3B7GA

Human dead-box rna helicase ddx20, conserved domain i (dead) in complex with amppnp (adenosine-(beta,gamma)-imidotriphosphate)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
ADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX20
total genus 69
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b7gA00
1E79D 3TSOA 3SS8A 4PSKA 2JJ1A 2GCPA 3TQFA 3ZYCA 3BIFA 1NLYA 1XTIA 2IA5A 3MRSA 4PSVA 1II8A 5EE3A 3UMRA 1E32A 1U2RA 1T0JB 2REBA 4TN1A 3K9LA 3JZMA 3L0PA 2G9NA 2JIZA 2X77A 2F43B 2QN6A 4CYMA 1B23P 4M1WA 5FI1B 2XXAB 1G8FA 5DSZA 4ABYA 5BYJA 5F3WB 1VPLA 4EJSC 1KSHA 3A36A 3I73A 4OHYA 1XMVA 3B60A 4PFSA 5JHHB 5AJWA 4J0QA 5H1YA 1ZJ6A 2QP3A 3AKEA 3Q8XB 1SXJC 1KMHA 2ZRBA 1GZSA 3OF5A 2BMDA 3BWDD 5P21A 5EJEA 3ZGXA 4BLQA 1N6NA 5C46F 5K8IA 5AUNB 3AVUA 2QP9X 2UZ3A 4XD7D 3BERA 1E2NA 3PQCA 4ZI2A 3U5ZB 2IXFA 1Z6TA 5JSZB 3GMTA 2JA1A 3BJIC 2X2EA 3B1VA 1E9RA 5DHFA 3HYRA 1WQ1R 2OBLA 5CB6A 4Q02A 3BH0A 3CF2A 4F7WA 4BLRA 621PA 2BEJA 1N5IA 3EC1A 3LVRE 3W6PA 1E69A 1Z0FA 2X19A 1ZIOA 3AF3A 3W6OA 4LPSA 2GHIA 4HB0A 2CCGA 3ECCA 4HUTA 4C0HA 1G8HA 1P75A 2O8BA 2A5GA 3F5FA 4RZ2A 5AUOB 3B82A 3L8YA 3CF6R 2P6RA 4TYQA 1ZU5A 5JCPA 1YR9A 2J0UA 1N6KA 2WJVA 2IX3A 1OXXK 2FEMA 1KNQA 2GXQA 5JRZA 4DB2A 1OXTA 4OI2A 4Y0AA 3I61A 1Z8FA 2QMOA 1WP9A 2F7SA 5IT5A 2BBSA 2VA8A 4Q18A 3KKMA 3THXA 2NO0A 2BC9A 2C78A 2XTZA 3FYHA 4JBYA 1A82A 1XCPA 5D3QA 2ZI4A 3OAAA 4Q7LA 2ZE6A 3BS4A 1ZM9A 1ZBDA 1JB1A 1JNYA 5BW8A 2AL7A 1S9HA 4DRZA 1OV4A 2QI9C 1EFUA 5JI2E 4DEYA 2DPXA 4PC2A 3GPLA 2LWIA 5IHPA 1TU4A 3ADKA 4R9UC 3W6NA 3EPLA 1ZU4A 1A7JA 1N5LA 4G1UC 1R2QA 1G64A 1G3MA 3LX8A 5SZJA 2QM7A 4IDHA 2FGKA 1ETUA 3EWAA 2HT6A 2OILA 1NNEA 1ESNA 5FR2A 3B5JA 3SE0A 2DCUA 4OHWA 2XNDD 3MJHA 4B3DA 4TZ0A 1OB5A 2OESA 4GMDA 3GFOA 4RVCA 5GJCA 3W5JA 2ANCA 2QZ4A 3KJGA 5F9FA 1L4YA 1OXUA 2QL6A 1NLFA 2R6GA 3QPWA 1JECA 5E7JA 3U60B 4EPWA 4GZMA 1KSFX 2GCOA 1GNPA 2AXPA 3HR8A 4TLAA 4OYHA 1VG9B 2DB3A 3MWKA 5HZKA 1OXSC 1H8HD 1YZGA 3C15C 3I32A 1DO2A 3UATA 4C3ZA 3C7KA 1JR6A 3K0FA 1X86B 4OK5A 4BRWA 1EWRA 2N42A 2ZRHA 4PHGA 4C7OA 2V8OA 5JJIA 2QA5A 1GFIA 4LYAA 1KI3A 4MH0R 4Q48A 3UK6A 3K0CC 1XWIA 2D62A 4DJTA 1EX7A 1VCMA 1NF3A 3H2YA 1XMIA 3B78A 4I81A 1P9WA 2ZM5A 4US0R 3L43A 1XEFA 3OE7A 4OJKA 3MWJA 3DVLA 1NI3A 4H9GA 1GIAA 5CK5A 1TMKA 4A2PA 3A1WA 4XH9B 2HYDA 1S0UA 1F48A 4AKGA 4XTCS 1XFAA 4JT4A 3SDZA 1C9KA 1VYUA 1NG1A 3WYGA 3ADCA 4PO9A 3Q5DA 4JBWA 5KUTA 4PZYA 2ZEJA 1T8UA 5DYIA 4UJ3A 2BWJA 2AFIE 1US8A 4C4PA 5LPNA 2ZYWX 4D2IA 4OK6A 3SJZA 3K0SA 1G5TA 5DE3A 2I3BA 4I1SA 1EK0A 2KB0A 3UXMA 1P7CA 2ZI7A 4N1AA 3ZLJA 2QAJA 1UAAA 5FUVA 2NO7A 3R8FA 5EUMA 1KIMA 4MYCA 3PUWA 5HKKD 1D9ZA 4G01B 4OQLA 1U9IA 4ZCIA 2N1BA 2O5VA 4BZQA 4IHQA 1CIPA 5DHAA 5FOTA 3K70C 4V0NA 1IJFA 2BKUA 1W36B 4UKDA 2AKAB 1G6HA 2LKDA 4KBGA 3SYKA 2HCJB 3KUCA 3I1FA 3VTKA 4D6PA 2H92A 1SKQA 1UBCA 3VFDA 2J45A 2IWHA 3QKRA 3QXHA 3QKTA 2BMJA 1E0AA 2YWHA 3TJZA 3CF0A 2CK3A 4B74A 2FFAA 2NOAA 3SYNA 3D31A 1L2TA 4CEJB 3LBIA 1W36D 3ZZTA 4LHXA 2FOLA 4HZUA 4JL5A 4FMBB 3H1TA 4IDOA 1CTQA 3AF1A 4Z8YA 4ZDJA 2CVFA 2H16A 2H7VA 4OI4A 4BGDA 5KYKA 1XBTA 5E7MA 5FUWA 2I1QA 3EIEA 4A0FA 5K8UA 3CM0A 5BN4A 5TY0A 2R6DA 4O25A 3K1JA 5ANRB 3CONA 3SBEA 4HI0E 1S1CA 1Z28A 2BEKA 4P4UA 2Q3FA 2PBRA 1GKUB 2VLIA 3T61A 1G7TA 1KDRA 5FUXA 2KSQA 1QHNA 4YMSA 1TNDA 2BM0A 4A6PA 1WF3A 1RRCA 4KV9A 1WBDA 4XTRA 5LD2B 2P5SA 3MLEA 3GJXC 1G7CA 4KU4A 4DB4A 4KFTA 4F91B 1GL7A 2MSEB 1PUJA 2NQ2C 4WW0A 3SZRA 1II8B 4A36A 3M4YA 1XTJA 3RWOA 4K46A 3BBPA 3PUXA 3B1ZA 1ZMXA 3NBXX 4M1SA 4QOSA 3R7WB 2YNMA 2WWIA 1TEVA 2GXSA 4IDPA 2JLXA 5CIWA 4N0DA 5L3VA 4NCJA 2ZU0C 4DHEA 1KDTA 3OFND 1G5RA 2ZJAA 3RRZA 1XXHA 3S1AA 2OLJA 5H70A 3ZS9A 2QRNA 4AYWA 1H8ED 1EFRA 3KXKA 1SXJA 1E2QA 4KITB 3RS0A 1PV4A 2ATXA 1JAHA 4A0GA 1XMJA 1N6OA 1VMAA 5FBVB 1LVGA 2ODBA 4GI7A 1KO8A 4BECA 1NLZA 2JJ2D 4ZCLA 2X2FA 1KYIA 3R7WA 4HUQB 1TUEA 2BBTA 1Q22A 3FKQA 1E9EA 5G3ZA 1WDTA 3QXXA 1COWA 2NTYC 2XTNA 4G0NA 1G3IA 4H1VA 1XMSA 4MGZR 2RHMA 2WJGA 3G0HA 2B8WA 3BH6A 3PUYA 1SXJE 1HT2E 3TAHA 4U00A 2XB4A 1X8KA 4DCVA 2A5FA 1SKYB 4NCHA 1ZIPA 1SXJD 1II9A 2FNAA 4I4LA 1ZNWA 4XSGA 4TLDA 1Z08A 4XVRA 4UXHA 4DCSA 1VCOA 4BASA 3CRVA 3W3AA 1WCV1 1DTSA 4RD4A 3NBFA 3HU3A 5EZ5A 1PLKA 5FL3A 2ZYTX 1Z22A 5CDFA 1NN1A 1V43A 4A2QA 1TEXA 1RC8A 2OFOA 1Z2CA 2G0NA 2QE7A 4IOMA 2Q9BA 2GZHA 2ODNA 5CLQA 2F1RA 3RS3A 2WIBA 4PC1A 1AS2A 2NO6A 2MMGA 1AZTA 3ZVNA 1N6RA 3VAAA 4TT3A 3ZQ6A 3CW2A 2KWIA 5BN5A 4MUBA 3GJ0A 1QHGA 2C03A 4RD3A 3JVVA 3QBTA 4P31A 2YINC 4L15A 2TMKA 4BEBA 4DIDA 5DGXA 3VNVA 3HU2A 3CR7A 4NCIA 3THOA 1KOFA 2GVDC 2F9LA 4JLVA 2AWNA 2VHQA 1NVXQ 5FOXA 1MRNA 4FWTA 3N5CA 4BFSA 1IXSB 3GLIA 1XTQA 2DR3A 2RH5A 1P62B 2CCKA 1YRAA 3CWQA 3N2IA 2F3RA 3SJAA 3DZDA 4D26A 2FEOA 2VP5A 4NCNA 3FFAA 3X1WA 1E99A 1JXMA 3AV0B 3MG9A 1H8EA 2NZ8A 4A0HA 2IS2A 2NIPA 4YLGA 3HYTA 1ZUNB 2Q21A 4DWJA 1NJFA 4ESVA 2ZRPA 1KY2A 2OAP1 1D5CA 1T5LA 3EAQA 4Q7KA 5TV2A 3R9WA 3GJ3A 4E03A 3GLIE 3D8BA 1ESMA 2RCNA 3H0KA 3K8YA 3FB4A 4GRAA 3L2OB 3Q85A 2QEQA 1KSJA 1HQCA 2IEYA 2AR7A 2XNSA 5TDHA 3RS4A 2P3SA 4PPNA 1IBRA 1CR0A 5H68A 1NRJB 3HU1A 