3C97A

Crystal structure of the response regulator receiver domain of a signal transduction histidine kinase from aspergillus oryzae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
b'PLSVLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAYQNRQFDVIIMDIQMPVMDGLEAVSEIRNYERTHNTKRASIIAITADTIDDDRPGAELDEYVSKPLNPNQLRDVVLTCHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal transduction histidine kinase
publication title Crystal structure of the response regulator receiver domain of a signal transduction histidine kinase from Aspergillus oryzae.
rcsb
source organism Aspergillus oryzae rib40
molecule tags Signaling protein, transferase
total genus 39
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c97A02
3.40.50.12330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c97A01
3KHTA 1WETA 1J56A 2PE5A 3KSMA 5JNTA 3O21A 4MR7A 2H0AA 2WJWA 1TMYA 1QP4A 3I5AA 5IUNC 1AB6A 4XFKA 5CHYA 4F06A 2JVIA 3KS9A 4HNSA 3LUCA 4MS3A 2RGYA 4O5AA 3MA0A 3N0RA 3I45A 3F7NA 4YP9A 1LJLA 2FMHA 1URPA 3OLVA 4RSMA 1GUDA 3EQZA 3Q15C 1NXPA 1UDRA 1FQWA 3QK7A 4KVFA 1H9CA 2VYCA 3JS5A 4YWHA 3URMA 2ZAYA 4RZSA 4UHJA 3K4HA 4IF4A 2NT3A 4OLAA 1GUBA 2FQXA 3Q7SA 4PICA 4H60A 2FQWA 4WUTA 4YS6A 1QPZA 1MB3A 3M6MD 3F6PA 1M2EA 4RK0A 1DBPA 3SQNA 2IDMA 1DCKA 2N9UA 1QO0A 4KNYA 1B00A 1P2FA 4L85A 3C3WA 4P1ZA 1JX6A 5DCLA 2WRZA 4YCSA 3NNNA 1RNLA 3OQOA 2PL1A 4OATA 4G0ZA 4PEVA 3H5TA 3T38A 1D2AA 2CWDA 1E6LA 3QEMA 2WY2D 2M1ZA 5C5EA 3UKJA 4RK4A 4XASA 2YHBA 3HDVA 2A9RA 1LBIA 1Z12A 1F4VA 5CNMA 2L18A 3RVLA 2GWRA 4FE7A 3G85A 3KG2A 2A9QA 3O2JA 2PUAA 1ZVVA 1Y1LA 3T95A 5BR1A 4RY9A 1P8AA 4NCBA 4DADA 1KGSA 1K66A 1CYEA 3SG0A 2PUGA 4YRZA 1ZN2A 2FLWA 4ZJPA 1PEAA 1DC8A 5PNTA 4W5OA 4TLLB 5TQ0A 5IEBA 1U2PA 2V0NA 3HZHA 2AYZA 2FW0A 2X7XA 4IILA 2HPHA 2R25B 5FWXB 1DCMA 2L19A 5TPZA 1TLFA 1USKA 3SNKA 4Z4IA 4F8JA 4N0QA 3B2NA 4MQFB 1NXTA 1R8JA 2IYNA 4OG2A 3F73A 1DJMA 2PMCA 5TE9A 3N53A 3TMYA 1C4WA 1SXHA 1VKRA 3NBMA 4JAVC 3OMXA 4MGEA 2JBAB 4Q6WA 3RVRA 5HKOA 6ABPA 1DG9A 3N6VA 1BA2A 2E4YA 3TD9A 5T7BA 4F3TA 4XAQA 2E4XA 5KQMA 5KI6A 1ISSA 2GKGA 4RY0A 1DRJA 5BRAA 1JHZA 2WJAA 4EYOA 5FBKA 4RK5A 2CHFA 2GI4A 4RU1A 3T8YA 4G86A 4MQEB 1RZRA 4QYWA 1QO0D 2VUHB 2E4WA 4JASB 4WT7A 5EWMA 4EVSA 9ABPA 1JFSA 2QSJA 3O74A 3OLWA 2R47A 4HNQA 4G0OA 2MYNA 4RXTA 1ZDMA 3K9CA 3KYIB 1EFAA 4RXMA 2CD7A 3Q41A 6CHYA 3EDCA 3IP6A 3QX8A 1P6QA 3OM0A 4MS4A 3RH0A 5CNIA 4GPAA 4IMIB 4D74A 1APBA 2O20A 4YLEA 4RXUA 4N76A 3H6HA 1DP4A 4IRXA 4CBVA 4KK4A 3HUUA 4N0PA 3CLKA 2NZVG 3HSYA 2QXYA 1JDPA 3GWGA 3LUDA 1SXGA 3DBIA 3OO0A 2QV0A 3H1FA 2GX6A 2P4UA 3KLOA 4JP1A 2DRIA 2YHAA 4ZMSA 2F8TA 1ZY2A 1CEYA 5BRJA 1YK0A 1KRWA 2QVGA 1ZH4A 3LUJA 3BRSA 3GA5A 3GYBA 4Q7EA 3HCWA 3H5IA 2E4ZA 5JS2A 2NZUG 3EGCA 2GBPA 3GT7A 3N0WA 4WWHA 2JRLA 1YS7A 3OMWA 1GCGA 1EHCA 3CG4A 4MRMB 1VLZA 1QP0A 2CHEA 4W5QA 3KLNA 1PNRA 4S04A 4L4UA 4MS1B 4Z4GA 4FB4A 1EAYA 1D5WA 1FFWA 3QLUA 5HM6A 2FN9A 5CNKA 5GOTA 1DBQA 2MYUA 2XDYA 4LE2A 4RK7A 4G0PA 2HJ9A 1D4ZA 3P9YA 4M88A 1NTRA 3TO5A 3H5LA 5B3JC 1MB0A 3CNBA 2FQYA 5KQPA 4W5RA 2IKSA 4NV3A 1NATA 4JB0A 2PUDA 2MYTA 4KZKA 3M9XA 2PLNA 3RVOA 3TX6A 1LBHA 1DCFA 3HVRA 2KYRA 3DLHA 3GRCA 3CKMA 1MIHA 2FEKA 4EYKA 1I3CA 1M5UA 4S05A 4EYQA 3NNSA 4IMJB 1USGA 3R0JA 1NXXA 3IP9A 5TQJA 3UUGA 4H3KB 5GQSA 3MYYA 1SD5A 1ZGGA 4Z9BA 1MAVA 3F6CA 3QELB 4LX8A 2FEPA 2E4UA 5DKFA 2QW1A 2LBPA 3LUFA 5KQGA 3OLXA 2FMKA 1Z2EA 4YO7A 3OM1A 4D6XA 3IPAA 1PEYA 2PUFA 1W25A 2WWVD 2PL9A 3HJFA 4H3HB 1Z15A 2PJUA 5B3JA 2QR3A 1BDHA 5I4CA 4ETMA 2P9HA 3RVNA 2MSWA 2QZJA 1RXIA 2MSKA 5IC5A 4RY8A 4EUKA 1F51E 2LUOA 3T6KA 2AYXA 2PUCA 3G1WA 2LP4Y 3LUHA 2FLKA 2PUBA 1NXSA 4EYGA 5EWJB 4N03A 1XHFA 5FWXA 3IP7A 3S99A 3DZDA 3RVKA 4W5TA 4MYRA 3E61A 2LIVA 4YGXB 3CU5A 4JA2A 4MQFA 1JBEA 1JWLA 3D8UA 3MMNA 5TPWB 1ZHHA 4RV5A 4MR8B 3MM4A 2JBAA 2OENG 3RVQA 1QQAA 3L49A 1YS6A 4HYEA 1HEYA 2IOYA 1MVOA 2FKAA 3A0RB 1GLGA 2HQBA 1E6KA 4MR8A 3FFWA 1U8TA 1OXBB 3JPYA 1SRRA 1ABEA 3EAFA 1ZH2A 1JFTA 1YK1A 2L2QA 4MQEA 3CFYA 4ETNA 3TB6A 3H6GA 3NHMA 5CNJA 1Z13A 4B09A 1LJUA 1S8NA 1BAPA 3HUTA 2QVCA 1RXEA 3LOPA 4G0YA 3GBVA 1TM2A 3QLUC 4KK3A 3C97A 3M9WA 4O1IA 4RDCA 4RK6A 3GBPA 4RWEA 5JNUA 5JS1A 2JVJA 3LUKA 4KFCA 5IUKC 5ABPA 1JL3A 4MPTA 2RDMA 2RJNA 8ABPA 1BDJA 1U04A 4MR9B 3H5OA 3OLZA 3CHYA 3LTEA 3GL9A 1JH9A 5D2CA 3A10A 3O2QB 4QYMA 2FTKE 1BVHA 4PZ0A 2PAFA 3BRQA 3H75A 3IDOA 3HO1A 1YVUA 5KWSA 4ZYLA 4QPJC 1JDNA 4Z99A 2E4VA 1QMPA 1OXKB 3NNDA 5F64A 3N8IA 3O1JC 5DTEA 5IUJC 4PE5B 2FN8A 2VUIB 4MLCA 4UHKA 1M5TA 5TPZD 5KC9A 2W42A 5EWLB 3KJXA 5FBHA 3E3MA 3JY6A 3SY8A 5KC8A 4RK1A 4EVRA 1KMIY 3RQIA 3O1IC 4Z0NA 5IBQA 3H5VA 3VNBA 1VPWA 2LPMA 2IPMA 3H1EA 2B4AA 2MYPA 1E2BA 1RPJA 1YTUA 4MRMA 3RVPA 3Q7TA 1JLKA 5IULC 1IIBA 4GNRA 1U2QA 1YMUA 4OBBA 4MS1A 4MS3B 3CG0A 3DGEC 4LZLA 5JNVA 3O2SB 4TN5A 4N41A 4RS3A 4XLTA 2L17A 3LFTA 3QLVC 3JPWA 3MQ4A 3HEBA 3N0XA 1RZRD 1JF8A 1JYFA 4MLDA 1PNTA 3LKBA 4WXMA 4JB2A 4E7OA 1A2OA 3OQNA 3OLYA 4W5NA 2FSPA 2PKXA 4Q6BA 4Z4CA 1CHNA 2A9PA 2FXIA 3DGFC 3QLTA 4IGAA 5E3JA 1Z26A 4EVQA 4KPYA 2ZWMA 3C3KA 3EODA 2RJOA 4DQDA 3VNAA 1EWVA 4XARA 1K68A 4KREA 4G0MA 3Q7RA 3FGZA 2FMFA 2TMYA 3LKVA 5FWYB 