3B7GA

Human dead-box rna helicase ddx20, conserved domain i (dead) in complex with amppnp (adenosine-(beta,gamma)-imidotriphosphate)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
ADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX20
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b7gA00
2GK6A 3VNVA 2IUTA 2N42A 4M53A 4IDOA 3EC2A 4CEIA 1E2EA 5LBIA 4OHZA 4DLYA 1G3UA 4PZZA 2ZJZA 1N6LA 2YJTD 2JIZA 2YWFA 4UQOA 3UANA 2C99A 1U8YA 2NTYC 1GNQA 1GL9B 2RHMA 3KXKA 3OIYA 4BLSA 4YDSA 4DLVA 1KSJA 4G5QA 3K0SA 2XITA 4ZIRA 2ZJ2A 4IDQA 1MRNA 3LWNA 3D3QA 2AXPA 2ONJA 1ZVQA 2X8AA 5FBRB 2QGNA 2ANCA 3THYA 1Z83A 3HU1A 1II0A 1KDTA 4NMMA 1MV5A 2IF2A 3E2IA 3K09A 1G21E 1U81A 2GEDA 3SOPA 4MA4A 2QG6A 4YXWA 3FFAA 3B5JA 1E3MA 2F9LA 1G1MA 2WSMA 2OEPA 1ZNXA 5E4FA 4GZMA 1IN7A 1OFUX 2IYQA 2ZJOA 4JJZA 1VHLA 1NRJB 2V7QA 3FDIA 4KI0A 4R2IA 5EE1A 3EA5A 3I5YA 1R4AA 4L5BA 4QGAA 1IJEA 4O2RA 2BMEA 2REXB 3FKQA 1E99A 3EPLA 3RDPA 4EQ6A 3KKOA 3WHLA 4BFSA 1KI4A 2WPDA 4B6FA 3RWOA 3AVTA 1I2DA 2WWHA 3TLXA 5C2JB 1CEEA 2RGGA 1W0JA 1GRRA 1Q3TA 3KJHA 4Q1BA 2Q0HA 1G6OA 4AWXA 3JVVA 3AB3A 3K9HA 3TR0A 1QF9A 1W4RA 5E7JA 1RRFA 2IHBA 2QPAA 1KOFA 2F3TA 4MGKR 1LB1B 4NYJR 4V02A 2KSQA 2VH5R 4IFBA 3W6NA 2WWYA 2ZI5A 4M1KA 3OEED 2AXNA 421PA 1E0KA 1KO5A 4N1AA 3F0TA 5FBLB 2FZLA 221PA 1Z08A 1FMJA 4MRRA 2ZRHA 3DKPA 2BM0A 2QTFA 4ZI3A 1GG2A 1QG2A 1DAEA 3KKPA 3TSOA 2JDIA 5FBWB 4MGIR 1AK2A 2V1XA 3W8RA 3MJRA 1ZC4A 4JZKA 3W9YA 5CIWA 4Q7MB 1W36B 3MMPA 3GEIA 1GUAA 1Y63A 1NSFA 4X8OA 5BN5A 1OH5A 4B3BA 5JHGB 5CB6A 4A92A 3KDSE 2OAP1 1EFTA 4HATA 3W6PA 2RKOA 1E2IA 5IHPA 2HCBA 2D74A 1N6NA 4S35A 2WAYA 4EFLA 2QMUA 2ZRAA 1NBME 3R9WA 2RMKA 4B2IA 5KO2A 1LW7A 3QI2A 2FN4A 2ZRMA 2VP4A 1AJEA 4FMDB 5AUOB 5F9FA 2ZUDA 2YNMA 1D9XA 2WOJA 1KI2A 2HXYA 4BZQA 4NYMR 1KI1A 2CCJA 3KXLA 3FKSD 3W6OA 3GMTA 2XNDA 5JBQA 2FU5C 5G3YA 2YOGA 3RSLA 5HKKD 1BS1A 1E9SA 2G88A 5FUVA 1D5CA 4QGGA 4IOMA 1LV7A 1YRAA 2DCUA 3OIWA 4BLTA 4RKFA 3MWYW 3MD0A 1ZINA 4LK2A 3RRZA 3NG1A 4P0TA 3K70D 2FNAA 4BFTA 4ZCMA 2A3RA 2J46A 1FL9A 4OYHA 4M1OA 3MGCA 1W46A 1Z07A 1X8LA 1MR3F 3R20A 5JCZA 4G5OA 2H8KA 3DM9B 2BEJA 1G41A 2CE7A 3P27A 1HQYE 2G6BA 3LRPA 1FMLA 2FG5A 4KJZA 1T3LA 3IUYA 2QNRA 2WMNB 2ZSEA 2FSFA 1YR9A 2WWWA 4DCNA 4DLXA 1X1SA 1CR0A 1ZIPA 3I8XA 5EXTA 1AA9A 1Q0UA 1NIPA 1DOAA 1E4YA 1KGDA 1NVVQ 4LX0A 1JQLB 1WCV1 4Q4AB 5GJCA 5UKDA 1KI6B 3GCGA 3D31A 5P21A 2AFHE 2KJQA 3EX7C 1GNPA 3UIEA 5BYKA 3HYTA 2BOVA 5LD2B 1G3MA 4LHWA 3V00A 3Q3JB 5FR2A 4LHXA 3BC1A 4R98A 2W58A 1F5NA 4DLRA 1JJVA 4L4UA 3U44B 3DM5A 3VMFA 4US0R 2H7VA 3K0AB 2IXGA 2VHTA 3Q85A 1Z0FA 4EUNA 3ASYA 2O8EB 5CM8B 2X2FA 3SYNA 1NVXQ 4URVR 3C16C 1S1CA 2J7KA 3H0KA 3BIFA 2FPLA 3CNOA 4Q9KA 2WSSA 1G5PA 1GP2A 2ZSAA 4DBLC 1J90A 5FPTA 5K8UA 1RJ9B 5J40A 3CR8A 2PJRA 4M9QA 4EPYA 2YWHA 5AUPB 5KNDA 5CLLA 2WIBA 2OXRA 4WOPA 2XAUA 4QM7A 4M8NE 2NO9A 3D8BA 1X3SA 2OCBA 4JL8A 2ZEJA 4FD2A 1ODFA 1JR3A 4QJ3A 2IX3A 1JEDA 1GKYA 2OFWA 4Z8XA 1KSHA 1P9NA 1ZIOA 5EQTA 1CR2A 2B8TA 3DZDA 1W44A 1Z28A 3SI7A 1GZSA 2AKYA 5FH9A 1R0XA 4F4JA 1HV8A 1OXVA 4RY2A 621PA 2LCFA 3RVBA 3EW9A 4CVNA 1MO6A 1W2HA 4Q4AA 1Z63A 3RS7A 4HDCA 1XP8A 1KDRA 2AK3A 3B9QA 1IXSB 3RNLA 4C2TA 4TLDA 1CJVC 4NH0A 2EQBA 2ZJ8A 3NEYA 4FINA 4ZO4A 5BXQC 4E07A 1P72A 1N6HA 1YKSA 1ZUHA 2FJUA 2GDJA 2MSDB 3NH6A 4C0SA 4PO9A 1OH6A 4C0JA 1FQKA 4BZPA 3U44A 3QPVA 3NVAA 1S1MA 4PC2A 3SBEA 4LC0A 3CF0A 1HUQA 3K0AA 4OHWA 4W5HA 2QROA 2O8EA 4TYQA 3VHXA 1JB1A 2C96A 2VF7A 4V03A 3HU3A 2AHOA 2XSZA 3EASA 2GJAA 4PPFA 2EWWA 4XJXA 1KK0A 4EAQA 4I1VA 4LSGA 1DG1G 1RJ9A 4BRWA 1NIJA 3CUEF 2UKDA 4ITRC 1KI3A 4BE7B 1XX6A 3ZJYA 4PHFA 3ZVNA 1IN6A 3WRYC 4ON9A 2PT7A 3C5HA 3UATA 2D62A 1NJFA 3GFPA 1IJFA 2VSFA 1QRAA 3BORA 3ND9A 4RZ3A 4JBXA 4AKEA 4HLCA 1IY2A 1WDTA 2MMCA 1QG4A 2VHUA 1E0AA 2GJ8A 2VP9A 1P4SA 3BK7A 4F91B 4GOXA 3VR2A 3QPUA 3EC1A 4LZZA 4O2LA 4CEJB 4B3DA 1KNQA 3GP8A 4YC7A 1Z0JA 3KFVA 4YMSA 2REOA 4DCUA 2J1LA 2QE7A 4TN1A 3QOFA 3AVOA 3IBYA 3KQKA 4PC3A 3K0EA 2OHFA 4D0NA 3WYAA 2FH5B 4RKEA 5KSPA 4O25A 1TF2A 1FNMA 3AH8A 3K0FB 1ZD9A 2KWIA 3H86A 1E6CA 4QJ5A 3R9IA 4DCVA 4A0RA 4HB0A 4HLDA 1T5LA 3TKLA 1G7CA 1MABB 3T1VA 4AYTA 1M1YE 6Q21A 4AYWA 3VKHA 2PZFA 2NZJA 1O3YA 1NLZA 4UNSA 3RANA 3GLGB 3IQWA 2QM7A 1UJ2A 2H57A 4M1WA 1KJZA 4MYCA 5DN6A 4RZXA 1YZGA 3HR8A 4KCGA 1U94A 2CL7X 2HEIA 5HPYB 4L16A 2CVHA 2PCLA 1IQPA 1TU3A 2C03A 2GVZC 1ZM9A 2JLVA 1R5BA 1U0JA 2ODNA 3VR1A 3BH6A 4TLCA 3QE0A 5FL3A 2ZI6A 2IBMA 3A1UA 3M0EA 4B3XA 1Q1QA 1JALA 4ZKDA 2ZRDA 3C4JA 1VHTA 1CJKC 4JLPA 4BZXA 5HR5A 1KDOA 1L7VC 1Q1EA 1JR3E 2MSCB 4E03A 1BOFA 1H65A 4JYBA 3OF5A 5FR1A 2QSZA 4DEXA 1G291 3IHLA 1E2FA 1P62B 2Q3MA 1WQ1R 3CRVA 4P4SA 4RD6A 1D2MA 2JJ1A 2QT1A 4Q7JB 2R6GA 1AQYA 3TW4A 1U0HC 2D2FA 2CCGA 4CEJA 4POAA 2FSHA 3U3JA 2ZU0C 2PLFA 3HU2A 4ASUD 4BFUA 4RSGA 1N0WA 5J4VA 5EZ5A 3AVWA 2VA8A 4W7SA 2LKCA 3CF2A 3NHBA 3I3SR 2IA5A 3I32A 4PQFA 1RZ3A 1TUEA 2VSXA 5ELXA 3K0FA 1E1RD 3ICEA 1OPXA 3B78A 3CIOA 3UK6A 3QXXA 5EXSA 1E96A 5KNBA 1MABA 5FL7D 1E9BA 2HLDD 4IFEA 3LBNA 5KSZA 5B30A 3AKYA 3EXAA 5KTYA 4H1VA 2J0VA 3GLGA 1OIVA 3F3YA 2X77A 2P0EA 