1NXQA

Crystal structure of r-alcohol dehydrogenase (radh) (apoenyzme) from lactobacillus brevis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords R-alcohol dehydrogenase
publication title The crystal structure of R-specific alcohol dehydrogenase from Lactobacillus brevis suggests the structural basis of its metal dependency
pubmed doi rcsb
source organism Lactobacillus brevis
total genus 97
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nxqA00
1GPDG 4GX2A 3HWRA 4LGVA 3GGGA 4PGFA 4L4RA 5HRUA 4BB5A 4LMPA 2GRAA 2DBQA 1PJ4A 4QO8A 4XKJA 2NVUA 3N7UA 3PHHA 3OJEA 4W9NA 1W0CA 3DAFA 2WEKA 4J7CA 4IJKA 3FTPA 5JC8A 4PLGA 1EQUA 2QW8A 3PQDA 2VRCD 3EVNA 1G6KA 1SAYA 3MOGA 1KEVA 3K92A 3KTDA 2I5PO 1P1RA 3QW2A 3A14A 4JBIA 1XCBA 3OM9A 4IDGA 1C1XA 4E5MA 3PK0A 3TPCA 1N5DA 1PZEA 3F6YA 3FR8A 2EP5A 4G65A 4PLVA 1N7HA 1P77A 1XIVA 3K31A 4XR9A 2IYOA 1KEUA 3WX0A 4BNYA 4Y8VA 5BSFA 4LSWA 1DFIA 4IQ8A 4F46A 3I9LA 1EUZA 4LMRA 3V2HA 1LLCA 3DOJA 1PJLA 1ONOA 3DTYA 4I5EA 2B4QA 1WLYA 4RDIA 3RAJA 4UUOA 3RBVA 3JQFC 2A4KA 5C5IA 2P5UA 4L73A 4YAGA 3PJEA 3B1KA 5BSGA 1BMDA 4BO2A 1DIGA 4A2CA 5L95A 1QYDA 1K3TA 3GMDA 2D0IA 3G17A 5TJHA 3EY4A 3H5AA 3WJ7A 4F6LA 2C07A 3DHYA 1VL8A 1E1KA 4YAEA 5A3JA 3ONDA 3ZNNA 3DOCA 1IZ9A 5G0SA 3HNPA 3NDIA 1E7RA 4KWIA 4MKZA 3JTMA 4CM8B 4EJ6A 3K5PA 1EVIA 3FHLA 1S6YA 4AJNA 1I5RA 1P1FA 3RC2A 1MP0A 2EGHA 3GRKA 5L53A 3M2PA 2Q49A 2B5VA 5FI5A 4Q9NA 2QHXA 2YHIA 3WB9A 3V1UA 3OIFA 2C54A 3B20A 1E1LA 4E4YA 2X0NA 3WGTA 4BO6A 2NU6A 3UICA 2HCTA 1HSOA 1E77A 4DXHA 3KBOA 3IUPA 3DDNA 1NQTA 3JQ7B 4HFRA 4IDFA 4R68A 4KOAA 4PVCA 1GUFA 1HYGA 1MB4A 1R0LA 3ZWAA 4RDHA 1A7KA 3UOGA 3DBLB 3FSRA 5AYVA 1H9AA 3PJDA 4OQYA 4J6FA 3ZU3A 1T1SA 3ZWCA 5I8WA 1Z75A 3TSCA 3STHA 1PGQA 1TXGA 5H82A 4HX5A 1VL6A 4JP2A 4BO4A 4ROSA 1UXHA 3ASUA 4ZVVA 2WTBA 3OJLA 4B4VA 4IDDA 2JAPA 4N54A 4QFDA 2C7GA 2VTEA 4AFNA 1MG5A 1WNTA 2YY7A 3RKUA 3HJAA 3LT4A 1AXGA 1NHGA 1OOEA 3IJRA 4E2YA 3I9OA 3NT4A 1KVQA 4YBZA 1NASA 2BGMA 2HMSA 2HRBA 4FS3A 4JXKA 1HE2A 5DBGA 3GR6A 4N7RA 4HBGA 3R0IA 1YS4A 1HDZA 4UUNA 4D46A 4QT0A 5EQFA 1EQ2A 4OXKA 4BNTA 4ILKA 1Y1PA 1SO8A 1NXQA 1SMKA 3ANMA 3EZYA 2FSVA 3KYDB 4BHTA 5JSFA 5HTOA 3NRCA 3CXRA 3JD4A 1UDBA 3GMSA 2VOJA 2VZ9A 4R01A 2O4CA 1WDLA 2EW2A 2VRBA 5EERA 5L40A 3T4EA 5A04A 3DC2A 1PIWA 1UZMA 2RBEA 3RC1A 3IJPA 1ZK2A 1PJTA 2ZTLA 1DLIA 3Q9UA 1HDXA 1YBVA 5JNLA 1NAHA 3MWDB 3WMWA 1XEAA 1R0SA 5TC4A 4GSLA 4II3A 4EBFA 1DPGA 4R51A 4YJHA 4GVLA 1HTBA 1JKIA 1GR0A 3K96A 3OF2A 4W9NC 4RO0A 5F5LA 3PHLA 1U9JA 1LDNA 2GZ1A 1AE1A 3SX2A 1P1IA 1GUZA 5JS6A 1A27A 2FY8A 3VC7A 3PDUA 4IINA 4CMEA 2JD2A 2BI7A 2VHYA 3B6ZA 5HA5A 1LNQA 5IDWA 3RASA 3VPFA 2B4RO 3HZZA 3PRJA 3DQPA 2EHDA 3JV7A 4R1NA 3ASVA 3D64A 4GX0A 4E5YA 1YDEA 3ZWNA 3TOXA 4JJIA 3HG7A 3JQ8B 1DRUA 2W90A 4GX5A 4BO3A 3PWSA 1SCUA 2GDZA 2Y0DA 4H7PA 3O38A 4CMBA 3KXDA 5AXBA 1M66A 2RHRA 3X2FA 4J16A 3GEDA 3KYCA 3WIEA 3GA0A 2YV1A 5BSHA 4EW6A 3FPLA 3WGHA 4J4BA 1YJQA 1YE3A 3DO5A 3BXXA 3F4BA 2C20A 5DOZA 1IYZA 3ANNA 4D3DA 2XPCA 5JAIA 1HT0A 3FN4A 4Z6KA 1KVTA 4YJFA 4YVFA 4PVDA 1ZSNA 4GL4A 3SC4A 2J6IA 1B16A 4PG4A 1GZ6A 3WYBA 3PGJA 1E5LA 3WFIA 3PPIA 1VSUA 4JLWA 2O4UX 1PS9A 3EGOA 4PZDA 1Y5RA 1C0IA 3SLKA 4BGUA 3A06A 2AQIA 4J43A 4NR0A 4A27A 4UVEA 3H8VA 1EE2A 4ZN6A 3D3WA 4B3IA 2D5CA 3DMYA 1U4OA 1R4NA 1UP6A 3LSYA 1B3RA 3M6IA 2X22A 2C5EA 2OMEA 5COQA 1GQQA 1ID1A 3P19A 3AU8A 4KDFA 2FMUA 5JMWA 2LDXA 4BNJA 5F21A 4OSOA 1T26A 2EKLA 2DVMA 1E3EA 3PZBA 1LSOA 1GPJA 1DO8A 1ORRA 5KVCA 1ULSA 2YW9A 4JK3A 4HFJA 4NQZA 1GY8A 2EW8A 4MP6A 2YJZA 5CAEA 4I1IA 5L7YA 1PJCA 4N18A 1GYPA 1I0ZA 3H5RA 1BDMA 3SJ7A 3FWZA 5A05A 3P2YA 3GNSA 4BKPA 3AFMA 1I2BA 3DFUA 1B7GO 1Q7BA 3K30A 4PG8A 1HYEA 1O9BA 1ZO8A 3ITKA 2PZLA 3S1LA 4R9SA 2Y0EA 4G2NA 4R1TA 1CWUA 4J49A 2GSDA 4J7UA 1A7AA 5C7LO 4MDHA 3RJ5A 3ROMA 2AEMA 1NQ5A 2VOEA 1ZEJA 5KNLA 5EQDA 4NJMB 2VUSA 4BMSA 2HK8A 5GMOA 4FFNA 3FCOA 3ZWXA 4BNFA 3C8MA 3RUAA 1JDJA 5KWEA 3QHAA 3RFVA 2QRKA 1XDWA 1IHXA 1EFKA 4Q3DA 4RF4A 4CMJA 4AJ2A 4GVXA 3C1OA 4L74A 5K9ZA 1J0XO 4WCFA 3CMCO 5KKCA 4JGBA 3HDYA 3LF2A 1DC6A 3L6DA 1R16A 5FWNA 3V1YA 3OMLA 5T8KA 2YZ7A 2X0JA 4KMSA 4NFYA 1NFRA 2CD9A 3EW7A 3H3JA 4NH4A 3JQEA 3EZLA 3ZU2A 4XRGA 2DQ4A 3F1KA 4DGSA 1YWGO 5KJ6A 3L4BA 3KLMX 1E3LA 2VN8A 3QIVA 5G2OA 2DUWA 4JX8A 5K6AC 2CDBA 1UXIA 5FF9A 3QWAA 4GMFA 3T7EA 2NVUB 2X9NA 4GLLA 5GZ1A 2FZWA 4ZGWA 4PLPA 4EUEA 2CMDA 4R9RA 5A9SA 4UEKA 3BMOA 1PL6A 1AGNA 2AA3A 2V6FA 1E3WA 2BH9A 3PJFA 4Z9XA 4NFHA 2AQKA 3HN7A 3JQ6A 1FK8A 3K2BA 1C1XB 1PZHA 3GNTA 4XD2A 3WR5A 4YT2A 2PH3A 1HXHA 2D4AA 2Z1NA 3CINA 1Y8QB 3LT0A 1GL3A 3AUAA 1CEQA 3WBBA 4EJMA 3I5MA 1PQWA 3QWHA 1K6IA 3GHYA 4MKRA 4PFJA 3AJRA 1SBYA 2FZEA 2Q50A 5U9CA 3U9LA 2BLLA 2PH5A 3UFXA 3JSAA 4DLBA 3L07A 1I3MA 3WSWA 2E48A 3VPGA 5K0ZA 4TVBA 2DBZA 1LQTA 3UH1A 5BT9A 1CYDA 4A73A 4CM6A 2NU9A 5JW6A 5A5EA 5JC1A 2GZ3A 5CDYA 2DUUA 3BHMA 2X0IA 3H65A 2Y1FA 3R1IA 5EIOA 4C7KA 1S7CA 4AJLA 1Y81A 3B1JA 3KB6A 1V3TA 1WW8A 5I7SA 4DQUA 3RUHA 4BNWA 4ZQHA 4L8VA 5F1PA 1GV1A 4IXWA 2G0TA 3MZ0A 3AFNA 3D5QA 4EITA 4BIIA 2P4QA 1UAYA 1HL3A 2A9FA 5B12A 4QTZA 4CR6A 1ZIDA 2PD6A 