4LSGA 3HJNA 3Q5EA 1R0XA 3F3YA 3TK1A 1XP8A 5KDOA 1MO6A 3RS2A 4JVSB 4DDVA 4TZ6A 5A4JA 4W5HA 4KFUA 5E95A 1UKEA 2ZXUA 3QUSA 4GNKA 2AD1A 3K9GA 3Q7PA 4LRWA 4LJ5A 4RD2A 5DI9A 2OBNA 3SFZA 2ANBA 4H1UA 4WAUA 4LZZA 4HUQA 5KTYA 1YR7A 2FGJA 3WYFA 3ZH9B 1MH1A 3QKSB 3EASA 3GJ4A 1VCIA 2OXRA 1U0LA 3EIQA 2WZQA 4PHTA 2CLDX 4KSCA 4BFTA 4BE7B 3C16C 2YV5A 3KJEA 4RD0A 3SBDA 2Q3MA 4EFNA 3RLFA 1X1RA 1XD2B 3VX3A 4JIMA 4DLSA 1U8YA 3H4MA 1KHTA 4TYYA 2WAYA 2GJAA 2I4IA 5AJVB 4C0LA 4CEJA 5EP2A 1QRAA 4R7ZA 1HH4A 4KVAA 4KSBA 1FP6A 1NKSA 1QG4A 3IGFA 3QE0A 4G5GA 1GM5A 1Q57A 2WSMA 3AVOA 4BLSA 1CS4C 5E3HA 2QUZA 3PCRB 4JYCA 1FMJA 4Q7MB 5CJPA 3DM9B 2CMKA 3QQ5A 3NHAA 4TQAA 4US1R 1TQ4A 1XZQA 3FTQA 1NMXA 5IDVA 2PZFA 2VL7A 2GKSA 4IOLA 4NTZA 4POAA 4N0EA 2BMFA 5EP4A 4IOJA 1SZPA 1U81A 3IQXA 2OHFA 2YOFA 4LBYA 3BORA 1OXVA 5IF9A 3KFXA 5CJ2A 1OYWA 3QY0A 4ITRC 2JIZD 2RGXA 1OFHA 3T5DA 3OE7D 1EFCA 2EW1A 1W0KA 2XSZD 1Q1BA 3SR0A 2W0MA 2XZOA 4C0SA 2C96A 4PX9A 3AEZA 3GFPA 2WWGA 2PZEA 2V55B 3OESA 4KFRA 5FPSA 1KJYA 3CH5A 1T5IA 2EYUA 4US2R 2IYVA 2QTHA 3U6KA 1DOAA 4LBWA 1MT0A 3THXB 4MKGA 3RSLA 2FU5C 2YC2C 5FPHA 4XD7A 3U3RA 1H65A 2WJIA 3VR2A 4L9SA 3VU9A 4EQ6B 3KQHA 2HF9A 3AP2A 2ZJ8A 4NP6A 4LI0A 3PUZA 5KSZA 3T1TA 1P61B 1C1YA 3T35A 3V9PA 2Q6TA 2VTKA 4F4JA 2WPDA 3GLGE 1RZ3A 4S2EA 4QHYA 1W4AA 2ERXA 2JASA 1NKTA 2AN9A 2WOOA 2PCJA 2GEVA 4HDOB 1VIAA 2QAGB 3O8RA 4M2LA 5H8WA 3DMDA 4JKIA 1CBUA 4AC9A 3Q3JB 3IPYA 4G5SA 3FGNA 1KO7A 1TF7A 5KNCA 1XD9A 3J81k 1KI6A 3L0OA 3PG5A 4KCGA 1ZC4A 5FOVA 4KYUA 1YKSA 5JI3E 3NXSA 4IDNA 3C8UA 5FOSA 4EIWA 4ZDKA 1GRRA 1RJ9B 1AZSC 5B57C 3A6PC 2P0EA 2YHSA 4LV8B 4DCTA 3TSZA 4O3MA 3U3OA 3AH8A 4L5BA 1MOZA 1E0SA 2ZRAA 2ZS9A 3NC1C 5G40A 3WBKA 4UNPA 1FQKA 1KKLA 4BEJA 1G20E 2ZJ5A 1YHNA 4UQOA 1KMHB 3FFBA 4LDJA 3A37A 3B6EA 3EARA 4BWYA 2FPKA 3B2EA 1F6BA 1W4CA 3P4YA 3DM5A 4MRRA 1Z0DA 4NCKA 1RYHA 2WKQA 2ZIAA 4QBGB 1XD8A 2CE7A 1R8QA 5KPDA 4TWZA 4KODA 1Q20A 1YRBA 4A8JC 2ZVPX 1UBEA 4EPTA 1O87A 1P2UA 4PAMA 2JDID 2IYWA 4C7OB 4TYWA 2RAPA 2C9YA 3TE6A 3AQ4A 3BB1A 3LW8A 4AYXA 3DZ8A 2VHTA 2J87A 4OQMA 2ZE5A 4EPRA 3HWSA 3RHFA 2D2FA 1SVKA 1KJZA 3VX4A 1MO4A 2VHUA 4QJ5A 4ZDIA 5EUQB 3V4RA 2MSDB 1RW4A 4PO8A 2O52A 4ESHA 1KMQA 1NSTA 5K8TA 4KYIB 4ON9A 3LY5A 4PAOA 4ZIRB 3F8TA 4HAWA 4NU0A 2REXB 3PEWA 4HB4A 1I4TD 1U0HC 4M8NE 4ZO4A 3R20A 1G18A 2CJWA 4FCVA 3NEYA 4NHOA 2V9PA 2ONKA 5KPJA 4PTLA 3CNLA 5ELXA 4LV5B 1JJ7A 2JLZA 4B44A 1HYQA 2JLRA 1P60A 2VSFA 2XB2A 3K0EA 3QIAA 1ZINA 1BS1A 4QC2A 2YWFA 1JPNA 1FUUA 1ZCAA 4LBZA 4D25A 2ZAMA 4V03A 1OT3A 4RCZA 5LD2C 1W4RA 3BFKA 2WMOB 1JR3A 4XWKA 1ZW6A 2J5XA 1VG8A 1UFQA 4X8HA 2V6IA 4FCWA 3WBJA 3ND8A 1HURA 5J4KA 2X8AA 4LJ7A 3VNUA 1CEEA 1XDBA 4U5XA 5KU1A 2C77A 4NZYA 3ZVLA 3X1ZA 5HPYB 1KNXA 1VTKA 5JEDA 4QM7A 1R5NA 5KOYA 2N46A 2QMUA 3E2IA 2EFDB 2EU8A 3EPKA 4A0RA 3QF4B 1RYFA 4PPQA 1E1QD 2OCYC 3BC1A 2AWOA 3MFYA 1UDXA 1Q12A 5SZHB 4MRNA 3THYA 3CX8A 1KDPA 4Q5IA 5FI0B 5DN6A 4PANA 3A4NA 3DOFA 1D9XA 3KXIA 1JALA 4RZUA 3CO5A 3TSWA 2FH5B 5FTMA 4OHVA 2ASEA 4TSFA 3JVUA 2R9VA 2VP4A 4TYNA 4LC1A 3P26A 4PHFA 1E0KA 1KI7A 4LOAA 1II0A 2OXCA 2BHRA 2W6IA 2RHDA 4IXNA 2VSOA 1J8MF 4MYTA 2ATVA 3ICQB 3UG7A 2IF0A 4PC6A 2CK3D 1RKBA 1R10A 4P0TA 4Y0VA 4ERNA 2GJSA 1XB2A 1G4UR 4QGFA 5AJYA 5FBLB 2YC4C 5CLLA 3UIEA 3QOFA 4CEHA 2G77B 2IF2A 1KGDA 2GZDA 3CX7A 4P32A 2GF9A 2OG2A 3IPXA 1N5JA 1WMSA 3LXXA 2J0UB 3IHWA 4HAVA 3DL0A 2EVWX 2VF8A 3CZQA 1R5OA 3I3SR 1U8ZA 4II7A 2NPIA 3GLHE 4JJKA 1ZCBA 2FFQA 3AKYA 4DLXA 4Z1MD 4A92A 2D4HA 3QBVA 1P4SA 2B92A 1Q1QA 4MYUA 1DS6A 1G17A 4D4LA 2QQEA 2HT1A 1FFHA 3OZXA 1YVDA 4KXFB 1M7HA 4IJMA 3LLMA 4ZKEA 1BKDR 4D4KA 3NDPA 2V7QD 3GP8A 2C9OA 4A9AA 3FWYA 4V0LA 1G8PA 1IONA 1XZPA 5KSPA 3RYTC 1XPUA 4AKIA 2ZI5A 2ZUBA 1E2LA 1UF9A 4GT1A 4MGIR 1XEWY 1DADA 3AVQA 5DN6D 5HZHA 1GL9B 5DI3A 5C1BA 2AKYA 3B7GA 5FBRB 2GWHA 4C2UA 2XGJA 4C2TA 3F0TA 1D2NA 1FX0A 2QENA 1R5BA 2ZANA 4TSFD 4GMXA 1SVSA 1YZQA 1G3RA 2GEUA 2W2VA 5FTNA 3TUZC 1WBBA 2O8FA 3AVYA 3RRNA 4DDWA 2ZJOA 5L3SA 3FHTA 3QJYA 4O0MA 1KKMA 1W0JD 2R44A 1KO4A 4JLPA 4B47A 4HLDA 2OBMA 2XJ4A 4NL4H 5D3MA 4CDGA 5DO9A 2FF7A 2W6JA 2YWGA 2QGZA 8OHMA 2JJ8A 1DAFA 1QF9A 3KKOA 4Q7JB 4Q1BA 4HLUA 3FHOA 2CNWA 4TQ9A 2DYKA 1AKEA 1U98A 4TMWA 5KNDA 3VHLB 3QI2A 4LC0A 4QNMA 1FW6A 4BLPA 2JLWA 4ZIRA 3KJHA 1ELOA 1OLOA 5J4VA 5JS7A 3TGPA 4TMZA 4MITA 4E22A 1ODFA 1GNQA 4F4IA 2RGNA 5G53C 5GADl 1J2JA 4YDSA 1G3UA 4DZZA 4LHWA 2Z5FA 1N0UA 5LB2A 4RZXA 3GLIB 1DBSA 4P4SA 3A58B 4EJSB 3QENA 4NKRA 4RFSA 3WHKA 4TLCA 2JLVA 2BOVA 4KO8A 5B58C 4ZV4A 2OE2A 1PUIA 2VP6A 4MDFA 4XOIA 2PZGA 3I92A 3GLGA 3AF0A 2JJ1D 1EGAA 1JR3D 2FX3A 3CR8A 2QG6A 3WHLA 4LJ9A 2X1VA 2QSYA 4KLZA 4Q47A 4EPYA 2CHGA 3BB4A 2HXYA 1Z63A 1VYTA 2UZIR 3TNFA 1W47A 4B43A 1NY6A 5TXGA 1D6JA 2ZS7A 1G7RA 4QNRA 1HEIA 3B85A 1YR6A 2G3YA 3KQNA 3NEJA 2WTUA 1FOEB 2QP4A 4C9BA 5EE1A 3AUYA 2G83A 3SC3A 5F2EA 3PITA 1KI4A 3I72A 4DVGA 4L4UA 1HT1E 1OFTA 1PZNA 1TQ6A 4X8MA 4ZI3A 2BIFA 2FE4A 1QDEA 2ECKA 3ZDQA 1LS1A 2BJVA 4DC9A 4P33A 1CLUA 4RSGA 1UKVY 5JBQA 4LY6A 1J8YF 1E9FA 1DEKA 2QMHA 1DARA 4RD1A 1T0HB 1BYUA 1E9SA 2GAAA 3AF4A 3CPHA 