4EKDA

Structure of human regulator of g protein signaling 2 (rgs2) in complex with murine galpha-q(r183c)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
318
structure length
318
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFDVPDYAAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVCVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the regulator of G protein signaling 2-g alpha q complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/inhibitor
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
total genus 109
structure length 318
sequence length 318
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4ekdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ekdA01
4DCVA 3SI7A 1W0KA 2J0SA 2CL0X 2NQ2C 2GBLA 1NY6A 2HV8A 3ASZA 4R7ZA 2VIIA 3SN6A 3O8CA 1G8PA 2XXAB 1ZINA 4DHEA 1ZVQA 2A2ZA 4ITRC 2VA8A 4PQRA 1E9RA 4HB3A 3EARA 5H68A 1QHYA 4A6PA 3VMFA 1GL6A 4YMUA 5F3WB 1TUIA 4LC0A 2CCJA 3CX6A 1FQKA 3PUYA 3F0TA 5EXPA 2QSYA 5CDFA 4EQ6B 2BBTA 5J4KA 1UKVY 1ZU4A 3ZGXA 1FMJA 2H5EA 4D82A 1WE2A 1UM8A 3A4NA 3W8NA 1X6VA 2F43B 1QRAA 3RSLA 1W0KD 3PEYA 5EXTA 1XEXB 5KNCA 1ETUA 4M1TA 5FTMA 3RABA 3VTKA 1JJ7A 1Q44A 4IDNA 3TJZA 2V8OA 3CPHA 4FI3C 3R9IA 2AWOA 3EZFA 1US8B 4F7WA 5E7IA 1AJEA 2RGXA 4HDCA 4AKGA 3LW8A 4G1UC 3U3RA 2FWRA 3MJHA 2IYWA 5LPNA 2QG6A 4WIAA 1BOFA 2XJ4A 3GJ8A 3U44A 2R8RA 2ZREA 2Q9CA 4HZIA 4A8JB 2G6BA 3GJ7A 3NC1C 4J0QA 1S9DA 1D9XA 1XXHB 2D7CA 4GP7A 4NHOA 4H1UA 4JLDA 4WA7A 3HDTA 4URUR 1T6NA 1VG9B 3I73A 2WWWA 4KODA 2PMDA 2W0SA 1U0JA 3E70C 5FL3A 3U4QA 1DELA 2EWVA 2DY1A 4V03A 2Z83A 4KYUA 4EDHA 4M9XA 1SULA 4LHZA 1GKYA 3SR0A 1GNQA 1T3SA 2R6FA 4PQYA 2ZJ8A 5EE9A 4AI6A 1E2EA 2H18A 4TMZA 1PJRA 1H65A 1P72A 4Q00A 4PFSA 3SZRA 2W6JA 1XMJA 1IAQA 4PO9A 3K70C 4AKEA 2JLSA 3BORA 5KPDA 4UKDA 4DLUA 2D2EA 1R8SA 1Z0JA 4D26A 4DLVA 4NH0A 3NC0C 5CIWA 2VF8A 4KBGA 1PVOA 2BM1A 3OAAA 2QPTA 4BWYA 2B6HA 2ATXA 1F6BA 4BECA 4YXWA 4CVNA 4F93B 3EA5A 2BMJA 4US2R 3W3ZB 1ZUIA 1ZC3A 2IEYA 4B74A 2C77A 5L3RA 4TL9A 2PX3A 3ZVRA 1KSHA 4D4LA 3ETLA 2KWIA 3GLIE 4TYPA 5AUQA 4OQXA 2W00A 1RPZA 3AGPA 2WWXA 1KSJA 2ZIAA 4FCVA 2HYIC 2GJSA 1G18A 1CJMA 4W5WA 5TB5A 2ZS9A 2IYSA 4ACBA 4DIDA 4CF7A 4N0DA 4MA4A 2J7PD 1GP2A 2IK8A 1VECA 4QBFA 2ZRAA 4IVRA 1VTKA 3CH4B 3CONA 1QG4A 1Z0IA 2OEPA 3OZXA 1OFHA 5DO9A 4P4TA 2O8EA 4CDGA 4NYMQ 3O8BA 2WPDA 2JATA 4XJXA 4Z54A 1RJ9A 1FL9A 3KDSE 3GPLA 4HSEA 1IBRA 1LS1A 3E1SA 3QEJA 5IRCD 1KY2A 1WA5A 1F48A 3DKVA 4GT1A 2NZJA 2R2AA 1NJGA 1R0WA 1NY5A 3GJ0A 2HUPA 3KKMA 4JLAA 2NTYC 2VSOA 2CJWA 2LKDA 1K5GA 4C7OA 3BRWD 5FBWB 2ZU6A 3AVWA 3JVVA 2CDNA 4IOMA 4YMWA 3SC3A 1WF3A 3I8SA 1E0KA 2FSHA 2YOHA 3K70D 4DCNA 1GAJA 4DLZA 3KUCA 3WMFA 2PT7A 1LW7A 1FP6A 3N2IA 5LD2C 2CE7A 3GLIB 2ORIA 4HDQB 1S1CA 1PUJA 3O8DA 4H9GA 1A2BA 4NP6A 1GTVA 2V54A 4KI0A 4WXRA 1IXZA 2ZJZA 1VG8A 3HJNA 3LRPA 2IHBA 2BBSA 1R2QA 3QY0A 1TTTA 4A8JC 4L4UA 3RS4A 3SQXA 2ZRIA 3KJIA 2XTZA 5DI3A 1E4VA 4MDFA 2F1RA 2D2FA 1FQJA 1E9FA 4Q1AA 3KFVA 2RGNA 5GVRA 2IXGA 3U44B 3IIMA 3PVSA 1XNJA 3BIFA 4BFUA 4UNRA 4D6PA 1Z07A 4ZCLA 3QUSA 1E4YA 1P2UA 2WJYA 5P21A 3X1WA 1IHUA 1VYVA 4US0R 3EG5A 3K0AB 4FN5A 3CPEA 4M53A 4ACAA 5FL7A 3B60A 1IY0A 1SVLA 4JVLA 3GLFE 3NG1A 1U8YA 1XJQA 2YWFA 2HF8A 2A7QA 2IBMA 2KBFA 3A37A 1W4CA 2FSGA 3IIKA 3Q72A 1N5KA 3EIQA 1R7RA 3K09C 3EPHA 2ZR7A 2OHFA 3AVQA 3VKWA 1FTNA 2FH5B 3KXKA 4OI2A 5HE9A 1I4DD 1DARA 5HTKA 4DZZA 3OESA 1R10A 1F2TA 1R8QA 2ZI6A 3EW9A 4EKDA 4NTZA 4PQFA 5AJVB 5HCNA 2IW3A 1GRRA 1TQ2A 5JEEA 4Q4AB 3RYTC 2JEOA 4TZ6A 1XPOA 2X2EA 4W5HA 4CW7A 4QL3A 3VNUA 4A9AA 1G17A 5SZKB 4PPFA 2QT0A 1RRGA 4LJYA 3B8HA 1GL7A 2ZRBA 2OUKA 4JVNA 1XEWX 3C8UA 3UMRA 2ZSDA 3ZH9B 3OEED 5AJZA 3ZZUA 3GLHA 3TUIC 1E3MA 2PH1A 3RHFA 3LXRA 3BB3A 3EPKA 1S0UA 2JLXA 3KL4A 3EPLA 5AWFC 3AKYA 3B2EA 1TEXA 2JLUA 3UWOA 5JWHA 5FPHA 2FSFA 2PZFA 1Q1ZA 3SJCA 3KKQA 2G88A 3D3QA 3TSOA 4GOKA 3VR6A 4XH9B 2V9PA 3HWSA 5FBRB 2V3CC 1E69A 2XTMA 2GCOA 3U4QB 4Q7MB 2ZRJA 3LA6A 4TMVA 3DPUA 4ZIRB 2WM9B 3ZQ6A 1A2KC 3VKGA 1U99A 2G1JA 2ERXA 2PJZA 3AQ4A 1U94A 3M0EA 2WJVA 2FF7A 3CRRA 2ZXUA 3S1AB 3EIEA 4K81B 5FTJA 1KNXA 1AQUA 4ESVA 1A1VA 2F1IA 3KXIA 2LWIA 4TZ0A 1IQPA 1E1RA 1W1WA 1YZGA 5DISB 1KTVA 3TVTA 2WMOB 3AKEA 2QGZA 1P5ZB 2ANCA 2ZRNA 3K9GA 1LY1A 2A78A 5GJVC 3ZQJA 2PLRA 4Q1FA 1RKBA 5HZHA 1PLKA 2IYUA 1ZNWA 2PCJA 2QM7A 4D4KA 2QORA 2UZIR 3NKVA 1S96A 2V6JA 3P27A 3FE2A 1Z22A 1VYTA 1HE1C 2XTNA 4TLDA 4Q1EA 2ZUCA 4AURA 3LX5A 3TAUA 2ZUBA 1HQCA 4FW9A 2E9SA 1XZPA 5EP4A 4XWAA 3CX7A 1CU1A 2ECKA 1X3SA 4HDOB 4B33A 1ZC4A 4B2LA 2R6GA 3IQXA 4GRAA 2R9VA 2A5YB 4RZXA 4TYNA 4DDTA 1KYIA 2O0JA 2KE5A 4ASUA 3P20A 1SVIA 4P4SB 1D8TA 3CBQA 5IK2D 1SVKA 2QBYB 1E79D 2DFTA 1MO4A 2QPOA 5UKDA 1KI6A 5H70A 2DR3A 4LHWA 4Q4JB 4ZV4A 2IYTA 5J4VA 2P6RA 3AP1A 1DAKA 1EX6A 2HXSA 1KSFX 3RWMB 3W90A 4HUTA 5JHHB 5JHGB 4GSYA 1AGRA 2XJ9A 4BEJA 2OG2A 3QIAA 421PA 1OPXA 3QKRB 4TTPA 1VYUA 2AKAB 4UXIA 1W36B 2V6IA 4XIGS 2JDID 2PCLA 4DCSA 721PA 3VR4A 2OBNA 3TGPA 2O0HA 2DWPA 4OHVA 4E03A 1P2SA 2VHQA 1R0XA 3KKNA 4ZPXA 4F38A 4K8OA 2OLKA 4FMCB 1YHNA 3AVYA 3NXSA 4C7OB 5M04A 2JDIA 2QI9C 3IEUA 2C9OA 3QPWA 2VBCA 1MABB 3GJXC 2AD5A 