1NXQA

Crystal structure of r-alcohol dehydrogenase (radh) (apoenyzme) from lactobacillus brevis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
251
structure length
251
Chain Sequence
SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-alcohol dehydrogenase
publication title The crystal structure of R-specific alcohol dehydrogenase from Lactobacillus brevis suggests the structural basis of its metal dependency
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Oxidoreductase
total genus 97
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nxqA00
1KVUA 3WNVA 1M6HA 3PJDA 3V8BA 4E3ZA 4R9RA 4CQMB 1PGQA 4E5YA 3C3XA 4RPKA 3PEFA 3AI3A 2O7SA 3H2SA 1FDTA 3RJ9A 4XDYA 4MVJI 4QFCA 2JKVA 1GFSA 3D5QA 2P9EA 3L4BC 3GG2A 2VT2A 1IHYA 4NFSA 1DFHA 5B4UA 4HP8A 2Q2VA 2SCUA 3RSHA 4UVGA 3INGA 4W7HA 2OXIA 3SC6A 1BXKA 3BTSA 2YUTA 4DVJA 4ALJA 3SXPA 4HUJA 1IE3A 1H2BA 1DRVA 4ALLA 3VZRA 1NAHA 3KSDO 4O59O 1U5CA 1YB4A 4Z9YA 5CHEA 3OSUA 1F8FA 1ULSA 2ZK7A 3AOGA 3OP4A 3OA0A 3P7MA 1M6WA 3R1IA 3I9OA 1Z45A 5T67A 1P3DA 1DIHA 4ZQBA 3KV3O 3OQBA 2GZ2A 3VH3A 3IC5A 1ZK4A 1PL8A 3DOJA 2OP1A 1PQUA 3RAJA 4E5MA 3M6IA 3OQ1A 4RF4A 3WIDA 3WTBA 3ZWOA 1CIVA 4FQ8A 3DBLA 3WGZA 4U7WA 4TZKA 1HLDA 4BO0A 1N7GA 2ZJ1A 4BO6A 3D4NA 3KYBA 3EAGA 1UXHA 2P5YA 4BNGA 4FFOA 3ORFA 2EHDA 4O63O 1ZK3A 4WPGA 2EKLA 4J16A 2WM3A 2B36A 2QIOA 3I9LA 2HU2A 4J43A 4H15A 3RCBA 3JQBA 5JYDA 2HUNA 1PR3A 2YHIB 2C54A 1I3LA 5GY7A 4WJZA 2W2LA 1I2BA 1E0DA 4AJJA 1PEDA 1ZCJA 4J2HA 2CZCA 4YVFA 2AG8A 4BO1A 2Q4EA 3PP8A 5JFOA 5JMWA 4R1SA 2IRWA 4WE3A 3N7UA 1MB4A 1GZ6A 2JL1A 2EXXA 2C82A 3ANNA 3C24A 3EMKA 3MWDB 4HXYA 1WWKA 4RF2A 4E6PA 5IDQA 2C29D 3VKUA 3ITDA 2YQ4A 1VM6A 1E1LA 1R4NA 4KDEA 4M87A 4AJIA 2AEMA 2X0JA 3JYNA 5CPBA 2BGMA 3JQEA 1ML3A 3F5QA 4RCVA 2HK9A 4PVCA 2OBNA 3GNSA 1ZEJA 3FCOA 1MG0A 3WLFA 1JAYA 4IDAA 2YV1A 1HYHA 2GN9A 3ZCXA 2DBQA 4DPKA 4IM7A 3E03A 3OA2A 1UXIA 1A71A 3WTCA 1HLPA 1E7MA 2VRCA 4OXKA 3WWZA 4OKIA 2OOSA 3X2EA 1X1EA 5ENDA 5TGDA 