4URZR 2IS4A 4HZUB 3GCGA 3EG5A 4ILEA 5J4HA 4GP7A 2BM1A 2V54A 3A1TA 2NO9A 3CIOA 2OCAA 2J0SA 3HR7A 2WKPA 3M0EA 3ZIAD 1GKYA 1T3SA 2V1XA 3QEJA 5FL7D 1G291 1HA3A 3BGWA 2QSZA 3CB4A 1DO0A 2AK2A 3AP3A 3WP1B 3DHWC 5L3QA 5FR1A 1UM8A 3TUJC 2WOJA 1ANKA 4RJLA 2CCJA 4PPFA 4C0KA 1E9DA 4QGGA 3TMKA 4FD2A 4XJXA 2R6FA 3EZ9A 5FPTA 1S3SA 4TMKA 1KZ7B 5E4FA 2WWFA 4Z1MA 1N5KA 1E9AA 1SQ5A 1OIWA 2F9MA 3PXGA 5JCZA 4KHZA 3KX2A 1Z47A 2BCGY 1DELA 5KSOA 4M1TA 1F5NA 1XJ0A 4M4SA 3B9PA 4Q03A 2XSZA 2AK3A 1WA5A 2R2AA 5FPYA 3LBNA 4DSTA 2QPOA 1K5GA 5AUPB 5L3QB 5E7IA 1CJUC 2ONJA 1E2KA 2FV8A 3IBYA 4FMDB 4TMXA 3GQBA 5HCIA 2WSSD 3B13B 4CW7A 2FZ4A 3TBKA 1A5TA 3MD0A 3SJCA 5AUQA 3N70A 4HSEA 2IYRA 4AWXA 1Q3HA 1XCMA 2WMNB 4WXPA 4D80A 4A82A 4FI3C 1GRQA 3PUVA 5TB5A 2GEDA 2ZU6A 4TL6A 4FMCF 1LV7A 1JR3E 1IY0A 2G6BA 3JZAA 2KE5A 5J4LA 1E0JA 1FP7A 1TTTA 1E9CA 3OIYA 1JBKA 1QHHA 1UEJA 3TR5A 4G5QA 5TMPA 4IFBA 4TMTA 1AK2A 5KNBA 3A1VA 3ZJYA 3WYAA 2IW3A 2KJQA 2A30A 2C04A 5GJWC 1W2HA 3ND9A 2IWRA 3C14C 2IHYA 1GG2A 4L8GA 2PMDA 3K0AA 2BJWA 4PQYA 3SNHA 4Q9KA 3NTUA 3I62A 1OFUX 1CXZA 3UWOA 4A2WA 1NY5A 2VP2A 3K09A 1XJCA 4QBIA 1Z0IA 1T6NA 721PA 2QTFA 1RVDA 1IHUA 1E79A 1T4GA 3G82C 4M9XA 3IUYA 1PVOA 2W2XA 2FMXA 2RGNC 2F1JA 2XZLA 2J59A 1IN7A 3WY9A 1A1VA 3SU8A 5CYPA 1NG9A 1E2PA 1GWNA 2DWPA 3HP1A 1JAIA 4M9QA 2QT0A 4DDUA 3U44A 1AIPA 4QG7A 4PC7A 3QSYA 1IOZA 2P65A 4LV6A 2R6CA 3EWSA 1XRJA 2DWQA 4M0LA 1E4VA 3IQWA 1R0YA 1UBFA 5B2ZA 1Q44A 2PJZA 1SVMA 2G1KA 1MO5A 1JQLB 2D74A 1GTVA 2ZS8A 4Q4LA 4UXJA 3CNNA 2OSBA 2VEDA 2FN4A 2OO7A 1HTWA 4V0ME 4PC3A 4B48A 5AJXA 1D2MA 2CEAA 4AG6A 5KO2A 3AVXA 2C8VA 1LS6A 4JZKA 1XTSA 1E2HA 1SGWA 2CVHA 3K9HA 4EUNA 4X8OA 3LVQE 4LJ4A 2LCFA 1OH6A 2OZEA 3VHXA 4NONA 4HB3A 4DLVA 4DLTA 4GOKA 1JI0A 2GBLC 4OHZA 3U3KA 1F2TB 2JDIA 2GTPA 1A4RA 1M1YE 2IYQA 4M53A 1MV5A 1CF4A 5FFMA 3BFVA 3ZD7A 1XF9A 1BYIA 4MKIA 1RRPA 2IYXA 3EIHA 1P3JA 2FFHA 2MMCA 3MAAC 3ZS8A 2JLYA 4HLCA 1WXQA 1OPXA 1ZYUA 4B3FX 3P4XA 2WWXA 1E96A 4NYJR 3AF2A 1W46A 4IW3B 1OH8A 3IEVA 1E1RD 1RJ9A 1AM4D 4Z54A 2ZROA 3LQRA 4G5OA 5C2JB 3M1IA 1Z0KA 4BFYA 4Q9LA 3GJ7A 2HJVA 2G1JA 3IIKA 1T3LA 3GFTA 2NZJA 2IBMA 2OT3B 1EX6A 1XCGB 2C95A 3D3QA 1P73A 5EE5B 1W2GA 1IXZA 4GOJA 4YMVA 2OM2A 4G3XA 5EE0A 2WAXA 4BLTA 1M7BA 2VHJA 3VR6A 4TTPA 4GPTA 3CPEA 5LDDC 4DSNA 4LHVA 4KJZA 1EESA 1Z07A 4BRUA 1CJVC 1KSGA 2LKCA 3K9NA 4A8JB 1W5TA 2ORIA 3B1YA 3BD9A 2DHRA 3QVVA 3W8RA 4CEIB 5KDLA 3C41J 1W49A 1NN5A 1QVAA 3RVBA 4B6EA 2O8EA 1VCNA 3QF4A 1VDZA 1H8HA 2CXXA 2HLDA 3ETLA 4JVLA 1Q21A 2BBWA 1KK2A 3KQUA 3KZ1E 3QEOA 3GLGB 5LBIA 5EXPA 1TUIA 2J1LA 4LX0A 2DFKB 4AIIA 4B3XA 1J99A 3GLFE 1KO5A 5TVKA 5D3MB 1JQJC 1ZC3A 4Q00A 2ZR0A 2QM8A 4I1OA 4AK9A 4HATA 1N3BA 1P2VA 3QKUA 2VIIA 3PV0A 2ZSFA 2O0KA 1YZLA 2CHVA 4JLBA 2OFXA 2A5DA 3AVTA 4QGHA 2JLSA 4DXAA 3ZQJA 1M6NA 1BIFA 3A4LA 3AB3A 3R8CA 4TLBA 4QJ3A 3WRXC 2EWVA 2JAQA 2WWWA 2ZJZA 5GVRA 1RRGA 2B7CA 2J3EA 3THWB 2FWRA 1Z0JA 2IK8A 4EKDA 2RGEA 2J46A 2VP9A 4MGKR 3I5YA 4L9WA 1NBMD 1P72A 2QROA 2H1LA 4WZAE 5JEEA 1IN8A 2FG5A 4U02A 5CM8B 1JEEA 4TYPA 1XJQA 3M6AA 3MJRA 5CB8A 3K70D 1OHHD 3CRW1 4JLDA 3E1SA 2V3CC 1KK1A 4CRWB 2IL1A 1MR3F 4UNRA 1N0VC 4WZBE 1R0WA 1A2BA 4F92B 1M2OB 1P5ZB 3LV8A 3U4QA 2A5JA 3SQXA 421PA 3T1QA 2RGGA 1OFIA 4AKHA 5AJZA 4IVRA 2IXGA 4Q4JB 5IK2D 5A5GA 1RE0A 1VIYA 1YZTA 5DI3B 2XEXA 1E9BA 3FVQA 4RY2A 3KDSE 3W8NA 2Z6VA 4DCNA 1XEXA 2A2ZA 2R62A 2WWHA 2B6HA 1NVUQ 4IFEA 2Z4RA 3CRRA 2QPAA 4IOKA 4NYIQ 3UMFA 1SKYE 5DYGA 4IRUB 1NP6A 4Q21A 3WXMA 4NBSA 5JS8A 3WNCA 1LF0A 2SHKA 1XXHB 4Q1EA 2HXSA 2JGNA 4JBXA 1GP2A 1L7VC 4DLRA 4DEXA 2IYLD 3KJIA 4HAXA 4LUCA 2E87A 4JLKA 4QRHA 1TL7C 1KAGA 5JWRA 2WWYA 4HEJA 1BH2A 5EE9A 5EXXA 4ASUA 3ZIAA 4NYJQ 3AP1A 1RPZA 1I2DA 4RD6A 1NIPA 1T91A 5LB4A 2DBYA 3NBZC 3IIJA 5KDDA 4Q9JA 4RKFA 4Z51A 5CDFE 3VKHA 1G5PA 1HE8B 1M34E 4B3GA 4R2HA 2EFEB 2OCBA 1DE0A 2RKOA 2IUUA 3SI7A 5FTLA 1OB2A 1KI6B 1NJGA 1E2EA 4MKFA 2VSXA 4Q1CA 1IN6A 2VO1A 3K0FB 3ZZUA 1Z6GA 1P9NA 4GL2A 1YZKA 2XJ9A 2ZTSA 3EA0A 4JVNA 2ZRKA 2E1RA 3QNUA 2ZI6A 1R0ZA 3RS5A 1J70A 3DDCA 1U90A 3LWNA 2HUPA 3S1AB 3NIBA 4BFVA 2P5TB 3AVVA 3OIUA 1E1QA 3AGPA 1KAOA 1G8YA 2ZRLA 1FNNA 2ZPTX 4MA4A 3GLHB 2W0SA 4OHXA 1XXHE 1W0JA 4DKXA 2A78A 3D7MA 4V0KA 5BWMA 3EX7C 1S1MA 1EXMA 4BZXA 4IXMA 2RGDA 1SVWA 1ZD1A 4QBHA 4C0JA 3ZZ0A 4P4TA 2ZR7A 1NSFA 2UVQA 2XOKD 3EXAA 1LTQA 2AD5A 4TMVA 4B35A 2YYZA 4OQXA 1N6IA 3GJ5A 4MRPA 4D0GA 4D4JA 4BFXA 1XPRA 3RWMB 1S3GA 2IYZA 2EYQA 3OIWA 2F3TA 1G1MA 2PH1A 2CBZA 3FE2A 4LYHA 1SULA 1KZGB 1ZD9A 4M1OA 1SVLA 2ZRMA 1HE1C 2YOGA 3OEHD 5BN3A 4LYJA 5EP1A 2EFGA 1AS3A 2PL3A 3WMEA 1RFLA 4LYFA 4C0QC 5FOWA 5G3YA 1W48A 1T8TA 2WJYA 3W9YA 3EPJA 2JEOA 4Q66C 3GJ8A 2FA9A 1JEDA 2FSGA 2PX0A 4W7SA 5J40A 4B76A 2PCLA 2ZRIA 1TADA 3EC2A 3NWJA 2ZRJA 2NMVA 4E5UA 1VKJA 4FXPA 4LK2A 3LBHA 4NYMR 1P6XA 2GNOA 1Q0UA 1NL3A 1ZM7A 4LPKA 3TR0A 1Z6AA 3QXJA 4XWOA 4IDQA 3FOZA 3K70B 5EXTA 2HYIC 3O8CA 3T34A 2OEPA 2WBLC 3GLFA 1BMFA 3MWYW 4DLZA 4UJ5A 3A1SA 1NIJA 3ONWA 4QHTA 2V6JA 3W5IA 4UNQA 1RIFA 1R4AA 5HCNA 1E2GA 2ODEA 3RRMA 1P2SA 1S9DA 3EA5A 4GBMA 4ZKDA 5SZIA 3SYLA 3IEUA 1M7GA 