1P75A 3OEHA 1D2MA 1M1YE 3SYNA 2J59A 1SXJE 1T0JB 4FCWA 4D25A 2ZE5A 1E2QA 2Q3HA 3EXAA 4QGHA 4ABYA 3IIJA 3OE7A 3SJBA 4AKIA 4GZMA 1C9KA 3L82B 3OEEA 3THOA 2GJKA 4B34A 1QVRA 2HT1A 3NDPA 3FTQA 3IGFA 4IVQA 1PLJA 3QPUA 5KSYA 3LQQA 3H2YA 2IX3A 4Q18A 2R65A 1E2GA 4BLOA 3ADCA 1WXQA 1XD2B 1JR3E 2PEZA 5FUWA 1TNDA 3LO5A 2BMFA 3GLHB 3QI2A 2NZ8A 4GOJA 2GK6A 1DG3A 2DWQA 3L0IB 3Q85A 1OXSC 2W6IA 3EASA 4HUQA 1T5LA 2QP4A 4U7DA 3RC8A 2VP4A 1Z08A 4R71A 3GJ3A 4CEJA 3F3YA 1MRNA 3AKDA 1KHTA 3VR1A 1A4RA 4IXNA 1RYFA 2IXEA 5TVKA 2I3BA 5BN4A 1FX0A 1ESMA 5BWMA 4A0FA 3NEYA 3GEIA 2MSCB 3A1WA 1IN6A 1KI7A 5JLJA 4ZIRA 1XEXA 2XITA 3ECCA 4XD7D 2LCFA 3CLVA 3HR7A 2GKSA 3KQKA 2XB4A 2ONKA 3N5CA 4MRVA 1L2TA 4QNMA 3C7KA 4ZDKA 3I5XA 2WOOA 4TWZA 4G5QA 1TX4B 4DC9A 4UNSA 5BN3A 2JCSA 2RGGA 4V0KA 3THYB 4YMVA 2G0NA 3TUZC 1P7CA 2EQBA 3KTAA 4GNKA 4WZAE 2VYFA 4URXR 1LFDB 3M4YA 3M1IA 2EFDB 2AKYA 5GJWC 1S4QA 4LHYA 1TADA 1NI3A 3U3JA 4DRZA 4DVGA 3NBFA 5HE8A 1E2NA 1O87A 2YHSA 1G7SA 4HLUC 4AC9A 4EPWA 2QM8A 3I72A 2DFNA 1X8KA 4FIDA 2WWIA 1S8FA 3U5ZB 4R9UC 3ZIAA 3B1WA 1TMKA 2P65A 1Q20A 3U6BA 3AB3A 1J90A 2J0VA 3X1XA 3QPVA 3PEWA 1JALA 2KI5A 1BKDR 4TSFD 4AG6A 2WSSD 2OZEA 5SZIA 2X77A 1SGWA 1B0UA 1KO8A 1NSFA 4QOSA 2IWHA 4O25A 4B3FX 1TF2A 5TY0A 2AFHE 1TQ4A 1XJCA 4KFSA 3I92A 2CLSA 4TT3D 4ZDWA 3MFYA 1YE8A 5DYIA 2IS6A 4M1SA 1OH5A 2YKGA 1NSTA 1G5TA 1G5PA 1OFTA 1ZD8A 4Y0VA 1CEEA 3BFVA 2FDCA 2ZSAA 1OFIA 1GWNA 3BBPA 5FL7D 4CEHA 3K9HA 3W34A 2VSXA 2FGKA 2PX0A 4EFLA 2XB2A 1E9AA 3KUDA 1SKQA 2CJWB 2D74A 1XX6A 3VFDA 5HPYB 1HE8B 3T15A 2N1BA 2ZAMA 2ATVA 2WZQA 1ZU5A 3PFIA 2O8DA 1D9ZA 1ZM3A 3P1JA 2O8FB 1KJWA 3K9NA 5HCIA 4BFTA 4BLQA 1U9IA 3PG5A 1N6NA 1NRJB 3ZDQA 3NHBA 2ZJBA 3RRNA 4Q1CA 1X8LA 4KFUA 1KGDA 4DT1A 2ZRMA 5EP3A 4R2HA 3WNCA 3S1AA 2RGAA 2I4IA 3CH5A 4HAXA 2GAAA 4JLJA 5BQ5A 1NG1A 4DCUA 4MYTA 1JR3D 3GFOA 4C0BA 2OILA 5AR1A 5FI0B 2FFQA 1N6PA 2ZI4A 4DEYA 2B7CA 4EPRA 1XFAA 5TV2A 4PO8A 2GK7A 1N6OA 2HCBA 3WMEA 2W2VA 3QENA 1KMHA 2XZPA 2W58A 5DH9A 1AZTA 4A36A 4B3GA 3TR0A 1NVXQ 4ARZA 1OH6A 2OCAA 2QZ4A 5F9FA 2ONJA 1ZW6A 2R62A 4FMDB 3J81k 2DCUA 2CL6X 4EJSA 4OK5A 1Z06A 3C41J 4QRHA 1SXJA 4Q9JA 1ESNA 2HF9A 3F5FA 3RC3A 2V1UA 5FUVA 1RRFA 5HZKA 1G16A 1ZM9A 2HLDA 5G3ZA 1BH2A 1OXTA 1RW4A 1JNYA 2WJJA 1G41A 4PHHA 2CE2X 4URWR 4GBMA 5FBLB 1ZUHA 4MGKR 1IN5A 2GJ8A 4M4SA 4MRNA 1WP9A 4HEJA 3K0CA 4RD6A 3Q7PA 5J47A 4L9SA 3B9PA 4HYYA 3SOPA 4II7A 3PEUA 3WYFA 1DOAA 3B78A 1CRQA 2IF2A 3IO5A 2NGRA 1NVUQ 2WAYA 4CEJB 2HXYA 1C1YA 3E2IA 3NH6A 2DYKA 4LJ4A 1QHHB 3HYTA 1P9WA 4IOKA 1W7AA 5CJ2A 4GP6A 4LV5B 3SJAA 2ZRLA 4IDOA 1KI1A 3TSWA 1EWRA 3MAAC 2JJ1A 1GDDA 2MMCA 3AVVA 4CZ2A 3A4LA 3W3AA 3WBKA 4B73A 3QKTA 2WAXA 4C30A 1RRCA 4HATA 5J4LA 1EXMA 2BMDA 2H1LA 3CNLA 4E22A 2YVUA 1QHIA 1UDWA 4Q01A 5LB4A 1XEFA 4HLDA 4JT4A 1G8YA 4ESHA 5BXQC 4YXWD 1XP8A 1KO1A 1QHXA 4MYHA 5JZVA 4FXPA 1KK0A 5FPTA 4ZCIA 4EQ6A 2WWGA 2VO1A 3ONWA 3LBNA 4QGGA 3L8ZA 1KIMA 1FP7A 4BLTA 1TAGA 1HT2E 2CCKA 4WAUA 2J41A 4FINA 2CHGA 1G3UA 1XTIA 1ZM4A 5FR2A 1OB2A 3AP3A 1QHSA 1CS4C 4I81A 1UDXA 2EFHB 2IEZA 3AUXA 1P60A 1DAGA 1KMQA 4S2EA 3P26A 1WRBA 4RJLA 2JLYA 3GJ4A 4NKRA 3W9YA 1WBBA 3AKCA 1JXMA 4Q1DA 3BK7A 4HLQB 2QGNA 3LNCA 2EU8A 5EE5B 3WY9A 5CB8A 1BS1A 2WIBA 1T5IA 1KI2A 2WPDD 3AF4A 1NBMA 3ZD6A 2OCPA 2SHKA 4ZI3A 3BAFA 1T3LA 3GLGE 2O8CB 1ZP6A 3CUEF 5EP2A 1E9EA 3PENA 4KFRA 1GKIA 1HUQA 2R6AA 1UBFA 1G7CA 3NHAA 4RVCA 4P4UA 1NN1A 4TL6A 4C0QC 1MT0A 2N46A 1YZUA 2BBOA 2RB4A 4JLPA 4B71A 1CF4A 3THWB 1ZNYA 2KBEA 3CRW1 5DIFA 3JZMA 1Z6TA 4ZDJA 1Z0DA 4HAYA 1M7GA 4RFSB 5FPSA 5HKKD 5GADl 4QM7A 4TTRA 3ADDA 2XAUA 3NBZC 3ND9A 4I1OA 3VX3A 2D3WA 1E2IA 4NYJR 2VP9A 4TLBA 3MRSA 4XOIA 2C2HA 3BERA 1SQ5A 2RHMA 4V02A 1AKEA 3TRFA 1AS0A 4HZUB 2FFAA 3SQWA 4B3CA 4QKQA 5K8TA 1HYQA 1AK2A 2JLRA 4JYBA 1PUIA 2CNWA 4LYJA 4MRRA 2GBLC 3UKDA 5CM9C 4TYYA 2V4ZA 1MH1A 2ZSFA 1NVVQ 2GTPA 1TU3A 1G8GA 1FZQA 1UPTA 1II8B 1KK3A 2GF0A 5HR5A 4JJKA 4JIMA 1DS6A 4QBIA 1LNZA 3HPQA 1E99A 3I32A 1N6IA 2OXCA 3AF1A 2RCNA 2J87A 5KSPA 1OH8A 1XBTA 5KNBA 1YR7A 4WXPA 3WHLA 2ZJOA 1CKEA 1NJFA 1Q0UA 3DVLA 1DTSA 1KY3A 4TMTA 4Z8XA 4KLZA 4LYAA 3SBDA 4XWOA 3SYLA 3THXA 2W0MA 2ODEA 4PXAA 1KOFA 2OLJA 1T3HA 4NCIA 2H16A 1NMXA 4OJQA 3V00A 2VRWA 4HB2A 2CXXA 2IUTA 1II0A 5L3VA 1AS3A 2GXQA 4AYXA 3U7FB 1P2VA 1OHHD 2REBA 2PZGA 4TQAA 3A8TA 3LH5A 3QJYA 2D62A 5CYPA 3TBKA 5FOXA 3TE6A 2NO0A 1VIAA 1B23P 1J8YF 1HQYE 1NLZA 4NYIQ 3CB4A 1E9CA 1XD9A 4X8MA 5SZJA 5IT5A 2RGBA 3R7WA 1G3QA 3QXHA 4MKFA 3KJHA 3VX4A 4Q19A 1GITA 2QPAA 3ZIAD 3I62A 1DAEA 3UMSA 2NMVA 3LLUA 2P3SA 3QKSB 4V0LA 2XZOA 2GWHA 2RGCA 3A36A 4JZKA 2P5SA 4Z1MD 3I1FA 1E9DA 4JSTA 2WMNB 1G20E 1CR4A 2J7PA 1DAHA 4LHXA 3KB2A 5JWRA 4RKEA 1IM2A 3CF0A 2ZETA 3K0EA 4TL7A 5FOTA 1WQ1R 4URZR 2QMUA 3GLGB 3QF4B 1E2DA 1G7RA 1M2OB 4MGIR 2BBWA 2NOAA 2OSBA 3DDCA 3I3SR 1KMHB 2XZLA 2QY9A 3BB1A 1KI6B 4LYFA 2YV5A 4GPTA 4BLSA 3IDQA 4A2PA 2PT5A 3RRMA 3DOEA 3Q9LA 4QJ4A 3GLIA 2IHYA 5JSZB 4C0LA 4IKEA 2BEJA 2HCJB 4TLCA 3RS0A 3NEJA 3A1UA 3A1TA 3QE0A 3K09A 4LX0A 2DPXA 4IXMA 3K70B 1RRPA 4NYMR 3U7GA 2GXAA 3PITA 1NN0A 4Q48A 4IHQA 2FU5C 2RH5A 4FWTA 2OFXA 2QAGC 1Z5ZA 5KHOC 1KSGA 1D2NA 1PV4A 