7ABPA 3RVSA 3A3KA 2IPNA 3CZCA 3C3MA 3Q9SA 3QEKA 4ZMRA 4KRFA 4FE4A 4KMRA 1Z18A 2JK1A 3O1HB 4P98A 1NY5A 1Z16A 5FWYA 3OO1A 1GCAA 3QEMB 3DLBA 4YV7A 3BREA 4F11A 4PYRA 1ZESA 5ED4A 2JVKA 2FEWB 3QELA 1DC7A 3KKEA 3HXMA 2IPLA 1FFSA 3C6QA 1QNLA 2M98A 2IPAB 2WB4A 5TQ2B 4N47A 1XWWA 1ZGZA 3CTPA 3EJWA 3LMKA 3QLVA 3HM9A 1DRKA 5IX8A 5JNRA 3FFTA 5DLEA 4Z9AA 3IP5A 1U0SY 1ABFA 3KYJB 2OQRA 3GV0A 4KQCA 4ML3A 5TQ2A 5TQ0B 1L5ZA 1YIOA 2QU7A 2A9OA 1M2FA 4EY3A 4G0XA 2HSGA 5KQLA 4YR7A 2FVYA 5BQ3A 2BGGA 3BBLA 3CRNA 3W9SA 3SAJA 4E7PA 1W9HA 3HDGA 1T34A 4DN6A 1EWTA 4LE0A 5EWJA 2JCGA 2F8SA 1Z2DA 4LDAA 4ZPJA 1C0EA 1PUXA 4JOQA 2HQRA 1Z17A 5JNWA 4NCAA 4OLBA 3D02A 3RVMA 4HNRA 3ILHA 1VRVA 5TPWA 3IPCA 4Z4EA 1D1QA 1BDIA 2WMYA 4RKQA 3JVDA 4XXHA 3HV2A 3NHZA 1SXIA 4WZZA 1AB5A 3ROTA 5C5CA 3H1GA 3FDFA 3EQ2A 4MAAA 3EULA 4OTZA 3FMVA 1FSPA 4D6YA 1ZAYA 1TJYA 3I09A 3MIZA 4G0QA 5IEJA 1TVMA 5T3YA 1FFGA 5EWMB 4ETIA 1LK0A 5HQJA 1DZ3A 3OQMA 4NQRA 1QP7A 2NUBA 1A04A 3LUAA 1EWKA 1PHRA 3JTEA 1P6UA 4QICA 1QQBA 3H5WA 2PUEA 4LRQA 2H3HA 1NXVA 2I6FA 2NT4A 4NICA 3ILYA 2FMIA 1USIA 2VK2A 3N75A 3JVIA 4Z4FA 3QX9A 3FFXA 4MS4B 2Q5CA 2R48A 1KRXA 3RVJA 4EGSA 1ZITA 3KCNA 4MR9A 3HK2A 1JYEA 5DGCA 3MF4A 4Z4HA 4O1HA 4F12A 3BILA 1L5YA 1NXOA 1YMVA 5JNSA 1XHEA 1A0OA 1E6MA 3KTOA 4G97A 2HQOA 2J48A 3CZ5A 2ID9A 4KV7A 1JFVA 2R4QA 3UK0A 2B1JA 3L6UA 3LUGA 4LDZA 2ID7A 4TLMB 3A0UA 4RKRA 3ROFA 4TMYA 3SM9A 1NXWA 1QKKA 3HS3A 4LE1A 3I42A 4MR7B 2JB9A 4WXEA 5EWLA 4Y9TA 4KQ9A 1ISRA 1D1PA 2MSLA 3O75A 1DBWA 1Z25A 5HSGA 3CS3A
chains in the Genus database with same CATH superfamily
4BNLA 1X13A 2WSYB 3WGTA 4BYMA 4ZI7B 5JJLA 4GM4A 1YDFA 4DJEC 3QY9A 1VB3A 1S2MA 3BFVA 2BT4A 1ZSVA 2AI2A 2DECA 4V24A 4QX6A 3MJSA 4EI8A 3BD9A 3I5MA 3VOBA 1G5QA 3P20A 3FTDA 3OZDA 4HNSA 4RETA 3GJ7A 2CCKA 2Z6UA 1WP9A 3MA0A 4DTIA 1H3EA 4OKIA 1YRQA 3A2NA 1URPA 4JI8B 1GUDA 3NBKA 2P9BA 2FEOA 3QK7A 3OZXA 4IHAA 3OZVA 2CXSA 1Y33E 1E79D 3KUDA 4JELA 3SHVA 3VR4D 4R1TA 3PPXA 4Q16A 5DW3A 4LWOA 4UM8B 5KTKA 1GL9B 3PNPA 1FIUA 1X1AA 1YD7A 2NZJA 3AUAA 3OCUA 3QG1A 3IAS1 7MHTA 5JROA 4U2BA 1PD1A 4MUXA 4XWOA 2HLDD 2X5NA 1U8ZA 2RI6A 5CFOA 3C3AA 3M6WA 1VECA 3SZLA 5CITA 4MYTA 4LUCA 1E9SA 2Q2WA 1XFAA 3PI7A 3MT7A 3SQDA 3AP2A 3ZU3A 1LCIA 1PGJA 4QGFA 5L7TA 3RBVA 3ZZNA 1GZUA 1ZSNA 2J4CA 3ZE6A 2N0SA 5IAEA 1GR0A 1CDOA 1O77A 5C8YF 1IAQA 2A0YA 2J46A 3WS7A 4QT0A 4V0ME 3LGXA 1LBIA 3R23A 4P3YA 4LF6B 1H1TA 3KPVA 2QUIA 2CXHA 2H4XA 1RPTA 1AGXA 1FRFS 1E77A 1KYXA 1XVIA 2I7CA 1JTEA 2OOSA 3DCJA 4XUDA 3A4LA 5AXAA 3WC4A 4ID3A 2HCJB 3KYDB 3AKEA 3D4IA 3PLRA 3HGTA 4TMTA 3DUFB 3WL6A 1N9KA 3VR1A 2J9YB 2FLWA 3T0IA 1OB5A 4RJIA 3WAKA 1RHJA 2D2FA 2UYQA 4HGOA 4CWAA 4BMPB 2HHCA 3CLTD 4DSAA 3TVTA 1EGQA 4I08A 3VKGA 5ELLA 2CFRA 3CLRD 2GWHA 4L4YA 3J81k 5MFZA 2V58A 5K3FA 2FN7A 3SNKA 4Y2VA 5L51A 4YV2A 3GOHA 3LSYA 4YCBA 3U09A 1C1XB 2HCBA 1XCJA 2XYQA 1XWFA 4K03A 2NU8A 1P0QA 2NUPB 1ZM7A 2NZ2A 3EVGA 5CT6A 3TMYA 4M9ZA 4M76B 4KOEC 1H2ZA 4F3YA 3WJ1A 4WPGA 1OH5A 2JAUA 1AGPA 4M7PA 4F5YA 2GTHA 1E5VA 2B5WA 2R751 1R4ZA 3IDAA 2P91A 3OICA 1MF7A 5DHPA 2VHYA 1SKYE 1WPGA 3NOOA 3DMDA 3R9IA 4O3MA 4LXHA 3ZZUA 3VO1A 1NJ1A 1QZZA 2CHFA 3AL3A 2G3YA 5AVZA 2EZ8A 3FDJA 2EW8A 2Q3DA 3EG9A 4RVNA 1RZRA 3RV3A 3GJ0A 3FCAA 2YYYA 2VT6A 1VSBA 1X70A 2WE8A 3RANA 4EW3A 9ABPA 1VPLA 4DIDA 1FRQA 5FPKA 4GYWA 1UC4B 4A0GA 3H8WA 5J4KA 121PA 1E8MA 2R86A 4B7UA 1C0KA 1RBYA 1ZDMA 2FSFA 1LDGA 5KYVA 3CNNA 1LPSA 2C04A 3R3HA 1TIPA 2ZJZA 4Z7JA 3RIGA 4L3OA 4NABA 3TTWA 1NIJA 4ZGGA 5HGXA 5G1NA 2HJRA 3MT9A 2YH2A 3H3JA 5CH3A 2RAPA 1GY8A 1YL6A 3KAQA 1DZIA 2ZZKA 2C7GA 1V47A 3O8BA 2AZTA 4L78A 2IC5A 2YR0A 5TIIA 5U4XA 1EFKA 3FOZA 1B74A 2PR7A 4I50B 4RKRA 1G4HA 3AGPA 4PLVA 1OW3B 2VRNA 3BWCA 2VRBA 1II9A 1A9ZA 2PGOA 3L4BA 2JATA 4XVQA 4BGEA 4UAJA 3L3BA 4ZT3A 3W1EA 4HDOB 3VSDA 4DV0B 3GUUA 1CEQA 3IP8A 4V1CI 3D8NA 2TECE 3KV3O 1AUOA 5I7VA 1Z68A 2BGKA 2FEXA 2WYWA 2XHZA 4HAXA 1JJIA 1VI6A 4KLCA 5HCNA 4OCZA 4WOCA 5H68A 4A10A 2BBTA 3ICCA 4C0KA 2ZJ7A 3DPIA 2JLBA 5TEVA 1JEYA 4HDQB 4Z8XA 3QTLA 3HDYA 4LDQA 1VLZA 1K86A 2ZJ0A 3JSAA 1ZD1A 1RJGA 5F7ZA 2ZUSA 4ZVOA 4EFLA 4FCWA 1T2EA 1ZNQO 2HDNB 5EJ7A 2VCHA 3TRKA 4YYEA 4J4BA 2G1AA 2FN9A 1KGDA 2JHCA 3L2OB 3SU8A 1XMIA 1D0SA 2IX9A 4KWHA 4BFCA 2XDYA 3MILA 4G07A 2F48A 4RK7A 4B1FA 4CMHA 2R68A 2XOKD 2P6RA 2DY0A 3EWSA 1FMCA 5HKAA 1YCGA 3DQZA 2CXOA 3GUZA 3UEOA 3RI3A 5JT1A 1LDEA 1CRQA 4FFDA 5G53C 3DTNA 1E2NA 2PXCA 3RTDA 2YN2A 4O2BA 4LWZA 2I2XB 3G2HA 1TJNA 5A71A 3QYPA 4KH1A 1NVEA 1KDPA 1MO2A 2A5GA 4M7RA 3DTTA 7AT1A 3DV9A 4B2PA 3N0VA 2C1EA 2OGTA 5AUOB 1DQSA 3FR8A 2Y9MB 1IB6A 2DQ4A 2QN2A 2ZPUA 2FEKA 2NO7A 3G9UA 5IARA 3WDLA 4NFYA 3A6KA 3X1DA 1XTIA 2I6UA 2CC2A 3R5TA 2ZYDA 3FI0A 3R0JA 3GCZA 2HSWA 2ZJ3A 2VRWA 1QVZA 4L2IB 1R6TA 3TTYA 4LC0A 5SYAA 1SCBA 1A9PA 3I9V1 3ZWNA 4BWVA 1W36D 1RXWA 3ESYA 4GWLA 2BCGY 5FJIA 1G0OA 1GN8A 1LH0A 5EHIA 1J22A 1EJ0A 2Z9CA 4OXIA 4PCLA 4PLGA 2FE4A 4U63A 1R0CA 3EEBA 1QV9A 3NHRA 2QJTA 4BQRA 2XTZA 2WA2A 4Y2QA 3BZWA 5IVPA 1Y3IA 3MRXA 1E3TA 1OA1A 3GDFA 5DHAA 1Z15A 2ORVA 5UKDA 4RL4A 4OX9B 3QXGA 3BQ9A 2IBMA 1MO5A 2CDCA 3WB9A 1OFTA 2XUFA 1I3MA 1G17A 3DNPA 1IUKA 1Z2OX 3MS2A 3IO5A 3MRTA 1EFRD 1TU4A 