2QQGA

Hst2 bound to adp-hpd, acetyllated histone h4 and nicotinamide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
291
Chain Sequence
MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nicotinamide inhibition and base exchange in sir2 enzymes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase HST2
total genus 96
structure length 291
sequence length 296
ec nomenclature ec 3.5.1.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2qqgA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2qqgA01
4K9OA 1J8FA 2H2DA 4JSRA 4JUBA 4QELA 2H4HA 4TWIA 4BVGA 1V5EA 1OVMA 1UPCA 3F6BX 3HWWA 3CLSD 5K6TA 2VK1A 4UTVA 3EY9A 1M2GA 4I5IA 3RIYA 5BWOA 1PVDA 4FEEA 2IHUA 2FR8C 4UUBA 2JI7A 2PANA 2VBFA 3FZNA 4GPEA 4K9PA 2Q5LA 3EYAA 5EJMA 2Q5OA 4BVEA 4RJKA 4RJIA 3GLRA 3IAFA 4UTRA 3EA4A 4V1CI 1HZZC 4TWJA 1V5GA 4Y6OA 4J1TC 2PGOA 4QQ8A 1M2JA 4IF6A 2EZTA 1PNOA 5EJAA 2UZ1B 1YC2A 1M2HA 2QQFA 4V1CB 2QQGA 1QPBA 2JI8A 2Q5JA 4K9NA 5MFZA 4K9LA 1POXA 1Z8NA 4BN5A 2AG1A 3OE1A 2B4YA 3ZGVA 3CLRD 3RIGA 4MPRA 2FRDC 3F6EX 5EJ9A 1PO7A 4MPPA 4Y6QA 4GM4A 4K9MA 2H59A 1T9BA 3FLMA 3U31A 2FWNA 1BFDA 3GLTA 2VBGA 4FEGA 2X7JA 4QPZA 4RJJA 3ZG6A 4BN4A 1UPBA 2W93A 2H4FA 2OORC 2V3WA 4RMHA 4Y6LA 1PNQA 4GM0A 4UTZA 3E9YA 4MPJA 4O8ZA 2JI6A 5DGDA 5FYQA 4D5EA 2OO5C 5K3SA 1T9CA 4X3OA 1SZCA 4R8MA 1XLTC 2OD7A 5BWLA 2NXWA 2Q5QA 2H4JA 4K9QA 4D5GA 2VBIA 3K35A 5EJ7A 4G1CA 2WVHA 2OD2A 5K6RA 1JSCA 3PDHA 2A1TR 1S5PA 4JD5A 3IAEA 1M2NA 1ZPDA 1E3TA 4GG1A 1Q1AA 4BUZA 1U28C 3PKIA 4JT9A 3PKJA 1YHYA 3CLTD 5EJ4A 4V1CA 5MFPA 1MA3A 4UU8A 4ZZIA 1YI0A 2UZ1A 4IG9A 4J16C 3D7KA 4JUFA 4JUCA 1PYDA 2IHVA 4JT8A 1YHZA 2Q28A 2Q29A 2WVAA 2HJHA 5MF6A 1OZFA 4K9KA 1YC5A 1Y9DA 3D4BA 1U31A 2BRUC 1T9AA 3U3DA 4JUDX 1SZDA 3JWPA 1D4OA 1YTLA 1OZHA 1Q6ZA 5AHKA 2NYRA 1N0HA 2H2GA 4JUAA 5EJ8A 5D7NA 2IHTA 4JU9A 2FSVC 2DJIA 4BV2A 1UPAA 2FN3A 4UU7A 4BVFA 5DEIA 4COKA 4KPUA 2JLCA 1Q14A 4ZP1A 4C78A 2A1UA 1O97D 1OZGA 2JIBA 4MZXA 1EFVA 4RMGA 1NM5C 2EZ8A 1Q17A 4KGDA 2EZ9A 2VK8A 4MQ5A 2EZ4A 3FSJX 5K2OA 1V5FA 3GLSA 4FVTA 4UTXA 2H2IA 1PI3A 1S7GA 2JI9A 1YBHA 2VJYA 3D81A 1DJLA 1EFPA 1T9DA 4BVHA 4C7BA 5FEMA 2VK4A 4BV3A 4Q9DA 4HDAA 4JU8A 4HD8A 1ICIA 4KXQA 5MGNA 3HWX1 2H2FA 1YNOA 1PT9A 1U2GC 3LQ1A 4L3OA 3ZGOA 2WVGA 1PTJC 4IAOA 1MCZA 1O96B 2C31A 2EZUA 5IMSA 2OD9A 4X3PA 3CLUD 4F4UA 4FZ3A 4F56A 5EJ6A 4RMJA 1U2DC 4L2IA 5EJ5A 2Q27A 3CF4G 1M2KA 2JLAA 4UTNA 1YI1A 5DGTA 2AG0A 3JR3A 5BWNA 1POWA 2PGNA 4RMIA 4BVBA 4GP9A 3GLUA 4UUAA 4GM1A 2H2HA
chains in the Genus database with same CATH superfamily
1Q7BA 3KPUA 1UBNA 2FUNB 2O2EA 2ACKA 4MGHA 3UB3A 1QE5A 4JASB 5SV2A 1J56A 3CNOA 3RU7A 2WWRA 5F2KA 1QX3A 3CZQA 2FZ5A 4LDZA 4P4LA 3TRIA 1SBYA 2R48A 1K3TA 4I9HA 4PANA 4B3IA 2JLZA 4NAVA 3ZE1B 4BNWA 4EFMA 4QOFA 4CMBA 1NYQA 4LKRA 3P2MA 3VYWA 5BMVB 3CINA 5JCZA 2EW1A 5HIAA 1N1DA 1XP8A 1YZLA 3HVUA 4R1SA 4LJ9A 3DE1X 4L6CA 2OCKA 3SSOA 1N6LA 3I4LA 4I3HA 4CKWA 1M6YA 1Q16A 4YRMA 3R09A 1OH5A 1LSJA 3ANMA 4WZ6A 3GUYA 4QREA 2YXBA 3OHMA 3INNA 2BP7B 1NVWQ 1PF7E 2E7ZA 1LBSA 2QRMA 3BMQA 1R4NA 1UC8A 2C95A 2QRJA 2VFAA 1E9CA 2Y6UA 3C5WP 4QYTA 2FRVA 3TNJA 3T4UA 3T41A 2TMYA 3BH6A 1V7PC 4QDTA 2ENWA 1N2SA 1WUTA 3DVSX 1DU4A 2VHTA 1YI8A 2P4SA 3FNGA 4OKNA 3RIMA 4RZSA 2E82A 2F90A 1FDVA 1R6DA 2HMUA 5A71A 3CN7A 3DOUA 4J75A 4RD1A 5FX2A 5HM8A 1BFKA 2HJVA 2ID4A 3RWMB 3TOXA 4XJSA 1XHEA 1P4HA 1TADA 2IE0A 3TRHA 5DX0A 1I6LA 4IW3B 3V4VB 4AO7A 4B35A 2PT6A 2P9HA 5ER9A 2OO5A 3S99A 3VPBA 3IE2A 1V48A 2FWJA 3ICWA 4CBVA 3RUFA 3LUPA 1JFVA 3KOMA 3DW3X 4AM8A 1YHZA 4ZO7A 5FR1A 1NRIA 1BAPA 5HFAA 1KTVA 3AZQA 4TLCA 5CJJA 2FVXA 1FDTA 1E99A 2O2DA 2QGFA 2FFBA 3GLHA 3QOXA 4ZEOA 4AMZA 4R9SA 2ZSHA 3EXFA 5D3QA 4IOJA 3UW3A 2V0CA 3KV1A 4DSUA 1QZXA 1WQ1R 2LP4Y 1EP1B 2ZKLA 2B2NA 2YWBA 3SQMA 4OVKA 1C8KA 1UKBA 1PZNA 4HL6A 2DGDA 1OSNA 3KS9A 3MMSA 3OUTA 3EIUA 4GMFA 4G5XA 5EUBA 3RYCB 4P83A 4AN1A 1ZCBA 3IDAA 4IDNA 1QG0A 3BJIC 3BWVA 4R68A 3ZWQA 3FDJA 2VOEA 4ZK6A 1VMIA 5H02A 4GBGA 2ZIZA 4F7WA 1F2VA 2BM1A 3B85A 3PXDA 4MI3A 3KT3A 4ARBA 1WB6A 2ZG6A 3H1GA 2Z4SA 2YOFA 3LHFA 1SPBS 4B0PA 3Q41A 5G0UA 4CCWA 5E4TA 2VR1A 3ADCA 3U60B 1ESZA 3AVXA 3OJ0A 3GFSA 4M0DA 1JEDA 2Z83A 3N8GA 5HCIA 4AG6A 1A7AA 3QUCA 2VJDA 5D5QA 4BFUA 3ASVA 4ALIA 1RWPA 3OBIA 3N58A 4A03A 3ER6A 1AD2A 5FWYB 5ELLA 3N2ZB 1GAQA 1UBHS 3D6TB 3LLMA 2YS6A 3I5UA 3QW2A 2PH7A 1Z0AA 4LCEA 4UVIA 1SPXA 4KR9A 2QVGA 4LX8A 2D1TA 4WK4B 3T1TA 3E4CA 3LYLA 4JZKA 2Q3CA 4DV5B 4X54A 1P2SA 3MFYA 5TMEA 5E3HA 1H05A 1LU9A 2DWOA 4XGRA 5IKMA 5IJZA 4V2UA 3MRSA 2ZRGA 1EK1A 3H0KA 1VSVA 1N5MA 2GFIA 2WJ3A 1X8KA 4XR4A 3RIYA 3FWZA 3DYBA 4CMIA 3E6AA 4ERNA 1K5PA 3D54D 3SZGA 5FJJA 1MC1A 4UW9A 1DG1G 1E32A 1FDIA 5CJPA 1V4NA 1BH6A 1KDYA 3QA9A 2BHSA 3OI7A 2GCPA 3HDJA 2FMKA 5FPYA 5BQOA 3SC3A 3UH1A 4BNNA 4MHTA 4GYYA 4R2JA 1E7YA 1B8VA 3U4HA 3U61B 1K5HA 4C7JA 2ZZNA 3DP9A 4IQ8A 5KDDA 2Y68A 4PWZA 3OY2A 1FLNA 3P9QA 3P9XA 4I0WB 4HNAB 4F2DA 1WHTB 3Q1KA 1ODCA 4X60A 2ZJFA 1MFPA 2I6SA 3KZXA 3MCVA 4II2A 3BQNB 2XB2A 2J45A 4RJJA 1EUCB 4NMMA 2D7CA 3C15C 3QP9A 2WAMA 4EPYA 3B2QA 3G88A 3OCXA 4ITRC 5T6MA 3WNQA 4RMHA 4OB8A 4J7XA 5CB0A 