2IYPA 3PK0A 4AVYA 4E2YA 3LQFA 2NV6A 5JE8A 3JD3A 3ONFA 3E9QA 3TOXA 1E6WA 2WMDA 1VLLA 2CY0A 5TS3A 2GR9A 3PWKA 4ZHSA 3KLPX 3GEDA 2JFGA 1CEQA 1ONOA 4FJ0A 4W9NA 1I01A 1HYGA 5HM8A 1ULUA 4A0SA 2GDZA 4I08A 7MDHA 2X5OA 5HWSA 5H81A 2I65A 3KLMX 4GGPA 1O9BA 4DQUA 4IGFA 1LRJA 1NX6A 3MZ0A 1IL0A 3EYWA 4JROA 4L0QA 4XX0A 4A27A 5BR7A 3TJRA 4D0SA 1YJ8A 3LK7A 3ZV3A 4AJHA 4YQYA 3G49A 1M2WA 2IEDA 3U5TA 3GGPA 2WD8A 4QT0A 4RDHA 5FWNA 5FI5A 4JBHA 4JXKA 5A03A 1JWAB 1SO8A 4JP3A 5JMPA 5I7EA 2B4QA 2CUKA 3KEOA 3GRPA 2JHFA 2WJPA 3OICA 1C0PA 2RHRA 1PS8A 3DZFA 2V6FA 3IP1A 5F21A 4KMSA 4B4OA 4E2XA 3RC1A 3K96A 3D5TA 3FTNA 2VHZA 1DAOA 1N2SA 1S6YA 2J6IA 1ZH8A 2R00A 3PHGA 3NX4A 4QO7A 5B4TA 3LC1O 2I3AA 2YHUA 1YQDA 1UDBA 3PI7A 4FC6A 4E32A 3D3WA 2NVUA 3V2UA 1YL6A 2FPGA 2NTNA 1CETA 4IJWA 3TOZA 1ISFA 2PD4A 1V8BA 1ZFNA 5TJ9A 3FSRA 4BGUA 3RBXA 3VVCA 4L74A 1BDBA 3P19A 1PX0A 2C20A 4YRAA 1UAYA 2UV8A 3U0BA 1IY8A 4OXYA 2VNAA 1ZO8A 1KS9A 1T1SA 3DFZA 3TNLA 4CODB 3H65A 3B70A 2V65A 1P9LA 3BMQA 4EYEA 4GI2A 2HLPA 5I8ZA 3HJAA 1NNUA 1MUUA 1T2AA 2H1SA 3LC2O 1HDRA 2CVOA 4LRSB 3BTVA 1X15A 1T4DA 2PZJA 1UXKA 1LU9A 3GUYA 4XCVA 4NJMB 3OJOA 5JCJD 2X8LA 2WE8A 4N18A 1U4SA 4BO8A 3F5SA 1P44A 1P1JA 4BKQA 3S8MA 2H6EA 1TA4A 2B83A 1DLIA 2J3KA 4UVIA 3QQPA 5BSGA 1Q0QA 3NDJA 4BO9A 5ITWA 3KETA 1NBOA 4J90A 4KUGA 1EMDA 3C1TA 4Y6PA 3O9ZA 3E9MA 4MKXA 3JTMA 3NTQA 5CP8A 4M1QA 4EUHA 3MJVA 4WECA 2J5RA 4K6FA 1ORRA 4PG4A 3LF2A 1GUYA 4ROSA 4DPLA 3FNFA 3QWAA 5GZ6A 4CR7A 4Z0TA 4D44A 4KP7A 2GERA 4OAQA 4B8ZA 3GVIA 4ZD6A 2CDAA 3NAQA 4U6SA 1VJTA 2NTJA 1KETA 2EKPA 1K3TA 2Y67A 3WOHA 1TT5A 5DP1A 2DUUA 2Q1SA 3FNEA 1LBEA 5JY1A 3DBHA 4D3FA 1BGVA 4DREA 5L40A 4ZQGA 5TIIA 1N1EA 3H8VA 1WNTA 3PIDA 2WYWA 4M55A 1PGOA 4ITUA 2Y99A 3OEYA 2ZB7A 2AEJA 1L7EA 2EEZA 4BNNA 1DSSG 2NVBA 1GDHA 1HDCA 5DBGA 4Q3BA 4WLEA 1P1KA 1R4MB 2Y0CA 4YJDA 3ZNPA 3CUKA 1P0FA 2D5AA 2I9PA 4NBWA 4CUJA 4P4NA 1M75A 3FPCA 3TSCA 3FNGA 1DRWA 3KM0A 3DO5A 3ZHBA 3PLRA 1I2CA 1ISHA 2VWHA 1KVSA 1NP3A 5F1PA 