2G0NA 5B64A 5IK2D 3TVDA 2AWNA 1U9IC 2BKEA 2YC4C 1SKQA 2ZQ5A 1BMFA 2E1RA 1J8YF 2A78A 2GZAA 3VR4A 3K1JA 1DADA 2GEVA 1GRNA 5CDFE 1DARA 2JLQA 2ERXA 3B82A 3AVYA 5FTJA 1XZPA 4PX9A 1M74A 2F1IA 4R9UC 4JMPA 5FPKA 2DB3A 3GQBA 4M9ZA 3RS5A 1EFUA 2ZAOA 3ZQJA 4D4KA 3KL4A 3AEZA 4IXNA 1D6JA 2BCGY 2AKAB 1T0JB 2JCSA 4GL2A 1VYVA 3AF3A 4MRVA 1N5LA 521PA 2C98A 2YOHA 1Z2CA 4BFXA 3KJGA 4UNQA 5DHFA 1ONBA 2PL3A 2ZE8A 4JLOA 5FOUA 3WNBA 1OE0A 4OK5A 4CDGA 1P61B 4FN5A 3QBTA 1WMSA 4URXR 2QSYA 4QRHA 3ZZTA 1TMKA 4LHVA 4TSFA 4YQFA 3L8YA 2GXAA 4KO8A 1BO6A 2VL7A 3ECCA 3HPQA 3SFVA 2PMKA 4RVCA 3CB4A 3A8TA 3R8CA 4D4LA 1KJWA 4FMDF 5HE8A 1EFRA 2GCPA 2GKSA 2QMEA 2W6IA 3I72A 4JLBA 3DL0A 1COWD 1SHZA 1UF9A 4HZIA 5SZJA 4DKXA 1Q20A 5DI9A 3FYHA 5L3VA 4QKQA 2OXCA 4L9WA 1X8KA 1XTJA 4L9SA 3DPUA 1ZM3A 3UWKA 3B85A 1XEWY 3IKJA 3A1SA 1N6OA 3LLMA 1KZGB 1P3JA 1CRPA 2ZJAA 4L8GA 1KNXA 1S9HA 1VCIA 3SJBA 3B7GA 4HAXA 4LHZA 2ZRNA 4A0HA 3AVQA 1OHHD 2BV3A 1IAQA 1T3HA 5AJYA 2VEDA 4KODA 4ERNA 1LTQA 1G8HA 4JYCA 3PXGA 1H8HA 2NMVA 5CLQA 1NBMD 5G53C 3TGPA 3P1JA 4IXMA 4DIEA 1HH4A 3C15C 3NWJA 2QUZA 3GLHB 2QRZA 2V9PA 2JLUA 2VP6A 2GRJA 4Y0AA 2PZGA 1W4BA 4GOKA 3UWOA 1KZ7B 4M0LA 1KK1A 3B1XA 5AJVB 5JECA 4Q1DA 3LXXA 4YONB 1G4AE 2HUPA 2IYLD 4Y0VA 3TNFA 3LV8A 4Z51A 4HDQB 4CYMA 1MRSA 2GJSA 4LOAA 4UKDA 4GP7A 1MH1A 4M1YA 3TE6A 3ZQ6A 3SNHA 2NPFA 1XTQA 2JA1A 2A9KA 1RYFA 2WMOB 2ECKA 2QT0A 4I1SA 4Q4JB 4TL6A 3K9GA 8OHMA 2JIZD 3WYGA 4LUCA 3WMEA 1IXZA 1KI8A 1E2PA 2ZUCA 4PZYA 2YC2C 3SYKA 3X2SA 3JZAA 1EX6A 4PPQA 1X8JA 1Z6AA 4DLZA 2IT1A 5CB8A 3A4NA 1OJLA 2VP0A 1W48A 3U3MA 4LI0A 1SXJC 3P32A 4HAYA 4MITA 2O8CB 4EPRA 4G5SA 2CHQA 3O8RA 3QBVA 1Q22A 4JIMA 5L3SB 3PR1A 3WP0A 4YXWD 4LWZA 5JWHA 2JLRA 4NBSA 1RIFA 1XCMA 2J9RA 4PAOA 4WXRA 5CK5A 4IRUB 4JT2A 5B58C 4UNPA 3QVUA 3ZS9A 3KB2A 2V7QD 2FOLA 4TQUS 4LJYA 3TMKA 4KV9A 3FMIA 3VFDA 1JPNA 2NOAA 3GLHA 1KMHB 2HF8A 1IM2A 1W49A 2N46A 3G5UA 2CLSA 4G3XA 2WPDD 4ARZB 1XPOA 4JVLA 1R10A 3IPYA 4JBYA 4LV5B 4ZDWA 4C0KA 1W0JD 1M7GA 1FP7A 2BBTA 4FCVA 4BWYA 5AR1A 5FTNA 2D2EA 3U3KA 3IO5A 4OI1A 4NZYA 1EWRA 1L8QA 3A4MA 5TVKA 3BH7A 1NG1A 4IOLA 3WBKA 1G4UR 4Q7LA 1XMVA 3B1WA 3LXRA 2YOFA 4Q4JA 1S3SA 3QKRB 2ZRBA 3BGWA 3CH4B 1TEVA 1E4VA 3AP1A 3EA0A 2FWRA 5LDDC 4D0LB 3PUWA 2FA9A 5BWMA 4LJ8A 3UG6A 2JDID 3B1YA 2DWQA 2O8CA 2L0XA 1OIXA 1W4AA 1N2CE 2TMKA 4JSYA 3NBXX 1IN5A 1R5OA 1T8TA 3W3ZB 3CPJB 4P32A 5L3SA 1XD8A 1QHIA 3VTKA 3SR0A 4DDUA 5FI1B 1B23P 5GVSA 4TWZA 1G3IA 1OV4A 2IYYA 3CF6R 3CZQA 1FTNA 1L2TA 2VBCA 2R65A 2CHVA 5DE3A 4DWJA 1TNDA 4C0LA 3HPRA 1F2TB 5HCNA 3SQXA 2Z83A 1ZAKA 3SQWA 1XWIA 2EW1A 4GSYA 2X1VA 1E2NA 5G3ZA 3WYFA 3REGA 1KMHA 1QDEA 2Q3FA 3SJZA 1Z6GA 2BKUA 2F3RA 4HLUC 4EFMA 2R2AA 1E2QA 1ZUNB 5FOXA 1SGWA 4KYUA 2IYRA 3VX4A 4QXAA 1RRGA 1XRJA 3L0SA 3DKVA 1N0VC 4OQMA 5FPYA 4M9SA 1XPRA 2FMXA 2ZSFA 2BMJA 3PFIA 1P60A 2KB0A 4LC1A 1RRPA 4MRPA 5KPJA 3NKVA 2XNDD 3NDPA 3AV0B 4PAMA 1KI7A 1A4RA 4Q47A 4A6XA 2RH5A 3U7EB 2IUSA 1Z0KA 2ANBA 2QPOA 3CPEA 4V0KA 3LLUA 4TQ9A 2ZRGA 5HZKA 5JRZA 1N5IA 3AGQA 5BW8A 3EZFA 3QKRA 4UXIA 5AUNB 2OCPA 2W6JA 3KQHA 2G3YA 2C8VA 3TQFA 2VP2A 3FWYA 5JI2E 3ZIAA 1NMZA 1GM5A 2GILA 4D0GA 2P2LA 2R9VA 2B8WA 3D6TB 3OE7A 4RFSB 1AS3A 4KFTA 1V43A 2JJ2A 1ZNWA 1E2LA 4IVQA 1W36D 2Q9CA 2IS4A 1CR4A 1U9IA 2RCNA 3GJ7A 3QVVA 3SN6A 3KXIA 4ZPXA 2IYXA 2PJZA 5SZHB 1R8SA 4HEJA 1XPUA 2J0SA 4R7ZA 4PSKA 1A2BA 2ZI7A 3IDQA 3TRFA 4WXPA 2ZRPA 4B47A 4R71A 4JL6A 1QHNA 2ZETA 3CRW1 1PVOA 1N25A 2ASEA 1S0UA 1RVDA 1E2DA 2IYUA 1UKEA 1F2TA 1I4DD 2PX0A 2FDCA 1SVIA 3IQXA 5D3QA 3LA6A 1JPJA 1JJ7A 1NMXA 3HDTA 5TARA 1GKIA 4LJ6A 3VR3A 4JLNA 4BQSA 4MYUA 4JLJA 3GLHE 3OFNA 3KX2A 1OB2A 2WJVA 2R6CA 1PUIA 1Q57A 5FOVA 2QY9A 3RLFA 3QXJA 1XU4A 1JXMA 2W00A 3CLVA 3KUCA 4TYPA 1T3SA 2JATA 1II9A 3H84A 2OLKA 2DFLA 4C0AC 5CITA 3LVQE 4HI0E 1T0HB 3E70C 1N6RA 5G41A 1YR8A 1YZUA 2E87A 2WSSD 5LB4A 3FE2A 3AF0A 3NBYC 2QGZA 4Z8YA 3LVRE 2ZREA 4DHEA 1X1RA 1Z22A 5J47A 3W5IA 4W5JA 2HT1A 1XMSA 2ZE7A 3RSOA 1S2MA 4A8JC 1NN5A 1SXJB 1LF5A 1JR3D 1D8TA 3B2EA 1UKVY 4Z1MD 2OUKA 4JLKA 4NHOA 1Z8FA 1SVSA 4FWTA 3AUXA 2ORVA 3OIVA 1WB9A 5EE9A 2OILA 4O3MA 3SFZA 4RFSA 1CP2A 4OKSA 1U98A 4B43A 3NTUA 2QEQA 1G8YA 3EAQA 4FI3C 4OHXA 2ZYTX 2EYQA 2FGKA 1OXXK 1YRBA 2R44A 2D7CA 2GHIA 5CIQA 3TH5A 4P4TA 4JSTA 2GESA 3W90A 1GVNB 3AVUA 4OQXA 3U6KA 1SVMA 4D80A 3CWZA 2RGNA 4PQRA 2ZRKA 4D6PA 1PZNA 1TEXA 2IEYA 1LF0A 3V4FA 5CYPA 3LAWA 1RC8A 1GTVA 3AF1A 1T91A 1ZNZA 5JSZB 4Q03A 4D25A 4TL7A 1YR7A 3BFXA 4D4MA 5KU1A 2ZRJA 3FTQA 2IS6A 2XSZD 5EP2A 1Z6YA 3LX5A 2OFOA 3RABA 2WWGA 1XTKA 1H8EA 2KI5A 4IVRA 4CGZA 2WKQA 1KO1A 2F1JA 2R8RA 1FQJA 1DO2A 1YQTA 4TLBA 3GLFB 2J59A 4D82A 4LBZA 4QBGB 4K81B 1G6HA 2UVQA 4EPTA 1CJMA 2CNWA 3QEJA 1ZM4A 2GAAA 5B2ZA 1NVVR 1XTSA 1XXHB 2FFBA 4GZLA 4XTRA 5IDVA 4M2LA 5K8IA 4OI0A 1IBRA 3A1VA 1NN3A 1TU4A 2AK2A 2VRWA 3Q72A 1FUKA 1SXJA 3L2OB 1UKYA 5TY0A 3GFTA 2Q21A 2X19A 4AG6A 1SKYB 2IYWA 1TF5A 1Q1ZA 2FZ4A 5FTKA 3ADBA 1SVLA 2P5TB 3T06B 5D3MB 3AKCA 4H9GA 3TSZA 3CX6A 4L15A 3EZ7A 1SVKA 1OFTA 2QTVB 2ODEA 1ZP6A 4TYYA 4PO1A 1E9RA 1LVGA 2QE7D 1LFDB 3GFOA 2FF7A 3U61B 3KB1A 