4EKDA

Structure of human regulator of g protein signaling 2 (rgs2) in complex with murine galpha-q(r183c)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
318
structure length
318
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFDVPDYAAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVCVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Structural and functional analysis of the regulator of G protein signaling 2-g alpha q complex.
pubmed doi rcsb
source organism Mus musculus
total genus 109
structure length 318
sequence length 318
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4ekdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ekdA01
3FWYA 4YC7A 4BLQA 2W6JD 1AGRA 2KI5A 4XD7D 1TQDA 2NIPA 1S96A 1V5WA 4RFSA 4NCNA 1AJEA 2F3TA 3L8ZA 2KE5A 1ZJ6A 2ZRIA 2H5EA 4WVFA 1I4TD 2QQ0A 2WWWA 3W6NA 4Q4JB 5DI3A 3CF2A 2ZJYA 2IS4A 3FKQA 2QG6A 3VHXA 1ZCBA 2L0XA 4D6PA 4LBYA 3U3RA 1CP2A 3IPYA 3DKVA 2PCJA 1ZUHA 3QPVA 1LV7A 3UG7A 4OK3A 2GDJA 2BC9A 2VA8A 3SEAA 1KDPA 1KO5A 1Z0AA 3AVQA 1VKJA 4HDOB 5HE9A 2J9RA 4S35A 3SHFA 3WYAA 1HTWA 4ZCMA 1O87A 4WW0A 5L3QA 4F38A 4KITB 3H2YA 2GILA 4M21A 4QGFA 4KODA 2QY9A 4TT3A 1QF9A 4D0LB 4BGDA 1U81A 4Z8XA 2CLSA 5HZKA 1H8ED 4QHYA 2C96A 2J0QA 3KQUA 3SYKA 1X3SA 4MH0R 2JJ1A 5G3YA 3ZGXA 3KKQA 4B34A 1GNQA 3SS8A 4E07A 1FUKA 4MGIR 3PEYA 4BFUA 3HR7A 1XNJA 2G1KA 5FTMA 1YQTA 3CM0A 1DG1G 1VG8A 3TUJC 4IVRA 5E95A 5CM9C 4AG5A 2WOJA 1DBSA 3ZYCA 1CLUA 1TNDA 1GKUB 1SVMA 3V4RA 1PVOA 4LJ5A 121PA 2D3WA 1LW7A 3KKOA 4L4UA 3QBTA 3BFKA 3NBXX 3P32A 2FF7A 3A36A 3VFDA 2X8AA 3X2SA 2OG2A 1T5LA 3OEED 3LV8A 1IM2A 2WVJA 3NG1A 5JHGB 2J3EA 4GMXA 1NMYA 3HP1A 4OHWA 3RS0A 3ADKA 3C16C 1P61B 1VIYA 2ZJ2A 3PJRA 3LBIA 2XXAA 4GZLA 3ND8A 1CXZA 5CIWA 4E22A 1FMLA 1GAJA 2ZVPX 4DSUA 2TMKA 1X8KA 2BMJA 5FL7A 4FWTA 2OAQ1 3NBZC 1RRCA 4C0HA 2WKQA 1CIPA 3HR8A 4GOJA 1J8YF 1KI4A 3CZPA 3K70C 4FXPA 2XOKA 3I3SR 4A2QA 1QG4A 2WAXA 4L5BA 1EXMA 3GD7A 2GZDA 2BM1A 3IEUA 1IY1A 1E2PA 4IFBA 4DZZA 1KZ7B 4DDTA 2CEAA 4JLPA 3I61A 1R10A 5FUYA 1V43A 4C0JA 1BS1A 2C77A 2W2XA 5FPSA 3RSLA 4DLTA 3OIVA 3ZD6A 3TMKA 2VHTA 4P3YA 2ZRJA 3DPUA 1U0JA 2UZIR 4HB4A 4UNPA 1FNMA 4AKGA 5JSZB 1AZTA 3TKLA 2CL0X 221PA 2FE4A 1E2GA 2F9LA 2W58A 5C4MA 2QAGB 3HYTA 3MWLA 1Z6XA 4AYTA 2PMKA 2G88A 4B33A 1D9XA 2QEQA 2H8KA 3TRFA 3Q5DA 5B30A 2R9VA 5K8TA 4B2IA 5F3WB 3PQCA 1U90A 2GK7A 4AYXA 2VQSA 1K5GA 4NHOA 3F0TA 4P0TA 2OFOA 1ZYUA 1U8AA 2J1LA 4TMTA 4JZKA 4C3ZA 3W5JA 3W8RA 1A4RA 5LPNA 2DFLA 1ZUNB 3GLIE 4MGYR 3JVUA 1Z0FA 4ZDIA 3T5GA 3QI2A 1F2UB 4DLVA 2GVDC 1JR3D 2HXSA 2YHSA 3T15A 3GLGE 2E87A 2BKUA 2P0EA 3WYFA 5FI0B 2IEZA 1KJWA 1YE8A 3VR1A 1OIXA 4B35A 3WNCA 2A5FA 2RGGA 2RHMA 3QNUA 5GVSA 1NVWQ 1Z5ZA 2H1LA 2VPPA 3U6BA 1M7BA 4DUGA 4C7OB 1RRGA 4GRAA 4Q1EA 1Q0UA 1RC8A 4V0ME 5K8UA 1BMFA 1NN0A 1KK2A 2YWGA 2WPDA 3CBQA 3QVVA 4NONA 4QJ3A 4DCUA 4URVR 1QDEA 2LWIA 4RD3A 5FUVA 5DH9A 1ODFA 5H1YA 5JSZA 2EFGA 1T6NA 2W6ID 1IN8A 1R0ZA 4B2PA 4TYQA 1Q21A 4XWOA 2IS2A 2QAGA 1KDTA 2EFHB 1J99A 4U00A 5FPKA 1HE1C 2CXXA 3WNBA 3U3KA 2CHGA 3U7HB 2AKAB 2VHCA 1WDTA 2NQ2C 1O3YA 1NKTA 1HE8B 3GJ0A 5UKDA 4CEHB 5P21A 4YXWA 3G82C 4IXMA 4PC6A 2A30A 5FR2A 1KI1A 3KX2A 3OIYA 2IYWA 3K9NA 2IYVA 5IF9A 3B1YA 2ZJZA 4P33A 2HEIA 4CDGA 1JQLB 1F2UA 4Z1MD 1JAIA 3VKHA 4E5UA 4NKRA 4UXIA 3A1WA 2RCNA 2GEVA 1FNNA 1CRQA 2JATA 4JT2A 1QBKC 1NVUQ 2ZJ5A 3ZS8A 4FMCF 4P31A 3IKJA 5AJWA 2ZE7A 3DZDA 4EPTA 2DYKA 4C7OA 2FJUA 4I1VA 5H68A 1G3MA 4A8JB 2IUTA 1T3HA 2AKYA 2GJAA 4YMTA 4Q48A 3IDQA 3ZZ0A 2ZS7A 1NL3A 1XWIA 3PEWA 3GEIA 4LY6A 1P62B 2KJQA 1UBFA 3G5UA 5F9HA 1G4UR 1TU3A 1ZU5A 1ZP6A 4IOJA 4NBSA 4WZAE 3BH7A 1N2CE 5JZVA 3O8DA 3TBKA 2UVQA 2P6NA 1M34E 1PJRA 4LBWA 3EPHA 1E79D 4A0GA 2EQBA 2A9KA 3KJGA 1W36B 1JI0A 2J59A 5JS7A 1U98A 1RE0A 1JPNA 4WOPA 2ZRFA 4B2LA 3KQNA 2D62A 3UATA 3TH5A 3ZJYA 5JJLA 2QE7D 2W6JA 3ZIAD 4CEHA 2XZOA 4JVMA 3PVSA 2A7QA 2Z4RA 3KQLA 1II8A 4TL8A 1WBDA 2FU5C 2P5SA 3PENA 1AZSC 4DWJA 3IILA 3AV0B 4JJZA 3I5YA 1SXJE 3CPEA 3FTQA 3UMSA 1XFAA 2O8CB 4LHZA 3ONWA 2ZI6A 3B78A 5DIFA 3B60A 4OI1A 1QHHB 2FV8A 1KHTA 2IWRA 3AUXA 2W2TA 1OXVA 3WY9A 2VLIA 2I4IA 2MSEB 1GL9B 1JQJC 1US8A 1X8LA 1TU4A 1KO7A 2QPAA 3RRZA 4BLSA 4A8JA 3OIWA 3RLFA 4FCWA 3EZ6A 5D3MB 4KI0A 5KPDA 4L9WA 1OIVA 4ON9A 3U2QA 2XSZD 3NH9A 1Z6GA 3KUCA 3MRSA 4HSEA 1TQ4A 2PEYA 2RMKA 2PT5A 2GHIA 2X1VA 4F4JA 1ZINA 3KB2A 4BPBA 4B73A 1E9FA 3K0CC 1CR1A 4PAQA 1H8EA 4JLBA 4HZUB 3IIKA 4LYAA 2DWPA 4Q19A 5CB8A 1VHTA 1TUEA 3RSOA 4DIDA 1EFCA 3CPJB 3NIBA 3TR5A 1PZNA 2GXQA 1XRJA 4KBGA 3DMNA 1TF2A 2AX4A 4L9SA 2F1IA 5DI9A 4PZZA 4TL9A 3CZQA 4LV5B 3I4LA 1HH4A 2ZAMA 3RS7A 1TPZA 3U61B 2X2FA 4AKEA 1U8YA 1KI9A 1R5NA 2CCKA 4D4MA 2NMVA 2PH1A 1G3QA 1OLOA 1DAFA 3CX8A 3K0FB 3PUYA 2B21A 4G01B 3RWMB 3OEEA 1GM5A 3T12A 2VP0A 1W5SA 4LHYA 4MRSA 4HLCA 3AGQA 2ZXUA 5HZHA 2QMOA 1ZM2A 3LD9A 1DAMA 1R5OA 3K0CA 2FFBA 4UJ3A 3RVBA 5AUQA 2QZ4A 1DOAA 2AWNA 3N2EA 4QFMA 3MUFA 2FGKA 1N6LA 1KIMA 1P2TA 2QTFA 5D3MA 3FHTA 1NMZA 2O8BB 3LX5A 2BJVA 2WWXA 4IEEA 2G1JA 1E9AA 4LV8B 2Q21A 4QBIA 2DBYA 3IGFA 3OEHD 4TQUS 1NLZA 5KYKA 5BXQC 5EE3A 3WMFA 5KSZA 4N1AA 3RS4A 4PANA 2RGNA 2WJHA 4JVSB 