4FCCA 4D41A 2UAGA 3QA9A 3NT5A 2O4UX 4AJ2A 4YAKA 4BNZA 3WFIA 3OQ6A 5JS6A 1GZ4A 5KJEA 3OM9A 2BRUA 4AJ1A 2GF2A 1D4FA 2RAFA 4A26A 1HDOA 2FMUA 3GDOA 4NR0A 2H63A 4FFMA 5IN5A 2AG5A 5G0SA 1BW9B 2PH3A 1LA2A 3KRTA 3WBBA 4FS3A 3PRJA 1B7GO 1NWCA 3IKVA 2NU9A 3CMCO 1JA9A 1GL3A 1DIGA 3OIDA 4FGSA 4PZCA 3BA1A 4KQXA 3AY3A 3PYMA 4KUHA 4YA6A 2I99A 3S1LA 3FBTA 1LDGA 2GRAA 3DFUA 4J2OA 5JLAA 3UW3A 1QXSA 1I8TA 3GDGA 4I5GA 4DYDA 3H3FA 4Q3CA 1BXGA 2QHXA 3L9WA 4NQZA 1ZXLA 5ILGA 3ZZNA 2B5WA 3LU1A 1DAPA 2XOXA 3DAFA 3HNPA 4GAEA 1WDKA 1YKFA 3H5NA 4EJ0A 4C7KA 4JIGA 1A9YA 4PFJA 5KWEA 1T1RA 1WXDA 3JV7A 3JQ9C 3O4RA 5DF1A 3I1JA 4URFA 2WYVA 4D7AA 4E33A 4UULA 4RVHA 1GADO 1UDCA 3VHRA 1GD1O 1O8CA 4GVXA 2ZB8A 2GSDA 3L4BA 4Z3KA 1SEPA 1MLDA 1H2HA 4B8WA 2C0CA 4IJUA 4DPMA 3IIEA 2PNFA 1GUFA 1EEHA 1JKFA 1Z82A 1X13A 3NUGA 1Z74A 2O23A 3UHAA 4BGEA 4ZICA 3BMCB 3NRCA 2O2SA 3QSGA 4YAJA 3QLJA 3FN4A 5L4LA 1C14A 3JQ8B 4L73A 2ZB3A 3PLNA 1ZSYA 4I5DA 3L6OO 1WDLA 3U3XA 4S1VA 2RCYA 2D2IA 4I9NA 4TMFA 3K31A 2NNLD 4XGIA 3VPXA 2POQX 4LCEA 4HNGA 1P1HA 2AE1A 3T4EA 3ZNOA 4EBFA 1EVZA 4J6FA 5JSFA 2GGSA 2JD0A 3ANLA 3N74A 3GA0A 1SEVA 2HAEA 4C7JA 4CJXA 4HWKA 2DTEA 3ZHXA 2VOEA 3RUEA 1BSVA 5L45A 3E6AA 4YJFA 4NH4A 3OHSX 3GAFA 4PG7A 3RUAA 1PJCA 1H94A 3PGJA 1YE3A 5ICMA 4CMIB 1XELA 2Q99A 3Q0EA 4BO7A 1LLQA 4J4TA 2EIHA 1XKQA 1W8DA 1E1KA 3OECA 1TT5B 1YRLA 4HFNA 4MVJP 4NZ9A 5JCJA 3RBZA 4ZU3A 5BSEA 1U4OA 2EERA 2Z1MA 4CLRA 1FDWA 4D79A 4CUZA 3ENKA 4LISA 4AJOA 2WDZA 3UXYA 3ENNA 3R6DA 4OJNA 1B0AA 4R41A 3F4BA 1H6CA 3CINA 4O1MA 5GZ1A 5DT9A 4J9VA 1A9ZA 1ADGA 1IUKA 4NMHA 2D4AA 4XIJA 4BNFA 3G0OA 4TVBA 4BNMA 4U0KA 3IUSA 1J5PA 2PR2A 4YDRA 1ZJZA 3CE6A 2CVQA 3UKOA 2NM0A 1LLUA 1O94A 3DHNA 4HY3A 3ICCA 4J7XA 1NPYA 2BMAA 1Z7EA 1CRWG 3ZU3A 4CL3A 2EJVA 2J5KA 3FNHA 1LRKA 4RDIA 2X7HA 3PHLA 4NK4A 3EDMA 1HF3A 5GZ3A 2JD2A 3F4LA 3V1YA 2Y93A 1V3UA 4EITA 3IDSA 1K6IA 3OF2A 3OJ0A 1PWZA 1U1IA 1XYGA 1LDMA 1C1DA 1EFKA 5ES3A 3B6ZA 1AUPA 4W99A 1NVGA 1O89A 1KERA 2X9VA 3DC2A 1UUFA 