4AJ1A 3W4JA 2PK3A 4XIJA 3WNQA 1PL7A 1E7WA 1UXGA 3JD3A 5HM8A 1N9GB 5LCXA 3DR3A 3BTVA 4Y9DA 2YHIB 5HWSA 1U2GA 3DMTC 4K9DA 5KJCA 3FNEA 2I99A 4LRSB 2HU2A 5G4LA 5JY6A 4YR9A 1YH3A 1CERA 2PR2A 1DFGA 3GN2A 2PZJA 3L9XA 2JHGA 1GZ4A 4O63O 1D1SA 3CTMA 4I9HA 3WTCA 1PR9A 4RGBA 3ULKA 1ZK3A 1LBEA 4FJ2A 2O3JA 1I8TA 2WM3A 4L76A 4NMHA 1M75A 4PG6A 4E0BA 3G79A 5I7VA 4ALMA 3ROKA 2I76A 5ITWA 1YB1A 1D4FA 1SB8A 1ADFA 4HUJA 4R54A 3PLNA 3NDRA 1T2EA 3D7LA 3WYCA 1KVUA 5ILOA 1WZEA 3GHHA 2NNLD 5JE8A 4BL5A 4NIMA 1H5QA 3U4CA 3GAZA 2ZB8A 2X5KO 1ARZA 3KSZO 1PTJA 2GO1A 1QV7A 3JQAA 4W4TA 2AG5A 5F3RA 3WGGA 1MC5A 3I9NA 4J1NA 2H5LA 4DPLA 5IXYA 2VCYA 4XGIA 1SOVA 4ZA2A 3B70A 1NR7A 4AG3A 4IDCA 4W6ZA 1ADGA 1G1AA 3EK2A 4HP8A 4OKNA 3IDSA 1KY4A 4XQ9A 5AQ1A 1XKQA 3BTUA 3I9KA 4WGGA 1BDBA 2NVWA 3AM4A 1XWFA 4AJOA 4PRLA 4CQMB 1YOVA 3QA9A 3ETEA 1DHRA 3DBHB 2Y93A 1MFPA 3ZCXA 3LZ6A 3PQFA 1KIFA 2Q46A 2WE7A 1KEWA 3GGPA 4TMFA 4P4NA 4NG5A 4UUPA 3ZZNA 4J3FA 3RCBA 1PWXA 2J5QA 3ICCA 5IDYA 1EVJA 2W2KB 4GAEA 3QVXA 1IPEA 2DBRA 5KTKA 3L4BC 2UVDA 2P9EA 4BNGA 5T6BA 4MIOA 2TMDA 1VJ1A 2X5JO 4M54A 4KQWA 3WNVA 2O3QA 3A9WA 1H93A 4H15A 1LLUA 1ZH8A 3GF4A 3JYOA 1UAGA 1D7OA 1EZ4A 4KP7A 1BHSA 2Y1OA 3U62A 4HWKA 3HDHA 4D43A 2DTXA 4GGPA 1I10A 3VZPA 3DL2A 1MLDA 1OAAA 3ITDA 1HRDA 5U4QA 4XCVA 2PZMA 4UREA 2BRUA 2ZK7A 3L0DA 3NJ4A 5JMPA 4W99A 2R00A 2RH8A 4E3ZA 1R4MB 2PY6A 1ZXBA 1GQ2A 1LDBA 4S1VA 3KYCB 1MUUA 1GCOA 2OZPA 1YDWA 1BWSA 2P5YA 4NHEA 3VH3A 1C0PA 3AW9A 4PZEA 4HXYA 4RV9A 3G1TA 2VQ3A 3F3SA 5AXDA 5F1OA 3Q11A 3ZHXA 1YQXA 2XF8A 2D1YA 2VWHA 3WYEA 4E5KA 3FF4A 4GWKA 4R1UA 5ES3A 4E32A 1DC4A 5IFLA 3E5MA 1XLTA 2E6UX 1P9LA 4CLXA 1VKOA 3RIHA 1JU9A 2OGUA 1JN0A 3ZNPA 1LDEA 1A5ZA 4MVJH 4BGEA 5COAA 4RL6A 1D8AA 4CM4B 4JQCA 3IUSA 2X23A 3NYWA 2WWRA 3FR7A 1F14A 4MVJG 3D3WB 1NBOA 4A03A 2FPPA 1I01A 4ZHSA 1EMDA 3GUYA 3GPIA 3KVOA 1YBAA 3PIDA 1I2ZA 4E21A 4D44A 1ML3A 3I9JA 2AEJA 1LA2A 4E31A 1DIAA 3S2EA 1XQ6A 3RBZA 2W2LA 1ZFNA 4B4UA 2OBNA 1NAIA 2B35A 3FNHA 4WASA 4XA8A 3W8FA 4QXMA 1RJWA 4GMGA 4XDZA 1R37A 4Q3NA 4R5HA 4CPDA 5KKAA 1GYRA 5JCJA 3TDKA 5MDHA 2B83A 4CMGA 1FF9A 3IL2A 1N2SA 1I33A 2Y99A 2C59A 3G1UA 2BKAA 4FOOA 1WZIA 1QLJA 2VHWA 3TL3A 5I8ZA 1ZVMA 1LLQA 2V7PA 2POQX 2WD7A 1HLPA 3DZKA 5CP8A 4EUFA 1DDOA 1T2DA 3T4XA 1PS0A 2YYYA 1ZSVA 4GKVA 2EEZA 2Y05A 3ZHBA 1A9ZA 1LTHR 2JKVA 2NU7A 2H1SA 3IOYA 4CQMD 3OECA 2YDYA 4KQXA 5B4TA 4FFLA 5JXWA 2CVZA 3AUUA 4KUHA 3SJUA 3S55A 3L6EA 4N5NA 4QQRA 4J1QA 2CDAA 4J0EA 3WICA 2ZB7A 3RC9A 2BHLA 1RYEA 2QRLA 5JLAA 4YJGA 1UJMA 3WGZA 2P2SA 4CM3A 2FP4A 4J9VA 2NM0A 4TZTA 2HLPA 3TOZA 4BQRA 4YAIA 3BMNB 4WCFB 2ZJ0A 4YQYA 3RSHA 5DNAA 4ZQFA 2WE8A 4MOWA 3INRA 4R1SA 3CH6A 1UXJA 1N1EA 3MTJA 4CMIA 2WD8A 5JO9A 5JAQA 2WSBA 1LSSA 3AI3A 3ROQA 5JFOA 4K28A 4BV8A 3QY9A 3PFWO 2ET6A 2RH4A 3E18A 5F1KA 1U28A 2GUGA 1LU9A 4PLYA 4BV9A 4MVJP 2ZTVA 3GVHA 3Q6IA 2JCVA 4BNLA 3KV3O 3DFZA 3ETDA 1Q1NA 3AY7A 5TGDA 4CQLA 3WGQA 1U5AA 1IHYA 2B69A 4R3NA 2H63A 1HE3A 4ITUA 3Q3CA 4Q3CA 5G0WA 1DJQA 1QP8A 5A9SB 3ICPA 3BMOB 2IYPA 4W7IA 5IG2A 3ZW9A 2DPHA 1E3WB 1W8DA 2B5WA 2GN9A 4G5HA 1H0KA 5I9LA 1Y8RA 5THQA 3H9QA 3EUWA 3VH1A 5I9MA 2BFAA 3QV1A 2ZATA 1P33A 2X9GA 2X58A 2A35A 1QXSA 2XAAA 4BO1A 5DF1A 7ADHA 1Z6ZA 5FFFA 3JD1A 3C7DB 4WLUA 1NVTA 4CUZA 2R00C 2Q1SA 2Q2QA 2W98A 3D3EA 4CM9A 2O50A 3MJCA 1TVEA 1P45A 4U6SA 3UCEA 3E9MA 1E1NA 1R66A 3WLFA 1F8FA 1LDGA 4OMUA 5JAMA 3CE6A 3NEPX 1CF2O 4ZD6A 5CEFA 1NP3A 3H4VA 7MDHA 3K9QO 3W1VA 3CUKA 4R16A 1TA4A 3R3JA 1I36A 2PKQO 1GAEO 3IQDB 3A28A 5A9TA 2AE1A 2DAPA 1ZW1A 2PD3A 1YO6A 1EK6A 1H6DA 1X13A 4OM8A 4BNXA 3PYLA 3BTSA 4MIEA 1EUDA 4FIZA 4CL3A 4FC7A 4CMKA 3BHIA 1T2FA 3OEYA 3OJ0A 3MJ4A 3ONEA 4HKTA 3WQSB 4DC0A 1PJ3A 3MWEB 4MVJE 2VWQA 1WVGA 4K26A 4J4HA 5BQFA 2BFMA 2DU8A 2ZYAA 2GF2A 3HFGA 4IIVA 1BGVA 4NBUA 2ZKLA 2DBVO 1EDOA 1QG6A 4J4TA 2I66A 3ZU5A 1WAMA 3VVBA 5LC1A 3VZRA 4E6PA 5ILGA 1H6CA 5F5NA 3DOOA 5IF3A 1QKIA 1IB6A 1QSGA 4WNCA 4M49A 1A4IA 2E4AA 4EUHA 3G3EA 1GZ3A 3Q2KA 3JD0A 2PKQP 3KOUA 4BNZA 1HDGO 3UHAA 3GNQA 3NUGA 3TZCA 4DIBA 4ZU3A 3UAGA 4W7HA 2FPGA 1XYGA 2XOXA 3R3SA 1JW9B 1NFQA 1MXFA 1T24A 2EXXA 4QO7A 3RU7A 2BELA 4BMVA 1DIHA 4DVJA 4UVDA 1OBFO 2O2YA 1VJ0A 3MTGA 3AY3A 5DP2A 3W6UA 3NDJA 3DZFA 3S2FA 4FBGA 3ONFA 1SZJG 4JROA 3U3XA 4IXTA 3WS7A 3GFBA 5KVVA 2GN6A 3KZVA 4XR4A 4GGOA 5K6AA 3PDJA 2VRCA 2O2SA 1PR3A 3C1TA 4FPXA 3I6IA 5U1PA 2OO5A 4YWJA 5TRTA 2WDZA 4NBVA 2UAGA 3HDJA 1VJTA 1FDVA 2F00A 3HHPA 4A26A 2NACA 3F9IA 1I3KA 2OP1A 3MJVA 1RKXA 3OEWA 1K89A 3MJSA 1B26A 1JKFA 1NYTA 4Z9YA 2PLAA 2DM6A 1YOVB 4JNKA 3NTQA 4IGFA 2EIHA 2BF7A 1DRWA 1OC4A 2AXQA 4J7XA 2YQ5A 1P1JA 3ZWVA 4XRRA 3JQ9A 3KETA 2X8LA 5DBIA 1AUPA 1DB3A 4IIUA 2VZ0A 1TT5A 3ETGA 2AQ8A 5H81A 3S8MA 1NTOA 3VOSA 1NWCA 3SXPA 4JP3A 4RVSA 5IDXA 3AWDA 3IMFA 2HO5A 4Y6PA 4FJ1A 3S2GA 1E7YA 4WK6A 3HN2A 5TT0A 3TZHA 1Z7BA 5FYDA 2CVOA 2FOIA 5DN9A 1Q7GA 1NQOA 1A71A 2G17A 2Z1MA 2RCYA 4NU5A 5T57A 4BNMA 2X9VA 3UGKA 3EC7A 3I6QA 1HETA 2VUTA 4ALNA 4EZBA 1YB4A 1DBVO 1B0AA 1PGJA 4O59O 3U4HA 5KVQA 3WBFA 4TWRA 2WJPA 1ADCA 3BMCB 4GLOA 1U5CA 3RD5A 3ST7A 2G82A 4MP3A 4RORA 3NT5A 3PQEA 4DIFA 4XWYA 4LN1A 