3P26A 2HF9A 1W7AA 4KFUA 5JI3E 1DELA 3KTAB 1U8ZA 1NY5A 1OSNA 5BN3A 1GL7A 3O8DA 1UEIA 5LB2A 2W0SA 4BLPA 5JMTA 2HYIC 2Z4SA 3EIQA 3IILA 3K9LA 5FPSA 1ESNA 3QG1A 2A5YB 3QKSB 3PEWA 3ZD7A 3B1VA 5JSZA 5E7MA 1DTSA 4GFDA 2EU8A 1LS6A 1G64A 1T5IA 3TBKA 4TZ6A 2DFTA 3SS8A 5AK0A 3C41J 1HYQA 5EUMA 5DN6D 1DAMA 2ZITA 4JT4A 1NKTA 1K8RA 1Z0AA 1IY1A 2W83A 5KDLA 4DDWA 3GLFA 1AS0A 2FGJA 1XCPA 4AK9A 4BLRA 2J5XA 4Z1MA 3TUJC 3RC8A 2GCOB 2R6FA 1M8PA 4B73A 1S9DA 4Q1EA 3A36A 1XXHA 4IJMA 4RCYA 3IIKA 1OF1A 2BM1A 2PH1A 2FSGA 1VECA 1CULC 5KHOC 3B60A 2ZVPX 3T5GA 4JLAA 2A5DA 4FCWA 2HCJB 1F60A 3IEUA 4FMCF 4EJSC 3NIBA 4XTCS 4NCNA 4RD3A 4NCKA 2ATVA 1KI6A 3A37A 1G17A 3AP3A 4NP6A 3LNCA 1WBBA 2JJ1D 1E98A 1M7BA 5D3MA 4FIDA 5JLJA 4WAUA 1M34E 3M4YA 1G9XA 4W5WA 2VIIA 1QHHB 1HTWA 4KYIB 1DAGA 2IXEA 3ZVMA 4LHYA 4NYIR 5FOSA 5M04A 1JR6A 4GI7A 1F3OA 4P4UA 1XNJA 3UMFA 2J7PA 3RS4A 3KTAA 4HZUB 4AIIA 4H1UA 4HLUA 4UJ3A 4NONA 2EFEB 4GT1A 4GOJA 4KSCA 5JEDA 2A30A 4Z54A 3ONWA 1T9HA 4CF7A 1OXTA 1GWNA 2XXAB 3QKSA 2VLIA 2WJHA 4LV8B 3CZPA 2GZDA 2V4ZA 3AVPA 3V4RA 4Q9LA 2QMHA 4IDNA 1BMFD 3NHAA 2GTPA 3VQTA 4B71A 2XTNA 3SHFA 4LJ7A 4V0OA 2J0UB 2MMGA 4NCIA 2ZSDA 3U7GA 3LH5A 2QAGC 4HUQB 2GCOA 2WICA 1KIMA 1ZMXA 2QRNA 2VO1A 3CRQA 1UKZA 1S4QA 1TL7C 4KVGA 2V3CC 2BWJA 4NPHA 3BBPA 4M9XA 2A5JA 4IEIA 5GVRA 2DPXA 2P5SA 4MRSA 4A9AA 2IXFA 2GZHA 1SXJE 1GNRA 3NBZC 4A0FA 1HEIA 4C0QC 1EFHA 4FWIB 4IOJA 5HCIA 4A2PA 2CMKA 4YMUA 3W34A 4WZBE 2ORIA 4G01B 1X86B 3EWSA 5SZKB 3QY0A 4LYAA 2VQSA 2DWPA 3I4LA 3IIJA 4LV6A 4PHHA 4TSFD 5DYIA 2PEYA 2DY1A 1W0KA 4G5RA 1ZD1A 1QHHA 2F7SA 4F4CA 2OG2A 1E32A 4B32A 4UJ5A 2G77B 1EFRD 1J99A 2W6ID 2WVJA 4HZUA 2GJKA 5A4JA 3MLEA 3TAUA 4FCTA 2B7BA 4TMTA 1G8GA 1QVRA 3NC0C 4AKIA 4ZI2A 2XZLA 2XB2A 3KUDA 3I5XA 2OSBA 2XXAA 2A2ZA 1DE0A 2B21A 2JASA 2JGNA 3GD7A 4RJLA 1EX7A 1ANKA 3U3RA 1P9RA 2CK3A 4ESVA 4FW9A 3S1AB 4DEYA 1ZJ6A 2GETA 5F2EA 1TF7A 2J0UA 1H8HD 2DFKB 3C5CA 2DFNA 2WM9B 2ZR7A 3GJ4A 4HUQA 3U2QA 3I73A 3A1WA 3LD9A 3QF7A 1OIWA 1J2JA 2IEZA 3BB4A 2QN6A 4OJQA 1R2QA 2X2EA 2IC5A 1Q12A 1VKJA 3IPXA 4DCTA 3GJ8A 3ZH9B 1E0JA 1MO4A 2PMDA 3MFYA 2OCAA 1N6PA 2P6NA 1FZQA 1P2VA 2NGRA 4ABYA 1SKYE 5FUXA 3UMRA 3PENA 1UFQA 5TMPA 3PQCA 2YVUA 1OH8A 3MCAA 4PC1A 4Q00A 1J8MF 3ZZUA 1GL6A 2QM8A 4Q9IA 3C14C 3SBDA 3M1IA 1L4UA 1NLFA 2ZS7A 3I1FA 5H68A 2Q3HA 5C4GB 4N3NA 2ZAMA 5KUTA 2GWHA 4OHVA 1X6VA 1DEKA 1ZUIA 1ELOA 2OFXA 2WHXA 1OKKA 3PCRB 3RRNA 2A5GA 2BDTA 5C18A 2NG1A 3AM1A 4MYHA 3FHOA 1RPZA 3QPWA 2AR7A 4F7WA 3KFXA 3TIFA 2QPTA 4IDPA 4GDFA 1KAOA 4LYFA 2N1BA 1CS4C 4QGHA 1CF4A 2ZJBA 1P75A 5CJPA 4JLVA 2F6RA 5EP4A 1NNEA 5TDHA 2Q9BA 3K09C 2OM2A 5GJVC 4TQAA 1CR1A 4DT1B 2QI9C 2JAQA 1CKEA 2CL0X 5C46F 1A82A 2ZJYA 1EXMA 1W5TA 4LYHA 3GJ0A 1M2OB 1MT0A 1TADA 2ZRLA 4QHSA 3S1AA 1W4CA 2IS2A 2YYZA 1YE8A 1NKSA 1ZBDA 5LPNA 3TUZC 2JLYA 2Q9AA 4IW3B 2G83A 4OI4A 4D81A 1E79A 4KBFA 2YWEA 1Z6TA 3B1ZA 2ZE6A 1MKYA 1D2NA 2AD5A 3KQLA 1VCNA 4EJSB 2CEAA 3EPJA 3Q7QA 3N70A 5A0FA 4US2R 2BHRA 3B13B 1ZW6A 1G8FA 2P3SA 2HV8A 2ZR0A 5E7IA 2AN9A 2F43B 1PLJA 4LJ5A 1GAJA 2QTHA 2ZU6A 3CH5A 3U6BA 3FVQA 2JLSA 2OBLA 3QJYA 4D2IA 2P65A 2RAPA 1VYUA 2HYDA 3MSXA 1O87A 3GEHA 1G7SA 4TMXA 4BLQA 4DC9A 1E1QA 1P9WA 1XMJA 5DO9A 1E69A 3SE0A 1UDWA 4UNNA 4A2QA 5DI3B 2NIPA 4TYNA 4LJ4A 1AN0A 4PHGA 2XZOA 4TZ0A 2WJGA 1ZYUA 4LBVA 4HAUA 4B6EA 3C8UA 2O8BB 3BWDD 2EVWX 2ZUBA 4CRWB 4DT1A 1RYHA 4KFRA 2G1JA 1JI0A 4BPBA 5JRJA 1ZCAA 2V8OA 5IRCD 4Q66C 4Q02A 4B44A 1US8B 1GDDA 3JZMA 3X1DA 3EZ2A 2EFDB 4DSTA 5CJ2A 3FGNA 4HAWA 5TXGA 2JLZA 1OH7A 2QENA 4URWR 5KYKA 2J41A 3RWMB 2GAOA 3CW2A 4UXHA 4YMWA 1JEEA 2IF0A 3KQNA 4B75A 4CT4B 4DSUA 4EJSA 5DLQC 1ZC3A 1QHGA 2OO7A 4PR0A 2QP9X 3O8BA 1DPFA 1KO4A 2VYFA 4D4JA 1JECA 5FOTA 4JVSB 4B3FX 1DAFA 3BH0A 4KBGA 2BVNA 4JVNA 1XB2A 2F43A 3PJRA 5EP3A 3N5CA 2GXUA 1R8QA 1YU9A 2EWVA 5DNYB 3KQUA 3EZ9A 4URZR 1EK0A 2XJ4A 1AM4D 2O0JA 4A0GA 1WRBA 3QXHA 1OW3B 4J0QA 5H8WA 4W9MC 4U7DA 3NDBB 4PFSA 4ACBA 2NO7A 2F9MA 4BGDA 1FUUA 4Q4HB 2W6JD 4GP6A 4C9BA 5DI3A 4PC6A 3ZIAD 3GLGE 4XSHA 3PEVA 4NKRA 2HJVA 3RRMA 3SYLA 3ZLJA 1W1WA 4R2HA 1AKEA 4DXAA 3OE7D 4NCHA 2IS1A 2JJ2D 2O8BA 4MH0R 4XH9B 3VKGA 3VKWA 2FEOA 1ZM2A 1Q3HA 3N2EA 1DS6A 3BFVA 4C0BA 4NL4H 1KYIA 1UBCA 1US8A 1GITA 4HAVA 4WVFA 4CZ2A 1IN4A 3CNLA 1P2TA 2WJJA 2BBOA 3EIHA 3LDAA 1ETUA 2YV5A 721PA 1PV4A 2O8DB 4DLUA 3E5HA 4EIWA 4EPWA 1Z2AA 4Q1AA 3L0IB 2IYTA 2ONKA 4BFZA 4C2UA 4YDHB 3Q5EA 3OFND 4B48A 3CM0A 3ETLA 3T1OA 3MWJA 3W8NA 4MDEA 1UAAA 4HSEA 4I4LA 1E9CA 2J3EA 2GBLC 1CIPA 2Z0MA 2ZPTX 3ZS8A 2JLXA 4F38A 5TV2A 2XOKA 2KE5A 1EG7A 1YR6A 3QXSA 3B8HA 3IHWA 4JBWA 3VR6A 3OESA 4HB2A 5EE5B 3QXCA 4Q4HA 3PUYA 1Z47A 4CT5A 2NO6A 4P31A 3WBJA 2GF0A 3CX7A 3GPLA 3CKLA 1XJQA 2ZRFA 3CONA 4DUGA 3X1YA 4GPTA 5FI0B 2IHYA 4QG7A 2QL6A 4QHTA 2NO0A 3ZD6A 1S3GA 1HT1E 4X8HA 1UADA 1G18A 3T1TA 2XTMA 2PZEA 3BRWD 1N6IA 2ATXA 2CLCX 4OJKA 1G3QA 4OQFA 4YLGA 3GJ3A 4ARZA 1E2MA 5F3WB 3RYTC 4EPVA 1KK3A 1K6MA 3K0CC 3OIUA 1U90A 3OAAA 1Z06A 4E5UA 1IONA 2WWIA 2O8DA 3HJNA 2REBA 1VMAA 4YMVA 5DIFA 1XZQA 5KSOA 3U7HB 5F9HA 3RRYA 3G0HA 1WF3A 2IUUA 3REFA 1ZRHA 3TSWA 