1K08A 1GU7A 1Q2UA 3T6KA 1XRSB 2AYXA 2XYHA 1NE7A 2PUCA 1F8YA 1U63A 3OF3A 3ZCPA 2PUBA 1ARZA 3LZ6A 3PXUA 2O3SA 4H15A 3KUUA 1NG9A 4RSGA 1U7OA 4KQFA 4LRWA 4KWIA 3EIEA 4W5TA 3OWOA 3B1YA 4A6DA 5KB3A 3K1YA 3VPSA 4TT3D 3FLBA 3PNOA 2D74A 4BJ6A 4RV5A 5A3RA 3L7BA 3OX2A 1DKNA 4JHXA 4FJ2A 3RVQA 1DPGA 4V2IA 5P21A 1F4LA 4B3CA 3DTYA 2AFVA 1ZD8A 3MGGA 4AJ2A 4UXIA 1F3OA 3SE7A 1XTSA 1QBGA 3VYWA 2DYKA 2IYVA 3FF1A 5FTNA 1XOIA 2BTOA 1RQRA 1ESMA 2REQA 4W82A 2HO4A 1Z62A 4EY5A 3RROA 2ZRBA 2BZ1A 1W47A 4YUVA 1LI7A 2WF8A 3G2JA 4XW2A 4ABTA 1FP1D 4KFUA 3VU9B 2ADMA 4UE6A 4MVJE 1XRPA 3NHMA 1QFMA 5JXHA 2G08A 3U9SA 3B3AA 3OJLA 5H81A 3FLEA 2GRAA 2H1VA 1VYTA 3CW2A 5DGTA 4O1IA 1DEHA 2AE1A 2PA3A 3OESA 4Q48A 1T4GA 2C4KA 4RDCA 1SQSA 5DSZA 5JS1A 2EZUA 1O8CA 3JAWA 5DHRA 2OYCA 1G0NA 4MTLA 4JUBA 1ZSYA 1KAMA 2ET6A 1ML3A 1G2IA 2FMTA 3L8FA 1OBHA 5CCDA 3WWOA 4RTLA 5EE1A 1VCOA 4ARSA 2CXPA 3GL9A 4ZDKA 2O7RA 2QQ0A 1E7YA 3U1TA 4CR8A 5C8ZA 4X8LA 3HO8A 3F7OA 5D3MB 3CUEF 1EIZA 3BRQA 3KAJA 1RRPA 3HO1A 4CLXA 4QPJC 5JDCC 2GTPA 4BE9A 2NO6A 3TG2A 3FWYA 5D5HA 3UMVA 2QF7A 4X84A 4JX8A 2P9YA 3T94A 1PLJA 3T3EA 3P45A 2CFIA 5FPQA 5C7IO 4QU0A 1RHMA 1XMJA 2CHVA 1BGXT 1C4OA 1YSCA 1JJAA 1N9GB 2EFGA 2IYQA 2QUKA 4R40A 3TYXA 2ZRPA 3LK7A 5A06A 4KITB 5KC8A 3PQ5A 1CZKA 3CUKA 1ZPDA 3ESZA 3UT0A 2WIFA 1JEEA 3PRJA 2E49A 4UTPA 2CXRA 4EGQA 1AK9A 1F20A 2Y1KA 3PUYA 4MVJG 4U3JA 4U6QA 1JEQA 3JALB 5DK4A 5B1IA 1NJ2A 1FDOA 3T7CA 2F9MA 4CIDA 3QU2A 4ZAGA 1GNQA 1DBIA 1FOEB 4C87A 4QM7A 1RPJA 4AMGA 2F3PA 1VGQA 5KKAA 3RODA 3SHWA 1JBQA 4AQYB 1FFEA 2IUEA 5JS7A 4CV0A 1G8SA 4XX0A 1V4VA 1XEXA 1SJ9A 3PEWA 1S4QA 3IBGA 3S40A 3HPRA 4TN5A 2FETA 3DBOB 1NASA 4XRGA 3ZQKA 2RHBA 1T5HX 4UM7A 2O2XA 3T1VA 2IQ5A 4DDKA 4EHFA 2QL5A 5AQ1A 4U8GA 4MLDA 3VISA 4ZYTA 2GO1A 1J1ZA 2E2WA 3OLYA 4RJJA 4BCBA 3AEUB 4FJ1A 2HU7A 5BQPA 3AOEA 4D9BA 1SXPA 5IP5A 2VPIA 3SIWA 4BKOA 3HY3A 2H2FA 4L95C 4UEOA 5JSYA 3DCNA 3U4HA 4D7AA 3H2JA 3S2EA 3TECE 5COBA 5AVOA 3Q7RA 3WWZA 2XXAA 2QRLA 4MUMA 3AUYA 3I53A 1FJ2A 3WIUA 1HFWA 3RVSA 2C07A 4D0RA 4Q4AB 2O8FA 2RK6A 5CDYA 1RLOA 2GFQA 1T35A 1PT9A 4Q9DA 5ITSA 2KSQA 1XQVA 3PC7A 2WIAA 5KAPA 1YS4A 3UAXA 5C4MA 2UZ4A 1QCYA 2OAQ1 1BVRA 4LF5B 1Y8CA 5DI3B 4X7RA 3SX0A 1YV9A 1FXUA 1JSLA 1W75A 3Q5GA 5AIAA 1SHKA 3MB5A 2ERYA 5ALVA 3JQ9A 1JHMA 2WD7B 3CR3C 4E4YA 4KCGA 2Q27A 1DHTA 4YRQA 3T7EA 3L0ZA 2IPLA 1EH5A 2I03A 2WTBA 1K5PA 3Q88A 1XWWA 2PUJA 2VO1A 3LNCA 2OV2A 3MCWA 3U80A 4DA7A 5IJ0A 4JXXA 3V4SA 2FU5C 4UASA 5A1TA 4C0WA 1CLEA 1Q7TA 2JHAA 3AVWA 4DAEA 3DYIA 3Q8XB 1W0JD 1XDDA 5F3DA 3GZ4A 4ROTA 5JARA 3RPEA 3DB1A 3BB3A 2Q3LA 5FOSA 1QS0A 5CFZA 4I4TA 3TZCA 1JDVA 2F43A 5LXTB 3SAJA 2I4TA 4GMFA 1XQ6A 4M46A 4P7KA 2Q7DA 1G3MA 2HV9A 2P2NA 3I9OA 3IE1A 3ELWA 3E5NA 5C8DA 2INGX 4TTJA 4WECA 4XIGS 1PYDA 4BKRA 5I7FA 1E2IA 1CUWA 5MN5A 2B6NA 1TRHA 1ZINA 4GMDA 5ALKA 4CL0A 4Q37A 3P8ZA 4PXAA 2IE8A 2PRYA 3MLEA 5TPWA 3G8YA 2O0HA 4KO8A 3COJA 1EP9A 1S3FA 2GDZA 2HADA 4K8RB 3R2JA 3CRQA 3R7WA 2OCKA 3DYBA 1ZG3A 1SXIA 4BXOA 4RPGA 2I1QA 2GJAA 3OOSA 4RE6A 4ZREA 3GQBA 3FMVA 2IXAA 2YWHA 4MP6A 4LWQA 3AKZA 1Y1PA 4DM7A 1KC3A 1C5KA 2ZETA 4H1WA 2Q7OE 4LF7B 2ZSBA 4CODB 5LPNA 4FW8A 2PL3A 3JRNA 1Z6AA 3LT1A 4RULA 1RAGA 4JYCA 1VFPA 2HXSA 1N5DA 1PT7A 2XMGA 3D2AA 3L8CA 4NP6A 1WD5A 5AKZA 4C14A 4FEAA 3KWJA 2NO5A 2A3RA 3O0TA 5EIBD 4B3JA 3QMWA 4X6LA 2Q1WA 5D3KA 4BO8A 3LUAA 1PHRA 3HVJA 4QICA 3LU1A 2OBLA 4NF2A 2DWPA 2QM8A 4JJEA 2SBTA 4QFMA 4Y2UA 3RTAA 3ZWMA 4B8WA 3ZS8A 3ZCTA 4GLLA 1VBKA 2D59A 1Z75A 2AOVA 1AY0A 2P3SA 3SNHA 4EGSA 3FUVA 1L6IA 1R9NA 2BFCB 5F1PA 5ECWA 3PFIA 1KTIA 5CRIA 4DIBA 2EKBA 4BB5A 3WNDA 2DPMA 1N1GA 1A7KA 1PN3A 1CY1A 1ZWKA 5JZSA 2I2WA 2ZXEA 2WU0A 2QTVA 2CN1A 4G6ZA 4B3HA 3DZGA 3EXHC 3VZPA 5C32A 5CDSA 4YRGA 4QG3A 4TZ6A 1C41A 2AN4A 5LZ2A 4JP2A 3SSMA 3A1WA 3GF4A 5DPMA 4Q21A 1J5XA 4U7GA 1QYIA 2GS9A 4H7KA 3NDPA 5L3QA 2AD1A 5IFKA 1I7SB 3KJHA 3OZWA 3KDAA 3EWIA 4GE3A 3M6XA 3O75A 5C9ZA 2GYYA 5K6AA 1IQ0A 4YC7A 3FGNA 3TSCA 1EUDB 2IGBA 3INNA 3PZBA 5HWSA 3S1LA 3O21A 1I6KA 1UJMA 3MWDA 2I2DA 3D0OA 4MCJA 4MR7A 1V5EA 3VTKA 4P36A 2H1WA 4NULA 5L3SB 3KS9A 1SUCA 2PX3A 4V0MA 2G9NA 5HS4A 3Q9LA 3VBEA 3FTPA 3D3WB 4OI4A 1QBKC 1THMA 1KZGB 2JJ2D 3BFXA 4TS4A 5B2FA 3F7NA 2ZI3A 1M8FA 1X1RA 2OSBA 2XMDA 1KHHA 2XSZA 3D6UA 3MUOA 3AR2A 3ZU6A 4EMBA 3Q3EA 4DXAA 3ZI0A 4Z54A 1BXKA 1P5HA 2QTTA 2G4LA 6AT1A 5LDGA 5I7AA 5M3BA 3VC1A 5D1NA 2JH9A 4Y1RA 4KXLA 5AVVA 4IF4A 1YDHA 2A57A 1V71A 2PBLA 1XA0A 4HS9A 1V2GA 1DO0A 1Z7EA 4H1HA 2BEUB 3I64A 3A3PA 1X8XA 2Q0QA 2HR1A 1W94A 4BECA 1UEXC 3FROA 4P58A 5JAHA 1DCKA 1N0UA 2HMUA 3DBVO 1QIGA 4P54A 4RFVA 4OI0A 1D3AA 3EMVA 3MTAA 3R0XA 3WMEA 5HM8A 2IY9A 4AY3A 5DCLA 1L5GB 1JR3E 1J42A 3PQEA 2IYTA 1ZUNA 4OIFA 3ZDZB 4EKDA 4YCSA 3Q1LA 3RSFA 3ZHVA 2XPCA 1N3BA 3C6BA 4WZBB 4EMUA 4F4DA 1Z9BA 1H23A 1DKOA 2IDZA 4K9MA 1Q84A 4X8OA 3K30A 1T4MA 1PZHA 1V3TA 4N01A 4XASA 2JLSA 5B55A 2XNKA 3N9IA 2M6LA 1MN6A 3NHKA 4RVDA 4D8WA 4GXQA 4BZXA 2EOAA 2AKAB 4JYBA 1UJ5A 1GTVA 4NYJR 2O1SA 2P9FA 5BSFA 1ECCA 4INOA 3TE7A 2ZW9A 4UBMA 4FT2A 2GBCA 4RY9A 2A0WA 1KMMA 1UCFA 1NI4A 2BC9A 1XDZA 3Q8WA 2O3QA 4GXRA 2ONCA 5IAAA 4XWKA 4FFBB 4XYMA 1GZ6A 2NN3C 2NV0A 1IULA 3AP1A 4AZ0B 