1QP8A 3ETGA 4NG5A 1YONA 2BH9A 1AHHA 3JCZA 4IIUA 1V0JA 1MC4A 1UP7A 1MV8A 3H5AA 3KEQA 3DEYX 4GKBA 2IZ0A 2CSUA 4XYEA 4XR9A 3LZ6A 1X0VA 3ZHZA 4JJFA 1E1MA 2UVDA 3RVDA 3WJAA 4IZHA 1JQBA 1MXFA 4BL5A 1T2DA 1I24A 3TZCA 1UR5A 1R37A 4UREA 2IEBA 4FSHA 3W4KA 1ENPA 1E5QA 5B37A 3ZGYA 4I9UA 1DIAA 4DC1A 5KJCA 2JAPA 4TKLA 1ARZA 4NK5A 2GASA 1U28A 2VTEA 1PJ2A 2E37A 1WMBA 2PKRA 1SB9A 2OORA 3VPGA 4EUEA 3MEQA 4XR4A 3I23A 5COQA 2X0IA 3MJTA 2IODA 1EQ2A 5I9NA 2FSSA 1EE2A 1ZSVA 1WPQA 4GX5A 5CG1A 4B4WA 1IZ0A 4PLFA 3NDRA 3ZV4A 5A9SB 1C0IA 4RVGA 3WMXA 2H5LA 3CZRA 3VH1A 4Q9NA 1HDXA 2DM6A 1ZMOA 3JD0A 4NFYA 1BXZA 5EQFA 1QYXA 4PLCA 2GPTA 3PDUA 1HE4A 3WFJA 4O6VA 3OH8A 5DZSA 3DR3A 1OAAA 2XXBA 5DOVA 2JCXA 1B8VA 1ENOA 1I3NA 6ADHA 1Y5RA 1BVUA 1E3WB 1LDNA 2PZMA 1P0CA 3LC7O 3RUCA 1A7KA 1NFRA 2OUIA 4Z9FA 2ZTUA 4J4BA 4AL4A 4XDZA 2O3JA 1IOLA 2X1HA 4YCAA 1YOVB 2D0IA 1ISJA 2HJSA 1B8PA 2E82A 4J1QA 4J1NA 4E2WA 4CMKA 1WVGA 3JQFA 1HZZA 4PLYA 4F45A 3AI1A 2YJZA 5THKA 1Q7BA 3G79A 2Q4BA 1IHXA 1QYCA 2YQ5A 1XLTA 4S3MA 4BMSA 1X7HA 4CM5A 3RQSA 4YJFB 4K1LA 5L7TA 4DLAA 4UEKA 3RUIA 1DFGA 4JGBA 3DAGA 2YV2A 4TRMA 2VRBA 4D45A 1JVSA 5EIOA 1CDOA 1OC4A 3I83A 4GX0A 4GX2A 3DZGA 3ROQA 3KYCA 1A72A 4FBGA 5KKAA 4XQCA 4FOOA 3RC7A 3DBRA 3HHPA 2VUSA 5L3ZA 4UUOA 4PLWA 3CMMA 3JQ7A 4OSOA 4BKUA 5EN4A 1QMGA 2EW8A 4BIIA 3ROKA 2CMDA 2P2SA 4R16A 4G2NA 2W2KB 3AFMA 3C7CB 3C7DB 3CSDA 3I9NA 1NXQA 3TRIA 5IDYA 5JPIA 1YVEI 2BD0A 2NU6A 4RVUA 4GSLA 3H4VA 3KXDA 1RM5A 2X4GA 2XF8A 4OO3A 4PLHA 3A14A 1E7RA 4QO8A 5IJZA 1HTBA 4IDEA 3RUHA 4D3SA 5H82A 5K9ZA 3BMOB 1QORA 1NQ5A 3F1KA 4GH5A 3VPHA 1PS0A 4EDFA 5KJ1A 2AW5A 4E4YA 1BDMA 3ONEA 4ZGWA 2FRDA 3OJLA 3KYDB 3ZWMA 3RROA 3IOYA 4LSMA 1M66A 1LQUA 3SJUA 1NR7A 4B3JA 1F06A 4IDCA 4BO4A 4YT4A 5TT0A 4WK6A 1PGNA 3BMNA 3JQCA 3VOSA 4QX6A 4YPOA 5TX7A 2WD7A 2JFHA 3JYLA 3SVTA 1DIRA 4AJLA 1U7HA 4ZRNA 2EV9A 1PJLA 3A9WA 3ZWAA 1RPNA 3GZNA 1GCUA 1UZLA 5KVSA 1ENZA 1R0KA 3D3EA 3KB6A 4BNYA 4RZIA 1N9GA 4JNKA 4JP2A 2O3TA 1NQTA 1O0SA 