2ZSAA 4M21A 4KI0A 5BXQC 4OI0A 1V5WA 3E5HA 2PLFA 1M8PA 4Q1AA 5JHGB 2C99A 3FKSD 2J7KA 3U3JA 3ZVRA 1FNMA 2W6JD 1ZD8A 2ZVQX 4PR0A 1NBME 2D3WA 2IUSA 4HAYA 2XXAA 1XX6A 2GXAA 5DLQC 2YVUA 4Z8XA 3CPJB 3IIMA 4D81A 4LWZA 1X3SA 2GRJA 1RRFA 3B9QA 3X1YA 4D0LB 2Y8EA 4JJZA 4DSUA 2JLQA 3GD7A 3VR5A 3ICEA 1GUAA 4B75A 1IXRC 1FZQA 2OV2A 5FPKA 4Q9HA 3K09C 2YJTD 3AVWA 3N2EA 3RC3A 1CJKC 2BVNA 1BOFA 1EWQA 1GRNA 1W44A 3MCAA 4YDHB 4LBVA 3X1XA 4FMDF 4I99A 1UADA 1AGPA 1GITA 2VH5R 3WNDA 2ZSEA 1ZNXA 2W6ID 1KTVA 3TQCA 1OF1A 1P9RA 4R98A 3QG1A 3SHFA 3MSXA 2IUTA 4BUJA 2WKRA 2CL7X 5FOUA 2GILA 2H57A 4KBFA 2Z0MA 1COWD 1N6HA 4HLQB 1E2IA 1DAEA 2CL0X 2ZE7A 3LX5A 4LGMA 521PA 1F2TA 1GILA 1XEXB 3IILA 1J90A 4CF7A 4AG5A 4M9SA 1U9IC 2RGAA 2QPTA 2B8TA 3NHBA 4PZLA 1YJ5A 1DG3A 4JKYA 1XU4A 3LA6A 2IS1A 3SEAA 2VHCA 2ZETA 3FDIA 2IEZA 1E3MA 3EZFA 1KK3A 3CRMA 1W1WA 1W0KD 1Z83A 1YU9A 2IXEA 3BH7A 3EZ2A 4B34A 3EPHA 1AS0A 2XX3A 3AGQA 3ADBA 3LDAA 3OIVA 1X1SA 2EWWA 821PA 3A4MA 4W9MC 2Q9CA 5CM9C 1E6CA 3CKLA 2EQBA 5FUYA 1WE2A 4AURA 3IO3A 2VPPA 2P6UA 1FUKA 1F3OA 2K5UA 4GSYA 1NMYA 3A8TA 2C9CA 5IRCD 4GZLA 5FTJA 4URVR 2ORWA 5C4GB 2P6NA 3GEEA 3U6BA 4X8LA 221PA 3QVUA 4MRSA 1JPJA 1DPFA 1QHHB 2QAGC 4PZZA 1IN5A 3KB2A 4BPBA 2QE7D 5B30A 4JVMA 1N2CE 2CHQA 2JLUA 1US8B 3NH9A 2QRZA 1OE0A 2R65A 1AQUA 3RABA 2QBYB 5C18A 121PA 2NGRA 1Z29A 3KKQA 2BMEA 2ZE8A 4M9ZA 1W36C 1CR4A 2G88A 2H17A 4DLWA 4OJQA 3RRYA 1OIVA 2PT7A 4MKHA 1U8AA 2HEIA 2H8KA 4EAQA 4CEIA 2OAQ1 3BB3A 3R9IA 1G3QA 3BOSA 2GF0A 5CK4A 1NVVQ 4F38A 1TF2A 5J5CA 6Q21A 3U7FB 1GOTA 1ZNYA 3TAUA 4FWIB 2H18A 3FMFA 4MRVA 4Q9IA 4CT4B 1VECA 1KJWA 1E1RA 4IKEA 3CNOA 4JYBA 4ZCMA 4JLNA 4TQUS 3RC8A 1C4OA 2NG1A 3X2SA 1FTSA 1UKYA 1O3YA 1AA9A 1VYVA 3NVAA 1DAKA 4TL7A 5JJKA 3FHCB 5DIFA 2RB4A 1TQDA 5J4YA 2W58A 3L0SA 4QKQA 1Z0AA 3B8HA 4RCYA 2P2LA 3TW8B 3MMPA 2ZUDA 3T5GA 1GNRA 1PLJA 2IC5A 4V0OA 1DAMA 1SXJB 1U0JA 3BAFA 3KFVA 4HZIA 4LJ6A 4UXIA 1G9XA 2D06A 5G41A 3U4QB 2W83A 2WIAA 3KXLA 1Q1ZA 4DLUA 4U7DA 3U7GA 3PFIA 1UDWA 4OBEA 1IY2A 3KKPA 4WVFA 2FPMA 4BLOA 4LJYA 2PJRA 2IHBA 1G16A 3THYB 5EZ6B 2CLCX 1ZM3A 2D2EA 5TARA 1Q3TA 4DUGA 3TLXA 2A9KA 3X1DA 1Z5ZA 3P1JA 4C0BA 1OJLA 3VQTA 4OK3A 2IYSA 5JFGA 2Q3HA 4JL8A 4MDEA 1G8GA 5EP3A 1EG7A 3L82B 1FQJA 2L0XA 5AWFC 2B21A 5EQTA 3OAAD 3UG6A 4O2LA 1R7RA 4UNSA 2A3RA 4WXRA 4DCUA 2RGBA 2REOA 1OSNA 4JT2A 1N0WA 1QBKC 3RDPA 4ACAA 3PJRA 4P3YA 3DPUA 2JATA 3T06B 3EZ6A 5UKDA 3CLVA 2OLKA 2QNRA 2ERYA 3KQKA 4TLEA 4E09A 2GK6A 2F1HA 3TRFA 3DKVA 4WA7A 3ADDA 3IDQA 4W5WA 4ARZA 4XVUA 4GDFA 3VKGA 1QZXA 1UJ2A 1QHSA 3REGA 1XNJA 3W90A 3I8XA 4XWAA 4R71A 4YMTA 2J0QA 3GLHA 2WJJA 3TKLA 4QFMA 3VMFA 1QHIA 4DT1A 3THWA 1NBMA 3BRWD 4FW9A 2XITA 1TAGA 2WPDD 4HLUC 4N3NA 4A6XA 1BO6A 4Q4AA 3L0IB 2GETA 2I1VB 3CUEF 2FZLA 5EXSA 2QGNA 4JLMA 3GEHA 1IJEA 3NKVA 4EPXA 3FMPB 4WIAA 3PEVA 1YZNA 2OCPA 2ZREA 5JZVA 1XPOA 4A8JA 4A1FA 4B2LA 4Q1FA 1YR8A 1TQ2A 2ZSDA 1S2MA 1S4QA 1VG0B 3B1WA 3SJBA 5KHOC 3MWLA 3QXSA 4OI1A 2HV8A 4URXR 3TVTA 2W2TA 4EFMA 1Z6YA 4MQBA 4CIDA 3W34A 2XTMA 4EFLA 1KO1A 4TTRA 5GJVC 2BKEA 1M74A 3WMFA 2DFTA 3FPAA 1Z3IX 3IO5A 4Q4AB 5C4MA 1HQYE 2E9SA 1X8LA 3OEED 2GAOA 1F2UB 2G0TA 3REFA 4AI6A 3ASZA 4FN5A 2QTVB 3EZ7A 1E2FA 1VG1A 4M1MA 4RFVA 3V4FA 4Q1DA 4MYHA 3PEUA 2IS6A 1MKYA 1D2EA 4URYR 4NH0A 4WOPA 4AKEA 2ZQ5A 4QGAA 5IK2A 4HAUA 2GBLA 4JLAA 2VYFA 2CNWD 3AVPA 2DWOA 4PXAA 2YKGA 1ZM4A 2EFCB 4OQNA 4DIEA 4AY2A 2AFHE 2Z83A 5CYOA 3IHLA 2NO1A 3H86A 3FMIA 3O47A 1S8FA 4I1VA 3E70C 1EFTA 1OW3B 1SHKA 2C98A 2Q9AA 2GA8A 1ZVQA 5J47A 3GJ6A 3VR1A 3Q9LA 1EFRD 1FX0B 4BFUA 3VKWA 1OH7A 2ZJYA 4NE2A 1B0UA 4YONB 4B2IA 5HKKA 1ZM2A 1UEIA 3SOPA 4ASUD 3NH6A 5JWOA 3BXZA 3LW7A 5HE9A 3UWKA 3O8BA 2AHOA 1GSIA 4DBLC 2GJ8A 5HR5A 1CULC 2ZI9A 4UNNA 1W5SA 2ZJBA 2WHXA 2HJGA 1G19A 4NPHA 4CGZA 3RSOA 4ZDWA 3L8ZA 1QVRA 3CWZA 4Q01A 1CR2A 3LNCA 5HE8A 5GVSA 3SHWA 3V00A 2O0JA 2BCJQ 1LY1A 1Z06A 5AR1A 1KI8A 2OUKA 3NG1A 1SVOA 4KLNA 4QL3A 1ZP6A 3RS7A 4FMCB 2XNDA 5JJLA 1XEWX 2O8CA 3P27A 1K5DA 1W7AA 1LW7A 2CDNA 5B64A 4NMMA 3OEEA 4V02A 2WICA 3ASYA 2WJHA 3AKDA 2HLDD 1JXOA 2J0VA 5BQ5A 1R6BX 3R9XA 2GDJA 1GDDA 5JMTA 2WV9A 2F1IA 4URWR 3DO6A 4P4SB 4B3BA 1GAJA 3C5CA 3NBYC 4LHZA 2W00A 2IT1A 2ZUCA 4YXWD 2QT1A 2KI5A 5DH9A 2ZRFA 5GJBA 1Y3AA 4A15A 1NN3A 2MSCB 1KDOA 3P32A 4D82A 1NVWQ 1ZUHA 4GP6A 1E94E 4FINA 1T3HA 3UANA 4CVNA 2FSIA 1D8TA 4PAQA 4XSHA 1LNZA 3OEHA 2WM9B 3OHMA 1MRSA 4URUR 2A5YB 2IYUA 2A7QA 1QHYA 4PHHA 3T12A 5JRJA 4JS0A 1X8JA 4YXWA 2GJ9A 3QPVA 4LCBA 3LXRA 4IVPA 3HPQA 3NDBB 2O8EB 4GFDA 4S35A 1CP2A 2KBEA 2F6RA 3A1UA 2ZRGA 4F4CA 2YOHA 3KUDA 1XD2A 1K8RA 1U99A 1ZAKA 3LFUA 1TX4B 1G4AE 1U94A 4M22A 2PX3A 3LRPA 4D4MA 2VQSA 4HYYA 2Z4SA 1R8SA 2ORVA 5FH9A 1NN0A 2QQ0A 4XVQA 1AGRA 2ZI3A 2QY9A 2ZYVX 2KBFA 1CJMA 3K0CA 2ZRNA 4JSTA 4Q4JA 1AKYA 1ZRHA 1DAHA 3LLUA 4WBSA 2PEZA 1BMFD 4KVGA 1SHZA 4G5RA 5JECA 2RGCA 1KI9A 5L8VA 3SN6A 1KK0A 2O8CB 4M1YA 1LB1B 2QAGA 3RANA 2VBCA 4LHYA 4DDTA 4W5JA 3RAPR 3LH5A 3U7HB 3Q7QA 4PO1A 3CZPA 1T9HA 4C30A 2YWEA 4ARZB 2YZ2A 4FIDA 3RNLA 2O8DB 3K53A 5FBWB 5BYKA 2VP0A 1OH5A 2C5LA 1S96A 4IVQA 2ZRCA 2CL6X 4CEHB 