4C0QC 2GBLA 3EPKA 3ZVLA 2IYLD 2AWOA 4Q00A 1KI6A 4HZUA 4JBYA 4DCTA 3M6AA 1TQ6A 4R71A 1KY2A 2ZSBA 2PZGA 1DADA 2WMNB 3JZMA 2JEOA 4A2WA 4EJSB 4XOIA 1MT0A 3AUYA 4Q7MB 2WSSD 1F3OA 1ELOA 1XX6A 5DISB 1E9CA 2YOGA 2JGNA 5KHOC 2VP2A 4H9GA 3BFXA 4R9UC 1D8TA 3AKCA 2WWIA 1ZAKA 2B7BA 3K0FA 4FMDF 4B3XA 1S9DA 2W2VA 4IFEA 4C0BA 1TAGA 2KBEA 1FP6A 2EU8A 3VTKA 1ZIPA 2BBOA 1G7TA 4TT3D 1W4RA 2C98A 1UKZA 4EPRA 2F1JA 3CH4B 2WIAA 1RYFA 5KOYA 1JR3A 2HT6A 4IW3B 3GLHA 1C9KA 4M2LA 2W83A 4ACBA 2WMOB 2OCYC 2WJJA 4Q18A 4XVQA 3NVAA 4MYCA 3EX7C 3TLXA 2OXCA 3PFIA 3WRYC 2XAUA 5KNDA 2O8BA 2FA9A 2IW3A 4LJ8A 5DHAA 3ZZUA 4D4JA 4MGKR 3EPLA 3V00A 5DYIA 2V54A 1GKIA 4FW9A 2ZIAA 4URXR 4V0KA 4RKFA 3D7MA 4EUNA 4Q9JA 3AVOA 3D3QA 3K9GA 2JLWA 1CEEA 4X8OA 4TZ6A 2NTYC 2QAJA 3F5FA 3BOSA 1OB2A 1OJLA 1OT3A 2XB2A 2BDTA 2W6IA 1IN4A 4JL6A 1T5IA 1KMQA 4P4SB 4EJSA 4UXJA 2HCBA 2PCLA 1PLJA 2NGRA 1YZKA 4HATA 3RRYA 2PJZA 4MDFA 2YYZA 2IF0A 1XF9A 4ZDJA 3RAPR 1E4VA 3CKLA 2GJKA 3UWOA 3A37A 4TN1A 1UBCA 1VECA 1K5DA 1S3SA 3LH5A 5JEEA 2CK3D 1WCV1 4PO9A 4PC1A 3R7WB 3J81k 1S3GA 5AUOB 1BOFA 4RVCA 5B58C 4AURA 1UF9A 2GZAA 3K09A 4D26A 2GNOA 2ZRKA 1Z6YA 2CVFA 3M4YA 1SGWA 3AQ4A 3IHWA 3VR4A 1YRAA 1P6XA 4Z1MA 2WM9B 3CRRA 3VNUA 4IKEA 3O47A 5JWRA 4IDOA 1NN3A 2O0KA 2O5VA 4PSVA 1UJ2A 2XZPA 3U6KA 1I4LD 4DSOA 3I5XA 1BIFA 4GSYA 4JLOA 3SBDA 4B3DA 3Q72A 2QPOA 4Q4LA 1W2GA 4LYFA 4XTRA 1XZPA 3UMFA 4HUQA 3PUVA 1E2LA 5CM8B 4MGZR 2YWFA 4M1WA 4G3XA 4NCKA 3B5JA 2YWEA 2KSQA 3VKWA 2BIFA 2CE2X 5FBVB 3ZD7A 2Z6VA 3IUYA 1XDBA 4WAUA 1XTRA 4MKIA 5HE8A 1LNZA 3M1IA 3GFPA 3R9IA 5H8WA 3PCRB 1NG9A 4P4SA 1A1VA 2CVHA 4C2TA 1E79A 4PQRA 4Q02A 2JLVA 2C9OA 1CS4C 4PFSA 4UNRA 4OHYA 1U9IA 3MAAC 2J5XA 4LC1A 4ZIRB 1HT2E 1YZNA 2QE7A 3RS3A 1JALA 5FPHA 2OAP1 1AA9A 4X8HA 5EXSA 1TQ2A 5EUQB 3R7WA 4BFWA 5HR5A 1IXSB 4HYYA 1W4CA 1ZW6A 3KJIA 3LLUA 2VSOA 3QJYA 1VMAA 3AP2A 3A4NA 3L0OA 1MO6A 4Z8YA 2CCGA 5CK5A 2H18A 4D4LA 3GLFB 1L4YA 4KFTA 1XTSA 2FX3A 1KSJA 2VP6A 4KAXA 4OBEA 1WBBA 1X8JA 4FMCB 2N42A 2BOVA 5IRCD 1ZNZA 2NO1A 3FDIA 3FOZA 2IA5A 3BB1A 5FBWB 2QQEA 2JDID 4PZLA 3QXJA 4R7ZA 1XJQA 1R6BX 4OI4A 4GT1A 3R20A 3LQRA 4AC9A 1QHYA 3FFAA 1M7HA 4B76A 5F9FA 2XSZA 2OBNA 1YHNA 1W4AA 2DR3A 4PHHA 2IYSA 1U0LA 3EARA 2QA5A 3AF1A 4Q1CA 2CBZA 2JASA 2G83A 2BEJA 2ORWA 3FGNA 4Q9IA 3UKDA 1M1YE 4A6XA 1XEXA 3L43A 1WP9A 4URWR 5HCIA 3FMOB 3GMTA 3C5HA 2GK6A 3DVLA 4LX0A 4JL5A 4O0MA 4ZIRA 1VTKA 1G5RA 1XB2A 3VMFA 4QXAA 4BFZA 2VYFA 2ZRDA 2RGEA 421PA 4OK6A 1R7RA 4LRWA 4YDSA 5DYGA 2ZRCA 5B2ZA 2J41A 1GG2A 1CULC 4LHXA 2JA1A 4W5JA 1E2NA 2WWFA 4ASUD 1SKYB 5J4VA 3AF0A 4CT4B 4W9MC 1T0JB 2GRJA 4E03A 1QZXA 3KFXA 1U99A 4DCSA 3LXXA 2ZJBA 4LBZA 4CEJA 4HDQB 4MRRA 3OE7A 2N46A 4URUR 3GJ6A 3LRPA 4BZQA 3GLFA 4YDHB 2EVWX 3SDZA 4G1UC 1GFIA 1P75A 2WV9A 2YC2C 1E0KA 2JLYA 3N2IA 3TQCA 1Q12A 2C03A 2GXSA 2J0VA 4KJZA 4RD0A 4KU4A 5GJCA 4AIIA 1RYHA 3SJAA 3LDAA 3PUWA 1DEKA 4LJAA 2C5LA 4TMKA 3P27A 4LK2A 1G16A 1Z47A 2HYDA 4GP6A 2I1QA 2XZLA 3QQ5A 1MH1A 1W5TA 2UKDA 3OEHA 1OH8A 2IYRA 2QI9C 3B13B 1MR3F 1MOZA 1Z0JA 4M9SA 3EIQA 1OH5A 3ADDA 4A15A 1A2BA 2QGZA 2V7QD 3UXMA 2Q3FA 1GOTA 3QUSA 1OPXA 3AM1A 2J7PD 2XB4A 2A5DA 4BASA 4C9BA 2GKSA 1MRNA 3BD9A 4OQLA 2QP3A 4TL7A 3TK1A 4GL2A 1MABA 1XTIA 1OXSC 2PLRA 3T34A 2OLKA 5JLJA 4LJ4A 3MCAA 1Z06A 4GFDA 1IONA 2BV3A 2WSSA 4XIGS 1AK2A 2ORIA 2ZE5A 2K5UA 3T06B 2B8TA 1KTVA 2GXUA 1D2MA 1AS2A 4NCHA 2VO1A 4JSYA 1T9HA 1E9BA 3BRWD 1R8QA 1KY3A 2VHJA 1E1RD 4TMWA 1FMJA 2V1XA 3U4QB 1ZM3A 2P65A 3D31A 1Q3TA 5A4JA 3N70A 3KKNA 1KDRA 1NSFA 1IY2A 2XEXA 4OQFA 4PSAA 2P2LA 1W36D 1CR4A 1KK3A 1MV5A 1VYUA 5CIQA 4ESVA 4LJ7A 5HPYB 4BLTA 3KXLA 5G40A 5FPYA 2CJWB 3N5CA 2G6BA 3ASZA 2EW1A 1NIJA 3T1QA 3TSOA 1IAQA 4DLUA 2Q9AA 4QKQA 3E5HA 2FSGA 1KO1A 2V3CC 1E0AA 2NOAA 5KU1A 1IHUA 1BO6A 1KAGA 3TE6A 3CNOA 3RDPA 1T0HB 2QM8A 4Q4JA 1EX6A 4XSGA 3REGA 1KGDA 1XMIA 2J45A 4TTPA 5D3QA 5J4YA 1W0JD 4B3BA 5JEDA 3EIHA 3QPWA 1E9DA 1XCGB 4B3CA 3IO3A 2YOFA 3B9QA 1XTQA 4MKGA 3SR0A 4WIAA 1G291 4M1SA 5SZKB 4ARZB 1G21E 4UNQA 1GVNB 4QOSA 3SNHA 3A4LA 4AKIA 1EFUA 2JJ2D 2FFHA 5FI1B 3NWJA 3CUEF 4C0KA 3NC0C 3SYNA 1D2EA 4MUAA 5FPTA 2XNSA 1D6JA 1ANKA 4UQOA 2R6AA 3KZ1E 2CK3A 3BAFA 3U7FB 4M8NE 5L3RA 2WWYA 2GJSA 3A4MA 3U4QA 3CB4A 1MO3A 3OHMA 2UZ3A 1E2HA 1BKDR 1VG9B 1WRBA 2ZANA 3EWSA 3FMFA 1U2RA 4PO8A 1B23P 1JEEA 3T1VA 4TSFA 1OE0A 3IEVA 2H92A 1KNXA 2YNMA 4K81B 5G53C 4XVUA 4MUBA 2B8WA 3W3ZB 3TIFA 5FBRB 4LI0A 4XTCS 5C4GB 1UEJA 1RVDA 2WWHA 1W2HA 2CJWA 2VHQA 1DO2A 4U7DA 2N1BA 4GNKA 1SZPA 2C8VA 2JLQA 1VIAA 4B3FX 4XSHA 4HEJA 5EQTA 2KB0A 2GEDA 1GDDA 2BMEA 4ZCLA 2DWQA 5TARA 5J47A 3VNVA 4NYJR 2GZHA 2ZI5A 3FHOA 5AUNB 3C8UA 4MYUA 5CK4A 4ACAA 2ZJAA 3WMGA 2BMDA 3U3JA 4D0NA 4ZI2A 1B0UA 2PJRA 3U5ZB 5KDLA 2QAGC 1Y3AA 1Z29A 1NBME 1YR7A 2HV8A 3I8XA 2XJ9A 3LLMA 1E2QA 2F1RA 2NZ8A 4U5XA 2OXRA 4HLDA 1WA5A 3HU2A 2ZETA 2GETA 1DS6A 5TY0A 2O0JA 4HLUA 1F2TB 2ZRAA 2YKGA 2E9SA 2Z0MA 3SQWA 4OI0A 1CRPA 4L8GA 1EFHA 3W9YA 1YJ5A 5TXGA 4HAZA 2Q3MA 2ZEJA 5BYKA 3VX3A 2IL1A 1S8FA 2HDNB 4AWXA 4RZXA 3UWKA 4JS0A 1XCPA 4DB2A 3BERA 4DVGA 2CHQA 2NPIA 1Q1EA 3LQQA 1CJUC 5J4HA 4XJXA 5BW8A 4LJ9A 1NP6A 1QVAA 4LHWA 3QEJA 4QNMA 