2QQGA

Hst2 bound to adp-hpd, acetyllated histone h4 and nicotinamide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
291
Chain Sequence
MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase HST2
publication title Structural basis for nicotinamide inhibition and base exchange in sir2 enzymes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 96
structure length 291
sequence length 296
ec nomenclature ec 3.5.1.-:
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2qqgA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2qqgA01
5EJ6A 2JI9A 5MFZA 2Q5LA 2Q5OA 2BRUC 1ICIA 4K9QA 1EFPA 4BVHA 5EJMA 4J1TC 1Q14A 4MZXA 3EYAA 1PNQA 2VBFA 4BVGA 4JUAA 5EJ8A 2UZ1B 4ZP1A 5DGTA 4UTRA 4V1CI 1O97D 4BN4A 1M2NA 4L3OA 4V1CA 2EZ9A 4QPZA 1SZCA 2H2GA 4JUDX 5BWOA 4J16C 1T9AA 1PTJC 3FLMA 3CLTD 4BV3A 4HD8A 2AG1A 5BWNA 2H59A 1OZGA 2A1TR 2VK1A 4JUCA 5K6TA 4C7BA 2OO5C 4MPPA 2H2IA 1PNOA 5EJ4A 4UTVA 1EFVA 2PANA 1YHYA 1T9BA 2EZTA 3RIYA 4JUBA 2JIBA 4KPUA 2B4YA 4D5EA 5IMSA 3FSJX 2NXWA 2JI7A 1OZHA 2A1UA 2PGNA 1SZDA 4RMHA 1YC2A 4GG1A 3D4BA 3LQ1A 4UUAA 1BFDA 4RJJA 1U2GC 3EA4A 4K9KA 3CLUD 3GLTA 3IAFA 2OD2A 5K2OA 5EJ9A 2VK4A 1JSCA 3ZGVA 2EZUA 3K35A 5FEMA 4D5GA 4X3PA 4K9MA 4UUBA 4X3OA 3CLSD 2H2DA 5K6RA 4Y6LA 3E9YA 4JU8A 2WVAA 1S7GA 2IHTA 4RJKA 5BWLA 1S5PA 2VJYA 2HJHA 4FEGA 4Q9DA 3ZGOA 2C31A 5FYQA 4BN5A 3D81A 1M2JA 2NYRA 2VBGA 4K9OA 4RMIA 4JD5A 4L2IA 5AHKA 5K3SA 2FN3A 5DGDA 1U31A 2FSVC 1HZZC 4Y6OA 5EJ5A 5MF6A 2FR8C 4C78A 5DEIA 4K9NA 4TWIA 4TWJA 2WVGA 4BVEA 3CF4G 4COKA 1PI3A 1UPBA 3HWX1 4IF6A 4KGDA 1PYDA 3PKJA 4F4UA 3CLRD 2JLCA 2IHVA 1M2GA 1J8FA 1POWA 2H4FA 1V5EA 3F6BX 2H2HA 2VBIA 4JUFA 1MA3A 1U2DC 2UZ1A 3PKIA 1M2KA 1PT9A 1YI0A 2Q5JA 2V3WA 5MFPA 3ZG6A 2WVHA 4R8MA 2H2FA 4BVFA 2H4HA 3EY9A 5D7NA 4K9LA 1V5FA 3GLUA 4JSRA 4GPEA 4V1CB 3GLSA 2EZ4A 4RMGA 2Q29A 3OE1A 4I5IA 1PVDA 4O8ZA 4BV2A 4IAOA 1E3TA 2Q28A 4GM0A 2JLAA 1Y9DA 5EJAA 3JWPA 4QQ8A 4BVBA 3JR3A 2Q5QA 2OD9A 1POXA 1MCZA 1YTLA 3HWWA 1YNOA 4UTXA 1YBHA 4FVTA 4JT8A 1U28C 4JT9A 1NM5C 4ZZIA 1N0HA 1T9CA 4Y6QA 3U31A 1Z8NA 5EJ7A 2JI8A 1V5GA 4BUZA 1Q17A 1XLTC 1YHZA 1O96B 2OD7A 2X7JA 4GP9A 2H4JA 4QELA 1UPCA 1T9DA 3IAEA 4FEEA 4UU7A 4GM4A 2EZ8A 2FWNA 4F56A 4MPJA 2VK8A 4IG9A 4RMJA 1OVMA 1D4OA 2Q27A 1UPAA 4MPRA 1QPBA 2QQFA 2DJIA 1Q6ZA 3PDHA 2PGOA 2OORC 2W93A 4UTNA 1Q1AA 4UU8A 3F6EX 1OZFA 1PO7A 3FZNA 1M2HA 4FZ3A 4JU9A 4MQ5A 3U3DA 1YC5A 2AG0A 4HDAA 2IHUA 4KXQA 3RIGA 4GM1A 2QQGA 1DJLA 1YI1A 3GLRA 4K9PA 5MGNA 2FRDC 3D7KA 4RJIA 1ZPDA 4G1CA 2JI6A 4UTZA
chains in the Genus database with same CATH superfamily
1XD8A 1Y4SA 4U7FA 4K6GA 4RPHA 4W1RA 2G3YA 5C5EA 2H4ZA 3FOAA 1FJXA 2C98A 1SBHA 3H3XA 3IE2A 3PDIA 4W7HA 4C3OB 4CGZA 4U2DA 2O7SA 2QMUA 1DXQA 3V2UA 4BMXA 3FH0A 5CXQA 3C3YA 1YBVA 6GPBA 1HNZB 3L43A 4FFBA 1XPOA 2J5QA 4GI7A 5F23A 1X1DA 2DFPA 3SU8A 3VHRA 2NNLD 2WWGA 3NAZA 3ZWVA 3ZVMA 3P7MA 1GFIA 1V96A 4WUTA 5H80A 1XMVA 3NKFA 4BBPA 4UXHA 1KAHA 4G1VA 2RAPA 1DC4A 3MTQA 4TXMA 3LUBA 4JI1B 3DAYA 1GSIA 1KJ8A 3UA3A 4P84A 3ZOKA 5H4GA 4ALNA 1EDDA 2UZ1B 1YRHA 4RHUA 4UTRA 3P5BA 4WXRA 5K51A 2ZIEA 1Z33A 5A05A 3RS7A 1U3WA 1R4NA 4EY7A 3QOFA 3TLKA 1V45E 2B30A 2GZ2A 3FLBA 4H1WA 4DRZA 4MW4A 1M2NA 4QOJA 5A4FS 1NZDA 3DEIA 4IIXA 4PQGA 4IV8A 3ZKAA 1K6JA 2GAIA 1SZCA 2X2EA 4KLZA 3COJA 2B5WA 1TLFA 1H6DA 2G5TA 5B3AA 3KQSA 1URPA 2NAPA 4DM7A 1YE5A 1JQJC 5A71A 2YN0A 2PX6A 3EAFA 3FW1A 4NZYA 4POAA 1V26A 1I7NA 3G9ZA 3WBJA 5BWOA 1BNCA 4C6TA 1NKSA 2JCXA 4DTCA 1SUIA 4N39A 2CKDA 3FPAA 4D4KA 1XLTA 4Q4HB 1JQDA 1WVMA 2WMYA 2D0OB 1PJLA 5JMPA 2ZWPA 4PWZA 1SBZA 4EB6A 3ODGA 5GMOA 1VG8A 3R0XA 2A67A 4GMFA 1E1CB 2HDHA 3ZY4A 1YXMA 2D1SA 2VTVA 3HDJA 3N2KB 2NOAA 3NR2A 3HCEA 4I2VA 4DZZA 3EDYA 4ZT2A 2WF9A 1KH3A 3H0EA 2Q5FA 2VSXA 3IP7A 3OZEA 3QU7A 4IYRA 4KL8S 3PJGA 3PPXA 4IHAA 4ZHQF 4DSOA 1KC3A 1HXHA 3ACBA 3HB7A 1KMIY 3C6KA 4BCDA 1YIDA 2PMKA 1VHWA 3DLPX 3MYYA 5EG5A 4PAGA 1WMSA 4E1VA 3M6VA 2FZEA 2GFIA 1Z0FA 2CNKA 2HK7A 2R2AA 4QODA 5GJVC 4NYIR 2GNAA 5JXJA 1P0MA 3EULA 4RESA 3CKYA 1W4CA 2GZ1A 2HMVA 3E15A 5KJEA 3T0GA 2ZSJA 1LTHR 4TM7A 3X1XA 2XGSA 2Z5GA 5AVVA 3MJCA 3HU3A 5JQWA 3AEKA 3JYLA 1KZ9A 3PUHA 5KTYA 1VQ1A 1G21B 3RC9A 3LUAA 1P61B 5HW0A 3O82A 4QNRA 3VDMA 3HL0A 1SQSA 1FMTA 3CRNA 1NW9B 2J48A 3U3KA 4CG2A 5CA0B 3KELA 4NSNA 2UZ3A 2I4TA 4P5DA 3AX6A 4XH9B 2E4XA 2NW6A 3MAGA 2PZ8A 4YJHB 3EZFA 4BFUA 4U2CA 1DTWB 4OQYA 2SKEA 5EKUA 5KPDA 1GPYA 2B92A 1GDDA 2JI4A 4FSXA 4OPMA 1EJ6A 2R8YA 3MS2A 4FFLA 1V25A 4F4DA 5TF0A 4AM8A 1UMBB 1PJAA 5C46F 3BVPA 3HKDB 3RASA 4G37A 5LXTA 1XMSA 3HP1A 3HJCA 4RJJA 1Z2CA 1EVYA 4JYCA 3NEYA 2JHCA 4K9KA 4EPWA 2PXHA 4CF5A 5ITZA 4CV0A 5IAEA 2QF7A 3M9WA 3K2QA 3NETA 5F78A 3GJ6A 3SLGA 1MP0A 3B12A 4BB0A 4CMGA 2VP5A 1KK2A 3EGDB 1OFIA 2DQKA 4G89A 1UQRA 2AEFA 4UBNA 4X60A 6YASA 3B3GA 5K0TA 4QARA 4EMSA 3IQDB 3HBMA 2H3HA 2NU6A 4E09A 1HNNA 1UBRS 4UTPA 1NASA 1K6MA 1NPDA 4BO5A 3ZGVA 4XRGA 2WI8A 4ZOBA 1MABA 5HPYB 2XUJA 1VPWA 3HPRA 1DJNA 5KYKA 2DPMA 1JDSA 3HBAA 3S4YA 3G82C 4B2YA 3TZLA 4D5EA 2P3SA 3KE8A 4QKQA 3T61A 3CLSD 1QHIA 3UCFA 3BBLA 2YV1A 1ESEA 2BUAA 1N2CA 3VO2A 3JQEA 1DCMA 4R5MA 3TW8A 