1P31A 4IS2A 1XA0A 3PEFA 1LSUA 2H9IA 3ROPA 4DLLA 1YB5A 3FNFA 3OJFA 2EJWA 9LDBA 4MVJD 3DMTA 3ZV6A 4EI2A 5C37A 2D2IA 1U8FO 2RHCA 1ENZA 1HF3A 4RVUA 5L45A 4ND3A 2P4HX 1GFSA 1EBFA 3C7AA 4Q3EA 5DCWA 2Q1WA 3BIOA 3BMQA 1HLDA 3RUCA 3OBBA 4FD3A 1NHWA 2HKIA 3DZIA 1JQBA 4PG7A 1O0SA 1U3VA 4IPTA 4IS3A 1JWAB 4TRNA 4WEQA 5ITVA 3F46A 4M87A 1ISJA 3QVTA 2B37A 3CZRA 5C7OO 5KVSA 4CLHA 2GERA 2EV9A 3UW3A 1DXYA 1FDUA 5JAZA 4JN6B 3H9GA 3M1AA 1QYXA 1PQUA 2B36A 4O0LA 4R3WA 4OOEA 1HKUA 3LK7A 2GR9A 4PLWA 4YB8A 4AL4A 1DRVA 1EEHA 2ZIZA 1DOHA 1V0JA 3LT1A 3HFSA 2Z5LA 1IPFA 3WQQA 1MGOA 4D0SA 1H6BA 2PZKA 2OP0A 4DBZA 4BS9A 4IZIA 3BZUA 4N5LA 1X7GA 3OSUA 4I5GA 4INAA 4DUPA 1E92A 1HZZA 2GN8A 1RWBA 2C2YA 2C29D 3WWYA 4BO8A 3CEAA 4XIYA 1XU9A 1KVRA 1ULUA 1IULA 1UZLA 5KOIA 2WMDA 4DA9A 1R12A 2JJYA 2VT3A 4D3FA 2NSDA 3GVPA 4YRAA 1EVZA 6LDHA 3PJGA 2NU8A 1GQYA 4FDAA 3COSA 4NJOA 4XYMA 4AJPA 4B4OA 3G0OA 3WMXA 2JL1A 3LU1A 2WD7B 3KEQA 1C1DA 2HMVA 2J3KA 1Y6JA 4J9UE 1H2HA 3RKRA 3N58A 4RZIA 4URFA 2PD4A 1L7EA 3K8ZA 1Z45A 1F06A 3DZHA 2HQ1A 3OA0A 2R6JA 1IE3A 1XELA 2EJVA 3W6ZA 3GZ4A 5IZ4A 4OGWA 4FSHA 4ALKA 2Q4EA 1PWZA 5A5FA 2JD1A 1JKJA 4LCJA 2VHZA 3RC7A 3NJ8A 1HSZA 1BSVA 1Z82A 3EAGA 4YA6A 4RQTA 4YJGB 5IZCA 5G0TA 3LYLA 3RFXA 3PXXA 4E2WA 1C0LA 3W4IA 2G1UA 1G0NA 3GVIA 3JQ9C 4D79A 3OP4A 3AY6A 1C14A 1PL8A 2A94A 3WXBA 3GVXA 1PZFA 1KOLA 1XQ1A 1DC5A 3ZNQA 4BQPA 1PJ2A 1VL0A 5DULA 5TLSA 3P5SA 4CMIB 1Y5MA 3L6OO 4M89A 3MJEA 4R41A 2CUKA 4NBRA 4PZCA 3GDGA 1BW9A 1MC4A 2YV2A 1QMGA 4YDRA 4Z9FA 3VDRA 2Y66A 4DWVA 1IL0A 1Z74A 2HJRA 4PLZA 4QX6A 4CLOA 5JCXA 1JAYA 4HNGA 4D41A 2VWPA 4RPLA 3E48A 3VPHA 4CQLB 4BGIA 4ND4A 4B7UA 2PGDA 5FI3A 4RPKA 1Q2XA 3L77A 1X1TA 3CPSA 3AUTA 3OIGA 3VPXA 3TZQA 3JQBA 3U0BA 3OQBA 5ADHA 2GNAA 4GWGA 1Y8RB 3WSVA 2GN4A 3AM5A 3LC2O 2ZTUA 2W4QA 1SNYA 3FI9A 2PA3A 5I7FA 3EHEA 3BTOA 1PZGA 2EP7A 5DZSA 4TRJA 5TT1A 5JYEA 1TI7A 5A9RA 3PIIA 3VAZA 1WWKA 1ONPA 4K1LA 3NGXA 3O9ZA 2CDCA 3EDMA 4TQGA 4YTEA 4WEOA 1DEHA 2C5AA 2IE0A 3BA1A 1I30A 3W4KA 4DC1A 3CZMA 2NADA 2YV3A 1LDYA 3CSDA 4YRDA 1P3DA 2VTDA 4UVHA 1PJQA 1PSDA 2BI8A 3GVCA 4RLHA 1X0VA 4DTIA 2GGSA 1T2AA 3ZV5A 1LX6A 2JFGA 3LC7O 1DFHA 2CY0A 4YT5A 4B7XA 3RQSA 2BMAA 1PU2A 5JDCA 2BFOA 5L4LA 1AHIA 4H16A 3PP8A 1B15A 3VTFA 2J3IA 1DAOA 3UCFA 4BKRA 5JO0A 3HSKA 4NU6A 3MEQA 3KYDA 3QWIA 3WFJA 1U4SA 1Z73A 2ZYDA 1O89A 2X4GA 1KYQA 1R6DA 4UEJA 4FCCA 2W2LD 4FJ0A 1ZK4A 1XSEA 2EWMA 1RM3A 5G0UA 2VYND 4OHUA 1DLJA 3ZWPA 4RQUA 3GAFA 1JLLA 4KTVE 3FRJA 1HDRA 4UVGA 3TWOA 4TVOA 2NWQA 2DKNA 4AJIA 4P22A 4DYDA 5JCJD 3WOHA 4NZ9A 4C7JA 3PWKA 3DONA 4CR7A 4KUGA 3O03A 4Z0PA 5T64A 4PLHA 4E5NA 1PS8A 1LJ8A 2TMGA 5KIAA 1PGNA 4PN3A 3JD2A 3DZGA 3C24A 3NTOA 4ND2A 3D1LA 1E6WA 3HDQA 2IZ1A 3U09A 2CF5A 4WCDA 1SC6A 4D0RA 4OXNA 4LCEA 1CQJA 3BAZA 5EPOA 4CV2A 3SVTA 1T2CA 3ENNA 1VM6A 4YJHB 4CUJA 5DOVA 3DBRA 2ZJ1A 4E2ZA 4RVHA 3NAQA 1C3VA 4B8WA 3GZNA 3C3XA 2Z95A 1IY8A 3D5TA 3NKLA 3RFTA 4YEDA 3OQ6A 1QV6A 2X7HA 3HUDA 5IDQA 2NTVA 3OHSX 1E3SA 4QUKA 1UDCA 3GFGA 3GN1A 4BB6A 5IZCC 1GCUA 5MGBA 4M8SA 1BXKA 4WECA 4JCOA 3ADOA 4FGSA 2J3JA 1H6AA 3VZSA 2DPGA 2QYSA 4J2HA 1KVSA 1ISGA 1HWYA 4CMHA 4ZRMA 3ZW8A 2NUAA 1TT5B 4WUVA 4DMLA 5IXSA 2Y1EA 2VWGA 2NTNA 1GEGA 3SBOA 4BNIA 1ENPA 4CLDA 4I9UA 3TZ6A 1N1GA 1HEUA 5AOVA 3O8QA 2FRDA 1EUCA 3MCVA 4YJFB 5B37A 4EGFA 2VUUA 1E5QA 3I4FA 4OO3A 4TKMA 5EESA 2VHXA 2GZ2A 2VYVA 5LDHA 5L9AA 1BTOA 1Y9AA 3OFSA 4ALIA 3JQBC 4IDEA 1ZUD1 3ZI0A 1M2WA 2IDZA 4AJHA 2YFQA 4TZKA 3RUDA 3RUEA 3E5RA 3H9UA 3ANLA 3VZQA 3HQ4O 2I65A 5GY7A 4ZRNA 3QVOA 1N92A 2Y1DA 5H83A 3OH8A 3C1AA 5ICMA 3M1LA 1R4NB 2QX7A 2XXBA 1JVBA 2PGJA 4TRMA 3NX4A 1NM5A 2XXJA 5L7WA 1P1KA 1XHLA 3VH2A 2PGLA 1HYHA 3I3OA 4BO5A 2I3GA 3IP3A 2UUOA 2CF6A 2PKRA 1EFLA 5CDUA 2Y1CA 1HDYA 2J5KA 1O8CA 3ZH2A 1KY5A 1NWHA 4BNUA 2V6MA 1YBMA 1EK5A 4CMCA 3AUSA 2FR1A 1RM0A 2OXIA 4YT8A 5HS4A 1GADO 3AM3A 3W8DA 3Q2IA 4NK5A 3PHIA 1UUFA 1LRJA 1V6AA 1ZK1A 2I3AA 3A4VA 3QQPA 4IQ0A 5L4NA 3U5TA 1WDMA 2I9PA 4BUCA 5DCYA 5A03A 4UULA 5JDCC 3KYBA 3VTZA 1B3BA 1JA9A 3DWFA 3GDFA 4GKBA 1M6HA 1X7DA 4WLEA 4C4OA 5B1YA 2YFHA 3V1TC 1ONNA 1Q7CA 4FFRA 4AVYA 1U3WA 2LDBA 5JBIA 5B4UA 3VKVA 4ND5A 1V35A 1FDTA 2G76A 1FDSA 2HMUA 4I5FA 3NT2A 4HADA 4J90A 1KBZA 2IZZA 4HFNA 1F17A 1H9BA 4IJVA 5KJEA 3TN7A 2F1KA 4G81A 4TROA 3GGOA 1A4UA 1CQIA 3LVFO 4Q3BA 1XG5A 3GH3A 4II2A 4M1QA 1LRKA 3ZWOA 2FR0A 4WOKA 5AVOA 1TLTA 3IAHA 5CG2A 3SLGA 1LEHA 3H9EO 4A10A 4GSKA 4S3MA 2JAHA 4NNJA 3GT0A 4CM1A 2Y67A 1VRWA 4W82A 1R0KA 4K6CA 3WGOA 3ZDFA 3VH4A 2NVBA 4TRRA 4RVFA 2PFGA 4XYBA 2Q4BA 4OOFA 2IZ0A 2X5OA 3PHGA 4R5MA 1E6EA 1K5HA 2BGKA 4P4GA 4DPKA 2QG4A 2HDHA 1Y8QA 1C1DB 3AOEC 1YL7A 2V65A 4WKGA 4D3SA 3Q0EA 3AOGA 4Y6SA 4ESOA 3UKOA 2Y68A 4PRKA 3AI1A 3IKVA 4UVIA 2OFPA 3S2IA 3MJTA 1T4DA 4MVJM 4NI5A 1WMAA 1Y9EA 4BKOA 3FWNA 1UDAA 3DZBA 1NPYA 3LDHA 4CV1A 1CIVA 3D4PA 4OJNA 4LVUA 4JBHA 4IDBA 1QR6A 1ZNQO 4GPD1 4DREA 2DT5A 3TQHA 1W6UA 3OIDA 1O94A 3OQ1A 1B8UA 1HE5A 1E1MA 1HDCA 4BNVA 3PGXA 3LQFA 1ENYA 4IJUA 2UUPA 5CG1A 1VI2A 5TX7A 3RI3A 1QORA 1BXZA 3KHUA 4YJDA 1KS9A 3I83A 3ZNOA 4DIOA 4DLAA 1N7GA 2V6BA 4L0QA 2QQ5A 4DRYA 4ZJUA 