1RPAA 1B2RA 2AMVA 3KYDA 2VTEA 3DZIA 5G3YA 5TRTA 4C6SA 3DUFA 4PBTA 1BCSA 1KU0A 4OQFA 3WKCA 3GFVA 4IILA 2GD6A 4KEAA 1NN0A 1GGNA 4HLCA 4MARA 3K3PA 4QXOA 2J1LA 2AFRA 1KDVA 2CJWB 4TV8B 1EWYA 4AD8A 2FJUA 3DE5X 1Y7PA 2VQSA 4EHDA 3EGEA 1TU0A 2H51A 4P33A 3OZRA 3DKRA 4WVLA 1DJMA 2UXCB 1E69A 3AGQA 1NG1A 3CUUA 3PE6A 1CIJA 1VKNA 3A1SA 3PPVA 4LXIA 4ZCQA 3RGWS 2ZANA 4YAIA 1RQNA 1LV7A 1FDSA 4KIFA 5DBEX 3ZWCA 2D00A 1AD2A 3V8MA 2QZZA 3L1IA 4IUYA 2HSDA 5FUYA 4CKBA 5TVGA 3U0VA 4WIAA 5BRAA 1QIHA 2IYYA 3EZYA 1JGTA 1NVTA 2O4CA 3ET4A 5DCYA 2O7NA 4FFPA 4MRPA 1EM6A 1JN0A 1ULZA 5L6LB 4C4PA 3FZGA 1PL0A 5BT8A 5KYUB 1Z4NA 3A6GA 2JFHA 2QSJA 2SKEA 2WM2A 1H1LB 4Y1GA 5AO9A 4O25A 3R3XA 3K9CA 1E5QA 2PK3A 4XFJA 1V48A 1ZRMA 1CUGA 1XZMA 1WUHS 4D41A 1VSTA 5I48A 5HNKA 2VHUA 2GVDC 4M1MA 2DLCX 5JD3A 4LMBA 4B4OA 1EZZA 4INPA 5K8LA 3OPQA 3WK6A 3C7TA 4FGJA 3K4PA 1E3QA 1K9SA 3OTIA 4R1OA 4TVSA 4M54A 2F6RA 3GBSA 3IMCA 1KQOA 4HLNA 4DIUA 4RTOA 1QTQA 5FA6A 4GKJB 4AN0A 4REMA 3K96A 1AQUA 3DW3X 3KOZA 2AX3A 4R8LA 3DBIA 4ESHA 4LVOA 1ZK1A 4YJGB 2AEMA 1XX6A 5F2NA 2YV1A 4EVIA 4CLRB 5LKRA 2ZSIA 1K2WA 2QD2A 3GA5A 5EHNA 1OZ0A 3H5IA 4Y8VA 1FNCA 2GM3A 4J7XA 3OF2A 3PFHA 3U7EB 4KO3S 3K16A 4CMGA 1CQWA 1VIYA 3HPQA 2WIBA 3HYSA 3RRYA 5HYVA 3Q72A 1L7OA 4LRXA 3BSFA 5CMLA 3T5TA 3N2IA 1L7NA 4CU5A 4HF7A 3SEQA 5IS2A 1TLLA 5EZSA 1QP0A 3S4YA 3X44A 5ALNA 2F3SA 4EG0A 1N57A 4I46A 4R3NA 2OLJA 3WMGA 1EAYA 4HRXA 3NJRA 3RUFA 3DOFA 4MULA 3AI7A 2UZAA 1DBQA 2P2YA 3AKYA 3RU3A 3U3MA 4OFXA 3N8KA 3WYCA 3RSOA 1UQUA 4NIMA 5HBGA 1D4ZA 4DZTA 9LDTA 4MA5A 5AW1A 3VDXA 4ROSA 1EGHA 4WN3A 3H9GA 5K0FA 1W30A 4M0KA 1EHIA 1NQTA 4NV3A 2JLUA 4B33A 4IIHA 3JD4A 5FL7D 3U5TA 1EXMA 4OHWA 1NF8A 1S96A 1C9NA 4JYMA 3ECAA 3NKLA 4O59O 1XQ9A 3CVJA 4J9VA 4JLNA 2WR8A 4Q4JA 4QYIB 3SIRA 2HPAA 1BZYA 1KO8A 3OSUA 1GGEA 4R9UC 2M9MA 4U2FA 5HQ3B 4LSZA 5LD2C 3U7JA 1A7JA 4MP8A 5KYKA 1O94A 3R0IA 1QV6A 4IMJB 3RSZA 2WWTA 5IPFA 1S7GA 2K7ZA 3AF5A 4L0MA 1C9KA 4B3BA 2EBHX 4P84A 1CUZA 2DX7A 2G9RA 2O2IA 3F6CA 3MJTA 4KLAA 1ZW6A 3ZLBA 4EARA 2O2CA 1EUCA 4UC0A 4GRDA 4L5AA 4R84A 3PXBA 4UAUA 3TI7A 2JPDA 3HCPA 4J3FA 3DOJA 3LX6A 4QFDA 3WLFA 1QIEA 4N40A 1NMZA 1BROA 2EBFX 1W5SA 1DV2A 2XEXA 3STUA 3QI7A 3QXCA 4D99A 4MVJA 5G4KA 3B9QA 3TAHA 4IS2A 4FBGA 4LJ4A 1D2NA 3OY7A 3FWNA 4LJ8A 4U7DA 4HNVA 1Y6FA 4LOLA 3ZYCA 2HGZA 3EF0A 1M6EX 1UDBA 3ZKAA 4IWYA 5IAKA 3IP7A 2VHWA 5L3VA 4H1VA 1R6BX 3S99A 5B7PA 3PGA1 1MP0A 1LPAB 1RYZA 1K8RA 4YY3B 3BFKA 1FUIA 3BTSA 3CU5A 4EO9A 4REQB 5FADA 1NVVQ 2Y0PA 2PZGA 2ZYVX 1AGYA 4WN9B 2XDQA 5LIPA 5ALIA 2VJQA 4AULA 2BM8A 4J1QA 2JBAA 3V97A 1TAQA 5A6VA 1NDQA 1QQAA 3HJNA 3K5HA 4D3XA 1MOQA 4ZMBA 4BO6A 4EI9A 1DAEA 3ICEA 3Q2OA 1I13A 1WS6A 1XL0A 1HL3A 2B69A 1UK7A 1ODFA 5BORA 4DA4A 1E6KA 1O87A 2Q99A 3LC2O 5EE0A 3LCVB 4X66B 3UK7A 2ZWAA 2H17A 2TYSB 3L0SA 4W7IA 1SC4A 2WP8J 4QU8A 5DT2A 1YK1A 2ZJFA 2A8YA 1SULA 2ZRIA 2E6UX 2PAAA 1T24A 1LK5A 4O8ZA 3R7DA 1BE1A 4WJZA 1LDMA 3KJIA 3T9FA 5ILQA 3TLGB 1FVHA 3TG8A 1KP3A 1TVKA 2FOLA 2K7FA 3U3JA 2WJIA 4U2DA 2NU9B 4C89A 4CM8B 1PR1A 3R3WA 1UKZA 3VU9A 5IHXA 3OTQA 4M55A 1TZKA 1VE3A 2PY6A 3P1JA 3WK5A 4HN9A 4BDSA 3E53A 5J1TB 1SG0A 3SVZA 2JCBA 1HYQA 3EC7A 1P60A 1Q17A 1B8UA 3CMMA 8GPBA 3W05A 1JH9A 2P0AA 1M7GA 3DL7A 2KB0A 5FWAA 2PFKA 1ECGA 2BEKA 2GPWA 3SIPA 4LISA 4LGCA 1TZCA 1GVNB 1E1DA 1JWBB 2O19A 3N7TA 1MV5A 4OKNA 5HF6A 5B30A 5M34A 1KJ8A 1K06A 1NUHA 4G09A 1H1DA 4KPUA 2IW1A 3WLIA 3PA8A 2JL1A 2P6NA 4HDKA 1N33B 4QEZA 2Y3IA 3CYFA 5AQEA 3VBCA 3U60B 1SD1A 2I4LA 4YQYA 4E33A 4RFSB 1YB1A 2C5FA 2W42A 2BIFA 3MINB 5EWLB 1NVDA 5LB4A 5AW2A 4HEA6 4PNZA 1JRLA 4EAAA 4CW7A 4C3ZA 2IY8A 4ZVQA 3EGVA 4NATA 3ETGA 5LQSA 3RS8A 2JGMA 1KDOA 3O92A 3PXAA 3CSSA 3K20A 4Y2PA 3LAWA 4R71A 2XUAA 3TOVA 2YWCA 4D9FA 4B48A 2P6UA 1NWCA 5DNYB 3WKDA 2VYQA 1HR0B 4DQKA 3G0HA 4GOJA 2J07A 2JAXA 4MLPA 4YFVA 3EGWA 1YHZA 1GRRA 2XRYA 4MS1A 2PT6A 3QU9A 4LZLA 5LBTA 2IZ0A 2Q6IA 4Q01A 4ND8A 4AK9A 3QE0A 2J3KA 2DPGA 3M6IA 2L17A 4Q39A 4RYLA 3HEBA 1U3FA 4IQ8A 1PNTA 2I3BA 4KAFA 4F6CA 2W8ZA 1KMHB 2HIHA 4AW9A 5DYYA 4FYXA 3NBXX 5EYPA 3OQVA 3FYSA 3NHAA 1NUSA 1CP3A 1WXXA 4X6UA 3RWBA 3UK6A 3F98A 2RK4A 2C9OA 3H42B 2WV7A 3B3GA 2BKLA 2PXAA 1DB3A 3ENQA 4UVEA 2X22A 1C8BA 2Y93A 4X20B 4KR6A 4IGFA 1TMKA 4EHHA 5C4GB 3GAFA 1PBTA 1E4EB 3TEJA 3ID6C 2BEJA 1YJCA 1MORA 1MRSA 2W48A 2HO5A 3FXAA 4ND4A 5AOAA 4FTWA 4YN3A 3KB6A 4H6WA 4I9UA 5G1OA 4ZDWA 3KYCB 1T9ZA 2DR2A 4KRFA 1Z18A 1K97A 2QYHA 1DT3A 1L4GA 3KR1A 3OO1A 1K4YA 3Q1KA 4IGKA 4V39A 3R7BA 3I76A 4CFYA 2FPGA 2PSHA 3AFMA 5A5FA 1W88A 1YQWA 4I8XA 5B4TA 2Q9CA 4KV9A 2GCPA 3DG9A 4NOKA 4TS3A 2DSNA 5IVKA 4B0PA 3MUNA 1FFSA 1WPRA 3QBVA 2GN8A 1HNWB 4CMJA 1ZGBA 4L1KA 4G5RA 1F0YA 5A4FS 4DWVA 1QE3A 1QVAA 3FYDA 4ZYZA 1W29A 1WW3A 3MXOA 4JJ7A 4KHZA 5BUQA 1L3CA 2XADA 1GGHA 1UZNA 2NNLD 2XMPA 1G7CA 4FT4A 3KSDO 3L4SO 4EY3A 4ZPXA 2IU0A 1IHDA 2OAEA 4LJ5A 4X54A 3IAM6 3V7FA 1P1FA 1XEWY 3BBLA 1B3RA 3FZEA 1XKTA 1G20E 4RESA 3THYB 4E7PA 3FSEA 4MUBA 4S2UA 5IZCA 5AVRA 4YAKA 3C3PA 5BMVA 1T4CB 1JQ3A 3DP7A 3KP1A 5BO5A 4DLWA 2IZ5A 4KVGA 3VVMA 4CF6A 4LNHA 3TW6A 2WU3A 4UCFA 1SUIA 2IXEA 1ZD9A 5E1MA 1BOOA 1C7RA 2IZ6A 2X19A 1EDZA 4GWGA 4CEJA 1ATIA 1ZK0A 