2HCTA 3C8MA 1IB6A 1E6UA 4E5PA 3N58A 4OQZA 1K89A 2OZPA 3LF1A 4TRNA 2AQKA 3VAZA 1W4ZA 3FTPA 1OC2A 3HFSA 1U8FO 3O38A 5CDSA 3E5RA 4NPCA 3SX2A 1B8UA 2BFPA 4GL4A 3K5PA 4GLOA 4U8GA 3WXBA 5FEUA 3PHHA 3GF4A 1DC6A 4O0LA 5K0ZA 3Q9NA 4RORA 4OHUA 2VUUA 1MG5A 2ET6A 3ROMA 4F6CA 3QIVA 1I30A 3NYWA 1WDMA 2QX7A 2DC1A 5EQDA 1EZ4A 1LQTA 4GPD1 3TL3A 4B79A 3DDNA 4JBGA 1U5AA 1GCOA 3WICA 2YY7A 3ADOA 2CDBA 4DIFA 1XU9A 3LLSA 4YRDA 4BKOA 1LNQA 3GEGA 4CLHA 4WOKA 3JQ9A 4LGVA 4D0RA 4RJTA 4WLNA 1D1SA 5DCUA 3L0DA 1V9LA 4LN1A 3C1AA 4OQYA 4UUPA 4F6LA 4R3WA 2ZB4A 3JYOA 5JDIA 3JQAB 1PQWA 4EEXA 3UCXA 1PJQA 5BNIA 5CAEA 1O6ZA 5ILOA 2V6GA 4CMGA 3AUSA 3KHUA 5EJ2A 3HADA 1ZEMA 2P68A 5A3VA 3NTRA 4P8RA 2DUWA 2X9NA 4ND4A 2Q49A 1VC2A 1ADFA 2XPCA 4BHTA 3TDKA 3HWRA 2ZYDA 4CMHA 5B1YA 2EP5A 3RD5A 4IQGA 5IAAA 1PR9A 3UOGA 3VC7A 2Y0EA 1VI2A 4M8SA 3SBOA 3K2EA 1RYDA 3E8XA 1MFZA 4PRKA 4JN6B 1PGJA 2HDHA 2X0RA 3O8QB 3QJ5A 2ILTA 3KYCB 3P2YA 4CM8A 5IFLA 1T2FA 3HDQA 1RM0A 3DBRB 1L7DA 1LDBA 5EPOA 4LRTB 4ZJUA 4MKRA 1LRLA 5IZ4A 1NFFA 1E77A 3Q6IA 4M86A 3AUTA 4RPGA 1FDUA 1I36A 3B20A 1ZK0A 2JJYA 3ULKA 3W8FA 4CR6A 3M1LA 2PTGA 3PYLA 3TQHA 1GU7A 3NEPX 4YEDA 5T64A 5JYEA 5AYVA 1BRMA 3K30A 4NU6A 2H9IA 5CEEA 3LLVA 3RIHA 1V6AA 5F5NA 1KBZA 1DHTA 5JO9A 4L8VA 2PZLA 2VN8A 3JD4A 3PXXA 4E13A 1NASA 2I6TA 5F3RA 3U62A 3AWDA 3CTMA 4GKVA 2O3SA 2Q1UA 4N5LA 1B3RA 2FOIA 2BGKA 1DOHA 2Q1WA 1HSZA 1N7HA 4BNLA 4P4LA 3SLGA 3MOIA 5IDWA 3ICPA 7ADHA 2CNBA 1ENYA 2GD1O 1EFLA 5KCZA 1PQPA 4R1NA 1R0SA 1QRRA 3KUXA 4TWRA 4BNXA 3NKLA 3F46A 5BT9A 4DLBA 3PHJA 1LC0A 4BNUA 2X23A 1AN9A 5DCWA 1HE5A 2HJRA 4UUMA 4ESOA 3PQDA 3JQFC 1DBVO 4CLDA 2NACA 2ZCUA 4EI2A 4PLTA 4UVDA 2D1YA 2UUOA 4OGWA 3ZWBA 3RFTA 4OOEA 3FWNA 1C0KA 4BGIA 4LK3A 3DBLB 4WEOA 1EBUA 4CM9D 1C0LA 2OHXA 1DEHA 1TXGA 1VL8A 1YDWA 2VQ3A 1F0YA 2YZ7A 4ND3A 2GZ3A 3L07A 2D8AA 3GH3A 3NJ4A 1K6XA 4ZQFA 3H9QA 2JCVA 3DZBA 4ALKA 3LT0A 2AE2A 1MC5A 3K73O 3UCFA 2BKAA 4XYBA 1HSOA 4K28A 3IS3A 3VH4A 3WGQA 4E30A 4XRGA 3WBFA 4FIZA 