2IYVA 2VHUA 4JLOA 3RWOA 3CZQA 4LOAA 3TVDA 4HLCA 4LJ5A 3W5JA 2FG5A 2DB3A 3QVUA 1A7JA 5L8VA 3FHOA 2GZHA 3BH0A 3OIUA 4KXFB 1Z29A 1YQTA 3MCAA 2VP0A 4HAVA 2GXSA 2ZRFA 3C5CA 1W2HA 4JVSB 4DWJA 4OI4A 1YZNA 2GJ9A 4B35A 4V0MA 1Z0AA 5JRZA 4NE2A 1YRBA 3EC2A 3U61B 5KNDA 2ZQ5A 4ZO4A 5JS8A 2G0TA 4LZZA 4RD1A 3EPJA 5IDVA 1CR2A 1XF9A 2ZJ2A 2P2LA 2K5UA 4KJZA 2Q6TA 3ZYCA 1KI8A 1XD8A 2B8TA 1VCNA 1XXHE 5EZ6B 4DBLC 2C03A 4QBHA 1KI3A 1OIXA 4URYR 4B2IA 4HAUA 3IBYA 1H8ED 3BH6A 1U81A 1COWD 1EFUA 1QF9A 5L3QA 3V9PA 1Y63A 1R4AA 2C98A 2A3RA 4I1VA 1IXSB 3ZD7A 1JECA 4D0LB 4QC2A 2JGNA 1ODFA 4JLKA 2O52A 1Z2AA 2AD1A 4M1WA 1GVNB 4U5XA 3W8RA 2WWYA 1X8JA 2YYZA 1U98A 2ZI5A 3B9QA 4IDQA 3AVUA 1AA9A 1Z0KA 3CWZA 5TDHA 3MWKA 4JLVA 4PC6A 4XVQA 2H7VA 2PZEA 3THYA 2QN6A 1P6XA 4M21A 3BC1A 1TF7A 2NO9A 4QM6A 2W83A 3DM5A 4DB4A 1EX7A 5TARA 1G9XA 2B92A 2QAGA 1N0WA 3EC1A 1W4BA 3Q5EA 4PANA 2IS1A 1NKTA 1U0HC 4D4JA 5EE0A 2ZI3A 1QHGA 2J1LA 1KJYA 5IK2A 2FJUA 4LRWA 2QQEA 4IFBA 4YLGA 4A6XA 3EA0A 4AG5A 4JLBA 2JJ8A 4RFSA 1HY3A 2J9RA 3G82C 4G3XA 2OCYC 1Q1BA 3K8YA 3LW7A 2VH5R 4EFNA 4XVUA 1EGAA 4EUNA 4LUCA 2A9KA 1U0LA 4DB2A 1QVAA 2ZE8A 4DDUA 4Q47A 3LQRA 2ZAOA 1DE0A 3FKQA 4TL8A 5GJCA 4QXAA 5A0FA 5K8IA 3DMNA 1FMLA 1Q1EA 4E09A 3F8TA 4BFVA 4XTCS 2ASEA 3R8FA 4LBZA 2ODWA 3VNVA 3AGQA 3CF6R 3SFZA 5A4JA 1OXVA 2BOVA 3OEHD 5TMPA 1GILA 1N0UA 2GCPA 3SBEA 3JZAA 1KDRA 4Q9HA 3G5UA 2OCBA 3OIVA 3I61A 1Z6AA 3TAHA 3KQUA 1F2UA 4PZYA 4KSCA 2BMEA 3TSZA 1G5RA 4PSKA 3OFNA 2J0QA 2QTHA 4BPBA 2DHRA 2Y8EA 3PCRB 1DO2A 3KZ1E 3ASYA 2F43A 1CTQA 1RJ9B 3DZ8A 1AGPA 4Q21A 4LY6A 3DEFA 2IA5A 3AF3A 1Q21A 3EWAA 4EPYA 1XWIA 4LCBA 3VR2A 5FI1B 4IW3B 4P4SA 5KDLA 1EWQA 4C0SA 3O47A 1U90A 2CBZA 2XOKD 4B3XA 3FYHA 2MSDB 2F9LA 3IHWA 3QQ5A 1SZPA 1UEIA 2QSZA 2ZI9A 4I1UA 4YDHB 1CR0A 3NDBB 1M8PA 1L4YA 1IY1A 4H1VA 2BV3A 2IT1A 4KSBA 5D3QA 2VHTA 3P32A 3K0FB 1JI0A 3GP8A 1OYWA 4W9MC 3NWJA 3TMKA 3R7WB 4B32A 2UVQA 3AV0B 4B3BA 2HJVA 4P33A 1HA3A 5GJBA 1DAMA 2FSIA 4JL5A 4KVGA 1UKZA 3L8YA 2RGNC 4PPNA 3AVXA 2KSQA 5KUTA 1G6OA 3Q5DA 2VLIA 2VP2A 1ZM7A 5H8WA 1NG9A 4YQFA 2Z5FA 4B47A 1E2LA 3D8BA 5E7MA 4RD2A 5KPJA 4AWXA 3CWQA 4DLRA 1AN0A 3I5YA 3CO5A 4IDHA 1Z63A 3U7EB 2D4HA 4JKIA 4B3DA 4DLYA 3AVOA 3B7GA 2YC2C 3U3OA 3BWDD 2QNRA 4C2TA 5JSZA 1II9A 1YR9A 2Q3MA 2YOFA 4G5SA 2O8CA 4UJ3A 4O2LA 2ZE6A 1ZUNB 2O5VA 1VIYA 5K8LA 3G0HA 2IS4A 1U8ZA 1FNNA 3DZDA 4D80A 4XSGA 3U3MA 2ZRKA 3FVQA 5FR1A 4PC7A 1XEWY 4W5JA 1T91A 2QE7A 1LTQA 3IPXA 1DO0A 2QENA 4UXJA 5FPKA 3P4XA 5DN6D 3OF5A 3ZLJA 4A82A 4TMWA 4Q4AA 5KDDA 4X8HA 3SNHA 4A8JA 5HKKA 4RY2A 4EPXA 2GJAA 1ELOA 1E9SA 1P9RA 4HUQB 2FE4A 4MRPA 4L15A 4QG7A 1JAHA 5FOUA 2JJ2A 2F1HA 1KZ7B 4KU4A 3GD7A 4L5BA 3QBVA 3NBXX 4XD7A 1W4RA 3VU9A 3LFUA 3B82A 5JRJA 4NDZA 5CITA 1E2JA 2TMKA 4AY2A 3RRZA 1AM4D 1GNPA 1NMZA 1II8A 2BCGY 3BS4A 3AUYA 4JMPA 2EYUA 3LXXA 1AS2A 3B13B 3QEOA 3FMOB 3VR5A 2HJGA 4DSUA 3KKPA 3AF2A 1DVRA 1IN4A 1ANKA 3QF7A 4TYQA 3A1VA 2RGEA 2NPFA 4PAMA 3T1OA 4JKYA 1WBDA 5AUOB 1SHKA 1OH7A 1CBUA 2OV2A 4AD8A 3KQNA 1YR8A 4F4JA 1YZTA 4FD2A 1QZXA 5E4FA 4IEEA 1TU4A 2ZSEA 1Y3AA 1WB9A 1NN3A 1KJZA 3KTAB 1L7VC 2F9MA 1P61B 3QXSA 5JMTA 1OIVA 4BFXA 4QGFA 3TH5A 5JEDA 1IOZA 4G0NA 4MDEA 1U8AA 4C0AC 3T06B 2R6CA 2H8KA 3LX8A 1BIFA 2X2FA 3BB4A 3AM1A 1NP6A 4BZQA 1US8A 1Q57A 1GM5A 2CK3A 4KV9A 5AJXA 4OHYA 3IO3A 2BEKA 2WJGA 4UQOA 5J5CA 2OT3B 2VQSA 1SXJB 1IN7A 3LBHA 2A5JA 4I99A 4MQBA 5EQTA 2ORVA 4PAQA 1CJUC 2ODNA 3ZVLA 4HZUA 1G4UR 2ZRCA 3B85A 2WKPA 2Q0HA 3K53A 3NVAA 1FPMA 1NNEA 3V4RA 2EFCB 5DLQC 3FB4A 4MH0R 1Z3IX 3GLGA 4B43A 1EFRA 2C95A 2XSZD 1R0YA 3CR7A 3L0OA 5KU1A 3GFTA 1TQDA 1E2FA 4OQFA 1GOTA 1P9NA 2WICA 4E5UA 1ZIPA 4LPSA 1W47A 1KDTA 1RVDA 2IYRA 4KLNA 4BLPA 1OKKA 1JEEA 3TKLA 3UG7A 1OF1A 2GXUA 2BDTA 3AEZA 2GNOA 1JJVA 4GL2A 3RVBA 2GHIA 2ZS7A 4UNPA 4E07A 2IS2A 1R5NA 5CLQA 5JS7A 3M6AA 1MO3A 4G01B 1JR6A 5DNYB 5H1YA 3AVTA 2QL6A 2REOA 2O8BA 3TQFA 4CT4B 1G64A 1YKSA 5L3SA 1W36D 3THXB 5CIQA 4OKSA 3OIWA 4LC1A 3EX7C 3MMPA 3SE0A 4C2UA 3FHCB 4R98A 4ARZB 2JLQA 1UADA 4FMCF 1XTJA 3O8RA 1AQYA 3EAQA 3RAPR 1EESA 2O0KA 4BQSA 3ZZ0A 2PLFA 1N5LA 4L16A 5JJKA 1Z6GA 4PHFA 4ILEA 4TMKA 3RS5A 4WW0A 3FHTA 1Q3HA 5E95A 2F3RA 3IHLA 1XCMA 1X86B 4A4DA 2ZYTX 2MSEB 2VP6A 3LVQE 1S3SA 4FMDF 5DSZA 1VPLA 5F2EA 1OXXK 3EZ7A 4QHSA 2WJIA 3FMFA 4P32A 2O8BB 1COWA 2QRNA 1G3MA 3CIOA 3GJ5A 1EG7A 4I4LA 3WXMA 4A1FA 4D81A 2OXRA 5IF9A 3A1SA 5K8UA 3U6KA 4DLWA 5DI3B 2B8WA 2FPLA 2JAQA 3TUJC 2UKDA 2OM2A 4B6FA 1X1RA 5C18A 4L9WA 4BZXA 2D7DA 3PEVA 3I4LA 3LY5A 4NL4H 2F55A 3GMTA 2GRJA 2GZAA 3LDAA 1XMIA 3AVPA 3BH7A 3THWA 5AJYA 4NBSA 4Q7JB 2A5DA 1ZNXA 1M74A 2AN9A 1ZMXA 2QROA 2GILA 4IVPA 3B5JA 4UXHA 5FTLA 1FTSA 3UPUA 2VL7A 4KAXA 4Y0AA 2VSFA 1Z28A 4EJSC 4OHWA 4S35A 1FUKA 5JI2E 4P3YA 4M8NE 3ICQB 2QMHA 4CIDA 2OBMA 3B1XA 5JJLA 2N42A 1N3BA 1QG2A 2I1VB 4OHZA 3KQLA 2QBYA 1KI4A 2QUZA 5EUQB 3TIFA 2Z6VA 3UWKA 1CLUA 221PA 1ZBDA 1D6JA 4M9SA 4Q4HB 4PHTA 2W6JD 3IILA 1Z6YA 2RGDA 2QEQA 3K0CC 5DHFA 5LD2B 4BGDA 1W4AA 2XNSA 2BVNA 1OT3A 2EWWA 2REXB 1T9HA 2H17A 1YU9A 5G41A 4NONA 4D4MA 2FZLA 2ZVQX 4PC1A 5KDOA 1SVWA 2IYLD 3LVRE 4MKIA 1KDPA 4DIEA 2O8EB 1E2PA 2EYQA 4OQLA 