1JZTA 1YZNA 2AQIA 3AGQA 3SC6A 3RYCA 2LDXA 5CT5A 4CM3A 1IY2A 1NN0A 2Z4TA 3DTVB 3H1FA 3I2YX 1VKNA 3L6EA 4D3DA 1ZOOA 2PPLA 3VMFA 4JEUA 4FEGA 1A9XB 4QLOA 5CA0F 3RLFA 1ZMBA 1R66A 4BJ3A 1EQAA 2QJFA 3CBGA 3Q6MA 4HAWA 4NBRA 3U7QA 3JYPA 3F74A 4INAA 3S70A 5KNCD 5LJIA 4MMYB 2W2OA 3CWQA 4ZOCA 4NAUA 4J1TA 4K9OA 1XEXB 4BNVA 1X9GA 5EI5A 1PNRA 5ILQA 4GYWA 2BONA 1DG1G 1I4LD 1Q0QA 4Y18A 2EHJA 1JEAA 3IBTA 3U49A 3LFUA 1IBLB 4DMCA 1ZOLA 5AHKA 4B4WA 4B3GA 5HSGA 1RRCA 2PLRA 4Z8YA 2R86A 5DIZA 3RUFA 1QS0A 1DB3A 3CH7A 3F6YA 1XC7A 3LT0A 3JQAB 4LX8A 4NJOA 5IAAA 2ZSFA 3UBTA 4IFEA 4DG5A 2EL7A 2AXQA 4EG1A 4UAVA 1DDOA 3TK1A 2CLOB 5KTMA 1QH8B 4N3AA 3ZR4B 4K9NA 4RD3A 1H1LA 5E6RB 4EHBA 2ATXA 2VNAA 4PS0A 5CK5A 1NP3A 1OT3A 4C89A 2Y9PB 1HG0A 4C4AA 4NU5A 1XT6A 4QTTB 5I9LA 4D26A 4M53A 5BW5A 1P29A 4HH3C 4CL8A 4MJ3A 3S2GA 4GZMA 2XZLA 2Z8XA 1JHRA 3QWBA 2ZB8A 1E0SA 1GPLA 2I3GA 4JFAA 3W2GA 3ZWCA 1RPZA 3BM5A 1ZRNA 3EUAA 1G7SA 1Z4OA 3NDJA 1PZXA 3A2NA 4R01A 4X6UA 1BMFD 4QSMA 3ZBQA 4JQOA 1JEEA 3M34A 3PHCA 5H1YA 4ARZB 5AVJA 5K0SA 2BKVA 3FPCA 3QTBA 1H6CA 1YOBA 3Q7SA 4URUR 4F4IA 1KQFA 3CEMA 4RCYA 1EB8A 2DTXA 4KODA 5FTJA 5LDDC 1T2AA 1TFUA 2HO5A 3IIMA 1FPQA 4NBNA 3LC2O 3R1IA 1XROA 3L7LA 4ZI7B 1J8FA 4EFDA 3LDGA 4V0LA 5FB3A 2DF8A 3WLAA 1ZKDA 2GAJA 2Q4BA 2TRSB 4ZREA 3AB3A 1BH2A 2PRJA 2UZ1A 2PDAA 5JW6A 3JZFA 1I4EB 3EDMA 4XR9A 2J07A 5FPQA 5JYBA 4YCSA 1FZTA 3FVQA 2FZVA 3CNBA 4XYMA 5I7WA 4N8DA 3W6OA 1T1GA 3SYTA 2WJAA 3KYBA 2WBLC 3TOCA 5G0TA 4KIFA 2MSEB 5C8XA 2YXEA 3VZDA 1YJ5A 2FZKA 1C3XA 1JAIA 4UHKA 2CHQA 4D92A 4YRBA 4YUAA 4EWLA 3P52A 3K0CA 2ZYWX 4IOJA 1KTVA 2V97A 3ETDA 4HS9A 2D2XA 4LYJA 4HZUB 2FUNB 4MV1A 2B25A 4DILA 4BVFA 4Q3OA 3KZNA 1NX9A 2FMIA 2JGEA 3ZQKA 2Y1CA 3OZAA 3ZHVA 2AD1A 2NYAA 2MSCB 3NWOA 2VDMB 3MLBA 2Y77A 1RJWA 2PMBA 3BORA 3CSSA 1S4QA 4FMCF 5T5QA 4KYVA 3VV3A 3QEOA 4Q4HA 5DYYA 3QYAA 4P4TA 3G5AA 2ZULA 1QIFA 2JHPA 5T4BA 4G0QA 3WSTA 4BBAA 1AX9A 5CPFA 2O7NA 5IKOA 1JFFB 3VGPA 3W8DA 1QP7A 4JMLA 1C4WA 1Y1PA 5HUQA 1FVFA 1E1CA 1G7RA 1I5RA 2GLXA 2H8KA 2QXYA 3I52A 3N2KA 2D5AA 3ZCSA 3EFHA 3EAGA 4S05A 4KHPB 1ZEMA 3TLCA 4GPEA 2XQIA 4D44A 3NDBB 3AVUA 1DP4A 2QRUA 5DYWA 4B4OA 1FE8A 2VNKA 4ZAWA 3H05A 1DAIA 2PEZA 2H7XA 2B21A 2B69A 1QRSA 3M6AA 4ER7A 2DOKA 1OFVA 2I33A 1WTAA 3M6UA 4ZI7F 1V8ZA 3G7SA 4O8ZA 4MDYA 4X7PA 5BW8A 2AMVA 1EFAA 2QZZA 3JQ8B 3GVXA 2Y2UA 2C99A 1RXEA 3V2HA 1GPAA 2HSWA 1U2TA 1K5HA 4NBSA 2A0WA 4CI9A 4NZOA 4FYWA 4TMFA 2O5EA 1YS2X 3I9NA 1G21A 1Z12A 3BDAA 1Y48E 3CLSC 4YRPA 4WBNB 4Y7CA 3F0TA 1JFTA 2MJLA 2VSNA 1NMQA 2OCBA 4PRZA 4NEQA 4EQ6B 2CFTA 5ALKA 5AM1A 3RIMA 5TX7A 1B8NA 1CUFA 5HKLA 2UVPB 5CA0A 2WPNA 4XB6B 1B3RA 1R18A 4NEHB 4WINA 2V7XA 3UV7A 3D43A 2VDLB 3WYDA 2BEVB 3SX0A 3M6IA 3KJFA 1B73A 1INLA 4YJHA 5B1DA 2FJPA 3QXSA 4MQUA 4RVHA 1DTWA 3AEXA 1BOFA 4X1OA 2CXNA 3WISA 3AMVA 4ERXA 2VC2B 3CSDA 3F3MA 5HIJA 3ZC3A 3M83A 4PWYA 1SUBA 3CPSA 3KKQA 1Z0IA 4UJ3A 5CRIA 3SZLA 4BNHA 3ANNA 4PQYA 1ZD9A 1N9ZA 1J0AA 1UMBA 1I3OA 3FKSA 4TTQA 1EIZA 3QU2A 1OWPA 2CVZA 3ZV6A 4QM6A 1CG6A 3HKDA 3NBQA 1N0HA 4HVTA 3RAJA 3QFSA 5KVVA 2C77A 3RFFA 2CZGA 2J59A 1QMGA 3EISA 5GONB 1VDMA 2EKLA 1EUCB 2EJUA 2IFTA 1V3TA 2YMMA 2ILVA 1HDCA 4FHDA 4PZCA 2IYSA 5ALEA 3CW8X 2QV0A 3EGDA 4WJZA 4D0SA 1RFLA 3R6DA 2QM8A 3DMTC 4YP9A 1GNPA 4I9NA 4CQMD 3I0ZA 1OHHD 2XVMA 2Z3WA 3MHPA 4BVAA 4AJNA 3D6FA 3QBDA 2CUKA 2HKIA 3P9KA 3DUWA 3BWXA 2APJA 1J23A 2VJBA 3WIBA 1LBTA 3LTNC 4FKZA 2ZXUA 3FOZA 1HE8B 4S0XA 2VXCA 5DBFA 3EUEA 2FB9A 4YDRA 2W58A 3AR4A 3FNRA 1R8SA 4WKGA 2A57A 1KY3A 3ZCQA 2GJKA 1QOPB 1TGVA 1YJAA 3PYLA 4XTCS 5ERYA 1EAMA 4RPJA 3TIIA 1CJUC 1TYDE 4YP6A 1PHRA 4GPIB 2E5WA 3R6LA 1XMOB 3VH2A 4JBYA 3GL9A 3T5BA 5JYDA 4F56A 2C9ZA 3UG7A 2ZAOA 5HZKA 4MK4A 2ZGVA 1JR3D 3DTVA 2MIIA 5KYNA 5JS1A 1KEUA 1A9XA 1LPNA 3W2EA 1EE9A 2I1WA 5MHTA 3JTMA 3WL8A 3CISA 3A4IA 1XRSB 2QRHA 1GCUA 3H5TA 4QDZA 4FILA 3SZMA 2GPWA 2G40A 5EUQB 2JLXA 1R6XA 2RCYA 3O47A 1XBTA 1XK7A 4RV4A 4RMJA 2PCJA 1F9EA 2I7DA 1OVMA 1CEEA 3U9LA 4DR4B 2X41A 2RONA 5G40A 5FH9A 5E0OA 1XEXA 4LHEA 3GJYA 3KALA 4UNSA 3E48A 1E62A 1T36B 2I6GA 5G2OA 1QC5B 2ZUFA 1ILEA 1M5RA 3PRYA 1IOLA 1UT6A 5DLYA 5DISB 1EEXB 1E5DA 2C3OA 2NTYC 2YUTA 4K86A 1XYYA 4NABA 5G4KB 3NYRA 3VPHA 5GONF 3JQAA 3HJGA 5DVZA 1OTHA 1WB6A 1R5OA 1P3Y1 1SHUX 1L7NA 3CZ9A 2C9MA 3OICA 4QU5A 4Y9RA 1M6YA 4AULA 4DG9A 1WZ2A 2A0KA 4QOFA 4C30A 3W4JA 3RBXA 1QH8A 1XZLA 1Z47A 2Z9BA 4O5AA 2XHEA 2QN9A 1MFPA 1T1RA 3GFTA 5LC1A 1T6BY 4K2HA 4OL9A 1WXFA 2XADA 4J7UA 2CLLB 4QOEA 1B8VA 1D8TA 1TMGE 2G4CA 2IEGA 2C83A 1AGPA 1Q20A 2PU7A 3ESAA 4BLQA 4YR9A 3K70C 2XMQA 4OP2A 1NW5A 1YB1A 2NO4A 2VTEA 3OIDA 4BC0A 1TAUA 1T5LA 4EBBA 4L8FA 4PFQA 3ERCA 4JODA 4TSKA 3WLPA 1E2PA 1SKUA 2W6JD 3WK7A 4B45A 4Q1FA 1FLNA 3VYWA 3OFNA 1DEKA 4L2IB 3EFBA 1SN7A 2P2CA 2X0DA 4CCAA 1ZLXA 2C9DA 2ZI4A 3BXOA 3L6UA 4YAJA 1E58A 3RKUA 2VWHA 3NVDA 3CVYA 4L5CA 4XWKA 4ARZA 2ZDHA 1I2CA 2IHUA 3NEAA 1Q2XA 5F76A 3VAZA 1TTHA 2O2ZA 2ACKA 2IEIA 1N6LA 4GOLD 2CXXA 3QKRB 4Q3LA 2QPLA 3IQHX 1SIUA 4JLWA 1NRXA 1E4OA 4ZI7A 3GLRA 2FWMX 2G6BA 3HCNA 2BH2A 1RHQA 2GXUA 3QUQA 4G0NA 5EJGA 4DQVA 4WEOA 3AUUA 5BYAA 2NP6A 4KU4A 4C0LA 