5I7EA 4MKXA 1KC1A 3LC1O 2DFVA 1YKFA 4B8ZA 2DTDA 1BW9B 4CV0A 1RPNA 4RF2A 5ER6A 4CLOB 2P68A 1ENOA 2FWMX 2D5AA 4XGNA 1C0KA 4BGVA 2AE2A 3LLSA 1KEPA 5G4KA 1B8PA 1K2WA 3NGLA 2YDXA 2VT2A 2HJSA 3TF5A 3RROA 1N8KA 1N9GA 2IXBA 1BG6A 4E5PA 3OJOA 2O7SA 2ZTMA 4Y67A 3QWBA 2O3UA 4GX1A 5EJ2A 4MPDA 4BMNA 2CVQA 2NV6A 3EVTA 1NNUA 4XEHA 4BNNA 5C3MA 2ZCVA 4A5OA 5ICSA 1M76A 1O6ZA 4RZHA 3H7AA 2SCUA 4JBGA 3KRTA 3Q1LA 2E82A 4MINA 2I67A 3LT2A 2HRZA 5TNXA 1I32A 4XZ3A 2Q1UA 4QECA 5HS6A 4IZHA 4OQZA 3IC5A 2VZ8A 5TSDA 1RM5A 3E9QA 3IP1A 1YONA 4L4SA 4XYLA 3UVEA 1H94A 5B4VA 2GCGA 1WPQA 1KC3A 4MJLA 4CM7A 1DIBA 1E3JA 1CETA 1BVRA 1OC2A 2DTEA 4L75A 4K6FA 4P4LA 2R2GA 3L9WA 3PZRA 4LK3A 4CLRA 2GD1O 1IOLA 1E7SA 1PQPA 4IMRA 5JY1A 1U3TA 2X0RA 2RIRA 3ZHYA 4F3YA 5KJFA 1J5PA 1VPDA 4F6CA 3FNGA 4FQ8A 1KETA 2Q2VA 4X54A 1KERA 4CQMA 4J0FA 1AHHA 3ZN2A 1BVUA 1O5IA 2AEFA 3CIFA 3UF0A 3DBHA 3P7MA 3E8XA 3JQAB 4EDFA 4PG5A 6ADHA 1P0CA 4PIVA 1PGOA 3GEMA 4U0KA 2HUNA 1O95A 3JQGA 4D7AA 4NPCA 4XYEA 5GZ6A 3BHJA 3K73O 1UR5A 3VVCA 2ZQYA 4J91A 1GTMA 4RPHA 2O48X 3V5NA 3F1LA 4E2XA 8ADHA 1GU7A 2HK7A 4IDAA 2W2KA 4FR5A 1GD1O 1MXHA 1ZMTA 1LI4A 3M2TA 4KWHA 3BYZA 3WGIA 1ADBA 4RF3A 1K6XA 4Z3DA 4FC6A 4XQGA 1CRWG 2ILTA 2E37A 3SC6A 1P1HA 3AK4A 3I23A 4F45A 5A06A 4D45A 2JD0A 3TFOA 4Y6RA 1VC2A 1ZEMA 4I08A 2UYYA 3U4DA 5DDIP 4AJ4A 3KSUA 3QWFA 3RVDA 2AMFA 2Q1TA 3FPCA 1U8XX 2J3HA 3JQDA 4BOYA 4CM5A 2Q45A 2WYUA 4WJZA 4YQZA 2OBYA 3PHJA 3F5SA 3H3FA 3QRWA 1I2CA 3O4RA 3CMMA 2VNAA 1D1TA 1UZNA 1YL6A 4IGEA 3ABIA 5JPIA 5IAAA 2G5CA 2HMTA 2YQ4A 3DBRB 4OXYA 1R4MA 3IIEA 3WGYA 4BO7A 5BNTA 4U6QA 1L7DA 2X6TA 3GZNB 1I24A 1YVEI 4GQAA 5KCZA 2EERA 4IJWA 4DYVA 3FBGA 1V3UA 1DHTA 3GC6A 4Z3KA 5IN5A 3PFFA 3TFQA 1BXGA 4QFCA 1XR3A 5J23A 1U7HA 3VPSA 1ZK0A 5CPBA 2P91A 4AJKA 3GG9A 2Y1GA 4RVGA 3RU9A 4E30A 5A1TA 4ZQBA 1DAPA 1LC3A 1LRLA 4JJFA 1YQDA 4IM7A 1TT7A 1Y7TA 5TIIA 5A3VA 1SEPA 4B7CA 4CM4A 1GV0A 3INGA 4RLSA 1VKNA 1I3LA 1ZMOA 1A9YA 3OA2A 1LDMA 3O8QB 1T4BA 1PJSA 2WYWA 2B0JA 4CL8A 2UV8A 4XB1A 2FSSA 5BR7A 3G49A 3FTNA 4YPOA 4XB2A 2O7QA 5DP1A 2O3SA 1FXSA 2X1HA 3V2UA 1LQUA 4HFMA 1L1FA 1OFGA 5A4DA 3RWBA 5GZ3A 1NR1A 2ZB4A 4M55A 4FW8A 3ZWWA 3DHNA 4J2OA 1B8VA 4JIGA 4DQXA 4Z0HO 3PI7A 2W8ZA 4PLCA 5I9NA 1VLLA 1PX0A 3PYXA 2PNFA 4TSKA 4RF5A 2NTJA 1P74A 3SEFA 4B79A 1P44A 4BVAA 4CJXA 4DPMA 1H2BA 4NBWA 3JQCA 1UH5A 3V2GA 4B3HA 3LF1A 4LVCA 2O3TA 4FFPA 3RBXA 4CODB 1MFZA 3F5QA 4YAJA 3RJ9A 2FPIA 3WIDA 4D42A 9LDTA 4Q3AA 4Y98A 2A92A 1CJCA 8LDHA 4YT4A 1QYCA 4OYRA 4EJ0A 2YHUA 1J49A 3RUIA 1NX6A 3K2EA 1NVMB 5CHEA 1FDWA 3JYLA 3U4IA 1F8GA 3JQAD 5BNIA 4BO0A 1DJNA 1V8BA 3A1NA 2P9GA 4O1MA 4GBJA 3GG2A 1OMOA 5BNFA 1YQGA 2JCYA 4ZQEA 3KM0A 4GH5A 3ZV3A 2EGGA 1E3IA 3I52A 3C85A 4P8RA 2OHXA 1LSJA 1DSSG 3D0OA 4MIYA 2OOSA 4U8GA 5DCUA 3FD8A 3RUFA 3D4NA 3TJRA 3ZWBA 3BMNA 4IBOA 1WMBA 4E33A 4J1SA 3X2EA 2C2XA 4OIMA 1B14A 3JCZA 5ENDA 2EG9A 4YCAA 2D59A 4YACA 2AHRA 2IEBA 4ND1A 1E7MA 1X7HA 4U5QA 4ZICA 3TL2A 2JCXA 1OI7A 1QRRA 2OUIA 3QE3A 4L9RA 5EL0A 4QSMA 3E6AA 3UN1A 4MP8A 3DHEA 1EVYA 4FGWA 1MX3A 1EE9A 4XQCA 3GPDG 1IUKA 1EBUA 3D4OA 3KEOA 4CMEC 1U2DA 1F12A 1ZXLA 2DC1A 1TEHA 3JYPA 1B2LA 4H3VA 2IODA 1MG0A 4E13A 4EEXA 1UP7A 3VDQA 4BNKA 1D3AA 4KZPA 2C7VA 4CM8A 2IRWA 5CEJA 2ZCUA 5EN4A 1K0UA 3DBVO 1Q0HA 4O6VA 2CFCA 4O5OA 4XX0A 5T5QA 2Y0CA 5COBA 4CR8A 4B4WA 3INTA 3P2OA 1T25A 4Q39A 1QLHA 1F0YA 1ZKMA 5CFZA 2GPTA 2QZ9A 5A02A 4NK4A 1T1RA 3NTRA 4MVJI 3DAGA 2UDPA 3JQ7A 1YRLA 1ZBQA 2OL4A 4ALLA 1GDHA 3V8BA 5CDGA 2Q99A 4XJTA 3I4CA 3F4LA 4UUMA 3EYWA 3DBLA 4JJGA 4B3JA 2HSDA 4MVJA 1JTVA 3QVWA 2EKQA 4WE3A 4FOSA 4ID9A 4J1TA 1LLDA 3WWZA 5L51A 4LISA 1RM4A 1UP4A 1XGKA 2GYYA 4DMMA 2J5RA 5LDGA 3IS3A 3OICA 2NLOA 4KTTE 1VSVA 2NQ8A 3H5NA 2VYVD 3E1KA 2EF1A 3GOHA 5EMHA 1WXDA 4IMPA 4UEOA 2CNBA 4R4JA 3ZWMA 4LRTB 4KUEA 3C7CB 3TRIA 3HB5X 2DFDA 2H6EA 5KJ1A 1VE9A 1W4ZA 1SOWA 1UXKA 5G4KB 4YAKA 1J6UA 4DQVA 4E12A 3I9MA 1ZJYA 2PV7A 4ZQGA 3JYNA 2Q2WA 5C7IO 1BRMA 1ZZEA 1ISHA 3UUWA 2DLDA 1PJBA 3PLRA 3H6KA 4M86A 1TB4A 1ISIA 3MOIA 1YXMA 1Q0QA 2AQHA 1HDOA 4OL9A 4U7WA 4XGKA 1FJHA 2QRJA 3ORFA 2I6TA 4L4XA 5ER9A 4IY1A 3GRPA 4CMAA 5JDIA 3WJAA 3R6DA 2X86A 4PLTA 1PGPA 3U49A 1HZJA 1J4AA 4R69A 4LSMA 2E49A 5EINA 4FN4A 1X15A 5TF4A 1X0XA 4DBVO 4YYZA 1GYQA 2GLXA 4XYGA 1SB9A 3PYMA 3GY0A 1JAXA 1I3NA 4IUYA 3K6JA 3AU9A 4GI2A 5IJZA 4BO9A 4AJJA 4NFSA 1R15A 2JHFA 4NBTA 3Q9NA 4PLFA 4CLRB 5CPFA 1YL5A 1EDZA 1PEDA 4BNHA 2Q3EA 1AN9A 1YGYA 4YXFA 1M67A 4HNHA 4AICA 5BSEA 1CDOA 1SPXA 4U0JA 1MV8A 3NV9A 1XU7A 2D3TA 5FEUA 2VNSA 1WP4A 4I5DA 1X14A 3JQ8A 3ON5A 3DAPA 3AOEA 4WCFC 5CDSA 2EKPA 5AXCA 5L7TA 3DXFA 3GDOA 4XJSA 3JQGB 3TZKA 5T8KC 3HB4X 1NPTO 2CSUA 3H2ZA 3DTTA 3GK3A 4NDNE 4CUKA 1U1IA 2AW5A 1GEEA 4WNIA 4WLVA 3B1FA 4ONEA 3L4SO 1X1EA 1ZJZA 1NFFA 3ADPA 5TJ9A 5THKA 4AJEA 3JQFA 3ZHZA 1FMCA 3ZU4A 3PWZA 4BKQA 3GEGA 2ZB3A 3DB2A 4RPJA 3HE3A 4MVJF 3WG9A 4QEDA 4A0SA 5CEEA 1U7TA 1LXCA 3N74A 1SEVA 3O26A 4HY3A 1E0DA 4P38A 3UXYA 3BMCA 1LC0A 2P9CA 4PCVA 2V6GA 1WDKA 3ZGYA 3E82A 2RAFA 5L3ZA 3GQVA 3CKYA 2WYVA 3WLEA 3UCXA 4DL9A 3QP9A 1M6WA 1E6UA 1U3UA 3I1JA 5T67A 4YRBA 1OZAA 2B4TO 