1M34E 5KC8A 3ONDA 3SYRA 3OX4A 1U2SA 2JJMA 1TJ3A 3UWKA 1M2VB 4DMRA 5H8WA 3U39A 2A9VA 1QGZA 3HU1A 2REQB 4D9HA 5BSWA 3ETLA 3OLYA 5SY6A 3ROTA 1Z4LA 1Z6GA 4MUBA 2ZUEA 4KOEC 1XL0A 4IILA 4PYRA 4IDEA 1QQBA 1XB2A 3HABA 4H59A 1H93A 2QYOA 5LKAA 4OGWA 3AG5A 2ZS9A 1NNEA 1SPXA 4WN3A 5J63A 5BQ3A 1CEEA 1MAUA 3VX3A 2FQYA 5GJBA 4TZKA 4OOEA 2IK8A 4RZSA 4BAUA 2JFXA 1P9RA 1D2HA 1SKBA 2B1IA 1YMUA 2EOAA 2VJBA 4PYMA 4RVDA 5EE0A 3UKJA 2X4IA 1J97A 1Y34E 1D4OA 2AMYA 1R4MB 1JJIA 1XWWA 2XSZA 4I8XA 4RF4A 3ZWAA 1OKKA 1PJ3A 1P2UA 2H4XA 3IIEA 3KD2A 3LBIA 3N2GA 4FEGA 5DM4A 5EZ6B 3TI7A 2V6MA 3RTDA 3TCKA 1SBQA 5HCUA 4NYMQ 4GPTA 4LQCA 2PM8A 4U63A 2Q6TA 1R2QA 1ORIA 4LW8A 5DGTA 4EUSA 2FK8A 4R8KA 3CUKA 4HAWA 3W2GA 1AKMA 4CMJA 3C8MA 1YL7A 3CURA 4QQRA 5HS4A 3L4SO 1SH7A 1E6MA 5TPWA 4KPEC 2UUAB 2FWMX 3QOYA 3WGVA 5EEHA 4HZUB 2GB4A 4IZOA 1TRHA 1UM8A 3KP1A 3GZ4A 3JYLA 2CV2A 3L8HA 3I1YA 1MX5A 3G8DA 1E6UA 2ZWPA 3LL4A 3LUJA 1RKVA 4MA4A 2ZJ4A 1A9SA 3MIZA 1UCFA 4YROA 2V6FA 4MEAA 4UDOA 3ZX4A 3ZHUA 4EJ0A 1RJFA 5F9HA 1PZFA 3BH7A 3OPQA 4GOND 2IBMA 1DIHA 1VG9B 4H1TA 1LXCA 1A9YA 5EOVA 4I4CA 3NJRA 2ZFUA 3ZDQA 3OZ7A 2YMLA 5G1OA 3WLQA 3SXUB 2M9MA 3JW8A 4L9SA 4UHBA 4L95C 4NE2A 4RD0A 3KAPA 2G08A 3CRRA 1PJBA 2WIFA 1OXKB 3JVVA 2C5FA 2R00C 4MS1A 4PNEA 1FCJA 3BGWA 1H2ZA 1NYQA 2C7BA 2Z58A 2EBUA 3N87A 4H4CA 1YSCA 4EPWA 1XTTA 1E7WA 4HTFB 4RHTA 3ZEAA 1DKRA 2R96A 2IKSA 4WNYA 5JJBA 1BS2A 2FF5A 3YASA 1I4OA 1OQAA 8LDHA 5CA0A 2JZOA 4B17A 4I55B 3H2YA 3VYRB 4HD8A 1V3VA 2Q4DA 1P2SA 3F7OA 4L1KA 5AVZA 4PZLA 3RGGA 2IPXA 3LF1A 2XQVA 3GT0A 1ISMA 1XF1A 5ED4A 1DTEA 4ZVTA 1JR3D 3DMFA 1SCIA 4A6EA 4FFNA 1JG2A 3R0ZA 3U56A 3WK7A 2D00A 5UKDA 3OZGA 5TGTA 3ZI7A 4D9BA 4XPZA 5F35A 1ZA2A 1U0GA 2CVOA 4QFDA 3DWGA 4OX9B 1GPMA 3PE3A 2VYVA 2Z8YA 3JQFA 3T3NA 1ZRNA 1L7DA 3AG6A 4FXPA 4U7FA 2OYRA 5FTLA 4GAEA 4BJHB 8ADHA 