1E2HA 2CVFA 5AWFC 1N6KA 3WY9A 2NQ2C 3CO5A 1TAGA 2PBRA 2RHDA 1G5TA 1GOTA 1RE0A 2EFHB 4I81A 1N5KA 4XVRA 5EE0A 3K70C 3GJ6A 1H8ED 2O5VA 5G40A 5J4LA 1HE8B 4B3GA 1S8FA 2YZ2A 3FFBA 1VG1A 3PITA 4U5XA 3THWB 2OBNA 4BECA 3ZGXA 3MWLA 1FP6A 3QKUA 3LQQA 2CNWD 1QZXA 1ESMA 1XFAA 3T12A 2EYUA 3F8TA 4TLEA 4ESHA 4NE2A 4RCZA 2DBYA 2LKDA 5K8LA 3SZRA 5FBQB 4PPNA 1SXJD 3KZ1E 2OZEA 4KAXA 4M1SA 4URUR 3PVSA 3SJAA 1J70A 3CWQA 4GMXA 4Q48A 2IK8A 4DJTA 1OB5A 4ILEA 1W5SA 1JQJC 2C9CA 1NP6A 1Z29A 3F5FA 3U4QB 5F98A 1G19A 2KBEA 4DLSA 4F92B 4QHYA 1R0ZA 1G16A 2C2HA 3Q7PA 5AJWA 2HXSA 2R6DA 1XMIA 1K5DA 4F93B 3LW7A 5JEEA 4D26A 2C95A 4ZKEA 3DOFA 4PSVA 5A5GA 2WOOA 2GXQA 2XEXA 5JZVA 3OEHA 4CIDA 5KOYA 1AZSC 2PT5A 4TMZA 1XBTA 5JWRA 1XDBA 5AJXA 3QF4B 4LRWA 4IHQA 3U60B 4JVMA 2C04A 3DZ8A 2AWOA 2GJ9A 2RGBA 1A7JA 3B9PA 2XZPA 2OESA 2QQ0A 2Z6VA 3L43A 1DBSA 1GRQA 3M6AA 4AYXA 1M6NA 3T35A 3HWSA 1NVUQ 1UBEA 3GJ5A 2QP4A 2P67A 1JAHA 4QFMA 4OHYA 2G0TA 1EGAA 4P3YA 3DMDA 3NBFA 5K8TA 2GF9A 3CX8A 5J5CA 2GVDC 5BQ5A 5JWOA 2F55A 4C4PA 3I8SA 1D2EA 2RGXA 3CR7A 1LS1A 1HA3A 4TT3D 4BFVA 1P6XA 3QKTA 2JJ8A 1ZNYA 3THWA 3CRRA 2D4HA 3QUSA 2EFGA 1JBKA 2FV8A 2WAXA 3L82B 4DRZA 4P33A 1NL3A 2YHSA 3AKDA 3TJZA 3IEVA 2VF8A 4NYJQ 3BJIC 2WKPA 1GSIA 2CXXA 2FSIA 1CXZA 2XGJA 1AZTA 3AUYA 3T5DA 3AGPA 1I4LD 2EFCB 2FPMA 3PUVA 4BFWA 1FTSA 4XWOA 3U4QA 1VCMA 2ZE5A 3RS3A 2WTUA 3THOA 4B35A 5EZ6B 1Z5ZA 2D06A 2HDNB 1KO7A 2UZIR 4N0DA 1QVAA 1BIFA 1KY2A 2V1UA 4MUAA 4QBIA 4EPXA 4KLZA 2WV9A 1WA5A 1UBFA 2AL7A 4PANA 1NF3A 2KBFA 3UKDA 3PIRA 1E9FA 3EWAA 4DSNA 2J7PD 3QF4A 3KKQA 4BEBA 1L4YA 1Q44A 1WP9A 4JLDA 4Q1FA 1YZQA 1PUJA 4MKHA 2GK7A 1F2UB 3U3OA 1TQ2A 1R0YA 5AJZA 5JJIA 1P73A 2V6IA 4B33A 3KJEA 3RAPR 1A5TA 1NN1A 1YVDA 2DWOA 1AGRA 2VHCA 4A6PA 3QQ5A 4XWAA 4TTRA 4PAQA 4BEJA 3VU9B 3ZVLA 1WBDA 4XVUA 1GILA 4NYMQ 2R62A 2WWXA 1C9KA 3I61A 1Z0DA 5EP1A 3R8FA 3MUFA 1MOZA 2CBZA 1AKYA 2J87A 4A15A 5GJWC 2P6UA 1JXOA 3ZZ0A 4NU0A 4US1R 4BUJA 1FPMA 1XEXB 3T34A 2GEUA 4BRUA 1KK2A 1NG9A 4NTZA 4MDFA 3AVXA 3EPHA 4QC2A 2BBSA 1SULA 1YZKA 4TMWA 4XSGA 5KDOA 5DYGA 4TYWA 1R0WA 4XWKA 2QQEA 2OE2A 4RD2A 1XD2B 2BCJQ 2FPKA 1QHSA 2ODWA 4PPGA 2ERYA 4S2EA 3H1TA 4OK3A 2ZROA 1W0KD 1S96A 1T4GA 1EESA 4OQLA 1KI9A 3Q8XB 3ADKA 1E2JA 4JJKA 2OV2A 3DMNA 1E2KA 4PQYA 4WIAA 4LBWA 3A6PC 5TB5A 4TL9A 1G3RA 1JAIA 1XCGB 3K53A 4FMBB 3ADDA 2H92A 3TUIC 5JCPA 4QJ4A 4QGFA 4BASA 3UPUA 5JFGA 4TL8A 4TT3A 2Z4RA 1F2UA 3UG7A 4WA7A 2QBYB 2BC9A 2ZYWX 2QMOA 3OEEA 3K70B 2GBLA 4KFSA 2HT6A 1J7KA 1VG9B 4HYYA 4E22A 2F1HA 3BFKA 3TW8B 4RD4A 2CK3D 5L3RA 3G82C 4E09A 2ZVQX 3EIEA 4RZUA 2CDNA 1MO5A 3VU9A 3AP2A 2RGEA 4YMTA 2ORWA 2D3WA 5BN4A 4DDVA 4EKDA 4IVPA 4I1OA 4V0NA 1BYIA 5SZIA 5KDDA 4XVQA 1VDZA 4PTLA 2K5UA 4F4IA 3BD9A 4PXAA 4IEEA 1Z3IX 1IHUA 2JEOA 1Q21A 2OLJA 2RB4A 1XEFA 3I92A 4KXFB 3LX8A 1XEXA 4N0EA 1T8UA 3QSYA 2B7CA 2WJIA 2CE2X 3P4XA 1PJRA 1WXQA 2OBMA 1CRQA 2G1KA 2O8FB 1KTVA 1TQ4A 1AQUA 5KSYA 4LJAA 1XD2A 3IIMA 1XF9A 3BS4A 1XTRA 3JVUA 3KKMA 4I1UA 5HTKA 2ZIAA 2C5LA 1OLOA 4KSBA 3VNUA 4O0MA 3SC3A 2FFHA 5FTLA 1NI3A 3PG5A 4RFVA 1R5NA 3K0CA 2BIFA 4U00A 3KJIA 3MAAC 5L8VA 4MKGA 1OKKD 3WRXC 5IF9A 3EG5A 3FKSA 3GLIB 4AKHA 3L0PA 2FFAA 5HKKA 3R9XA 4DCSA 4GBMA 3LY5A 3X1XA 1U99A 1II8B 4LGMA 2Y8EA 2QBYA 1EFCA 3SHWA 4GRAA 2G9NA 3DDCA 4RZ2A 1DG3A 1E94E 3ADCA 3DOEA 1RKBA 4MGYR 4NYIQ 5CDFA 5EUQB 4A8JB 4Q4LA 5DHAA 3W5JA 1AGPA 3MRSA 4Q1CA 2C9OA 1ZM7A 5C4MA 3BB3A 1XEWX 3UMSA 2FEMA 2ZANA 1YHNA 2BJWA 2RGAA 3DHWC 4MYTA 4LYJA 3X1ZA 2C77A 4ZDKA 1AIPA 1E79D 3WNDA 1PLKA 2I1VB 4IKEA 4Q18A 3FB4A 2NZ8A 1E9AA 821PA 3Q5DA 3ZYCA 1WE2A 4X8LA 1NVWQ 1YJ5A 2BEKA 3EZ6A 3TVTA 3FOZA 2H17A 2I3BA 5H1YA 1U2RA 4KITB 1GKUB 2I1QA 3FHCB 2O8FA 4P4SB 3T15A 4LPSA 4B74A 3PEUA 3PUZA 1OFHA 2VPPA 3MG9A 4A36A 5JS7A 2J0QA 1ZD8A 4MGZR 2QP3A 1RFLA 1HY3A 1R7RA 1HURA 5ANRB 3E1SA 5FPHA 1Z6XA 2I4IA 2WKRA 5KPDA 2H16A 1E1QD 2VHQA 2VTKA 3QIAA 3DO6A 121PA 1VIAA 3K9NA 4WBSA 5GADl 1FX0B 3GLIA 1UDXA 2O0HA 1IN8A 3SU8A 2IL1A 2ZRIA 3IO3A 3EPKA 1II8A 3P4YA 4G1UC 4LPKA 5CK4A 4Q9HA 1DAKA 3EARA 5KNCA 2LWIA 3BAFA 3HR7A 2V54A 3CNNA 3AKEA 4KU4A 4LY6A 3GLFE 2IWRA 2CLDX 2QA5A 4OK6A 3RS2A 3SJCA 4B3CA 4G0NA 4MUBA 4A8JA 2PCJA 1T6NA 1XXHE 2QORA 2QZ4A 2YWGA 5FTMA 2D7DA 1U8AA 2B92A 2XB4A 2ZSBA 1UPTA 2O0KA 3CPHA 2W0MA 5FOWA 4M1TA 2FFQA 4UNRA 2ODBA 1SHKA 3CBQA 3VX3A 3V9PA 3D7MA 1VG0B 2IYZA 4BLOA 2ZTSA 2ZYVX 3FMPB 1TUIA 3W3AA 5EE3A 4KLNA 3A1TA 3AF4A 3UXMA 3IGFA 1NJGA 3X1WA 4MRNA 4PZLA 4A1FA 4GNKA 2H1LA 5FUWA 5E3HA 1XTIA 5FUYA 2XTZA 1JNYA 1TPZA 2OAQ1 3LW8A 5CM9C 4AKGA 4DB2A 1G7RA 3GEEA 4K8OA 1FW6A 2XJ9A 1F48A 3CRMA 1NSTA 5L3QB 4OL0A 4OQNA 4UXJA 1KHTA 3AVVA 1YZNA 1KSFX 3P20A 4ZDIA 4V0MA 3ZVRA 1E2GA 1FX0A 1KKMA 1V5WA 1ZU5A 2B6HA 4ZCLA 3ZDQA 1KDPA 4BFYA 1BYUA 2ZM5A 1GIAA 1CJUC 2ZS9A 1EWQA 4TTQA 5E95A 4QBHA 4JL5A 1OYWA 4JS0A 2OT3B 5C1BA 4M21A 2NO1A 1KMQA 4LJ9A 3BOSA 2HJGA 2PEZA 2A5FA 3QNUA 5JS8A 2RGCA 4M22A 2CCKA 3BXZA 1SQ5A 4QM6A 2BMFA 4C7OB 4PC7A 4OBEA 1UBGA 1UM8A 2BMDA 2C9YA 2QU8A 1YZTA 3WMFA 4DVGA 1C4OA 3WNCA 1FFHA 4Q21A 3TQCA 5J4KA 3GJXC 3OHMA 3NH9A 3VR5A 1A1VA 1AS2A 3NEJA 