2ECKA 5AYVA 1BC5A 5ALPA 3P20A 4C14A 3MVEA 4WN9B 5C5DA 2VYFA 3P2JA 1JJ7A 1JJFA 1JV2B 1V9LA 2JEZA 2Q2NA 2FSIA 1NUAA 1TQDA 2GYYA 2OP0A 2W6ID 3OPQA 3L7OA 3RTBA 3SC4A 4B3SB 2X3YA 2RAVA 4L73A 1I7SB 3FPLA 4IXDA 2Z2YA 4PYOA 3IPXA 3RODA 5KTPA 1A97A 2ZRPA 3JYHA 3NT2A 1TZJA 2VBCA 5EUMA 5F2EA 3MUOA 1L7DA 5JPCA 2XUHA 1XI2A 3ROXA 3WWZA 5CLJA 3NHZA 4UHFA 3RJZA 3UHPA 4E6PA 2B8EA 4HGQA 2OM6A 4HZUA 4HGOA 3BQNB 4LTDA 5CM9C 3O8CA 4XWAA 3FPFA 4BQQA 3DZDA 5C1IA 1AOXA 4JI0B 4LVCA 1JJVA 5BP7A 4BWVA 4QATA 1MD9A 5D5HA 3AV0B 1I3KA 3FHOA 4KOEC 4DIUA 4EG4A 5CVDA 3T12A 3AUYA 1RZRA 5REQB 2FN7A 3UXMA 5F5NA 2KWIA 2QT9A 2WC1A 3OIGA 1IK6A 1FFWA 2IYZA 1BAPA 3GEDA 4I1YA 5KKAA 1DT3A 4FINA 4EKNB 5L7WA 1JFFA 1A4UA 3NYQA 4INPA 1PGNA 1LJUA 1N3YA 3EE6A 3KJNA 1NVMB 5GZ6A 1DRVA 2ZYUX 3BDVA 1A8SA 2V7BA 2ZB4A 3WNVA 4NQRA 1P4AA 3TXYA 3DZGA 5A02A 2UUPA 1UP7A 4DJJA 1RE1A 1BE1A 4U0JA 4KBGA 3P5SA 3I09A 4RIFA 3BB4A 3IQWA 2I8LA 4H6PA 4RAOA 5EYPB 4YV0A 4WKBA 2JATA 4CIVA 2SCUB 1JQKA 3FF1A 1JH9A 1WABA 1LLFA 1P9NA 3LQYA 4R2XA 2W5UA 1ESDA 2AW5A 3R7WB 2QLJA 2JJ2A 3JQ8A 3A4TA 2Z08A 4DCMA 1P0FA 3EH1A 1Z83A 2ZQ5A 3AT1A 4X20B 4ZT7A 5L3ZA 1MDFA 3D0RA 3SHQA 1D4ZA 2Q41A 1K66A 1LH0A 1JR4A 3U9SA 3D2BA 3TM5A 3VJMA 2V0CA 4S0ZA 3TNFA 3CMMA 2Y4OA 4WBNA 3DMGA 3KZCA 3FNHA 3LGAA 1KJNA 3O8LA 4DZRA 4LSGA 2H08A 3V1UA 2ZAIA 1ST3A 1EXDA 4RZXA 2V4MA 4P7KA 3NHUA 4PC3A 2R8OA 1FTYA 2UVPA 3E9RA 3IJEB 4TSFA 4OP1A 5AUQA 4AYXA 4UQLA 5K6TA 2IDKA 3ANMA 2VJNA 3P0HA 3K7EA 2BEVA 3SNKA 2ZRQA 1F3OA 3FYUB 1M8JA 4AQDA 3O8RA 3ZVNA 4M0LA 3OJWA 5M7EA 4R41A 1Q0UA 2E2WA 2NADA 1J2UA 4IKEA 4EUSA 2XSZD 2J31A 1V7ZA 4LK3A 3L8ZA 1A88A 1TYAE 4G07A 1JWBB 2DHCA 4D4LA 1IVYA 1HRDA 3EZ6A 1NF9A 2C2OA 4MO2A 4LZJA 4MV6A 4BAZA 1IXSB 4UULA 2WWYA 3FR7A 3OE7A 1KR2A 4JI3B 4CQLB 4AQ7A 1U3DA 1S0UA 3DMYA 2GBLC 4Y6SA 2WNSA 2BLNA 2PLFA 2GILA 5GONA 1EUCA 1GZ4A 1LZKA 3KS9A 4LCJA 5EXTA 5G1PA 3MCVA 1NBAA 2W8ZA 4AIIA 1PZNA 4WRRA 1P2BA 3UT5B 2GHIA 2WJIA 1H4TA 4HJXA 5LZ5A 1R27A 1VXRA 1Z18A 2A0UA 4C5AA 2PZFA 1CB0A 1P5FA 3ETCA 3ID6C 2KSQA 5H16A 1OI3A 3TJRA 2OM2A 3VR0A 1JI3A 4QDJA 5GM2A 4MS1B 3BICA 4Q9LA 2YZ7A 2BJHA 3NDIA 4MV8A 3RRFA 1AUOA 4N3BA 4BL5A 1Y42X 2FQYA 1Y1QA 3SHOA 2QG6A 4ROSA 3O8OB 2GM9A 2QDXA 3A1WA 4LISA 4OAQA 4E13A 5EP3A 1I2DA 1K3UB 2BH9A 3EA4A 2XB8A 4OQZA 2IELA 2ONYA 3K0KA 4E3ZA 2CJFA 1R6VA 2Z9DA 4G81A 4N65A 5U4QA 3LOUA 3IUJA 2XNKA 4QQNA 2B34A 2ASVA 1ISFA 4AUNA 5TQ0B 4YO7A 5F4BA 4DIBA 5CGQB 2VRNA 3MCWA 3EZ9A 4YMGA 2DLCX 4RIHA 3ND9A 1VLZA 1D03A 3AXTA 3BGDA 3I8SA 3F9CA 2A9OA 2JGDB 2DFLA 3BWDD 4FHFA 4LJAA 2QV7A 4HDMB 5AICA 3ZTWA 4D4GA 5IANA 4JI4B 3AM1A 4X8OA 1Y5NA 5T6MA 4MQ6A 3UWKA 5ER6A 2WT9A 4Y0VA 4OK5A 4H7JA 1M8KA 1T36A 3MCTA 3IQXA 4E3WA 1QC5A 2IT1A 1XVUA 4ZK2A 1YU9A 1WW8A 5DNEA 4JU8A 1J4AA 3PQ5A 3LWNA 5G4KA 2OHVA 5FLEX 1Y8AA 3AZQA 4Y2TA 8MHTA 3TRIA 5EHNA 4WK4B 5KQMA 3I01A 2J4FA 4LC0A 1XKTA 4Q19A 4NENB 3SYMA 2KB0A 5AWFC 4ZVMA 2DM6A 1T6NA 4DR2B 4W1SA 2IEAA 1C8KA 5ADHA 1TADA 2BKXA 4JOSA 5D1NA 2XJ9A 1BZYA 1J39A 3D4LA 4AD8A 3S29A 1M2JA 1ZY2A 2RB5A 1XMIA 4FN4A 5L9AA 2ZM5A 5K3CA 3BWCA 4JJ4A 1U3FA 3ZQ4A 2VBGA 1FP2A 2DAPA 3WWYA 1OT5A 2O4CA 5LP6C 1ZI8A 1N6HA 1SHJA 3M1YA 4O33A 1C1HA 5TJ9A 1X9IA 2HHHB 4RY9A 4L2IA 5DIFA 3HGTA 4J0KA 2VRBA 4BEVA 2VZ8A 1GQOA 3CCCA 2GTIA 2PLWA 2Q3LA 1OAOC 1B6SA 2OCKA 4A92A 4XUEA 1KC1A 4MSUA 3V8PA 1YB2A 1NJ8A 2AT1A 2YHAA 4LDJA 4N54A 1L0BA 3QKRA 2DCUA 2ERYA 5EJ5A 1DAOA 1VRCA 3Q2KA 4GPBA 5DWDA 1L4NA 5GPBA 1OOEA 1EHYA 2HU2A 3QTTA 5F64A 4DQKA 3AVTA 4P2GA 2VNIA 3H9EO 3P0FA 1T4DA 3RBAA 1XZNA 1ZN7A 3GY0A 2WVGA 3DULA 2QNIA 1RVDA 1BDMA 3MRVA 3R3VA 4B0PA 4MB6A 1YZ3A 4WN9A 4OHRA 3HCOA 4QXOA 4ZO7A 2OV6A 5F52A 1P5JA 1R4AA 2X15A 4PPYA 3S1AB 4J8PA 1GGHA 3QY0A 5KKNB 1ZHFA 2OZLB 2BT4A 4KXNA 3FIJA 3ME5A 4DUYB 1GNTA 1C4KA 2VJKA 3CKMA 5E4JA 1RRFA 2VLIA 3AI2A 5LLTA 4EUEA 5CDTA 2VJDA 3O0DA 2RHOA 1EH5A 1T35A 4X8MA 1ZD4A 1AB6A 3OOJA 4KPYA 3F9RA 1E1RD 4HC4A 4ZT3A 4LF6B 3S2IA 2ZUDA 4EG0A 5TS2A 4R1PA 2OC9A 1NJ2A 3ZIUA 5CB4B 1X1RA 2VT2A 2NT3A 4EA8A 3KVOA 2CDAA 2VBIA 5HM8A 2OCPA 4DDMA 2BCJQ 5E7MA 4EPYA 4FDMA 2J9YB 2QE7D 2XWBF 3PL1A 5REQA 5BV1A 2UYCA 1QJ4A 3TN7A 1H2FA 2A30A 4A8JC 3I9KA 2FRXA 1PYOA 5AXBA 1FTQA 5FTLA 4JLSA 5E9WA 3U16A 1UT8A 4CCSA 3FNFA 1Y9AA 4RF4A 4X54A 1UXIA 4QU8A 1E0AA 2WTBA 3QVTA 5CJ2A 3DW1X 1DWOA 3RYTC 4Z1MD 3M6WA 1ADYA 3LLVA 1PS9A 2IDMA 1GLVA 3R9XB 3EIOA 2QR2A 1IN6A 1RLJA 3D59A 3JWGA 1AHNA 1VMAA 5EYPA 3UW3A 4E31A 3K9QO 1RHRA 3ILYA 4W8GA 2SCUA 4QUKA 1VLVA 3QOWA 1M2EA 4LX0A 1AHIA 2QRJA 1NG9A 4XQCA 1ZD3A 1U7WA 2R79A 3K2BA 4K46A 1W30A 2ZJAA 5LBTA 1FL9A 3REGA 4BLPA 3IAXA 3R7WA 3Q3EA 5JNLA 2WINI 2ZUCA 3INYA 4RQUA 4L3WA 4Z7JA 1EB9A 1Q6YA 3V1MA 4X20A 5IK2D 3C98A 4LF7B 1TL7C 5EUCA 1YQTA 1Y5LA 1SB9A 1F2VA 1RNLA 2OVFA 4GKBA 3UH0A 4ZGGA 5B6IA 2X6QA 3OWXA 1NR1A 3WMWA 1PGOA 1AURA 1UBKS 2HOQA 3M82A 1PJSA 2IRWA 3DBRB 3FM9A 4KQ1A 4WK6A 5DYNA 4DWOA 3GNQA 2H17A 1IVNA 2R62A 1JDBB 2ASEA 2C7BA 3TFOA 5FBHA 5GIPE 1JLLB 1DKUA 3AJDA 1PX2A 2GHQA 2QG9A 2QLBA 1Q1EA 1SXGA 1VB3A 2HPHA 3AP3A 2ZP1A 3FYUA 2FPLA 2Q29A 3DT6A 1ZZEA 3FETA 4R0VA 3ROMA 1RE0A 1TO6A 3LLCA 2D74A 1X87A 