3VI4B 1IQ0A 3E5RA 1BX0A 3UOWA 5IJ0A 1BMTA 3GGJA 3NIFB 4HDKB 3SX2A 3FTFA 1UOQA 2XODA 2FZVA 5LMUB 2CUZA 3LT0A 5L3ZA 2X3FA 3I23A 4FPXA 1RRFA 3T0FA 3AUUA 5BSKA 3BDAA 3HHPA 2YFHA 2OAEA 3IEKA 1I8TA 4RHUA 2XZOA 3MIIA 1XO1A 1LVHA 4WH0A 4R7TA 1ILWA 1NAHA 4WZBE 2ZJAA 3CZ9A 4P0TA 1Z4IA 5DHUA 5TIIA 4M55A 3DBRB 4KX3A 4L0CA 3VSAA 2YZMA 4LHZA 2XT0A 3UENA 3ESAA 1YZ3A 3RK1A 2YIVX 4DOMA 4ITUA 3PU6A 2ZBDA 3MA0A 4DYHA 4WLNA 1R2QA 4QRDA 1XDGA 3SE0A 3UCXA 3AERB 3RABA 3VX4A 2VHEA 3BJZA 2DBQA 2BGKA 1XZEA 2IITA 3V7FA 2AJDA 4MK4A 3W3AH 5JQGB 3ZY2A 4CV2A 4HVLA 3T5TA 4KXVA 2VHYA 4O4JF 2Y2VA 1J2RA 4E09A 2JCGA 4HBZA 4Q02A 4ALNA 4CHGA 2EATA 1BNCA 5I7SA 4JLUA 3L7BA 4ZJYA 4WVFA 3G2QA 4BFZA 4COOA 4ETWA 4MMXB 3HM9A 3LE8A 2QGZA 3T1OA 2DFNA 2R6HA 2M6SA 4NICA 1VKRA 3JAKA 4KQ1A 4EB3A 4ZZ2A 1SCIA 1ZRHA 4UATA 2YZ2A 2GCGA 1LDYA 2GZMA 2JAUA 4XYEA 2QL5A 5A7HA 4R16A 1N0VC 3HFGA 4PSVA 5TQJA 2I4LA 4PSAA 3KAQA 3L49A 4P7JA 1MRZA 4ODIA 3NHZA 3DCNA 2R751 3H65A 4RVOA 4CMCA 1KDRA 3UCEA 1LK0A 3AVUA 1V7QA 1KMMA 3DM5A 3LLSA 4CCSA 2QN6A 3G9ZA 3Q2KA 1BHSA 3ORFA 4EB6A 4TPKA 4EJSB 2ZGVA 4F4IA 2B3DA 4AAYA 4KOAA 1PJZA 2XQJA 1GY8A 4DQUA 1FRFS 2C0CA 2H1CA 2YJ6A 3BQMB 3EGOA 3PR3A 3N70A 5FORA 4INZA 4MW9A 3QPWA 4UAUA 4Y6RA 5DK4A 4GR4A 2OFFA 1AS0A 4HQLA 2V7TA 3OZIA 4MGYR 5C51B 1I36A 2J5RA 1ZJJA 4UBKA 3FZQA 3GRYA 4PINA 5GIPE 4LNUB 4MVYA 1WPXA 2HJSA 2OGTA 4GP9A 3ZVLA 4RPIA 3S2UA 2PS1A 4O2AA 1KFKB 1D2RA 4HVTA 5KJCA 2FSFA 3FNFA 4QJ3A 2R6ZA 5DNDA 5GWXA 2H7VA 1Z3IX 1NYTA 4UNIA 4DM7A 5HKAA 1V9CA 4GKKB 4QGAA 2ZXFA 2YINC 4NOLA 3BWDD 3EFBA 4G01B 5JS7A 4J7UA 1SG6A 2XUDA 4EVSA 3G9UA 1ZRNA 3OZFA 3JAWB 4F3RA 2LVBA 4B3TB 3LBHA 3DAYA 2P9FA 4PYNA 3L92A 3ROGA 3ZWCA 3FVTA 1L8AA 2WTEA 5EJFA 2VP2A 1Z18A 4KDCA 3TVTA 1EUDA 1Q3TA 1QJCA 1V43A 2BGTA 2V65A 2XMBA 1KI1A 2HU2A 2Z08A 3GZNA 3LOQA 4MJXA 1EUYA 1MAUA 1JI3A 2Q9CA 1ZW1A 1BE6A 2IK8A 5EEHA 2FHPA 4MPPA 4B3MB 4UHHA 1TVEA 1DBQA 1XVAA 2RGWA 4QRHA 3ROMA 4BNKA 1R0SA 4KO3S 1P75A 1I33A 1RJ9B 4NFLA 5EPOA 1RI5A 3MCUA 4NFYA 1DAOA 1BW9A 3MQFA 4IFBA 3E3MA 5DGDA 4JI4B 2N1MA 3GUHA 3HJUA 1WTAA 4IUBS 4WSOA 4HLCA 2O7RA 1ZGCA 1EVJA 2F3QA 2R7LA 2C7OA 1BE1A 2RGNA 3C1UA 1KI6A 2PSFA 3HV2A 2Z6UA 2RCNA 3HL4A 5I7AA 4GBMA 4UUMA 4W9RA 5CLGA 1JHUA 4LXIA 3EQ7A 4QXMA 1V9SA 3DEJA 2I34A 4YALA 2VJOA 4YGYA 2HGZA 4W5QA 4HQFA 1BH2A 1XQ9A 2HWWA 3CR8A 1ZSVA 4EKEA 5EJEA 4JGIA 3WKDA 2WW8A 3PXAA 1YI0A 1W76A 4AP5A 4PQYA 2Z5LA 5ITVA 1M2OB 1IDN1 4MULA 1L5LA 2QORA 1UDAA 1KO4A 1R0RE 1U8UA 3F8TA 3N2GB 5KYWA 2XQVA 1QMPA 1YS2X 2X0FA 4DPKA 5H80A 2X3YA 5EIHA 2HSZA 4G09A 4K28A 3RRFA 1W5BA 4KQKA 5CHEA 4GMDA 5AT1A 4E88A 4OLBA 5AUQA 4EEZA 4GICA 1TJ3A 1CZLA 3KL2A 4H18A 4LJ7A 4YUAA 3KAJA 3HA5A 5AESA 2XE6A 3N7UA 2V55B 1EFVA 4HTFB 4YAUA 4YR9A 3FMVA 3TYXA 3HJAA 3RRBA 4M7PA 2LBPA 1P7YA 2PWPA 3UNXA 1C81A 1NVUQ 2YJTD 4N03A 2JLBA 3IOMA 3K9GA 4F2HA 3RWBA 1Y5MA 1XTPA 3DXFA 4IVPA 4M54A 2X2FA 4P08A 1O6CA 1O96A 5JASA 5JQGA 1D5CA 1FFGA 3OPVA 3PL1A 4TWRA 4CF6A 5FEMA 4D3YA 4KACA 1U3FA 1SOVA 2XITA 4RTLA 2BTQB 2ZVJA 5HJEA 4E5VA 5JD4A 2DP4E 4HWGA 4RS4A 1YO6A 5ES4B 3PITA 4M36A 4XYMA 1SURA 5CDYA 1VL2A 3HWRA 1T3ZA 2IYWA 2INGX 4TSFA 4WWHA 3OURA 1ZXBA 1EFRD 4QQFA 1ZVJA 2RI6A 1C1XA 4MS3A 3VU3A 1II0A 1GCIA 4FFPA 3CRVA 4F4UA 4U63A 4M83A 1X7DA 2VP0A 3CNQS 3C3KA 3IV9A 4L2IA 1VHJA 4QYIB 3D02A 4XUEA 1G9TA 3A9SA 4MUFA 1SKMA 3ZGNA 2VTBA 3QKRB 1SB8A 5G1OA 3OQIB 1DBVO 3E22B 3URMA 1XAIA 4M7OA 2C1EA 3TEJA 2B1RA 3DBVO 3O03A 2ZJ6A 3FFAA 4FCVA 4OJKA 3KJIA 2J46A 1ZK2A 1DAEA 2FB9A 3NT5A 3IAS6 4C0LA 4L4ZA 3T3DA 4CI9A 1X3LA 3GZTB 1GZ6A 4C0BA 2MU1A 5I7VA 2DMRA 2IBMA 4R9RA 4FM9A 2W11A 5E8JA 3VHXB 3WLAA 1RQLA 2O6LA 2UXDB 3P2KA 4N3NA 3TQIA 2BFMA 3E1KA 1U8FO 2G88A 3HS3A 1WXQA 2Q2WA 1WMSA 1ULTA 2R6JA 2X0JA 3A06A 4ETIA 1SXPA 1L8LA 2YVKA 2XQFA 3C5VA 4E1BA 4B2PA 2GRAA 1E94E 1DT3A 4KK3A 2FUG1 1SOAA 3ECSA 1W1WA 3C5EA 1G6KA 3EZ9A 2PQMA 2O8FA 4C5AA 1K4YA 1ACMA 2QRHA 3NANA 4ZQEA 5DTIA 5DW0A 5AK0A 4IH9A 2J3JA 3MT9A 3OLCX 3IXQA 1D2MA 1E1CA 1XDWA 2BMVA 1M75A 2UU9B 2GVDC 1JG6A 4GZ3A 2MDTA 2YNMC 2EBWA 5K3FB 3VRHA 2CKMA 3PNLA 4HT3B 1WXDA 2X41A 2YN4A 1CRQA 3TQQA 3V1MA 2AN5A 3AY0A 1TVMA 1GWNA 4QEZA 1DQYA 1ULSA 3OU7A 2E55A 3U0VA 2GF0A 2QGNA 2OENG 1XVLA 2W2LD 1Y34E 4B71A 1A5SB 5KNDA 1MO2A 4ZICA 4TLEA 3DEIA 4PLCA 1H66A 4LE0A 4NEHB 5AI6A 5A5VA 5IPFA 4EFDA 4LBYA 1OB2A 1AA6A 1T1IA 2BUAA 3KEMA 5LDGA 1AKRA 4FOPA 4RD4A 4CG0A 3OT5A 4QARA 1QYXA 1YE8A 1YS1X 3NAMA 4HDRB 2OYCA 2P35A 3TCKA 4YRRA 3NI2A 2D54A 4MRAA 4XB2A 3HVIA 2Y67A 2P3SA 2PD3A 4O4LF 5KCZA 1B4DA 2R6R1 2AGVA 2ZXEA 1I7SB 1CULC 1Z45A 1JQDA 1Z6QA 2BCGY 2YWRA 2PHZA 1R6TA 1L7RA 2CY0A 2C96A 4OFWA 1OXMA 1TM5E 4LJAA 3G23A 1GL9B 6PFKA 4I55F 1U63A 3WGVA 4PY2A 1I2CA 3OQOA 3VV2A 1PKEA 1LPBB 1PR1A 1YJQA 3T7TA 4U6QA 4XA8A 4XJXA 1YHNA 2IYAA 1YZUA 3LDGA 4OAPA 5BW5A 2VAPA 9MHTA 1VL1A 4WFQA 2CFOA 1E1YA 3EZ6A 4PLHA 4JJ4A 2QPTA 1RXSA 2VSYA 3VOBA 4ZODA 4U2FA 1HE3A 2FQQA 1AA9A 3BN3A 3HA7A 5EHNA 1YR6A 4NHOA 1NVKA 2DBZA 2HREA 1EYZA 2EYQA 1RYDA 1TUBB 1PZGA 4FMCB 5CITA 2XOKA 1R0KA 5EESA 1P7WA 2BFDA 4O59O 3LLVA 3T3HA 4O63O 2XQIA 4CTKA 1XMSA 2NSDA 4WJKB 5T4EA 