1S96A 4WCVA 5B12A 1SVKA 3I04A 1S0UA 3BM5A 4XYBA 4KI7A 2EF1A 1LWNA 1R0KA 1TQDA 1RZ3A 4JQZA 3LP6A 2EW8A 4Q4LA 5C51B 4OF4A 4ROTA 1C2TA 1YZYA 1SZJG 2W6MA 2ERYA 3KKPA 5HZGA 3BHIA 2IX3A 4RFLA 2FZWA 1MT3A 2W0SA 4FSHA 2IH2A 1OBOA 4PRKA 5DSTA 2J07A 5H02A 2X5XA 1W35A 4TLLB 3RPEA 3TF5A 3VH4A 4MW6A 1MX9A 2R8OA 1QGUB 5IP5A 4A8PA 4OLAA 2Y0CA 5LBTA 4DG9A 4AP9A 2J46A 3N8DA 3QEAZ 2JI6A 4G97A 4V1CI 1ZOOA 1U1IA 2H63A 4NE9A 3CZCA 2Q7OE 1KPHA 4WZAE 3ISTA 1I6KA 2DPGA 5EE5B 1R8JA 2CN1A 3H87A 5CHEA 4JUBA 3OU2A 3RRJA 3F7TA 4EWLA 4YRBA 1KOJA 5T4HA 1KI7A 3SC6A 3DKPA 2EEZA 1JTEA 2BHLA 4MW4A 1G5FA 3C8ZA 2QZ9A 4CF6A 4MOWA 2QB5A 3DWIA 4QU5A 1YJAA 4IH4A 5GM1A 1I13A 3VGJA 1L4UA 2I7DA 3S55A 3IEPA 2IFTA 4UPEA 3P0RA 2IE8A 1Z5WA 3LYUA 3L0YA 4QUIA 2AT1A 3KOMA 4JLUA 4V24A 5L9AA 5AKJA 5AUPB 2PUFA 3RRMA 3AF1A 3F67A 1AG9A 2WM3A 4OI2A 3TVTA 4AY4A 4B8YA 2LZ0A 4GPZA 4MCAA 4NG4A 3GPLA 4I99A 4RCVA 4ZAYA 1CQIA 2ZR8A 5JD6A 2IEGA 4J0KA 2CLKB 4YAEA 1A82A 1BA2A 2OSVA 4ZALA 2EJCA 4COOA 1DAPA 1I1OA 2BFBA 2FPGB 5KYKA 1KK3A 3OESA 4LOJA 4C7VA 4B4KA 5FBWB 4UASA 4MIOA 1RPJA 4HWTA 2QLFA 3TMAA 1YTLA 1MXHA 4MPPA 3G6KA 1JHXA 2HLDA 1JF8A 4TRRA 2Q6OA 2XHEA 4ZOAA 3UJ8A 4D0GA 5FWYB 1KH2A 1NLMA 1WZUA 2MIIA 4MHOA 1EE9A 2BWJA 3KCNA 4J6FA 1IXYA 3ABSB 3DTVA 3L0SA 2IYQA 4EY8A 1F60A 2O3JA 1IN8A 3FYUA 1XTKA 4CRWB 4W82A 5K0ZA 2DVMA 2ONCA 2WWYA 2NUPB 1X3SA 2VTDA 3RRXA 4XGIA 5EJ7A 1SEVA 3LA6A 2VCEA 2UUBB 3GGOA 1K0UA 3CUYA 3BSFA 1L4MA 3HV0A 1MRSA 2EDAA 1AK2A 1TI7A 3IPXA 3MK31 4NENB 1EVZA 1OPXA 2R751 5IVDA 5KVQA 3RT1A 1COWA 4CG1A 1YNSA 1Y3CE 5DXFA 3U48A 4NOMA 2I6XA 3B3AA 4ENTA 5JATA 3B2NA 3ZTYA 2XNCA 4Y6LA 2QRQA 4L8GA 2O6LA 2XH8A 3RI3A 4CLEA 2H2IA 1JQBA 1Z6QA 2VHQA 4C5AA 4HKTA 5JD4A 1WUJS 2VPYA 3O0TA 4G6ZA 5HP4A 2QN8A 1E77A 1GYPA 1X8KA 3VSBA 2X7XA 2OGWA 1RABA 1W2GA 4E13A 1V5WA 5JJIA 3FCUB 1RWMA 3TVYA