5BSHA 2NWQA 1AE1A 3A1NA 3W1VA 1C1XA 4AJPA 5A06A 3HSKA 5I7VA 4YT2A 4MIEA 5G0VA 1VJ1A 3CEAA 5C7OO 4CQMD 1R4NB 5T8KC 3DHEA 5B4VA 1R15A 3GAZA 3WGHA 4IDDA 1ISGA 3NTOA 5FI3A 4NNJA 4XA8A 1H93A 4J91A 1NPDA 3C7AA 2O3RA 4IS2A 2AHRA 1JWBB 3QWIA 1F12A 3JD1A 4MVJE 2F00A 3GFBA 4MP8A 3ZNQA 1H9AA 1Q0HA 3GHYA 2Y1DA 4GMFA 1YBVA 3E82A 5A5FA 1JU9A 2A35A 3FWZA 3ZH2A 3PGXA 1LI4A 4FD3A 1P1IA 1W73A 4YAEA 4PCVA 4LCJA 1X0XA 1Q7GA 4CLXA 4DTIA 4BNHA 1D7OA 2GUGA 4UUNA 2EGGA 3V2HA 4E12A 1TVEA 3DHYA 3NGLA 3QY9A 4L9RA 2P5UA 1WAMA 1PZFA 4FJ2A 4TRRA 1Z6ZA 1YGYA 1A7AA 3QWBA 3WGIA 2DLDA 2IZ1A 3VPFA 4NBRA 1I5RA 1JLLA 2ZYAA 3JQGA 3GR6A 3GY0A 1LDEA 4WCFA 1Z7BA 3ST7A 1J4AA 1KEWA 2RIRA 3DMYA 3Q9UA 2AA3A 8LDHA 4CQLA 3PWSA 1TB4A 4UEJA 2EWMA 3ABIA 3L4SO 4BUCA 3U09A 2EF1A 1T26A 4EJMA 2OL4A 1F14A 2FZWA 3CZMA 1YB5A 1UP6A 1VSUA 3GNQA 2B35A 4HBGA 2HK8A 1XHLA 1W0CA 3SJ7A 5A5EA 4KUEA 3WGGA 1XDWA 4CL8A 1Q1NA 4Z9XA 5JDCA 2FN7A 3EGOA 1HDZA 2HMSA 3FF4A 4WGGA 2DU8A 2QYSA 1UZMA 4B3IA 1U9JA 4YJHA 3W4IA 2TMDA 4W82A 3A06A 3ZWYA 4WOJA 4XQ9A 3AFNA 1XA0A 4YWJA 2G0TA 2W98A 4D42A 2PY6A 5LCXA 5I9LA 3W8EA 1HDYA 5CPFA 1ID1A 5DDIP 3RC9A 1UDAA 4R9SA 2NVWA 4AICA 3EZLA 4ID9A 1BG6A 3ZU2A 4J0FA 3GVPA 4IDFA 2NADA 4J7UA 4R69A 2X58A 4PZEA 4XIYA 2I5PO 2EGHA 1VL0A 4IMPA 5T6BA 5FFFA 3D3WB 2NVUB 3X2FA 3BTOA 3GT0A 1Y8RA 4JX8A 5BNTA 5F5LA 4CLOA 3WX0A 2WE7A 3ON5A 3DL2A 4OXNA 2Y68A 3RKUA 3WYBA 2J5QA 5CEJA 1IPFA 3HN2A 1G0OA 2G17A 2XXJA 1CQJA 3QW2A 5JDIC 3VTFA 4P22A 3ZI0A 4BO2A 1BVRA 2CDCA 2DBVO 3BMQB 4TKMA 4YJGA 3DOCA 5ER9A 5G0TA 2O4CA 4N7RA 1YL5A 4MP6A 5TQVA 1A4UA 1NM5A 3E48A 3R0IA 4CMCA 1PL7A 3PJFA 1FF9A 2DFVA 1QYWA 2ZTVA 4L4SA 1BMDA 2DBZA 3QVXA 4YR9A 2B0JA 4RL6A 2VYND 4J7CA 2J3HA 1H0KA 3ZU4A 3IQDB 3FBGA 3U49A 4PLGA 1KEVA 4PG5A 2G76A 4EW6A 3GPIA 1I3MA 4Y6SA 3ADPA 5ENVA 4AJKA 4R1TA 4JBIA 3HN7A 4X54A 4DIBA 5G4KA 3QHAA 5CDUA 3QVTA 5AXAA 1AHIA 1Z75A 2D59A 3GVHA 1F17A 4DBZA 3PFWO 3H3JA 4IPTA 2Q2QA 1Q0LA 2C5EA 3A4VA 1DJQA 2B4TO 8ADHA 1GV1A 4WASA 4XQGA 