4M87A 2HHHB 2WTMA 3K0HA 4I55B 3IELA 3DC2A 3GJ0A 2O2YA 4RPGA 5TV2A 5EQDA 2HIMA 3AR3A 2AT1A 2ZCJA 2XZPA 5H9VA 2OXIA 5TPWB 5EJIA 2PRSA 3L5KA 2ZTHA 4IJ5A 4YXWD 4OHBA 1I4EB 3N2LA 4H0CA 2JEZA 4ZVKA 3ZDCA 1E60A 1THTA 3SHOA 4WUTA 4Q9IA 1A2BA 1GSIA 2DFVA 3VBEA 4BLVA 3FZNA 3EOAI 3WGHA 2G9NA 1A9XA 1M2WA 2RGNC 2RAUA 4BX8A 3ADOA 4HLNA 3F9IA 5EZSA 2NUAB 3AL2A 4EW6A 5J47A 3TTXA 1SUIA 2O05A 1UC9A 3OG9A 1V2HE 2QN8A 1XL1A 3B51X 4HAOA 3SF0A 2RHCA 4C4XA 3K2IA 4WKBA 1NPYA 4IDHA 4BRWA 2ZJ3A 5KTOA 1JUDA 2I54A 1TO6A 2ORVA 2Y9MB 1DC6A 3DDUA 3CVYA 4MOWA 4FEGA 1HC7A 5TJ9A 1KXJA 1B0PA 3O3MB 3LVRE 3EPPA 4I1OA 3TL3A 4CEIA 4Z7NB 1TVKA 3V4SA 1D8TA 1N2GA 1Y8AA 1TLLA 1GILA 1SN7A 2XUJA 2ZQYA 3WMWA 4FCWA 4W7SA 5B2EA 4CQMA 3TOCA 2XJ9A 3T9FA 1S2NA 2VJLA 3Q72A 4XE5A 2WPNA 4N5NA 1FYWA 3SVLA 3PFKA 3KKLA 5DOVA 4D5GA 3KQSA 5JI2E 3KKKA 1FRVA 1CUXA 3IALA 2A67A 2NVWA 2GK6A 4FFRA 2CXUA 3A4VA 1SRRA 1BXKA 1Z4JA 3M6WA 4GX2A 2PMCA 5H1YA 2DHDA 3WJ7A 4B1FA 3JAMA 3FYUA 1VPWA 1JHVA 2C9CA 3FUCA 1GR0A 2V6GA 3IDZA 3WFIA 2ZPAA 5JS1A 2OHGA 3HFJA 4PS1A 3AV0B 4V0NA 3DPSA 4I36A 4KPYA 5FPTA 2BC9A 4R8VA 2JLXA 5B1HA 2PH1A 3FPBA 4TS3A 2IHVA 3LPMA 5FLYA 4XUDA 1E2NA 1WX1A 2R97A 5L3SB 1NKVA 5IRCD 2CL0X 3PK0A 1ZO8A 1TYCA 2ZPTX 1NBWB 1OZHA 5DOZA 3UF0A 1WZEA 5BN3A 1P31A 2A0FA 2R1VB 5ALOA 1B0AA 2HTEA 1MR3F 5IT4A 1W0KD 1XWWA 3DEZA 5HTKA 5HJ5A 3M6IA 2OQ2A 4ZXFA 4A10A 4RMGA 3R6WA 4PFSA 3B6EA 1MB4A 1G7CA 1HDYA 2C78A 2RBEA 2ZQ5A 3LQ4A 2QPOA 4OI4A 2J6BA 4DMCA 4XI9A 2C20A 5DTQA 3LWZA 4DIEA 1L4LA 1VPEA 5L6MB 2VJYA 1ZIOA 1JYFA 3GY0A 4KW7A 4OQZA 4WA8A 4PZAA 1ZESA 2ZJ7A 3A9TA 4EMBA 2B7BA 3JCZA 3IPXA 1JWLA 2RGAA 3I2JA 2QAGC 3IO5A 4JC4A 4XLTA 5EOVA 1VFNA 3AJ9A 1ZUNA 4BYGA 5EIEA 1KKUA 5JCPA 3H5VA 1K2VN 3THWA 4ZV4A 1U6KA 2H57A 4KO2S 1HT0A 2Q3EA 1CHNA 4LIPD 5G0TA 3KQKA 3MWYW 3M33A 2M98A 3K6SB 3EC7A 1X1AA 1D4AA 3FTDA 1AN0A 4Q93A 3ZI7A 4OBEA 1CS0B 3ZE2B 3PLAE 3UPTA 3AY7A 1E2PA 1VSBA 1UJ4A 1FUUA 3TLMA 5J1SB 1OB5A 3PBKA 3W9UA 1NNI1 2JJ2D 4WT7A 4RJ2A 3UJCA 4GKAA 9ABPA 3SEQA 1M0SA 4G0MA 2NU9A 2FFRA 4RHYA 2EL7A 2Z9BA 4X3CA 3NHBA 1GEEA 3F3KA 1G5PA 1PG2A 3GYBA 3DD1A 2XW6A 2I1QA 4DV2B 4HDRA 1ORHA 1PQPA 2B34A 4RV5A 3OVMA 4XVQA 2CVFA 4LWQA 1HMPA 2PVSA 2J09A 4KAAA 4EKIA 1EPUA 1U0FA 2C4MA 1WMEA 3EGIA 2A30A 3R23A 1V16A 4MQBA 3GUZA 2DWQA 3EVAA 3L7AA 3GDWA 3WLHA 1L7DA 4C6TB 2QUKA 1LUAA 1U7OA 1Z15A 3LXXA 2QN7A 1ELOA 4NCNA 4G2TA 4CKXA 1H22A 2JIDA 3GNTA 1A4RA 1UWKA 5K3FA 5IEBA 1PS0A 2NVUA 2FZWA 4MQMA 3KRTA 5CHYA 1SA0A 1UKEA 5DHSA 2DUUA 1UAAA 5CLQA 2WICA 3HFSA 1TTPB 3BC1A 2P62A 1CBUA 4G0YA 4BNGA 4TTQA 4EMUA 3GDGA 2HNKA 3U48A 5CYGA 4G8CA 3V5NA 4FZJA 4CFZA 2IHZA 1Z6TA 3IAEA 2DY0A 1AZWA 2UAGA 2W6CX 1YWGO 3AVQA 3IQDB 5E9QA 3TMKA 2MYTA 4JH0A 2PFGA 3U1BA 5A6SB 4DFDA 3BWYA 2CEAA 5HMMA 4KREA 3JS5A 3P71T 4KG7A 3PJEA 2P6UA 3GMIA 3E70C 3BRWA 2OBXA 5CDHA 3AL0C 2ZAOA 4IG9A 3EH2A 4KR0A 1Z26A 4RK6A 4CIAA 1C9KA 1P5ZB 3EGDB 2QZSA 5EINA 3ROZA 1FYFA 3CJRA 1YE3A 2XOKD 3HA3A 4QSMA 1M67A 1H94A 2CVHA 4U7DA 2WWYA 3T5PA 3PDWA 3G2KA 2HWKA 5F1PA 1OFTA 4YC7A 2ORYA 3GMTA 1ZITA 5D7NA 1E7RA 1U1CA 2PWYA 2DJIA 3H9EO 1QH8B 1UKYA 3OT1B 2BZSA 4S1PA 1UDBA 1EVQA 5ILQA 1M74A 4P7GA 4ZOAA 4FHGA 4YAGA 5JY1A 2FK7A 1ZD2P 3FX2A 5KQRA 4M9QA 1OV4A 4QYIA 4CEJB 3PHBE 1Q7EA 4ID3A 2Z8YA 4ZOQI 4CTNA 2WQ7A 4OAOA 1QCDA 2I67A 7GPBA 1MN6A 4KQHA 1W0JA 3N7AA 4G6ZA 3OLXA 5F5XA 1UXJA 1X6VA 2JAOA 3GW8A 5P21A 3V4PB 2D13A 4BCBA 5LOVA 3HB1A 3QOYA 4JBLA 1KDPA 2GX6A 3G13A 3V3TA 2BTQA 2PZMA 2VXCA 4W5NA 4BE4A 1VGRA 1MIOB 1JPVA 2PBLA 1O96B 1XX6A 2IY7A 1LFAA 3ET4A 1EDEA 2OD9A 1FNBA 2NN3C 2P9GA 4ZOLB 1WKCA 1EX7A 2BMEA 3G02A 5LZ8A 3U80A 1WZ2A 1KAGA 1EBUA 3TXXA 4CUZA 4OMDA 5HUJA 4OLAA 2VYVD 3PFIA 2UZ0A 2XECA 1T43A 3TR6A 4RXUA 1P62B 2JAPA 1EJ6A 4OSOA 4I14A 5AQEA 4XOUA 3DT8A 1E1QA 1UM9B 4LS3A 3W8RA 1UBFA 4EBBA 1K86A 3D3EA 3T94A 1MVOA 3UQZA 2X5OA 4N3BA 1ESMA 2CB0A 1KBQA 4LF7B 4O2AF 3VKWA 3AYZB 4C7OB 2JK1A 5EJMA 4MTLA 3P0FA 1DINA 3WLTA 1KC3A 1NJ1A 2OFOA 2Q4RA 3N2GA 1TYEB 4GPTA 4B6EA 5KYWB 4JVNA 1W34A 3FB4A 3U7HB 2HQOA 1T3TA 3ZQJA 5IJ9B 3HYTA 1PK8A 1RQNA 2OZEA 1B1CA 3L02A 3WK6A 3OTGA 4S2EA 1ZH2A 1MJNA 3E23A 3OLWA 3QX7A 2OHVA 1AQYA 1IYZA 4G1EB 1KAHA 2ZXUA 2VPIA 1Y9ZA 2HA7A 3GJ3A 4EB8A 2EX1A 3PRKE 3QLVC 2VF4X 3H5IA 4FDVA 4AO8A 3T5CA 1T26A 2FPOA 3NWPA 5CX4A 3WJAA 4MVXA 3GIWA 2H51A 3MELA 4UD6A 3WIVA 5EMKA 3WLLA 3CJTA 2G5GX 5T4FA 1MLDA 2Y1XA 4GSYA 4X92A 3UAVA 1E2IA 1RCUA 4CL8A 2PVPA 3F7MA 1P0IA 2D4HA 1A8PA 4MRMA 4AJLA 1SXJC 2IKSA 2IZ5A 3BCUA 1C4OA 2CNLA 4RK7A 3QFRA 3ANXA 4MR7A 3RO7A 1CY4A 2ZIWB 3OQNA 3GD7A 3MCTA 3SIRA 5B3KA 3FUVA 5I7RA 2C2HA 4LDAA 3W7BA 2F4NA 2RJNA 1E20A 1OYWA 4JI5B 4CYMA 4M0CA 3PKIA 5CW2A 2XCSB 3K1AA 4CJXA 3EXHC 3KEGA 3RRMA 1MORA 2BV3A 4BQRA 5JDIC 3IB3A 4HWKA 5LMCA 4RDCA 2AI3A 2C2YA 3L7OA 5IJ9A 4MUBA 1QHFA 1IM2A 2F2TA 2FLVA 5IZ4A 2H29A 2HA2A 3LVQE 1OMOA 1JWAB 4GI5A 4RVFA 1EFHA 4ZI2A 2BF7A 1CUEA 1Z39A 2QF7A 5KX5A 3G0IA 5TRTA 2CC2A 4JU9A 3MJVA 1UDCA 2I6GA 2I3GA 4I4TF 4KKXB 1TCCA 4CDRA 4CKCB 2GRJA 3TEMA 4MUIA 4MZXA 1VIYA 4Q4AA 4YRFA 5FHRA 3U17A 3I37X 5PGMA 5EWJB 2PZEA 3P2JA 1SBHA 2C1XA 2G1KA 3DKIA 