4FB5A 1NPDA 4XDYA 4WLFA 1YJ8A 4OH1A 2FN7A 4N5MA 1ZSYA 4RCVA 3KLPX 4OKIA 2GASA 2HAEA 4CLEA 1E7QA 3KSDO 3KUXA 2VHVA 5DBFA 2QYTA 1QYVA 3FBTA 2NQTA 1ISFA 3QLJA 4XQEA 4CM9D 3LLVA 5TS3A 5CDTA 3PVZA 1V3VA 2C0CA 3AI2A 3EMKA 3VHRA 1DC3A 4I8XA 3IKTA 3ZWYA 2OORA 1ISMA 3T7CA 1BXGB 3ZV4A 2QZZA 2IEDA 2QIOA 3H2SA 2ZYGA 4FFMA 1Q0LA 5HBRA 2BGLA 1JWBB 3ENKA 3TNLA 4UAGA 4EEZA 1K6JA 3WQRA 1HE4A 2FR8A 4KDEA 2FHSA 4WLNA 4EYEA 3F47A 3KO8A 1MA0A 4RJTA 4Z0TA 2YUTA 2ZQZA 2AG8A 3GUCA 5ENVA 5JYDA 4BKUA 3BMQB 2BD0A 2IXAA 4TKLA 3VKUA 2PWZA 1G0OA 5L4SA 3OETA 2PTGA 4A7PA 4I9NA 1DIRA 4NJMA 1JVSA 3GLQA 3QVSA 5DT9A 5TQVA 1W73A 2CZCA 4IQGA 3PTZA 4OSPA 3QJ5A 2JFHA 1V9LA 1QYWA 2HMWA 5G0VA 1A72A 5IN4A 1GUYA 4FFOA 4HV4A 4CV3A 2BFPA 1RYDA 4LW8A 4MO2A 1NQAO 3QSGA 2VYNA 1P0FA 3W8EA 3E03A 1AXEA 4OAQA 4RVDA 3DEYX 5JDIC 1NVGA 2HK9A 2D8AA 3E9NA 2C82A 2JFFA 3WTBA 2J8ZA 3H9JA 4WPGA 4WLOA 3JYQA 1Z7EA 2O23A 1ZCJA 4RPGA 1IZ0A 4ALJA 4WOJA 5AXAA 3WDSA 3DZJA 3HADA 2O3RA 1LUAA
chains in the Genus database with same CATH superfamily
2ZRDA 4GX2A 3HWRA 3LC0A 1E2LA 4PGFA 3KT6A 4L4RA 1YS9A 3K15A 2LWIA 2DBQA 4CE6A 5CNKA 1F2UB 1FTGA 3DL7A 5EIEA 3COPA 1S1MA 2NVUA 3OESA 3PHHA 3ZVKA 4LYEA 2Z5FA 1M2KA 1YUMA 3DAFA 2FPWA 3MT8A 3K94A 2GNOA 1PHRA 5JC8A 3THWB 4CKWB 1JDTA 1UBRS 2HQSA 3EUFA 5H0IA 3WK8A 3WAKA 1SAYA 4F97A 4DS3A 4IEIA 1II8A 2AMJA 1W36C 1ADYA 3EDQA 5CJ2A 2ZJ5A 3AUFA 3A14A 3AMVA 3DC7A 4JBIA 4RD1A 5EZYB 3WMGA 3D1VA 4MZDA 4Z5XA 4A1OA 3TPCA 3VPCA 5CD9A 5H59A 1P72A 1PZEA 1C3LA 3F6YA 2EP5A 3GBSA 3T5PA 4N8SA 2OPHA 1LW6E 4G65A 4K3UA 4FCTA 1QIDA 1P77A 1XIVA 3CW8X 1KEUA 3T3PB 1ZAYA 3DE1X 3UBMA 2ADOA 3NHWA 4MKGA 1KKMA 3PEUA 5BSFA 2PIAA 3NWBA 5FQOA 4CEIB 1QK3A 1DFIA 1EJBA 1QWSA 3CZ5A 1FSZA 2QUJA 4A6EA 4F46A 1MH9A 4EF4A 1LLCA 3FOWA 3DTYA 5TMPA 3RAJA 5CA0B 3RBVA 5KYVA 3FDZB 3HBNA 4JYMA 1ISRA 1G8FA 4L73A 2NUBA 2QN8A 1QH1B 1PVDA 2P3LA 3KBBA 1IK4A 4A2CA 3IFSA 1K3TA 4ZCQA 3WWCA 3ZIAA 1D4ZA 1MDFA 2D0IA 2DUNA 2VA9A 3W2IA 4DR3B 5IVIA 4QPNA 2YJ5A 2WAOA 3GJ5A 3G17A 5TJHA 4YCBA 5EE9A 5AJUA 3H5AA 4F6LA 3C6BA 3ZNNA 1IZ9A 3HWX1 2C1XA 1HG1A 1E6LA 1UFVA 3HNPA 2HQOA 3IQZA 4J0JA 2GK4A 5AVWA 3NUQA 2BUBA 3ES9A 4CM8B 3FHLA 4Q7MB 4A6DA 1S6YA 4AJNA 2ZDGA 1DWUA 1I5RA 1USKA 3RVJA 4A36A 1W9MA 2ZBUA 4LHWA 2Z3ZA 3AETA 3OX1A 4EGCB 1L6IA 5L53A 1PT5A 2GYUA 1AM4D 2R1TB 2GK6A 1OVGA 2HXYA 4IDOA 1SIWA 4KN5A 5AUOB 1XAHA 2B5VA 4Q9NA 5TMEA 2GPYA 1QHIA 1XRNA 3NWEA 4M0LA 3WB9A 4E4YA 2ZCJA 1E1LA 2XYGA 4XAQA 4DKXA 3DXZA 1H3EA 4PBSA 2PMWB 2E5LB 2FXIA 2NU6A 3UICA 3OCZA 4DLZA 2VQ6A 1WRBA 4KFSA 1OE0A 2PKEA 1IM8A 1QE5A 1NQTA 1YDFA 2I6QA 3U37A 4D8TA 1U1GA 5I7AA 1CR0A 2CUTA 4NXNB 1MB4A 3UJ8A 1A7KA 3ZS9A 3URKA 4FFDA 3FSRA 1KYIA 3QBEA 1JQ5A 4CNBA 3HN6A 1H9AA 3PJDA 4DSAA 5CNJA 2BM1A 4EFDA 5I8WA 5HQ3B 1BH6A 3UM9A 3STHA 1LPSA 3MAGA 3N07A 5H82A 3GFRA 3HGQA 4HYQA 3KCNA 1EPUA 2AUNA 2BCEA 1VTKA 1YQTA 1VL6A 4G8BA 3KQLA 4FHZA 1TAUA 4ZVVA 5KKNB 4LWZA 3OJLA 1WQ3A 2P30A 5HDBB 4QICA 4AFNA 4WZZA 5EJFA 3RR2A 3KQYA 3UANA 1SZPA 1MJFA 2CNKA 3ANXA 4J94A 4LJ9A 3M8KA 1V8PA 1FNSA 2Q0SA 1CRQA 2C4VA 4KYVA 4AY6A 4IJ6A 3QVJA 4ZALA 3A31A 5BOSB 3FOBA 5T4EA 2Z83A 4ZVNA 4E2YA 1YIDA 2I4MA 2ZI9A 2GHIA 3A37A 3V4ZA 4YBZA 4QJ3A 3D54D 3HV0A 1HE2A 3C97A 3ZCUA 2V1XA 3VPAA 3QEMB 2PAFA 2H3HA 2V9CA 4UUNA 4CDGA 4UXHA 1M3SA 3G6WA 1G64A 1RI4A 4EB6A 1U0BB 3ZKWB 2RGBA 3E5HA 4OXKA 3N8KA 1V7PC 1KGSA 1Y1PA 1SMKA 4MITA 5TPZA 3RVMA 2FSVA 4WX2B 5JSFA 4R9NA 3ENQA 5ALZA 1TKAA 3QG1A 4C6TA 1GITA 1J2YA 2IP2A 2VF5X 2B3DA 3GMSA 1BN6A 3JD4A 4FZVA 4L3VA 4ZVLA 2AZMA 1BKYA 5JTTA 1Q1EA 1ORWA 1L4NA 3F6CA 1SC9A 1QHHA 3T4EA 4Y1RA 2P41A 1UZMA 1G3QA 1FLDA 3WWDA 1N36B 3GZTB 3RC1A 3BRQA 2XWQA 5IUKC 1JYEA 3USES 1NLFA 2ZTLA 4KIJA 1DT5A 2ZR9A 3R2JA 1XL1A 3MPUA 4MVCA 3MWDB 4UHHA 2O2JA 3WMWA 3QYPA 5CH5A 5TC4A 1P0IA 4ZVQA 4PTYA 5AKHA 5FBHA 3ZGVA 4EBFA 5K20A 1JKIA 1GR0A 3AHEA 1QVRA 1AO3A 5K05A 1NQWA 4PPGA 3HR4A 2GZ1A 3SX2A 5L3SA 1A27A 3VC7A 4AZWA 4QNMA 1KDVA 1PT7A 3DVAB 3PDUA 4IINA 4CMEA 1S9HA 5HA5A 4YRLA 3MWFA 5ELXA 3ODPA 4N12A 1FTYA 3DQPA 3PRJA 3ANTA 3ZDXB 3IDOA 3JV7A 1YKSA 3R7WB 3UK1A 3I1FA 4RANA 1YVDA 1FTSA 1VZ3A 1YRBA 3D64A 4GX0A 3ETNA 4QDTA 4E5YA 4PSKA 3TOXA 4DV7B 2PX3A 2O5RA 1DRUA 1L0BA 2W90A 4HGYA 1IY2A 3FOCA 4B09A 3A2KA 3NHLA 5FUYA 5KQLA 3LWBA 4B44A 2XNJA 4K40A 2CZQA 1AZSC 2ONZA 4PC1A 3C7TA 4DCNA 3R5KA 3GEDA 4NQRA 4Y9TA 1V5IA 2H1RA 2ZT8A 3WIEA 4EW6A 3I53A 3B3AA 4HF7A 1D5WA 3BFPA 1BIFA 4J4BA 4KRGA 3FIUA 3ONWA 3N5KA 1U7PA 5EUMA 3F4BA 4F72A 3TW0A 2C20A 2PGNA 1V8DA 3ANNA 2XPCA 5A62A 1HT0A 1V4BA 3WLSA 5DI3A 4M0KA 4Z6KA 1KVTA 5F77A 1W0KA 5KQMA 1TO6A 3BA6A 3RS3A 1ZSNA 4GL4A 4UTVA 1NULA 3C8UA 1U63A 2VA8A 5AICA 2WF6A 1AUVA 3R6WA 1Y6ZA 2P69A 3AL3A 1E5LA 1LNSA 1CKEA 1VSUA 1THTA 3EGOA 4PZDA 2FPOA 5LUBA 3LRPA 3JXEA 2B7CA 4KN8A 2D13A 3H5VA 4LZPA 5ALIA 4NR0A 2XYHA 4EKNB 3ROGA 2IUFA 4QUJA 4S12A 1DXOA 3I2IA 1WE2A 4U8HA 5E6UA 1LLFA 4MUEA 4MPRA 4B3IA 3LM8A 2M98A 3CS3A 4TV8F 3K9GA 3TW8B 2K5UA 4YJ2F 4OI0A 1K4MA 5CT8A 3RTEA 1HFEL 2FDCA 3NBQA 3GP3A 2V9ZA 2SECE 2X22A 4YUYA 5LA6F 4LTDA 1G3IA 3RS4A 1GQQA 1J0BA 3DV9A 2R68A 5KINB 1QRUA 