3CZPA 2IYQA 3MD0A 3PUWA 3IQWA 4JSYA 5KSZA 5KSOA 3PUVA 2ZEJA 3C15C 1NLYA 1XRJA 4BFYA 3KJGA 4CEIB 4ERNA 3REGA 1BYIA 1IJEA 1D2EA 1JPNA 2H57A 2NO1A 3Q7QA 2P6NA 1HEIA 3ZJYA 1IXRC 4NZYA 2GVZC 3UATA 4Q9IA 4BASA 2PJRA 1G8FA 1HV8A 4MITA 1G6HA 1KO4A 3CRVA 5L3QB 5AK0A 1KK1A 2IUSA 1ZCAA 5JWOA 2JLVA 1GIAA 1T0HB 4Z1MA 1QHNA 5FTKA 2C96A 5C4MA 4FWIB 2QQ0A 3QXJA 2GA8A 4LSGA 5EZ5A 3V4FA 4DSNA 4V0OA 3DM9B 1T8UA 3W5IA 1VCIA 6Q21A 2XGJA 1UKYA 4IEIA 2ZRHA 2ZS8A 4QFMA 2FOLA 4Q9LA 2DWOA 5CDFE 2X1VA 4JJZA 5BN5A 1SVSA 1RE0A 1U2RA 4RD4A 3ZVNA 2WTUA 4AIIA 5GVSA 3HPRA 4M0LA 4P0TA 4OI0A 2BJWA 1CJTC 4FCTA 1JEDA 2CEAA 2V1XA 2JJ1D 1IJFA 1AKYA 1XCGB 4DEXA 5CM8B 2BWJA 4BRWA 2A30A 3WRXC 5B57C 1G8HA 2IYYA 4BUJA 2W2TA 1XDBA 1J7KA 4B48A 3RANA 1G7TA 3VHLB 4K46A 1G3IA 2MMGA 2UZ3A 3K0FA 1ZYUA 3CX8A 2GETA 2CLCX 2AWNA 3QSYA 1Z8FA 2EFEB 1W48A 3WRYC 1GRNA 1Z2CA 5ELXA 121PA 1Z0FA 4KFTA 1CJKC 2ZANA 4JS0A 1OHHA 2FMXA 2YNMA 1YR6A 5EP1A 1OB5A 1Q3TA 2AK3A 2C99A 4DUGA 1G19A 1XD2A 4RZ2A 4TLAA 4JLNA 2YZ2A 3MWYW 4JBXA 1W2GA 1KI9A 3BXZA 1NN5A 2ANBA 4IFEA 1KDOA 1KZGB 2CVFA 2DBYA 2F6RA 4NYJQ 1VMAA 1HURA 5JI3E 2QRZA 4D2IA 1E1QD 2YOGA 4Q4JA 5AUNB 5E3HA 1Z6XA 4A0GA 2H92A 2ZVPX 1XPRA 2ZITA 4F91B 3GQBA 1DAIA 4OQNA 2J0UB 5EJEA 1E2KA 1N5IA 5JCZA 4RKFA 1J2JA 3GEHA 4EJSB 4RSGA 1P4SA 1EFHA 2YJTD 2QA5A 5J4HA 2OFWA 3SFVA 2HT6A 4MYCA 1JR3A 4O0MA 4C3ZA 3T5DA 5B30A 1OYYA 3LBIA 1O3YA 2C78A 1UFQA 3AF0A 3X1ZA 2ZRDA 1IONA 3MLEA 4BE7B 1N5JA 2VTKA 5CK4A 4UNNA 3CRMA 3I8XA 2QE7D 1W44A 3K9LA 4PHGA 4URVR 1XJ0A 2CK3D 1YRAA 4G5RA 3CNOA 4DCTA 1EFCA 1DADA 2GF9A 1FOEB 2OE2A 2JA1A 2G77B 1C4OA 1OV4A 4OYHA 4LBWA 4RZ3A 2JASA 2QU8A 3JVUA 4O2RA 2JLWA 5LB2A 5AUPB 3TLXA 5KOYA 4KHZA 5FTNA 3T1QA 3ZS9A 4PO1A 2AK2A 1M7BA 2W6ID 3UG6A 1P3JA 4RCZA 4EAQA 4QHYA 2V7QA 3P4YA 3WP1B 2D06A 3HU1A 2FA9A 4TLEA 5C4GB 3SDZA 1RIFA 1BYUA 2G9NA 4IOLA 4KO8A 1E0AA 1EFTA 3D7MA 5EXXA 1FFHA 1GG2A 4LHVA 4V0ME 3RRYA 4JBWA 1OKKD 5FBQB 1I4TD 3BD9A 5G40A 2Q9BA 1SHZA 2CMKA 2C9CA 3TK1A 4C4PA 5FBVB 3L0SA 4QJ3A 1OXUA 2QTVB 4FMBB 1MRSA 4QNRA 3QKRA 3H0KA 5ANRB 3SS8A 1S2MA 1XXHA 3CKLA 4TQUS 1H8HD 1P73A 1VG1A 4KYIB 3T35A 1N6KA 2WWFA 3QG5A 1CP2A 1LVGA 3QXCA 4DDVA 1XMVA 5A5GA 2XX3A 3PUXA 1QBKC 2O8FA 1MOZA 1ONBA 4ZKDA 1F5NA 1SVMA 3T1TA 3D31A 2WHXA 2ZYUX 5LBIA 2BHRA 4WVFA 1JB1A 2LKCA 4DT1B 3W6NA 1SXJC 2BJVA 3FWYA 3WNBA 4YMSA 4KITB 1DBSA 5JECA 3T34A 3U60B 1JQLB 3VU9B 4PC3A 3E5HA 5FOVA 4IDPA 2J46A 1XTKA 1N6HA 2KB0A 3UK6A 3BFXA 3KFXA 4TN1A 3TR5A 2ZI7A 3REFA 3T5GA 2C9YA 3VKHA 5B64A 1NIPA 3IKJA 2EVWX 2Q3FA 4XVRA 4LK2A 1BMFD 4X8LA 4U02A 1S9HA 1CR1A 1SKYE 2OESA 3EIHA 1JBKA 1F2UB 4GMXA 4PSVA 1LS6A 3NTUA 4N3NA 1TPZA 4PTLA 1V5WA 4CEIA 3KQHA 5AJWA 4EIWA 4HAZA 1PZNA 2VPPA 1MO6A 4DKXA 2AFIE 4ASUD 2BCJQ 3CNNA 4IRUB 4JVMA 3MUFA 1E98A 5DE3A 2HYDA 2GEUA 2WSSA 2WVJA 4DSTA 1T8TA 4GZLA 1N6RA 4PPQA 5KO2A 1CIPA 2IUUA 3N2EA 1SKYB 3KX2A 4M9QA 3EZ9A 1E0JA 4B75A 2BIFA 521PA 5CLLA 1VCOA 4MKHA 3VQTA 3BJIC 3WNDA 1K8RA 3BFKA 3DOFA 4D0GA 4M1YA 2Z4SA 4DLTA 2ERYA 2E1RA 2J0UA 3WHKA 3A58B 1EFRD 2IXFA 2XSZA 2YWEA 2FPKA 1G4AE 4ZCMA 1X1SA 3FKSA 2FPMA 5JJIA 2HDNB 1W0JD 4G5OA 3L43A 3TNFA 1KNQA 4JT2A 2ZM5A 5KYKA 1KAGA 3RS7A 4A2WA 3KXLA 4NU0A 3QNUA 3T61A 4OQMA 4AYWA 1TUEA 1ZD9A 3MSXA 4OBEA 5EE1A 3RLFA 1Q22A 4QBGB 1GKUB 3OAAD 2B7BA 4X8OA 1NKSA 1GZSA 5E7JA 2IWRA 2NPIA 1U9IC 4GI7A 4A92A 4NCHA 1UJ2A 1RC8A 1KO5A 4Q02A 1F60A 4C0KA 2PEYA 4NYIR 2BC9A 4LYHA 1G291 1HTWA 4LDJA 3VR3A 2PMKA 1N0VC 3HU3A 4UJ5A 4TYWA 4G5GA 2ZSBA 3SYKA 1N6LA 1XU4A 2QMEA 4M2LA 1UAAA 3QKSA 1XB2A 5FOWA 1CULC 5CK5A 4DLSA 2Q21A 5LDDC 2YINC 3H1TA 1XZQA 4CT5A 4C0JA 2V7QD 1AIPA 1FUUA 4QJ5A 5FPYA 3QF4A 4DJTA 1E1RD 1M34E 2CHQA 1AZSC 1NVWQ 2RMKA 2X8AA 4U00A 4TT3A 4ZKEA 1E9BA 1J8MF 4MUBA 4PC2A 2IYXA 5SZHB 1MABA 2ZR9A 3U3KA 4NCNA 3X2SA 4EPTA 3ZZTA 1S1MA 4JBYA 3IEVA 5J4YA 1N2CE 2A5GA 2ZJAA 3H86A 1VDZA 2RHDA 1BO6A 2WJHA 4BFWA 1NIJA 3UXMA 1Z47A 5DI9A 2J7KA 1XTRA 3CRQA 3HU2A 1TQ6A 2FFBA 3WYGA 4LGMA 2WIAA 621PA 2XNDA 3EZ2A 3IPYA 4TMXA 3PR1A 4P31A 2GAOA 2W2XA 2OAP1 1W5SA 1CJVC 1GUAA 2NO6A 3GLFB 2VF7A 2YC4C 2G83A 2QTFA 3EZ6A 5DYGA 2CL7X 4PAOA 5F98A 3VAAA 3B1ZA 4JYCA 1LV7A 4ZDIA 2ZE7A 5FUYA 3X1DA 3C16C 4YONB 2CVHA 5DN6A 2QMOA 5JFGA 3L2OB 4Q9KA 1TF5A 1KK2A 2NG1A 1FNMA 1OE0A 1E32A 2VHCA 3RDPA 4ON9A 2L0XA 1FX0B 3CF2A 2F1JA 4HAWA 3HR8A 2XXAA 3GEEA 3K1JA 1MO5A 4OL0A 5JBQA 3DKPA 4W7SA 4XSHA 4MRSA 3WYAA 1F3OA 4LI0A 3T1VA 3A6PC 1YJ5A 3C5HA 2NIPA 1UEJA 2DFKB 5C2JB 1SXJD 3GCGA 4MGZR 4TSFA 3R9XA 3SHFA 3LWNA 4A0RA 2C04A 4RCYA 1KKMA 1E2HA 4M9ZA 4Q4HA 2GEDA 3N70A 2ZTSA 1NF3A 1ZJ6A 1CRPA 3RS2A 1NL3A 2E87A 4YMTA 2ODBA 2P6UA 1VHTA 3DO6A 2GESA 4Q5IA 2ZUDA 2G3YA 2V55B 1LB1B 1W36C 5EE3A 1M7HA 4C9BA 3CR8A 2FV8A 3QG1A 4NMMA 4AK9A 2BKEA 4V0NA 1IY2A 1J70A 2F3TA 4IOJA 2ZRPA 1GL9B 4PSAA 4CEHB 4RD0A 2QAJA 2Z43A 3FOZA 1W5TA 2ZR0A 4M1OA 1E0SA 1H8EA 1L4UA 1JXOA 3A4MA 2PBRA 1GFIA 2J3EA 2JIZA 3PXGA 2ZJ5A 2R6DA 3EWSA 5D3MA 4N0EA 5KTYA 2CLDX 1E94E 4TTQA 3DHWC 4WZ6A 4BEBA 2ZPTX 3GLHE 3BOSA 4D0NA 2CCGA 4LJ6A 1A82A 1DPFA 3NBYC 3T12A 2FGJA 2AX4A 3FMPB 4PX9A 3VHXA 2IL1A 3LV8A 4GDFA 5G53C 3ZVMA 3B1YA 5BYJA 5CJPA 3LAWA 