3VSCA 1ANKA 3RQIA 5IU6A 4Q7LA 3VKGA 2VVTA 3E9NA 5DE3A 3GLIB 1FVOA 4UZEA 1PBTA 1T9DA 1E7SA 4I19A 4O02B 3ZDYB 3SC6A 3W6NA 5KOJB 3EVEA 3ES9A 4IVRA 1JDNA 1PDVA 3BILA 1W75A 2CJPA 5E38A 1IEVA 3RJ9A 3VU1A 3AVYA 3HU1A 1HOTA 3RVOA 3T3IA 3IAS1 1L4EA 1ZMXA 4EH1A 4P53A 1CQPA 5LZ5A 4F9FA 2B5OA 5JNUA 3L3BA 3UMMA 2DT5A 1O4WA 1X74A 1I3MA 3X1KA 1GZ7A 3JWGA 2KM1A 3I2IA 4MX8A 4R2KA 3AC0A 4F5ZA 2AOVA 4B3SB 4OJYA 4BVBA 1VI6A 2P4UA 4X1YB 4GM1A 1OFUA 3H0CA 4JVMA 4F6LA 4DBLE 3QOWA 4RIIA 4Y9DA 3HCAA 4IMJB 1VKJA 2QUBA 4UTVA 4NMHA 4WINA 5LBUA 3E4DA 3PNMA 4OK3A 1KJWA 3GDFA 1WB4A 4FCCA 4HDSA 1RLMA 3ZVMA 4HR7A 1NG9A 1KC1A 4PVDA 1IVNA 4YIHA 1M1NB 2FEWB 2P2DA 2PGOA 1P1RA 2ZJ2A 1SOMA 1XA4A 5AKZA 2DRIA 1SHLA 4TMVA 3C70A 4IFEA 4UMEA 1V4VA 3DBRA 4S0ZA 1RYZA 2ZUSA 5AKLA 3JQBA 4PIMA 1Z47A 1UWLA 4OIFA 2Z58A 1T5OA 2X76A 3HMKA 3WADA 4P93A 2Y1EA 1ZVQA 1O03A 1ORIA 4ESHA 4ZC1A 3SX0A 1M83A 3W2TA 3ZOKA 3ETDA 3DF7A 4FFWA 3U3MA 4JSTA 3K4PA 1V4BA 3UB4A 3PE3A 1TT5B 2XA9A 3QX3A 2W98A 1Z13A 1T8WA 4JQZA 2J87A 2OFPA 1FPQA 3HH8A 2C58A 2ZAIA 4ISBA 3H9UA 2IPAB 2OB1A 3GEDA 1R4MB 2IXAA 3R20A 2DR2A 1SNYA 4YV7A 3TVDA 4WY5A 3V8MA 3I5XA 4LY3A 1L5ZA 2A4MA 4B4DA 1UPTA 4ZI7A 1XKXA 4RKWA 1OOEA 1EUCA 1V16B 1FYVA 2PNFA 1VMDA 2FEPA 1JA0A 1SD1A 2GOYA 3COYA 3JZDA 3OJWA 5AHRA 4Z0HO 3VYVA 4D9IA 3IT1A 1UXIA 2KW5A 1WHTA 2YV2A 5FUXA 5J4KA 3KQPA 1GA1A 3TQTA 3HJBA 4PNZA 3U7IA 3HJCA 2NTJA 4MVJI 4U8GA 1ZJ5A 2BGMA 3OE4A 3M4JA 3KXKA 3L43A 4QQKA 1OH6A 2FR0A 5KHAA 4GVLA 2BLLA 1OREA 5JMOA 1ACJA 2NUTB 1VIMA 3JALB 3K05A 3LQFA 3HJRA 1JDBC 1HYBA 2R60A 1L1FA 3VYTB 1D2GA 3FJOA 4PYQA 5HK9A 4RV9A 3N6VA 5H82A 1QGDA 1T6BY 3LW7A 5BV1A 1JQAA 3NU1A 3PFFA 4F97A 2JHFA 5TF4A 4BMPB 2OQIA 1CS0A 1ZJ6A 2AJ8A 1UWVA 1TCAA 4R1UA 3TIIA 1S8OA 1EUQA 1CEEA 2HK6A 1D0VA 4QHYA 4I4IA 4Y2SA 5KU7A 1FYEA 4QOHA 1JXQA 5JATA 3AMVA 4JX9A 1J90A 1V5FA 3DLAA 4M9UA 3GLQA 3IDSA 5CIQA 5DCLA 4DIFA 2HZBA 4EI7A 3SLRA 2DFPA 1D4FA 4HAYA 1NFFA 3RTCA 3CUEF 1NE7A 3IYLW 2OXTA 3KLNA 3N39C 5HQJA 3K1JA 3TS1A 2V1UA 4EHJA 4L5CA 1L4UA 1IHPA 2OKCA 4HN9A 4E70A 1VZ3A 1P7CA 1XCLA 2L19A 3BREA 2AJBA 4IMIB 2K5UA 4JA2A 3OZVA 1SU6A 4PHTA 5AUOB 4KQ9A 1UXGA 2Q9BA 2YMQA 4OQXA 2N0SA 4BJ3A 3GRKA 3PSHA 4P54A 3U4GA 3OQMA 1GG2A 2HQSA 5L45A 4JHLA 1N3IA 1PU2A 2OXCA 3ZQKA 1DE0A 1P4GA 5DEOA 3TL6A 4BC1A 1CDDA 3PIDA 3NM4A 2YJGA 4DF3A 1N57A 1OFIA 1EM8B 3DTNA 3HY3A 3PGLA 4QELA 4EZEA 3TLJA 1ZM7A 4O1MA 1S9HA 2B21A 2JI4A 2P4QA 5CX1A 1T8RA 3STXA 4BNTA 4PO3X 1BD3A 1P77A 3UPDA 1RXIA 1PJBA 3GGOA 4NTZA 5HEKA 3OQHA 1R5OA 4L02A 3NJ4A 4PPNA 1HZZC 3UUEA 1J5XA 2GMWA 3LCVB 2VKTA 1G59A 3WSVA 1Q12A 3VPHA 1QIDA 4GQBA 3SK0A 5CCEA 2GT1A 1KRXA 2QRGA 3VNQA 2FG5A 3PNYA 4TYNA 3ETNA 3JQDA 1VXRA 1O6FA 4OY3A 4BNFA 5HHTA 1DOZA 2CJYA 2JZOA 2JIMA 1T36B 4DLVA 3GPIA 3RAPR 1SCBA 3FXAA 2PM8A 3KJEA 1V3QE 2O7NA 3W8NA 2WKRA 1KIAA 2CXRA 3DYVA 1IXKA 2IXDA 3GT3A 3GPBA 4B4OA 4Q39A 4Y1FA 2IF2A 1DEXA 1X38A 1JR4A 1H69A 1QFZA 1Y63A 1E79A 2BEJA 4RWZA 4CM4B 3H13A 4EFLA 1UZAA 2RB5A 1M7BA 2ZBEA 4MVJP 4BX3A 5A4AA 1IXRC 1NW5A 1C2YA 4KV7A 2GTPA 4L75A 2WB2A 4LTMA 5FTWA 2A9VA 4CM8A 3KU1A 2OZLB 2WNHA 2HHAA 1OFHA 3QPVA 4MKGA 4J90A 2NZJA 4PGGA 4QASA 4A6EA 4CEHB 3EN0A 4J0IA 1Z2DA 4YMLA 3JASA 4RVCA 3I1YA 3ZCQA 3EPJA 4KXWA 4KN8A 5JMWA 3EVZA 2EKZA 1V41E 1BXZA 1Z0ZA 4H7HA 2NUAA 3O1IC 1J2UA 2BMDA 1OFGA 3BXHA 4Z8YA 1JLHA 1EHIA 1QZZA 2YUIA 4DXAA 3VTFA 3NH9A 1AKEA 5CCDA 5KOYA 1KEUA 1PV1A 1P9LA 3GNQA 4FYMA 5DT9A 1C7RA 1H3EA 2YFQA 1YB4A 2O5VA 3IIIA 5BYAA 1UMCB 3THYB 3DE5X 1V45E 4DSOA 1VECA 2JGEA 1M2VB 3AFMA 4G97A 5IAGA 5CLIA 5TJHA 4W7HA 5KTRA 3IDOA 1GAEO 4QBHA 5I47A 2UYGA 5D1HA 1UDRA 1NXPA 2UV8A 3WFZA 3T6KA 4J0KA 4E5UA 4WJZA 4D2IA 3QW4B 3VDMA 2EXXA 2HCTA 2C99A 2WKWA 4W6QA 3EZLA 2YRWA 4IV8A 4EA9A 3WB2A 3G6WA 2AFHE 3RJMA 1IN5A 1L7OA 4BEJA 2A7XA 3HJGA 4HXGA 2QAGB 3WLSA 2DETA 3EPHA 4AIRA 1UMKA 5IJWA 3LVBA 2WFLA 1MGPA 1I0IA 2WU4A 3Q7EA 4KWEA 3S2YA 4F86A 4YAEA 4Z1OA 1IK6A 1JZSA 1GYRA 3EK2A 4UZSA 2B1QA 1L5SA 1QHSA 2CDNA 4X91A 1SUWA 1ZW6A 1UBKS 1TIKA 3K5WA 3B2EA 4AY4A 5JALA 3K73O 2FV8A 4H6VA 1Q1NA 2IP1A 2MSKA 4MW2A 3GH1A 5IVKA 3P2OA 4CVNA 3DG9A 1HYGA 4FYIA 4EEKA 1D3AA 1UOEA 1W93A 4U0JA 2QIOA 3KSUA 3EEBA 1NNUA 3NWEA 4W8GA 2QY6A 1A8SA 1CWUA 1GADO 2HDOA 4H15A 4ZVNA 2FUCA 1G98A 4JOSA 4RENA 2H3HA 2V6FA 3NKFA 3RJ5A 4A8JA 3KTAA 3HXOA 1C41A 3MGBA 1J23A 3SS9X 1YIDA 1RM4A 2EU8A 3CLSC 1HL7A 5CVTA 3QELB 4BE7B 3MWDB 3UMJA 1W8DA 3T0IA 3QKSA 5CH8A 1ODLA 1QQTA 3CLRD 1O87A 3DBLB 2PUDA 3NZEA 2F6RA 5AW3A 4Q34A 3ZHUA 1W52X 1BVRA 5JS6A 2C4NA 1CNMA 4NULA 4U02A 2RCYA 3H9GA 1XI2A 2PGIA 2DG2A 3FF4A 3ITKA 4XX0B 2MOKA 4QYXA 3LQKA 1Z4OA 3DE4X 4GM0A 4A6PA 4B8YA 1JAYA 1WMAA 4JKOA 1E2JA 4B84A 3GLFE 4HFMA 2ZVPX 1TUGA 4OREX 1C0IA 1CNFA 3UA4A 2IXEA 1PGQA 2W42A 4XIGS 4BP9A 1P1IA 4JITA 2R65A 5EY5B 4CLOB 1HTTA 5CA1B 2JKVA 3H4IA 2FF5A 4QOJA 4FMBB 3NV7A 4JB8A 2ZUTA 3WC4A 5K6RA 1G8FA 3FF1A 3GRUA 3O2SB 1XEXA 4BB9A 1Q1AA 3SX4A 1ZD4A 1DKLA 2JL1A 2Q3FA 4A73A 3JXEA 2XD4A 3SJUA 4DR1B 1RXWA 3F6SA 1I2BA 3QVKA 4AKEA 3C16C 5ARDA 5FWDA 5BV7A 4KYUA 1FC0A 4QHTA 4E3ZA 5L4SA 2I62A 3FPAA 2Q2NA 1LF5A 3IEMA 1LBQA 2CUNA 