2IYYA 3HDTA 4F93B 1E2JA 2AX4A 4BQSA 5CITA 4JL6A 1KY3A 1DAIA 3U44B 1A2KC 4KFSA 3I5XA 1W4BA 4B2PA 4BFZA 4WZ6A 3T1VA 4I1UA 3B1XA 3TW4A 2XOKA 3P20A 1HY3A 4M1KA 3KB1A 2QORA 3SQWA 2FSFA 1JJVA 1OIXA 3U3MA 3VR4A 2V1UA 3TUIC 1UBGA 1LFDB 1ZNZA 2XZPA 5AK0A 1OKKD 4YMWA 3LQQA 2CJWB 1E4YA 3DMNA 3VR3A 1YZUA 2O8DA 3QKRB 4K81B 2QMEA 3TH5A 1Z2AA 4B32A 3QG5A 4QXAA 4OQFA 4BFWA 2O0HA 1VHTA 5L3RA 4E07A 1X6VA 2ZSBA 3FKSA 2OFWA 4O2RA 2QBYA 3BFXA 4IEEA 3PR1A 1I4LD 1Z6XA 4YC7A 1QG2A 2CE2X 3DOEA 3KQLA 1CJTC 4AYTA 1J7KA 1F2UA 2FPLA 3BK7A 1DVRA 1HUQA 3CRQA 2Q0HA 3H84A 5DISB 1OKKA 5CIQA 4DUGD 1N25A 2V7QA 1IY1A 1E2DA 2GK7A 3U2QA 2FFBA 1OHHA 1AJEA 3O8DA 5FBQB 5JSZA 1IQPA 5K8LA 4JLOA 3K0AB 2DFNA 4B6FA 4B71A 3D6TB 2VF7A 3I8SA 4DSOA 3KTAB 2R8RA 3T15A 5L3SB 4EPVA 3I4LA 1E2MA 4HDQB 4Q4HA 4RKEA 1SVIA 2IYTA 1DG1G 2FSHA 1GVNB 3DKPA 5HTKA 3U7EB 4PPGA 1E98A 1L8QA 2V4ZA 3CX6A 3G5UA 3PIRA 3ZD6A 2H5EA 1XTKA 2HCBA 3GEIA 1IN4A 4GOXA 3AUXA 4XIGS 1G41A 5JWHA 1Q1EA 2GVZC 1PJRA 2PT5A 3WP0A 1G21E 1I2MA 1NVVR 1VHLA 3LD9A 3UMSA 3IBGA 3WRYC 2RMKA 3BE4A 4DT1B 4JMPA 1QHXA 3OFNA 2ZYUX 4V0MA 3PEYA 2CLSA 5FTKA 1MO3A 2C2HA 2XAUA 1HV8A 1N6PA 3C4JA 2FJUA 3CBQA 2D7DA 4HAZA 3WNBA 2BDTA 2R6AA 2WVJA 1K6MA 4KAXA 2GCOB 1AN0A 4LJ8A 3TIFA 4EJSA 2O8FB 2ZITA 1FMLA 4TL9A 4YMUA 1UKZA 3CH4B 3AM1A 4JLJA 1IM2A 3VU9B 4AD8A 4EQ6A 4PQFA 4C0AC 1FL9A 2VRWA 4MUAA 4YQFA 2ZR9A 1GL6A 4LJAA 5JLJA 4PSAA 1CR1A 1G6OA 1MABA 2J9RA 1CRQA 3W3ZB 1N6LA 2ZAOA 4FCTA 2F43A 3TVDA 4HDCA 3WMGA 4TL8A 3PENA 4OL0A 3KKNA 4D0NA 3SFVA 2HDNB 3HPRA 4QHSA 4CT5A 4B73A 4QM6A 1F60A 1EFHA 2GXUA 2ZJ2A 3UKDA 2EFHB 2GCNA 5KSYA 1XTRA 1L4UA 1TPZA 3QXCA 1P2TA 1NMZA 1UPTA 2BV3A 2DFLA 2PMKA 5M04A 3MUFA 3KTAA 1DAGA 4HB2A 2GJKA 3IKJA 3NC0C 3LAWA 1TF5A 4TT3D 2D7CA 1ZUIA 1YE8A 1WB9A 3PVSA 2J7PA 2P67A 3QF7A 4IEIA 2UKDA 3LO5A 3KL4A 4B33A 1I4DD 1AQYA 3AKCA 4A4DA 2ODWA 1LF5A 5F9HA 4PQRA 4JSYA 1FPMA 5DNYB 3QPUA 1YQTA 3GLFB 3T1OA 4MGYR 2WSSA 1KI1A 1IAQA 3FMOB 4NYIR 3MGCA 2JCSA 4RZ3A 2FDCA 1CU1A 2PLRA 2ZRDA 4L16A 1TU3A 2BBOA 1FTNA 2QU8A 2GZAA 4TTQA 4Q19A 4DLYA 1CKEA 2B7BA 4Q4HB 3C5HA 3QKSA 3DEFA 4NDZA 2DY1A 4QBFA 2NPFA 4ACBA 5FL7A 1CRPA 1KI2A 1ONBA 3UPUA 4BZPA 4B3CA 3ZVMA 4ZPXA 1OYYA 1MABB 2Z43A 4QJ4A 4EDHA 1WRBA 2PEYA 2F55A 4NYMQ 4CZ2A 1PLLA 2HF8A 3Q72A 1GKIA 2O8BB 4RFSB 2AXNA 2JJ2A 4K8OA 1G7SA 1Y63A 5SZKB 2J41A 3EW9A 3U61B 4OKSA 2GESA 4R2IA 2J7PD 5A0FA 5F98A
chains in the Genus database with same CATH superfamily
1E79D 3TSOA 1PJ8A 3SS8A 1SUFA 1P18A 2G06A 1OX5A 2PV0A 4A8TA 3CLUD 1TKBA 1Y1QA 3ZYCA 3BIFA 1NLYA 1PWXA 3VPDA 1PQWA 5CNMA 4IEFB 5EE3A 4TXNA 1SPBS 3RKUA 3SY8A 4ZCQA 1DI0A 5CTAA 5GQSA 4XIJA 1DJQA 1T0JB 3BDVA 4QDKA 5EZYF 3JZMA 3L0PA 4NBLA 2QHXA 5EIHA 4CKZA 2X77A 1QVZA 2QN6A 4H7IA 5DTRA 3T3MB 1B23P 4M1WA 4UBIA 2BHSA 2XXAB 1NI5A 4NX2A 5IT4A 5DSZA 3HA5A 2LVBA 4EMSA 4ABYA 2Z08A 3DAPA 4O4LA 1VPLA 3GARA 3K9WA 4EJSC 1AQNA 3UPTA 4OHYA 4UHDA 1A1SA 3OM1A 3OZIA 5AJWA 4J0QA 1TKCA 5AH0A 2QP3A 3KVRA 3ZXSA 2VLBA 1M76A 2YN4A 3HK2A 3EGCA 4ENPA 1M2OA 3NHYA 3U26A 5BSUA 4YCMA 5EJEA 4P3OA 1IHYA 3ZGXA 4BLQA 4IJQA 5JTTA 1N6NA 3PHHA 4AWBA 5C46F 3OHPA 2PE5A 3WMXA 3NO4A 1XTVA 4L0DA 2P9ZA 2QP9X 3DA8A 2PWPA 5DN9A 3R3XA 4K9OA 1U4SA 5LNK6 2DOKA 2AIRA 3U5ZB 4UE3S 1PEAA 2IXFA 2IZ6A 1ATZA 3H1PA 3GMTA 3OQMA 1EU1A 4NZPA 1ULUA 3KVNA 4FKZA 4OY3A 4XD2A 4D6YA 5DHFA 2IHJA 2YX1A 3CFYA 3BJRA 1WQ1R 3C48A 5BMVB 2VT3A 3BH0A 4BLRA 1ZSNA 4JDUA 3IV7A 4QXQA 3KQTA 1SCNE 2B9VA 2WLSA 4H1WA 2X19A 2CZCA 1ZIOA 3V48A 3W6OA 2NTVA 3DE7X 2EKDA 4YUWA 1C0PA 2C1ZA 3DBRA 5H16A 3MIIA 1U3CA 2AZ4A 5AHKA 4KZPA 5K0LA 4C0HA 1FSGA 3PLNA 4NWIA 1UODA 1PG5A 2H2DA 4HPWA 2VJKA 2BAGA 3PGXA 1WP4A 5BWNA 3CVYA 1N2CB 2A57A 4O4JB 4OBBA 3J81A 4W5TA 3CF6R 2P6OA 1CDEA 1KYVA 1QE0A 3DMGA 2WJVA 1U9ZA 5HS4A 2IX3A 1D1TA 1T8WA 5JRZA 1EBBA 3H9QA 5KCZA 3OQOA 3PNMA 1OXTA 5JO9A 4B6OA 3KCQA 3T4XA 1ZH4A 2VDNB 3G5TA 2CW5A 3WGJA 1FFXB 3N6XA 2NO0A 2WUWE 3VPBA 2BC9A 4JBYA 1P5FA 2QNBA 2XTZA 4MV1A 3IOCA 3USZA 2ZSKA 2BGIA 1ILEA 2XUJA 1DWOA 2ZI4A 3OAAA 3UB3A 4YCBA 3M6IA 1Y4UA 4WTOA 1GGEA 3EXIA 4X1IB 3IAAA 5EJ2A 3ADOA 3EG9A 1YCGA 1GCGA 4K87A 1OV4A 3SQMA 3UN1A 1GGKA 3MYRA 1VHQA 2J4DA 3OFVA 1EFUA 3FD8A 5NULA 1PW5A 1KL7A 3AC0A 3I8OA 5AVJA 2DPXA 4PC2A 2OR3A 3DTTA 3GPLA 2VJQA 2HHHB 1W8IA 8ATCA 3DBLA 4YJGB 4O63O 2VQDA 1R2QA 1G3MA 1EIWA 5JXHA 3LX8A 2B8JA 2I80A 3GRAA 2QM7A 2VNHA 1EBUA 5DFAA 1KVRA 3Q6IA 4WCVA 5KOJB 2A6PA 2FGKA 4MNTA 3OIGA 3HN7A 1UJNA 3DQQA 3B38A 1FDTA 1GEEA 3L7BA 3JD3A 1C9YA 5K2MA 1F3LA 2XRYA 5IUNC 3A2KA 1FFEA 1MNQA 1G8MA 2B9EA 3ILYA 4GMGA 4H7JA 3V3KA 3EQ2A 5JFTA 5H7XA 2XF8A 2YZNA 1DXQA 1S89A 1Z38A 3GFOA 4RVCA 1UBKS 2QZ4A 2WWTA 1L4YA 1GV0A 1P0PA 3HI6A 3IDSA 3QPWA 3ENVA 4I14A 4QEZA 4EG7A 3G0OA 1NRWA 1P1RA 2VAPA 2Q9UA 1I0LA 2MSWA 4GZMA 2QJTA 2YY5A 1GARA 4HXYA 3LL7A 1G9TA 3G2HA 4MHOA 1OC2A 3MWKA 5HDBB 1CQJA 1OXSC 4F2GA 1H8HD 1YZGA 3C15C 4XWGA 1ZBQA 3I32A 1BOOA 2H52A 3R5JA 5T7BA 1GQFA 4ZYVA 1H6AA 1ZOLA 4BN4A 1JR6A 5ALQA 2N42A 1I7LA 1YJXA 1AXGA 1ZESA 2OCDA 2PHZA 4OQPA 5GM2A 3UK6A 4XR4A 4LCEA 3S68A 4Q48A 2UVPA 3CVUA 4JXXA 1D1SA 