2YWHA 3SEAA 2A5FA 3PV0A 3MGCA 4KBFA 5TXGA 2R44A 1EK0A 3W6OA 4CYMA 3FMIA 1NBME 4Z8YA 4Q7LA 4QHTA 5G3YA 3WBJA 2BM0A 2NO7A 1ZRHA 1MR3F 1JAIA 3ICEA 2JJ2D 1NBMD 4B2PA 2IYZA 1MV5A 4Q7KA 4XWKA 1E2MA 3ND8A 4ZI2A 2OAQ1 2RKOA 3K0SA 2ZROA 5EUMA 4WOPA 3OE7D 2OO7A 1YVDA 2ZYWX 3PUZA 1UBGA 1JPJA 5C46F 4PR0A 1R5BA 3KKOA 4BFSA 1RYHA 4O3MA 4TQ9A 2P5TB 4MUAA 3QBTA 2XNDD 821PA 2FX3A 4HB0A 4DLXA 1Q12A 1TL7C 2FZ4A 3KJEA 2IC5A 3CW2A 1D5CA 5BW8A 1TEVA 2CNWD 3RNLA 1NMYA 3FFAA 3CPJB 3OFND 1DEKA 3PQCA 4NCKA 4C0HA 1UF9A 2VP5A 1H8HA 1T4GA 3PIRA 5FFMA 2XOKA 2AL7A 3NIBA 1R5OA 4AKHA 2G1KA 1KAOA 4YDSA 1E96A 4NPHA 1YZQA 3FKSD 1NVVR 3OHMA 1ZAKA 4PZZA 4AYTA 3GFPA 3TW4A 1E6CA 4XTRA 4CRWB 1OW3B 3H4MA 1RZ3A 3QKUA 4JL8A 2QAGB 3MWJA 4LBVA 1V43A 3WP0A 4US1R 1G21E 4LJAA 2P67A 4Q03A 1I2DA 3ADBA 4WBSA 1XMSA 2GZDA 2GCNA 2BKUA 3ADKA 2RAPA 2YWGA 5JCPA 4PPGA 1ZD1A 3GJ6A 3PJRA 2WKQA 2ZRGA 1BMFA 2FEMA 4I1SA 2WOJA 5CB6A 4LWZA 1XCPA 5IHPA 2ZJYA 1LF5A 3UIEA 2C5LA 2IF0A 1R0ZA 2PL3A 1Q1QA 2ORWA 1G3RA 3GLFA 4RZUA 1DAFA 4LJ8A 2Z4RA 1J99A 1WDTA 4GMDA 3B1VA 1SVOA 3ZS8A 4KCGA 4R2IA 3WMGA 3HYRA 3KB1A 1GNRA 2AXNA 3MJRA 3OIYA 3TQCA 2EFGA 3MWLA 3CM0A 3DMDA 3FGNA 4OK6A 1R6BX 1VHLA 4OK3A 4MYUA 1W0JA 1K5DA 2AXPA 3RSOA 5DGXA 3K0AA 1HT1E 4QGAA 1YZLA 5J40A 4B6EA 1E79A 3HP1A 1ZM2A 2B21A 2WBLC 2P0EA 1N25A 2QP3A 3QXXA 1KO7A 4HI0E 4F4IA 5D3MB 3LD9A 5BYKA 2I1QA 4IJMA 1I2MA 2VEDA 1ZNZA 1F2TB 2WV9A 4PZLA 2XEXA 1RFLA 1W49A 1FW6A 1E1QA 2ZU0C 3LLMA 2AHOA 2KJQA 4LJ7A 2FEOA 5FUXA 4BLRA 3X1YA 4LBYA 4Z51A 4BRUA 1XPUA 4GOXA 3MG9A 1WMSA 4DUGD 2GVDC 3U7HB 3QVVA 1WCV1 3C4JA 4L8GA 2J5XA 4YC7A 3R9WA 1Z83A 1GSIA 4BFZA 4F92B 2JLZA 5FOSA 3TW8B 2HLDD 1ZIOA 2FFHA 1W46A 5EXSA 2ZYVX 1PLLA 4MKGA 2O8DB 3D6TB 1OFUX 1G1MA 2Q9AA 4DXAA 4OI1A 1VG0B 1VCMA 1UKEA 1XTSA 3NH9A 2DFLA 4M1KA 3B6EA 1OJLA 1LF0A 4M22A 1VKJA 1IN8A 2Z0MA 4A0HA 3FDIA 3UANA 2HEIA 8OHMA 2C8VA 2WWHA 3U2QA 1QDEA 3Q3JB 3Q8XB 3SHWA 4F4CA 4WZBE 4OHXA 4POAA 3R8CA 4B44A 4JL6A 4OJKA 1NLFA 4Q1BA 2JIZD 3W6PA 5B58C 2AR7A 4M1MA 4LPKA 2FN4A 2QP9X 3FPAA 3R20A 5C1BA 3DL0A 4KVAA 1DG1G 4CGZA 1S3GA 1OSNA 5DHAA 1XTQA 4JLMA 1MKYA 4MGYR 2FNAA 2GCOB 3C14C 3H84A 5B2ZA 4EPVA 3QOFA 4RD3A 4DDWA 1KKLA 4UNQA 1CXZA 2OBLA 4NCJA 1OIWA 3BGWA 5FH9A 3IBGA 1GRQA 2GEVA 2QT1A 4RFVA 4LJ9A 4Q4LA 4GFDA 2OFOA 4N1AA 3AH8A 4BZPA 4HLUA 4Q66C 5L3SB 1P62B 2WSMA 3L0PA 1UBCA 3UMFA 1ZCBA 4B76A 4HB4A 1P2TA 4A15A 2F7SA 3RS3A 4A2QA 2J45A 1A5TA 1M6NA 4DSOA 4EFMA 5F9HA 3SJZA 1L8QA 4LV6A 2WKRA 1I4LD 1OLOA 2EW1A 3AP2A 2VHJA 1K6MA 1UBEA 3IUYA 1YZKA 2X19A 5CYOA 3FFBA 3SU8A 1HH4A 1QHHA 2CHVA 3BE4A 1JQJC 2GDJA 4LV8B
chains in the Genus database with same CATH superfamily
3OZUA 5DT2A 4CLRA 3OQ6A 3GX1A 3ZWXA 4B9AA 2C9MA 1BH6A 1LNQA 2CLHB 2GPYA 1BEUB 2GBLA 2HV8A 1JIUA 2DHEA 2R79A 3I30X 4FHDA 4KIJA 1L1RA 1X94A 4R7ZA 4A27A 2GR9A 2HHLA 1V96A 2IEBA 2CN1A 2FB9A 1VC2A 4MIKA 1ZINA 1GPLA 4QYIB 3STUA 2VA8A 2ZBUA 4HB3A 4A6PA 1QHYA 3P2EA 2P4UA 4KXQA 5FX2A 1GAWA 5F3WB 4G0UA 2NVUA 4FUTA 3CX6A 1FQKA 2O1EA 3AEQB 3AFOA 3KRTA 5J4KA 4ZAFA 2BBTA 3VR3D 4B5LA 4CLOB 3FD8A 1FMJA 2H9IA 1FB5A 3G23A 3H6HA 1WE2A 5JBNA 3W8NA 2OKGA 1QRAA 5BN4B 1U5CA 4MI6A 5ES3A 1ETUA 1ECBA 1GY8A 2GHQA 4M1TA 5IKMA 2IY7A 1N3YA 1J25A 1JJ7A 1OZAA 3IP9A 4PR3A 4WL0A 1POXA 1XG5A 2G9UA 3KPUA 3TRKA 1FDTA 1TKRA 4DV1B 5E7IA 2FUCA 2C7OA 2PY6A 5KX5B 3DGFC 1A71A 3ZV4A 1Z4MA 2DUJA 3LW8A 5ALRA 4ZZ2A 4AKGA 4WBNB 1OFGA 3M9LA 4TUYA 3IP6A 2EKBA 4G1UC 2IYWA 3UAVA 2I8AA 1BOFA 2XJ4A 4MP8A 1HYEA 4UZEA 4KGVA 2YN2A 4WGFA 5CYGA 3BMXA 3NC1C 2P2DA 4FFSA 2ZBQA 4O4IB 2X5OA 5EJ8A 4JP2A 1S9DA 3HM9A 5HFAA 1E5DA 3LYAA 1KMIY 3HDTA 2XUZA 4URUR 5JSYA 3TD9A 1VG9B 4MDFA 4G2NA 1Z5GA 3NWBA 1B42A 4LGCA 3K30A 4N6GA 4F2PA 2FDRA 2G5GX 4HVAA 3TTTA 1H85A 1KEUA 5DM70 3MT7A 2EWVA 3KZMA 4HS4A 4V03A 3BRWA 1JJBA 1OBOA 1TJ3A 2V59A 1SULA 2WYHA 3CUTA 1JQBA 2VA9A 3GPCA 2V0NA 2XXJA 3L4SO 4ANFA 1GKYA 1YL7A 3BGSA 3OE4A 3S81A 4UVHA 4I1YA 4LQCA 2F3UA 3H1PA 1BE1A 1T5DX 3WHPA 1PJRA 3H2KA 1P72A 4IHJB 3A3NA 1MZPA 4PFSA 1SC1A 2NUTA 4CM8A 1J33A 1GNLA 4RENA 4AKEA 4ZYYA 5KPDA 3ILHA 4UTOA 5DU2A 1PWXA 2PYDA 3WGIA 4O2BB 2WB2A 3BXHA 1EEXB 3FJYA 1NUPA 4MJ7A 3UMVA 4OHKA 3GU3A 2IOYA 2Y1EA 2RAVA 3NC0C 4NVRA 4NH0A 4OV6B 3QVSA 3Q7IA 2D1QA 3WO0A 5GONF 2QPTA 3B53X 1B15A 4B6PA 4ZOLF 3O1HB 3W4JA 4ZMBA 2G5TA 1U04A 3F46A 2J4CA 2W4IA 3GDOA 2BMJA 2Y93A 3G1WA 3NV7A 4NZMA 1RQPA 5DFAA 2HIGA 1ZUIA 3TNLA 3WBFA 1ZC3A 1L4MA 2C77A 1A9RA 5L3RA 5E1OA 4G41A 4A91A 2DTEA 2QUJA 3ZVRA 1EGHA 2AG5A 5AUQA 3MEQA 1RPZA 2HL6A 4NJEB 4KDFA 4CM9D 2Q3CA 1QS0B 2ZIAA 4FCVA 1XV5A 1SURA 3UJCA 1G18A 4YJ2A 5BQXA 1QBGA 4O2AB 2O5RA 2BJHA 5K8CA 4N0DA 1WZIA 1Y8ZA 1S6YA 3O4IA 5BQPA 1VBFA 2P0YA 2IZZA 1ZOIA 3ZGZA 1GP2A 4BO2A 4QYWA 4G09A 2ZUSA 1IATA 2YCLA 5ALYA 5H5JA 4O4HA 3VM6A 2P9CA 4C7MA 1BVRA 1LGYA 1U1CA 1QDUA 1WR8A 2W6MA 3N39C 4ARUA 3R0XA 2Q5FA 4CDGA 5CDTA 1GTMA 2O8EA 2R5NA 2C59A 3O8BA 2YFQA 4HK4A 1VLJA 1EAMA 3AUKA 4FK8A 3EVZA 4MWTA 2NT3A 3VZBA 4Z54A 2C4MA 3KDSE 1ZVKA 4DJAA 4YI3A 1LS1A 1D09A 1UMBA 2FR8A 3QOXA 5IRCD 3T0IA 4RGYA 3LG2A 3O8OB 4HGOA 1WA5A 1JFVA 4QE3A 1LKZA 2G82A 3LHIA 3EZNA 1AUPA 3I6ZA 1NC3A 3O3OB 