1Z83A 3HKCB 3LFUA 4HMQA 5DXJA 4CCAA 4EKYA 1O08A 1P7ZA 2HJHA 1HY3A 5A9RA 4B3FX 2XXBA 4EI8A 1JHYA 4ARZA 1BQ4A 5HM6A 2Z6QA 1AQLA 3D59A 4QU9A 4PV7A 2QE7A 2QTGA 1CJKC 1IOLA 1XG5A 2C4UA 2LKDA 2SKEA 4G4SP 5IC6A 5ALFA 4F04A 1Z0IA 4GWLA 4X64B 2VTBB 1AJEA 1A96A 1ZZGA 1GA4A 2IYRA 2K7FA 2AOTB 2BHRA 1PI3A 3VR5D 1JKFA 3QF7A 1MO4A 2BGUA 3IIEA 2MMGA 1LLCA 3KDSE 2PS9A 1VBFA 1X9IA 4HFNA 3NWOA 1WR8A 2I7DA 2IUSA 4FGLA 3STYA 3KM0A 2XCRB 3S68A 3DV9A 4RK0A 2LWIA 3A6FA 3OO0A 1N5KA 3ZWBA 4D46A 1PTJC 2BFWA 2W2KA 2WDZA 2WAXA 2QLFA 2XHEA 3L0SA 5A5FA 3Q6NA 3CLUD 5U9CA 3Q8LA 1FXUA 5B7NA 2XA1A 4M8SA 3PX2A 4JP8A 2QBYA 1FS6A 1KHHA 2BVNA 4MV0A 1U8AA 4F3CA 3C8UA 5I4KA 1H9CA 1G8GA 4RORA 1M76A 3FPJA 2VTDA 2ESRA 3I8XA 3OEHD 1UZLA 4OU5A 4S05A 1YQEA 4YRJA 3REOA 2JLWA 1FZTA 1KARA 2PT7A 1ECLA 1HDXA 4JUBA 1Z33A 4NK4A 4XEUA 3ROXA 4PM4A 3RC2A 2AG8A 2H8GA 2J3EA 1IIRA 2YC2C 3DONA 4UAVA 1VPDA 5DMHA 4NECA 1VIAA 5C18A 4NH0A 2IS1A 2D5LA 1I80A 4DNPA 3RE1A 1M8GA 1VE5A 4HEHA 4U9IS 5JRDS 2QD4A 2A9KA 2HPVA 3TAXA 5CG1A 1V1RA 2CF5A 1M2JA 4V3CA 2YMMA 4EG5A 1MX9A 3K3PA 4INPA 2WIJA 1FY2A 1KYTA 2HF9A 3PZBA 3RTEA 1Z2AA 1TUIA 3L0DA 4N0DA 4PPFA 5FV7A 2MIIA 3SM3A 3SYKA 5C7OO 3GLIE 2D2EA 3MUNA 3OE1A 1MKYA 3RUIA 1BGXT 3TM4A 1E66A 3X1DA 1LNQA 3AFOA 4KXYA 3UTCA 3ZQ4A 2XKBA 4ZHQA 3U0BA 1X70A 3MTQA 5LQNA 4CQNA 1EAMA 2J41A 5EIWA 4CMJA 2R85A 5EVCA 4FSDA 5JSHA 2Q2QA 2H4FA 2R2AA 4BB0A 4BGUA 1Z73A 2XYVA 3H3XA 4OV6B 3OLZA 1QIMA 4X20B 5AM0A 4YJ3B 3KBBA 5CEJA 4ZPXA 2A59A 4QXOA 3GJ4A 2JHAA 1WHSB 2QG9A 1E4EB 5EC8A 1RWQA 3RF7A 5JVDF 2AOUB 2GM4A 4Q66C 2ASEA 3EGXA 2OILA 4YO8A 3O0DA 3AINA 4FD2A 1JSCA 1UAGA 5EQFA 1VCMA 2VYCA 4ALKA 1XRJA 1CETA 1DWOA 3IEIA 5FUYA 2GCOA 1QCYA 1EWTA 2VPXA 1WP4A 3FR8A 2B98A 4NBVA 5BV2P 2CLCX 3PL5A 1YZFA 1FNSA 2ZBRA 3PUIA 4HOYA 4PPGA 2CLLB 4NXMB 3U4AA 1Q0UA 3VR1A 5CDUA 1SD5A 4I50F 4L5IA 1DOHA 3LP5A 4D80A 4F9GA 3Q8KA 3G5TA 3L06A 4BZXA 2ADFA 4OXYA 1YZKA 2CMDA 3IBGA 3FI0A 3JAWA 3L4JA 4E4RA 3IUEA 4D9JA 2WHYA 4OXQA 5BMOA 3W6ZA 1XCBA 2EGHA 1VBNA 4HNRA 3SM9A 1JH9A 2QLNA 2ZI3A 1BYUA 1U4SA 4IDGA 2ATXA 2IHYA 4O2AB 3GEHA 3EWNA 2VKQA 3JR7A 3PENA 3W3AD 2BEWA 2DTDA 2XYRA 3P96A 1S89A 1SEVA 3EXIB 1UFOA 3EEYA 1FBTA 2E1PA 4EG4A 2GJKA 5FI5A 5IKOA 3I5YA 3I2YX 1M73E 1UC4B 3NG1A 4JY7A 4YRNA 5KVAA 3GLSA 5ALRA 1GV1A 1J8MF 1BMQA 1VRWA 2E21A 3OCUA 4BB6A 1H0SA 4EP1A 4FOOA 5LQUA 1K27A 2GHQA 2W4IA 3FCCA 4XX1A 3K9FC 2CV0A 5GM2A 3DE2X 4TS4A 4RQTA 3CXRA 1L5RA 5TQ2A 1DX6A 5JXJA 2B4RO 1Q0HA 4IJ6A 1K1EA 1U65A 1ZMOA 2MT9A 3C98A 3PFWO 1V6CA 3EWIA 4M21A 5TNXA 1EFPB 5FH9A 2CSXA 4R05A 1KQ3A 3I61A 3VDNB 1JH8A 1YS7A 1RTKA 3QTLA 1XLWA 4FUTA 4AMYA 3JAKB 1GXSA 1LDMA 2X2OA 2M6KA 1VHTA 3D8TA 3IRVA 4MR8A 2H3EA 4J0QA 1JVNA 3ODPA 3KZKA 4YRGA 1AQJA 2AG0A 3ICCA 1NF2A 3VHQA 4L5YA 3P19A 4V0OA 5CB6A 4Q03A 5A4DA 3H9CA 5IBCA 2G0AA 3L0PA 4RJTA 5TSDA 1D03A 4WKOA 5ALNA 3WAKA 2R3SA 1KYZA 1GZ4A 3CLSD 1MJGA 1ZKDA 3IE0A 5EHGA 5CAEB 5ALSA 3WLNA 4CL0A 1UH5A 2WJYA 1NW6A 1EGVB 1YJAA 2R4UA 5T8KA 1Y0BA 2GPAA 3X3HA 3ONFA 1EFUA 3HBNA 4YCNA 4LZPA 1K7CA 3KZOA 1XAJA 3D4NA 3EZFA 3PKZA 1KJQA 2EGGA 2PFSA 1NJ2A 1ZWLA 4RF4A 4XFKA 4OHKA 1QB7A 4ZT4A 1RJDA 1UAYA 4X1IB 4X84A 1GSHA 1M66A 2IIVA 1IBSA 4MW0A 4LOIA 1J9ZA 3SMQA 3VR4D 4BTLA 4YPFA 7AT1A 3W5BA 3RVMA 4KTVE 5TARA 4GIBA 4YV2A 3B82A 3IEXA 2D5CA 3IQGX 3ZCUA 5H9WA 2BFEA 4WZBB 1V8FA 1G9SA 4IXDA 1R8XA 3HYSA 3O2QB 3TFQA 2EP5A 4B6JA 1SGWA 1PNQA 4LA4A 3U9TA 4RA9A 4MW5A 3WKAA 3RYHA 1NN3A 3IVRA 5EWLB 1QFYA 3SN6A 3ZDQA 2E4UA 2A5LA 2RGCA 4R8MA 2VYFA 4G0PA 1F0YA 4M8NE 1D6NA 5B30A 1JI0A 1GNTA 1ZCZA 3QV2A 1OXKB 4A23A 4IYJA 5IKXA 3AY3A 2R79A 4JXJA 4WRRA 2OCBA 4XJVA 3RWOA 2QM8A 1P29A 4NCIA 2EFYA 2RHWA 3E3LA 4LVOA 3WA6A 2Y92A 5HKLA 3DDWA 2AZDA 1QIGA 1H1LA 2CL7X 2IIQA 3M3PA 2J6IA 2O06A 4W8OA 5I6DA 1GQOA 3QXGA 1KSGA 1XRSB 4IRXA 4V02A 1MNAA 4P5PA 2MSDB 4Y1RB 1LC0A 3OMLA 3SDZA 4EJMA 5LA6F 4YCCA 5KWIA 1N8TA 2I1LA 5IT9A 1UBJS 1V7ZA 1U7PA 4WKCA 4OMCA 4C89A 4F72A 1Q0TA 4CMIB 3M9LA 3QPUA 4HUTA 4OGFA 3QBJA 2XVMA 5KNBD 3AOEA 3JVVA 2R96A 3N74A 3N05A 2EERA 5EPEA 2IX3A 4D99A 2GBIA 1G1AA 1NM5C 3MLEA 4H4EA 1E3LA 2YHIB 1ZD5A 5CMLA 2CVPA 4XDHA 1X1DA 1RYEA 5ENDA 1I4DD 3X1ZA 4LJSA 1OLUA 1SCNE 1ZVVA 1QR6A 3I0NA 2BBTA 3ZJYA 1D5WA 1F4LA 1YFKA 4CM1A 3O8QA 2GDJA 3SBDA 5KHOC 5JH7F 5G3YA 5KQPA 1QC5A 4QA9A 4JB3A 1RC1A 1LLDA 3ITDA 2QW8A 3D3WA 4NZPA 5CLFA 2WWHA 4E14A 2D2FA 4ATNA 5A3JA 2IS4A 2PCLA 5A6VA 3FBWA 4AUNA 1QF6A 1ISGA 4YJKA 4X3PA 3ABZA 3HLTA 4C29A 3L6CA 1Q74A 3A04A 3TW6A 4E5DA 5EJ5A 3GEIA 3VKUA 1YFZA 1XC7A 2I4RA 2JAQA 3R3SA 1ZN8A 4Q1BA 1VA4A 1WCWA 2J5QA 5BT9A 3K0SA 1NPDA 5IUJC 3MS4A 3RYFB 1K6JA 1QX4A 2RHDA 2ONKA 5A4MS 3ZKWB 4G81A 5A3QA 3CIFA 5B3JA 3M9WA 2JLUA 4IIBA 4Y2JA 2YRXA 3P1JA 4OFZA 4F93B 3Q7TA 4H4DA 1UT5A 5EKXA 1RHQA 3H8SA 3MB5A 1OZAA 3SHTA 1UJBA 4DUYB 5FOTA 1ZC4A 2A6PA 1IMOA 4FR5A 4O8CA 3LRXA 5DM0A 1TUEA 5BUZA 5DPMA 2C8KA 5ES3A 4BMCA 3ZNQA 1MW9X 4Y6OA 3UMYA 1U3VA 2X9NA 1DJOA 3I53A 4GLLA 1M1UA 3FRJA 4HPWA 3S55A 5JU6A 3HXKA 4CUJA 3CX6A 3IULA 3QXXA 3T7IA 4LOJA 5BN5A 5HVNA 2HMWA 4NLLA 4DUGD 2FTKE 1M9NA 3AONB 4TYMA 2X8WA 3HYNA 4GKBA 2VWHA 4M49A 