3PEYA 3QEOA 3TK1A 3HYRA 4RD1A 2Z5FA 1OXUA 2ZI3A 1XD9A 1HT2E 4A2WA 2WIAA 5EJEA 2YKGA 1GFIA 3BE4A 3BB1A 4LCBA 2NPIA 3DEFA 1KSGA 2CL6X 4X8MA 1I4TD 5IT5A 2AD1A 3O47A 1IY0A 1TTTA 2F1RA 4TMVA 1DAIA 2Z43A 4WW0A 1XJCA 2XOKD 4URYR 4C0HA 4AURA 4PSAA 1IXRC 2W2VA 3T1QA 5L3QA 3SDZA 3NXSA 3THXB 5JJKA 2QAJA 2P6RA 1UEJA 1E0SA 2IYVA 2ZR9A 5HE9A 1A2KC 2WJYA 1HE1C 4AD8A 4WZ6A 1P2SA 4XD7D 3MWKA 5HZHA 3GLIE 1P5ZB 3AF2A 4FXPA 4DUGD 2AFIE 1W2GA 2DHRA 4B2PA 2CHGA 1VCOA 2QAGB 1VIYA 1G7TA 2AX4A 1KO8A 4HUTA 2ZRCA 2Q6TA 4HAZA 2W2XA 1NLYA 4K46A 1LNZA 5J4HA 3K8YA 1W47A 1DAHA 1YZLA 1KJYA 2ZI4A 3WXMA 1NY6A 1FOEB 1VG8A 1SVOA 4ZDJA 1QHYA 4CEHB 2UZ3A 2V6JA 4C7OA 2C78A 2GNOA 4EFNA 2GA8A 2ZS8A 4AI6A 3OAAD 1CLUA 3N2IA 3ND8A 2WWFA 4QOSA 5JJLA 4Q7KA 4Q9JA 1Y3AA 4TLAA 2RGNC 5FFMA 4M1MA 3VAAA 2IWHA 3QENA 4QNMA 4DLTA 2ZXUA 3PUXA 4AC9A 5FBVB 4ASUA 4XOIA 5B57C 3H4MA 1P7CA 3TAHA 1E9DA 2ZYUX 3RS0A 2V55B 1G8PA 4G5GA 4V0LA 1K5GA 1SVWA 2JLWA 1FNNA 4NCJA 1E1RA 1B0UA 4ACAA 3O8CA 1R6BX 2OCYC 4B2LA 1RW4A 1N3BA 4WZAE 5FL7A 5EXPA 2HLDA 3LO5A 4HLQB 4ZCIA 3FMOB 1CTQA 4A82A 3THXA 1DVRA 3B6EA 1MO3A 2DR3A 3LQRA 2BJVA 3T61A 1IOZA 3R7WB 1VTKA 4M4SA 3VHLB 1QHXA 4II7A 2VSOA 4V0ME 2CJWB 5IK2A 3WHKA 1W36C 3A4LA 1ZU4A 4C30A 5CYOA 2E9SA 3BERA 4MQBA 1NN0A 2QAGA 2IYSA 4IDHA 5H70A 3J81k 1P2UA 4DIDA 3WMGA 2SHKA 4FMCB 2YINC 3LBHA 4LBYA 3ICQB 3AQ4A 3KKNA 4AG5A 1N0UA 1I2MA 1TX4B 3C7KA 4Q19A 4EDHA 3HP1A 3L0OA 1OYYA 4B76A 4CEHA 2FX3A 3H2YA 3OEHD 2J45A 2ZJ5A 5EXXA 4KVAA 4Q01A 4IOKA 2WBLC 1N5JA 3LBIA 5DGXA 1CU1A 1CJTC 1PLLA 4NDZA 3RHFA 2A7QA 1F6BA 4AY2A 4OI2A 3A58B 2H18A 4HB4A 4XIGS 4CEIB 3QG5A 4I99A 4Q5IA 4PO8A 3Q9LA 4HDOB 2RGDA 3LFUA 4PHTA 1C1YA 1G20E 3FPAA 2PLRA 1D9ZA 2DYKA 4ZV4A 3OZXA 1KAGA 1G5RA 4U02A 2ZI9A 4ZIRB 5AUQA 1CBUA 4C3ZA 3WP1B 4TMKA 1COWA 1TQDA 3MJHA 1RRCA 2XNSA 2W2TA 4JKYA 1OT3A 1VYTA 3ASZA 4HB3A 1OFIA 1VPLA 4XD7A 3THYB 2VHJA 3FHTA 1DO0A 2FE4A 2WZQA 3DVLA 3IBGA 1Q1BA 3U7FB 5BYJA 4B34A 1KY3A 3FMFA 4MKFA 2GXSA 4MKIA 3R7WA 1M7HA 1QBKC 2PX3A 4QL3A 2IW3A 4LDJA 4RD0A 5J4YA 3PV0A 3I62A 2CJWA 2R6AA 3NC1C 2XX3A 5DH9A 1NMYA 1OHHA 5DISB 5GJBA 3TR5A 2O52A 3U5ZB 5DSZA 1BH2A 4TTPA 5JHHB 1SZPA 1NBMA 4DSOA 4DB4A 1OXSC 4KHZA 2H5EA 1XJ0A 1HQCA 2BBWA 1E9EA 4CW7A 4JKIA 1TQ6A 5LD2C 3SEAA 4DZZA 4A4DA 4EQ6B 1KKLA 1U0LA 4QNRA 1Z0IA 4DDTA 2MSEB 4QBFA 1BKDR 3RC3A 4GMDA 4JLMA 2GCNA 2VP5A 1LY1A 3L8ZA 1ZCBA 4DLWA
chains in the Genus database with same CATH superfamily
2GK6A 1PFGA 3P7MA 1T2CA 4N8EA 2Z1DA 4U2KA 2N42A 5SY4A 3UAZA 1RJGA 2HHHB 4BAZA 4G26A 4PN7A 2XBLA 1QIFA 5CGZA 4EA9A 3BT7A 1GCIA 2PGLA 4LDPA 4M0EA 3I5MA 3B2QA 3IVMA 4DR1B 5ICCA 2CLLB 3W7AA 4RLSA 4A8HA 2I0FA 2JVJA 4DLVA 1JG7A 1KSJA 4G5QA 2NAPA 2OY0A 1JW9B 4WESA 5AQEA 3BN3A 1XTPA 4ITVA 4RQTA 2R86A 4WINA 4IDQA 3U4HA 4AJNA 4D8YA 3DFKA 2VPIA 1XK6A 2WWTA 3KVOA 3A11A 1PFYA 3FSGD 4HL6A 2X8AA 5DHQA 3S2IA 4MPJA 1LI4A 1Z2DA 3FDXA 1P91A 4NMMA 4NEQA 3E2IA 5CFNA 2VRBA 2QV7A 2QZPA 3HCDA 1Q2XA 5BN5B 3FFAA 3B5JA 3EZNA 1J9ZA 1LLFA 4ZOBA 2BKVA 3ZE6A 1RWMA 3AY0A 5COBA 3STXA 4AFNA 2P77A 2QY6A 1D1TA 2OEPA 1YHYA 3B20A 3KLPX 4MEJA 4XQ9A 4EHBA 3FPJA 2IYQA 1Z15A 3CISA 4ZVLA 2P62A 3WB9A 1VHLA 2RHCA 4HQKA 2O3QA 4C89A 5EE1A 5ICFA 2RI0A 4N6OA 4YX9A 1UMCA 1R4AA 1QH8A 4HTFB 4QGAA 4QYSA 2BRUA 1IJEA 3WBBA 4DLBA 5F64A 4K0RA 3WYNA 5FD8A 1C0EA 4NWIA 4B6FA 3RWOA 3R7DA 1YQXA 4YMIA 1GRRA 1Q3TA 4V0RA 4FSHA 5I7OA 1P4HA 2Q0HA 3L6DA 2FPGB 1JIKA 1HPLA 2B9VA 4AWXA 1VJ0A 3AB3A 1O57A 4J75A 5KEIA 1X1QA 1XGKA 3SKVA 1QF9A 3CVOA 1W4RA 4EBBA 3OBBA 4JXXA 1QS0A 1KOFA 2F3TA 2QZSA 3VNSA 2KSQA 1YRWA 3R5FA 3L04A 4P53A 1V16A 2WIFA 5CAEA 4M1KA 4MW7A 1TCBA 3OEED 5D87A 1ZD4A 3R5XA 4YAEA 4HZGA 1O9GA 2R8PA 4NBNA 4J0DA 1XFDA 1Z08A 1FMJA 221PA 2Y1KA 3DKPA 1YDHA 2BM0A 2CKMA 3A14A 3BKXA 3SKYA 2H9YA 3EOZA 2I1LA 5JNSA 1QG2A 1UC8A 3VDRA 2J3QA 4TWRA 3OQVA 4K26A 3N28A 4O4IB 4FHDA 1T34A 3LLVA 3TSOA 1A4IA 5BNTA 3RU9A 2V1XA 1U3WA 4MP6A 4W99A 1V1MB 3BD6A 4AUMA 1ZC4A 3EVCA 3W9YA 1EFPB 1BX1A 1Z26A 3JSAA 5DV9A 3RH0A 4BOYA 4DBVO 2D1SA 3JVIA 1W36B 2BMAA 4K40A 1QPZA 3CZRA 1Y63A 3QTBA 4OOEA 4BWVA 4ND2A 4B3BA 4DIFA 1LVHA 3HBMA 3TBFA 5CB6A 4KMOA 4HATA 3LHSA 2UZ0A 3FX2A 1E2IA 1FDOA 4FR2A 4FJ1A 4YRDA 5CBPA 1DQYA 5IHPA 2QU7A 3GYBA 5LU8A 3C4VA 1M34A 3IE0A 3NAMA 1YS2X 2G7ZA 2OSVA 3R2JA 4M0PA 4M7PA 3RC1A 3PBKA 1H66A 4Z3KA 5KO2A 1C9EA 1IWOA 1L4GA 3QI2A 1RADA 1OFGA 1W85A 2VP4A 3P19A 4FMDB 5FHQA 3IAAA 4DIMA 5AUOB 5AVWA 2P2CA 4XM0A 3ZR4B 5H3LA 1C1XB 1R0SA 2WOJA 4YI3A 2HXYA 1VL0A 4RHXA 5FYDA 4AF8A 4U7PB 4CF4A 2VFAA 1E5VA 3W6OA 2VC2B 1DRUA 1BS1A 4AKTA 4G4JA 5THQA 3RG2A 3DW3X 1LV7A 3ZHUA 2Q49A 3MD0A 3ANSA 4A27A 2HTEA 1FMCA 4LK2A 5DWDA 1TIPA 3GZJA 3ZGZA 3GL9A 2Q45A 2FNAA 4N65A 1YZ3A 4RU1A 1FL9A 2H9IA 3P4UA 3EGXA 4FD3A 4B1FA 1X8LA 4CIYA 1IHOA 4ND8B 5JNVA 1JPUA 4P81A 3DM9B 2AMFA 2BEJA 2PNFA 3AF5A 3NONA 2ZWAA 1HQYE 3CYFA 3P27A 3Q6NA 1C2YA 4R2KA 3TO5A 2I80A 2FG5A 3BSFA 1FFAA 2BKAA 2D5BA 1ICEA 2Y71A 4KOAA 2X40A 3IUYA 2R1TA 3BHIA 4K1LA 2WSLA 5KZMB 5MFPA 1WW3A 2FSFA 4G5YA 2DQ4A 2LPMA 1PFQA 2WWWA 3H9EO 4ID3A 2XT6A 4DCNA 4OYLA 1GTL1 2BJHA 