1P6QA 2V5AA 1TW3A 3I83A 1WMDA 3G2NA 4QPNA 4ZOLF 4RF3A 4FOOA 4IAOA 4M0MA 2EJBA 3N5KA 3PGXA 1TF7A 3FUWA 3GARA 4LGYA 1DAGA 1NSYA 3DL2A 4LXXA 4CV2A 3U7EB 4H1UA 3B7WA 4JROA 5CT4A 4BDSA 4CQLA 3KEMA 3PWSA 1W1UA 3PVCA 5HF5A 1MEOA 1WM1A 2Q5QA 2OXIA 1TRHA 2Q8QA 2V7QA 1OBHA 4YBRA 2JAWA 1LTKA 3M5PA 3EWAA 3UT5A 2DGDA 3FCXA 4GD3Q 1KFCB 2Q7DA 5LL6P 3OPXA 2BDEA 3N8NA 4GQIA 4MUEA 2FF7A 4UFNA 4AP6A 3LQQA 3V7YA 4R71A 2ZREA 2WKRA 4GU5A 3ADDA 1YZUA 1YBHA 4U7HA 3Q2IA 1HM5A 5K4AA 1LI4A 4N7JA 3ETNA 2XZOA 4MS1A 1U28C 4CR6A 3UGJA 3DDOA 3S68A 1ORHA 2O1XA 5AJWA 2GARA 4KJZA 4MVJA 2VPPA 3V4FA 1N36B 2QTNA 2ZBUA 2ZBRA 5CURA 5C8DA 3O8OA 3JVEA 1MX5A 1SUFA 1BFUA 3WGOA 1IL0A 1FSZA 1BSVA 1JSLA 1UF9A 3GGOA 3HQ4O 3HSKA 3HUTA 3MBOA 3NI2A 3FOWA 1LFDB 1SHZA 1CV2A 4LOIA 2VPYA 1IJKA 1B1AA 3UAGA 3L92A 3CF0A 4BP3A 1QU2A 1FPMA 1PS0A 4S2UA 2FWAA 4L4YA 2IYXA 4M89A 4GZ6A 4Q7JB 2DUUA 2IYUA 2XZPA 1G4UR 2HX1A 3C5EA 4QXMA 5TQ0A 4URVR 5DM2A 3UMBA 2A58A 3C5VA 5FOSA 3R9KA 2YV5A 1NM5A 4LEIA 4ZC1A 5HTKA 4C43A 5KKCA 1AS0A 3FHTA 4R05A 4ZAZA 1NYQA 2JGDA 2YCLA 2P0EA 4HDMA 1N3IA 1HZZA 4KI7A 4UW9A 4DIEA 4MS3B 4EW3A 1UPCA 2B4AA 1X38A 1IXKA 1TF5A 1ZGBA 2WYWA 4QGBA 2ODWA 3HY4A 2QD5A 4LCEA 1MVOA 4Y98A 2C95A 2EZ8A 4YCAA 1EDEA 2JA2A 3EGOA 2C1ZA 3EVDA 2AC2A 1G5RA 1SUWA 4XDYA 4BRZA 4LOJA 2IYPA 2C4UA 4HZIA 4JQSA 1TCUA 4CPDA 2C61A 3S2EA 3OOWA 3L05A 3VVLA 4LNUB 5LWHA 4BTEA 1TDJA 4K26A 5I4BA 2BGUA 5CJJA 2AYZA 1JR6A 1HETA 4MCJA 4OCZA 1V16B 4NENA 4BQIA 4CW7A 2IUTA 2B1GA 2CBGA 3WRWA 2C8KA 4H1HA 3CUUA 5D85A 3M6MD 4B3HA 3W5AA 1XVIA 1O4WA 5JFGA 1O5IA 3GOHA 1IN8A 2AGVA 2ZATA 3GQVA 3IMKA 4PHTA 3I5YA 1EGMB 3AUJB 1ZMTA 1W93A 1J9GA 3HV0A 3O4GA 2R6GA 3E82A 3FAZA 3M0EA 3MW8A 4E46A 5K8UA 1HH4A 4GXTA 4NE9A 3PNLA 3DTTA 1L1FA 3JD3A 4F84A 4JR2A 5B4UA 2CBZA 3LXXA 3R7AA 3CC8A 2NZVG 1TMKA 4JHLA 4MQMA 4CUZA 1N6IA 1YU6A 3BIOA 5I3CA 1W4BA 1W46A 4B6QA 4HB2A 2Q4OA 3D9QX 3O84A 3WP1B 2A9PA 4D6PA 3KKEA 2R6FA 3CEAA 1L5KA 4MUIA 1T9KA 1XCLA 2PWAA 3HZZA 4MRSA 2WQ7A 3OQVA 2HPZA 4FHZA 3KJIA 1OFUX 2WSYB 4EL5A 2VYQA 4GLJA 2VT6A 4JGGA 3H18A 1FU8A 3DO5A 4HN2A 3CE9A 3UJ6A 2IWHA 3UAYA 1BEZA 1P7WA 5B12A 3NM4A 5ICSA 2YYYA 2LKCA 721PA 3DL7A 1ULUA 3CTPA 5AKYA 1ADBA 3QENA 3F6EX 5ALYA 2YJNA 3X1WA 1Y3IA 2IOQA 2H0QA 2Z9CA 5BVHB 2J87A 1HA3A 1NVTA 1FFEA 2LRHA 3JQCA 5FUXA 3S1AA 1KIMA 2CV0A 1P73A 3AUAA 1CRZA 4FZ3A 3T3EA 2OZLA 4OHFA 4FBLA 2EKPA 2JLWA 1XTIA 5GV8A 4PNPA 1KJQA 1ISIA 4YRRA 2JDIA 4NARA 4Z86A 4PX2A 2ICAA 2PSJA 4ZICA 3V55A 4Z0HO 1R7RA 3PQ7A 4JLUA 1U5AA 4N47A 1H2EA 2HRZA 1DJLA 2R8RA 3CX8A 4M1SA 4QPCA 4R1NA 4XQ9A 3VNAA 3B5EA 4EIWA 4FWBA 1OA1A 2XI4A 2XNCA 1A5BB 3OTHA 1H42A 2QL5A 5CB4A 5L6LB 3P4UA 4B3TB 5IAGA 1YBFA 3K32A 4UTZA 4U7GA 3UHFA 4DIFA 5I9IA 1V2GA 3STHA 4YIKA 1QP4A 1J06A 3QI2A 4Q1BA 4F8EA 4RM2A 4XGQA 1WF3A 2YWDA 3H8VA 2OUIA 3W78A 3KZKA 2DJ5A 1YB5A 1Z28A 2EX1A 3W8FA 4K6FA 4CF7A 2E7ZA 2IPAB 2EVWX 4TTSA 2Q0HA 1YE8A 3VJKA 1Y1KE 2HMUA 4KMMA 4EW1A 2VKQA 3O2NA 2C2GA 3FFAA 2PMCA 4QYSA 3IQIX 1HT1E 2G9RA 3ROKA 2OZKA 3STYA 4BQNA 4E1BA 4UQPA 5A9RA 2EP5A 5EIBD 3R9XA 5FFMA 4OQNA 1OXTA 2XCIA 2IS1A 2DMRA 1JSZA 3GUUA 4KFRA 4OHMA 3W6ZA 3ZHBA 4TMXA 4NMXB 4MZXA 1DQYA 2VSOA 3UANA 1I6MA 3C3EA 2AQHA 2GPSA 2AUTA 2Y1LA 3BD8A 3ICCA 5CCEA 5JO0A 1S3FA 1G66A 1TQ6A 2FEMA 4BVGA 1T4BA 3CZMA 1GILA 3UAXA 1P2FA 1SCQA 1PJCA 4B3JA 4QYTA 3T0FA 4QBTA 2PUFA 3CYFA 1CDEA 3F5MA 4OHPA 4PNHA 5FNVF 1CJBA 4KWIA 3WLMA 5HZMA 5BOSB 2V98A 2WU4A 4MYHA 3DBRA 1T24A 3BHMA 4ZQHA 5EWLB 1PR9A 2QN8A 4Q0MA 2C2HA 2GK3A 2PBRA 5GADl 3FYHA 2BGWA 1JLLA 5HWSA 3ORQA 3TX6A 2WLSA 3HRKA 3W5JA 4QPZA 4HI0E 1CZHA 1E66A 2Y9MB 2IIBA 3QU5A 1X0VA 1P45A 3PZRA 3ITKA 4JBXA 3N6RA 2NZXA 4QUGA 2XCQA 5C1BA 2C5LA 3O31A 2FVXA 4PZUA 5ILOA 3WGGA 1GQYA 1EUYA 2OBXA 3K09C 1N2HA 3EDRA 2P68A 3KQVA 5LYYA 3MTBA 1ULZA 2UDPA 4X7RA 1MAUA 1ESMA 1ONPA 2H59A 2PWBA 3TD6A 4BNUA 3JD0A 4QFDA 5TQVA 1SOAA 4I99A 2O1WA 3LL7A 4IIYA 5DSXA 4Q47A 5JY1A 2FOLA 3CLTC 4R1OA 1J9ZA 4CMIA 2X40A 2WJ4A 4JUCA 5A5VA 3A1DA 2YOGA 3K5HA 4DV2B 5KNDD 1ZGCA 4HQLA 3SEAA 1VSQA 2EFEB 3IPRA 4F9TA 4MJXA 1ODIA 4JYBA 1GGEA 1HOXA 4ZARA 1J97A 3UUEA 1OW3B 5FUBA 2H2IA 1J2RA 3PUIA 4KTTE 2W2LA 5AVXA 2O8EB 3THSA 3ZDRA 3R5FA 2FW1A 2NZ2A 3KZ1E 4IJ6A 2WYHA 3EDQA 3FGOA 5A7GA 5FFNA 1RWQA 4YCJA 3U3RA 2XITA 3W2TA 1UEJA 3GT0A 1BWSA 2UYGA 1LRJA 4M6WB 1NDHA 2OLJA 4MS4B 1E4EB 2XKAA 3Q0IA 4JELA 1GDHA 3L0YA 4X41A 2JIBA 3GP8A 2DY1A 4PGMA 3R23A 1EX9A 3VOTA 3IL2A 4WGFA 4DCJA 1C8BA 2HWWA 3Q7EA 5CFRA 4DUGA 3RFVA 3S27A 5K01A 4F86A 2BF7A 3AHEA 1T8PA 1ADCA 4FOPA 2AN3A 4KX3A 4N0QA 3U17A 4DABA 4FFNA 3BDIA 1UDBA 1VGQA 1KORA 4HWGA 5H4HA 1XZIA 1ISHA 4LFCB 1W36D 4IDFA 5I4CA 1EP9A 3IJRA 3G8AA 2JGMA 4RZIA 2ZTUA 4EENA 5KUTA 1P7ZA 2Y2VA 3A70A 3N3AC 2F6RA 1G8MA 2C4NA 2HU7A 3EIHA 2IOFA 3PS9A 3Q88A 2ZCVA 5JJBA 4C1BA 1BYIA 1I51A 4QM7A 1UAAA 2XVYA 4QYXA 4WL0A 5H82A 1IXZA 3E9EA 1VSVA 3HCPA 1S6YA 3HNPA 4EG6A 3HZOA 2VF2A 1QGED 4DEYA 4UE2A 1C1DB 1UZNA 3HKEB 4LNUA 5JY6A 1XPUA 3A0RB 3W77A 4UM9D 4ZZ2A 3ZZMA 1SBYA 3OAAD 4QO8A 1V16A 3EVAA 1IDOA 2NACA 3LU1A 3PNQA 4WKNA 3BMOB 5HZHA 1YFJA 3IP8A 2Y0PA 4CI0B 1T3TA 4PO9A 5AM2A 