4IXNA 1EX7A 4ZALA 5FBRB 3VC7A 2Q8PA 3NHZA 4ADSG 5KWIA 2HKIA 4Z53A 2HRRA 5C5CA 1P5ZB 1QX3A 2W6IA 4FQ7A 5EQJB 2VBCA 2EWMA 5TLSA 4LJAA 1A1VA 3G13A 2BKAA 2Z2YA 4F97A 3LG2A 3ZDEA 3V4OA 3IEVA 1UK6A 1VDMA 2HF8A 1GUFA 3AERB 3RG2A 2VP5A 3AHHA 2IYZA 3LWNA 3PC2A 4NZNA 1YR2A 4HXGA 5F2OA 3N2NA 1FZTA 3OZBA 3UG6A 3R3JA 3GPBA 3ZHRA 2C2MA 1JKJA 4FHCA 4JEHA 4NQRA 3VKFA 2MSEB 3NGXA 4ZDIA 5J3JA 1A04A 2JLRA 2O14A 4INZA 1U3DA 2XRMA 5KYWB 3VPAA 3RSCA 3PFFA 3JVIA 3TM5A 4IHJF 2HCTA 3FFXA 3G89A 3KKQA 4MS4B 4K9PA 3ACBA 2ON6A 4JSRA 2JIOA 3FPSA 4LZWA 3AM5A 4NPCA 4PX5A 4YCJA 3SN6A 2HFJA 3N1UA 3GGDA 5DGCA 1OCEA 3CPHA 3TLMA 2GD0A 1U65A 3JQAA 5CYPA 2YHIB 1GQYA 2ZDQA 5FBLB 1NXQA 3OE7D 4LXUA 2O1EA 4NBWA 4A2WA 2OA0A 2BFCA 3PK0A 1CJSA 3QPWA 1KJJA 4N3GA 3OJWA 1KJ9A 2C7VA 5IM5A 3MYRA 4K9KA 4ERNA 2C0PA 5JAUA 3O4IA 3D3EA 3T3MB 4QOIA 5HIMA 2C5BA 2P40A 5FPTA 2OHFA 1RLIA 2WINI 1JR3A 3WFJA 5A4JA 3KHTA 4YO8A 4CRWB 3E5RA 2PE5A 5E8RA 1P44A 4A8JA 2XH8A 1ZUIA 1WA5A 1QHHB 2PEYA 2X1VA 3WFIA 2GCOB 4I1UA 1SC1A 1LDBA 4MDYA 4ECEA 3F9IA 5IUNC 3MTDA 2W2TA 3R5XA 4Z49A 5FUXA 3FOBA 2RAFA 4L5IA 2WF5A 1EUDA 3FH0A 5EIXA 4TKUB 2PMBA 2H1RA 3RDPA 3LUCA 4MS3A 4O5AA 5HKLA 1B8VA 5F9FA 2JFBA 3IR6A 1Y6JA 3PUJA 4R2WA 3VR3D 2PX8A 3A7EA 5LNK6 2I6SA 3ZHYA 5JHHB 1I7QB 5L3SA 3E2IA 1ULTA 3DDNA 2AQIA 3N74A 4B4UA 2AE2A 1UDRA 1UXGA 4I7EA 4JNCA 2X8BA 2G8NA 5EP2A 1C3OB 2DLDA 3URMA 4B87A 2LDBA 1C3XA 4FC6A 4FWIB 5F2KA 1GUBA 2HU5A 3Q7SA 2A7XA 4BB0A 1G38A 1U98A 4OFZA 4HJXA 4BKQA 2WWYA 3Q4GA 5JADA 1N2ZA 1MB3A 1UPCA 1JG3A 3AUXA 1O58A 1BN7A 1VLJA 3QPDA 3QX7A 3J80A 4HSGA 4DYVA 2FXVA 4J03A 1DWOA 2CUTA 2WRZA 4P5EA 1RNLA 4NBVA 5KTPA 4BZWA 4HQNA 3BAZA 4KGDA 4NBSA 2CWDA 3L05A 1QHSA 1DQYA 2DPYA 3QEMA 2XCRB 3UENA 5EZYB 1YULA 4MWOA 2JFVA 1V5FA 1C14A 1WR8A 2GPJA 3AETA 3UKJA 4A2QA 3D9QX 4GYYA 4R83A 3DXZA 1G8MA 2TRSB 3PXEA 3TTXA 5SZHB 4S35A 5AKJA 4FE7A 3HR8A 2OGSA 3HGMA 3W4IA 2A9QA 1W4BA 5HJEA 2PWBA 1CUXA 3O8OB 3KZVA 1EZ4A 1KARA 1LZLA 2J9GA 1IZZA 1GWNA 1U8AA 4NMWA 4YRLA 4DADA 1RIIA 3OA0A 4WBNF 1HC7A 5BQOA 2AT1A 2R7NA 3F9CA 3GMDA 2GZ2A 1TIKA 1NR5A 4RZIA 1XDGA 4J49A 1MOZA 2VEDA 2JGDB 3IP1A 4JJ6A 2VHZA 4PLWA 1FL9A 3TJMA 3SYRA 5FOWA 1TZJA 5BSHA 4KIWA 4TWBA 5DBFA 1RM3A 1L5QA 2PS3A 5G0VA 2G9QA 3IIEA 2IV7A 1JHPA 5EJ9A 1V9LA 2ZWVA 1JA1A 3IBSA 2CLLB 4YP5A 5DNVA 3VZBA 2NSDA 5CGQB 4BPRA 3V6MA 4F7DA 5BN5A 4JOSA 4LMAA 1QH1A 2OHXA 1S1CA 3ZIAD 1F6DA 1GYPA 1TCBA 1A5BB 3MSXA 3NAZA 4OG2A 1L8AA 3TXAA 1QLWA 3N53A 3ME5A 3GVCA 4HGZA 3P9KA 1SY7A 4RVOA 3KEFA 3AR9A 2YNMC 3ZZTA 1A9XA 3GRRA 4JZYA 4J43A 4PGFA 6ABPA 3QEAZ 1QR2A 3TD9A 3V46A 2AG8A 1J9GA 4RMHA 3M2TA 1GU0A 4HX2A 1T1JA 3VPDA 2J5BA 4Q18A 3A36A 3MEQA 5IMBA 1FMTA 3UJ6A 5LLTA 3PIIA 2GKGA 1RP1A 3QHPA 4WFQA 5CFRA 1K6XA 3MJVA 3LHSA 4CFZA 1DCTA 1UXHA 1U9IA 4F85A 4MGKR 1RBMA 1HURA 1QO0D 3B78A 4YP6A 2XCSB 1TUIA 1FP4B 1ADGA 1R4NB 1RI5A 1WUTA 4HNQA 4IJ5A 3WB2A 4CIAA 3BHMA 3IVXA 2A9VA 1T91A 3KR0A 4OJTA 4UXHA 5DXFA 1LX7A 3GLVA 1C7IA 1Z6YA 2O57A 4JBYA 3JQCA 3HM2A 1Z73A 1Q1GA 5KYUA 2XB4A 4ARZB 3EDYA 1H1LA 2E18A 3EDCA 4A92A 2E21A 4O3FA 4B7CA 4RCVA 3JQGA 3Q9UA 2Y27A 1HQYE 1WWKA 4DUYB 5JZBA 4ZTZB 3ISJA 1N1DA 5JCJD 3CF2A 3MMSA 1GDTA 1AXGA 1M2NA 1V11A 1XDUA 2XUZA 3JR3A 3DDSA 3OEED 4JLUA 1QIJA 5B3KA 4EIWA 3FBTA 4HNAB 4HDSA 5D8DA 4BHTA 4CEHB 3L7AA 3HKDA 4JI6B 5L53A 1N36B 1NQ5A 4CQMB 2D8MA 2J0VA 1XVUA 2B4QA 3KQQA 1KY4A 3LC7O 1JILA 2H1FA 3ABZA 1IPEA 4K46A 4KR0A 1SBZA 1TM4E 1ZH4A 3BRSA 1VHJA 5AUQA 4U7PB 4NG5A 2Z08A 2FRXA 4R1UA 3JZMA 1QIIA 4RPJA 2E4ZA 5AVQA 3SWWA 3L6DA 3WXMA 1JUDA 3H2YA 3PD7A 3BCRA 4R31A 4AJ9A 1TADA 1HE1C 1XD2A 5EIEA 4ZOAA 2UVPB 2XYGA 2A58A 1TJ3A 1YR1A 3AEKB 3KDPA 4O02B 4NLLA 4K2AA 1OLUB 4K6FA 1SIWA 2IYXA 1JFFB 1AV6A 2CUZA 4ZIRA 1V3VA 3UPDA 4E70A 1PNRA 1Z07A 5JANA 5K6RA 3HL0A 3AEQB 1NNI1 2FAXA 2V6GA 1D5WA 1BQ4A 1OV4A 4OK3A 4N8EA 2CLOB 2VDLB 1WHSA 4RZ3A 2GEVA 3PFKA 1XZ8A 3UV3A 2WF9A 1XU7A 3JD0A 2HAEA 1C0PA 2EWWA 5E7QA 4M88A 5FOQA 3ABQB 2Z9BA 3H5LA 4WXRA 1EWQA 2F9FA 5DNEA 3DZFA 3OZUA 1V45E 4I14A 4IIEA 2QD5A 4RCYA 4Z86A 2DWOA 1JDBC 4U39A 4XJXA 5E4JA 1GADO 3E2MA 4NBLA 2Q2VA 5SY6A 3K0AB 5LOVA 4K6KA 4ER0A 4UTZA 3CNQS 4PHCA 4OYRA 3SK0A 3SYKA 2J6CA 4RF5A 5C5DA 1G8KA 3U13A 2GN4A 3WSTA 3CKMA 2ICAA 4QWMA 1H42A 1I3CA 1JAYA 4FI3F 3V32A 1MB4A 4KFRA 3OEHA 4ARVA 1RSZA 1PV4A 3L1JA 1QIFA 1GNSA 1OYOA 1R1DA 1DAOA 4ZOLB 4XM2A 1S02A 3UCXA 4CXMA 2OYSA 3K35A 2HF9A 3AILA 3GG9A 4MWCA 2HIGA 3PVSA 1FJHA 3AVPA 3KM0A 1T9DA 4IXTA 4B6RA 3AG5A 3FETA 3E03A 4OGGA 5DBOA 1B1AA 4CR6A 5CLFA 2BE7A 2B9VA 2WWRA 1PJBA 2H7CA 4LQ4A 4J0FA 3GJ3A 4KR9A 1R8SA 4P4LA 3GQVA 4K6GA 1E89A 3N2YA 1MDFA 3IDFA 3UT5A 2OUIA 2FA9A 1GPDG 1K5GA 1VHQA 4WBXC 2B3DA 2L0XA 1ZGCA 2FW1A 1FXSA 2P9HA 2QRHA 4MV4A 4NCHA 5CNKA 2UXBB 1XD8A 1C9EA 1N2CE 3R6GA 3OIWA 4H4CA 4MAFA 2F90A 4RD4A 3UJ7A 2QG9A 3EIOA 3AONB 3FIJA 1VM6A 3ENWA 3A3YA 4RTRA 2NQ2C 1B1CA 1O5OA 1RIFA 4P22A 3DVAB 1HYBA 2BMAA 2WAXA 2XZLA 2PX6A 1ZOOA 2XE8A 1Y3HA 3A4IA 2I5PO 3HYCA 2QM0A 4A4DA 3C4JA 2B3TA 4K2HA 4RIFA 3T4EA 5AM2A 3UJBA 3TOZA 3DVSX 4PZCA 4RTPA 2WD8A 3AB7A 2R1ZA 1UOEA 5DMXA 3L49A 3ZY2A 1W35A 2QVLA 1THGA 1G5RA 2IOYA 2I7VA 4QGGA 5ERYA 1ESCA 1V7QA 2BH9A 3KUKA 