1JLMA 2NZJA 1N1EA 1FYFA 3GJ0A 3KKMA 2NTYC 2LKDA 1QP8A 4YPOA 5HVNA 5FBWB 1B7GO 2PAAA 1VI2A 3OCUA 2VQDA 1SUEA 1MOPA 4OAQA 1N36B 4GQBA 1QU3A 1OREA 3UB4A 1S2DA 2YOHA 2ZRQA 3ADOA 4FSDA 4LIPD 4ZC8A 4KR3A 3JALB 1T5TA 2PMFA 3PHCA 1Z36A 1JFSA 4J0HA 1GCAA 2HPZA 2V97A 3GRPA 3TZ6A 1UBJS 3N2IA 4LOHA 1GNSA 4YAWA 3ZXXA 1OI4A 4I9GA 1VJGA 4IIXA 1X14A 2JCYA 2RKBA 3ORRA 4HDQB 2Q2WA 4U7JA 1MH9A 4AW9A 4BLWA 3X43A 2JGDA 1MX1A 2V54A 3H9GA 3K6SB 1IN1A 5HUQA 2IHBA 1U28A 1R2QA 2BBSA 2ZCVA 3GFSA 2JI8A 3QY0A 4IV0A 1CEXA 4LYDA 5LLTA 1QNFA 4L4UA 2OFFA 3BE8A 5G0WA 5JS1A 4M1QA 4BNNA 2D2FA 5FBKA 1FQJA 1E9FA 1I6WA 4Q1AA 3LDUA 3KFVA 2RGNA 5GVRA 3U44B 1GN9A 1NW8A 2VR1A 3IIMA 1GCOA 3GELA 4GPIB 1XNJA 5JDIA 3DTNA 1QCCA 4BQPA 1Z07A 1VA4A 3K31A 4F6RA 4YCSA 1C9NA 3B20A 5HWSA 2PQ2A 1MZVA 1QE5A 2EW2A 2GFIA 1IHUA 1Y3CE 1XYYA 4DR1B 2JAWA 3H5TA 5ILGA 2WDPA 4FN5A 4ACAA 2WU3A 4Z3OA 1KA9H 1P1BA 3B60A 1ZJZA 4FOPA 4GPBA 3NG1A 3GLFE 1XJQA 1F8XA 2G9QA 4AP6A 5BRJA 1RRMA 1ZAYA 3O0TA 4O4LF 1NUUA 2CYAA 3BIWA 4ZT6A 1YONA 1G4HA 2R2GA 1JPVA 3Q3GE 4M0FA 4TS9A 3KT8A 5A7HA 3RFTA 3ZY6A 4CIBA 2QYTA 1Z17A 2QQGA 2WJWA 3E82A 4PONA 1QZ3A 4M98A 4MNTA 1DARA 4DMRA 4J2OA 3OESA 1DFGA 1R10A 2YX1A 5H83A 1HDIA 4PQFA 4R8LA 4Q4AB 4HGRA 3JSXA 3GYBA 4BYMA 1VJ1A 3CUUA 4FCCA 3VNUA 4D8UA 2J32A 3DMRA 4RVDA 3T3OA 4PYNA 4HDSA 4OF4A 4CMGA 1DXQA 3AFHA 2P5UA 4LJYA 3N74A 3B8HA 4CM4A 1I13A 1ISFA 1GL7A 2IGTA 4AO8A 3TX6A 1E89A 3EISA 4WWHA 4FB4A 2FFJA 2IYOA 1QSGA 2B8JA 3ZH9B 3FUXA 3HO6A 3R5JA 3ZZUA 1XVAA 2PH1A 3AJ9A 4Z86A 3RHFA 3E9NA 5HIKA 4HNGA 3AKYA 1S89A 1TEXA 3N3BC 1YJXA 4HAOA 3ZI7A 5JW6A 3EEYA 4L76A 4D9HA 4Q7QA 5A4AA 3IMGA 1W73A 2X1MA 4K3UA 3ONVA 3KKQA 4CFSA 1QHEA 3R5KA 4GOKA 3KWJA 4F46A 3VR6A 4XH9B 4ID9A 2HJWA 2V9PA 3M1LA 3T3EA 1CERA 2R48A 1BHQ1 1P77A 2BGWA 1VLZA 2WF9A 1DIOB 3KB6A 4Q7MB 2OD9A 4P54A 3LC0A 2DLCX 1EVYA 2V65A 1X13A 3G2OA 1N3IA 1T1EA 2DH5A 3DPUA 3Q0IA 4PF1A 4DAOA 1JL3A 2FWBA 4RA9B 3AQ4A 1A8QA 1RI3A 4FGKA 5B36A 1AKRA 2PD6A 5IFLA 2WJVA 2FF7A 3GG2A 4I3GA 3S1AB 1YHYA 1UPAA 3DWGA 1VJCA 2BFNA 2W2MA 3O8LA 3AUJB 4NS1A 1AMUA 5REQA 2YL2A 3HBNA 3MBIA 3KXIA 5CHEA 1IQPA 1E1RA 1W1WA 1X80B 2QTBA 4EG3A 2YFHA 3CE9A 2VHZA 4D96A 5BVHB 3FVVA 3DEZA 1N92A 3OJFA 3PQ7A 7GPBA 4YRNA 1OAOA 1UINA 4HQRA 1LY1A 3O5AA 3ZQJA 4F8YA 4Q1FA 2FZVA 4MROA 5HZHA 2IYUA 2PCJA 2VDMB 4PFJA 5C0OE 4CIWA 4PPYA 2GNAA 2IZ7A 4MS4B 2QM7A 3PF9A 5FULA 1QNLA 1GR0A 1RKVA 1AMNA 1YQ9A 2POCA 4ZYWA 3RG8A 4DCMA 2PKYX 4LOJA 3JAKB 2Z9DA 1Z22A 2C2WA 3NLLA 5KKNB 4KTTE 4AURA 1QE0A 3JATB 1H0HA 4YASA 3ANYB 3RK4A 3W5UA 1HQCA 4QYSA 2QMQA 2B1QA 2E9SA 4FW9A 4QLAA 5EP4A 4F0JA 4YTEA 3QVTA 2BISA 1Z13A 3AF5A 1OAKA 2G6TA 2NWQA 3QIVA 1LBIA 2ECKA 2W71A 4TV8F 4JI4B 4ND6A 4TYNA 4MIYA 4RZXA 3GY0A 3NAMA 1JSCA 1U1DA 4PAGA 1XDWA 3C8HA 4RMIA 2KE5A 4YAFA 4P4SB 3WQQA 4F7DA 1CF2O 2OMKA 1LDNA 3CBQA 2B1JA 1D5WA 3L1HA 4UCXA 1Y6FA 2QBYB 1SMKA 3ZWPA 4G4SO 1MO4A 5EL0A 5A1JA 5UKDA 4GGOA 1KI6A 2DR3A 3QU2A 4LHWA 4DF3A 1SD5A 2IYTA 2P6RA 4JR1A 1U1EA 2O6LA 1I7QB 4IQFA 1C9EA 1RAAA 2B94A 4HUTA 5JHHB 1AGRA 1NP7A 1E6WA 3MRVA 1L5LA 3UYLA 1YCDA 1JLRA 2HRCA 4BEJA 3H75A 4X0EA 1YS1X 3BWEA 1OLSB 1B2RA 2EGUA 3WGGA 2GM4A 1PDWA 1PJ4A 1X38A 3EQ6A 2H2GA 1XT6A 2JDID 1QFMA 4I9FA 1KORA 3SKXA 3RBVA 1AV6A 1VSUA 5DBHX 1VLQA 2H2IA 4ARBA 5K3OA 2A14A 4E2YA 2DWPA 4OHVA 4A16A 1V8DA 3ET4A 3KKNA 4RPLA 4ZPXA 4X62B 4K8OA 2OLKA 4FMCB 3AVYA 3DE4X 2O07A 4C7OB 2AEMA 2X6TA 3JALA 3KVRA 1Z2EA 3RBZA 1XRSB 4G5FA 1CPYA 3GNLA 5DLYA 2PAFA 4YR9A 1KZ4A 1P75A 5BV1A 3KOUA 4Q37A 2Y9MB 3SC2A 3SYNA 2VJPA 3GEPA 1T0JB 4ZVKA 1HE3A 3V4VB 7ABPA 3W5CA 4WACA 3N2KA 4RYLA 1M2HA 1GUZA 2JBAB 2RHLA 3SLGA 2CUZA 4JB3A 1TYCA 2XE8A 4L4ZA 1VLVA 4QGHA 1NOJA 3OF3A 4MAAA 4PFQA 5DVZA 4ABYA 4IH9A 3EOAI 4YAGA 1KEKA 1RKQA 1UXHA 4NECA 4KWEA 5D51S 4B34A 3MMNA 1QVRA 3RG2A 3OU7A 2OVFA 1Y4DE 1ZUWA 1B8UA 4ABTA 4P0QB 4R3NA 4ROTA 2UYQA 4TTJA 2R65A 1E2GA 4XYGA 3Q3IA 4BLOA 3R4VA 4EWLA 1ZDMA 3QUAA 1JR3E 3F9CA 4JJ6A 1N2OA 1TNDA 2PSJA 3LO5A 5ERGB 2EZ4A 5FUWA 5J1TB 3OQIB 4F06A 1TK3A 2ZTUA 2GK6A 5H7XA 1XDUA 3A14A 2QZJA 4FYXA 2CVZA 2W6IA 3EASA 1XOIA 3FR7A 3HCDA 4WADA 3C8ZA 4U7DA 3ZJVA 2PX5A 5LU9A 1DL5A 1V71A 3PYXA 4MCHA 3T9EA 4R71A 2QSJA 2FPIB 4F86A 5CCXA 4BV8A 2X4LA 3DMTA 3VR1A 3N59A 4IXNA 1ZH6A 1U7XA 1BRTA 5TQ2B 3H97A 4MVJG 1ESMA 2QUBA 4J90A 2DY0A 2VZ0A 1L5NA 4RANA 1OLXB 3V1NA 3P4UA 1Y4UA 3NEYA 1YZFA 5CGZA 2HWXA 4Z5XA 5CBPA 5JH7A 1KH1A 5L45A 1FFGA 3F47A 3FZYA 4YI5A 3V2UA 4XD7D 1XN1A 4Q15A 1T15A 5D85A 2RBKA 3HR7A 2YJNA 3UTCA 3HO8A 5BSFA 2XB4A 4FHCA 2QTNA 6NULA 4HGZA 3C7KA 4IDDA 4ZGBA 1L7XA 4G5QA 1W4LA 4K6GA 3MQ2A 1C8LA 3M8KA 4OMDA 1U3VA 4UNSA 4V0KA 3THYB 1JKJA 1ZRNA 4LQ4A 1CHNA 3K73O 1P7CA 2EQBA 3NTLA 4FGLA 4WZAE 2W48A 1DIBA 4OG2A 2I80A 2XQKA 3KQTA 4TTIA 3VKVA 2GASA 4J1TA 5GJWC 3LUGA 3PNBA 4LHYA 3U3JA 3QBEA 5EPEA 3DZCA 3ANSA 1Z25A 4EFKA 5KQRA 1XLTA 5HE8A 4HLUC 2ZB3A 4OH1A 1G7SA 4EPWA 2C0PA 4N8SA 2IUFA 3WX0A 4F5YA 1KBQA 3E22B 3LA8A 2VJNA 4IIUA 2N0SA 3U5ZB 3ZIAA 2J9XB 3B1WA 4I8XA 2C1ZA 3W9BA 1XKTA 1J4AA 1USWA 4KUGA 4PM4A 3R44A 4XGIA 1C1DA 1JALA 2XZTA 4AG6A 4EI9A 2WSSD 3UWDA 1LI7A 2Z8XA 3N58A 3HXMA 3FF4A 