3R7BA 2EEZA 3EIQA 1IULA 5B64A 5AFSA 5BUCA 2HHCA 4MCHA 5EJ9A 2ZROA 4X44A 1XKLA 2HEGA 2JGAA 3BB3A 3WDSA 5E38A 1L5SA 3CJQA 3FHCB 3JZMA 3S7ZA 1D9XA 5SY4A 4MVJP 5BPHA 2ZBVA 4KKVA 2GEDA 4R9NA 5BNWA 1B7GO 4JDUA 3ISJA 2RGWA 3B48A 5HOEA 4DMFA 3NBMA 2B8TA 1WUYA 4RV9A 1HNWB 1NQWA 1YZYA 2NO5A 5BMVB 1THTA 2QLTA 5KC9A 3EIEA 4BQEA 1GPNA 4JBWA 4FMDB 2G1JA 2I4IA 4CMBA 2BVNA 1F9AA 2WT8A 2KPOA 1TCBA 4QYIB 4GICA 1S1MA 4GQBA 3ZDEA 4YCCA 1XP8A 2VL7A 5DOVA 1NF3A 3SP1A 4N5DA 2AS0A 1ODJA 3T1TA 3F78A 2R6R1 3L07A 3W90A 4X94A 5EMLA 1SXPA 3Q41A 1J56A 2QKYA 5G41A 1E7YA 3FTCA 4EQ6A 5BVHA 2CBXA 4V0QA 4BFSA 2QPOA 1RTTA 4KAFA 3Q8MA 1ZXLA 2O0LA 1VI6A 2OCIA 5I47A 4BY9E 3VSCA 3KYCB 4BQFA 4DQLA 1SHKA 3RTDA 2IQIA 3RHSA 5B55A 3C8UA 3JW8A 3TPCA 1J1UA 3CINA 3KD3A 4HB3A 3GF4A 4WY8A 4OXQA 3VYRB 1PQWA 3N2NA 3UOAB 2FR8C 4AXXA 5HA5A 2OFWA 1YA4A 4DR6B 2B0JA 3E4DA 2JAHA 4DPLA 1N2GA 3C6YA 1FTNA 1PBTA 3SS7X 1CD5A 3E1SA 5FWDA 4BNNA 1GJRA 3FCOA 1ZVMA 1AS3A 2RSLA 2V7TA 3FKJA 4TKMA 1CZNA 2QP3A 3ESDA 3DJYA 3OEHA 1PYGA 2YXNA 5EWJB 3E9CA 2V59A 4YJ2F 3OA0A 1DRJA 3M4XA 1XAIA 3OPYI 3QWIA 1E1LA 1PTJA 2VHEA 4UD6A 4ZQEA 3U56A 2H6EA 2CFRA 1HX7A 1OXBB 2O3RA 1RD4A 4JI6B 3WBFA 2IXGA 2ZFUA 4XGNA 3AJ8A 2ZRHA 5BMVF 3C3KA 1V8OA 4TUYB 3C7CB 1L7PA 4FMDF 4EP1A 3Q72A 1NI5A 3HO6A 1K7SN 5HCIA 4FI3F 1SD2A 3PRHA 3G0IA 2DQ4A 2GERA 2XB9A 2I29A 1WSAA 4NNOA 3ROFA 1GAQA 4AWBA 3CNOA 1NLUA 5I45A 3SYNA 5LA6F 1TM1E 2QRVB 1E69A 2WHPB 3O26A 4UMFA 1AQJA 2NN3C 3ZDXB 1MC8A 5ICGA 3H7IA 3EG9B 1O58A 2MYTA 4G0ZA 2IP1A 1CCWA 3CLRC 4ZVKA 3SOZA 1NRIA 4D81A 5JCPA 2OAP1 4EX7A 1O77A 4S3MA 5IDYA 3UJHA 5AIAA 5LZ4A 3R9WA 2QXTA 1AZTA 3WYEA 5ENDA 2XYHA 3SQDA 3ZD7A 2Q3BA 5BOSA 2E18A 1IG0A 2O2JA 3W06A 2OOKA 2ZTHA 1HC7A 5EWLA 3WK8A 4HNHA 2PV0A 4QGHA 1XRJA 2GBIA 2C3YA 5EJ2A 5GZ3A 1C9MA 5JH7F 3KPVA 2EQAA 3LGXA 2DHQA 3O7MA 3UT0A 3G59A 3ENWA 2GFHA 4G5QA 3LJKA 5T3UA 1FDTA 1L3IA 2FSSA 3JYOA 3URMA 4QGAA 1SD1A 2E89A 5H0IA 2O3SA 4UATA 3KD2A 2I8CA 2OVBA 4R2KA 4ALJA 4FIDA 1G20E 1XHLA 2Z3ZA 1BVHA 3W2HA 4YA6A 1JYFA 2I2CA 3JU3A 3PCTA 1I94B 3A7DA 4P5EA 5CYOA 4D8XA 3HK2A 2CLSA 4CM4B 4NECA 2VDUE 3ESYA 4G26A 4W6ZA 1AKMA 1GQFA 4EPTA 4ZDJA 1YL6A 4U2GA 1QVAA 4R6XA 3M6LA 5BSUA 2A5GA 2QRGA 5I51A 3KEFA 3OD1A 1IN4A 4IO0A 1JU9A 1JDPA 1W76A 1XKQA 4J4HA 1YQWA 5DT9A 4XCXA 4IINA 4Y7DA 2IH2A 3GLSA 4XSHA 3F67A 5BN4B 5B36A 1NW6A 3OP4A 4WZ6A 1WA5A 2HR1A 3P9NA 3ZLBA 3FHLA 2PO7A 4LYYA 1AY0A 2HJRA 2A5DA 3GNSA 3UWDA 1U8FO 2O8EA 3SBDA 1XTUA 4ZTZB 1J5PA 3EQ2A 2IH4A 1EK0A 1GG5A 2GUGA 4JY7A 5ALFA 5IVIA 3MSXA 3ZVRA 4YV2A 2IYFA 3IX7A 3TECE 5ER9A 2CXSA 2XQVA 5CB6A 2O59A 1RKXA 4M6WA 2IL1A 3BWMA 4XAQA 4MS4A 4C04A 1E4EA 4JB2A 3ENQA 2IYVA 3REQB 3V8VA 3PUKA 4D6YA 1NXPA 4Q93A 1JL3A 3ZV3A 4OUDB 3ZN2A 2XH8A 2GN8A 3FBGA 4WZBE 4AS1A 5IJAA 5T64A 3JQGB 3KEOA 1FFHA 4G09A 4WK2B 5ECYA 4BEJA 3N6XA 1T9GR 3E8XA 4M4SA 2ZSHA 1C3JA 1GRVA 3GX1A 5IBRA 3UK0A 4XLTA 1VBKA 2Y1EA 3B89A 1STOA 1Y8CA 3T5TA 4FQ8A 3GRRA 1LVUA 4WVFA 4P4SA 3GYBA 1EFVB 3FLEA 4LXGA 4DCGA 4QBFA 3PEVA 1A9ZA 4BNKA 2QD3A 1JT9A 3C5CA 1DDGA 1E9DA 1U3CA 2GZHA 3AFHA 3M9LA 1CVLA 4GSLA 5AO9A 2CNBA 3FCYA 3WK9A 3UVEA 4IZ6A 3TFWA 1DL5A 1NZFA 4UVDA 4ETWA 4LYDA 3FIUA 5JAQA 1KK3A 3GRAA 2W9XA 3NEPX 5HGJA 1ZH4A 1C3LA 2IEYA 3QGMA 5JAIA 4H77A 4KMOA 1C1DA 2HSZA 3HKEA 4J1NA 2RK3A 3NG1A 4PFJA 1E7QA 3GLGE 2LCIA 1X7GA 3E27A 1L4EA 1SKQA 1DSSG 3LXMA 1FYFA 2O3JA 4QBKA 3CR7A 5FHQA 1FDSA 1JZQA 2AJCA 2J0UB 4XB1A 2ZJ1A 1HQDA 3BMOA 4IWNA 2VCYA 3VHXB 1XLTC 3BCUA 1MBZA 3DLBA 2HJWA 3I9JA 4Q9JA 1HYGA 1N6RA 1WQ1R 4IV5A 4CDMA 5CCBA 3WA6A 2JLVA 3N39C 5BORA 4N0MA 1D7AA 1KK0A 2C7VA 4U6SA 5FXMA 5KWSA 3KOMA 4NLLA 2XD9A 5JSKA 1NOKA 1TD1A 2ZUVA 1OMOA 1W0KD 2O8CB 2H07A 5C9ZA 1PK8A 4WLVA 3A6KA 3QNUA 1PRYA 4FNOA 1CRWG 3H2YA 2Z6QA 3A1SA 1WLYA 3JARB 4HWKA 1G3UA 5BMVA 4DANA 1D1QA 2R1VB 4MPJA 1Q57A 3WRXA 5HUJA 2FXIA 1OJLA 2QTZA 1YT5A 4FGKA 4IYJA 4QYIA 5FA8A 3SFVA 2Q3MA 2VIIA 2EGHA 2IZZA 3AB8A 1RLMA 4R0NA 3E0XA 3KXKA 1Z25A 2ES4A 2F4NA 1Z4MA 4L6AA 3RVKA 3FVRA 3M4JA 1PHPA 3FTEA 3O1HB 1CUJA 4B2PA 4V02A 1H8HA 1NYTA 1V3QE 1SOVA 3MEQA 3LT1A 3I1YA 5TGTA 3Q3CA 10MHA 4WUVA 3VPXA 4R8SA 4WOBA 3OKCA 2ZLBA 1FUIA 2W2TA 3N0TA 4JP2A 3OIYA 1ZEJA 5DO9A 5FA6A 4U9HS 1F0YA 2WAMA 3KL2A 4X90A 4C5BA 3O4RA 2ZJ7A 2E4ZA 1JSXA 2O06A 2P75A 3DE0X 2O2GA 4RCZA 3SPXA 2R00C 3UZUA 3WB9A 4HT3B 4BEWA 1A5AB 3TBHA 1WF6A 3U0BA 1IBKB 3NKVA 5ICCA 1E89A 1EVIA 1M1YE 1Z7YA 3TNLA 3FXAA 4WFJA 3H3JA 1N2JA 4AK9A 3E9ZA 2QMQA 2QVCA 3D1LA 3PT9A 1EZZA 1D6MA 1FFCA 3CO0S 5LCXA 4DNFA 1QE3A 4E5SA 3UGQA 4JLOA 3QUAA 4PZEA 2TECE 3V48A 1OZFA 2IGBA 5EWJA 5C2JB 4B75A 1UMDB 4MJLA 3ZGLA 3LFHA 2WSIA 1YCHA 2PGXA 1ZCJA 3MQFA 3HCAA 2JAOA 3LP8A 1XIVA 4OV6B 5C8YF 1NN5A 4OK3A 1WQ3A 1P8AA 2QRMA 3A06A 2NTNA 3HHPA 4BC1A 1H65A 4C4XA 3HM9A 3BEOA 4KXQA 4TUYA 4S1VA 5DHPA 4C21A 4L15A 4RPGA 1CJSA 4WXEA 4B6GA 1CJVC 4FJ1A 4EYSA 5IJWA 1P75A 3QW4B 4RDIA 3BB1A 3I73A 4LMBA 2O7RA 3UMRA 1XRRA 1KBZA 2QRVA 2WHPA 4IFTA 1UKVY 1V3VA 4KGXA 4D9BA 1Z4IA 2G88A 2PZAA 1O4VA 3AETB 3T4XA 2I3ZA 3EG9A 3PK0A 5AHRA 2DUNA 4N5HX 2ZSEA 3BILA 4UNNA 3MOIA 1H2XA 4LE2A 2Z5LA 2BTEA 1NMZA 3HJUA 1OX6A 