4ZREA 3ZE0B 3ZTWA 5BW4A 3OJCA 1M6WA 4LRYA 1QZUA 4MEBA 1A9OA 1E3DA 4LF8B 1AQNA 3K16A 2WAOA 1NTRA 5KKCA 4HNTA 1HSZA 2UVDA 5BSEA 3V4RA 2YN2A 1TTTA 1NDHA 4UOQA 1QVWA 3WGYA 4BQSA 5ICMA 1CRWG 1RCFA 3L1IA 2ZFUA 3CBGA 3EC1A 5A7FA 4CDMA 2W83A 1DZ3A 4LYFA 3A6EA 1RC0A 3LJKA 2P2ZA 3TE6A 1FP4B 2UUAB 4KN5A 1L0BA 2I2BA 4B75A 1WEKA 2JH8A 3RVBA 4B83A 2Q5QA 2OD7A 2I6TA 2J9FA 2M9MA 4CM9D 1IONA 1JS1X 1O58A 1T2UA 4B82A 1UZNA 3FHLA 1VJTA 2GM9A 3EMDA 2CHUA 4N3AA 5FNVF 1IMJA 4JLPA 2QUZA 4JZYA 3PC3A 1C30B 4YJHB 3TR0A 1W5TA 2NZYA 1K7FB 1FW8A 4JT9A 2O0JA 3N6XA 4KO4S 4D9BA 221PA 1ADJA 2PL9A 3ZTTA 1LSSA 2X3UA 4IZ6A 1H0RA 2AK2A 4P81A 3SKXA 1NONA 4HQ6A 4NCKA 3IT2A 5FQOA 3C48A 4XQ0A 2FKAA 2Q28A 1YDWA 1GLNA 1XD9A 3R75A 1VE9A 3CF6R 2I7VA 3MGGA 4G5RA 1ICEA 3HKDB 5C8VA 5L8VA 1D2NA 3A36A 4TMXA 5KPJA 2XF2A 2H0RA 4FW9A 2X9GA 5LJIA 4HDOB 3WE7A 4GNKA 3SZLA 4LEIA 4CGYA 3ZDAA 4QXAA 1SXIA 3LLUA 4R1MA 4D3FA 1T2NA 4OHRA 1OJLA 3NTQA 3RYFA 5EZYF 1VRVA 3WBJA 1ZCFA 1DAKA 1S96A 2I6FA 4FCTA 4M86A 4ZQHA 2VF8A 3U7QB 3TF5A 1TB4A 2C9BA 3P97A 3TIVA 1NDQA 3BCRA 3ZNOA 1T2DA 1W4BA 4DLWA 5C32A 2IOHA 3VGPA 4PG6A 3GVCA 4L50A 4XB1A 3REGA 1BS1A 1DJQA 1I3NA 3G7UA 5B37A 4YAIA 3CWCA 5C37A 5B64A 5I7OA 4IMPA 4YWHA 2GD0A 3LQRA 4P2BA 2FWAA 5E4YA 3VR4A 4ZRNA 1KVTA 4IAOA 2HXYA 1T4CB 5CFLA 2GERA 2WFAA 5AJUA 4LDNA 4RTSA 1C1HA 4U4AA 5DTJA 5H3CA 3R76A 3FMFA 3GGCA 3PDUA 3QRWA 4XM0A 3ND6A 4PX5A 1AKYA 4JI7B 4DMLA 3D64A 5LWHA 1IEWA 3ZY5A 2ZQZA 3CUVA 3U13A 4PLVA 3SF8B 3W9BA 1Y1LA 2O5RA 5DBFA 1B41A 5HS6A 1I3KA 4BLSA 3TFOA 4HATA 1WXFA 2BR3A 5IYZB 3QBVA 3ZGZA 1NURA 4PGFA 1E1MA 1F2TA 4HP8A 3ZTYA 3PPYA 4EYGA 1QQ6A 5L6LB 2ZT5A 3DV0A 3IOYA 2DJ5A 2VN8A 1TPZA 4J4TA 3RS5A 3IKVA 2AN3A 1PR6A 4JQYA 3FWNA 1CP3A 4FGZA 4N9WA 4PHCA 1NY6A 2R8YA 3CNLA 4N12A 2UVPB 2RC5A 3SKVA 3KSAC 1F5SA 2JFZA 2Q5JA 3KTFA 4MQUA 5IMBA 2IU4A 1JLLA 4DTIA 3E9MA 2QG4A 4IFTA 4G1MB 2DE0X 4MV8A 4QVGA 4RYDA 4K46A 3WDKA 5JEDA 3HU3A 4OCZA 4V0ME 3OZGA 2VH1A 2FRDA 2XNSA 3TRFA 2GD6A 3INRA 4RLFA 6GPBA 2VRCD 1C0KA 1MO5A 3FNBA 5LP1A 2WM3A 1SCUA 3JYHA 2X7JA 1UP4A 2QJRA 4DJ5X 1YB5A 1KH1A 3FGZA 3MT8A 4G1BA 1N34B 2Y93A 1JLRA 1TGVA 3P0HA 3JQRA 4NDZA 4Q1CA 1K8ZB 4Q6BA 4HJXA 3KU4A 1DQNA 4B2YA 1H4SA 1YBVA 2CBZA 2FPXA 1A8IA 3UICA 4HUQA 3JQ7A 1Y4AE 4L57A 1OXTA 3KKPA 3R8CA 2F8MA 4LUCA 3SS7X 3A6PC 4AZ0B 4AJ4A 3O82A 1P0FA 1N1MA 1CY6A 2OP0A 3BVPA 4JLJA 1DS6A 2WF8A 1W44A 4PG5A 3W3ZB 2BFEB 3QFHA 4WZBA 2R2GA 1JA9A 1T2VA 1S02A 1EP9A 3LM8A 2YC4C 3PUXA 1A88A 3MHTA 2V7UA 1WVIA 3NBQA 4FOSA 2IWHA 5LOVB 4UCXA 5JXGA 2ZP1A 3GIDA 4PC1A 4WOJA 1MAVA 3H1BA 5EP2A 3FOZA 1MJ5A 1ZNWA 4MINA 5T57A 3WRXA 3ELBA 4GZ6A 1BCSB 3GQBA 3UK6A 5GV7A 1CVIA 2VIIA 2VO1A 2I4NA 1ML4A 2FAXA 3DL7A 4TTPA 3AKDA 2VATA 2VXYA 4YR7A 2UYCA 1YE5A 1YTLA 4M1WA 4CW7A 3SOZA 4N6NA 3R7WA 1AH2A 1PN3A 1BXRB 1ABFA 3GLFA 3DB2A 4ZMSA 3BRWD 1Z7EA 1O0CA 3OWHA 4V0RA 2E4YA 2D59A 5IDXA 5J2UF 3H16A 1C9JA 2GN9A 2HK8A 3W8EA 4DMRA 4PX3A 1KYWA 3HKBA 1UBCA 4QBKA 4DA7A 1J5PA 4QNMA 2I0FA 2VA9A 1GXSB 2OK8A 5GOZA 4DBVO 1K8RA 1N9ZA 3SEZA 3ZE8A 3ECAA 4MKIA 2JRLA 4GSLA 2NU7B 3ZX4A 1NP3A 2G63A 3AV3A 3TLGB 3BHMA 3NBFA 4BQPA 1UBLS 1CQJB 2I6XA 2WI8A 2V8BA 1X1SA 2VEOA 4J9VA 4RPJA 1P5HA 1U99A 3KQUA 4UREA 1XAHA 2GLTA 1NBAA 4E2XA 5MDHA 1G8KA 2R87A 5H68A 3GAFA 1FLDA 4G1VA 3BXGA 1KK3A 1R88A 1VQ1A 1YKGA 3I39X 4QATA 4EPTA 3BMCA 3OTOB 2YY6A 3JSXA 3SDBA 1EZ1A 3EXIA 3F4KA 3LF1A 5AXBA 4GX0A 3VA7A 5DCWA 2WJIA 3HVHA 4HQNA 4UMVA 3VPFA 1EFCA 1A9TA 2JRCA 4UHCA 2G5TA 1EHCA 3FH0A 2HCRA 2DR0A 2D7DA 1XPUA 1DL5A 1HV8A 2WWWA 2DF8A 2GO7A 1LRLA 1YV9A 5I01A 3DCJA 5DH9A 1NIPA 5B1DA 3A7EA 3O4GA 2X1VA 2DKNA 5DB4A 5FKJA 3RS9A 3REQA 3P0JA 4EQ6B 1HDGO 2RAPA 2FMHA 3D3QA 3E9CA 3FOWA 3QG1A 1ULUA 1AKTA 4PSCA 4KE7A 6AT1A 5B3AA 4RIEA 5GONA 1N5OX 1C3EA 4M8IA 2H11A 3IMKA 1X77A 3ZVKA 4ZAFA 2CHFA 3BTOA 4L4UA 4AWBA 5EWMA 4M1QA 1KBOA 3ZE9A 3AEKB 2DFDA 3LY9A 4EUEA 1PGNA 1Z8FA 3EAQA 4HWTA 3V2GA 2AN4A 1WCV1 3AUAA 1IUKA 4FFVA 4RZUA 2BRUA 4Y9TA 2JCBA 3A28A 2RG7A 4QNRA 4BFYA 1Q1GA 5TF0A 1ESDA 2I65A 2Q3JA 2X4LA 3DAHA 4ZVPA 3R4VA 5EXEA 4H31A 4M0LA 2FW9A 3O8OA 2OO5C 5GOTA 5IAEA 1KJYA 1QUFA 3IPRA 1ZUHA 5JCOA 1C2TA 3EASA 1OF1A 4JL6A 3QPBA 2JCSA 4H3VA 5F1YA 3OY7A 5SZIA 3K71B 1EK6A 1Z2PX 1P33A 3INYA 4OUKX 2OBMA 3OIUA 3HUEA 1UIRA 4FHZA 4FYWA 4QNNA 4RC9A 1M7HA 5JAPA 4DDMA 3GRAA 1WVGA 4JROA 3CHYA 1O5TA 2ZRBA 2YWHA 3QXJA 2ZI6A 2ZRQA 3FNEA 3M4NA 4V03A 2HEIA 4OJNA 5GONB 5C8YF 1AB5A 2F8SA 7MDHA 3FROA 2PBFA 3OEYA 2R8EA 1TRHA 2BKXA 2ZZMA 2Z09A 3OSUA 1GPUA 1K06A 3BK2A 1VKOA 1E1DA 3DHNA 3P9KA 4ILKA 2FFAA 1CP2A 2V58A 3A3YA 3USCS 3WL7A 2W43A 4JOBA 4AJ2A 5B4VA 3U4MA 4JXZA 1IPHA 4KE8A 5B57C 5FJIA 2GYYA 4WXPA 1PNRA 1HT1E 3C6XA 1GQ2A 1R6UA 2FLWA 2C5FA 4UM5A 2Q99A 2GCNA 4X1OA 5A2GA 5F3WB 2HRRA 4YMVA 5J4LA 3NONA 4KQXA 5EJGA 1QTRA 5JLJA 1ORVA 3I0ZA 2X6TA 4LZZA 1KK2A 2WKQA 4DQLA 2J0VA 2ZJBA 1KI9A 1XCJA 4O2BA 3AXSA 2QD3A 5K2MA 3ECCA 3Q6MA 4QVIA 2XGMA 3A6DA 3OICA 4L7VA 4BFLA 3ZDFA 3V1YA 3OTHA 1XCMA 4US1R 2YCLA 1CKEA 1NG1A 1EZZA 4XFDA 1R15A 2Q46A 2Q3DA 2QW1A 3VISA 3DGFC 2OHIA 3LT1A 3OWXA 3LWNA 5SZJA 1NMZA 4O33A 4OATA 2GXAA 3TTYA 