1L4LA 1NN1A 3ZBPA 4BCBA 4EGJA 4KDFA 2AR9A 2LDXA 1I4EB 1CUGA 2IEIA 3OZIA 1M2HA 3I37X 5CK5A 3PITA 2JG3A 1UM9A 1DO8A 4DR7B 5A7HA 2WTUA 3RVBA 3DPUA 4BTLA 1GY8A 2UZAA 5CAEA 2YJZA 1G60A 4WXPA 5L7YA 3FPKA 3IHWA 1NURA 1BZYA 2P2LA 4MB6A 4RKWA 2QP3A 4YAWA 4CNQA 1BDMA 1JPUA 2H51A 2X2FA 3A11A 3EF1A 3GPCA 3GNSA 3P2YA 4QA9A 4RMGA 2QMUA 4BKPA 3O7MA 4OXIA 3B78A 5HIKA 4YP0A 4TTIA 1FFBA 4NF2A 2WFZA 4FKMA 3VO2A 5HJ2A 4CDMA 1B7GO 3KOMA 4PG8A 1X7WB 1O9BA 4I55F 4ZJPA 1L6RA 1NVUQ 2FUG1 4HDRB 1U2RA 3FUXA 3K6RA 4HQLA 4PXYA 5M3BA 4DNOA 1NXVA 5JRDS 4U02A 4KQFA 4OQNA 2R751 3QLVA 1TPYA 4BVLA 4B81A 4J7UA 1EJ0A 1A7AA 4RMIA 4OTZA 4FYXA 5CH8A 1DXHA 1GA6A 1YV9A 2WHQA 4WD3A 3ROMA 4CN9A 1ZEJA 5C8DA 2IUEA 2J0UA 1MRSA 1S01A 1BDJA 1HOXA 1L4EA 4G37A 4NJMB 1KQGA 2JLXA 2ZM5A 5GMOA 4FE3A 4FFNA 2BFWA 3HKBB 4IZOA 3T9DA 4JMPA 3S7ZA 3RUAA 3R0XA 5JVDF 1KPGA 3GLSA 5KWEA 1NBME 2H07A 3E5NA 4AP9A 3L1HA 2ZIUB 3TBFA 3PXGA 3ZE2B 1NVVQ 4RF4A 4OV6B 4H4DA 3RTCA 3FPAA 4L74A 4RVCA 1WPXA 4WOPA 5DW0A 2VDWA 1Y89A 3I58A 5KKCA 3KOYA 3LF2A 4EHLA 5K0TA 3IESA 5JWOA 4MB0A 5JRZA 3PC4A 5A0VA 2WU1A 1F0KA 2G06A 4YN3A 4FYMA 2JVIA 4P86A 4QGFA 4X8MA 3MS4A 2CD9A 1SN7A 5A3RA 5KSZA 1TU0A 3C3MA 3EZLA 1DG3A 1H5UA 2ALJA 2DQ4A 3N0RA 1EK0A 1RPJA 3F1KA 1E2KA 3V1KA 4DGSA 4R71A 1TVMA 3CR7A 1OYWA 3KLMX 3LX4A 4FOPA 4XXHA 5CUQA 1IN1A 1QIHA 2DUWA 1CUSA 4B84A 1UXIA 3AJ8A 1Y3FE 3T7TA 4Q01A 2UYHA 5LMCA 3T7EA 2B30A 2B82A 1E2NA 2V97A 2H8KA 2OO5C 3O9VA 4C78A 4JQZA 1WKVA 4R9RA 1G16A 1PJAA 3V8NA 4UEKA 4QM7A 3BK2A 4WHMA 5FRDA 1AGNA 4MRPA 3LA6A 4D8XA 4HH0A 5LU9A 1SQ5A 1PF7E 4BRWA 3HBFA 1XD2B 5IW8A 2ZSJA 4I50F 1PZHA 3GNTA 3CV3A 2G0NA 3HHEA 3KZCA 3PXCX 5B6JA 2E4YA 1YD7A 4R83A 3QU9A 3KVVA 3E9ZA 1J0DA 1A8QA 3I5MA 5KTMA 3JRNA 5AKGA 4PFJA 3AJRA 2C2ZA 3QF7A 2FZEA 2Q50A 3IVMA 4ZAVA 3SNHA 4M0DA 2PH5A 1XBTA 1GPAA 1E2DA 1UK7A 2N47A 1RI2A 3HLKA 3JSAA 3UH0A 4ZHQF 3NBFA 1I3MA 2VS1A 4EHNA 3DTNA 1ZIXA 2WICA 2E48A 1RYMA 3BL6A 2F3UA 1FS5A 4JP1A 2F3PA 2ODPA 3VPGA 3Q2OA 4DV5B 1RRPA 2ZJOA 3QE9Y 3EJ6A 3UH1A 3HXKA 4BRUA 2JARA 3EGEA 2QL9A 4P3NA 3U9TA 2Y1LA 3OOHA 1ZHOA 4ZMSA 4CM6A 3FSJX 2I87A 1NVBA 5G1PA 3TH5A 1N6KA 1J0CA 1U4NA 3E3AA 3OAAD 4M60A 5AW5A 4ENQA 1IK6A 2CBZA 3TUZC 3H65A 2Y1FA 3R1IA 5EIOA 2B98A 1NNI1 4G4JA 3BC1A 4ER0A 4AC9A 1PP4A 1W46A 1VSBA 5IBPA 1LPBB 2AWOA 4I4IA 1C41A 3HXOA 5JSHA 5DLQC 2XNHA 3RUHA 3TLCA 4BNWA 2YMMA 2OCDA 3ZK8A 3L40A 5F1PA 3ZKAA 1RWQA 1NBIA 4HN2A 4TXNA 4ZDJA 5KNCA 4GM1A 4ENTA 1MB3A 1UAYA 1HL3A 3KYJB 4M7PA 4UCQA 4IF6A 3SU8A 3HJUA 5CJJA 5FAKA 1O03A 1ZIDA 3P0IA 4HK4A 4PHHA 6AT1A 2X41A 4X7BA 4H17A 1JB9A 2EAUA 1O6GA 3WNQA 3GLFE 2YCLA 1CY0A 2ZUWA 4IW3B 4QARA 4EAAA 5HM8A 4XUCA 5LXTA 3R20A 1AQNA 4POAA 3MS7A 4EW1A 2ZIAA 1Y9ZA 2VSXA 1BQ4A 2YHIB 1U2GA 4G0MA 4OK3A 4QYIB 2W70A 2IU0A 1O5OA 3ZXSA 1ZIPA 2J07A 2C98A 3JRWA 4LRSB 2QVGA 4ARSA 5K3FB 1JR4A 4NYMR 1C29B 1T4CA 1YH3A 1CERA 2ZBVA 3G2IA 4RK4A 3RVNA 3MWYW 4M88A 4ZCRA 5JHGB 1DFGA 2IC5A 3D6VA 1YJCA 3DEKA 3L9XA 2JHGA 2SCUB 3QE4A 1F2TA 1UKAA 1K08A 5D1NA 3O7WA 3VZBA 4F8EA 1T1EA 1Y5LA 3CEPB 1LBEA 4K8OA 4ZZIA 5JYCA 1CUIA 4DDTA 1M75A 5DNDA 1Q20A 2GKOA 4FEEA 3HA3A 4LWOA 5IDVA 3TCXB 5BT8A 1CJBA 5BNWA 2NSHA 2P67A 1D4FA 1N8SA 1SB8A 1DQNA 1M5RA 4QOGA 2WNIA 3B60A 4R54A 3TD2A 1Z34A 4NY1A 1T2EA 1PX2A 5HEKA 5TQ2B 5BXYA 5ILOA 3GFTA 2PL3A 3MTEA 2X6QA 3TX2A 1I5EA 5GV7A 2ISQA 2SKCA 2ZB8A 5HHTA 4HNSA 4QU9A 5C46F 4MV8A 2QT9A 5THXA 1J2RA 3ZLJA 3W2EA 2AG5A 3CX4A 4XLZA 2VP9A 2H5LA 2B6NA 1IEVA 3CX6A 4HSEA 3U4GA 1G4HA 4IP0A 1EGMB 1T5LA 1H2YA 3B70A 6REQA 3UXMA 2PXXA 4RK0A 4OKNA 2ZJ7A 5IEBA 3KR2A 4X44A 3KP1A 1SQ6A 2JHPA 3AUYA 4XQ9A 2ERXA 2C8KA 2Q2OA 3Q87B 4MEBA 4WGGA 4XWGA 4KR0A 2JKZA 2NVWA 1HZZC 1HYBA 1UOQA 5IK2A 1N9ZA 2CB0A 1K8YB 5DKFA 4U2DA 3TE6A 1YR1A 4AJOA 1NY6A 1YOVA 4AY4A 4CQMB 1PD1A 2QA5A 4O4JB 4BX3A 3K1TA 1NVDA 2A67A 4FI3F 3C3CA 3PXBA 1PT8A 4RZ2A 1QTRA 1A9RA 3PEWA 3CH7A 3GGPA 4TMFA 1Q0TA 4UUPA 3ZZNA 1JHYA 2Z4RA 4Q0MA 3SEZA 1NI4B 1RZVA 3RSGA 2IIBA 1PWXA 1JH9A 2J5QA 4PQYA 5IDYA 2ZI4A 4HLNA 1B23P 4OLFA 3T3HA 1XLUA 4UBNA 3D7MA 4BFWA 1XTSA 1JEAA 2UVDA 3DV0B 4PONA 4BNGA 1W1IA 3LWDA 1VB5A 2IKSA 2IYSA 3MWJA 3JR7A 4MIOA 3WNBA 3VNRA 4Z7OB 1T9GS 1Z5WA 5IAKA 1DELA 3WNVA 4BQSA 1LLUA 2G80A 5GGYA 1D7OA 1WS6A 2FUEA 2J41A 4RAOA 1VYUA 1JHRA 2PX4A 1L8XA 2V5AA 3PQ3A 4OFXA 3EWIA 4D9KA 1KYXA 4GXNA 3WLHA 4QRHA 5JXIA 4D43A 3EPKA 1DX9A 2XEDA 3PHBE 2P65A 2AN5A 1G5FA 3KIPA 2PWBA 5DM4A 4LI3X 4OGLA 3ITDA 1KZGB 1PHPA 1IJFA 1C3OA 3MMNA 1T5OA 2EDCA 3DE0X 1AO0A 3GP8A 2QL5A 4LVNA 3NHMA 3RM3A 2CVFA 5JMPA 2WWFA 4I6JA 4XCXA 1Z6TA 3T5MA 3F8TA 4ZVMA 4E3ZA 4UNSA 1R4MB 2AG0A 2ZYUX 3IILA 2H11A 4ENRA 4K9RA 2ZR7A 4I4TB 3AILA 4K1XA 5AVSA 3G2MA 3L8EA 3VR2D 2PRIA 3TKLA 2D0PB 2V7QA 2YL2A 3ZIAD 3R7DA 2QORA 3OIVA 3IP9A 2L2QA 4CW7A 1BWSA 2IP1A 5BR1A 4X95A 3CLRD 4HXYA 4KC0A 2HCBA 4QRDA 1P4RA 2BP7B 5ESDA 2AI1A 5F1OA 5ESWA 1OXBB 4BFTA 3S1AB 4GWKA 4R1UA 7AT1A 4DJ5X 4AKEA 1DBRA 1P9LA 1U7DA 4DNQA 3H5IA 1QYIA 4RIGA 5KBYA 1XTJA 1W2HA 4KPUB 1S2DA 1X7XA 2DXIA 4CFZA 3TQRA 1DMSA 2OGUA 4DY6A 4EKEA 2CL0X 3EY9A 1LDEA 3L49A 2NT4A 3OURA 1AF4A 3RRMA 4B34A 5B1EA 