4YGYA 2YXPX 3VPXA 1DOAA 1E4YA 3NRCA 1WCV1 3IDOA 3UJCA 3TW0A 1U0FA 1KI6B 1A8QA 2O6HA 1KDZA 1ZSYA 3IT3A 2NNLD 4ZVPA 2AFHE 4OAOA 1IZZA 1OTXA 2XA2A 3D6JA 3ANNA 4I46A 4PRYA 5A7HA 4W1RA 1U7ZA 3AF6A 1IZ0A 2X2PA 4K9MA 1ZS9A 4KE7A 2VOJA 4LHWA 5A6SB 5LD2B 2ZT5A 3Q3JB 5FFFA 4N7JA 5ADUS 3DJYA 1F5NA 4EB8A 1JJVA 4L4UA 4MULA 5LQRA 3DM5A 2G9VA 4D0SA 2PT6A 3W9SA 4US0R 1BWSA 1XV5A 1VLVA 3NIGB 2IXGA 5EA2A 5LLTA 1O94D 1XTVA 1AUVA 1Z0FA 3OCYA 4L73A 3ASYA 1G5FA 2FQ1A 3JPWA 1OASA 3VZPA 1YI0A 1FDIA 2TMGA 5ALKA 3VHXB 2HLHA 5JDCA 3BIFA 2FPLA 2YCLA 4C2BA 3BDIA 2R11A 3VSCA 5DNCA 1O0CA 1Z17A 3BMCA 2WNSA 5K8UA 1OLXA 5J40A 3CR8A 1ABEA 2PJRA 2VAPA 3TZ6A 3USES 2L18A 1FRQA 2YWHA 4XKJA 3QVKA 2C58A 3WHIA 1X74A 1TRKA 2ZQYA 2WIBA 5CLLA 2OZKA 3F2IA 2XAUA 4WOPA 1W76A 1MOSA 2O7RA 2ID4A 2PWAA 8ADHA 1C41A 3GT7A 1MEOA 1X3SA 2ZEJA 4RWEA 1ODFA 3Q3CA 2IX3A 3KQOA 3C4QA 4H3HB 3ZV4A 1GKYA 3EPRA 5AT1A 2V7XA 1C14A 2GBPA 1ZXXA 2DSNA 1NPTO 1V4VA 2OFWA 2YHBA 4MWEA 3H5RA 2FPIA 3DZDA 2B8TA 2I65A 1W44A 3SI7A 4F6RA 5MN5A 3QOYA 1PK7A 5FH9A 5CT6A 1TRHA 2YXBA 2XDWA 3WJ2A 3P9XA 3LGAA 4QLOA 2CUTA 1UKAA 1IBKB 2A9VA 1J9GA 4P54A 1C9YA 3RBXA 4RV5A 4BJHB 4CVNA 3DBOB 4Q4AA 2AW5A 1EINA 1HYBA 2VJOA 3GDWA 1KDRA 4H18A 1R50A 2G63A 1BWRA 3RNLA 1LDMA 4TLDA 1NXQA 1P5FA 4ZOCA 4FINA 5BXQC 4L5YA 1EAYA 1ZISA 3QOXA 3HTXA 1FYVA 1ZUHA 2FJUA 1NYRA 3DV0A 3TL2A 1TM3E 2MSDB 3HY4A 2AG8A 1K5PA 4PO9A 3LECA 3BIJA 5EWJA 4AZVA 3QPVA 4BZPA 3GGSA 1S1MA 3FI9A 3RUAA 3OPNA 4X00A 1HUQA 2PJUA 3LF2A 3M4XA 1F5SA 4HV4A 5JYEA 2XE8A 1ADGA 3SBXA 1BFKA 4MAFA 3PPYA 5A2QA 1SC4A 4Q82A 4CF5A 1OVGA 3AU9A 4HNAA 1AY0A 1EVIA 3PDUA 4OYRA 4PPFA 4DJ5X 2OC4A 4IZIA 4NQZA 3SLRA 1QX4A 3CUUA 5KWJA 3HO8A 2C2XA 4I1VA 4LSGA 1E7YA 3EDMA 1JQBA 4LNUB 5JUWA 4AJ4A 1M6VA 4XE5A 2BGTA 3HM9A 3NMUF 3DEYX 3FPGA 1XO1A 2P3QA 3CUEF 3K20A 5B2FA 2RE8A 2JC3A 3PD7A 3MFQA 4AG3A 1Q0TA 3VR4H 5B3JA 3WRYC 1T0UA 3V4PB 4L5IA 3ZCSA 4Q34A 2QRLA 1X14A 2PYIA 1RQLA 1IJFA 3BORA 3TAXA 3NU1A 2N47A 2M1XA 4I08A 1B00A 2MMCA 5JD5A 2OD7A 2ZBRA 4UUAA 4J0KA 1J22A 1DTWA 5K1ZA 3UJ6A 4UCWA 1E63A 4KRGA 2GT1A 3EF0A 4JBHA 3E3NA 4LRQA 1OX6A 3S55A 4LXYA 4JI2B 3CVWA 3VR5D 1G66A 4WK0B 3V97A 3VTZA 3BXGA 4DMKA 3GN1A 2X0RA 3EBLA 3JD3A 4REQA 3AR9A 3ZDDA 3B52X 4B3DA 3F8WA 4FSDA 4MVXA 2OZPA 5KTKA 1BCSA 1CVRA 2J1LA 2QE7A 3E9QA 3JASA 4IRMA 3IBYA 3KQKA 3K0EA 2OHFA 4MQFA 5IDXA 1QIKA 4E5MA 4WCFB 4R16A 1PD1A 1SUPA 3HJTA 2D2XA 1RXEA 2I8CA 3JQAD 1AG9A 1ZD9A 3OZRA 3ANMA 1PQ4A 1S7GA 2GYUA 1C3XA 4ALLA 3D7SA 1XTTA 1T5LA 1G7CA 3EZGA 3GYGA 3FLMA 4GC9A 4Q9AA 2Z1NA 4AYWA 2CVZA 2PZFA 4CLXA 2CMDA 3JRWA 1O3YA 2W2KB 4HFMA 4TV8A 4CKBB 2O05A 1OR8A 1YZVA 2DMRA 3ITDA 3GLGB 1F6DA 4QJIA 2P7IA 1IHXA 1EGQA 1ZOIA 1KJZA 4M1WA 5EIFA 1PWXA 1XA4A 1EEXB 2E1PA 1B6SA 2EFJA 1AV7A 1FTYA 2XUDA 3ILYA 4QODA 4Y6OA 3ENQA 3RS9A 1OQAA 1U94A 2OECA 3QMMA 1I5EA 1P6UA 4L16A 5TC4A 1U2QA 2ATEA 1TU3A 2C03A 1Y6GA 1R5BA 1U0JA 2ODNA 3FM9A 3KT8A 4ZAZA 3BH6A 2C42A 3QE0A 1UT6A 3P9PA 2H1IA 6NULA 4Q15A 4OHKA 3A1UA 1L5KA 4B3XA 1ADCA 1BD4A 1DQNA 4UBLA 3WDSA 2QG9A 3AOEA 3M9XA 1VL2A 1BH6A 2A33A 3C4JA 3VDQA 4QFDA 4BVGA 5BV7A 2NU6A 1KGSA 1Q1EA 2VA9A 4TRMA 2P5YA 3RBZA 1NUQA 2WA2A 5IBCA 1H65A 4JYBA 3OF5A 3OI7A 3I53A 3N1UA 4DEXA 4NZ9A 3WGHA 3IHLA 3CRVA 1P62B 5THXA 3ZC3A 4G56A 3OTOB 3D1LA 3FGOA 4RD6A 3NHYA 3HFRA 4Q7JB 2I6XA 2R6GA 2C9MA 3DBHA 1MJGA 1AQYA 2N9UA 3RQSA 1U0HC 1PK9A 2Y92A 3TW4A 5IC4A 3ER6A 1XZHA 5PNTA 2DECA 4F3TA 4CEJA 4GZ5A 4L6AA 4G36A 2FSHA 5IKEA 1TEZA 3GZ4A 3K31A 1E61A 4RSGA 1N0WA 2R96A 5J4VA 2VA8A 5JNLA 2YJZA 3OTGA 4LXGA 5TLSA 3CF2A 3NHBA 3I3SR 1GPKA 3I32A 4JOSA 1QM5A 4BN0A 5LXTA 4DDKA 2Z9CA 3PQ4A 4WFJA 4XR9A 3UAGA 3B78A 1M8KA 2YWXA 1M1NA 4IF6A 3OX4A 2YL2A 3DGFC 5H16A 2MJLA 3VZBA 3DA8A 4FC7A 3F1KA 4I9GA 4LZAA 4CXMA 2GLXA 5B30A 2OGTA 2UU9B 4WZZA 1P2GA 4XUDA 5KYYB 1N78A 3VISA 1OIVA 3F3YA 2X77A 1OU4A 2X3UA 4OQ4A 2A0KA 1KTIA 2AWNA 4XR4A 5EE3A 1FXWA 2ZQ5A 4DMRA 4RPCA 2P8JA 5CCBA 4IIDA 3U16A 4EKIA 3Q7TA 2JLQA 3B82A 1FUIA 1NF2A 5U4XA 4YB8A 2XMSA 2X4GA 2VDMB 3GFGA 3NTQA 1XZPA 1HE3A 3ETNA 3P0RA 4EYGA 2IFTA 1VHDA 3HXPA 4JMPA 4M9ZA 5JSQA 2I4TA 3QWHA 2Q7XA 3CCFA 1D6JA 1T0JB 4I4IA 4Y7DA 1VYVA 3AF3A 521PA 2C98A 5HKBA 4IIJA 2ZBPA 2MYTA 3KJGA 4X9XA 4UMDA 3E9DA 3KT6A 2RCYA 1ONBA 4JLOA 3WNBA 1OE0A 2AOUA 4OK5A 4XYEA 3GN2A 3F6CA 1WMSA 4EGCB 4URXR 3FTDA 3ZHQA 4GQIA 1TMKA 4FFVA 4LHVA 2C5SA 3LP8A 1E1YA 3RSZA 4D3SA 5REQA 3M6FA 1R6VA 2G70A 3ZE7A 1M2GA 1MGOA 4AS2A 1H2ZA 4HMQA 3UJHA 2VL7A 5B4VA 5G2OA 2C0CA 1UFKA 1TM4E 5JC1A 2P4SA 1KJWA 2FKAA 5EJ8A 3UMBA 2QMEA 3I72A 4Z4CA 5C5DA 2ODAA 1Z13A 3IQGX 2O3TA 1KMMA 3FYUC 4OXNA 4HZIA 3TNDA 4DKXA 4X3CA 1Q20A 5I8WA 3M6WA 2NUPA 3HUFA 1EYZA 3WWDA 2J6HA 1WY7A 2Z2YA 3HYSA 3UWKA 3TFOA 1ITZA 1TM1E 1XEWY 1PJ4A 3WWZA 1FP2A 5CPFA 5B3LA 1KZGB 4RIEA 5LP6C 4NXMB 4L8GA 4FLFA 3C45A 1KNXA 1JLKA 4FFDA 4A0QA 1VCIA 2VDWB 4JYPA 3B7GA 1ZL2A 1IC6A 1WCXA 1XE3A 2BLNA 5EMMA 5FNZA 2VEDA 2IZZA 3C8ZA 4L3VA 1I0IA 1WPQA 3MGAA 1TYDE 2ET6A 3DB1A 3RSFA 3M33A 2JGEA 4LTMA 2EL9A 4LIPD 4MKXA 4ZVSA 4PG8A 4IXMA 1ETHA 1Q7BA 3C15C 4Z4HA 3GLHB 2AG1A 1GZ6A 2VP6A 