3NT4A 3BHMA 4MINA 1HXHA 1XQ1A 1KIFA 2V6BA 3OIGA 4YAIA 5G0UA 3ZDFA 3TZHA 4NIMA 2PGJA 2G5CA 1D3AA 1T2EA 1PZHA 3QE3A 1I33A 4Y98A 4DWVA 5KKCA 1YJQA 3DXFA 4J49A 4MVJF 3M2PA 2HMVA 4BNJA 3DBHB 3GDFA 4CM9A 1E7QA 4L76A 1V35A 1T25A 4CM7A 2PD3A 4ZN6A 3NT2A 4ALMA 3TFQA 5F1OA 3GMDA 3LSYA 1P33A 1X14A 4IGEA 1E3LA 1GV0A 1SC6A 3D64A 3WSVA 1EVYA 1H9BA 4BGVA 3GGOA 3H9UA 4RF5A 4ND5A 5LDHA 4R3NA 1JKJA 2F1KA 2O50A 2VUTA 5EL0A 4A10A 4DL9A 1LX6A 5KVQA 3C1OA 4QEDA 1ISMA 3HG7A 3FHLA 5G4LA 5A9RA 5HS4A 5BSFA 3P2OA 2GNAA 3GMSA 4B7UA 4CPDA 4CQMA 3S2IA 2VT3A 5A4DA 1EVIA 3R3SA 2X9GA 4DXHA 1DO8A 1J0XO 4R4JA 3I9MA 2FY8A 5IN4A 3F6YA 1E7WA 3LDHA 4J4HA 2OP0A 2QRKA 2UUPA 4NJOA 3W6ZA 4IDBA 3UVEA 1PIWA 4FFRA 3H9EO 1LJ8A 4IS3A 2Q45A 1ZZEA 3WYCA 4WLOA 2P4QA 4MP3A 5G2OA 2R2GA 1EBFA 4O5OA 1Y9EA 4XRRA 1PJBA 2Y05A 3EHEA 3H9GA 5JY6A 1G0NA 1ZK1A 2Q2WA 4DIOA 4W6ZA 3UICA 2DQ4A 4LVCA 4R5HA 4PVDA 1PS9A 3OIFA 4DQVA 1E6EA 5I7SA 3H2ZA 1MA0A 4MVJD 1ZUD1 4HFMA 3V5NA 2X5JO 4IJKA 5DULA 5KTKA 1KYQA 1N92A 3OFSA 1BXGB 1E3EA 1FK8A 1NPTO 1YB1A 1P1RA 1IPEA 2Y1OA 3BYZA 4I9HA 5K6AC 1QLJA 4WNIA 4CM4A 1HDGO 2QG4A 4IQ8A 2C7VA 2LDXA 2C2XA 3SEFA 2VNSA 4NHEA 2DT5A 1XQ6A 1U3UA 5TT1A 2J3IA 5A3JA 5ITVA 1KVTA 3AM3A 2BGLA 2YW9A 5JC1A 4ZA2A 2PFGA 3DQPA 2GN8A 2NUAA 1A27A 2E48A 3INRA 3ZW8A 2IE0A 3GOHA 4Y67A 2VCYA 3KBOA 1RWBA 2YHIA 5IXYA 4GX1A 1QG6A 4MPDA 4W7IA 3EZYA 4WUVA 3L9XA 4FC7A 5IZCC 4XEHA 2A94A 3VH2A 4ZQEA 1ZSNA 5A1TA 3I5MA 1E3JA 3QVWA 1K2WA 3H7AA 4HFRA 4IY1A 4WCFC 2Y1FA 3WQQA 3AW9A 5C37A 2EKQA 1KEUA 3K92A 2V6MA 2VWPA 4K9DA 3UF0A 2BHLA 3TN7A 1LTHR 4WNCA 3A28A 2JAHA 4MVJH 3B1JA 4YT5A 2Y0DA 2NQTA 4HFJA 5JO0A 2FR0A 4DBVO 1ONPA 5L4SA 4FFNA 4NI5A 2W8ZA 4GWKA 3D4OA 3DMTC 4ND1A 1I32A 5JDCC 1L1FA 2HKIA 3OBBA 3CPSA 1NTOA 4JQCA 4XGKA 1ADCA 3DWFA 3WJ7A 1DFIA 3AOEC 1EE9A 3HZZA 3GEMA 5TNXA 1GEEA 3BZUA 3DZIA 1ISIA 3OJFA 1UZNA 4ND2A 4U5QA 3NV9A 3WNQA 1MXHA 1DXYA 4WLUA 3DB2A 1EK6A 3NGXA 2DTXA 3KSUA 5FF9A 4L4XA 1KY5A 4J0EA 2VWGA 3DZHA 2FSVA 4OYRA 