4OMDA 1RXEA 3WLLA 1XWIA 3IS3A 5EMJA 4DJTA 2P2GA 2Q5OA 4XWTA 2CNLA 1AOXA 1SHJA 2FPGB 1P2BA 2JFYA 2VH1A 2XADA 2ZDHA 3DD1A 2X0IA 2GYWA 2GUWA 3ETNA 4PCLA 5FEMA 3RS8A 1E6LA 3MTBA 3H8SA 4ER6A 4P84A 5LZ2A 1TMKA 1IEVA 3A1CA 4A2PA 2HYDA 3E82A 3RRBA 3BHJA 4XTCS 2Q6KA 4RIFA 4W9RA 3H2JA 3L0DA 4D3DA 4DRXB 2ZLBA 4ETNA 4ZO8A 2A33A 3ZHRA 3ZJ4A 4BNGA 4COKA 4G26A 1FLAA 3Q5DA 3KT0A 4JBWA 4JGBA 5KWJA 1Q15A 2ILTA 4RF2A 2ZEJA 5ENDA 4ARIA 2XNHA 2EWMA 3M81A 2AFIE 4L4SA 4DB4A 4S1NA 3RFTA 1SN7A 1KJJA 4DQKA 5LPNA 4MLCA 2OCLA 4FYYA 4R2MA 3HDYA 4D2IA 4HYEA 2I3BA 1YQDA 4I1SA 3VDRA 4EEXA 2GN4A 2W6CX 5L9AA 2ZI7A 4WY5A 3KFLA 4J1SA 5EERA 1XLTC 5FUVA 3R8FA 3KYJB 2WYOA 3PUWA 2GZSA 4OQLA 3TXAA 2PKRA 1SQFA 1ZW1A 2O5VA 3BCHA 3FZGA 3DXFA 3JSXA 3OUZA 3OY7A 4U7JA 4ZYZA 2Z5LA 1W36B 5H02A 3I9V6 1JN0A 1V96A 4A6EA 1TJNA 4C1BA 4EHLA 1G5HA 2IP1A 3IE0A 4KMRA 3VTKA 4MVXA 4O8CA 1OBFO 3I1FA 3GGOA 4D6PA 4F3CA 4ZFNA 5K4GA 3QE4A 4U7GA 1WV1A 1QQAA 2H06A 2J45A 1I14A 1RWPA 3QXHA 3IR6A 4GWGA 3ESBA 1GU7A 1XK6A 4W82A 4DR6B 3TJZA 4B74A 3CF0A 3IAS6 2FFAA 2NOAA 3F6YA 1L2TA 3AFIA 1JMVA 4LCJA 1NMEA 3R5TA 1YQ9A 4YCJA 2JNWA 4IHJF 1VMDA 4Z8YA 1R18A 3M2TA 4N5NA 1C5KA 3AFHA 3N74A 1C0KA 1JFLA 2H16A 2JD2A 3OEWA 5TEVA 5KYKA 1OQAA 5HSGA 5FUWA 3OU7A 2I1QA 1PG0A 3B3GA 2BTEA 4G36A 4A0FA 4D3SA 1FSPA 4R41A 1M6VB 3PQEA 5AW0A 5ESXA 2JFXA 5EVJA 2C82A 3PJFA 5BN4A 2NT3A 4QBTA 4MYRA 3AETB 3P0HA 4Y3UA 4IGAA 3UMMA 5GIPE 5CAEB 3ZWMA 5G0WA 1NVMB 1Z28A 3TXYA 3VUFA 2BEKA 2Q3FA 2PBRA 1G21B 3OO1A 2DQZA 2ENUA 2NV2B 1WR8A 3C97A 3L8HA 3T61A 3UFXA 1KDRA 2HA7A 5FUXA 2W37A 2B25A 3CA8A 5I7VA 2YUTA 4MQMA 2BDUA 5AW8A 3MOGA 1JXQA 1MORA 4KV9A 2AI3A 3GIWA 2I3AA 4XTRA 3MLEA 1CUVA 4Q3KA 2CB0A 3U49A 4AN0A 4F91B 2OXEA 3BRSA 4HTFB 3WE7A 1IPFA 4WZAA 1ZUWA 2G1UA 4WW0A 5I4KA 1LDYA 2NP6A 5HS6A 4K9LA 4YP6A 3M4YA 1XTJA 1LRLA 3L5KA 1AUVA 2EQAA 1XRRA 2DU8A 4MJXA 1X80A 2W2QA 1Z16A 1ZI8A 2H5IA 1UOOA 3NBXX 4NNJA 3O4JA 3AIOA 4V38A 3TTXA 1TEVA 2F2TA 4UAUA 3GRUA 3F96A 4NCJA 4CI9A 3T5BA 5JT1A 5LP1A 4HLNA 1QB7A 1S6YA 3PT9A 5B7GA 1SUPA 3QW4B 1W5AA 1KZ1A 3CUYA 2DPGA 2TMDA 2YJ5A 4I6EA 1LDNA 1XLTA 4GZ5A 4LGYA 4FB4A 1MA3A 2ATXA 5CPFA 1MMFB 4WZBB 3UW3A 5GM1A 1XMJA 1VMAA 4RS4A 3KZOA 3OETA 1T8SA 4LDAA 2ZSHA 5D3ZA 3RG8A 3CZRA 4FLFA 1Z82A 3OQIB 4UDYX 1E8MA 2Z2KA 2ZP1A 4N82A 1X1BA 3ORYA 5E1OA 3THWA 5ECYA 3NIGB 1Z5PA 3O2QB 3HU5A 2NVBA 5G0SA 2PUJA 5G3ZA 3R76A 4Z4CA 1QP4A 1XTBA 1QQ5A 2P1DA 3D1VA 2RHMA 3F97A 2PT6A 1GXSB 3G5MA 5K03A 3OTOB 3BH6A 4K28A 1UZUA 3GDWA 2Q1YA 2QS9A 3S29A 4XFJA 2JFGA 1SXJD 1SXQA 1II9A 1MXHA 1Y1LA 2FNAA 2ZJ4A 1ZNWA 2GBIA 3QWAA 3R0VA 4I4LA 4ICIA 3RJ9A 4RKRA 4UTXA 1BROA 4ENSA 2PKEA 5U4QA 4G67A 4MPRA 3K35A 2Q5LA 1TIKA 5BVHB 2B83A 4WFKA 1UKCA 2CDAA 3DXYA 1Y33E 5PNTA 4DQVA 1PLKA 3PCTA 1Z22A 1CX9B 1NN1A 2WFLB 4O08A 1TEXA 2VAMA 5G02A 5CDFA 4AO8A 4B9AA 1Z2CA 5DLYA 1RC8A 3FAKA 4GBED 4TT8A 4WLVA 4DR5B 3FIUA 2J4CA 2F1RA 2ZYIA 2C5EA 3DE2X 4JMLA 2O9JA 4RMIA 1C1XA 1EUQA 1GLVA 3PBKA 1JTEA 3GEMA 4QU9A 4ZWNA 2HQ1A 2HWXA 2OYCA 3ZQ6A 2OBBA 2A88A 2CF5A 3CW2A 4ZU1X 2KWIA 2P40A 3BMNB 4GPD1 4DYDA 5C1DA 3GJ0A 5A6VA 4C5BA 2PUGA 2YQ5A 2AOVA 5DNDA 2C03A 2R11A 1P4GA 2CUTA 3FWPA 4RD3A 2H9IA 1M34B 4LY0A 3L4BA 4DIDA 4P31A 5IJ0B 5LYJB 4ALKA 3N05A 1DOHA 1XTUA 1HYGA 4LTMA 2JIQA 1GU1A 1Z18A 5JCOA 5CA1F 2IH5A 2IPOA 1FFGA 5T3UA 1V2GA 1GQQA 4P7BA 4JLVA 3WZMA 1CY8A 4ZJUA 5KOHB 3M4JA 2ZBEA 3AEYA 4FWTA 1ZN7A 2DUNA 3WC4A 1XTQA 3VHRA 3GUZA 3O74A 1FSZA 1CF9A 3NHRA 3OH8A 2CCKA 3CWQA 3OT5A 4HGRA 4D26A 4E46A 4GI2A 5AHXA 1RYMA 5IJ9A 4NCNA 3FFAA 3X1WA 1E99A 1ZZGA 3ESAA 1W2WB 1H8EA 1JLKA 3WLRA 3WB2A 5JISA 4UBMA 3R2JA 2Y6VA 1FFCA 3QH4A 3HYTA 1ZUNB 3A4YA 4PZCA 5HIJA 4DWJA 5IAAA 2Q7DA 5CEFA 1DJNA 2UVPB 2YJ4A 1Z7WA 1RE1A 3DLPX 1WJGA 1JFSA 2CMHA 3TBHA 5JAQA 4RA9B 4M46A 1ESMA 5KQRA 1R12A 2XWSA 4RTSA 2GB4A 5J2UA 2YVQA 3AW9A 1KSJA 1HQCA 1V11A 2IEYA 4N0QA 4P22A 3PFNA 2Y71A 1K06A 2XTAA 2QQGA 2IDJA 3ACCA 3N0TA 4MWOA 3S55A 1FEZA 1V8FA 4BZZA 2QUJA 2ZXFA 1NWHA 1CR0A 1UC5B 1XKLA 3HU1A 2ECFA 1UMDA 3Q5EA 1R0XA 3TK1A 1KEZA 4GVXA 3R6TA 3UK1A 3E7PA 1IE3A 2O05A 1PJBA 1HEYA 4W5HA 3IAHA 5EZSA 2HL6A 2ZTMA 1O54A 2F90A 3AW8A 1RRKA 3BWCA 4JXKA 4KDCA 3GCZA 3UVEA 4CKCA 3EGXA 1KVQA 3JALA 1QUEA 3W78A 3FGOA 1GAQA 4WAUA 1JKFA 1MJ5A 2PRZA 2WIFA 3OCYA 4LZZA 1QVWA 4UU0A 3W6UA 3T9CA 1HFEL 1IHPA 1L7BA 4GOND 4A1OA 3EIWA 2VUHB 4BLVA 4C43A 3ZIUA 3SHVA 4PHTA 3EIQA 2WZQA 1M10A 2CLDX 3KJEA 5TMBA 4OHFA 2ZATA 3VX3A 1XD2B 2BF7A 1PTKA 3LQKA 1U8YA 1VKRA 1XK7A 4ZVOA 5CYFA 4Z86A 4BJ3A 5LMZA 5T67A 5AHWA 2DLDA 3O5AA 4PVDA 4R69A 3A27A 3MLAA 1FP6A 4KSBA 5E1MA 3RTBA 3IGFA 1XR3A 1Q57A 2HTFA 3A6ZA 2CKMA 4AX4A 3OUUA 2WSMA 2AX3A 2VXOA 4Q1VA 4MW2A 4TVKA 1CS4C 2XLCA 3PRYA 1FMJA 5CJPA 1A69A 3AOGA 3WGQA 4L51A 4BAZA 2F4NA 2CMKA 5AW4A 4TQAA 4C3UA 1E5XA 3PXEA 1WTAA 1XZQA 5IDVA 1GA1A 2OZLA 4U7TB 3VZBA 1UAYA 4UOEA 2BRUC 3FRJA 4N7MA 2UXBB 5JUWA 2BMFA 3PNSA 2HA3A 1SZPA 2Q4TA 2QX9A 3IQXA 4LBYA 3T0GA 3BORA 1VYHA 1YACA 3TQSA 2WMDA 3GT7A 2M98A 2TSYB 4KXNA 2GN8A 4ITRC 4DJ5X 5CDUA 1VE6A 4IVNA 1CUBA 3NT2A 2RGXA 4CIAA 1JS1X 3H2HA 1ISJA 1EFCA 