3KQTA 4LZAA 2QD5A 5LZ7A 3ZHCA 1C30A 3NYWA 4C43A 2WWRA 3FR7A 3LUKA 4MVJG 4POOA 1NBOA 4WCVA 5AOBA 4EG6A 3VZDA 3O8RA 1FP2A 1AJEA 3EVDA 4TWIA 1I01A 3GUYA 5EJ2A 3A6EA 2XQVA 1YBAA 2C96A 1P91A 2ADFA 3TOVA 4E21A 2YXEA 1JSRA 1ML3A 2AEJA 1RWOA 1LA2A 3IBCA 5J4HA 2A1UB 4E31A 2FPXA 3B8HA 4X93A 3E05A 4N3AA 1Y8AA 1JNYA 1VCOA 1N8TA 1U7OA 4YECA 1APBA 4X64B 2UVQA 4MV0A 3S2EA 1C80A 1JLKA 3ZWQA 2B5OA 1XQ6A 1T36A 2QTCA 4OJQA 2Q3DA 4NH0A 3PENA 4WN9B 4CTKA 3DPIA 1KZYC 2R25B 4YC7A 3RYCB 2G4LA 2E5WA 1RJWA 1R37A 3KE8A 1Y80A 4UAUA 3FWHA 2R86A 2FZCA 4DZRA 2JI7A 2B83A 1M1UA 3UATA 3V4FA 3AF5A 4XASA 1BO6A 1JDUA 1A04A 1N2SA 2WHYA 4WA7A 1YCHA 3IL2A 4D4HA 5KX5B 4KI7A 1NIJA 1X19A 1OY1A 4CGYA 1W5FA 4D4JA 5LJLA 4ZQIA 2VHWA 3EXEA 5I8ZA 2GKGA 5KEIA 3STVA 1JIQA 4P35A 3GT7A 4PSDA 4MICA 4XVCA 4WMLA 1Z5VA 1PS0A 1Y1KE 1HNWB 4KGXA 2E4ZA 1EH5A 2PMBA 3L7IA 1E2HA 2JKVA 4O8ZA 2NU7A 3IOYA 2H1SA 4O3FA 2I78A 1UPBA 4C88A 3U44B 3MSCA 4KXMA 5F5XA 5B4TA 5EHIA 3TGLA 4FFLA 5TPZD 2Q6KA 1Q0PA 2CVZA 1M2OA 5C4GB 4A8JC 1ESMA 3HKEA 3QTLA 4HH4A 2RD2A 4CKEA 1I2AA 2NZXA 5FUQA 1COZA 5BMVA 1R0CA 4QQRA 1O95D 4J1QA 4J0EA 4OY3A 5J43A 2ZB7A 1GLNA 1WBDA 1CEEA 3RC9A 3F49S 1RYEA 2KLHA 3FCAA 3MFQA 2GJ8A 3ZHVA 2E4UA 1AUOA 3FVQA 1R10A 3AVPA 3PKZA 2FP4A 4J9VA 2CXTA 4LXGA 5KVSA 4Z4IA 2HLPA 2FW7A 2Q7OE 1EP9A 1IEXA 3BPSA 3IR5A 4WCFB 2IW1A 2JAOA 1L9KA 2W0MA 5A2QA 3L4EA 1CEXA 4OQFA 1I4OA 4HDCA 3TIFA 5DNAA 1UMKA 2W6ID 1JFVA 4K9PA 3RS9A 2AVNA 3INRA 4R1SA 1NDQA 5D87A 3CH6A 3BD6A 2QTVA 1UXJA 1DAEA 3DAOA 3FB4A 3VPDA 2WD8A 4MTLA 4NU8X 4Q7EA 4R81A 5JAQA 5JO9A 4CMIA 2IV2X 1AUQA 3ROQA 5JFOA 2ZVDA 3N2NA 4BV8A 2LCIA 4OI4A 4R98A 5FADA 4KQ1A 1AHPA 2PVPA 1FE8A 1Z5OA 2RH4A 3AGPA 5DTQA 1LU9A 4ZEXA 1NW8A 2ZTVA 1YQ9A 3GVHA 3NRJA 4BNLA 3ETDA 1Q1NA 5FUXA 2H2AA 1W35A 4RY9A 2YV5A 5TGDA 3O3NB 5CVUA 2Q27A 3HB9A 2GHTA 1P6UA 1U5AA 3WGQA 4EVIA 5HJEA 2XGJA 2QUHA 3PR1A 2NYRA 4ITUA 4JKYA 4P3KA 4Q3CA 4RY8A 1KXZA 2P4SA 5D00A 5G0WA 2FX5A 2YNMA 3ICPA 1YK0A 1BWPA 2IYPA 4KMMA 5A3SA 3ZW9A 4WFQA 3RRBA 1JXOA 2ACWA 3WI7A 2XECA 3D1JA 1RBMA 5I9LA 1S2IA 4P36A 2AJTA 3CB2A 2FA9A 1SCIA 2BEJA 2GJ4A 3B48A 5I9MA 3VH1A 1PR4A 2XADA 3QV1A 2JAWA 4L78A 1P33A 5K0EA 5LQKA 1DDGA 2PLWA 2A35A 1QXSA 2RKWA 2X58A 4NZMA 2C4TA 4ME6A 3PCTA 2COEA 4ZV9A 5BOVA 1ZYUA 5FP0A 3C7DB 3U39A 4ERNA 1IB0A 2C2KA 3HL0A 2PZ8A 4BJ1A 1BX3A 1SOUA 1UPUA 4PBTA 1CNMA 2ZUUA 3G89A 3E9MA 3ZDCA 2FN9A 3UFXB 1R66A 1W0KD 3DE3X 3MXOA 5J9FA 3A6KA 3LVQE 1KI8A 1YR9A 4O4LA 5IC6A 3TLAA 2PPVA 1CF2O 2BEVA 3NEPX 3HU5A 4LYFA 3K9QO 1JPNA 3A2MA 2RG1A 4N7MA 4HOYA 4YS6A 5DXAA 4D8WA 3R3JA 5DWVA 1E1QD 2R7NA 3GFOA 3DFIA 2FRDC 3IIMA 2EZUA 4MULA 3E8SA 4C5CA 5AW7A 1W4BA 1P18A 3K72B 2NU9B 4CWAA 4Z1MD 5H9WA 2BFCB 3GLIE 1PBNA 3BGVA 1O8BA 2DGDA 5DHPA 1G17A 4IICA 3B7WA 1YO6A 1H6DA 4Z9AA 3NBMA 3PYLA 3WLPA 4FIZA 2X4LA 5I9SA 5ICEA 1M0WA 3RS0A 3OEYA 4HKTA 1WUTA 1JL3A 2W2PA 4C21A 1JJIA 5CR9A 1W88A 2IPNA 1TUGA 3IDZA 5HVNA 2VWQA 1WVGA 1JI3A 4J4HA 5BQFA 2GXAA 4F3CA 2OENG 2I7CA 3NKFA 4JI5B 4IIVA 2ZKLA 5CDFA 3R7AA 1LQ2A 1A2QA 1KO1A 1D04A 2XWSA 1WAMA 5FOXA 5LC1A 4B17A 3Q3IA 1ML4A 4E6PA 3KPVA 4U9HS 3DOOA 3G0DA 3O83A 1LPNA 3U17A 4IHQA 4N03A 1MZPA 1SVNA 2HV8A 3DFFA 1Z5GA 3G3EA 4CT0A 3ZJUA 1SOMA 3GRUA 5EMJA 3VSAA 1CUYA 4F3NA 1XYVA 1GA1A 3LA8A 2YJ4A 3L4KA 1UBOS 3VUEA 2HRQA 2AFRA 5LMUB 1ZUIA 3GNQA 3NUGA 1QTIA 1RWMA 3TZCA 4NZPA 1IRIA 5HX7A 3W5IA 1L9XA 3T6KA 1WB9A 2E9SA 3FZGA 4RVOA 3R3SA 5CYOA 5AJZA 3CNEA 1T24A 5KMGB 3P0FA 1TMOA 2ZU0C 2C84A 2XVAA 2ZUCA 4JUFA 5BW6B 5ALVA 5B2FA 3HWSA 2R4UA 3CNLA 3W2GA 3MPOA 4ED9A 2WI8A 1OBFO 3EN0A 1CJUC 2XB9A 3HDVA 4HAVA 5SICE 5JAOA 3FNRA 3N87A 4B46A 1GGNA 1TRKA 1EXDA 1FLAA 4KXNA 1JIVA 1OPXA 1S7GA 3I6YA 3QU2A 1U2QA 4MARA 2DQKA 5ARCA 3SZ3A 1GAJA 1OWMA 1ZW6A 4HGZA 4C0QC 5JH7F 1V37A 1Q50A 1VLVA 2RG7A 5KB3A 1Z2PX 4FBGA 3PTAA 2A5JA 3IEPA 3U3XA 3L92A 3WS7A 2WSSA 3GFBA 4EW3A 2GN6A 2G04A 3LPCA 1T9CA 3O2JA 2O2SA 1BXRA 3ELYA 2ZTHA 1B2RA 4KN9S 4QXQA 1M54A 3F73A 4BGDA 4BZZA 5EAIA 1Z37A 2POCA 4FFVA 3HO1A 4HRYA 2XXAA 2WDZA 4JU8A 2C4MA 1L7XA 2PMKA 1RAEA 3F9IA 5A5GA 5HFJA 3FX2A 4ARZB 3MJVA 1RKXA 1ODLA 1B26A 1JKFA 1M34B 4X9XA 1QH8A 4HTFA 2PLAA 1ULBA 3IE0A 4ARAA 3FLMA 1FUKA 4JNKA 3NTQA 2EIHA 2H9AA 1DUIA 1DRWA 2AXQA 2FTKE 1VYHA 4FE4A 3G8CA 4J7XA 4PS0A 4TVKA 5A71A 3ZWVA 4LDZA 2GXQA 3DEJA 3K5WA 4XRRA 4ZO4A 3W7VA 1RXUA 1T4MA 2X8LA 2D00A 3OF3A 3KETA 2R3SA 3B1XA 2IUSA 4XTCS 1YR3A 3CRNA 2PIDA 4RE5A 1M6EX 3HI4A 1AUPA 1DB3A 1TVKB 4FMPA 2VZ0A 1GFIA 2WIFA 1QB8A 1I3CA 2XRFA 5ERGB 4HPXB 3FB1A 4L50A 2ZQ5A 4O8CA 3RODA 1LBIA 4RVSA 1FVFA 2PDAA 2XYRA 2P2CA 4UCFA 2XZLA 3IMFA 2A9PA 1V6SA 1YI0A 3X1DA 1SXJA 1QIKA 4FJ1A 2GA9A 4YLEA 3S2GA 4LC1A 4XJXA 5G40A 1KI6A 1ZWLA 2QM0A 2YICA 5TT0A 1M6NA 4EF6A 5DN9A 4NJEB 4AUKA 4RHCA 3AVWA 4ES6A 3QEJA 3ZYZA 2G17A 1ABBA 2RCYA 3GUHA 3G9ZA 1TM4E 3DBOB 1PLKA 2X9VA 2YNMC 4LZNA 5K6RA 1XQVA 4ALNA 1GZDA 1YB4A 1DBVO 3U4HA 5KVQA 1AMOA 4TWRA 1WZCA 1FFXB 3DMDA 3KC2A 2WJPA 3F4KA 5F78A 2JZOA 2HU8A 4ITVA 3ZVNA 2QRVB 1JZTA 4UM8B 4Y2SA 2NYVA 2G82A 3DUWA 1BVYF 3NT5A 4PPNA 3CU5A 1ZICA 3PQEA 5HK8A 4JI3B 3RT1A 3DUFB 4IS2A 3LBNA 1T5DX 