4WAUA 5AQ1A 1RLUA 1HF3A 3HI6A 3TLGA 1XMOB 1LSUA 2NU7A 2V97A 1KDZA 1VMAA 2I99A 5J9FA 1H2HA 2VUIB 4CQLB 2W71A 4KIFA 4QKQA 1PFKA 1FP7A 1QYCA 4PZLA 4D3ZA 2Y2UA 3DZHA 4N49A 4AG5A 1Y7TA 3U81A 2EFJA 2G09A 1LJ8A 5AJXA 3H19A 3RG2A 1NXXA 4FQ7A 4MCJA 3EFEA 4RH0A 2OPHA 5JFTA 2MYPA 4IIJF 3II6X 4K9QA 2RI1A 1I9CA 3THWB 1H8HA 5D3MB 1AS3A 4JSRA 3AQIA 3E81A 2X22A 1DXYA 4YRZA 2ZW9A 1V8BA 4M3NA 4J91A 1I1QB 4X6YA 1RHJA 3GRVA 1BCRB 3HUUA 3USZA 3OTWA 1XZLA 4EY5A 4FGJA 4K81B 2P68A 2W2LA 3C4JA 5T4HA 5REQB 4AYTA 4CXMA 3HK2A 2NPFA 4BECA 1UBRS 1Z74A 2VDNB 1F7VA 4DQXA 5FBVB 4PEVA 3GQBB 1QLJA 3W34A 1E9DA 7ABPA 5IK2A 5DIFA 2QM7A 4E51A 2I91A 3KLBA 3L77A 2JIQA 1I14A 1RXUA 4YECA 3LBFA 4BATA 1PJQA 4BN5A 1FUYB 3GP3A 3WB9A 4QIHA 1ZS9A 3M8KA 3L0OA 3OFSA 1S0UA 4LBVA 2XB6A 1A98A 3UW1A 1VSQA 2E9SA 2H18A 3QTBA 4QPNA 5AVJA 3EZYA 3WX0A 3B9PA 3A31A 4WI1A 3NASA 3H5TA 3M5WA 2O8CA 3X1JA 3SFZA 3BJEA 2JLQA 4ZDJA 1EJBA 1N6RA 3EUFA 1O89A 1XXHB 1ZNYA 2QV7A 4TUYB 3SEAA 2GBFA 1ZDMA 1PJLA 1ZISA 4O2RA 2P6NA 1M5RA 3A2NA 4JQOA 1D9ZA 5B7PA 1AK2A 2VYNA 1YH3A 3MOSA 3KSZO 5DHQA 3ZD9A 2MR6A 4EEXA 1W36D 5DN9A 3MLAA 3V8EA 3MHPA 2WZDA 3BOSA 2BMFA 2VI5A 1EWVA 1SUCA 3CA8A 4IFIA 1R12A 7YASA 2LV8A 1SFRA 3CCCA 3TBFA 1MG5A 3U7EB 1U80A 5JSZA 1HE1C 3EGVA 2YVLA 2BCJQ 3DF9A 4NWIA 4OQLA 5DGCA 5MFPA 3CS3A 4DV6B 1DAGA 1WW3A 2OWDA 1T2EA 2G77B 5KYNA 5HIKA 3AB7A 4DMUB 4C2AA 4WCDA 4A8JB 4LZLA 1JALA 2FW1A 2D0OB 4O25A 3DOEA 1F6DA 1OA1A 1TZJA 1WY5A 2GF9A 3L1KA 1K3FA 1SOWA 3QEBZ 2W8BA 1QRRA 4DMHA 4B3RB 5DLDA 3B3QA 4DMGA 3AXTA 1OCEA 2EFEB 2ZIXA 2WIGA 4AMBA 1JYEA 3C3JA 1K08A 3DE3X 3RS0A 5K4GA 1O2DA 4IDOA 5TMDA 3OAAA 5C53B 4WUVA 4YJ2F 5KNDD 4DR6B 3EODA 1NWHA 2XTJA 3K0AB 4NXNB 3AZOA 2B8JA 2MINB 3INTA 3WHKA 4V0MA 4A2QA 3KYJB 4FHDA 2RGYA 3UB2A 4EL5A 5C81A 4JJ8A 2VCEA 2V4ZA 2CFIA 4FVTA 2YZNA 4FHEA 4JVOA 4LTDA 2Z57A 4MRSA 1JQBA 4WASA 4Y6GB 2HJWA 3WKBA 2Q1TA 3HJHA 3M89A 1NRJB 4JYMA 1GUZA 1U28A 2PUTA 3CONA 1QE0A 1R9NA 4G1UC 2A8YA 4BFWA 2PKYX 4G9EA 2BGJA 2ZJ0A 4OI2A 1C3OA 4XM1A 2R1TA 3F2IA 4XD2A 3V33A 3L4KA 1WABA 2EW8A 2J7PD 2JNWA 3S7ZA 2FWRA 4AJEA 2OA0A 2ZIVB 2O2GA 3U7QA 4D9GA 4KVFA 3PFGA 3TXAA 3W7AA 2CJFA 3DFFA 3FBTA 3I6IA 1DFHA 1E3WB 3E27A 3MMNA 2FZ4A 4GQAA 4N7JA 1I7NA 4FFNA 4UUPA 4AS2A 2DECA 3IJ5A 1ZPDA 2QTCA 1UQTA 2PAAA 1M6HA 1KO8A 4M98A 4WNAB 1EX6A 1FIUA 4ZZ3A 3T61A 1F48A 4AD8A 2HO4A 1ISRA 3GU3A 4S24A 4JLSA 1J0CA 4FGKA 1EVEA 2O7VA 4DJFC 3GO4A 1E6CA 5DN6D 4G5QA 1U3DA 4RK5A 4E1VA 4AYWA 1JQLB 1ZSNA 4FT4A 1U4NA 4RVGA 3EJWA 1H9BA 2MYUA 3PI6A 5B7GA 3DZGA 3I2FA 1K66A 1LFDB 3CYFA 2CJWB 5K0EA 1QHNA 1AY0A 6LDHA 1Y4UA 4JXKA 1H2RS 2QYSA 1G8PA 2I2DA 5L7WA 1R0ZA 1JFFB 1E6LA 3U4CA 2WJHA 3RIGA 2V54A 3IP9A 4IIUA 1UF9A 5DBIA 2RI0A 4CM8B 4GYJA 2FP4A 4AECA 4BMVA 2VBGA 2FA9A 1IJBA 4E5NA 2DBVO 3NETA 1NN5A 4PQEA 5BRAA 1LSOA 3DTVA 1UL1X 1SXJD 3EVGA 2XUHA 1EXDA 1WNTA 3BXZA 2E6KA 5ALEA 1XUOA 1Q0PA 5K8LA 1ENYA 3FDZB 2ZUVA 3FW1A 3TX6A 4BRUA 1OH8A 3KLPX 2Z2ZA 3A1FA 2FGJA 2ACEA 5EYPB 5FO1A 3W2IA 1W6UA 3KJXA 3QNUA 1XZKA 2VL7A 4WLEA 4W7IA 1BE0A 4BDSA 1T36A 2QLTA 3AJAA 3ZJVA 4OYYA 3RVQA 1X7XA 1Z2OX 2GD1O 3ICPA 2YQZA 3NHJA 4NZMA 5CK4A 1U28C 1BDJA 5THKA 3R9KA 3DUWA 3VJKA 3WP0A 4K3UA 4HNUA 1OIWA 1L5MA 1QS0B 1WJGA 4KUGA 1W94A 5F1OA 3LX6A 4P32A 4DNXA 1IM5A 1WOMA 1C3JA 2AOXA 4JJZA 3H5RA 3DD5A 3ZVNA 1MB0A 4LC0A 5JVDA 3T7AA 1EFRA 2BKUA 1VG1A 1PWHA 3EYWA 4RESA 1E2MA 2QYOA 3ZV6A 4DEVA 4KITB 2C5EA 4GPBA 4MO9A 1O0BA 4FB4A 3DWEX 1TW2A 1Q44A 4FWTA 4YUVA 1RLOA 3UMFA 1F2UB 4FKBA 1C3LA 2FQYA 3OZRA 3NTXA 2PDAA 2JCXA 5J2TB 5JWRA 1Z4MA 1NDUA 1XPOA 2XADA 5IEJA 5HZHA 2OCYC 3WISA 1XTJA 2JJQA 3VO1A 2HIHA 4R9VA 5DYIA 1AG9A 3RK0A 2RGDA 1U7TA 3SVTA 1Y8RB 1HLFA 1HE2A 3IMEA 4UPVA 1R64A 1TZCA 3EIEA 2X9QA 4UBLA 4ENVA 5CXQA 3W5AA 1T6XA 4GZMA 4YH1A 1LRJA 3OKAA 4JKIA 1IY8A 4TTJA 2XV1A 4YQZA 1ZEJA 3RSQA 4IF4A 4EBFA 4G0QA 4QYWA 4YNBA 1W5EA 5HE8A 3FOEC 3AHEA 3K1YA 2NIPA 3HWX1 3UT5B 4AY2A 4ZCTA 4IDCA 1BVHA 3TBHA 5AKGA 5HBGA 2QD1A 3L93A 3LUCA 4GMGA 3WMFA 1HNZB 1UDWA 1THGA 2YV4A 3ABQB 4F56A 3HNOA 4OYLA 1A9RA 1XJCA 3NIDB 2UZAA 3QKTA 2VT3A 2YHIA 1NBHA 1G3RA 4YV0A 1MRNA 5IT0A 2EL9A 3IQIX 3KTOA 4X62B 5E2AA 2QY9A 1T25A 4NBRA 4NMXB 4BNDA 3ISTA 4RETA 4UNRA 5BVHB 2NP7A 3TSOA 2JFUA 1ARZA 2RJOA 1ZR2A 1JTFA 3O83A 4ZT3A 4JP5A 2AXEA 3WGLA 3RUDA 2PKEA 1E5DA 1MTOA 2MSEB 1T8YA 2CNWD 3PWSA 3QTTA 4FGSA 5D86A 4XRGA 5SY4A 4R0VA 3SVZA 2F1KA 1PV2A 3E9RA 3GA7A 4NF2A 2VDOB 2QJOA 3PPVA 3MXOA 4ZDIA 2YWXA 2VQFB 3RNOA 1ZL2A 3DWIA 1YRAA 2ZR7A 1GRRA 3D8UA 1P9WA 3T4PA 3O90A 4J0JA 1SIOA 1ZCAA 1SBQA 2NV6A 1H1LB 5IX8A 1B26A 3ICEA 1L4BA 4TROA 4L8YA 4JI1B 4AF6A 3W5VA 3LFHA 3FCOA 3WL5A 1OGJA 1VC2A 3AEXA 3U6KA 4YAOA 1DDOA 4UCQA 1ZN2A 4GM4A 2H1IA 4GLBA 5AWFC 3X2SA 1OLOA 5LN1A 4QPZA 3TJMA 4JR2A 4DUPA 1JU4A 4EUFA 1GCGA 4Q9KA 1Z4NA 5CJ2A 2OUIA 3OJXA 1KXZA 4FS3A 1DO2A 5F35A 4J0FA 2XMZA 1KEEB 4WECA 4BNHA 1IH8A 3PCRB 1CFZA 5FO0A 5A4KA 5D8DA 3AU8A 2WLTA 4W8HA 1SZCA 1NVTA 3CZMA 3OQBA 3R6LA 4KWHA 1VKNA 2WVHA 1Z0DA 4GW3A 5EQJB 1H2YA 2COUA 3BIFA 1GVNB 2GK3A 2JFNA 4EHLA 3EVTA 1TQDA 1UMDA 1RM3A 2WKPA 1PIWA 3K5PA 3OH8A 4ZJUA 5FD8A 4B3DA 