2X77A 5F9MA 1B0UA 4QOSA 4R0VA 4C6TA 4E08A 3G0CA 2RSLA 2HRDA 3I92A 2CLSA 3X1JA 3P9XA 1DIGA 4TT3D 9MHTA 2D3TA 4RA6B 1TOAA 3RAJA 3G1TA 3MFYA 4ZRNA 4GLOA 2IS6A 2GPSA 4Y0VA 3S2ZA 1LI4A 1HFEL 3F74A 3KAQA 3ZU5A 5L6MB 2FDCA 2EKZA 5FL7D 1GZ4A 4CEHA 3K9HA 4X94A 5D00A 3W34A 1JI3A 1LDGA 3BHNA 1GZ3A 4R1OA 4E3ZA 1PSWA 3KUDA 1PK9A 1SKQA 2CJWB 2P0AA 2JH9A 1HE8B 4P84A 1ZD4A 1FMCA 2N1BA 2ZAMA 1R3UA 2ATVA 2WZQA 2QRPA 2Y1KA 3PFIA 1JQKA 3RKRA 1D9ZA 3P1JA 4X20A 4BB9A 3Q8WA 4MMZB 3KQYA 1W75A 3DZJA 5F2KA 1NRJB 1GU7A 3JD0A 3O90A 1X8LA 4KFUA 4DT1A 4A0SA 2FW0A 4YYEA 5J58A 3FNHA 2DULA 5JJ5A 4QDOA 2Q6KA 2I4IA 2PXAA 4UTXA 4HAXA 3V1LA 5DWVA 1QC5B 3DO5A 3RD5A 3M4ZA 2GAAA 3UOGA 1BU5A 5BQ5A 4DCUA 4C0XA 2WVHA 2OMEA 4LRXA 3ZCRA 1ZOLA 4YRAA 4LECA 5AR1A 1Y42X 4RVNA 5AKLA 2NP6A 1WP4A 2K2QB 5GGXA 1AX9A 2NZYA 5LL6P 1SU8A 2EKQA 5ED0A 1RAHA 3JQFA 3L1UA 3TSCA 3X1MA 1N6OA 1W94A 1NTOA 2HCBA 3EGOA 4R81A 5T57A 2YV3A 3KOWA 4ZT2A 5KYUA 1BXZA 5DH9A 2XZPA 4D7AA 3H5WA 3KUKA 1DAOA 1L7RA 1MJGM 2FMIA 4MQLA 1U4OA 4OU5A 2X0DA 2OQVA 2ONJA 1QH8B 3M89A 1X7YA 2DCUA 3V8BA 2R1UA 1NR1A 1O96A 4OK5A 4UTVA 3C41J 1J6UA 4YJDA 1ESNA 2HF9A 4QATA 4RC9A 5FT9A 5FYDA 2YWRA 4IV5A 1HLDA 5FUVA 4QT0A 5LZ8A 1X77A 4AZSA 3VVBA 1G41A 1QO7A 1W6RA 1ZMOA 4I1RA 4L5YA 2GOYA 1SIUA 3DHYA 1I33A 4HSGA 5FBLB 5TMDA 4AXBA 1I8TA 1IN5A 1D1PA 3D4NA 3H9EO 3ENWA 2OPHA 2PE5A 4ZCRA 3V1KA 5LIRA 1NV8A 3Q7PA 4YJGB 4ZAVA 5B53A 5HFNA 2VT7A 1TM7E 5C3MA 3PEUA 3R0VA 3W8FA 4G0YA 2ZATA 3TXXA 1DOAA 1JEYA 1Z7GA 4QECA 4IGKA 2HDOA 3IUNA 4A7PA 4CEJB 4CKZA 4F9FA 5LYJB 3H5OA 3LS2A 2JFQA 5EN4A 1TQ8A 4YRMA 1JTFA 1P5FA 4LJ4A 3HYTA 5DHSA 1P9WA 4IOKA 5BSVA 1W7AA 2QW1A 3UICA 1HFKA 1WWKA 2FR1A 1DQYA 1NQVA 3SJAA 4S1OA 3TSWA 3KSMA 2W22A 1ZCZA 2Z1DA 2COKA 1YNOA 3Q15C 4KIFA 1JYEA 1R9JA 5TX7A 4B73A 4G0MA 4DR2B 1WETA 4EW1A 2PH7A 3ZHVA 2CJYA 3MLAA 2Q49A 5C7IO 1T8RA 4HATA 3H87A 2BMDA 4E22A 1PT8A 1U28C 2YVUA 1GZDA 1UDWA 4Q01A 1FNDA 3UFXB 4JT4A 4EG5A 4YMHA 2GA9A 1G8YA 3FWHA 2B4TO 1B73A 4U5QA 4XEUA 4RE6A 3ZWNA 6ABPA 3IR5A 1JWAB 4HWRA 3WFJA 4G4GA 4GXQA 4EX7A 3FLAA 2ZTMA 5LMUB 1NUAA 3UJBA 2FKAA 2VO1A 3HL0A 3ONWA 2OO5C 3UXYA 4RULA 1QRTA 1M2NA 4UVDA 4O63O 4WLNA 4F9TA 1GGKA 4B4OA 4KPUA 4P5PA 4WAUA 1TC1A 4QDTA 3GDHA 5BSTA 2L69A 1AKTA 2GZRA 1YFZA 1ZK3A 4CQMA 1XTIA 5KYXA 5FR2A 3DDSA 4XKJA 3VOAA 3TG2A 4YRDA 4WCFA 1GCUA 2W8BA 4JP3A 4RS3A 4TUYB 3ECSA 2V0GA 2EFHB 2IEZA 3AUXA 3PS9A 1P60A 2YHIB 5AVKA 4NARA 2I91A 1JRLA 2EATA 2IDMA 3IBTA 3IVAA 1L4NA 2A1UA 4NKRA 5K4HA 3AKCA 3RNOA 1JXMA 4P9NA 4W4TA 1BMDA 1ZD5A 3QLUA 5KTRA 2EU8A 4LMRA 1KZ6A 5IN4A 1OA1A 3A9CA 2X9NA 4OHMA 1KI2A 1NJ5A 2C7GA 2GPAA 3AF4A 2PKWA 3Q1LA 4FSHA 2OCPA 1RYMA 2WHRA 3LQ1A 5KWEA 1T13A 2QL5A 3BMOA 3CUEF 1PL0A 4R8MA 3ZE9A 3I6BA 1DLIA 4KFRA 3ZHUA 4N41A 1UBFA 2PHZA 1RBYA 2FSVA 3OF2A 4C0QC 1T36B 2EZTA 1XAIA 3VDMA 1RYDA 3Q0TA 1YGPA 4LWQA 5EG5A 1I1QB 3HACA 4ZDJA 2R6HA 2OP0A 4FJ1A 1Z0DA 2OCXA 3H8WA 1U3WA 1XTUA 3K6JA 3KVVA 4QU8A 4RFSB 4RJKA 4WKBA 4AZ0B 1F4VA 4KIUA 4NAVA 1V5EA 3ND9A 4CMIB 5T41A 4YRPA 2BGLA 1E2IA 2WWTA 4NU8X 4NYJR 5BN5B 2JBHA 4F2HA 4TLBA 2Q8PA 2C2HA 7MHTA 1GQSA 1W1UA 2RHMA 1XTVA 2AFRA 4V1CB 4HZUB 2GAFA 2K6GA 2NUTB 1KHHA 2AXQA 3SQWA 2NSDA 5K8TA 2QHXA 4JYBA 2CNWA 4LYJA 4E2FA 2GBLC 3UKDA 3HYCA 4R1MA 1RI1A 2G5PA 2FWNA 2ZSFA 3K2QA 1F2DA 1NVVQ 4HOYA 3L7IA 4CR6A 1TPYA 1FZQA 1UPTA 1II8B 4QU5A 4M87A 1EA7A 2V6BA 2PKXA 4ZVTA 4KL8S 1QFYA 3I32A 1U0NA 2EARA 5HA5A 4BU1A 4DSAA 4IR7A 3ETGA 1LXCA 3LZ6A 4AP5A 5KSPA 1OZFA 2OYSA 1Q0PA 1CUBA 1RQNA 1J0AA 3I2IA 1IUOA 4KEAA 5HRCA 2J9FA 2ZJOA 5A0TA 4MCJA 3UUWA 4MR7A 2PM8A 5JZMA 4Z49A 4JXKA 2WLSA 2VAVA 3DVLA 4TMTA 1RADA 2V7GA 3KFLA 4V3BA 2HU5A 4Z8XA 4XWOA 3SYLA 2G08A 2WA2A 3FAKA 4GSLA 4ZC1A 4BFCA 1COZA 1LX7A 3BRCA 3L0DA 1T3HA 1KJJA 1DIHA 3FLMA 2Q5HA 1CQIB 2JFWA 1XZJA 2RAFA 4D42A 4KPYA 3FBTA 1PFQA 4J8PA 3BF8A 3SDBA 1II0A 3LVFO 3LZDA 5IMSA 1Z5VA 2R7MA 3ROQA 1D04A 1XA3A 3S99A 1P2VA 1WABA 2YNMD 3ELUA 4I5IA 4TQAA 4TV8B 3LH5A 4XWYA 5CYPA 2D62A 3JXEA 1V16B 5JC1A 3ORHA 1DLJA 5LZ9A 1UFRA 4CIYA 1R6TA 2NO0A 4LDRA 1VIAA 2QKYA 4G4IA 1X92A 3A3KA 1VSBA 3BE6A 1HQYE 1NLZA 3RC1A 5SZJA 4DHWA 2GHRA 1O95D 2RI6A 3KJHA 2C83A 2WIJA 3C6YA 4CL3A 2V45A 3QKSB 4NQRA 2X76A 2B8NA 2CXNA 2GWHA 3A36A 4Z1MD 1E9DA 3MJFA 1ZO8A 3PTZA 2OXIA 1CR4A 1JWBB 1VGVA 3GW8A 4RIFA 4JI7B 4LRTB 4GQAA 2D0IA 1O6ZA 4IIYA 1IM2A 3DNMA 3O74A 3CSSA 4GZ5A 2ZETA 5FOTA 4RS4A 2FEPA 4URZR 2P68A 3V8VA 2QMUA 1E2DA 4XASA 1IJBA 1M2OB 3RIHA 1J8VA 2BBWA 1SC4A 2DBZA 1KYVA 3A9UA 3I3SR 1KMHB 3KSRA 4DQXA 2QY9A 3BB1A 4P7KA 1KI6B 5JSUA 3OJWA 3AIMA 1VYHA 3IDQA 3PD7A 1U5AA 5F4ZA 2K4MA 2PT5A 3IJPA 5DGHA 1Y8RA 1N5RA 5DBIA 5JD6A 2A67A 5AW7A 1GKKA 4PV7A 3Q9LA 3GLIA 2IHYA 5BMVF 4L5JA 1ZVMA 4IKEA 5JSZB 1J2RA 5C31A 3V8MA 2BEJA 2HEGA 3IELA 3RJTA 1USUA 1KQGA 3FNRA 4F84A 2UZ4A 3A1UA 3WWYA 4RTRA 3BWBA 1EDDA 5T7BA 3PGMA 1XCOA 1VKNA 2Y67A 2A0XA 4NYMR 4DDKA 1Z4KA 4PSCA 4WNYA 2C5SA 1RXWA 1C1XA 4Q48A 1XO1A 3OWXA 4IHQA 5I9TA 4AKSA 4NCXA 3ONFA 3D1LA 1Z8DA 3QSGA 4TMYA 6YASA 7YASA 4I7EA 4UEJA 1STOA 1QLHA 1PV4A 3FPLA 3O1LA 4JLOA 3G2HA 1CJCA 3CZQA 1XCBA 4INAA 1RQXA 1U3UA 4RSHA 3TVDA 2VAWA 2Z9CA 3F9RA 