2E3JA 3IAUA 3FXAA 1LK7A 1VI2A 5DULA 3ANNA 2E4XA 2HMYB 2H7CA 2ZYGA 3C8HA 3GH1A 3PX2A 1T9CA 5AKJA 2GX6A 4FLEA 4EBBA 1JKIA 4L50A 4WNIA 4K6CA 2V98A 5FPSA 1CG6A 4NOKA 4FN4A 3PQ5A 2JK1A 4FX2A 1AHNA 5AOAA 5CTJA 4US2R 3U7JA 4RTNA 3NI2A 1JIXA 2BZSA 5ISMA 1DOAA 4IQ0A 2PL1A 4ROSA 4QXPA 3RSLA 3RARA 3KU4A 4WKPA 3N75A 1H65A 1MX3A 5ALEA 2E4ZA 1CUZA 4WXEA 3AP2A 4Y7CA 2JVKA 1LSOA 2ATIA 3D4IA 3AOEA 3PUZA 5BVHA 4I4TA 1YJCA 3NBKA 3MTIA 4L5IA 3V9PA 5FKJA 1EG2A 5GGYA 3K0HA 1VPEA 4S2EA 3ZHTA 2EGHA 4EGFA 4G0MA 1NKTA 2WOOA 1G9SA 4WK2B 3LPLA 5D2CA 3A14A 3ZDFA 3O8RA 3PQFA 3M6XA 4RPIA 4ALNA 1B43A 2R68A 2CB9A 2WUEA 3TLBA 3Q3JB 1TE2A 2XDYA 4GPAA 1TF7A 1JIIA 2IX9A 1XD9A 2PL9A 1U7OA 1RMQA 3L0OA 1RLJA 2VPWA 4F45A 1APBA 1RJDA 4KCGA 1WDLA 4JV5B 3ZU6A 1NVGA 3FYSA 3ZZTA 1Y5IA 2I33A 1QTRA 2Q3JA 3DO5A 4B17A 4NC9A 1JQ3A 1GRRA 1AZSC 5B57C 3FJ1A 2PUCA 4O3MA 1QP8A 4DCTA 3TSZA 2W6OA 4DUYB 4RE6A 2V9ZA 4LVNA 1KC3A 4YDQA 2Y1CA 3CYFA 2ZRAA 5C7YA 2C59A 5LA6A 3WBKA 1C9EA 4CQLA 3NALA 3RIGA 4UQOA 4AJ1A 4DLPA 4GXNA 4RTJA 4NQRA 2NXWA 4AS3A 4BO4A 5E9QA 1YA6A 4NDAA 5BSMA 5BMOA 2BCEA 1RQPA 4X3PA 4EY6A 7ADHA 1YFKA 3LYUA 3O26A 4H4DA 2LIPA 3E22B 1W4CA 4PXYA 4MRRA 1Z0DA 4DDHA 4B3TB 3WIOA 4IZOA 1E7SA 1XD8A 3V1LA 2CE7A 4HRAA 3WIEA 5KPDA 2JL1A 2LR0A 4TWZA 2IU6A 1NW9B 2XGMA 5EJ5A 3I5UA 4PAMA 1U63A 4B82A 1Y1RA 1QANA 4JEHA 5T8KA 2IIPA 2Y0CA 4N3GA 3H9JA 2A67A 2CMDA 2WYIA 4M0KA 4ZQCB 4AYXA 4PGAA 3JQQA 1XZJA 2AOUA 2VHZA 3VC2A 3WAGA 3HKDB 4EPRA 3NBAA 3HWSA 1TLLA 2JGJA 3KYIB 1L5HA 2H31A 3TL6A 4QJ5A 1NMSA 5IXSA 5JZMA 3AKZA 2MSDB 1RW4A 2O52A 3KZKA 4X61A 5KYVA 2OQRA 4HVTA 3O0DA 4CR6A 1SRRA 1U3GA 2XF2A 1NR5A 2ZIFA 4XWYA 3LY5A 2JCYA 3E05A 1ODTC 2HCRA 3GWZA 4HAWA 3B3AA 2REXB 3KAPA 4NU0A 4UNIA 4XLLA 2QN8A 4AJOA 3PEWA 4DRXA 1J24A 3DE4X 1OZHA 4PTYA 4PIVA 3JAWB 3T3IA 5AVTA 1DIRA 1LLFA 4UVGA 4B83A 1WHTB 4RTOA 3IQIX 4IXTA 4PTLA 3GRPA 1E5QA 4G4SP 4KQ9A 1PEYA 2NAPA 3VPHA 3T7DA 5A4IS 4B7AA 2VSFA 3AJ8A 3OF3A 3U4CA 2XB2A 1XN1A 3LHSA 5C5IA 5E95A 3PLRA 2R6HA 4D5EA 3PIDA 5TS3A 3UBTA 1FUUA 3L7IA 1SKUA 4D25A 3K94A 2J9GA 4U5QA 4XUDA 9MHTA 4YRFA 2DR2A 1FZTA 3I28A 1G2QA 1JR3A 1M2GA 1T10A 3MWFA 5F4ZA 4XWKA 5C81A 3CRNA 5EHZA 2V6IA 3WBJA 2X13A 1QOPB 3ND8A 1JZSA 1ZIXA 1R3DA 2FFRA 4RIHA 5K99A 2LW7A 5K8CA 4GPZA 4U5XA 3KJXA 3LFTA 4Y6OA 4F2HA 1JYFA 3KOXA 4C7BA 5LJLA 3N2LA 5HJ2A 3DE1X 1PBTA 3X1ZA 2QXUA 2RB5A 1MZPA 1IMOA 3C3JA 3R7LA 2N46A 3WWEA 1UP7A 4GRDA 2YH2A 3HACA 1N4DA 1X7WB 3EPKA 2C0CA 4NH4A 5EZYB 4PPYA 4PPQA 2IYFA 1UXJA 4ENUA 1ODKA 3CLUC 3P2IA 1Q12A 1MT3A 5E6RB 4MRNA 3X2EA 3JCZA 4RACA 3CX8A 2YDXA 1KDPA 3DD5A 4Q5IA 1EFKA 5EHGA 5BNIA 4JT9A 1QX4A 2Z5VA 2BFFA 4AMUA 5JW6A 4X95A 2ACVA 4RZUA 1T36A 5DB4A 3TNDA 2O7QA 2MYTA 3LX4A 3S70A 4IGKA 1ND6A 3JVUA 1SKAA 1MB3A 2VP4A 1IFXA 1T9ZA 4FOLA 3DCIA 4TS4A 3WJ7A 2GN0A 1L6IA 3EEOA 2PG3A 3ANMA 2I8CA 2H08A 2QN3A 4P34A 4EUSA 4KNYA 1EDZA 1KE2A 2RHDA 4IGFA 3TQOA 3R3WA 2I2WA 5E6RA 5EJGA 1RFGE 2IF0A 5AKIA 3T95A 4YH1A 4H3VA 4AKSA 4DDKA 2EG5A 4UZEA 4IIJA 5BOSB 5I4BA 1KYXA 1QK3A 1G4UR 3KPYA 4HGYA 1A9PA 2JFPA 2YC4C 5CLLA 3QOFA 3UIEA 3RBVA 3BL5A 3QV1A 5AKYA 2WNSA 2ZCUA 5D7NA 3IVXA 1ZOSA 2FUCA 2VTEA 3NUQA 1WXWA 2GF9A 4HEHA 3K9BA 4LOJA 4BTEA 3OECA 3IPXA 3OQ1A 4RNCA 2PZJA 5IEBA 4QAQA 4ZOLA 3DL0A 4BY9E 3CZQA 1DJPA 1U8ZA 2G70A 4II7A 1CJCA 4BJ1A 2NPIA 2UU9B 1U0FA 4G81A 3LLSA 3VZQA 3HYNA 5JR3A 2P9BA 3ROQA 4NATA 3O3OB 1Q1QA 4HBZA 5G4KB 1G17A 2QQEA 1QU3A 4OPMA 4HGQA 1YVDA 1Y82A 1M7HA 5A1TA 3HSKA 2RHHA 4CKWB 2IY9A 4Y0NA 2Y05A 3MWDB 3EISA 4KWHA 5GMOA 5TVGA 3B36A 3ST7A 4G1FA 4NDNE 5IJ0A 4AKIA 3RYTC 1H3NA 5F5LA 2IBSA 2O2EA 4R81A 3T5CA 1AUOA 3S44A 1AMUA 1XEWY 1FU7A 1YCDA 4L8LA 5D51S 3C3EA 4ZEVA 4UAJA 3B7GA 1VB5A 2GN2A 3AIMA 3FWNA 3M6MD 4NE7A 4NZ9A 5FBRB 3WJ2A 4C2UA 4Y8VA 1FX0A 4ZQFA 1A97A 2WT9A 4FCCA 2O2DA 1SVSA 4GMXA 2W2VA 4QWWA 4CKWA 2GEKA 4YRSA 1BDMA 1EX9A 4IQ4A 5ALZA 4ZU3A 1WBBA 4KWIA 4DCCA 1DDOA 3AVYA 3GDHA 1VXOA 2RK6A 1OROA 1QS0B 1L9XA 4AU1A 2GI4A 5BV2P 4CLRB 3S2YA 3U7RA 3CJQA 4XYLA 2VF2A 2R44A 2WU4A 2HQRA 2C7GA 2JIMA 2AGVA 3EBLA 1PWEA 3UT5B 1DAFA 1SCKA 1V37A 5DCWA 4UAVA 2J6CA 2WHPB 3FHOA 5CCDA 3T52A 3D8SA 3TTUA 1N2OA 2FUEA 3TZ6A 2JJMA 3JZFA 3Q3EA 3CNBA 4RLHA 1N9ZA 1JU4A 5FWDA 1PNQA 1R6XA 4LC0A 3UKOA 1KJNA 1QKKA 4QNMA 1FW6A 4BLPA 2J9XB 3ANYB 5D87A 4ZIRA 5BN3B 5HWSA 1TYZA 1DKQA 4OYRA 3TAXA 3ETGA 3MJSA 4FJ2A 2FEXA 3DE0X 4IUCS 1ODFA 2FQXA 3FYUA 4MITA 5G53C 4B6PA 3OZVA 3WNVA 5GADl 4YDSA 2NV6A 2WT4A 2XY4A 4RVNA 1H94A 1G3UA 1YZYA 4YT8A 4CTMA 3IDOA 3R9XB 1MQAA 3BDAA 2R0QC 3UCFA 5ALWA 2FWMX 4AUNA 4BBJA 1YULA 3L7DA 3A58B 4DXDA 5FOQA 1EGHA 4RFSA 3U7QA 2EP8A 3EBPA 2JLVA 1V41E 2BOVA 4KO8A 4O5AA 5B58C 1LDGA 1QKJA 3DG9A 4GICA 3DR3A 3I58A 4I6JA 5JNUA 4MDFA 3P9YA 3OVMA 1M8GA 4HV4A 2NUPA 3G7SA 1KYZA 1EDBA 2I3DA 1JR3D 2FX3A 4IDBA 5EFOA 1BQ3A 1X7ZB 3WHLA 4ES6A 4PS0A 4G24A 4A5SA 3BULA 4N5LA 1LBIA 1IPHA 4KLZA 2ADOA 4Q47A 5FJJA 10MHA 3DYVA 2CHGA 3U7IA 1Z63A 1VYTA 3TNFA 1W47A 5I7OA 1D6JA 1G7RA 1W88B 4EHBA 1WW2A 2UV8A 2HN9A 1X77A 3W7AA 2Y1OA 3EGIA 5NLLA 5TQ2B 5THXA 3RK1A 2QTTA 4MVJA 3KO8A 2PNFA 3INGA 2HZ7A 