3VYTB 2HQBA 5FTKA 3LOUA 4TROA 1SN7A 3JPYA 3WGYA 2ZATA 1KZ9A 3LQ1A 3MAGA 1AMOA 4BAGA 2RGNA 5HE9A 2ZBDA 2D5IA 3HB1A 4NE2A 3GUCA 4FHGA 3TB6A 2JNWA 2ZDGA 1WPXA 4KDRA 3WLNA 4C5AA 4DLRA 3THXA 2NTVA 5A4KA 4C29A 5IWAB 2QVCA 4WH0A 2DFTA 3CSDA 3ISVA 2PRSA 3C97A 4BVBA 5ILOA 2PTHA 4IDCA 1IONA 3VMFA 2YQ4A 4ZAWA 1ORVA 1M2JA 2XTAA 3R9XA 1RYBA 3STWA 5E0KB 3AVTA 2GYWA 3NT4A 2ODEA 5EJAA 2AZMA 5IDXA 1Z83A 4ZZ0A 4HAZA 3SFZA 1GRQA 1KFEB 4MV5A 5EXEA 3ZU4A 1I5RA 1YVUA 4LQCA 4ILEA 5AXCA 3ZKWB 3AOEC 3HN7A 4TN1A 2WIGA 4Z99A 2QYOA 4BFLA 2G06A 1VRCA 2RHRA 1SXJE 1GZ5A 4RJ2A 1A97A 3DW1X 2I2BA 1IC6A 2WWWA 1MOPA 3LQRA 4HRVA 2P5YA 5LQMA 1EBUA 4UU1A 2C5HA 4RKEA 1KMIY 1NLYA 5KJ6A 1QU3A 4BBJA 2OKGA 4ISBA 1AHPA 4XQ9A 4I6GA 3OFJA 2DKOA 4FC7A 5JAMA 1VPTA 3P97A 4RJTA 3F5SA 2B4AA 4ZI5A 3HGQA 3R5HA 1ZW1A 1XJ5A 2VP6A 3OLCX 4XFDA 2H4FA 5CIYA 1CSEE 2X23A 2FZGA 3L7MA 4JWKA 1QANA 4RV4A 3W6PA 2NTJA 2DBYA 2JK0A 2YJ5A 3GZTB 3JQ9C 2BLLA 4BS9A 2WP0A 5KSPA 2JGEA 3BL5A 2XVXA 3EWAA 2YFYA 3OKFA 2WJZB 3DAOA 5T8KC 5F1OA 3ZZMA 4AO7A 2FWIA 3TTVA 1RZUA 2E1RA 2Y1DA 3MQ4A 3MWEA 1F17A 4QDKA 5LZ7A 1E2PA 4OGKA 5HIKA 1RZRD 1SAYA 3EBPA 1CF9A 2BV3A 3BB4A 5ANRB 3OQNA 1E7RA 4JMPA 3ZD8A 3VI4B 4MB2A 2GFHA 4FMCF 4PG4A 4R6XA 1E2UA 2X3FA 1DKPA 5E3JA 4XIYA 5I9SA 5T4EA 2GA8A 5LQUA 3C3DA 2P2ZA 5KNLA 3EODA 2XDAA 2ZRQA 3PSAA 4MVJP 1YFLA 1ODKA 4ZVMA 1E2EA 1D4AA 2C0QA 4ALIA 1G20A 4LSGA 4I1SA 1E9DA 4HL6A 4OQDA 2CVFA 3K0CA 4TXNA 4MUKA 5HRAA 3LF2A 4LDRA 1MFPA 4IKOA 5IJAA 1GTZA 4E11A 5FWDA 5JJBA 1QF6A 1KH1A 3NUGA 4W5WA 3Q3VA 2HXGA 2YQZA 3EGXB 1GPUA 3VNQA 2FSSA 3QRWA 1KORA 3LVBA 4G4JA 1WE2A 3OQPA 3FVVA 1N8TA 3R7SA 1PJTA 1E1CA 4X8HA 3PL5A 3QKSB 2VN8A 4O8CA 4Q15A 4FZ5A 5CCXA 3ESDA 3A4NA 4QO7A 4E12A 4UAGA 3ZBTA 4GX5A 2OCBA 3HLTA 1W0KA 2VZEA 3DHWC 3ZTYA 2XWBF 4A9AA 3NC1C 4N82A 2AOWA 2B0CA 4TXMA 5IX8A 3RFCA 3R0QA 4D8UA 1ES9A 2V3WA 2ZJ2A 1JR4A 1X1QA 2TMKA 2EFJA 3CC8A 2OQRA 4ZARA 3VOTA 1AA9A 2G71A 1BVUA 2GLTA 5TQ0B 1VXRA 3RSLA 1Y89A 5CEFA 2QMYA 4DQ0A 3L7LA 3OZSA 4P4TA 4QU9A 5K4AA 3MBIA 1EK5A 4DB4A 3S27A 4V02A 4PGAA 1FDIA 3IVGA 1J7JA 3W9SA 4JLPA 5C52B 4BQSA 3RS5A 1LF0A 4LTDA 3C6ZA 5CIQA 1KI2A 5EWJA 4NBRA 2DUUA 2HJHA 4UJ3A 1RJEA 1WABA 3D5EA 2HV8A 3QGMA 3L8DA 4Q3DA 1K6MA 4RE5A 1DTEA 1TO1E 4RSHA 2OVFA 4S1WA 2UZ1B 4UBOA 4DEYA 5ALFA 4YX9A 3CA8A 1NNSA 2P11A 1T8WA 4NNPA 4CIXA 3IPCA 4GVLA 5C8XA 3ZJUA 3WGGA 2R4TA 1CDEA 4FYVA 3OJOA 4MUNA 4OQNA 4UAVA 5FH9A 5LQCA 1AB5A 2R66A 1QFJA 2ZT6A 2W2KB 3B6MA 3L6BA 1OX4B 1U94A 1XZKA 4MAAA 1XZJA 1YGYA 3KQVA 4PYLA 1LBQA 2G1PA 1B41A 2VCEA 3HXLA 2UYHA 4E1VA 2A84A 2C8VA 2QY9A 2JJ1A 4GOKA 4LGVA 1X7XA 4P7GA 5JZOA 2R8RA 1OT5A 2AUNA 2O06A 4LCJA 1R0YA 3I4FA 2WU1A 5K6AC 4PZDA 3TRHA 2Q49A 4MGYR 3WG9A 4AWXA 2PR2A 3ETDA 1BW9A 3I2YX 3JVVA 3SQMA 5FOTA 1EWKA 4BLTA 4UHEA 3O1LA 4QSHA 3AR5A 4EPVA 3OQ6A 1DOAA 2NW6A 1T1RA 1BG6A 3DR3A 1P33A 3LBIA 1Y3AA 2VK2A 1JQEA 2ZR0A 3RNOA 1N2OA 2H31A 5GVSA 2Q21A 3BZBA 3C87A 1QB8A 1CWUA 2CMKA 3L8MA 1HLFA 3L9WA 3GZJA 3RRMA 3VKVA 1ZOLA 2OAP1 5KYWA 1YRBA 1LVGA 3N7AA 2JEZA 2BJWA 1NBHA 4QO8A 4E22A 1O4VA 2P2DA 3H13A 2HLPA 3R4VA 4R3UC 3TW8A 4BP9A 1YL7A 2VNIA 1L5YA 2VRCA 4C1NA 2UUBB 3E7PA 4TM8A 1A0OA 3R20A 2Y2VA 3BMCA 4GYKA 1TQ2A 4LVCA 5BN3A 1AQJA 1U8EA 3P2YA 1PNOA 3NV9A 2FX2A 4TX1A 1VJRA 1JFVA 2XVYA 1D5CA 1GGKA 2FZKA 2WABA 3M6LA 4E2WA 1NRIA 4RGQA 5ISMA 1P2VA 1DDOA 1NYLA 1E64A 3EUEA 5KVAA 4D9EA 4BUJA 1NXWA 4XVUA 3GEPA 4HB0A 3TKLA 1M2VA 3I42A 1L6RA 2IYPA 1A5SB 3CZ4A 3IT1A 2IHYA 1RWBA 1HA3A 4E1BA 1N2GA 1VJDA 1EQUA 2V98A 1A4RA 3MLAA 4GH5A 4QDUA 2OBMA 2YMMA 1A69A 2WJWA 3FOAA 1ZZGA 5IBPA 3ZV7A 1T9GS 1XJQA 2ZIAA 5FFNA 4XWTA 1J0DA 2H5IA 3HBAA 4PQEA 3ZNPA 3N2KA 1X7HA 4YXWA 3CLHA 3VJKA 5J4HA 4OQXA 4GICA 3TUJC 2QM3A 1AZTA 5CB4B 2GCOA 4A26A 4BDTA 4BMYA 5CP8A 1BMTA 1WVMA 3RYTC 3KVRA 5F3WB 3OLVA 4HXYA 2ZUWA 1HNNA 1D04A 3Q15C 2BGNA 3W4KA 1TVCA 4F9GA 1H9CA 1P7PA 5A5EA 1Z56C 1XZEA 1ZUWA 4DMLA 4PICA 2AN9A 2YKGA 1BTOA 4R2XA 2ZM6B 3WGHA 1TYAE 4YS6A 2EQAA 2WQ6A 1U0BB 3SXPA 1BOFA 3ON5A 1VCIA 4YHBA 1R8YA 4G1EB 5WRFA 2IDMA 1E3DA 3QE2A 4ZVVA 5JE8A 3IDQA 4FFSA 1T13A 4F38A 1FYXA 2BSAA 2Y1CA 4L85A 4YJHA 4C78A 3R3VA 5JCPA 5K3OA 1I1NA 1ECPA 4X1YB 1JJFA 3DBRA 1KERA 3FHTA 3ZJYA 4OK5A 3KFVA 2H48A 3N2GA 3GLFE 1O96A 4UUMA 3FNQA 3K5IA 1U4OA 2WY2D 3RJZA 1G60A 2Z8XA 3W06A 1VA5A 4P8RA 1PDWA 2Q4BA 2X9VA 4DA0A 1OXXK 4L9AA 4K6HA 4ERXA 1R0SA 3WL8A 1K5DA 2GHTA 1YZTA 3I83A 3AR8A 4Y2SA 2QXUA 1TA4A 6GPBA 4C01A 3L06A 3VR0A 3M3PA 1UJ4A 1I01A 1Z0JA 2YY7A 2H6EA 1K7XB 2FZWA 4KG7A 1V7CA 2ZE5A 4O2AA 4RUKA 4H59A 3ITKA 5GIPE 2Y0EA 3R44A 5CLJA 1R0KA 5BN4B 2CXXA 3M4YA 3RR2A 5C81A 4D8TA 2YZNA 2JLCA 3N8GA 3M8KA 3R4CA 1XZQA 1L5NA 3GJYA 4ZI7F 4JOBA 2G36A 1Y48E 2D7CA 1FS4A 1U1DA 1SGWA 4IDFA 2WB2A 1F1BA 2FWPA 4XJTA 1VLHA 3TB4A 1JQDA 4L9SA 3OCYA 1WLYA 3NBMA 4JAVC 3TCKA 1CJTC 4QE3A 3OPMA 1BMFA 2FRDA 3MQFA 4FP9A 5T7BA 1VL0A 5JCOA 4N39A 2WAAA 4XAQA 3AUUA 4RMIA 3TAXA 4WCFA 4B4DA 1XC7A 1DAFA 1SOWA 1TF7A 4BP8A 4E5VA 1GAEO 2BEWA 4W8OA 3VR6A 3ZDAA 2QTAA 2EZTA 2X2PA 3BRWA 2QMOA 4HAWA 4PG7A 4Q24A 4RU1A 1PAUA 1BHJA 1X42A 2XA2A 3OTWA 4B6GA 5HOEA 3C7CB 3MMZA 1TUBA 1M1UA 4WT7A 2BHSA 3ZR4B 3JYQA 4QLBA 1WRBA 