5BN5A 2FZ4A 3CNNA 3MWKA 1OSNA 1ZD1A 1FX0B 1W1WA 3DZ8A 2JDIA 4PPNA 3NDBB 2J0SA 3ZQ6A 1E2DA 2IWHA 2DY1A 4LV6A 5IT5A 1JR3E 2C9CA 2IS6A 1VG0B 3GLHE 2P5TB 4JVLA 4Q4HB 1E0SA 2ANBA 1GITA 4NZYA 4Q1FA 4RD6A 3LWNA 3B1XA 3QXCA 3CRMA 3TW8B 1G8HA 2VSXA 2IYTA 2ZS9A 1W47A 2FEMA 2XGJA 1DPFA 4GMDA 2D2EA 3D6TB 4KHZA 3CH5A 2ZI4A 4OJKA 2QRZA 2VEDA 4DKXA 1NLYA 1GSIA 1M74A 2B6HA 5EP4A 4OQMA 3QSYA 1Q1BA 3SOPA 1KSFX 3BK7A 5FOSA 1E6CA 1XJCA 5HCNA 3DL0A 3MJHA 1E0JA 4KVGA 4TMXA 4W7SA 3K0EA 1ZNXA 1RKBA 4PX9A 5LBIA 3C14C 3FPAA 3MJRA 4ASUA 4DHEA 1E1QD 1VCOA 4O25A 4JLVA 4AYWA 1OKKD 3AP1A 4FWIB 2ECKA 4IJMA 5JCPA 4HLQB 2ZROA 2YWHA 4I1UA 3JVVA 4N0EA 3VR6A 3EC1A 3VQTA 2LKDA 2ONKA 1KI7A 5JRJA 1PUIA 2GCPA 3EZ9A 2A5YB 4A8JC 1VCNA 3K9HA 5JBQA 1KMHB 5IDVA 1WMSA 2IYQA 4Q4HA 4MRPA 2B7CA 3OF5A 3CWQA 3KJHA 1KSGA 1P60A 4EQ6B 5F98A 1SXJD 5SZHB 4PC3A 4TTQA 1G20E 4JLJA 3MLEA 1ESMA 1X6VA 2V7QA 4QBGB 4A0RA 4MDEA 4LDJA 2GESA 3RS5A 2DFTA 2J7PA 1T3LA 1Z0DA 3CRQA 4TLBA 4TQ9A 4D4KA 4A82A 5KDDA 521PA 1EG7A 1YKSA 4EPXA 2F6RA 5C1BA 4MKHA 4N0DA 3ICEA 1N0VC 2RGAA 4B43A 3EA0A 2GTPA 1R0XA 3MWJA 4B47A 4K8OA 1NNEA 2GXAA 1E3MA 4D82A 4GDFA 2WKPA 2YVUA 5FUXA 4EAQA 3P1JA 2D74A 2ZAOA 3BE4A 1HT1E 2CE7A 4ZKDA 3ZVNA 1E1RA 2PT7A 3CR7A 3W5IA 4BFVA 3NDPA 4AY2A 2FZLA 3SYLA 1GWNA 1Z2CA 2IXEA 1NJGA 4HAYA 4V0NA 2EYUA 1N6IA 2C78A 4TLDA 5A0FA 4B75A 1CJMA 1ONBA 2QM7A 2PZFA 3AF3A 4NDZA 1XD2B 3I72A 4Q7LA 1P4SA 2ZUCA 4MITA 3AKEA 1Z07A 1A5TA 3H4MA 3U3OA 1KMHA 1FTSA 5CJPA 1R8SA 1XXHE 4JLDA 3REFA 4DLSA 1TEVA 5CYPA 1NLFA 3TJZA 1WE2A 3PV0A 3L2OB 3THYB 2BCGY 5BQ5A 2RGNC 1KK0A 2GBLC 1MRSA 2WJIA 2ZI7A 3KXIA 3NEYA 3C15C 5EE0A 1NVXQ 3GLIB 2AL7A 621PA 1QVRA 5EE5B 3SHWA 1E32A 2GAOA 1N25A 1W0JA 3GLGB 4EFMA 4IRUB 2OCAA 2ZI9A 3OE7D 2O8CA 1YR6A 1DTSA 2BMFA 2IYZA 4I4LA 2HUPA 1RJ9B 4IDNA 4OL0A 1QHHA 4RSGA 4US1R 4JYCA 2ZS8A 3QENA 2OBMA 3K9LA 3ZS9A 3U44B 3GJ8A 2JJ2A 3TVTA 1Q44A 1OB5A 3ICQB 2NG1A 1N0UA 4PPQA 1ZRHA 3GPLA 1WXQA 3SJZA 1L7VC 1D9ZA 1OH6A 4QC2A 4DLRA 1UBEA 3QPUA 3AF4A 4ABYA 4OJQA 1E2EA 6Q21A 4PR0A 1GNRA 5KPJA 3HPQA 4Z51A 4DCVA 3THWB 1AQUA 3CF6R 2J7KA 4BE7B 2IBMA 3OZXA 3B1VA 5FBQB 1XD2A 4DSNA 4LPKA 4HUTA 2QSZA 5KTYA 1RRFA 1C1YA 4Q7KA 1CJKC 1JJ7A 5KO2A 3EA5A 1JBKA 3LBHA 4IDQA 1SVIA 3AVXA 2FFAA 3BH0A 4MRNA 4A0HA 2QMHA 2AR7A 1IN5A 3GCGA 2ZR7A 3THYA 1PUJA 2ZI3A 1UFQA 4O2RA 3WYGA 4YMWA 4AI6A 1FQKA 2AFIE 2BBSA 3VU9B 2HCJB 2F7SA 4YQFA 3T35A 1G8YA 4BLOA 5HKKD 1EFRD 3GLIA 1BYIA 4JT4A 1R2QA 1L8QA 5DGXA 4XH9B 1OXXK 3GLGA 4M9ZA 4X8LA 3W34A 2P67A 4EJSC 2Q9CA 1YZGA 4B74A 3K53A 3Q9LA 1YZLA 2NO7A 5ELXA 1AQYA 4NU0A 1RJ9A 1XMVA 5EP2A 2DB3A 2OESA 1Q57A 4US2R 5JI3E 5JRZA 2F3RA 1JNYA 4KVAA 3BB4A 4FCTA 4C30A 2ZJ8A 1OYYA 3OAAD 1TUIA 721PA 1DVRA 1OH7A 2OFWA 2IXFA 2OCBA 3DM9B 4P4TA 2Z5FA 1GL6A 1W0KD 5JECA 4EPVA 4M22A 3UK6A 4LGMA 3T1OA 3CLVA 3K09C 3CW2A 5EE1A 4DDVA 1G7SA 3GEEA 1P3JA 1XPRA 2ZITA 4LC0A 3A6PC 1KSHA 1SHZA 2CL6X 3I62A 1HV8A 3NEJA 1G4AE 2BJWA 4OQXA 1GRQA 2E1RA 4MYTA 2ZYTX 4YMUA 4JLKA 1G5PA 2FH5B 5C46F 1VCMA 2IK8A 3SE0A 5LD2B 2O0HA 3AVUA 3MSXA 2YC4C 1AS3A 1SVKA 3QIAA 4Q66C 1UBGA 5FUWA 4RCYA 5CJ2A 4GI7A 5SZJA 4D81A 1SXJB 4R2HA 1FTNA 1GP2A 1NKSA 1NI3A 2BWJA 3CONA 2V6JA 3KB1A 3EZ2A 4TLAA 1G8PA 2REOA 4A1FA 4TQAA 2D06A 1AKEA 1NJFA 3R9XA 1Z6AA 2G3YA 1FP7A 3CX6A 1U94A 2G77B 4TSFD 1U9IC 3DMDA 4FN5A 3EAQA 1P2SA 4DDWA 4BFTA 5DLQC 4NYMQ 4C0SA 1HURA 4PSKA 1W46A 4DSTA 4Q7JB 3GJ4A 1N6RA 3W3AA 4CRWB 821PA 1E1QA 2FPKA 3KQHA 3A1TA 4LJYA 4DXAA 1QHIA 3SJBA 2I1VB 4KFSA 3Q7QA 3CNLA 2PLFA 1KJZA 2ZSAA 1OKKA 1DAHA 4TZ0A 2VL7A 3Q3JB 4TYPA 3Q8XB 3GJ3A 5E7JA 4FCVA 2WHXA 3AEZA 5J5CA 3B85A 1CTQA 2ODWA 1SVLA 4NYMR 2ZRBA 2WIBA 3LX8A 2EFEB 1G17A 1OHHD 1ZC3A 2DFNA 4Q03A 5FOTA 3RHFA 1J7KA 3NKVA 4V0LA 2V8OA 4ZKEA 4PAMA 1XCMA 1XEWY 2QENA 2JLZA 2BHRA 4LJ6A 2ZE6A 2NPFA 3VHLB 3X1ZA 1SXJA 4KYUA 4R98A 4F4IA 1E9SA 2Y8EA 4LPSA 5LDDC 3Q5EA 4BEJA 3FMIA 3RC3A 4WA7A 3X1DA 4FD2A 1N6HA 2O8DB 2XX3A 2FSIA 1YZUA 4OHXA 3BS4A 3BORA 3ASYA 2ZE8A 4FMBB 1T4GA 3TVDA 1KO8A 4G5QA 5FOVA 1KO4A 4PPFA 2BBWA 4I81A 2FG5A 4QGHA 1M2OB 4M53A 1GUAA 4JBWA 1G19A 2D7CA 3H1TA 1J70A 5AJZA 5FTLA 3VKGA 2QP4A 1EK0A 2GF0A 5LB4A 2ZR0A 3SU8A 2CMKA 3BFVA 2XJ4A 5EZ5A 1E4YA 2AD5A 4V02A 5GJVC 1OFTA 1RFLA 2RGXA 2QROA 2EWWA 4IHQA 1N6PA 3RWOA 3V9PA 2FSFA 3FE2A 3RRNA 2FFQA 4DIEA 1N6OA 3SI7A 1TMKA 1VPLA 4TYYA 4A2PA 4LCBA 4DCNA 3QVUA 4XWKA 2FNAA 3QKSB 1VYVA 1GRNA 3TNFA 1HA3A 1G7CA 1X1SA 4RCZA 2QBYB 4RZ3A 2R44A 4DJTA 5EE9A 2SHKA 3PEVA 3ZDQA 2OZEA 5JS8A 5K8LA 3CRW1 2WBLC 4HAXA 3AKYA 1JEDA 3WP0A 2FPMA 2MMCA 2ONJA 3WXMA 1T8UA 4US0R 4BRUA 5B64A 3FHCB 5FFMA 4PHGA 4CEIB 2F1HA 2IF2A 3FFBA 3SFZA 4M1OA 3ZH9B 1TTTA 2AXNA 2MMGA 2ORVA 1ZVQA 3LA6A 1Z08A 4BRWA 4W5HA 4PTLA 5G41A 3DO6A 4NP6A 1XMSA 1WB9A 1LF5A 1HQCA 1NN5A 5FH9A 1E2KA 4FINA 4CGZA 1G9XA 5IK2D 4NYIR 1FFHA 2ZSDA 3OFND 4WXRA 4GP7A 5K8IA 1G18A 1X1RA 4KBFA 4TMVA 1M6NA 2VSFA 1Z3IX 5L3QB 4ERNA 3CF0A 5L3VA 3KKPA 1SKQA 3B2EA 4JSTA 1E99A 1YZTA 2OM2A 3AVYA 1XJ0A 1KJYA 4JIMA 4URYR 1AS0A 2ZSFA 3SBEA 1ZU4A 2OCPA 3BIFA 3GJ7A 2OV2A 3HU1A 4F4CA 4M9XA 3QKSA 1P9NA 1P9WA 1A7JA 3O8RA 4G5RA 1ZCAA 1JXOA 5FOXA 5JHHB 