4J9UE 3AUYA 1T1EA 3ANLA 1KI4A 1NP3A 3LXUX 4DVGA 2N0SA 1LH0A 1HT1E 1OFTA 2RARA 5KKAA 1F6WA 2PLNA 1DMRA 3NVMB 1I10A 1DQPA 1B8UA 3RSZA 1RYBA 4DA8A 1LS1A 3U3XA 2BJVA 3KE8A 4PAGA 1CLUA 2XB9A 4I9HA 4J7UA 5JATA 4LY6A 4UTPA 4ZZ1A 5K0SA 1J8YF 1DEKA 1QGAA 2IQIA 3A7EA 3MTQA 3RVOA 4EUFA 1CEXA 1Z3CA 1B1AA 1JIVA 2DAPA 3KSUA 4URZR 4JIGA 1U8TA 3DCNA 4AJJA 3DH0A 3H97A 3DT8A 3B3QA 4UZFA 3EYAA 1ZISA 5CH3A 5KOJA 2OCAA 1BXRB 1SHUX 5K5EA 2FW9A 2XE7A 1WF6A 3I1IA 3K1AA 1VM6A 1UOQA 1T3SA 2QZJA 4JJ7A 4L22A 1ZJ4A 1KOJA 3DEZA 3ZHYA 3H1GA 4EB3A 5FL7D 1G291 5K0NA 4G0PA 3ZH2A 4F0JA 3V32A 4EECA 3CX4A 3PJEA 3PICA 5DBEX 2C0PA 1NUHA 2B1GA 3NOVA 5E9AA 5L3QA 4EP1A 3JQ8A 3NXKA 4ZQEA 2CZQA 3TL2A 1G98A 1AV7A 1K9VF 4WGGA 1QQBA 1QSGA 5CMLA 4RY8A 2WOJA 1JSXA 2ASVA 4KK3A 4CMBA 4RJLA 4ENVA 1WSWA 4C0KA 4WKNA 2O2IA 3PGKA 3DJYA 4PF1A 4LC9A 3N76A 5E0OA 3WICA 1E3JA 2PGJA 4QTZA 3EVFA 4B3RB 1JDTA 3E9NA 2YW2A 3INNA 4IIDA 1NXXA 2UYGA 4BO1A 1XZHA 3BCUA 4RY0A 2VJLA 4DR7B 3BHNA 2FP4A 1Z47A 5KSOA 4M0EA 4BTLA 3OTIA 1F5NA 2J08A 2E4VA 3B9PA 1Q0LA 3DVQX 5ERXA 1WA5A 4IGIA 5FPYA 3JQEA 3LBNA 3EODA 3KD3A 1EDEA 4HNHA 1CJUC 5JMOA 1J1ZA 4FMDB 1IATA 3LHKA 5SY9A 3VH4A 4EDFA 1ZH8A 4Q3AA 4GIBA 5KS2A 5HCIA 1J6UA 4CQJA 4NARA 3W77A 4RK7A 4ZGGA 2TMYA 4IZIA 1M1XB 4K6FA 5ESDA 4F06A 4AVYA 2EZTA 1JZQA 2UZ0A 5LBUA 5F7OA 2G5GX 2IYRA 1Q3HA 1I5OA 3PE4A 3M6WA 3SC2B 3WL5A 3EUFA 2X0EA 4HJXA 4EGCB 1RCFA 2QYHA 4TL6A 1Y34E 1W93A 1ZMRA 3MSCA 4D79A 1FYWA 3LUBA 4G63A 1XYYA 4B7UA 2KE5A 1CVLA 2VDQB 3RU3A 4M9UA 1FP7A 1TTTA 2X9GA 4ALLA 3HJGA 1JBKA 2NUPB 3RAFC 1J8DA 4I4TF 5A02A 4XEUA 5KTSA 3TR5A 3OTQA 4HBGA 1AK2A 4IFBA 5KNBA 3GEDA 2ZJ3A 1IWPB 1OFUA 2A30A 5FWAA 3JQBC 1W4ZA 3PE3A 5G0TA 1L3BA 1D2RA 3DE6X 1OC4A 2IHYA 1GG2A 4L8GA 3WGHA 1F8FA 4D45A 1OFUX 1CXZA 2Z6UA 4OA5A 4OB8A 1CFJA 1X80B 3NAGA 1ECPA 4Q4CA 5CFQA 1M1NA 2ZAGA 4NZZA 1YVUA 4CL8A 4QBIA 2PAFA 3E23A 5A7HA 4JR1A 2JI7A 4HEQA 1RVDA 2JAWA 2JRLA 1E79A 1T4GA 2DPLA 3A0UA 4K6OA 4DC1A 1ORRA 4UOZA 2I6QA 3CVWA 3N87A 1ZMBA 1PZGA 1N2XA 1QLJA 2F1JA 2H4WA 1GFSA 3MWEB 1SIWA 3P2JA 1A1VA 3MJEA 5CYPA 4FKMA 1CY0A 3W5SA 4YDRA 4BAUA 2DE0X 4I8DA 4J91A 5K2OA 3R5HA 3DBLB 3WOVA 2Z9DA 2I7DA 3H42B 4M6WA 4UBKA 2PU5A 3THRA 3BBLA 4PC7A 1IOZA 2A4KA 3TBFA 4B0PA 1OGYA 4Z7NB 1R0YA 3JRWA 4OUKX 5B2ZA 3R0JA 2PJZA 5DIZA 4BNYA 2G1KA 1K98A 4WLUA 1PT5A 3AI3A 3TFWA 4B0OA 3FYUC 1USVA 2VEDA 1DIBA 2GPJA 2GT1A 4XX0A 1J2YA 4XPIB 5CDSA 4CV1A 1P45A 3DLHA 3WK9A 3N6VA 3QE9Y 4Y7DA 4AG6A 3G02A 3ZWYA 2C8VA 1C30B 4UEQA 5HQJA 5JLAA 3K9HA 1D2GA 3MINB 1S3FA 4MWTA 4QARA 1IM5A 4YO8A 3VDQA 4Z0TA 5KTNA 3HEBA 3LVQE 4EVQA 1SB9A 1YIOA 1EM8B 4KMMA 3WKAA 3GC6A 3M5PA 4NONA 4R5HA 4GOKA 2GBLC 3BVPA 3N0XA 4MV8A 2ZGVA 3ICPA 2O3RA 2JDIA 3G49A 3U3KA 4ESEA 3LM8A 5GZ1A 1A4RA 1M1YE 2HPVA 3NHSA 1MV5A 4XX0B 5FFMA 3BFVA 1XF9A 1KZYC 5ADUS 3M1AA 1Y4ZA 2FFHA 3LRXA 2IITA 3D6HA 4ZZ0A 3UMGA 3G7UA 1WXQA 5DX0A 3P4XA 2I87A 5LQAA 5KAMA 2QIOA 1VB3A 2QLJA 3R1IA 4UDXX 4NYJR 3LY8A 3AF2A 2B5VA 3S5UA 1NPYA 1OH8A 3IEVA 3HGQA 5B36A 3TNJA 4G09A 3LL4A 3NQ41 4OYLA 1XNHA 3OCUA 4CM1A 4IJVA 3TW8A 2M6SA 4H1TA 2PYDA 3IE2A 4X0EA 1X1CA 2FFJA 3M1IA 4E33A 5CFNA 1ECBA 4Q9LA 3W5AA 2HJVA 1T3LA 3I5MA 3JARA 2NZJA 3NNDA 2YVAA 1XCGB 2C95A 4IZHA 1HT3A 3V2UA 4M1EA 1YJ8A 2BEVA 1NW7A 3QTBA 5ICMA 3NGMA 1ADYA 3ZLVA 3VA7A 3DTVD 2YJGA 3Q0EA 4GOJA 4KXXA 3RJTA 1G5IA 5EE0A 2WAXA 2WV7A 1J2RA 4BLTA 4JR0A 4P54A 2IVZA 1H23A 1BHJA 1PEDA 1T0IA 3CPEA 4RJKA 5LDDC 1U6JA 3AR2A 4KJZA 1EESA 1ORTA 4E4RA 1KSGA 3A0RB 2LKCA 4PLZA 4A8JB 5F5NA 5FRDA 4B85A 3BD9A 3LFHA 3C41J 1ZX1A 1JDUA 3DAHA 4YIKA 1HE2A 2D59A 2ZB4A 4GUAA 2W6ZA 1J56A 1QVAA 5IC5A 4BVKA 1RWXA 4CTOA 3QF4A 1QGUB 5AI8A 5E38A 3B2QA 2BR3A 2QVLA 1ZQ1A 1A4IA 2A9FA 2RG7A 3LP5A 1NAHA 2E1PA 1UBRS 4ZREA 1YAHA 1T3TA 2Y1FA 3KZ1E 4FDVA 2UUPA 3RUHA 2ZB8A 2I67A 3QEOA 2DR0A 4I36A 4ARCA 2IE0A 4QUAA 3MT7A 4X92A 2PR7A 2AEMA 1YJAA 2NTEA 4NI5A 3WLKX 1HDXA 1J99A 1N8SA 1T29A 2Z09A 4N5IX 3GLFE 3GG2A 1KO5A 3V46A 5K3DA 4M8IA 4J2OA 1LDMA 4DL9A 1FJGB 3I1JA 3TD9A 2WYUA 4A0SA 5HF5A 5LQCA 3HUTA 4TGLA 1NDQA 1NVKA 1TT5B 2QR5A 2TS1A 3QKUA 4K6MA 3KXDA 2CVZA 4XOUA 2O0KA 1YZLA 2ZYRA 2CHVA 4G2NA 3RU2A 3ZI7A 1IVSA 4L6CA 4P81A 2H8GA 5FHRA 3P19A 2O7NA 3CCFA 4HGZA 2G63A 4Q3DA 3T54A 4I8IA 3PLAE 1XCJA 5GOTA 1T5TA 3IMEA 3AB3A 1E0DA 4BNFA 4MW7A 3WRXC 2EWVA 2JAQA 2WIGA 2WWWA 1D2HA 3MTGA 5F33A 3THWB 2IK8A 2I6TA 3NGXA 4WVLA 4ZTBA 2PTGA 2VP9A 4MGKR 1UK8A 5ETJA 3I5YA 1NBMD 4LRSB 1P72A 2DTEA 2QROA 3C4VA 3MJDA 1IN8A 2FG5A 1Y8CA 1YL6A 1JEEA 4U02A 1XJQA 2XUKA 3EXHA 2IW1A 4F5ZA 5KQMA 3CRW1 1AKVA 3L8EA 1W5BA 3KVVA 3FPEA 3JYHA 1KK1A 1WPGA 2LDXA 2XMSA 4JLDA 3PKJA 4MV6A 2RSLA 2VK4A 3K1AB 3GPCA 2XYGA 1R0WA 1N92A 4RS3A 2WMYA 2CY0A 5ALLA 3D6MA 4TSKA 5TF0A 1M2OB 4ENWA 1CNMA 3U4QA 4JJ4A 5T4EA 3P2KA 4ZC1A 1V3UA 5HOQA 2IXBA 1IRIA 3D0RA 1QCCA 3GJTA 4MQFB 4EJ0A 1HLDA 2VBFA 3UH1A 3GB9A 3AEQA 1QUFA 2H2IA 2IXGA 3A6HA 3ESXA 4R51A 1TU0A 4DCMA 4OX9B 1H5QA 1UKAA 1E9BA 3BXGA 3GFVA 3KDSE 4FUQA 4RY2A 4DPKA 1XEXA 4RIEA 2R62A 1NVUQ 2VAVA 4IOKA 3CRRA 2QPAA 1NJ1A 4EG8A 4DQUA 3EVEA 4KRGA 3GU3A 3KR1A 3WXMA