4ZEXA 4G0OA 2OD2A 3RTGA 3D3KA 4CF7A 3WYAA 2F7SA 1ENYA 2RGAA 1CUSA 3GLGB 4JQOA 3LW7A 1Q15A 1UFOA 3UMRA 4UUNA 2AWNA 2GVNA 2D0IA 3VUFA 3ZVRA 1OQAA 4JKYA 1GSIA 2JJQA 2VDNB 3KPYA 5I51A 8LDHA 2PD4A 4ARZA 5JFOA 2E0IA 4BX2A 4CBVA 2VP9A 3FCSB 5EGSA 2ZBVA 3PUHA 4BNMA 3UJPA 5CH8A 1MFZA 4GOLD 1KYVA 1SXGA 3R24A 2QV0A 1XP5A 2OV1A 3P4XA 4P80A 1JVNA 1L4YA 4MO2A 3AZQA 2CDNA 3K9BA 1YZFA 4MUAA 5CPFA 1VIVA 5EQDA 4HKTA 4DC1A 5B6JA 2LNDA 5DTIA 1XTRA 3ZBPA 5IXYA 3LM8A 5JXWA 4GX1A 4I4NA 2WU4A 4NECA 1UBRS 4QPZA 3W8RA 3B60A 3NBZC 3KRTA 1H4TA 1IMOA 4PO1A 1J1UA 1CD5A 3GT7A 3GRAA 4DIOA 2QBYB 1FMJA 3Q6IA 2YXPX 3BCSA 3HR7A 3L7JA 3KSBC 1O94C 5CX1B 3TEFA 1MD9A 2BDTA 5ALTA 1GCGA 1EHCA 1T5TA 3FUUA 4D3SA 4IIXA 3SJAA 3SQOA 4RPIA 4F4UA 3G2KA 1VHLA 1WCV1 4IUBS 3P2EA 2B2XA 2OCPA 2I8LA 3B7PA 4Y67A 1W5FA 4S04A 3FYUB 3JW8A 2ZRMA 4C3VA 1E9BA 1ZN7A 4NH0A 3VNUA 4JT4A 3RK4A 3O9ZA 1JHOA 2QUAA 5EMHA 2CMFA 3PB3A 4O08A 4LY9A 3TOCA 4DQVA 4DG8A 4AF6A 3HZZA 2W4IA 3P9YA 3RYIA 4D4GA 3ZE1B 3TL3A 2FQYA 1KETA 5I01A 5KQPA 3IURA 3JAMA 1H6DA 1ACMA 4FFWA 4L9WA 2HEGA 4JR0A 3HFJA 2WT4A 4D92A 1IZ7A 4G63A 2YN4A 5HK8A 4B3IA 2Z4RA 1N2CA 1Z5PA 4QIHA 2OHIA 3UW3A 1LBEA 1RTTA 2QX9A 4QXMA 1YVRA 4U2GA 5F77A 5KOJB 1GGJA 1CVIA 5YASA 1L4LA 1YZLA 4GM0A 1LBHA 2ZGVA 2VR1A 1CY4A 3ED5A 4BKUA 4KXWA 4NZ9A 3TW4A 1YA8A 2VJAA 1TTQB 5FQOA 4AJKA 3K0AA 1BGWA 1OI3A 4UBLA 1C1DB 2Q6TA 2JJYA 2AKEA 3V1YA 2PWPA 1OLSA 3VYRB 2Q2NA 3BMNB 4D6PA 5K45A 2FCRA 2ZAMA 2HWYA 2MHCA 1KSFX 2P3QA 1ZJWA 1PFQA 4DOMA 1P73A 1U7PA 1Q0PA 1ZXXA 1ABBA 5THXA 1GKKA 4I50F 1LKZA 2R9VA 3QF7A 2IX3A 3WLJA 3GA7A 3OM1A 3PT9A 2ZE7A 4RDIA 4MH0R 2SECE 2WWVD 5E6UB 4EO4A 3CEMA 4S0ZA 4L4RA 4X92A 3ZK9A 3L7CA 4AIIA 5IJZA 2I76A 3OOJA 4MWEA 4XDZA 3W5BA 1UR5A 2YCLA 1HM5A 2LW7A 3G9TA 2SNIE 4JLWA 3BPSA 1KBZA 1WSWA 5K8TA 1VLMA 2G04A 3IB6A 4DANA 2G83A 5P8WA 3S55A 2ZEJA 3NPMA 2QZJA 1MA0A 3IQGX 3FTNA 3JVEA 3LQKA 3M9LA 5L3RA 3FOWA 1MT3A 3SF8B 5HHTA 5L4LA 4F3CA 5FRDA 1VMAA 3IRUA 1Y4SA 4FCTA 3JWJA 1GO2A 3HLKA 2FLKA 1RBZA 3KALA 4PPFA 3ZHQA 1U9JA 2PGXA 1EIWA 3KK0A 3ZLTA 3NJ8A 4BZQA 1A2QA 1C1YA 2XSZD 3O90A 3P9PA 4TL7A 3GEGA 3GUHA 4RKYA 4Y1EA 2VTBA 2YRFA 1IK4A 5LMNB 2AWOA 4YRCA 3FBGA 5DLPA 3S7ZA 3SBOA 2IH4A 3H11A 4WXHA 3U4IA 3GEMA 1T8TA 3D7KA 1IZYA 3TK1A 1SXJA 4X00A 4ZCSA 1KF0A 5JXJA 2P90A 2C9BA 3FWKA 4HUQB 2P1RA 3L02A 3IUQA 2ZI6A 4MQ5A 1WBJB 3EQ6A 3IAHA 2OV4A 1ANKA 1C3VA 3LPAA 1S2LA 3AY7A 3G5TA 4OJKA 1N0IA 4IAOA 2ORYA 4JLDA 1MGPA 1CFJA 1JQJC 3HMQA 3VJLA 4JFAA 2YCBA 3JRXA 4C2TA 4KXXA 2P69A 3IOMA 1Z13A 4PQFA 5JO9A 4B09A 4UPEA 1UM9B 4JYPA 3STXA 2VZ0A 3EMBA 1N5LA 4HT3B 4IO0A 3T7TA 1QORA 3T9DA 3LUKA 5HF8A 4I1IA 4ENQA 4CIWA 3EXAA 1M54A 4GOXA 3O38A 1PW7A 1KJIA 1J6UA 1X2BA 3UBTA 3GUYA 5TSDA 1ZCJA 2FPPB 5CA0B 3U44A 1BYUA 1V6SA 4QYMA 3DEIA 1DDIA 4ZGWA 4Y6RA 1XEWX 4EKGA 2WG1A 4CMIB 1GKIA 2ZVPX 5KWSA 2J6IA 2YY6A 3K0FB 4TSKA 5KNCD 4ZOEA 1W36B 1QMPA 2RK3A 4IXWA 5NLLA 4WMLA 4TVBA 2PM8A 4FK8A 4L4ZA 2AUTA 5G3ZA 1YVPA 3MG9A 4PE5B 5F35A 3H1PA 2DTXA 4RACA 3VO2A 4XJSA 2QPAA 4U6SA 2WKPA 5DV9A 2B2NA 5GZ6A 5JVDA 1ZWLA 2EFEB 3SY8A 3EXEB 4H7JA 2OLEA 3DXXA 4HATA 3RQIA 5IKPA 2PT5A 1DAKA 4CE6A 3O1IC 4NDAA 1TK9A 4KRYA 2IXTA 4FEYA 1G5FA 3KKZA 3VOAA 4MB0A 3MOIA 3K8ZA 4RQAA 2VPZA 1XZDA 5FTLA 8ATCA 1NOKA 1PGPA 2YFHA 3LHKA 3TTUA 1EQ2A 1OZGA 4C5BA 4EJ0A 3UOAB 2QV7A 4OBBA 2GPSA 3O2SB 5THQA 2ZWIA 1R2QA 3MS7A 4IIJB 4A73A 4EQZA 5TQVA 5HDBB 1JF8A 3T34A 1WTAA 2E87A 5M5BA 2R8YA 3TZKA 4ITUA 2IOQA 3AI1A 2W2LA 1P0IA 2EJUA 4KPYA 2C3UA 1EM8B 3RKRA 1B23P 1G291 1KOGA 2GXSA 1NX6A 4KQEA 1YVDA 5EMMA 3V4VB 4EUEA 4ZO8A 3WSWA 1W5TA 5BURA 5IZCC 5FWYB 1ODCA 1TJ4A 2EFCB 2AMJA 3ZE9A 3IUJA 4I6EA 1YCFA 2ZYRA 2V55B 3QHQA 3NH6A 4GC9A 5ALSA 4OQQA 4OY3A 1XXHB 2AD5A 3K7EA 2R2AA 4TWAA 2GJKA 3X1YA 2PGLA 3VYSB 1VTKA 1GCAA 2BVNA 4YCNA 4OMDA 4UNRA 3DLBA 4RZHA 1Q83A 2IEBA 1CF4A 5ED4A 4EM6A 4IINA 1LU9A 2PL5A 4R2JA 3FOEC 2BFAA 1T5IA 1TL7C 4GOND 4XM1A 3TBKA 3OJCA 1YRLA 1G8FA 2WWGA 3IJPA 1QPZA 5K0JA 3MK31 3LMKA 3N2LA 4RA6B 3AF0A 3DFFA 3A70A 4RPCA 3DD1A 3GPIA 3QUBA 4X3CA 1T4DA 4NRDA 1VCMA 2WG2A 4Z9AA 1YTLA 1JEAA 3CNOA 5KBYA 3MJRA 1DOZA 5FNVB 3VGPA 1NUPA 4LOHA 2CBGA 2H5LA 1BJRE 5KWJA 3AJ9A 1DKLA 4G0XA 5K0LA 2E7ZA 2FVYA 4F4IA 2CEKA 5DOZA 1XAIA 5CAEA 2ORIA 2ECFA 5KVSA 1AJEA 3TTSA 4N65A 3EVFA 2Y05A 3IKMB 4A82A 1T2NA 1ND6A 5AOCA 1SEVA 1QFZA 2H4YA 4QATA 4G56A 4JOQA 5DIZA 3PGLA 4F4CA 4A6XA 4HNRA 3PXDA 1TX4B 5JJKA 4PIPA 1O03A 3AHDA 2XR1A 1QWSA 3GNSA 1XU4A 1MW9X 2R8XA 3GCDA 1T36A 2CB9A 5BWCA 3R5FA 5CIWA 3S28A 2ZIWB 2HYIC 2UZ1A 5AM3A 3MGCA 1T1SA 4PWYA 3EULA 3QU5A 2OFFA 1FSPA 2ZUDA 4WL0A 4IJ6A 3ROQA 1Q0LA 5H0IA 3U7GA 3NWOA 3THRA 2P35A 1XTPA 3GLRA 3GRYA 2XB6A 2CFOA 4P86A 3S8YA 4R7ZA 4P0QB 3BXOA 3JQ8B 3W3AA 5CFPA 2IS4A 3HG7A 4OLJA 4A8JC 1WVIA 2EIXA 4FCVA 1ADCA 4YCDA 1AHHA 3KU1A 3RUAA 5IABA 4IOMA 4MGIR 1ZM9A 3IJEB 1TAHA 4MW1A 5AOVA 1O9HA 3OPNA 4AJ1A 4YT2A 3GLGE 4UCWA 1PJAA 1WLSA 2EFDB 4XIIA 4DR3B 2FI1A 4EBBA 2IELA 5EJIA 4KQKA 3IUMA 3H99A 3KCNA 4L7VA 5JH7A 2PLAA 4IKPA 5K1ZA 4KQXA 4H6XA 3HK2A 5IH3A 1I1QB 1ONPA 2ZRDA 2ZYGA 1ULSA 1U6JA 1AGNA 4R81A 5FNZA 1Z33A 2G80A 3UWDA 4MVJD 1L7BA 4XRRA 1Z63A 5KQRA 2QRNA 2CNOA 