4OXKA 5G2OA 3LPCA 3KPVA 3W5JA 2FG5A 2DB3A 4H0CA 2HU8A 5IKOA 1EWVA 4DIOA 2GZHA 4KXFB 2Q6LA 3E22A 1L3CA 1TYZA 1VMDA 5CJJA 3V8EA 3F96A 5MHTA 2C54A 1W2HA 3VC3A 5KNBH 1QFZA 3B6ZA 3BJEA 4JVSB 4QO8A 4OI4A 4FZRA 3SVLA 2P11A 4V0MA 1YACA 1Z0AA 2Y2UA 3BIOA 5AIBA 5KNDA 3TXAA 5I7FA 1VL2A 3PNPA 4OHOA 3ASVA 3ZK8A 4K9QA 1HDYA 2FCAA 3USES 1YJBA 5TEWA 2P2LA 2K5UA 2YWCA 4G25A 3F6RA 1KI8A 2B8TA 5EZ6B 1VCNA 2OQ2A 4V1CA 4P98A 4QBHA 2XI4A 1OLUB 3BH6A 5B3AA 3EVFA 4JV5B 3H2IA 2AOTB 1X39A 2UYCA 1OGYA 1YR2A 3A06A 1EZZA 1LJLA 1R4AA 2C97A 1IXSB 1R12A 2W6ZA 3NIDB 3ZD7A 1VZ3A 2WG2A 4D0LB 5JUWA 2C7BA 1ODFA 2JGNA 4NS4A 3IPLA 3UUEA 2B5VA 2IHTA 4JLKA 3W2EA 2NZWA 4H7KA 4M1WA 4U5XA 4IJVA 3O31A 2XY4A 1NVBA 1V6CA 4I55B 4EJ6A 3G5TA 2ZI5A 3H2BA 3VTFA 5IJXA 1WW3A 5CURA 4CMBA 3D4IA 4JLVA 3WK9A 3CWZA 5TDHA 3RVSA 3HZZA 4DA7A 2H7VA 4TXMA 3FI0A 4L28A 1PX2A 3THYA 4BKOA 1GJRA 2Y2VA 4A2CA 2NO9A 3EQ9A 2BEUA 5AK3A 1RBQA 1EX7A 2V5VA 5GV7A 3M1AA 4UCQA 5B58T 4EUKA 2C2BA 5HOQA 2JH8A 1W4BA 2FZCA 4PANA 2PGNA 1RWMA 3EC1A 5K6AC 3AU9A 2MYUA 3I39X 5KQMA 4MP3A 1U0HC 1V41E 1FLVA 3DDNA 1ULUA 1QHGA 1X0VA 3E15A 5EE0A 2J1LA 4GVXA 1N5OX 4R1SA 1X7GA 2FJUA 3DZIA 3DO8A 5LQNA 2QQEA 3VH3A 1AG9A 1P1JA 3EA0A 4K05A 2V9ZA 3T1NA 2JJ8A 2XVMA 1HY3A 4RFSA 1JE1A 3G82C 2PKEA 1XZIA 1BMQA 2H1IA 3USCS 3V2IA 3NB0A 2WTBA 4MQFA 1JAXA 1JKFA 2IYEA 4H0FA 3A6KA 2VH5R 3AEKB 4I19A 5CNMA 4EFNA 4J16C 5IJ9B 5AHXA 4EUNA 2PNJA 1H5NA 2PR2A 4AQDA 2A9JA 3CEPB 4PRKA 2G9RA 3PUJA 2XMBA 3HCBA 3PGXA 3G68A 4HXFB 4LY9A 5BV0A 2ZE8A 1WB4A 1TM4E 4BNVA 2ZAOA 4DUYB 1Y3IA 2C5EA 2NZUG 2O50A 1Q83A 2APJA 2FMHA 3DMNA 4E09A 1KJNA 1WVIA 1DV2A 2RGUA 4X1OA 3VNVA 3AGQA 3OO1A 3SFZA 1K68A 3KZOA 1GILA 3DYVA 4D4HA 1IULA 2PGIA 3L0ZA 3QFFA 1KDRA 4NJOA 3OCJA 4CU5A 1SC3A 1KEEB 4NEHB 3OIVA 3OJEA 4L75A 1GZ7A 1NPDA 1Z6AA 4NC9A 3BJMA 5A4IS 1L5HA 3FCXA 2BMEA 2BMVA 1QP0A 1TZKA 2FETA 3ABSB 3BWCA 2PN1A 3OFNA 4GG1A 3TSZA 1J1ZA 3OTWA 5JPDA 1THTA 3HB9A 2ZKLA 2ZZMA 2ZIWB 3KZ1E 1WVMA 3OD1A 3RU3A 4MR8A 3CVYA 4XOUA 3O84A 2NTNA 4JNCA 2ATCA 2RBEA 3AF3A 1Y8QB 3G7SA 4LEIA 4EF4A 1XWIA 1RABA 4LCBA 4P4SA 1FP1D 2WUGA 1EWQA 4C0SA 4RMGA 2P4QA 2B61A 4FEEA 4B3XA 1NKVA 2H2AA 2XB6A 3FYHA 3UFXA 1PKEA 3EGIA 1SZPA 3AR4A 1P5HA 4PCVA 2QSZA 2MYTA 2ZI9A 2AW3A 1ZKDA 3C48A 5JXJA 5DCWA 2NUPB 2J8ZA 2VHVA 1UDCA 4HNUA 3RLIA 4YRCA 2IT1A 4KSBA 1T2UA 3ACBA 4G97A 2VK8A 4RSRA 3ZE8A 4BX0A 3GP8A 1FXWF 4L8LA 1GLGA 1GDTA 2GZ3A 3BAZA 1NE7A 2D2VA 3DAGA 5MDHA 4B3BA 2HJVA 2OV8A 3IR6A 1HE2A 4M37A 5FFFA 1MG0A 2Z04A 3IBCA 2PZKA 1N33B 2FSIA 4JL5A 4Y2QA 1UKZA 3QW2A 3K5WA 3F49S 2RGNC 3L41A 3L8YA 5F33A 1IK6A 1VPVA 2W98A 3B1FA 3RB8A 4H7IA 4AF7A 1G6OA 4ENVA 4L0DA 3IEPA 4JI1B 2CDCA 1NWHA 3IBSA 3HJUA 1NG9A 2DUMA 3PE6A 3GT0A 1E2LA 3PXEA 4OJTA 1O4WA 3UCXA 4E6PA 4XCQA 4ND8A 3IDOA 1AN0A 3RRXA 3L46A 5LC1A 4OB7A 2I4OA 4KACA 5U4QA 3QM1A 4NLLA 6AT1A 1NTRA 1TLFA 4RK1A 4O0LA 3BWDD 1EE2A 4Y6RA 3SXJA 3U3OA 2VJDA 4WKOA 4LNUA 2Q3MA 1WY7A 2JIMA 1R0SA 1ZA2A 3SM9A 4KWHA 3EUEA 3OT5A 4WT7A 2ZE6A 3ZBQA 1ZUNB 1VIYA 2WIDA 4EFDA 5I4CA 2O4UX 4M0EA 5DYYA 3R3HA 5CG2A 1HRKA 1PG0A 4E4RA 3ZGVA 3R1IA 4IUYA 1JEJA 2ZRKA 5FR1A 3U3MA 3V97A 4W5JA 1Y89A 1EHIA 2YJ5A 3EUWA 2QENA 4UXJA 1M1YA 3QE3A 5FPKA 3GGDA 1QXSA 3VZCA 4M8IA 3ZLJA 4RACA 3FOAA 2PFGA 5CW2A 2M2IA 1PD0A 4AP9A 5JSQA 4FLEA 4ALMA 4X8HA 2BFPA 4PX3A 4O4IF 5EYPA 1XCJA 1RQ7A 3L7OA 2ZIFA 1ELOA 1SQSA 3QBDA 1E9SA 4M88A 3CUKA 4M0MA 3HA3A 1KZ7B 3QPDA 3NI2A 3CNBA 3CURA 3RIGA 5KOJA 4JHXA 3L07A 3GARA 2TMKA 3UT5B 3E1GA 4FFRA 5I9SA 2H59A 1Y4SA 2YZ7A 1II8A 2BCGY 4QUJA 3RF7A 4GW3A 1R6AA 2AMYA 5JD3A 1WUKS 2EYUA 1AY0A 3JQDA 1CQXA 2RH8A 1B2LA 3BA1A 2GZ1A 2HJGA 2BGGA 1GTJ1 4ER3A 3A1VA 2NPFA 3LQYA 4JKOA 1LU9A 3LSTA 3EQZA 3FTFA 5KS2A 2X42A 4ZT4A 1IUKA 1SHKA 3GBPA 1F0YA 2I9PA 3FCCA 3ULKA 4RXTA 5EYPB 4EMSA 5A2GA 1YR8A 3KQNA 4PTYA 1P4AA 1T9ZA 1GZHB 2C9BA 2V74B 3VOSA 4MZXA 1J1UA 4ZQIA 4QODA 1F1JA 3KAPA 5FFNA 1E1NA 5HBRA 1WQ3A 1ULHA 4RMHA 5DZSA 5AOCA 1NVDA 2VHWA 3E9DA 1GXSB 2JGRA 4CMHA 4MDEA 4CQLA 3UK1A 2QG9A 3L18A 4FT4A 1ND6A 2I2AA 2H8KA 2R6CA 3EG9A 4R9NA 1UPFA 1BIFA 1Z9BA 2WJ6A 4FYIA 3LWDA 3BB4A 3CZCA 3BPSA 4WY2A 5A9RA 1KE1A 2W37A 3MJDA 4IAOA 2B30A 4HNAA 4YCCA 4IIJB 2GM9A 1G60A 1TVCA 1Q57A 1FYWA 1SVUA 1QK4A 4JI0B 1D7AA 2CK3A 1ENYA 4KV9A 5AJXA 4ZYLA 4I3HA 3F73A 4E14A 1G55A 2BEKA 2WJGA 3AOEA 4XGRA 3QPBA 2YVKA 1IN7A 2G07A 1A2QA 4MQBA 5F7ZA 5A4MS 3SEQA 2AE2A 5I01A 5F52A 4NF2A 2HIMA 3ISVA 3HE3A 3ZVLA 1E5QA 1G4UR 3EBOA 1OWNA 4ETIA 4KMOA 3SF8B 5A4FS 4EG4A 1Y9JA 1FPMA 3V4RA 2YWJA 1Y8CA 1BXKA 4IIGA 1ML4A 3I9JA 2JK1A 5DLQC 1VB3A 4OXYA 4AY3A 1C3XA 1W96A 3UV6A 3N2GB 3WMXA 5JTTA 7MDHA 2EF0A 2JGLA 4ZEOA 4HFRA 2UDPA 2YDXA 3C43A 1QAOA 4BZWA 4H4CA 3TIXB 3T52A 4P5EA 2C82A 3OTGA 4HWPA 4QOJA 1ZIPA 3CF4G 3WYCA 4KLNA 1KEWA 4KIGA 2B37A 1CY4A 2GXUA 5ALWA 2E82A 3SYRA 4K3VA 3RVBA 2VOJA 1YDHA 4D43A 4KB5A 4UM9D 1CSEE 4DW8A 1R5NA 2FMKA 3DBVO 1FVOA 3GUHA 5JS7A 1JR6A 4WFIA 4UHHA 2EGGA 1L8OA 1SC6A 4O8ZA 4O4JF 3L7LA 1DJPA 4R1UA 4ZVVA 5IJ0B 5JZBA 2E85A 3L9XA 4Z4QA 5I4IA 1U0BB 2YY7A 5L3SA 3STYA 4LXQA 2WV7A 4HWKA 4Y6OA 4KG7A 4H3KB 2JLBA 3MMPA 5HFJA 1JJAA 1JMYA 2VKQA 3FDZA 1BCSB