The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
120
|
structure length |
120
|
Chain Sequence |
b'PLSVLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAYQNRQFDVIIMDIQMPVMDGLEAVSEIRNYERTHNTKRASIIAITADTIDDDRPGAELDEYVSKPLNPNQLRDVVLTCHS'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Signal transduction histidine kinase
|
| publication title |
Crystal structure of the response regulator receiver domain of a signal transduction histidine kinase from Aspergillus oryzae.
rcsb |
| source organism |
Aspergillus oryzae rib40
|
| molecule tags |
Signaling protein, transferase
|
| total genus |
39
|
| structure length |
120
|
| sequence length |
120
|
| ec nomenclature | |
| pdb deposition date | 2008-02-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00072 | Response_reg | Response regulator receiver domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