4AO7A 3VUEA 2BHSA 4FYIA 2X9GA 4P7KA 2BEUA 3IAM1 3N7AA 4Y0AA 4BQNA 1DKUA 3T3IA 3A6LA 3ZQUA 2JVKA 2XA1A 5K3FB 5BSHA 3CLTD 1M66A 3UWOA 1KZ7B 4M0LA 1KK1A 1X0VA 2VN8A 2OV1A 3MJVA 4OHPA 5AJVB 5BV1A 2KHZA 1ZJJA 3T4EA 4YPOA 3A9UA 4JHXA 2HUPA 1WXHA 1RAIA 2ZULA 1FXUA 2B1QA 2ZKIA 3BULA 3VVBA 4Z51A 3NBUA 2W37A 2Q4BA 4FVTA 3Q88A 1ZH0A 4GP7A 1WW2A 1I13A 4M1YA 3TE6A 4CNBA 1FDSA 1XTQA 4FZ3A 1PS8A 2A9KA 2WYHA 3AJEA 3ND5A 3Q2OA 2G17A 2R6ZA 8OHMA 1BHJA 2BUBA 2QF7A 1JB9A 2MYUA 2WYUA 3B3QA 4JEMA 5DM2A 4LUCA 5EINA 4F84A 1QIIA 3DMTA 4M1QA 4P0QB 1XAGA 1HFWA 2ZUCA 1CY0A 3X2SA 3LTEA 5FFNA 1W4LA 1JKIA 1X8JA 4Y3UA 3MTGA 4LF9B 3WG9A 2H3HA 1G2IA 3AV3A 1W48A 1M10A 1P1IA 1PJAA 3QA9A 5JOQA 3PUHA 3L46A 4PSUA 5K8CA 4G5SA 4D56A 3REQA 4WK2B 4F04A 4I3FA 4JJIA 2Z09A 1Q22A 4JI8B 3RC2A 2BFDB 5E6RA 2HMWA 1FDTA 1JG1A 2HBQA 2P9EA 2VTEA 3ROKA 3WP0A 4JV5B 1JTVA 2VUTA 3DEJA 3NFYA 3ZJ5A 2Y3IA 3VH1A 3PFCA 5JYDA 1TVCA 1VYHA 4D44A 2J9RA 3PHCA 5G0WA 1SIUA 2AN1A 2EG9A 5EZYA 3V9AA 1JQKA 4QVGA 2NP7A 2NZ2A 3PEFA 4Q3LA 2YS6A 5C3UA 4W5OA 4DKJA 3QVUA 3JQ9C 2ZATA 4D99A 3B12A 4MVJH 3T4XA 5KOHA 2V7QD 2FOLA 5HIKA 1SNYA 3OSUA 1DKLA 1JPNA 5BORA 1RYNA 1W49A 2OHXA 1MJ5A 2RJNA 3OY2A 3JWEA 2EWMA 2CLSA 3ZZMA 2HTFA 3I52A 1V7PC 1ZN9A 5EHGA 4LOLA 5IVIA 3IPYA 2PUVA 4JBYA 3EMKA 1W0JD 1CJSA 3U80A 2NXEA 5BW6B 1VJTA 1U8XX 2O1SA 1FP7A 2DUJA 3FOFC 3RNOA 1AHNA 2GD1O 4WOKA 1OX4B 1HYGA 3KEOA 2FN7A 4KX3A 5EJIA 2Y0DA 2YZ7A 4MWGA 2OV8A 3KEGA 1B8VA 3OMXA 1GUZA 2WVHA 3CO0S 3WBKA 5KWEA 4GI2A 1XMVA 4N6GA 3PGMA 3GFFA 4JB3A 2FG6C 2WHPA 4Q4JA 5KVQA 5LZ4A 3G23A 4O59O 5EL0A 2IV2X 1PDVA 3DT9A 3G89A 4F0JA 2J5RA 2SCUA 1TEVA 1ZW1A 1E4VA 1VOTA 4MLZA 2FA9A 3FNGA 4TV8F 5BWMA 2QQGA 5IKPA 2DWCA 2PSHA 1MAAA 2JDID 3NDIA 3H87A 4OGFA 1YB6A 3GRAA 1TJPB 1K7YA 3O3MB 4R3WA 4KB5A 3L4BC 1JIJA 3KCNA 4HEHA 1IN5A 1T8TA 3EY4A 4N18A 3ILHA 5AH0A 4ZARA 4DZTA 3L92A 5IJ9B 3BTOA 4DDUA 2PLAA 1XZFA 2W43A 1LFAA 2IEDA 2YV1A 3I6YA 4P3PA 4TWZA 4CUZA 3U1BA 1I7QB 3AHDA 1J33A 4XLZA 2FP4B 5H4GA 1TNDA 5HCNA 1K4MA 5EJ4A 3SZOA 1AMNA 5BNFA 2EW1A 2FSVA 1IUNA 1E2NA 3KEQA 4ZAVA 4B6PA 2HIHA 5GOTA 3SJZA 3P45A 2F3RA 4HLUC 4MWCA 3MLAA 1ZUNB 3GUHA 4Y1GA 1S8OA 3TZLA 3IT1A 4QUEA 1TT5A 1XRJA 3DKVA 5DP1A 5F1OA 2C8JA 4DLPA 4OAPA 1OX5A 3INNA 4H59A 5IDQA 1EXWA 1XPRA 2ZSFA 2BMJA 3TQSA 1P60A 2KB0A 4R0MA 5TPZA 3NKVA 4O29A 2Q1XA 4H4CA 1RPAA 2XF8A 3AG5A 3R40A 1T9KA 1YF3A 3EOAI 1KU6A 2IUSA 1Z0KA 2ANBA 3CPEA 4V0KA 3ILVA 4UBNA 2OGSA 5LXTF 3T7RA 2ZRGA 3CNEA 2WQ7A 1HRDA 1MRZA 2DKOA 3OZUA 5KVAA 2HA7A 3AL0C 2PNJA 5TNXA 4YJFB 1U80A 3DZKA 1A9YA 1T2VA 4HGRA 4B4VA 5NULA 3PGLA 3OLWA 2BEVA 3O3NB 2AV6A 3PEEA 5BN1A 3KQHA 3T5TA 3GMDA 1TZ2A 4R8MA 1DWOA 2VP2A 3TQFA 2OXFA 3ZIAA 1L5HA 7AT1A 1KE2A 1RIIA 3ZHXA 1I33A 2GSWA 2GILA 4D0GA 2C83A 4NICA 3A70A 2J5KA 3GEDA 2ZFUA 4TTIA 4RFSB 2V5UA 3T7JA 3W04A 3K6SB 3PQ7A 2IIBA 4IVQA 1E5LA 3C5EA 1TMOA 1L1EA 2F64A 1CR4A 2Q9CA 4J7UA 2L82A 1AK9A 3C97A 3DOHA 4ZPXA 4DCMA 4YDRA 1QTIA 4L2IA 5ALVA 1EK6A 3F9CA 3BGIA 3SZ3A 3TRFA 1YQ9A 1XT6A 1PVOA 3CRW1 1N25A 1RVDA 1E2DA 2IYUA 4P1ZA 1F2TA 2FPOA 3UC5A 3IQXA 1N7GA 1T29A 3LA6A 1BOOA 2EKLA 3BA1A 4KAAA 3HDTA 2DBVO 3O8CA 4FGSA 2GCGA 2HRBA 1RZRA 3LXUX 1DIBA 1NVAA 3GAFA 3OQIB 1WCWA 4KV7A 1CUVA 3KX2A 1CQIA 1ULBA 2WJVA 4L8YA 1KYVA 1YC5A 4OLFA 3VH4A 1E60A 5CG2A 5IDWA 3I45A 4LVNA 5IUKC 1JXMA 4WGGA 4TYPA 3CEMA 5KVSA 1CYDA 1D2CA 1DC3A 4ZOLB 2OLKA 3MS7A 4LHSA 4C0AC 1G2PA 5CITA 1RXWA 2ZXFA 1N6RA 1I1QB 5G41A 3U13A 3F8SA 4UBIA 1E4EB 3PRHA 3BQ9A 3DPIA 3O9MA 3DL2A 1WXFA 5T3UA 3SM9A 4P0PB 3NBYC 1SUIA 4RTQA 3FY4A 4M88A 3LVRE 3T9AA 4CN9A 3VUFA 5KNDD 4IO1A 3ZOKA 5J47A 3W5IA 1KPGA 1NC3A 2HU8A 1V2HE 1XMSA 1K8QA 1M2NA 2HF2A 2R60A 3BJRA 1S2MA 1UM9B 1SXJB 1XVLA 4UTZA 4YVFA 1SA0B 1SUFA 4A8JC 1XC7A 4QO8A 2BYTA 3ED5A 1B8UA 1HDIA 2OUKA 5EIXA 1EVZA 1BDMA 2QN9A 2J8ZA 3OIVA 1WB9A 5LZ2A 4O3MA 1UXKA 2HBYA 1QK4A 2FEXA 1U98A 4MICA 4NZMA 2DHCA 4U0JA 4J90A 3WB2A 4J43A 3AR6A 2XNHA 2HA6A 3DT8A 2X13A 3UMYA 3FVVA 1CIJA 5AYVA 2ZYTX 1I2CA 1H2BA 2EYQA 2JI7A 3P8ZA 4ZHQB 2C0PA 3ZQKA 1OXXK 1P1HA 4X1OA 2D7CA 4P4TA 2ZJ1A 2GESA 1ZKMA 1B3BA 2WJPA 1PI3A 1CJBA 2EJCA 3B8EA 4WOBA 1YZHA 1C0IA 3FBTA 4H4EA 4WLOA 4BNKA 1GLVA 1R8YA 2DM6A 4BRSA 3INTA 3JQGB 2Z98A 2AQIA 3IE2A 4D6XA 1OLSA 2Q62A 1MHPA 2G07A 3WGIA 4Q3EA 5GP1A 2P68A 4QYIA 5F5NA 5CYPA 4RTKA 1GGKA 4D25A 3VV2A 4UD6A 1T1SA 1Z8NA 4F11A 3UA4A 3BFXA 5FA8A 4TWBA 2WZBA 4BTVA 3FTQA 4PQEA 3RABA 1Z6YA 2EZ9A 2OFOA 4BE9A 4PV7A 4OMUA 2KI5A 3TQQA 3HXQA 5JIBA 1KO1A 3KIPA 4DBZA 3MWGA 5L53A 1VIMA 3CLSC 3GLFB 4QBGB 3G9QA 4EPTA 5EPEA 1CJMA 2JGKA 1Z4QA 3AINA 5C1IA 3L1VA 5HF9A 1L5RA 1XXHB 2D1FA 3DAYA 2MIIA 1JFFB 1GXSA 1TU4A 3ESAA 3DBIA 1N8KA 3BMOA 1UKYA 2GFHA 2Y27A 3GROA 2Q3JA 1UBMS 2VYVA 3PZRA 1TF5A 4R8SA 1L7QA 1XCLA 1YCGA 3HUTA 1IRXA 1CETA 2I9PA 2QTMA 3A25A 3JSXA 3NCTA 2C54A 1ZJZA 2HRZA 2HWWA 3DMRA 4EA8A 4EK9A 1KYWA 4B09A 3TSZA 4ER0A 2RHTA 1IHPA 1ZUWA 3EZ7A 4XDYA 1OFTA 1OI3A 3ONFA 5DASA 4IMPA 3DUFA 4M1ZA 1ZP6A 4EG8A 4TYYA 1HBJA 1LVGA 1HE5A 3OPXA 5K0JA 1JG6A 3CC8A 3V42A 4CUJA 4PONA 2C7OA 4EJ6A 3M3PA 1W7AA 4KFUA 2PGXA 