3MYRA 1XVUA 4BU0A 4UUBA 1LSUA 3MLAA 4C3OB 1Z0DA 2VSQA 1JDBC 5BO5A 5ECGC 1YB2A 2EDAA 2Q2NA 1Y1SA 3H5OA 3OJFA 3OPXA 4KE8A 1E0KA 4LQDA 3VOAA 3U7HB 1OJ7A 4K2AA 1VLJA 1L8OA 4MVJD 4Y2XA 3DMTA 1V39A 3DCJA 5CB8A 4EI2A 1Q11A 2D2IA 2XZDA 4A9AA 4GPIB 3GRCA 2PSHA 3KPJA 1DU4A 4QYTA 1RI5A 1XLWA 4DLXA 1C0EA 3C7AA 1FXUA 2WIDA 2Q1WA 2R1VA 1TQ4A 1GCGA 5JS8A 3O1LA 1RXVA 3NYIA 2JGDB 3KQSA 3EZ6A 1JQBA 3OE1A 3HA2A 4IPTA 4IS3A 4U7FA 4WEQA 5ITVA 5KNCD 3B85A 3OQMA 4M87A 1MX1A 2CHVA 4WH0A 3QVTA 4XSVA 2B37A 1LZKA 2XTAA 2RHTA 4NCIA 1SHKA 4LYHA 1DPFA 2GERA 3QVGB 3QXCA 4HYYA 1D6JA 1DIOB 5CNIA 1DXYA 4ZU1X 2G28A 2J3MA 2Y3IA 5BR8B 3WNZA 4RGVA 4ENWA 2JJMA 1PQUA 3FTCA 2B36A 3GLKA 3QMMA 2PRZA 4DCTA 3W05A 3CLSD 1JDNA 3P94A 4AL4A 1DRVA 1EEHA 1SM4A 5E95A 3SKVA 5T7BA 3QBVA 4X97A 1PSWA 3DWIA 4P08A 1DOHA 4RXTA 1V0JA 3TBKA 3LT1A 1N33B 2AB0A 4KVGA 5KNBA 2YXBA 1IPFA 1PW5A 4CIXA 3PG5A 2X77A 3PFNA 4R9VA 3DA8A 4DBZA 3D4LA 4BS9A 3I8XA 4M1WA 4PS1A 1CVLA 3FOAA 3OT1B 2W2NA 4N5LA 5IMSA 1A9SA 2X7XA 3OZUA 5A7GA 2V54A 4INAA 1Z0IA 1E92A 3OU6A 3TIIA 2QXTA 1RWBA 4OXRA 2C29D 3WWYA 4BO8A 1RHMA 1ZZGA 3DYVA 4HH1A 1XMOB 1U0FA 3IERA 3UWSA 2Y27A 4FS8A 1XU9A 1SURA 1F2UA 2UYOA 4QWWA 4X94A 1IULA 5KOIA 4BYMA 1Y37A 2VP2A 1TGYA 1WY7A 3CX7A 4DA9A 5AK0A 4RWZA 3CH4B 2B2XA 1OH7A 2JJYA 3WHKA 3OC6A 4GFDA 1M8JA 2NSDA 1TIKA 3THWA 1EVZA 2JFZA 2O59A 2WU3A 3C3EA 5FH9A 5K4AA 4XYMA 1J21A 5KYYA 4AJPA 1P2BA 4PE5B 4B4OA 3G0OA 5BPFA 2QUZA 4YYEA 3MRSA 2YHSA 2RGWA 5EZYA 3KJIA 4MW1A 1XE3A 1DKPA 1Z6QA 2HDWA 4PN7A 1YFLA 4RIIA 5F76A 3NKVA 3VHQA 3AFOA 1C1DA 1QFXA 4R7TA 2VZLA 4F5WA 3Q7EA 5FWDA 3CVVA 5AMXA 1OSNA 4LDPA 3RKRA 2C0QA 2I4OA 1DOAA 2JGAA 1IAVA 3S28A 3GRAA 4URFA 4DLUA 1L7EA 1WCXA 1Q44A 3O2QB 3C43A 3TPFA 5BURA 3DZHA 2RHLA 3OA0A 4GZ3A 2PS9A 1F7VA 3W5HA 1XELA 3H6HA 3C3AA 2BHRA 1VKZA 2XE8A 5ETJA 1G5IA 1COWD 4QULA 3VA7A 2TRSB 3AC0A 4EY4A 2XDQB 4JDPA 4LCJA 2VHZA 1A9XB 3IQWA 4YA6A 3NZEA 4RQTA 4YJGB 4F2DA 4UOEA 4H0CA 4OX9B 1YA8A 3KZKA 2L0XA 1QH1A 3Q5GA 3RYHA 1MX9A 2IGBA 2L17A 2G1UA 5AVXA 2HHJA 2A0KA 2GK3A 1BWRA 1IDN1 2OE2A 2C5GA 5AW3A 1T3HA 3LE8A 4RKEA 2B8WA 3O1HB 4G89A 4PV7A 2A94A 4PZZA 4RHEA 2ZE8A 3RREA 3M6FA 3ZNQA 4BQPA 3RADC 3R6LA 5TLSA 1RLOA 3AYXB 5FPTA 4GYJA 4FD2A 5CBPB 1YE8A 2PT9A 1SXJC 4ZOQI 1JUDA 3GDGA 3DOIA 2H2WA 1MC4A 5IARA 2BEKA 4QU8A 4YDRA 1RRMA 3VDRA 4DMHA 1Z74A 4PLZA 3QUQA 1W47A 1W5TA 1Q12A 4HNQA 5DHSA 2WR8A 1FFHA 2J9FB 2D2FA 4HEJA 1N2GA 2C4NA 4P53A 2R1TA 3VPHA 4BGIA 1R5NA 1FYEA 1IQRA 2GAIA 2PGDA 3W6OA 2V7VA 4AY5A 3WV5A 3RVKA 3AUTA 1JT9A 4U00A 3AR7A 1YZQA 3NH6A 4AMBA 5IEJA 3WRYA 3TZQA 1PFQA 3WQBA 4C0SA 1DX4A 4M98A 2OXEA 3OQBA 4DILA 2GNAA 4QFBA 1XMPA 2NTEA 2VK8A 1WM1A 2XGMA 2YMLA 3A1WA 1Q15A 4FU0A 2BY4A 1F5NA 3HK2A 2V7QD 4GBED 5LKAA 4Y6GB 1NV9A 2PA3A 3EHEA 1PZGA 4BC1A 3RSFA 3DYIA 1O77A 4A8TA 2EZ8A 3DMRA 4BTVA 3LOUA 4MV3A 3VX3A 1RC1A 3V4VB 5JYEA 3UGJA 1UANA 4ASUA 2QLNA 3INYA 3MUEA 1GRRA 1LTQA 4B8YA 2QW0X 3RU2A 9GPBA 4G0VA 1FMFA 5FBKA 3VR6H 1MAVA 2PWAA 2FCRA 1W7AA 2WSIA 4F2HA 1U02A 4JZKA 4QVGA 2ZDHA 4YRDA 4ZT6A 4JCCA 2AOTB 1T4GA 1KFKB 1HE1C 1JX6A 2C4WA 2BUAA 1SVLA 2IYNA 3GVCA 2VJMB 2O0MA 2XZPA 1T2AA 1U2ZA 3OZTA 1X8JA 3QPCA 1TCUA 4IQ4A 4UTRA 4FN5A 4GECA 1NYLA 2OKGA 4C0WA 3B3JA 1EUDB 2QMQA 3KR1A 3T52A 5FEMA 1C4KA 2AFHE 1JHZA 4G9BA 3P45A 4IWYA 4TT3A 2J3IA 2G9RA 3UCFA 1OGIA 4BKRA 1KGDA 3DO8A 5JO0A 1AVTA 1XZ8A 3HSKA 1J07A 4KB5A 4TV8B 4Y2HA 4WSOA 5BQ5A 3QWIA 2A3NA 4FZRA 4YJ2B 1Z73A 1S8NA 3R9XB 4I66A 2LV8A 1RPAA 1RYZA 3DH0A 3FJ1A 4UEJA 1I7LA 4FCCA 4AYXA 1MR3F 4WK0B 4RY0A 3M5WA 5B3AA 2EWMA 1YF3A 4JGGA 2VYND 4BNDB 4E08A 2IHBA 3EXHA 4OHMA 2MYPA 5ALPA 1RKBA 4JAVC 2NG1A 3V9PA 1P0MA 4P58A 3H75A 3JZMA 4LDQA 4MYHA 1T8UA 2NUTA 3EFHA 5G1OA 3WOHA 3LO5A 2IYUA 4H7FA 5DYTA 3ZUPA 3MWDA 4OLHA 4ENVA 1JR3D 1NUAA 4P3XA 1CY6A 3PWKA 4CL2A 1VLZA 2M6SA 2O5VA 3I5UA 4KUGA 3FAZA 4Z0PA 5T64A 3RAPR 2O1XA 2J6HA 4PLHA 3TLMA 4CU2A 2GNPA 3M4JA 2AJBA 3BRSA 4JGIA 4MRMB 2EKBA 5TEWA 5LOVF 1E3MA 1P4HA 3DVAA 4MSUA 4RYLA 3GFQA 3A4LA 4HDNB 4RMJA 1D7AA 4PN3A 4OVKA 1VGRA 3C24A 2R60A 1TJ4A 4I55B 3WL3A 3D1LA 1GTVA 3P9IA 3UKDA 1OKKD 4ARIA 2HCFA 2O7VA 4V1CI 2R6DA 3TNDA 4C76A 2P62A 2QUIA 3KAPA 3BWYA 2QE7A 3NNDA 3EIOA 3ENNA 4UW9A 5AKXA 4DEYA 4AQYB 1ZMBA 2QL7A 3MFYA 1IQUA 3B9RA 2GVDC 2I4TA 4N5MA 5AJWA 5LSAA 3GLHE 1JA0A 4KXLA 3RANA 2FEMA 1XCPA 1ZH6A 2OLJA 3IQHX 2QTTA 3ETHA 4MTCA 3AEXA 2PRYA 4RGYA 1TU4A 5JFTA 1G9XA 2QWXA 4B4KA 1KL7A 2WSYB 3NAQA 1C3VA 4YRCA 1YS2X 1H1LA 1QX3A 5B64A 1BS9A 3IB6A 1N2XA 3R5HA 2X7HA 5JVDB 1WU7A 1VJGA 3OHSX 2O5CA 2NO5A 1WDTA 1N34B 5DO9A 1JU3A 4LRXA 3M6WA 3GFGA 3GN1A 4N9QA 4QEKA 5K03A 1KAMA 1UOPA 1Y9DA 5JZSA 1S4MA 1SCUB 1FFAA 4JCOA 4L8LA 3EGDA 4UHKA 1TM1E 4F6RB 2DPGA 1A96A 1OGYA 3NHYA 4IIDA 1ISGA 1RLMA 2YHAA 2HLDD 1P4AA 4JOCA 2OR3A 2G4CA 4HTAA 3T7JA 3HCBA 3BXFA 2WF8A 1AK9A 4DMLA 4BEVA 3N70A 3T9CA 1GG5A 3TRFA 1GEGA 2IH2A 2J87A 2AVDA 1Z63A 1G291 2HREA 3S4YA 4EHJA 4W8GA 3TW8A 4AO6A 3GJSA 5EJ7A 3KQOA 1V16B 5ULLA 4TSFD 5HRAA 5B37A 1E3TA 4TLEA 1KJ8A 4BBAA 2R5WA 4TKMA 4X60A 5BP7A 1RAHA 1Y4AE 1Z2DA 2R6CA 1L3CA 2WHXA 4NHOA 2NSLA 4TLAA 3DLHA