1QRAA 3L7KA 3W3AA 4F71A 2ODTX 4RTRA 4N47A 1JR6A 2GPYA 5K8CA 2A88A 1IUPA 5KQMA 4KSCA 2P5TB 4TMTA 4UHFA 1BX1A 4LVUA 1BJKA 1KH2A 2WINI 3EEIA 3WNBA 3WXMA 2Q7DA 4N76A 1UM8A 5BNTA 4HDSB 2FI1A 4UE3S 2QX7A 3BTVA 1PJ3A 4P4SA 3TO5A 1DC7A 4LHWA 2CXNA 2P65A 1I5OA 2JW5A 3QWFA 4GPZA 4C01A 4QZVA 5JHHB 4Q48A 2J3KA 4X7BA 1DEKA 3PGJA 3CLTC 3T9EA 4IZHA 1E6WA 2FSSA 4EMSA 2A1UA 4OB6A 4Q12A 4B6QA 3IAM1 3NJ8A 4G8DA 3KFXA 1P2TA 4LISA 3STVA 1H23A 4IOKA 4KMMA 5DX8A 4BZZA 3STHA 1G20B 2JIRA 1A8QA 2PL5A 3A1VA 1GPMA 3L4BA 1Z56C 3D8NA 5KUTA 4ENQA 1J06A 4FW8A 5C9ZA 4N41A 3KO8A 4HB2A 4RPKA 3TW8B 3VO8A 2GJAA 3KJZA 5KOHB 2QG6A 2H63A 3H9QA 4TM8A 4UDYX 5FTLA 3X0DA 4ND8A 4B48A 2DWCA 1W4CA 3EVDA 1BDIA 3MTBA 1MGOA 1Z5VA 4K6CA 1GG9A 4PAGA 4I9GA 4OHMA 2O8BB 3GLIA 2MMCA 2BW0A 3O1LA 1RJWA 2AQKA 3WI7A 4OK6A 3HABA 4ESOA 1QTQA 4M0UA 3PVZA 3E7DA 4QULA 1V11B 1B6RA 1GQQA 1N2CA 2WD7A 4WTOA 3RT1A 4J7CA 4DCSA 2JLVA 4I6EA 4KTTE 5A3VA 4B8ZA 5C3UA 4D6YA 1NMYA 1GJRA 1RU3A 1SC4A 4G0NA 1W88A 4UTPA 1F0KA 5IK2D 4NU6A 2C5AA 3TTUA 1D2AA 1G2QA 4Q3KA 3NAZA 3RLIA 4KVZA 1J9GA 1PJTA 4HJRA 3DKPA 5HSGA 2YZ7A 4KMSA 3ZHZA 4PLTA 1ZZEA 3MD0A 2WJGA 3O4VA 1GCUA 2ZROA 1LH0A 2WYIA 1I5EA 3B8EA 4GNRA 4J1TC 4J16A 5CX1B 1BEEA 5EKTA 4EA8A 1GPNA 2GS9A 5DFAA 2QZPA 1X1CA 3DVLA 4EF5A 2Q8PA 4DYVA 5JADA 3N5CA 3NOVA 1IM8A 1Q7RA 1DO8A 2D8AA 2L17A 2QTTA 4JT4A 1RRKA 1D4ZA 5GY7A 3MIZA 2Y77A 1VDMA 5FBKA 4AJNA 4BAGA 3EGXB 2ZRJA 2MTBA 2Q9UA 5CR9A 1F7UA 4PX9A 4TWAA 2LZ0A 3FFBA 4M0FA 2G1PA 3L0BA 1AVTA 3D6HA 1N3BA 3E84A 2PXXA 1DOAA 2J07A 4C7MA 3T7DA 4G56A 1JPJA 2OC4A 1MG0A 1TF2A 2NXNA 3JVIA 3LUDA 5DTEA 3E35A 4RVUA 3EDOA 1XDZA 4HFJA 4RSRA 4HN2A 5J63A 2ZM6B 2Q21A 5A0VA 3PXEA 4D9NA 2HFJA 3D8SA 3MUOA 2HW8A 2EBFX 1L7QA 3ACBA 2UKDA 4ERXA 2XTNA 3GEPA 2D2IA 3ZKAA 1DEAA 2FSUA 2HLHA 1AB6A 3FMGA 4PZEA 2ECFA 3LIIA 1DVRA 1G8MA 1QRDA 5F7OA 1Z8DA 4Q3CA 1B0UA 3WWOA 1IHUA 4IX9A 4L51A 2NQTA 2IGBA 3MYRA 1RBYA 2HXSA 4F45A 3LT2A 5KYGA 2BFFB 1J25A 1G21A 1YA4A 3QFSA 4Y0VA 2NUPA 3OD5A 3AI1A 4FDTA 4ZO6A 4PQRA 3V7NA 5DLYA 3UMBA 4E4YA 2QL7A 5F73A 4YUZA 5JYBA 1CC1S 4DQ0A 1Z4LA 2DHEA 2ZCUA 3B9QA 4COKA 1VE3A 2IEBA 2ZIUB 1P19A 1VKZA 1C29B 2HIAA 1QFSA 3H1AA 3FCXA 1B1AA 2ZLBA 3ORRA 3WWPA 1WBBA 3WWYA 4DJDC 1OLXA 1QK3A 5AVXA 2EZ4A 3K0BA 5L3VA 2UUOA 1CEYA 3BE5A 2H2IA 2PVCA 3ZWDA 2OGZA 2WJWA 4A2WA 4YRKA 3RVSA 3MJSA 1G3IA 3ASZA 4AN4A 2VSOA 1TK2A 3CZCA 1BD4A 3PPIA 3TL2A 3E03A 4A6DA 5JPDA 1XQYA 4D3DA 4HDAA 4P7BA 5AOBA 1RCTE 2XDYA 1J07A 4FZVA 4LHYA 3DGEC 1GKUB 2GJSA 4F7DA 4UEJA 3CEAA 3TECE 1A50B 1VL0A 3E8MA 3PNBA 5C8XA 4JI2B 1VHQA 4D9KA 2AOTA 3A32A 1FX0A 1T1EA 3DMDA 4OH7A 3TZEA 4AKSA 1W49A 4MAMA 1U2GA 3EW7A 4E2YA 2AMFA 4ROSA 4NE9A 1C9EA 2DLDA 2C8JA 3DP7A 4MCIA 1GN8A 1NXVA 3IJPA 1QH8A 2J0SA 2WF7A 1H2WA 1ONSA 2LGJA 1QJ4A 4UNQA 1U94A 4GYKA 5EIXA 5E6RB 1I10A 2AQ8A 1O94C 3BFKA 3GJ6A 4EY6A 2GR9A 4H6XA 2QK4A 1WXGA 2P9BA 3TMAA 4WL0A 5ISMA 4AP9A 2JIZA 1B15A 3JZIA 3ROKA 3HKCA 4WY8A 3AVTA 4X85A 4HMPA 4NFSA 3MSCA 4UU1A 4OHWA 2WHPA 3RD5A 2OTCA 5DM2A 1W96A 2PRIA 3KVOA 1M6EX 2PMWB 2JBWA 2ODBA 4EABA 2X8JB 1ZM9A 2GZRA 1GDHA 4IGIA 3EISA 4GC9A 3QWAA 4UULA 3RC1A 1EP2B 1OWNA 1RHMA 4KQ2A 6CHYA 2JGJA 1UPBA 4UE2A 1W2HA 1K2WA 4B32A 5IDVA 1SC9A 4CLOA 4J43A 1SA0B 4M22A 2VHJA 4P3OA 4KLZA 4TUYF 1ZBQA 2V96A 3D3JA 2PXAA 1H2EA 1ZRMA 2P27A 5KVCA 3IERA 4W6ZA 1FYXA 2X42A 3HPQA 4PLGA 4WNCA 3UCFA 3WZ2A 2VBIA 2ONYA 3UJPA 2XRFA 3GI1A 5LNK1 1KYYA 2RB4A 2A1TR 1JQKA 4V0QA 5LXTA 2B25A 2IYQA 1MC4A 1DDIA 4YGXB 4NI5A 4P3NA 2E4AA 2RBKA 1ZXXA 3C97A 3FLAA 4HAWA 3BD6A 4G65A 4HGPA 1ZUD1 3WYEA 5B5SA 1UXHA 5BQFA 1U3UA 4O4IA 3IPYA 2UZ1A 2KSQA 2EWVA 5LA6A 2Q2VA 3CPJB 1NN0A 1EFTA 1RAHA 3GQVA 1U2ZA 4NBSA 4TL6A 5LJLA 3NDBB 1WMFA 1E0KA 1J0DA 4ER6A 3CWZA 1HEYA 4TKVB 2AXQA 2OM2A 2WD8A 3DKKA 4AJPA 4LF9B 1MABB 3I5MA 1CY2A 2BR5A 3DDOA 5EJ2A 2W48A 2OGWA 4MQ4A 4BHTA 4JODA 4DJAA 4GI2A 3R8XA 3CKKA 3I83A 3V1TC 1GQFA 1TL7C 2FPMA 4OTZA 3SXJA 4YX9A 1XROA 1YQQA 2CXHA 3Q3VA 5AXCA 5DCUA 5LVAA 4E5SA 4BLUA 2L69A 4R8SA 3HGQA 5E95A 1QUEA 2ZYDA 4FHCA 3RVKA 4OQ4A 1GRQA 2KLHA 2WWXA 3FSJX 3EA5A 4GFDA 4QOGA 3PHGA 2L0XA 5K0GA 1PKXA 2ZAYA 2Q50A 2P6MA 5A02A 1ZN7A 2AFIB 2Q4DA 4TMYA 2IYTA 4PG4A 3RTGA 2YIDA 5H8WA 3WRVA 1E5XA 2WMDA 3CN9A 3NLLA 1QHIA 3KHUA 4OHXA 4Q9DA 2NO9A 3C41J 5I5GA 4Q1EA 3B36A 5LD2C 3ETGA 4R83A 4DR4B 5KYUB 4UKDA 4ZTZB 1C4XA 5HKOA 1QCCA 2G4CA 4M8LA 4FC7A 3CB2A 2XMCA 2C7GA 3TTVA 2W22A 4BNLA 4OQNA 4CM3A 1JB1A 3K72B 3HO1A 2PO7A 1KZ9A 1ZN9A 2O23A 3O91A 3L04A 1UMCA 2B6NA 3ZGXA 3THYA 1J8FA 3L9XA 1V5EA 2E37A 2P9QA 1TKAA 2H9IA 2R6AA 1SU4A 4N3GA 4YDHB 3R44A 1Y1SA 2F48A 3UAWA 1JIKA 2IEAA 3EDCA 3VU8A 1G3QA 4B9EA 4FYYA 4RLQA 2RD2A 5CB4F 1KEPA 3QNWA 1J97A 1RLTA 2XMPA 1DFGA 3SYTA 5ITZB 3H2SA 4EG8A 5A9SA 1OUMA 1WZIA 4JX8A 4KXFB 4R8RA 5JMTA 4DR7B 3GAAA 1FFYA 3NH6A 1TO1E 1SXJE 2JI8A 1K6EA 1LW6E 4RACA 5EXXA 4MQFB 1O54A 3FWKA 5ESXA 4YXWA 2LE0A 2J32A 1TLTA 3CH4B 3CXUA 4H1VA 4TTTS 2JFVA 4CEHA 1QYWA 2C92A 1T3SA 2IYXA 4DL9A 3ASYA 1FDRA 5LUAA 1RZRD 1A4XA 4TQGA 3H2YA 3G1UA 2IVFA 1ZG3A 1TYZA 2I8CA 2LDBA 3GNLA 4KUEA 4B5LA 5DP1A 4D0GA 3FI9A 1TNDA 3N8IA 3VJMA </