1DRVA 5KJCA 1GGVA 5IW8A 3U40A 1G8JA 3ZW7A 3ZS9A 2R00A 2I7XA 2YXDA 3FPJA 4GFDA 4MP3A 1A88A 2X8JA 3ZHXA 3AUSA 1CUHA 2ZE8A 3PPIA 3KAPA 4JC4A 3WFZA 2JA2A 2WFZA 4PN3A 4HEHA 3THWB 5EJEA 2HDWA 4EPYA 2P4SA 3FMFA 2W11A 1PK8A 4IIUA 3AR4A 3PPYA 1W2WB 1PYOA 1X1DA 1T5BA 2XQFA 3JZAA 4Y9TA 4O4JA 5T4HA 1YT5A 3G79A 3LY5A 3VV3A 4C0BA 1JSCA 5KC9A 3P4YA 3G2NA 3NXKA 2IHUA 2ZWPA 3G5MA 3K0SA 4BJ3A 4OX9Y 1YFKA 1UBSB 3SCZA 3KSMA 3ZY5A 3DCYA 3PBKA 5HJ7A 4DA6A 4GNKA 1MX3A 3PGVA 1GPNA 4FS8A 3EGDA 4MPRA 4M0EA 5AM5A 5AI0A 1U4SA 2FGKA 2OEPA 1A5TA 3DM5A 3FMGA 2C98A 2O2YA 3WLOA 2QLMA 5LZ4A 4D0LB 4QA9A 1XR3A 2V4ZA 4AUEA 1KZYC 1VHTA 3A4TA 2LIPA 3F67A 1SPBS 2K5UA 1DQNA 4MYUA 3BK1A 2SCUB 4ZQEA 1NXPA 2JEOA 1IRXA 2FUKA 2P6PA 5A6SB 3PDJA 2PDAA 4P82A 3VVLA 4AECA 4Q9LA 5LFAA 1TCCA 1F12A 3M7IA 2CEAA 3PL1A 1XROA 2X4IA 3EMDA 2HK8A 4O4HF 1PRYA 4YUYA 5IT4A 2QT0A 2VP4A 2ZR8A 1YR8A 3ROEA 2CJPA 3IBCA 3HBLA 3PX3A 3A9CA 4OEHA 3UANA 3UA3A 5LM3A 4Q9JA 1B00A 1KK2A 1P2FA 4YV1A 1ZLYA 2W37A 3UC5A 1B6GA 2CVHA 4QJ5A 4R0MA 5CBPA 2PSDA 4N3BA 4A8HA 1MG0A 3PCRB 2CL0X 2C94A 2H5JA 3OQBA 3DFUA 3UAWA 1NVWQ 1USWA 3C8DA 1SCAA 4C3UA 5KNBA 1QGDA 3LLMA 4QBGB 3IQHX 1EGMB 5BWBA 1LI5A 5D6OA 1J8DA 1VJGA 5AW9A 2R62A 3B1ZA 4W1QA 3NWBA 1RJ9B 1V3UA 2VDVE 2R6GA 4Z0HO 3M3HA 3NP9A 2D5CA 3PJRA 3I0ZA 1WXIA 2QL7A 2WHYA 4UNSA 2C2OA 1ZVVA 1IBRA 4O5OA 5CD1A 3HA5A 3WDMA 1JE0A 2PN1A 1U9IC 3P2IA 4RV9A 3KHUA 3S8EA 2BF7A 2PUGA 2GAFA 2EX1A 2GH1A 3WRYC 2G25A 1Z38A 4M0MA 1DSSG 3TDMA 4C4SA 4WKPA 2OCAA 4CLOA 5LBIA 5CR9A 4KAXA 5SV2A 1KOLA 3BXPA 4A0HA 1SCNE 2Z2XA 2X6RA 3DJFA 3HY4A 5CXXA 2IF0A 5BVGA 3EA5A 2AFHE 1JKIA 3HDQA 2FWJA 3F4BA 1P0PA 5T4BA 3USZA 16PKA 5JMPA 3GIWA 4RAOA 2WDPA 1BFDA 2FWRA 2LDXA 2B99A 5EJFA 5TE9A 4EITA 4F46A 4EQ6B 3RUDA 5BWMA 5JI2E 4TXLA 3MUEA 3L6EA 1V1MB 4P3PA 1JWAB 2HCFA 2OGWA 1D8AA 3BA6A 3EEIA 3W7BA 4AYWA 2IOFK 1T10A 2OCLA 3HWWA 3VSCA 2BFPA 1TMOA 1TM5E 2TSYB 3JWEA 4BLWA 4XLLA 4JR2A 5BNZA 4QFBA 2BHRA 2CVPA 2P8SA 3D1LA 5AW3A 2NTNA 3IS3A 1FFCA 2P3OA 3ESCA 1AGRA 2GI4A 3HN6A 2ZRJA 3V8BA 4ZHQA 13PKA 4MQEB 4GZ3A 2NX2A 2ZTMA 3KV1A 4OAOA 4IRMA 4EVSA 3I8XA 4PPYA 4WK6A 1ZFNA 1R88A 2BFBA 3QA9A 3OX3A 3G0CA 5EUMA 1JR6A 1HKHA 3RFTA 2YUTA 3NAQA 1W5EA 2YDXA 2O8BB 3PP8A 1PZNA 4EEKA 2G5TA 4HPWA 3A05A 4BFSA 1PLLA 3KQHA 1P91A 3ZY6A 3OKCA 3IP6A 2GN1A 4LYGA 4MGZR 4ZFNA 1WD7A 4FZVA 1IVSA 3CBQA 3GLGA 4K6OA 1JI0A 1ST3A 2Z04A 1JQBA 1PDVA 2TMGA 4RVGA 5EPUA 3SIXA 4EBFA 3S5JA 4KGVA 1JT9A 4DREA 3ZGVA 2GRJA 2NV6A 4KK4A 4D79A 4JXZA 1IZ0A 4JMLA 4EFMA 1PJCA 2GX6A 2RGCA 1IOLA 4M1KA 4P38A 3A6PC 3D6VA 4PTZA 3B53X 3RAFC 1PL8A 4JUCA 2Q9BA 4OLHA 2VP3A 1SQFA 3TAUA 3DLIA 4B6FA 5I9LA 4N7JA 1PWXA 1GM5A 1QR6A 2I9KA 3ZOKA 2B6HA 3L6CA 4RNDB 2CDRA 2C9YA 2F1KA 4OP1A 5D87A 4BQEA 2CLEB 1U8YA 3FPFA 4YJFB 1H0RA 1E2FA 5J2TB 1QOPB 3ADCA 3W6NA 5AVJA 5CYGA 4IZOA 4YRPA 3N59A 4MI1A 1ULBA 4LF9B 3K9GA 2VDJA 4DE5A 5AI8A 3H4MA 2ZAGA 3KOMA 3V1LA 4B5LA 1FLVA 5D85A 3RS7A 1KIMA 2W6ID 4FUQA 4EZIA 1CJVC 5FV7A 1JAIA 3DDOA 4RHCA 1QG6A 1TYCA 1DWQA 1CT9A 4G85A 5CX1A 3TSZA 5E1OA 3D5TA 2AG1A 3OMLA 3TZQA 2VUTA 2IIBA 3NKFA 3EGIA 4LE2A 3OKPA 4LX0A 3OCZA 1FUKA 2CZCA 1DT5A 2M6RA 5AUNB 3IPRA 5HCUA 2BN4A 4XVHA 5HUJA 4D4MA 3DZJA 1HTTA 4PR3A 2JC3A 2G88A 2CWWA 3KBBA 2BSQA 3O94A 1DIBA 1ZIPA 1E4VA 4LZOA 3H9EO 4PYIA 4UEWA 3HFRA 4GMGA 2PUDA 3DJYA 4DT1A 1G2OA 1T3HA 2IKQA 1MEEA 1I9CA 1QPBA 2R11A 3BXEA 1V37A 4BQIA 2YJ3A 5G41A 1SUWA 3LSTA 4EA9A 1CZUA 4LBZA 3IAUA 4Y3UA 4UW9A 3RARA 1TUEA 2QTHA 2NO1A 3U0BA 3DLHA 2PU7A 4ENPA 2ZIXA 1JMKC 2P9QA 3JQAD 1HQDA 1SC6A 3LDHA 4Y18A 1CJCA 3P2JA 5CFNA 4BWYA 1RRVA 2WJYA 5KOJA 4WI1A 2W5UA 4Y7CA 3HCRA 1Z4MA 1NXXA 2AR0A 2YC4C 5GQSA 3MYYA 1JG7A 2Q45A 5SICE 3BH0A 4RSRA 1TF5A 4HYTA 3WQRA 2E85A 2Z09A 4TWIA 3PFBA 2YJ6A 2HF7A 2VNJA 4LX8A 4Z9BA 3DZBA 3G9QA 4AZ3B 2VDWA 3EDMA 1QK3A 2R60A 4WE3A 1HMYA 4IDGA 3VDNB 4DV6B 2QTMA 3H9CA 4EW2A 1XJWA 5T3UA 5LJLA 2PUFA 2C57A 3I8OA 2RGNC 5KO2A 2RBGA 2XUDA 3QUTA 4JHLA 3CGGA 4HDCA 4C4RA 2F17A 2XXJA 2IA5A 4I99A 3WKBA 3HSKA 2KBEA 4JGGA 5J2UA 3TPFA 3JTMA 1BSVA 3H97A 1EUZA 1LK7A 1O57A 1ZLXA 1ZICA 3SE0A 1G21E 2QN7A 4MVYA 3CX4A 4M6WB 4AJPA 5HXAA 2O8NA 2XQJA 3T41A 1G9SA 1HH4A 1Y9AA 1NW5A 3KKPA 3PEUA 3JWIA 3U49A 3I1FA 4ICIA 4QYSA 1JPNA 1WQ1R 4MYRA 5EIFA 1BJKA 3WRWA 6PFKA 1VBNA 3KT3A 4DLBA 4ZT7A 1U2ZA 2WKRA 3HB9A 3FB1A 4Q3CA 4RDHA 1TF2A 4YAEA 4Z8YA 2RCYA 5BW6B 2VJNA 2CSXA 1YS6A 4K9SA 3WNQA 4C05A 5E3HA 3DNMA 3DZ8A 4YMSA 3HCAA 1IEVA 1MVOA 3IRVA 1MUUA 5JD5A 3K09A 4ZANA 3U3OA 3X43A 1E58A 2ASEA 4KX5A 2JS7A 4H4DA 2Q29A 4K9RA 3V2HA 1DTWB 2MDTA 4MGHA 3GEHA 4O4HA 5KX5B 4JQSA 3EQ8A 2OXFA 2BP7A 3RC9A 1ZU4A 1GNTA 2RARA 5TT1A 2OHVA 4YT8A 2VA8A 1YJQA 2ACVA 2GOYA 4JL5A 4X1IB 4EHAA 4UD6A 3LA6A 5F5NA 4I55B 1NL3A 2C2BA 2XWSA 5CNJA 5H02A 2FHPA 3GX1A 3L82B 4Q12A 4R01A 3ZGNA 5A9SA 3LOPA 3BJEA 2QLBA 3EEFA 1P2BA 1QHNA 2JKVA 1LLFA 3M9WA 9MHTA 5HDQA 4DSOA 2J0EA 4F4FA 4IV8A 1U31A 1RM4A 3NXSA 1K6EA 4DR4B 1L7QA 4OM7A 1U04A 5DSTA 5E95A 1LTKA 1Z4JA 3H18A 1GAJA 3SSNA 2W6JD 1HE5A 5JALA 4LYDA 4JIGA 2I87A 1YIAA 1SHUX 3HCNA 1ISIA 5EPEA 5BNIA 4NXMB 1PO7A 2HGSA 1CRLA 2IY7A 2UVDA 2KQUA 4CN8A 1G19A 3D8RA 1KO4A 4L16A 3D6AA 4I5EA