4ZRMA 2G1PA 1QC5A 4EF5A 3FXAA 1U8ZA 3JWPA 3P0IA 4JR0A 3TNYA 1WDLA 4JJFA 3L7CA 3FRHA 3P9ZA 3HV2A 3RIYA 4BLPA 2DF8A 2EOAA 2HYIC 4ZQCB 4K2AA 2JFGA 3IILA 3VSBA 4CR7A 1CSEE 3FPFA 2A5YB 4I50B 2K7FA 3KKLA 2EU8A 1LS6A 1T5IA 4YGXB 3L8HA 3PKIA 1NYLA 4H15A 2I4OA 2OYCA 2QD5A 3RAFC 1QFXA 3VNAA 1FNCA 2NACA 4WI1A 5EUMA 3FCOA 3KLBA 3WGJA 4CM8B 3UXYA 2AJBA 3VO9A 1Z8DA 3WIDA 5A4DA 2H1OA 1EUCB 5F51A 4G63A 4BP1A 1W88A 2W83A 3QVTA 4YK7A 5K20A 3GRPA 3GVIA 4V0SA 3VA7A 1M8PA 1QIJA 2IEBA 3DZHA 5FWXA 3QH4A 4P38A 4ML3A 4ZV9A 3U56A 1NU8A 1F06A 4RIIA 1QYWA 2FSGA 2WIJA 1SCAA 3I3OA 1EXDA 3QITA 1L5SA 1BE0A 1BEEA 1IJKA 1B42A 4FCWA 1FVOA 1CNEA 2UVPA 3OJEA 4H27A 3THRA 4EJSC 5B1HA 3I6ZA 4D81A 3ASVA 1KI6A 2PH3A 1G17A 4JU9A 4NP6A 3S2UA 3LNCA 1AGNA 1U2TA 4ZJPA 3BICA 1SK9A 3LF1A 1WBBA 4KGZA 2XUAA 1I80A 3K92A 4ZCRA 1EGMB 2I03A 2PDAA 3OETA 1Z88A 2JFYA 4RBNA 1MX3A 2OCIA 3ELYA 5JAPA 3ZVMA 5JTUA 2N1MA 4KE9A 1N2HA 2FG7C 1QH1A 4KLCA 1VE9A 4LHYA 1AUPA 4P4UA 1QGED 4W5QA 4EYEA 2BONA 4AIIA 2J3LA 2JAOA 3ZHTA 4GOJA 1GN9A 3TW6A 4V0QA 3GVXA 1GWNA 2JJYA 5C1PA 2JFNA 3ZPXA 1EX1A 2MT9A 2Q3DA 1GQFA 2QVLA 1HDCA 3QKSA 1JGTA 5EESA 1ADBA 1JXAA 3I2IA 2WQZA 2WJWA 2GZDA 3RSGA 3COZA 3AVPA 3FPEA 3LOPA 3I39X 1O4WA 2VUUA 3F6EX 4JUCA 2GA9A 3NHAA 4RV4A 4U6NA 2FPWA 1CV2A 2XTNA 5TQ2A 3VQTA 1QYXA 5I9LA 2CEKA 3GRYA 4C4ZA 2QRQA 2ZSDA 2IPLA 3U7GA 4FPXA 1RSZA 1ULAA 1ZMXA 4YHBA 4E3ZA 2QD1A 5KTMA 1USIA 1UKZA 4RPIA 1FA9A 3S0JA 2FVYA 1PJ2A 3HDYA 1DEOA 4LGVA 4KVGA 2NM0A 2P6PA 5J2UB 4NPHA 1RTKA 1FDVA 3CQ9A 2HU5A 3PB3A 3CLRC 4IEIA 2DPXA 2P5SA 1PSDA 1VJRA 2ZT7A 4JXKA 1HF3A 3BJMA 4MRSA 2GZHA 4KXNA 3IP9A 5HNKA 1YJ8A 3QV1A 1PKXA 1QGUB 1RPJA 1KYXA 4A2PA 4WACA 4YMUA 4KQWA 3W34A 4DA8A 1EUQA 2GPBA 1N9GA 1HMYA 3FF1A 1ZQ1A 1X86B 2IYAA 3EWSA 3JY6A 5DX0A 4TOIA 5SZKB 4LYAA 4MV4A 5BSKA 5L51A 2DWPA 3I4LA 3IIJA 3K5WA 4IQFA 1XALA 1PRYA 4LV6A 4PHHA 5DEIA 1ULTA 5DCYA 1W0KA 4A3SA 1QHHA 3W7VA 2B35A 2Z3WA 2F7SA 1DJNA 3E5RA 3BJZA 1M8JA 2CNLA 1P39A 3WLKX 1E32A 1LPPA 4BV2A 2D0IA 1FF9A 3R6TA 4EL5A 2G77B 1EFRD 2W6ID 4HZUA 3T52A 3V1TC 2FMUA 2JG3A 4O2BB 2GO7A 3UHAA 2HPHA 5B6IA 2YWBA 1G8GA 1QVRA 3NC0C 1GFWA 1IMOA 1X0XA 2QXYA 4IJWA 3MHTA 3HDHA 4DNXA 2C5HA 2H7YA 1GV0A 3KUDA 2JBHA 3ANXA 4FBMA 2PR7A 3HKBB 4FLMA 4FYVA 2CLIB 4YRLA 4DL9A 2A2ZA 1ND6A 1U2GA 1CZNA 3UHFA 3BX1A 3M6UA 4KRYA 4LFAB 2G4CA 2A1TS 5BV8A 4RLFA 4WY8A 3CEAA 1JMYA 5J5AA 2HSWA 1YMQA 1UOOA 4MYRA 2X0DA 3FYSA 1ZJ6A 4S24A 5F2EA 4KIJA 2J0UA 2DFKB 2YUTA 3QJGA 4BX0A 5AW2A 1NATA 3KBOA 3QUQA 4MCAA 5JATA 4HUQA 2I6TA 2H2FA 1WVMA 2Y76A 1JE1A 3GXBA 5ITZB 1MH9A 3AIKA 3CGWA 4JUDX 4DQ0A 2C29D 2I66A 4OJQA 4A26A 2I1WA 4W8OA 2Q46A 2HSZA 1RXYA 4YS6A 4PZ0A 1E0JA 1KQPA 1BCRB 2Q5OA 2NUAA 4FGUA 1AB5A 5ITVA 1N6PA 2Y68A 3OM1A 2P6NA 1PKEA 1KOLA 2ASVA 3Q2KA 4AZTA 4ABYA 2R6R1 1SKYE 3QEAZ 1FU8A 1HE2A 1QLHA 2NZWA 3ZE9A 1HZJA 5I7UA 1DG9A 3PQCA 3DULA 1V7ZA 3VOTA 1QU2A 3Q7IA 1LBEA 4KH1A 4D8TA 1FFDA 3WL4A 2GRUA 1QIEA 1G20B 1GL6A 2X3FA 3MN1A 5TRTA 1ZIDA 3ZY6A 3LWZA 4BVEA 1AA6A 2WT9A 4N3NA 5KUTA 2GWHA 4HUJA 2NTVA 1DEKA 3KSZO 4UATA 1I1OA 2YWDA 3GCWA 5FLKA 3TX2A 2ZIZA 3IR7A 4NMHA 4DA4A 2P7HA 1S02A 3A27A 2YASA 2PGIA 1ZCZA 2AX3A 4GI3A 3TIFA 5AOVA 4E46A 4F7WA 4OA8A 2PMWB 1GGFA 3H8JA 4NK4A 4QAQA 1TM2A 4RAQA 4E2WA 4HVCA 1CS4C 1LC3A 1CF4A 1P75A 1KY4A 4MNTA 4RMNA 4RMHA 1SC6A 2GK3A 4UW9A 2Y05A 5JNUA 1CUYA 1EFAA 4TQAA 4D41A 2NNWB 2NUBA 2QI9C 4O4IF 2CL0X 1A82A 3LC2O 2DPLA 1EXMA 1JR2A 3GGPA 3IH5A 4QHSA 3RAJA 5D01A 5F1YA 3SMQA 3GP3A 2V96A 4B9AA 4K6HA 1GTSA 3HABA 5DM60 2ZKLA 3CGGA 1Y1PA 1YE8A 2QIOA 3TUZC 5FO1A 2W8BB 2JLYA 2B36A 3AIMA 1DPGA 1QBGA 4K6MA 1PZFA 2OFPA 1NULA 1I4WA 2G83A 2JCYA 3H5NA 4QTZA 3BD7A 5HUQA 4KDFA 3ZCUA 2QGFA 4CKEB 1GG5A 1UDBA 4UCFA 1D2NA 3I2GA 1VSUA 2AD5A 2LCIA 1YR2A 4C0WA 2QYHA 2JF0A 3G7UA 1OAOC 3JARB 1KAQA 5T57A 3Q7QA 1QYDA 3O8OA 4U1RA 4CM7A 4E7PA 5KX5B 3H18A 4RF4A 4N0MA 1V5IA 2XBUA 3PNMA 1RWQA 2QZZA 4YR7A 1H3FA 3B13B 4ZT7A 2P3SA 5B4UA 2C7QA 1M5TA 1WB6A 2V9ZA 4MR8B 2NU7A 1A9RA 5FV7A 1QG6A 4UOZA 3JWJA 2AN9A 3EWNA 3UM9A 4CI0B 3VYVA 3GBVA 1FLNA 3FR8A 2GHTA 3G1TA 1V26A 1J5EB 1DEAA 2P65A 4MO9A 1VYUA 1V8BA 3MSXA 3OKFA 3GEHA 3LKBA 4OJYA 4WY5A 5EMKA 3W05A 4DCCA 3PNSA 4BLQA 1P9WA 3EIUA 2ZTLA 2VAWA 1GLNA 1CCWA 1T15A 1W6RA 2ECPA 4BX8A 3QFHA 1M2VB 4OSPA 4Q93A 4UNNA 5AHRA 4CMGA 1H2YA 4RVDA 3VO8A 5AI5A 1U0TA 4BVHA 4JNKA 3R0ZA 4XLLA 3LUKA 4EH1A 2GEKA 4LBVA 1PW7A 4QLBA 4B6EA 4G0QA 3GV0A 4ZREA 1U2DC 3BWDD 4I36A 5JSUA 5TSDA 2GPWA 3FCXA 1RRMA 4OHRA 3GLVA 5AD1A 1OBFO 2G1JA 4DUYB 1ZEMA 5JALA 2A0WA 3GAAA 4WL0A 6AT1A 4TXHA 4Q02A 1X94A 4PLYA 5IRCD 5KYVA 4KW7A 1PZXA 1HK7A 1SM4A 2FXVA 3LUJA 4XWTA 2GN9A 3X1DA 4AP6A 4DSTA 4PX2A 5CB0A 5CJ2A 1G5HA 3I30X 4HAWA 2ZT8A 3FAZA 4JC4A 4JZYA 5AKJA 2JLZA 3QVXA 4RMGA 3TRDA 2INGX 4URWR 1JJIA 4MGEA 4Y2YA 3IMKA 3SIWA 3CW2A 1NW4A 3P71T 4HDMA 4ZT2A 1IHYA 1WU7A 2REQB 5BVHA 3D2BA 3G2JA 3V80A 2NXWA 4JOCA 3LQ2A 3CUVA 1QHGA 2D00A 1JX6A 3C7TA 2QP9X 2XUQA 4IKOA 4DXDA 4BEVA 3QE4A 3H9UA 4RQUA 1DPFA 4TGLA 3D8RA 4D4JA 3GX1A 1JECA 4GPD1 4UHHA 1PV2A 3EXIA 2P9BA 3BH0A 5T5QA 2HQSA 2BVNA 4JVNA </