3IBGA 4UNNA 3WMEA 2D7DA 3A1SA 4A9AA 1G8GA 3T61A 4P32A 5BN4A 3LY5A 1RZ3A 5EXXA 2O8FB 4TMZA 3IO5A 4F91B 2YJTD 1BYUA 1UKVY 2Q6TA 3SQXA 3I8SA 3HJNA 1J2JA 4Q21A 4MA4A 5HKKA 3FB4A 3UG6A 4CEIA 1CF4A 1EFRA 1UKYA 3R9WA 3PUXA 1JXMA 4BLRA 1E69A 3KJEA 4RD4A 1AGPA 2C95A 1J90A 1ZIOA 5J4KA 3QY0A 5C2JB 1XEFA 3PXGA 1GKYA 2XXAB 1VCIA 2PZEA 2WICA 2FEOA 4NL4H 4NCJA 2IYYA 3M0EA 3NBFA 1IN7A 1YZQA 1N5JA 1KNQA 5EP1A 5B57C 1U8ZA 4ZV4A 4FIDA 1KI8A 1ZUIA 3KKMA 3AKDA 1F6BA 1A82A 4B3GA 2FGJA 3DEFA 3OAAA 2ERYA 5CB6A 2VH5R 2QP9X 4WZ6A 1G5TA 1W0KA 1NMXA 3IIMA 4GBMA 2ZTSA 2ZYWX 4DLZA 5L3SB 3C5CA 4M1MA 4NTZA 2GEUA 1LB1B 2QUZA 1CKEA 5AK0A 4KCGA 4IEIA 4PHFA 1E98A 2RGDA 4KXFB 4HB2A 1W48A 1L4UA 1NSTA 1OFHA 3P20A 2R6GA 1CJTC 2O52A 5DE3A 4DEYA 3FYHA 2ZYVX 4HI0E 2O8FA 2HLDD 5EXPA 1F60A 4OI2A 3TSZA 3LBNA 3I1FA 1QHXA 2RKOA 3LW7A 2VBCA 2F43B 2FSHA 2ZU0C 3K1JA 4YONB 5FL3A 1Z8FA 4WZBE 5ANRB 4XWAA 4FMDB 3NTUA 2P3SA 2ODBA 4HDCA 4M4SA 3K70B 3KXKA 1P7CA 1EWRA 2IS1A 1M7GA 1WQ1R 2QPTA 2OHFA 1T3SA 4IOMA 3SC3A 2FMXA 3DOFA 5IHPA 3RRMA 1OXUA 1OF1A 2QT0A 2RGBA 2PBRA 4NYJQ 4RD1A 5CDFA 1W49A 4NH0A 4TWZA 3X1XA 2YOHA 2EFCB 1FQJA 2A5GA 2X2EA 5EXTA 1H8HD 3P26A 4OKSA 4HLUC 1LS6A 2IT1A 3BB3A 4DB4A 3C4JA 1DG3A 5JWOA 4G5GA 4HAUA 1K8RA 2RAPA 3KUDA 2GJ8A 4HAVA 4B71A 4DLXA 3LO5A 2ZQ5A 3GFTA 1Q20A 5L3SA 1LS1A 2F55A 3S1AB 1SVOA 2IHYA 2FOLA 1NBMD 1S0UA 3AVPA 4KFUA 2IX3A 1UEIA 4OHZA 4F7WA 3EC2A 4ZCIA 3W6PA 4QJ5A 1T91A 4EFNA 5DSZA 4A0FA 3U7EB 4IVQA 3T5DA 2GJ9A 2ZRMA 1OHHA 2VP9A 2WKRA 1TX4B 3NH6A 2V1UA 1GL7A 5BWMA 2DPXA 5FTNA 5DN6D 2FWRA 2QU8A 4K46A 4ARZA 1G1MA 3BH6A 2BM0A 1KZGB 3MD0A 3O8BA 2F43A 5JCZA 3L82B 2GCNA 1Z0KA 1NF3A 3CO5A 1GZSA 2VF8A 4O3MA 1DAGA 2H17A 4ZDKA 4OYHA 4AG6A 2OFXA 4IDHA 4UKDA 2RHDA 1Q22A 4WBSA 2IEYA 4TLEA 1KK1A 1JR6A 2CLCX 1AKYA 2CNWD 5E3HA 4LUCA 3ZQJA 3EASA 1EWQA 4BFSA 4BFXA 2NO0A 2FDCA 3WBJA 3L0IB 2ZRNA 2R6CA 3TW4A 3U3MA 3O8CA 1XZQA 1P73A 2AHOA 5FTKA 4RD2A 4GOXA 1TF5A 5SZIA 4POAA 4L16A 3RS2A 4C4PA 4H1UA 3V4FA 3NHBA 3AVWA 5AUPB 4Q4AB 1IY0A 4RKEA 3DHWC 1D2NA 1KDOA 1OIWA 3NBYC 5E4FA 4TYWA 2JCSA 4N3NA 1YRBA 2HF8A 3DM5A 2XTZA 1TEXA 3A1VA 3L0SA 4YMVA 2JLSA 4JYBA 1D5CA 4RJLA 3S1AA 2ATVA 2XTNA 4KO8A 1XPUA 4L15A 3OIUA 5KNBA 2V6IA 2XITA 3B8HA 1XD9A 5E7IA 4PQYA 4MQBA 2MSDB 2ZUBA 1S1MA 3FVQA 3FMPB 4CYMA 3VR3A 4EKDA 1COWD 3GQBA 2Q9BA 1KKMA 1FZQA 4QM7A 2OO7A 3U60B 4RY2A 5E7MA 1W7AA 1YR9A 3KQKA 1ZD8A 2WAYA 2A78A 1KKLA 3HYRA 5JWHA 3TUZC 2O8EB 1MKYA 1YU9A 2GWHA 4M1KA 1IJFA 3CX7A 1FUUA 1F2TA 3SN6A 2W0SA 1CR2A 5F2EA 1OFUX 2J46A 1GIAA 4PC7A 4QRHA 3K0AB 2ANCA 4QG7A 3AF2A 1II8B 5KSYA 2PEZA 2ZR9A 4XVRA 4PXAA 1EESA 1JECA 3R8FA 2C2HA 4KLNA 2WJYA 1E9EA 2V9PA 2ZUDA 3NC1C 4AK9A 1JPJA 2QSYA 4D2IA 4GZMA 1KAOA 4MKFA 4PPGA 5CITA 2C9YA 2G0NA 4JLMA 4CF7A 3QF4B 4LOAA 3GJ5A 3EPJA 4Q4AA 2RGCA 5KSOA 2GF9A 2J0UB 4GPTA 3VAAA 1FX0A 2R2AA 3QXXA 2GVZC 4G5SA 4C0AC 1N0WA 3HPRA 5IK2A 2QT1A 3OFNA 1US8B 2WZQA 3PG5A 1Z2AA 2WOOA 1UDXA 3GEHA 4LZZA 1Q1QA 1P9RA 2ZJOA 2YINC 4DDUA 3WHLA 1HY3A 2EWVA 5TDHA 1X86B 1HYQA 3JZAA 2DCUA 5CYOA 3IIJA 2VRWA 4Q1BA 2JLUA 3VR2A 3VX4A 4KV9A 4IDPA 2DWOA 2X77A 4ILEA 4IXNA 3AB3A 1Q3HA 2Z4SA 3UMRA 3QF7A 1YR8A 4C0LA 2AFHE 1W36C 1Z6TA 2JIZA 1RIFA 2KWIA 1ESNA 1YVDA 2X19A 3TAUA 5H70A 2O8EA 3LW8A 3ND9A 5JJIA 1SQ5A 4XD7A 3OESA 3QBVA 4UNSA 1C4OA 3K8YA 3E2IA 3RC8A 5JJKA 3K0AA 4Q5IA 4D0GA 1ZBDA 3PEUA 2I3BA 4YMSA 5BYJA 5JFGA 4U02A 5FOWA 4TYNA 4DRZA 5AR1A 2ODEA 3B82A 3B9PA 4B6EA 1OW3B 2CHVA 3Q7PA 4ESHA 1HUQA 2JLXA 3QF4A 2EFDB 1ZM9A 2H57A 2OLJA 2J0UA 2OT3B 3EG5A 1MO5A 2W00A 2DHRA 4I1OA 5CLQA 4DLYA 1AM4D 4A92A 4W5WA 1IOZA 2VP4A 4IVPA 5EZ6B 4BECA 3THXB 3ADCA 3QXSA 3R8CA 3QKUA 2RB4A 3B1WA 3D8BA 5A5GA 1BH2A 1I2DA 4EQ6A 4D25A 1N5LA 4QBHA 1R0WA 1LTQA 1Q1ZA 1E94E 1GILA 2WTUA 2O8DA 3HWSA 1AN0A 4R2IA 2ATXA 1E2IA 1KI6B 4ZO4A 1IXZA 3FKSD 3QXHA 1KI2A 3TUIC 3ETLA 5GVRA 1UDWA 4C2UA 4KFRA 2QORA 3UANA 4F93B 1Y63A 1JB1A 3NHAA 4O2LA 2LCFA 2WWGA 4G0NA 1Z28A 3TAHA 2V55B 3PITA 4CIDA 2JAQA 2HLDA 2G0TA 4HZIA 2QMUA 4FI3C 1IBRA 2ZRHA 3QG5A 4ZI3A 3K0SA 3QKTA 4DBLC 1IXRC 5FOUA 1G3IA 1NIPA 1N5KA 1Z63A 2GAAA 4QM6A 2WJGA 3ZZTA 4ZPXA 2IYUA 3CWZA 1G8FA 2ZREA 5FTJA 2BCJQ 3A8TA 1ZD9A 4QNRA 3QOFA 4JBXA 1GNPA 1PLLA 1VDZA 5GJWC 1N6NA 3W6OA 4B6FA 4KLZA 4BFYA 1XU4A 4CVNA 2XNDD 2VIIA 3EW9A 5J4LA 5LB2A 1OV4A 3PR1A 4B48A 2KBFA 4JL8A 3HU3A 1H8HA 3GLHB 2NZJA 1CU1A 1A2KC 1NN1A 3H84A 3THXA 1S2MA 2R6DA 2R8RA 3GLFE 4BQSA 1W4BA 3SJCA 5AJYA 2EYQA 2P6UA 2Q3HA 3B1ZA 2R6FA 3AGPA 3E70C 4BWYA 4PZYA 3UIEA 2ZSEA 2AD1A 1ZNYA 3RANA 4GOKA 1LY1A 4M0LA 4Q47A 4TTRA 4EDHA 2IC5A 1E2MA 1NBMA 4LSGA 3X1WA 4BZXA 1WF3A 1TL7C 4EPWA 3A58B 3BXZA 5JI2E 3ZVMA 2HJGA 3QE0A 3E1SA 4DC9A 4JJKA 5BN3A 3IPXA 1LVGA 4NE2A 1XD8A 3BC1A 1JAHA 3QKRB 3RNLA 2A2ZA 3IQXA 4ZDWA 3A1UA 3EZFA 5DNYB 1DARA 3VR5A 1XTJA 4JLNA 4AKHA 1HEIA 5DN6A 2ERXA 4P4UA 1TADA 3WNDA 4B32A 4V0MA 3ECCA 2W0MA 3X1YA 2OUKA 5CLLA 4S2EA 4DT1B 3LVQE 1N3BA 3U44A 1PV4A 1TF7A 3H0KA 2CDNA 1G6OA 2WJVA 4MYHA 4RFVA 2LKCA 3WRXC 2ZM5A 4J0QA 3P4YA 3MG9A 1ZNWA 5C18A 2OEPA 1LFDB 4D80A 1XEWX 2HT1A 1DE0A 3U7GA 2CNWA 3T1TA 2ZRGA 4A6PA 1SULA 1SKYE 1E96A 2HF9A 2OE2A 