4NYMQ 3V7NA 3N2YA 3LF1A 2BGGA 4FD2A 3WMXA 1JT2A 5MFZA 4CM9D 3I5XA 2MCFA 1NBOA 3F3YA 2ZT5A 4RABA 4BKPA 4H0FA 2ZSUA 4MRRA 5FV7A 4O1IA 4AKTA 3Q3IA 1RQRA 2RGNC 2VP0A 1L5NA 2BY4A 4K9QA 4M46A 1B93A 1XSEA 4KVAA 5TJHA 2FX2A 1FQJA 5LLSA 3ZI4A 5IM4A 1F0KA 2Y68A 1D5WA 3N74A 1PDVA 1Z5PA 4J1TC 1H85A 2XXJA 3PC7A 3SSMA 3ZHZA 2G7ZA 1G3RA 3V7UA 3LWZA 1T2VA 1XLVA 4K28A 4OUKX 3EYAA 4GL2A 1UEXC 4A7PA 5CH5A 1GPUA 1UAGA 2VBFA 4QGGA 4ZAVA 3KZMA 4PONA 5AKHA 3VYUB 4CM4A 4O2RA 4L72A 4V0ME 4M0PA 3T9EA 3T3OA 3D7MA 2CXPA 2C92A 2QTVB 1XNHA 4DY6A 2C2WA 1Y5RA 1U2PA 3LBIA 1ZK4A 3GK3A 3GMIA 1GQRA 1VKOA 2D0DA 3LBFA 4AN0A 3HA5A 4EBFA 3CN9A 1F5SA 4FXOA 1XF9A 3H99A 3B60A 4NXNB 3N1UA 3DWIA 4DSNA 5BN4A 1R4ZA 1VBNA 2ISCA 1Y0BA 3TAHA 4KXLA 4OVKA 3ONNA 4CIXA 1ZHHA 1RAFA 2WUEA 3ZWPA 1LCIA 1W96A 4R40A 2NO0A 3NDRA 1CUSA 2C00A 1NVWQ 4JUDX 1C29B 2PX3A 3OFVA 4XPZA 3LC0A 4ALLA 2O2YA 3DZCA 2X0KA 3PDUA 5GJWC 3USZA 1PW7A 2UKDA 2WTMA 1CQPA 1NW8A 3Q1KA 4MNTA 5KTRA 1DIHA 2C58A 4B43A 3FMFA 3JAWB 4FDLA 3H84A 4A8TA 1HL3A 3BJMA 1P3DA 3WLFA 2I87A 3NLLA 3IB3A 2IYNA 4DKJA 5ICFA 3REQA 1LSJA 2VK1A 1LLCA 4W6QA 3W1EA 4E6EA 2WAXA 1WP4A 3ZLVA 1UC4B 2AOWA 4OUDA 2X2PA 5KYXB 2GDZA 4O2BB 2PR7A 2F9FA 4UM8B 4ZOAA 3JQGA 1U04A 1GUDA 1RS0A 2WK1A 3ZE1B 2FN9A 3UBMA 1MRNA 1DFGA 2ZRCA 3IEIA 4CT5A 2DWPA 3ANSA 3I8OA 2DECA 4DKXA 1KL7A 2CV1A 2Q2WA 1F0NA 2GGSA 1EFVA 3BRQA 2PEYA 3EHDA 3JQAD 4TYPA 1LWNA 4ZTBA 1L8QA 1QTNA 5IU6A 4KSBA 3VPCA 3C4QA 2XUQA 3AY6A 4HLCA 2HHAA 4JUBA 3S1SA 3CUWA 1GITA 3I1FA 5COQA 1FNCA 5A3JA 4FLMA 1JDUA 2CV2A 1U8CB 1IUPA 3K0CC 4TLBA 2PMFA 2F9LA 2WF5A 3HR4A 4RSMA 4HYYA 2XT6A 4F2HA 3O93A 3RW9A 2HCRA 3E58A 1R3UA 1UL1X 2HO4A 5DX0A 2BGRA 3H5VA 1G3MA 1Y4DE 2DSTA 3GFSA 1SC3A 2DPYA 1UJBA 2JI7A 3PWTA 3VYSB 2J0UA 5JNTA 1N6OA 1RQXA 4YT2A 1CZUA 1NATA 2GEVA 3AQIA 3VHXA 4BBJA 1MXHA 3TTSA 2N46A 3WRVA 3SQNA 2V9ZA 3DD5A 2JAQA 1QX3A 3B9BA 2C5BA 4R81A 4EK9A 2Z8ZA 3WHKA 4EX6A 5IF9A 1YNSA 4NG5A 4LIPD 4BVLA 4P1ZA 5MGBA 1PT8A 3IVAA 4IM7A 2OORA 4M1ZA 4N5NA 4CDNA 3BTOA 1SZDA 2JFGA 3IE0A 2V7UA 3T8YA 2O8CA 1WJGA 1M67A 3D4BA 3GGPA 1BFDA 1SRQA 1IM5A 1BGXT 3LPNA 3OEWA 2YWBA 1AKUA 4BZZA 3HI6A 3JARA 5C3UA 4C07A 3KXDA 3N7AA 1DJPA 4U00A 1WMEA 2R1VA 3QQPA 1FNMA 2AHRA 3GLTA 3F3KA 2WG2A 4QLBA 4PM4A 4O2BF 4BLWA 4R8VA 1O3YA 3F98A 4OQQA 3V8QA 3F6CA 3MCUA 1MAVA 2X0NA 1A4IA 4LHXA 1W9MA 1ZU4A 3H04A 4IFIA 3RSOA 1AGXA 4PLWA 3A9VA 2PH5A 5D1HA 2EZUA 4PRYA 2CLCX 3IULA 1THMA 1PZFA 3LBNA 4X3PA 4GGPA 1BS9A 4FNGA 4HAOA 4M9CA 1O2DA 2FEAA 1USKA 2FW9A 1X0XA 3GNLA 4MW6A 4W5HA 1M8GA 3TG8A 1UWVA 3N59A 2PZMA 1HQCA 1VI2A 1OLOA 2Q0SA 3H5OA 3C3JA 2CB0A 4LVUA 3DO6A 2XUPA 4MCAA 5BSVA 1KFKB 4DQXA 3AVYA 3G0BA 1ZW1A 2OHJA 4JJ6A 2FFAA 4UXIA 5LP1A 1EU1A 3CVXA 2BP7B 3B52X 2VJYA 1JKFA 2IPMA 2HJHA 2GRJA 4MKIA 4FJ0A 4FU0A 1PJZA 5ERGB 2QTCA 2C31A 3T7DA 3BMNB 3ZJ4A 2WRZA 1MIHA 3G2LA 3KXPA 3TSAA 2YWFA 3BWVA 4WNIA 3WB2A 1L5QA 2VCEA 4DCTA 3F2IA 2XCSB 1ICEA 2WIFA 4UVGA 4EYOA 4H7EA 5G1NA 5DBGA 1AV6A 2ZIUB 2Z6AA 3H2ZA 2V7GA 2CD9A 2CLDX 3BUSA 4D9MA 4ESOA 4COOA 4UCQA 1UMDA 3BA1A 2QY6A 3GP5A 3Q87B 4FSDA 3FDIA 4BRUA 3I12A 1GARA 3VU3A 1KNQA 3OZSA 2XIJA 1OU0A 3PHHA 1D0IA 4PC7A 3UV6A 1Y1LA 2RB4A 4XUCA 2YIVX 3WY9A 4C7KA 1R4MB 4BVKA 3RS3A 2IA5A 1HE3A 2JARA 2ALJA 2OLEA 2P4HX 2COEA 2ZU6A 3RU9A 4BMOB 4BWGA 4DEVA 4HNRA 1HT3A 4CCWA 2ESRA 2QUIA 2FGJA 4RL6A 1Z8HA 1HT0A 2A84A 4BFXA 1TLLA 3CLVA 3S2ZA 5HS4A 2RGEA 3DEJA 5MF6A 1MOPA 5L4SA 1RLIA 1I7PA 1HYEA 1TAQA 4FDUA 4E22A 5IZCA 3HDTA 2C03A 2WKQA 4D8TA 4Z4HA 1MO6A 1QUFA 1T2CA 1RADA 1U0OC 1WDMA 3AETA 2ZEJA 2ZJOA 3GJZA 1V48A 1CQXA 3PLNA 4FC7A 3WKBA 4C6HA 2IY8A 2PIAA 3OTIA 5A62A 3QVWA 1TJ5A 3OHSX 1JMKC 1KMHB 4QO7A 3VMMA 4CTOA 4WIAA 4OMDA 4XWTA 1HT2E 5JXWA 2JIRA 1E18A 4X84A 3R09A 3EXG2 3AF6A 2IJGX 4BMNA 2HLHA 1LI5A 2NX2A 4MW2A 3DZKA 3I28A 3WQSB 3P9CA 5J5CA 3WLJA 1ZJWA 1E1KA 4HDKB 4B81A 3L0CA 2ONZA 2XB6A 3C70A 2VAVA 2EQ5A 3MS7A 4B2LA 2B3DA 4BNIA 1UKBA 4IEIA 4EO9A 2PV7A 4KBYA 4PXYA 1YZLA 3UB4A 3T4EA 1HDOA 1V7QA 3G85A 4LNAA 4N8SA 4B4VA 1GTZA 2JLCA 3HBFA 3Q98A 3O4IA 2VJAA 4L75A 1GXSB 5JAHA 1TIBA 2R1ZA 1H2HA 3I6QA 2HA4A 2WM2A 4ZANA 3QLUA 1KVTA 4OG2A 1XZGA 1WU7A 3R5TA 5CDFE 1ZSVA 4OIFA 5IS2A 2F7SA 4NMMA 3NHFA 4BAUA 1EFLA 4DOMA 1JGTA 2Y1DA 2I2BA 2CB9A 4IY1A 1QF9A 2OFOA 3TINA 2HBZA 1PR6A 3ER9A 1FXUA 1P9RA 2QTVA 4Y67A 3PQCA 2OHIA 2B98A 1HI9A 3IAAA 4DE5A 1TYZA 3RWOA 3OU6A 3OTGA 5AM5A 4O6VA 5K8JB 1JR3E 4JJGA 3HVHA 1E2IA 1K7YA 1QK3A 2CF6A 4Q1AA 4KDCA 5CYGA 3FUUA 2CHEA 4ZEVA 3DD1A 2PTGA 4BUJA 2UXCB 2AEJA 2H85A 2PGDA 4ZO8A 1R50A 2WVHA 3GUYA 3BTVA 2P1DA 3AFIA 5JLAA 3S2YA 4ANFA 1N75A 3WNZA 1LS1A 5JO9A 4IPTA 1VKHA 5LOVB 1WMAA 4AKSA 1RHUA 2YYZA 4AMUA 1Z75A 1CR4A 5KWEA 5DV9A 1SU8A 1TNDA 1QIMA 3SM9A 2XDAA 2GN9A 3I9FA 2QN2A 5JHGB 3DPIA 2ZJ2A 3KXIA 4BX0A 3NHSA 3O83A 1CUAA 3ITNA 3JAWA 4LJ9A 3I0MA 2XVZA 3FJYA 1CIJA 3ETEA 3H1PA 3O2SB 2ZE8A 3KQPA 1JKIA 5F1YA 3E5NA 3UQZA 4OHBA 3KFLA 3NATA 4O4JB 1JALA 1PT7A 2QVGA 2Y0DA 4E1AA 3BCSA 4O2BA 4OGFA 5DCYA 5KYXA 4CL0A 1EUDB 4LAFA 1JMYA 2Z2JA 3REOA 1AB5A 2GH1A 3STTA 2FMTA 4AL4A 2EBFX 4Y9UA 3T1YB 2P1RA 1MW9X 5M29A 3AIIA 1A3CA 2Z04A 