4AD8A 1QG2A 3DKPA 2IUSA 3I32A 3THWA 4PO1A 1R0YA 2F9MA 2REXB 4JVNA 2G9NA 4BZPA 1QHSA 1ZMXA 3PUZA 4NCIA 1ZM7A 1F48A 1ZM4A 2JJ1D 1P5ZB 4UXHA 1M8PA 1VHLA 4Q9KA 2IXGA 2WSMA 3MWYW 3F8TA 4QGGA 3L8YA 3MMPA 2VF7A 3AP3A 4LHVA 2MSCB 1DO0A 1KOFA 3LVRE 1DELA 4HUQB 5DHFA 4DEXA 2DFKB 4NPHA 4RZ2A 3W90A 2R62A 3VU9A 1IQPA 3CRVA 4H1VA 3GP8A 4BEBA 2AN9A 1L2TA 1JJVA 1FPMA 3NXSA 4QBFA 4EIWA 1AIPA 3EXAA 2HXYA 3QKRA 4B44A 5KNCA 1COWA 4Y0VA 5LD2C 1VYTA 3IHLA 4A4DA 3IQWA 4CT5A 2HYIC 5FL7D 1J8MF 4M9QA 1UAAA 4RZUA 3BGWA 4DT1A 2Q0HA 2OSBA 1QHGA 1SVWA 2H16A 2D2FA 2PX3A 3QEOA 1SXJC 4OK5A 4Q01A 1U0HC 5GADl 1DAIA 3G0HA 2PL3A 3UPUA 2QMEA 4X8MA 2XOKD 1Z22A 2BKEA 3SFVA 1Z83A 3LNCA 1OYWA 3EWAA 3QG1A 1MO4A 2AK2A 3AVTA 4LWZA 2QTHA 4JMPA 3KTAB 1E2JA 4HAWA 1RPZA 4HB3A 4OQNA 2NO9A 2QN6A 3ZVRA 3BWDD 1XXHB 2RH5A 5M04A 1I4DD 2C99A 2ZRPA 2J87A 4TL6A 4QL3A 4V03A 4QGAA 2ZYUX 3PIRA 1CR0A 1QRAA 4A36A 3KFVA 2YV5A 1T8TA 2VHUA 4HB0A 3H86A 3CPHA 5CDFE 1IJEA 2OILA 2Z43A 1RRPA 1P2VA 4LYHA 5G3ZA 2REBA 3F3YA 5AJVB 5TB5A 5TMPA 2ZU6A 3IBYA 3L0PA 4QJ4A 3GFOA 2AK3A 1NVVQ 3I92A 3K70D 2JJ8A 1HQYE 2QNRA 5TV2A 3WP1B 4Y0AA 3EIEA 4EPYA 2V4ZA 4TLCA 2QL6A 2ZRLA 5AJXA 5AWFC 1F5NA 1KYIA 2BBTA 2FN4A 1EGAA 4M1YA 4Q1DA 1G7RA 1XEXB 3B7GA 1EFTA 1SHKA 3DOEA 4Q9HA 2ASEA 2ZVQX 3ZIAA 1FW6A 5KSPA 1ZC4A 2GCOB 3THOA 4F92B 1OXTA 4QHTA 2NO6A 1NVVR 5KDOA 2BVNA 4I99A 3SZRA 4DUGD 5J40A 3TGPA 5GJBA 2IHBA 1N5IA 1BMFD 2R65A 4PAOA 2QGNA 3LXRA 2A5JA 1OFIA 2WPDD 2QRNA 1CBUA 1R4AA 1QHNA 3GJXC 3KTAA 1Z0IA 2IYXA 3MFYA 4BLPA 3CR8A 4CEJB 3HDTA 3EZ7A 3BBPA 4BUJA 1II9A 1XXHA 3C41J 4LBVA 4OHVA 5DO9A 1G3RA 2FPLA 1CJVC 4Q9LA 5FR1A 1E9RA 2VP5A 5TVKA 1DAKA 2BEKA 2JLRA 4CZ2A 4MRVA 4YLGA 3Q85A 2CCJA 4E09A 4Q1AA 1FL9A 1E2FA 1G64A 1XP8A 2IUUA 1VG1A 4Z54A 5JMTA 3B6EA 4G5OA 1PLKA 3TQFA 3W8NA 3WBKA 4UJ5A 3AVVA 1N6KA 1S1CA 4RFSB 4YXWD 4JLAA 2PMDA 4URZR 4NYIQ 4NMMA 3WHKA 8OHMA 4PQFA 5HTKA 3AH8A 1RW4A 1ETUA 2H7VA 4ITRC 4IOKA 2AXPA 3BJIC 1G3UA 2B92A 2OBLA 3FKSA 1XPOA 3I73A 5DI3B 5KUTA 4WXPA 1UKEA 1NY6A 1S4QA 3KL4A 1XTKA 1MABB 1NG1A 1DAEA 2ZPTX 3LAWA 2P6RA 2C04A 2PX0A 1SVSA 4I1SA 2XTMA 5L8VA 2ODNA 1H65A 1FOEB 4IOLA 4KSBA 3KDSE 1S9HA 4KSCA 1P2UA 1IN6A 2GCOA 4PC2A 1P72A 4II7A 1GRRA 1NY5A 3LFUA 1XBTA 1XMJA 2HJVA 2VTKA 4PHTA 3C7KA 4V0OA 3DDCA 1KI3A 5EJEA 2QTVB 4JKIA 4LYJA 3TR0A 4DLWA 1LF0A 2D4HA 1I2MA 3ZLJA 1UADA 3TSWA 1UM8A 3CIOA 1GTVA 2CLDX 2GA8A 1EX7A 2XNDA 3RYTC 1W44A 2YZ2A 4QHSA 5EUMA 3MGCA 1II0A 1G6HA 2A3RA 4KYIB 5EP3A 3P4XA 4JKYA 5FBLB 4EFLA 3RABA 1R5BA 3ADBA 2CL7X 2Z83A 4M1TA 2QBYA 2JIZD 1UPTA 4CW7A 1G41A 1NRJB 1K6MA
chains in the Genus database with same CATH superfamily
5CW1A 4QDJA 1P80A 4YC7A 4PGMA 5ITZA 1X9GA 2KI5A 2NIPA 1YNSA 2EKZA 2HPZA 4C14A 1A5BB 2PQ0A 5F4BA 3AEUA 4P38A 4DIBA 4MWEA 4G1FA 1JA1A 4TS1A 4WVFA 1I4TD 4FI3F 1UEXC 4BN0A 4CCWA 3RU2A 4E2WA 3W6NA 4PLFA 5DI3A 2YQ5A 3GNQA 2QDXA 5BP7A 2VR1A 4M8SA 4ZAZA 2YBDA 5D86A 5K20A 2QXTA 4GOOD 5EC8A 3SOZA 2CWWA 3ESXA 4ZC8A 4RXUA 2OHVA 3Q7RA 3VHXA 5T7BA 1ZCBA 2ACVA 5LL6P 3IKLA 3IPYA 4N8DA 3TQQA 2PCJA 2P75A 3JQDA 2WA2A 1LV7A 3LT4A 2GDJA 2BC9A 2R0QC 4QDUA 5T8KA 3A6FA 5IXYA 3N2NA 1V3UA 2VA8A 3H65A 1V3VA 5ALXA 3T7KA 3AVQA 5HE9A 4YCLA 4S35A 6AT1A 4GMKA 3WYAA 5JAOA 4L95C 2P27A 4BX3A 1C4XA 1M6VB 1FJ2A 3H5WA 2EHJA 2VEOA 4ZCMA 3DFZA 1JG2A 2Z5VA 3L6DA 3OH8A 3QWBA 4FDUA 5A4KA 4KITB 1GZUA 2AGVA 2GILA 4KODA 2OOSA 5ENDA 5FBHA 5IN5A 1LGYA 3N0XA 4MVJM 5GQSA 1F0KA 1K7SN 3GWZA 4HG2A 4YV1A 1G8SA 3VC7A 1A2OA 1XDDA 2CLSA 3HB1A 3QXGA 5I9IA 2X9LA 3GFBA 3BJZA 4D9BA 1YDWA 5J4YA 2C96A 4BQPA 2DRIA 4PU0A 1Y9JA 4KAFA 4CN9A 4B84A 5JXGA 4BUZA 2PAFA 1I2CA 1NXXA 2XIQA 4RANA 2GHRA 4I4TF 5DXFA 2LRHA 5G3YA 3O8LA 4E5YA 4UEQA 3PJDA 4MGIR 3RSSA 3VH3A 3O6VA 1QFMA 1F6DA 4RY9A 3MGGA 4BFUA 5FTMA 3KYCA 3ZWAA 1DG1G 1VG8A 5IBQA 1RJFA 2FAXA 2ZRQA 4IVRA 5E95A 3STUA 2P2GA 3BL8A 2G1UA 3WYDA 4DR3B 1CZUA 2ZCUA 1P7PA 3GMDA 3H6HA 1CLUA 1TNDA 1FFEA 4NY1A 4R4JA 3U19A 1CT9A 1EPUA 1TZBA 1AUXA 2QTCA 2JAHA 3QU7A 4LJ5A 4MQ4A 4MVJG 4XUCA 3EXHC 5IBPA 1S4MA 2JL1A 3RR2A 1NHGA 3QBTA 3BFKA 3BMCB 2CVQA 3FIUA 3P32A 4HVAA 4OHOA 3UB4A 2X8AA 2WHEA 2NV0A 3QYJA 2WWRA 3D4LA 3RGWS 2J3QA 2WVJA 1IWBB 5I47A 4NX2A 3IC5A 3JW8A 2EG9A 3BWEA 3RUDA 4O4IB 1VIYA 1ZR4A 3LBIA 4MJ7A 1UMKA 5A2GA 1WKVA 3IUJA 1DKMA 1FLAA 1LLQA 3ND8A 3QTLA 4LXHA 2O7VA 4UC0A 4URHA 1X8KA 2BMJA 3D43A 4ZCPA 4GQBA 5D3ZA 2OAQ1 1H1TA 1I33A 1FFAA 3KOZA 3U56A 3V8BA 2IDJA 3ENWA 2QZJA 1CIPA 1OQAA 4Y2YA 1T2DA 1J8YF 3ZCQA 2HL6A 3PC7A 1KI4A 2YRXA 4H15A 5L7TA 4KPUA 3C3XA 1Q0SA 2VK1A 4UU1A 1JJIA 1HZZA 1QG4A 2WAXA 4L5BA 1EXMA 3GD7A 1USUA 4RM3A 2GZDA 2BM1A 2IHKA 3IEUA 4G8CA 4ZRMA 1E2PA 4IFBA 4DDTA 4FFBA 4JLPA 4M1QA 1W25A 4JN6B 4TM8A 5AVOA 1V43A 3IP9A 5I7WA 2C77A 3GA7A 3PB3A 4LOJA 5FPSA 3RSLA 3WL5A 3OIVA 3TLEA 3TMKA 4P3YA 3BMOB 4WNIA 2ZRJA 4JI1B 1K6JA 1AXEA 2PZKA 4FGJA 4HB4A 2C9DA 1FNMA 3VPSA 5JSZB 4ZO6A 10MHA 2CL0X 4OHCA 1HX7A 1E2GA 5C4MA 2FKAA 4QBTA 2PMKA 3WZMA 2QVZX 3AXSA 3V8PA 2OSVA 3MSCA 4S04A 2FP3A 2H8KA 3R5KA 4OQYA 3Q5DA 4MV8A 3ROPA 1RKUA 3FCYA 3SSAA 5K8TA 4B2IA 1SD5A 3ISJA 4CJXA 4CQLA 3DR3A 4EF5A 3C6KA 3F0TA 1KYWA 3JQ9A 4P0TA 1H2ZA 3D8UA 5EUBA 2OCDA 5TGTA 2J1LA 2IXDA 3B70A 4IO1A 2G7MC 3QRWA 4TMTA 2RBGA 1BGVA 4ROTA 5JD3A 4C3ZA 5AVSA 4G4GA 3W5JA 1T34A 1J9ZA 3CZCA 4RENA 5REQB 3W8RA 5B7PA 4INAA 3Q9UA 3EVDA 3TBHA 3S6JA 1UQTA 1J8DA 4G67A 3DTVD 2QX8A 3EE6A 5JDCC 3OPYI 1EJ6A 2X9NA 4MHTA 4JUCA 3T5GA 3WYEA 4ZT4A 2GVDC 1K75A 1ZGHA 2W6CX 4EZIA 2X40A 3W2FA 2P0EA 4FKBA 1CUUA 2HO5A 3D54D 4U7JA 3D7LA 2UZ1B 1KJWA 2IEZA 2O2ZA 3HA5A 1OIXA 4M7PA 4L72A 3CUTA 2RGGA 4Z9AA 4DYHA 5GVSA 4OA8A 2VPPA 4PPYA 4L6CA 3LQ4A 5IH3A 3RRFA 4EX7A 1M7BA 5JS2A 4YP5A 3T94A 1B2LA 1QOZA 1FNSA 4EY6A 1RC8A 5K8UA 1OBVA 1XQ6A 2VJCA 3PYLA 2B30A 3Q6MA 4OEHA 3HWRA 4G5FA 2C4KA 2WRZA 3AEXA 4D9GA 1RM4A 2PRIA 1G9TA 1U2EA 1I51A 3EFOA 3OOEA 1P31A 3AR5A 2O0LA 4M0EA 4RD3A 4LF4B 1X2EA 3ENQA 2EFGA 3GAFA 5A4AA 3HFSA 4FFVA 3U7RA 1IN8A 1B41A 3B12A 4IG9A 3IT0A 4ZEWA 4TYQA 4B2PA 3P7MA 2IS2A 1JE1A 1Q5PA 2VXCA 1FK8A 1KDTA 5EFZA 1ECLA 1J99A 2EFHB 3B6JA 4NCXA 4Q3OA 5B4VA 2DPMA 5FPKA 3GPIA 1NMQA 1DT3A 1JAYA 5B6JA 2R00A 1X1EA 2NQ2C 4AJNA 1AHNA 3KZCA 1XNGA 1IQUA 2V97A 4L3VA 1R66A 2G8NA 3ZBQA 4ME6A 5UKDA 4DA0A 4YAGA 1EXVA 4YDRA 5P21A 5I9SA 3G82C 3K16A 4LEIA 4CM1A 4GDMA 4F9EA 2FMUA 3H3FA 3D6VA 4P7BA 4ZOLA 2P2CA 3ZXUB 3T1HB 5K1ZA 5DM2A 4FQ7A 2VNHA 3OIYA 1GUZA 5JZOA 3LKDA 4ZAYA 2JFOA 4L6IA 3PRKE 1V41E 3B1YA 4P33A 1U3CA 2AUNA 1UPUA 5BNWA 2HEIA 3VR4D 1JQLB 4UCWA 2C92A 3MFQA 4Z1MD 3JPYA 2PVCA 4E5UA 4Q7EA 4P35A 4NKRA 1PBTA 4FSXA 2G4CA 3EN0A 2OOKA 1WAMA 3JQAA 4L4YA 1R0RE 1DIOB 3HVIA 2EZTA 3I42A 5AKHA 3UGQA 4EPTA 2JLWA 3OA2A 1UAGA 2PTHA 2DYKA 1LJ8A 2UUAB 2PRZA 1JBQA 2PPLA 1M8FA 4A8JB 4YI3A 3AHIA 4DPLA 1T3HA 2IBTA 1PTKA 2GJAA 3I52A 2ZIGA 3TI9A 3R4CA 3NUZA 3ZZ0A 4Q3CA 3GEIA 3ZUPA 3PHJA 2NU7A 4W6QA 4HDMB 2XBMA 1ZU5A 1ZP6A 2C97A 5JU6A 4B5LA 1F4VA 1N2CE 1CYDA 1GR1A 1UPAA 3EQ9A 3JARB 3UJPA 3E9ZA 4YR9A 1ISHA 2LVBA 5JADA 1VSTA 4EH1A 3TBKA 1L7XA 3CCFA 4X1YB 3VJKA 5JPCA 1Q6ZA 4LI3X 4MQMA 4XEUA 3EPHA 4A0GA 2EQBA 1I10A 2WAOA 1JI0A 3EXFB 3WB9A 2XADA 5AKEA 1RLTA 2YN0A 1JPNA 1MU0A 1J24A 5B36A 4FUQA 3ZJYA 4DGQA 4BNZA 1OVGA 3PGLA 4C4OA 5HBRA 1NW3A 3W9BA 4MA5A 2E5LB 3P19A 5LP1A 2Z4RA 4OU4A 4GIBA 5LQJA 2FU5C 3AZPA 5K6AA 3LPDA 2ADMA 2X42A 3UBTA 3HDVA 1XZLA 4G4JA 4FOOA 1TKAA 5LC1A 4D8UA 4GUAA 5EI5A 1UDBA 3ZWWA 5A04A 3WQQA 1SUAA 1YS1X 3G2PA 3UMSA 4MR8B 4B3TB 2F2TA 4CDRA 1O97C 1ENPA 3GVXA 5DIFA 1YTLA 1DTWA 4UTOA 2A0WA 2FV8A 2W43A 3DBVO 3KLPX 1L4HA 3AUXA 4O8CA 4Y9DA 3BL6A 1Z0SA 3VH2A 2PBZA 3CY6A 4RWZA 4D56A 2DHQA 1BXRA 1U7ZA 1US8A 1X8LA 2QPAA 2XVAA 1QE3A 3AINA 5I7OA 1ZIYA 4IV8A 4OAOA 2NXWA 3QNMA 1CUWA 1RBQA 2GZ1A 1YDHA 1IRXA 3HFRA 4NENB 3EJ6A 1Z6GA 2AW5A 5DLYA 1OJ7A 3ZYZA 1U3WA 4JP1A 5A1TA 2YVLA 1ZH8A 4V38A 2R7AA 3P9PA 3K0CC 1X2BA 4WKBA 1H8EA 3L4BC 3O82A 3ETEA 3MINB 2DWPA 4LYAA 2JAWA 4PRZA 3KAJA 1VHTA 4BTVA 1WG8A 4AJ9A 5HVNA 4ALNA 3O3MB 2AQIA 1L9XA 1RYMA 4J9UE 3RSOA 3GY0A 1MTOA 1SJ9A 4S1TA 1FJHA 3TR5A 2PRSA 1XRJA 2G06A 3HB9A 3LUAA 3DMNA 1TF2A 4L7QA 4L9SA 4RMNA 4F8JA 4BO3A 2QD4A 3OETA 4LV5B 4PFKA 2VUHB 5HF8A 1HH4A 1QGUA 3DV0A 3H8SA 4ZA2A 3AI1A 4ZP1A 4O29A 3X2FA 3U61B 1KQGA 1RYZA 3KSRA 5BUCA 1EGVB 4QQRA 3CX8A 2Z30A 3KEOA 2I6XA 3R0JA 5BR1A 2BTQB 3JWJA 3UK1A 3IQGX 1SNYA 2FPRA 4EYEA 5I4IA 3FFWA 2A5LA 2R7MA 3SC2A 2GK4A 4S05A 3LOPA 1CETA 1ND5A 1TUBA 1WDLA 2IEAA 2NQ8A 3EMKA 5EJ6A 3RFUA 5EMMA 1PTJA 1GGMA 1Y3HA 1QCDA 2YRFA 4QODA 5E8JA 2QMOA 4N18A 3UXYA 4D57A 2JKYA 3T3EA 2JCGA 1NULA 2FFBA 3Q7SA 4JP8A 4DNFA 5AUQA 4MI6A 3HCOA 3N2EA 3WGVA 3P96A 5T57A 4EGFA 1QO9A 4QOJA 2JFHA 1P2TA 3LRXA 5D3MA 4ZJUA 3ZE6A 4PGAA 3GH1A 3ZE1B 3R0ZA 4EW3A 5DW3A 2FMIA 3BGOS 4ODIA 5LQRA 1JW9B 3WS7A 1Z0ZA 3IGFA 3HVRA 4CCYB 5EE3A 3WMFA 3JD4A 4ZV9A 1Z12A 1VPWA 3JX9A 1KMNA 2JFUA 2RGNA 4KN8A 3LCMA 2GBLA 3ZVLA 4NBVA 4UAGA 1EZ4A 2ZIZA 1N0HA 2FN3A 4HZUA 2Q6LA 2ZSHA 4AX8A 4UDYX 3WMXA 4GKJB 5EJAA 3OCZA 3SLRA 1WUIS 3ECAA 2P4QA 3M6AA 4DCTA 4ENVA 5BSGA 2PZGA 2Q45A 1CNEA 3QMPA 5KTMA 3DL2A 3JZMA 3FHJA 3NAQA 3TCNA 4BGVA 4XOIA 4D9NA 1MT0A 3AUYA 3OBBA 2R79A 4Q7MB 4DV6B 2JF0A 4K03A 5ESXA 1F3OA 4JJEA 1ELOA 1XX6A 1JL3A 3LS2A 3OX3A 3Q8WA 3ZEAA 3QHPA 1I1NA 2H7XA 4EB6A 4BNXA 2O23A 2WM8A 2O19A 2JGNA 5BPFA 2EL9A 2ZSUA 1Y4AE 4DR6B 4ZHSA 1FFXB 1N5DA 1ZAKA 2AX3A 5D84A 1EX1A 3RS8A 1RLIA 3T4UA 2ACWA 3NO4A 4IFEA 3T9BA 1QH8B 2KBEA 1W9HA 2BBOA 2I8CA 1G7TA 4TT3D 2H1HA 2X58A 2GYWA 4ENPA 3LUPA 1UKZA 2EQAA 4AS1A 2I3GA 3VR0A 3CH4B 4DDHA 1LRJA 3TXYA 3MOGA 2EEZA 1BMTA 5KOYA 1JR3A 1UWKA 4IW3B 4KQ6A 4NOLA 2XYVA 4HDSA 4M2LA 3U4MA 5DV9A 1RAFA 5JDIA 1TEZA 2WMOB 3NTOA 3NVAA 2FN9A 3PNKA 1JQKA 3JQ7B 2PXCA 4MYCA 5HGXA 5K5EA 2J4DA 4EUEA 1QV9A 5KNDA 5EZQA 4C4XA 2ZB8A 4LJ8A 3EPLA 5AKIA 4MGKR 2AOWA 4LECA 3BRCA 3NKLA 4B7UA 1BRMA 1Q1AA 3AILA 5DYIA 5PGMA 3PXCX 4CMCA 4URXR 1TMOA 1Y9ZA 5E3IA 1YVEI 5HJ7A 2QRPA 2VXYA 2CUZA 2AFHB 3C3BA 3AVOA 5BVGA 2YJNA 3D3QA 3FFTA 1P1IA 1DBWA 1WP4A 3QHQA 3EYWA 3I4FA 2BDTA 4QO7A 2XB2A 1BE6A 4JL6A 4A73A 5C52B 1JQ5A 2BEWA 4XB6B 1FE8A 2VQ3A 4ALJA 3SIXA 1V6SA 2HCBA 1N77A 1PLJA 1Y5RA 4LISA 5ESRA 3V8NA 5CEJA 1X77A 2XLCA 4ZYXA 2OXEA 2I2XB 4FSDA 3ZHQA 2FJ0A 3PKIA 5EWMA 1UKBA 3EYAA 3VNAA 4ZDJA 1E4VA 2PWPA 5CPBA 3KVVA 3UWOA 4QQKA 2H85A 2K2QB 