4V3CA 1ZR2A 3NHMA 5I01A 2JFBA 1PS8A 1EJ0A 2WJGA 4UMEA 1LK0A 1B8PA 2FEPA 2BE7A 4XLLA 3AHDA 3COYA 1S2NA 2O05A 1NVVQ 4CBVA 1M6EX 3CNEA 1K8QA 4G5OA 1R0BA 4DV6B 1TC1A 5EIHA 1Y6JA 1UJNA 1OBOA 1XQ1A 5HE9A 3GO4A 2NQ8A 4KXUA 5K8CA 1VI5A 2J32A 1XCBA 2O5RA 2PZKA 3K92A 2ATEA 3VKFA 1UINA 1ONSA 4YRLA 5DLQC 1N4AA 1FTWA 4LC1A 3KLMX 4UTOA 1AXEA 3AP1A 2BFAA 4J0HA 5AK0A 5F9FA 5AXCA 5AD1A 4LHWA 1AM4D 3ML1A 1A69A 2PBFA 5HK8A 3C4JA 2V58A 2C4HA 3U5TA 1F06A 3PR2B 1NXTA 5I7OA 2YTZA 3PHJA 4I50F 4A15A 3QA3E 4JBNA 5L8VA 4OLBA 3B7PA 3WWDA 3L7YA 4ID9A 5AW6A 4Y6PA 4Z4CA 1UXJA 3BZWA 3E7WA 4HLUA 3N86A 4F5WA 4R4JA 3A3NA 5KVAA 4MOWA 1RYEA 3IPYA 4P08A 1XRQA 2J45A 2ZI7A 2C5AA 4X9XA 1GDTA 2J46A 5EINA 4AUMA 4ZCTA 2B35A 1RHKA 1U4OA 2AJDA 3UPTA 5TPZA 3ZIDA 3IAM1 2RJ3A 4DJ5X 1J0CA 1OYWA 4O4JF 3QWAA 3OEED 4WTOA 3H17A 1Q3TA 4G65A 2I5PO 4KOAA 2AA3A 3DHEA 3Q10A 1G20B 4F7WA 1CVRA 4V2UA 4A36A 1QV9A 1SCUB 4QT0A 1GCGA 1VLMA 5IEJA 3UK1A 3AW9A 1BDBA 4S35A 4US2R 5EXPA 4M49A 3RG2A 3S28A 3R0IA 4OKSA 3BIFA 1ZCAA 3GCXA 1EYZA 1Y9EA 3IAEA 4HFMA 4N3CA 1PR1A 1T3ZA 3CUYA 2JFUA 4GBJA 1RAIA 1H0RA 4BE7B 2GBCA 3T06B 5AP9A 2F55A 4OSEA 3VAAA 1KDZA 1U02A 1U0GA 3UJCA 1U8YA 2NXJA 3IDFA 3AVOA 1XE3A 3MPOA 2D5BA 4M55A 4ALIA 1E3MA 2BP7A 4B6OA 1RPTA 2VK8A 2UUBB 1KBQA 4ZAFA 3ESZA 5BW4A 1G60A 2VJCA 2WSSD 5FWYB 4D0LB 2IXAA 3BMNA 4XB2A 3SK0A 3LH5A 2QVXX 1AO3A 3LQ2A 1RABA 1XXLA 1G1MA 1V71A 4KFTA 5GGXA 1S2LA 4BRWA 4DAOA 1LQUA 5KJ6A 4YUWA 4MDHA 1ZOPA 5LNK1 1LDEA 1DPFA 4UEKA 3KJHA 4H3VA 4YK7A 1E2GA 1CZOA 2QX8A 5IRCD 4BXOB 1CR0A 1PV1A 2FZ5A 2HNBA 4R1TA 1XDDA 5F9HA 2VHCA 4TKUB 2VTKA 2GBFA 4JC5A 1QU3A 1NBHA 1KWKA 5DKFA 3GRFA 4GLOA 3GA0A 3ORYA 3QEJA 1R4MA 4WZBB 1NRWA 3IGFA 3KO8A 7REQB 1EX7A 2P1ZA 3BSWA 1XNQB 3HXKA 2FLWA 1TM2A 3I04M 4WI1A 1BS2A 4C0QC 4RKFA 1E0DA 3NTLA 3D8UA 2H7VA 3AUXA 2GYWA 5D5QA 4CLXA 3VRHA 5CFMA 1L4UA 1EDZA 1LSOA 3QUSA 3GR6A 1HR0B 4J3FA 3GGDA 2AMLA 2AR7A 5E1DA 5I7RA 4QXRA 4LYAA 1KMHA 2R48A 3RAPR 3L8GA 5IT0A 2GCEA 5A2GA 5BT9A 1P7PA 1YS7A 1C7FA 1FY2A 2ZR0A 2XE7A 3D6JA 3NIWA 4XR4A 4AMGA 5IULC 3D1VA 3WX0A 4PN3A 4W1PA 2GD1O 3HU1A 5IAKA 3GLGB 1KI1A 2QR3A 1YQGA 3K4PA 3U3DA 2C9BA 1SXJB 4HDKA 2AG8A 3EZ7A 1PTKA 2PPVA 4Q00A 1KP3A 1ZGHA 3IEXA 5FRDA 1DT5A 5FOXA 2OR3A 5A9TA 4EEXA 5D51S 3M1AA 3Q8WA 3R9IA 4D9FA 2DKOA 3C4VA 4KNYA 4LHYA 2QIPA 1GXSA 1DBSA 4RS3A 3K31A 3QX7A 2HU8A 1ESNA 2O2IA 2BKLA 4R9VA 3D7KA 4RZ3A 3UWMA 5ALTA 4NFYA 3E23A 4BAGA 4RJIA 4IRXA 1WDKA 1I1HA 2QLMA 1Q15A 4CM7A 1CR6A 2OBNA 2WMNB 3KWFA 4K1LA 3ZGYA 2GEFA 2AKAB 1I13A 2GNPA 1KMNA 4V0NA 1YZFA 1S8AA 1JQLB 1W5BA 3UMMA 1G6HA 4D9CA 5E9AA 4WKCA 1N7IA 2BRUC 13PKA 2V7PA 2M9MA 1C7EA 1HRKA 1TUIA 1DADA 1NJ5A 3DDWA 3A1NA 3O3NB 5HS6A 3TR0A 5CXUA 2XOXA 5EJMA 3MUFA 4MVJD 1WBJB 3O8NA 3IELA 1DQNA 2VRCD 4ZYVA 5B3LA 4EGSA 2WSBA 1Z63A 3K0HA 3L4BA 3RRXA 3UFBA 1XCOA 2J8ZA 2PSSA 4UHBA 4EEKA 1ODKA 5LOVA 1QO0A 2PBZA 1LY1A 4KN9S 5BSGA 4MKRA 4XARA 3R5XA 2HA7A 4CKEB 4NZNA 3B9RA 4JL5A 2PWZA 1X1QA 3QEAZ 3PFBA 4PVCA 1EX6A 3V3KA 4RTMA 3K0SA 5T41A 1Q19A 1WZIA 2MWMA 2VDRB 4EHDA 3K2IA 4B17A 2C0QA 2Q49A 2CK3A 3GFBA 3WKEA 3SIPA 2COUA 3FVTA 4RKRA 1PD1A 5LQUA 2HJVA 1EP3B 1OBVA 1OIWA 1GGMA 4O4JA 4O2AB 2OGSA 4QT4A 4Q5IA 2JZOA 1E63A 4MWGA 1VJCA 1EUDA 2UVQA 5DCWA 2IOFK 3G2JA 4CF3A 5HF6A 1KO5A 3DZIA 2RGRA 1NDUA 5GGYA 1YD7A 2CUZA 4LJSA 1LNSA 4G67A 4LV5B 1IHYA 1K7FB 3TOSA 2HDNB 3CNLA 4JXKA 1TJPB 1OC4A 1T3SA 2MU1A 4RVGA 1CDOA 1ZMOA 4JBGA 1G7CA 4XFDA 4DCCA 2FN8A 2CNDA 1Z7WA 1I30A 1W8DA 4FE3A 1C2YA 3BX1A 5IARA 3U4CA 4JZYA 1IJBA 4BO0A 2JC3A 1V0JA 3ZY5A 4BNTA 4OI2A 4LS3A 2V9CA 3SEZA 1CSEE 2XWJI 4TXHA 3RS5A 4PX9A 1MQ8B 1PWXA 3GIDA 1IHPA 2HN9A 4FFVA 4M0EA 1ZJ4A 4WOPA 5DGHA 4BWYA 4F12A 5FEUA 4L0QA 2XECA 1UJ2A 4WERA 3WGVA 1E2KA 1GU1A 1NUUA 1T5IA 2I6XA 2BBWA 2JCSA 2O8NA 3AF1A 2FWPA 3AVPA 3QK7A 1TX4B 3QVLA 5EE5B 4P35A 2CMKA 2JRCA 4RLQA 4F06A 5KNBA 3H4MA 1W8IA 4I5EA 5EHZA 1NXXA 5KHOC 1R6UA 2V0NA 4EITA 1FU7A 3DNMA 1SCNE 4BFTA 3C3DA 4UUMA 2WFAA 2CNOA 4I46A 2WDPA 4B3XA 1KS2A 2DBQA 2LIPA 1BHJA 1AKVA 4HGYA 2ATCA 6PFKA 5DFAA 1QH0A 2A8YA 4XM0A 4XSVA 3PPVA 3EXIB 2PG3A 3H75A 3MNFA 1XJCA 3LXUX 1I10A 2FGKA 3PQDA 4GX0A 4LDAA 3TKAA 2V6GA 5AKKA 2NXWA 4AECA 3UY4A 5IM5A 3DVSX 3SAJA 1G20A 2ZYRA 3MGGA 3H5IA 1SCUA 4DLZA 1BJTA 3PHIA 3F7OA 1N8KA 1P74A 4QG3A 3EX7C 1UOPA 1TVCA 3MXTA 2DWOA 2CVPA 4O25A 2JDID 5ADUS 3KEGA 4P3YA 2VS1A 2G5PA 4REMA 3VNSA 3VX3A 2ZUTA 4KLNA 3L8YA 3GEBA 2HWKA 4TS9A 2W6QA 2QX7A 3AM4A 4KN5A 3UFXB 4XQGA 4XYLA 2JIMA 5LD2B 2I1QA 2G72A 1D7OA 4CG1A 3FYUC 4OKIA 3KAQA 3QLTA 1D9ZA 2LKDA 4JEMA 3QJYA 3DV9A 2OGUA 2IE8A 3X1KA 5FNZA 5FWYA 1QM5A 1IHUA 4OL0A 3F90A 3W9YA 4B84A 4L57A 3GJ3A 5E2IA 5A6VA 4DJTA 2Y0BA 2MR6A 2AN5A 3BTSA 4HAZA 3CLUC 4HLNA 5IH7A 1UFOA 3V4PB 1JSCA 4JAVC 4XIIA 4F46A 1VLHA 1XDUA 1ISPA 1NPTO 4MVJH 5ALVA 4OBWA 3P9ZA 1WCXA 4UUBA 2PA0A 3H3FA 4BXOA 4ARSA 1W5FA 4KWTA 5U4XA 3TL3A 4DPMA 4UE6A 4ARIA 4TKUA 2DSNA 4E15A 3RVQA 5K6RA 2O0MA 4UNPA 1Y8ZA 1QTQA 3E9YA 1IWPB 3AR2A 3H1TA 1I80A 2VZEA 3OPYB 3Q7IA 3FTDA 3WL3A 2ZITA 4RK7A 4WZBA 3NOXA 1BVRA 7REQA 3EMDA 1ND5A 4K2AA 4YCNA 5BWLA 1Z35A 2YRWA 1ESZA 2BHTA 