4TN1A 2GZRA 4I55A 2NLOA 3LH5A 1U4SA 1DJNA 2CK3D 1JHXA 4PO9A 3AJDA 3C3CA 1H4VB 4UVHA 1BOFA 4RVCA 4GRIA 2YVAA 3ZDZB 4FYVA 1EAMA 2ZRKA 2VZ8A 3ZCSA 1K7YA 2A84A 3UFXA 3M4YA 4TXMA 1NFQA 3AQ4A 1H3NA 1UXOA 3LUDA 2O1WA 2WM9B 3S44A 4QFBA 1E7WA 2B25A 4WEOA 2WJ4A 4IKEA 1DC5A 1F8YA 4IDOA 2O0KA 2JC3A 4JYZA 1ZXLA 5IG2A 1I4LD 2YMMA 2IKQA 4C7MA 3I5XA 3KNZA 4Z4FA 1BXZA 2P9CA 5C4IA 4DIKA 4LYFA 1U9YA 3P9QA 4IGEA 4XTRA 4X0EA 5LP6F 2YV4A 1ECCA 4G81A 3ZDFA 5DEOA 5LQMA 4IIJF 3QSGA 2IYNA 3G59A 3O8OB 5BYAA 2C29D 2BIFA 4GBJA 1G0OA 1X1BA 2DECA 2QVLA 2Y1LA 2GLTA 4P4NA 5CH8A 5ALKA 5TVGA 5EUCA 1S2LA 3IUYA 1IMJA 2CC2A 3IAM1 1PV2A 1LNZA 1LTHR 3ABZA 1OU4A 1EXWA 4WD3A 3P9KA 4K6CA 5TPZA 1LSJA 4LRXA 1L7NA 4L9AA 2PS3A 3D4IA 4J49A 3ZH2A 1YNOA 5I7FA 3MAAC 1XHLA 4LC1A 1X7YA 3V1KA 1X7GA 2EIXA 2LZ0A 5C8XA 2BJHA 2DLNA 1M2FA 3RS3A 1TAHA 2NUTA 4TV9F 3HKCB 3LF1A 1LSSA 5TT0A 1R4ZA 1AA9A 4QSMA 1T1JA 4ER0A 2PQMA 4Z4EA 4BVGA 1E1CA 2ZUWA 1XK7A 5GY7A 3KSAC 4K0KB 4QLOA 2OUIA 5KTRA 4HYYA 4R01A 1W4CA 1W73A 3FDZB 5DGDA 5A4MS 5KS2A 1Z5UA 4J3JA 4MV4A 2WK1A 1VBNA 3CLHA 3OMXA 1MZPA 1TFRA 2CCGA 4E3ZA 1MGPA 2IZ7A 2QRUA 3V8QA 4CKWA 2GRAA 2H18A 4D4LA 3GLFB 3RKUA 3ZQ4A 2WUFA 1TMYA 4KFTA 5KOJB 1XTSA 3WKDA 2FX3A 4OBEA 5KWEA 3ABIA 3R9XA 1Y1SA 4FMCB 4HR7A 2BOVA 3F7MA 5DHPA 3ZX4A 4CMAA 2DTEA 3FOZA 3BB1A 1OYOA 3O8NA 2JDID 3S70A 1N7HA 3NHZA 5NLLA 1CQIB 1JDTA 1R6BX 2E0IA 3CLSC 3VPXA 3ETCA 4MI9A 3GEDA 5AVZA 4X95A 2W8BB 2WZBA 3P2IA 3M6IA 4JQSA 2XRMA 2R6R1 3H9GA 4OMFG 3Q6NA 5LFAA 1IH8A 3V2UA 4R0MA 1ZI6A 1U9CA 3CFYA 3N8HA 3U09A 4PHHA 3OQOA 1KYXA 1U0LA 3V4LA 4F84A 2QA5A 1L5MA 5EIOA 2QRLA 4TKLA 4YRLA 2ASVA 2XUDA 4E21A 2PH3A 2J32A 2EJUA 2WA1A 3EOZA 5DHRA 2OORA 2OO5A 5ALGA 6LDHA 5LM3A 3DMGA 5TPWA 5K51A 3C5HA 1W2WB 3DVLA 4O0MA 3N58A 1CZLA 1G5RA 4D9MA 1LQ2A 2VYFA 1IE3A 2RGEA 3ZCXA 1QIIA 421PA 4B8YA 3OMWA 4DMMA 4JSRA 4FTWA 4YDQA 4F2DA 5DVZA 5DYGA 2YS6A 4OXIA 4D5GA 4LHXA 3QI7A 1CULC 1WS6A 5JAHA 2WWFA 1VOTA 4ASUD 1Z4KA 3QITA 3SBOA 2AN4A 3KYDA 2DAPA 5AI8A 3C97A 3KTFA 1NBEA 4LJSA 1T0JB 2GRJA 2VQDA 4CT4B 1QZXA 4E03A 1QIGA 1W93A 2NU6B 1SY7A 3B5IA 2C2XA 3IP8A 3LXXA 4DCSA 1QIEA 3DLAA 1DMRA 1RQGA 3W04A 1PG5A 4MVJH 1E7RA 2N46A 4G4SO 1P3DA 3LVBA 4MRRA 4ETNA 1UJ6A 5FA8A 2EVWX 3IFSA 3EBLA 2WV9A 4QUBA 3HYCA 3LPMA 2JLYA 1G0NA 1JN0A 2A0FA 2YHIB 3N2IA 2VDJA 4WLFA 3ICPA 4RD0A 5ARDA 4JHLA 4KU4A 2HOQA 3HL4A 3L7IA 3ROFA 2X0EA 2DKFA 2FPGB 5DSXA 2IEBA 3P27A 2JGRA 2X3YA 5JAPA 5JR3A 4ABTA 3GUUA 1N3LA 4LK2A 5CX4A 3L92A 1I2AA 1MXHA 1MG0A 4GP6A 4OYLA 5C80A 2WI8A 2MSKA 2PVSA 1MH1A 5JW6A 3M4XA 5IDXA 5C8YB 2C42A 1VB5A 1OH8A 2F3QA 1JLMA 1L0BA 1WHTB 1ZXBA 1MR3F 1MOZA 4X61A 2DBQA 1SZCA 1VHQA 2ZJ7A 3QEBZ 1XHFA 3EIQA 2WY2D 4AJOA 3ZHTA 3PEFA 1OH5A 1UBHS 1A2BA 1PS0A 1SCDA 1YVUA 2A57A 1BGWA 3H5TA 3N8IA 4FYKA 1GOTA 3AM1A 4BNVA 3DDSA 4AQ7A 2J7PD 1M2KA 2FW0A 4BASA 1DX9A 2L82A 2ADFA 1SKUA 3EFEA 4G5XA 5FI3A 1MABA 2DY0A 2EZ4A 2PLRA 4DYDA 6NULA 5KWVA 4RXTA 1BDMA 3V4SA 4YJ2F 3WDLA 2WYUA 1PJ4A 2IE8A 4JJ7A 3FR7A 1QUFA 2FMKA 4D99A 4BE9A 1AK2A 5HG0A 4WKOA 4K1LA 1ONNA 2C1ZA 1DMSA 3T06B 3UTDA 5JXJA 2JH9A 5ALDA 4C20A 3U7IA 4MUFA 1AS2A 2Z8YM 4NCHA 1CUAA 2JD0A 2ARKA 1POXA 1T9HA 3GK3A 2QTVA 4HXFB 4CL2A 2QT9A 4JHXA 1KY3A 3BXOA 2NZYA 5K3SA 4BHTA 2K6GA 4OX9Y 1FDIA 4B82A 1OLSB 1YGPA 3D2AA 1G38A 1E1RD 1FZTA 3DAYA 1FMJA 3DR5A 1V4VA 3FOAA 1XWWA 5LYJF 1Z62A 5EZYB 2O2GA 4MW5A 1MNQA 3N70A 4RF3A 2QRMA 1XRMA 4FGUA 1CY8A 1KDRA 5K4AA 3OP4A 4ZVQA 3U4AA 3HV0A 5FPPA 4RBNA 1UWCA 1W6RA 1N8NA 5BWNA 3K4QA 1CR4A 1MV5A 1VYUA 4ESVA 2IP4A 5HPYB 4BLTA 3CUUA 3AY3A 1Y7PA 5G40A 2R85A 5FPYA 3FNQA 1NQ5A 2VJPA 3ASZA 5B1YA 1LPNA 5ICGA 3WWPA 4DLUA 3RF7A 5IS2A 1E5LA 2V5UA 4FZRA 2FUG1 5LNK6 2P9TA 4IJ5A 4Z3OA 1IHUA 3REQB 3WO1A 1KAGA 5DP2A 4EJ2A 3BTUA 4X64B 4JQOA 3ROQA 5JSQA 4KRFA 1UPFA 2WFAA 3CSUA 3R40A 1ZSYA 1KGDA 4LXTA 1QYRA 3R6WA 4P5DA 5D3QA 5CVCA 4FDVA 4DMLA 4IQFA 4RTQA 3QPWA 4F7DA 1GT6A 1XCGB 2P35A 3ODPA 4B3CA 1M76A 3EDRA 3M1LA 2FPUA 4MKGA 3SR0A 4R2KA 3V7FA 4M1SA 3ZR4B 4ARZB 1MJGA 2V59A 1G21E 1Z36A 2OBXA 2RDMA 2V58A 2PDAA 4QYXA 4C0XA 2PE5A 4HWRA 1FDVA 1ENYA 3NR2A 1EFUA 2JJ2D 2R1TA 4EAAA 3BE5A 3A70A 5JUWA 3CUEF 3MC1A 2CNBA 4I46A 2JBWA 3P0EA 2QTWB 4PTZA 1SC9A 2IUFA 4C0KA 5FPTA 7MDHA 2LPMA 2M6RA 2XCOA 1MENA 2FF5A 1WCWA 2QRVB 3DVAA 1R4MA 5L3RA 3AI2A 3VGPA 4NG4A 4AMZA 3LUKA 4EM6A 1MO3A 3U4QA 1OILA 4EHKA 1BKDR 3C3WA 4J1QA 3UJ6A 3KSDO 1B6GA 1O0SA 3K32A 1PWEA 3T1VA 1XU7A 5I8ZA 1W76A 4RTNA 3LQKA 1RI5A 1RYEA 1T24A 5CBPA 3LY8A 4FGSA 3M6VA 4GPAA 4K81B 5BN5B 2HPHA 3W3ZB 4HFMA 2JI7A 2V6BA 3KZNA 5GGYA 3TRDA 3VO2A 5JLAA 2IU6A 4E4RA 2J5RA 4RA9A 1FP1D 4NE7A 2NSHA 4G84A 3ADPA 5KC8A 4REQA 4U7DA 2N1BA 4GNKA 1R0CA 1SZPA 2JLCA 2Z4TA 3ZWBA 2JLQA 1VIAA 2Y1OA 4B8ZA 4HEJA 2ZKLA 3JWPA 4ZCLA 2DWQA 4HADA 1ZGGA 1C30B 3Q3VA 4ID9A 4OMDA 3G9UA 4M8KA 2X7JA 3V4ZA 4MLZA 2Y27A 4ACAA 1H1DA 1PG0A 2RI0A 2SBTA 3LMKA 3G0GA 3OSZA 2I62A 2H4JA 4UZSA 1FDWA 1J4AA 5G0VA 2GVNA 2SKEA 1Y3AA 1FRVA 4QU0A 3STYA 3DL7A 4RORA 3V4OA 2HDOA 5JVDB 3UBMA 2F1RA 2P11A 2PGNA 4WDQA 3V9AA 3HCEA 2OXRA 3QTTA 5FV4A 5I5GA 2FWIA 5LMNB 5TY0A 3WL6A 4UAJA 2VK4A 1GEEA 1YT5A 1RWWA 5EG5A 3EIXA 2YKGA 2YH2A 3S7ZA 5F21A 2B98A 1JYEA 1WEKA 4WX2B 3QVXA 2DFDA 3CE6A 4XDHA 1Q83A 3TLBA 5TXGA 1MXFA 2I8AA 4YRGA 5DCYA 1PR4A 3ETGA 2MINB 1TT7A 4OPMA 3FF1A 3UWKA 4JS0A 4YXFA 1C3OA 4TKVB 3ASVA 2F59A 3JASB 2GWRA 3BERA 3G68A 1JFRA 3A3KA 4DVGA 3BCRA 2Z8XA 1V5IA 4CPDA 2HSJA 1P0QA 4XJXA 5BW8A 1NP6A 4IHJB 1MX5A 3MWKA 4JXKA 4ARBA 1W1WA 4BTLA 1FP2A 4CQNA 1KVUA 1UMBA 3DBIA 3AEQA 3GLTA 5CFZA 3O4GA 3O94A 1E2DA 2IWHA 2J0SA 1PFVA 2A9FA 4IGAA 4LKOA 2B5OA 5IT5A 3MJCA 3IV9A 1Q84A 3OQJA 4KOEC 5AKYA 1P5RA 1WU7A 3GLHE 1GVHA 2IS6A 1KFBB 2O50A 3C6XA 3F1LA 4Q4HB 4WGFA 1E0SA 2P9YA 3QVTA 4MTCA 4MQFB 1CHNA 5AW8A 1E6LA 1Z82A 1G8HA 1A9RA 2ZS9A 3JWGA 1UFKA 3RBXA 2J6BA 3EUAA 5GTDA 3NHSA 3E05A 3IQFA 1G8AA 1UINA 3P97A 4GMDA 1NPDA 2A9OA 3CH5A 1TZ2A 2ZI4A 3C1AA 4OJKA 1C9EA 4G8BA 2O8VA 1TVKA 4MAAA 2W90A 1XRSB 4MKRA 4YRKA 4UOEA 3AKZA 5EWLB 4YAFA 1NZFA 3BK7A 5FOSA 5HIAA 1E6CA 4X65B 3UHFA 2AEEA 2VF2A 3QKWA 5HCNA 3TNYA 2JH3A 4YYEA 2VTEA 3DL0A 4E2ZA 4F3RA 5HYVA 4W7SA 3L4KA 3E82A 2XMDA 2P90A 3VV3A 1RKBA 2WLTA 4PX9A 5LDGA 3C14C 1EWKA 1E8MA 3ETJA 3FPAA 3OHSX 3ORSA 2L2QA 2CFIA 1X14A 4MLDA 4OGGA 1VCOA 2OECA 1WMEA 4JLUA 3UMCA 1XRPA 2QLFA 3T4XA 2OK8A 2WQZA 2O2DA 2BGIA 4AW9A 4PSUA 3GUZA 3GOQA 4GS5A 5AK5A 3HA2A 3AP1A 1J2UA 2ECKA 2B35A 4IJMA 1M8JA 5C8ZA 4K28A 1WW2A 2ZROA 1V48A 4I1UA 1A9XB 5JCPA 4N0EA 5EXDA 2A0XA 3NHRA 3VQTA 2VAWA 2O4UX 4D8YA 1GPJA 4QYWA 5DRTA 1KXZA 2VAXA 4QDOA 2WTXA 3H11B 5J63A 4B6OA 1PUIA 2WHYA 3EZ9A 3LYLA 2A5YB 2OPBA 3K9HA 4EHAA 5FP0A 5M7EA 4S3MA 4N8SA 5IDVA 3W5UA 1WMSA 2IYQA 1ZD2P 4H3VA 1ZGBA 5AW3A 3HK2A 3IVMA 3KL2A 4Y2TA 3AIKA 5KX5A 1HNWB 4D0SA 3KJHA 4OUDB 1KSGA 5F98A 2WQ7A 1NR1A 1W0CA 2ESRA 4Q9IA 3EEYA 2NUBA 1YWGO 3JQGB 3MLEA 2V7QA 4I5IA 3RH0A 5IKXA 3RS5A 1BN7A 2XODA 5GGXA 2DFTA 4RS3A 1T1GA 1HPLA 1LPBB 4N0MA 4D92A 3QBDA 4KQWA 5J2UB 4Y98A 5LZ9A 3D6NB 1QGDA 4XCXA 3OZIA 3SC6A 5ERGB 1NT4A 4LQ4A 3ZJ5A 2VDRB 2HMVA 4WK4B 2BFPA 1FFBA 2JNWA 4A82A 1ECJA 4EEKA 521PA 4BGUA 1EG7A 2EJBA 2H4FA 2B2NA 1RLUA 2HU7A 2IELA 1O2DA 2H2IA 3ZN2A 1P4RA 1UOOA 3EA0A 1H22A 3MWJA 3HC7A 4K8OA 5U4XA 4G85A 2C94A 2Q0SA 3ESZA 1FA9A 2YVUA 2XY4A 2Y6VA 4GYWA 1VM6A 4Q34A 1NQTA 2D74A 2WT8A 3H3XA 1H6DA 3ZVNA 2VYCA 4ZKDA 3W5IA 5IAEA 3CW8X 3QUCA 4BFVA 2CBGA 1KEEA 3RPEA 1NJGA 5E9JA 3STHA 4G37A 2GFHA 2EYUA 3CUWA 3QLVA 4AT1A 1A98A 1ABBA 3LA8A 1CJMA 2CUTA 4H77A 3D6AA 5BUQA 1C9MA 3ZPXA 2HWUA 1OXKB 3AF3A 5AH0A 1NVBA 3I72A 1T9KA 4GZ5A 1P4SA 2ZUCA 3K9CA 4FFOA 3TMYA 3H4MA 5CDUA 1J5EB 1F8UA 1MOQA 4W7HA 4Q05A 4DA4A 3HDJA 2AR0A 4PLVA 1XXHE 2Y2VA 4WHMA 3REFA 3UENA 1ZG3A 3PICA 2IGTA 5KINB 3NIWA 4XFJA 1OUMA 3LWDA 3E7XA 1ZICA 2AMLA 4IZ6A 4O4HA 1BEEA 1S2IA 1YI8A 5BQ5A 1IDOA 4HVLA 1MRSA 2ZI7A 1NR7A 4C88A 2XCTB 3AHDA 3LHDA 5ALYA 1NFRA 3C15C 1I9GA 5EE0A 1Y5IA 3O2SB 5HKAA 1LTKA 4EYSA 1I7PA 3WWOA 1FVXA 1KMMA 3L18A 1E32A 2QX9A 2QX6A 2JFPA 3GLGB 4EEZA 1PGOA 2JBAA 4ZYZA 2QZPA 4IBOA 2ZI9A 3OE7D 5JS1A 1WKBA 1M6YA 5H3CA 2IYZA 4E11A 3JQBC 3NM5A 4EARA 1PZHA 1EP1B 3O93A 1WXIA 5AKXA 1QHHA 1YH3A 2Z04A 4OSEA 1U0NA 2ZS8A 4BO4A 3D7KA 3K30A 2G72A 1OAOC 3KP1A 3TVTA 1Q44A 4JEHA 1J21A 2HJWA 1U3UA 2CT8A 1ITZA 4MS4A 3ICQB 1A5ZA 3HM2A 2JZCA 1WXQA 3RIXA 3QLUC 2OGTA 4OB7A 1JILA 5HBGA 2I9KA 4WCVA 3NFYA 5TQJA 1YMVA 1X1QA 1UQUA 3WGZA 4GZ6A 3R5FA 4PAWA 1TAUA 4Q4DA 3QPUA 4QQNA 4JI2B 1E2EA 3L7AA 1GNRA 2B34A 1R4NB 1FTQA 2I71A 2XPCA 3GFGA 2XT9A 4Z51A 5KPJA 2UYHA 2BUBA 4DCVA 3THWB 3CF6R 3HUUA 4JXJA 4DJJA 1C41A 3OZXA 3OZWA 3B1VA 3PWTA 3BXXA 4I4TB 1TKCA 5DHTA 4XDYA 1T5DX 4CXMA 4HUTA 4ZT7A 2PSDA 4G9GA 3AOEA 3QOYA 3ELBA 3JD1A 1HDCA 1G6KA 1JBKA 2OVFA 1O77A 1SVIA 3QX7A 4IDQA 3BH0A 4MRNA 1CIVA 2QMHA 3GC6A 2AR7A 3URKA 2ZLBA 1DHTA 2CXPA 1JQAA 1MPTA 1WUKS 1YB2A 2K4MA 2PXAA 1PUJA 3MXOA 4GYJA 4UTZA 5LWQA 2QOEA 2A88A 4J0DA 4RL4A 3VU9B 4ZMBA 5BSWA 3RODA 2HCJB 5FJJA 4YQFA 3T35A 1Y9EA 3CRZA 4KPGA 3GELA 1MB4A 1T0UA 1R9JA 1DKQA 1W52X 5T6MA 3Q3HA 4JT4A 1TJ3A 2HXGA 1L8QA 1ZCJA 3NWPA 3NBQA 5DGXA 5LLDA 1F4LA 4BWGA 1A27A 3HQ4O 4GYYA 3CNQS 2CB0A 2HQOA 4KQXA 3GIDA 4CUKA 4EJSC 4DG5A 5EZSA 2YX1A 3KYIB 3Q9LA 1YZLA 2EIHA 3DDUA 1YJAA 1N8TA 1BNCA 1O4VA 1YS6A 4NU0A 3DLPX 3CLUD 1ATZA 1GA4A 1SUIA 1DO8A 4R3WA 4EJMA 2QK4A 4DMFA 4US2R 4LRSB 1BD4A 4QATA 4C30A 4D0RA 4ES6A 2QU7A 1Y1LA 2NZ2A 3RHSA 4D9HA 4K5QA 3OFJA 1BXGA 1ORWA 1DVRA 1V7PC 5EQJB 4J1NA 2OFWA 4KE7A 4WI1A 2W2PA 1UJ4A 4EUFA 4PYRA 5FLEX 1N1GA 3GRPA 4MA0A 1H5UA 3ZWOA 3MUEA 1VE9A 2RHCA 4YFYA 3IAUA 3CLVA 3CZ5A 4K9NA 3T1OA 5B7GA 4DDVA 1BW9B 4E2YA 1FFYA 1M34B 1UOQA 3Q40A 3E9MA 4LC0A 4OH1A 2VNIA 1Q1GA 4PXSA 4KGZA 5T67A 2CL6X 4GBGA 4CKCA 4ZMSA 3NEJA 4ZVTA 5CA1A 4MYTA 3L8EA 2YY6A 2ZYTX 4JLKA 2CNOA 2HMAA 2FH5B 2PUTA 1H9BA 3Q12A 4I50A 4MUMA 4MYSA 4CKBB 4RVHA 3VBEA 5C46F 1L5RA 2IK8A 3FNHA 1CHDA 3P9XA 3AVUA 2IHNA 3EXG1 4A8TA 1ULZA 1CQJA 1YL7A 3G5TA 3RAEC 1AS3A 1Z5PA 3FYUB 5KQLA 4Q66C 3QWAA 4RCYA 5CJ2A 1QR6A 1SXJB 1GGVA 1FTNA 4LGVA 4R2HA 5CTAA 1ZGJA 1JKJA 2FETA 1UMCA 4DY6A 3ONFA 2NVBA 2REOA 3ZI7A 4MZDA 3LFTA 1QC5B 2D06A 1E3DA 2O2IA 4ZOLF 3RFXA 5JTUA 3LIIA 1NJFA 1QKKA 2HPVA 5EMJA 3NOXA 4GOMD 1D6NA 1ETHA 1LFAA 1FC0A 1M8GA 2JFVA 3G1UA 1E3IA 2NWQA 1U9IC 3LY7A