1ZITA 3GHHA 4MUGA 1GGVA 3AY3A 4MVJG 3BE6A 4TWZA 2F1RA 2R60A 3FZGA 4LA4A 4BOYA 4JIMA 4L9RA 1ONOA 3PDWA 1KJIA 3PFHA 1Y3FE 5ESRA 4LK2A 1T43A 1QHNA 4PG4A 4AY4A 1KKUA 2ZE6A 4DREA 3A7EA 5EGNA 2AOTB 2MSWA 1E94E 4A2WA 4XUDA 4URXR 1BKDR 2W8BB 4D82A 1QRUA 1RXSA 1O0CA 1QBKC 3WXBA 3DZHA 3NRCA 4BDTA 1Q7BA 4XJSA 1PN3A 4ZGBA 3PNVA 3SJCA 3NOVA 4JVNA 1COZA 3MD9A 2P6UA 4TN5A 1XTJA 4HP8A 1U5BB 1SUSA 1HQKA 2QTTA 3A1FA 5MN5A 3GLGA 3LI2A 4YRGA 2N0SA 3GROA 1QIGA 3PNSA 3T7RA 2IEDA 1SXJA 2FN3A 4ECEA 4XVRA 3NJ8A 4GKAA 1WB4A 4WDQA 2GPTA 2XTNA 1DWPA 2MOKA 4K6HA 4M7WA 4XA8A 3VZSA 4AY3A 1HZZC 3CJTA 4YRJA 4RXTA 2YZGA 3B6JA 1M73E 2JFYA 3FWKA 2M32A 1K89A 1W19A 5C31A 2ZWAA 4AQYB 1IUOA 4MKGA 1B26A 4HEA1 3R74A 1VSTA 1LC3A 3DCJA 4MYUA 3E70C 1F4VA 1ZVQA 3W6UA 1O95D 2B5OA 3QUTA 3USES 2BGKA 3PR3A 3I05A 5HHTA 1II0A 3B1XA 5BNFA 1EHCA 2PJRA 2PMDA 4LKOA 4FWTA 1F48A 4PQFA 2FG6C 4M37A 2HCJB 5C34B 5BURA 5KMGB 2X3UA 2AE2A 2X0IA 5KSOA 4I3GA 4DSZA 1ZRMA 2QW0X 2VQSA 4BTVA 3WMGA 1FLDA 3EA5A 2XF2A 5AI8A 2YUIA 3WGNA 5GVSA 2J6BA 2YZKA 3DZBA 3R24A 2Q6TA 1ZXBA 4FFSA 4FYPA 4GUAA 1EFHA 4GE0A 4UU0A 1JHYA 2I6QA 1I0ZA 1XUOA 3A05A 5DW3A 1I9GA 1RLOA 3EGVA 5ECGC 5DMHA 3O21A 5HE8A 4OXYA 4JYMA 1DJOA 1E96A 2PU5A 1SXIA 2NO9A 4P4GA 4ZO4A 1QZTA 3F6BX 1V4VA 1QF7A 3RVSA 1MPTA 4CKEA 2XD4A 1OU4A 4DUGD 3AEYA 4LJRA 3FCSB 1MT0A 1N0UA 3E9MA 1CWUA 3CT6A 4Z3OA 1ZD2P 1U81A 4LSWA 3WLOA 2PBLA 2A14A 1KBOA 4Y2PA 5K0NA 5LJLA 1YASA 1I4DD 1QO9A 2A3RA 2QSZA 2V3WA 1ZAYA 1NN1A 4W8HA 3GEHA 4XM1A 1P7CA 5EUBA 2PAAA 4O2AA 1ZK2A 1U1CA 3G2MA 5AHOA 1OH7A 5ECDA 5MFPA 4M1TA 3QVUA 2ZQYA 3CG4A 3GIWA 2E9SA 2I7XA 3ONWA 4RFSB 5CFQA 1F20A 3PXEA 1DAFA 4K87A 4FYHA 1Q95A 3LY8A 2E5LB 3LIPA 2CL5A 3BE4A 2OB1A 4DLRA 3BD9A 3K9LA 3PJFA 3PX2A 3WBBA 2O57A 3ADPA 4F4JA 4H7KA 3E9NA 4EKIA 3ANLA 1ZRSA 4IMRA 4LG1A 1K8ZB 1RBZA 2YASA 2Z6VA 3P9XA 4ZQGA 3U7RA 5LVAA 4MV9A 1C1YA 1H2ZA 1JA9A 1XXHB 2IIQA 3P4YA 3WK5A 1XCJA 3PCRB 2K4MA 1TW2A 5BYJA 3ROGA 2XRZA 3GAMA 1J07A 3A4MA 5G53C 1MHPA 2JLUA 5JDIC 3PU6A 1FOEB 3FMOB 1J8VA 3GXBA 1AC5A 3FAKA 1JHVA 1RC1A 1WS6A 1EQUA 2WFLB 2O2DA 1KAQA 2HCFA 3NWBA 3OO0A 4I6JA 2QR5A 4KR0A 3RARA 2QL7A 1KSGA 4RMGA 1H22A 5AKGA 3ZLJA 3RFXA 1RXWA 1CLUA 1UOEA 5SZJA 1FX0B 2EV9A 3WBKA 3PQEA 1L1RA 5HQTA 5FBWB 2HJSA 2A94A 2GVZC 1ZIDA 3P9RA 2HXGA 4UNIA 1R15A 4RGYA 1B0ZA 5CIWA 2FSGA 4KGZA 1ZK3A 1M0SA 3ES9A 3Q5EA 3WZ2A 3WGIA 4J49A 4QQ8A 2B4RO 2YWHA 3LRXA 1F5NA 3G1WA 4JB0A 1IZ9A 2Z4RA 1LDBA 1JFSA 4ZXPA 3DXXA 1TO2E 5GJBA 2R7MA 2OD9A 1P17A 3HH8A 3SR4A 3K2EA 3RM3A 3VPGA 2NO1A 1XU4A 2Q46A 3EXIA 4CQMB 5JZ9A 5KCZA 1CF2O 1JLRA 1MCZA 1N9GB 1KI3A 1E1NA 1XDSA 2GA9A 2WUVA 2YV4A 3FUXA 3QLVA 4GZLA 4LXYA 5E95A 1D0VA 3ROQA 4G6ZA 3WGJA 4WVLA 4A9AA 4CEIB 1DQSA 1IBCA 3UXYA 1P91A 2KLHA 2XQJA 4Z9YA 2NZJA 1I3MA 2UZ0A 4BX3A 3Q15C 3ZK9A 3GVIA 5KVQA 4ZMBA 1X2BA 2ONKA 2WLTA 2I34A 3PXCX 3QHAA 5DBHX 4YN3A 4YFYA 4CR7A 5BN3B 4U5XA 4V0MA 3MRTA 5K3OA 1CR1A 3ONVA 3C7KA 2XNHA 2JD2A 1JDBC 2MSKA 1U3UA 2Z58A 1YUNA 3G89A 1QHEA 3LHSA 3WDLA 3UFXA 3ZU5A 5A4DA 4IFBA 1AQNA 1BDHA 3N2EA 2IE0A 1E7RA 1U9CA 4I9FA 4V2IA 4HNQA 3BOSA 5AM3A 4PYQA 4PF1A 3K1JA 1E2BA 4FCTA 1UJCA 3DE7X 3FWZA 1YDMA 4P8RA 4YROA 3X44A 3L0SA 4BNWA 5K8TA 1FZQA 4G4IA 3VKVA 1WCIB 4U39A 4CL2A 1ZW6A 2VWPA 2H7YA 5IABA 5KNCA 4LOKA 4BN0A 3S81A 2Q3HA 2FP4B 4HXGA 3Q4GA 1Z13A 3I4FA 4WXHA 1NUHA 1X6VA 4P54A 4A5OA 5BN5B 3FGPA 3UM9A 2FJ0A 1IONA 5F7OA 1FRZA 1NWHA 2L42A 3AHGA 3TL6A 2GCOB 3CUVA 4LXHA 4UU7A 1NHGA 2XWQA 1FLVA 4GM4A 1CUYA 3SIXA 4NMLA 2E6KA 3T7IA 1LW6E 1XMJA 4NU8X 5JD5A 5DNCA 1GAEO 3E7FA 5IKEA 3DMTA 4W5WA 1ZHOA 3OPYA 3MYRA 4OXKA 4YJ3F 1ZVJA 8OHMA 3G9UA 4AJ1A 1JB9A 2WTXA 2ZBPA 1P4SA 2BM8A 1U0EA 4EO7A 4M9XA 3R7FA 1Z5VA 3MFQA 2AF4C 4KVFA 4YCMA 2OFXA 2FKAA 4X65B 1CS4C 2OOSA 4GEKA 1GNSA 3K15A 3U80A 2AOTA 4B74A 4BJ5A 5HDQA 4YJKA 5J58A 2W8BA 2FUCA 1MNQA 2J1LA 2ZWVA 3DQQA 4FN5A 4X24A 1NBEA 5DX8A 3ZDZB 5FLXA 3WSVA 1E6KA 4ZV9A 1VHDA 1MIOB 5EMHA 3C24A 4MPRA 1BMFA 1ZD8A 3KBOA 4CDGA 1HYQA 4OBBA 4E5MA 4EJMA 1U5BA 1WXQA 2X9LA 3PF8A 4D57A 5JZBA 2QQFA 3EA0A 1H69A 1LX7A 3CRMA 2C1EA 4NZMA 2E5FA 3KB2A 3AIOA 4JP3A 2ZIWB 1JKJB 1FMLA 3WYAA 1MOZA 4RWEA 2OBYA 4UEQA 4LWZA 5EA2A 2YJ5A 4NXMB 2PGOA 4UAUA 1JIJA 2ZPUA 1J0XO 3I2GA 4MQFB 1P31A 5LN1A 2QU7A 4YB8A 2I54A 2NSLA 2P78A 1UIRA 4TL7A 2K2WA 4Y2QA 4HQRA 2D54A 2WEKA 4TTVA 3I9LA 4GOKA 3VVCA 3T5PA 5I5GA 4ISBA 4IQGA 4OAPA 5ALZA 2W42A 4N18A 5TMPA 4QECA 3T1NA 1VM6A 3OM9A 1T3GA 4O1HA 4B7UA 1K2WA 4DJFC 1JLSA 1UZLA 3PIRA 4RVSA 2RGGA 5KMGA 2PNFA 1PO7A 2QXUA 1SXHA 4OP3A 2G1AA 1GR0A 4EAAA 4F3KA 1FJGB 3DDCA 3EOAI 3O4VA 1GVNB 1RM3A 3MWDB 1A82A 1CZRA 3O9MA 1X13A 2X7HA 1RQ7A 3VZCA 2NUPB 2ZWOA 4GMKA 3BK7A 5DLPA 1GLNA 2PVCA 3RIGA 4B3BA 5LDGA 5F9MA 3H0KA 3FD8A 3BIJA 4WA7A 2DBYA 5GOTA 3T94A 4YAGA 4PHHA 3DE3X 5IX8A 2FSPA 3WMFA 1JKXA 2Q4RA 2X22A 3OT4A 5LP6B 1ZOSA 2VF4X 3VO8A 1RVV1 3WSWA 2FPUA 2F8TA 3TKYA 5TSDA 3FUTA 1VHQA 3G0HA 5HNKA 3L7AA 4Y2GA 1GRCA 1PEKE 3RFUA 2V96A 3NH6A 3W6NA 3X43A 4C3VA 3SJAA 4EDHA 4HNUA 3ADKA 4ZU1X 3WGZA 3LSYA 1WO8A 3IA2A 4NKRA 1PR5A 1F2UB 2Q6LA 3V1LA 1WD5A 1L7VC 2IUYA 5CAEB 3V46A 1C3OB 3KNZA 1UZAA