3S2GA 1VRWA 1I0ZA 1JN0A 5U4QA 4CM1A 1S7CA 3AJRA 4TQGA 3UFXA 4CV1A 5GMOA 1T24A 2VYNA 3FRJA 4XGNA 4CLRB 2IZZA 4YTEA 1TLTA 2RBEA 4IXTA 4HADA 1YQXA 3RASA 4GGOA 4MVJM 3ROPA 5T8KA 2X6TA 3VKVA 3VZSA 3WIEA 4DUPA 1VJ0A 4OSPA 4YAGA 1C3VA 3UUWA 3FD8A 4ZQHA 1KC1A 4AJEA 2ZTMA 3WGTA 1HKUA 2HMTA 3KTDA 4RPJA 4P38A 4ALNA 3MWEB 1AGNA 4YYZA 2ZYGA 2FWMX 5IF3A 5TSDA 3RJ5A 4TSKA 3UAGA 2PZKA 4H16A 1Y9AA 2BELA 2IDZA 1EK5A 2BLLA 4RLHA 3U4DA 4BQPA 3PJGA 1VE9A 1RYEA 5JW6A 4UVHA 4E0BA 3K2BA 4YRBA 3RC2A 4L4RA 1SPXA 4TROA 3INTA 3ZW9A 3U4HA 1ZKMA 1FJHA 1GR0A 4CMBA 1RM4A 3IKTA 1N1GA 3E9NA 6LDHA 3HE3A 1C1DB 5JCXA 4MKZA 3TPCA 3KVOA 4PZDA 4PN3A 1Y81A 4BNTA 3ANMA 4GWGA 2W4QA 2CFCA 1WLYA 2X0NA 1YH3A 3MCVA 4NFHA 4BNVA 1U7TA 4EZBA 4Q3NA 4I5FA 3MOGA 3B1FA 4FFPA 5JAZA 5L4NA 1FXSA 4LSWA 4AFNA 3E1KA 4FPXA 3GUCA 4WLVA 2D3TA 5DP2A 4N54A 2RH4A 1CF2O 3CH6A 3ZWXA 1UH5A 5TC4A 3ZV6A 1V3VA 1XGKA 1IYZA 4UEOA 3O26A 3IAHA 4NBTA 3EK2A 1E5LA 1TT7A 1KC3A 5HA5A 1U3WA 2VYVD 3RKRA 4JJIA 3AU9A 2Y1CA 4CM4B 4NJMA 5LC1A 1GPJA 1GTMA 1HYEA 1NFQA 2D5CA 2OBYA 4KTTE 2TMGA 2EW2A 4E31A 2OMEA 3COSA 4IJVA 4M89A 1P45A 3F3SA 4QXMA 5KJ6A 2Y1GA 3G17A 4XWYA 1PSDA 4RGBA 4BV8A 5DCYA 2HQ1A 4BMNA 1ZVMA 2AMFA 4XJTA 2RH8A 4XQEA 3STHA 3QV1A 4BMVA 2B4RO 3OJEA 1DPGA 3HB4X 1H6DA 1CQIA 3I9JA 1QLHA 5JAMA 1I2ZA 3Q3CA 3UCEA 4OKNA 4OMUA 2BFAA 3DOOA 4W4TA 2PD6A 2AEFA 5KVVA 3D4PA 3V1UA 1OOEA 2PGDA 3PHIA 4J1TA 3AY7A 4U6QA 1T4BA 3DTYA 3GN2A 4XYGA 1HE2A 4MVJA 4KDFA 1HL3A 1X7DA 4QFDA 4CR8A 1P77A 3W6UA 1UAGA 2PH5A 3FR8A 2CVZA 3WR5A 4D3DA 3QVOA 1SOWA 4U0JA 3MTJA 1E7YA 2PLAA 3B1KA 3GNTA 4RV9A 2DKNA 3GC6A 5F1KA 2PGLA 3PDJA 4RZHA 5HRUA 3O03A 3JQ6A 4EGFA 3QP9A 3PZBA 4CMEC 1A5ZA 4Q3DA 4DMMA 5TRTA 1J49A 1H6AA 1VL6A 2OGUA 4BVAA 4GLLA 3HDHA 2ZIZA 5G0WA 3JYQA 4II2A 3I4FA 4I1IA 1I3KA 1EDZA 2I3GA 2DPGA 1R4MA 1J6UA 3PYXA 3P5SA 1OMOA 4FFLA 3WSWA 4NBUA 4M54A 4BO5A 5DNAA 4C4OA 2I76A 1FDVA 3GPDG 3HDJA 1E1NA 4ONEA 4B4VA 1NYTA 2GYYA 5L7WA 1PWXA 3H5RA 4M49A 1AXEA 2Q3EA 1HE3A 3CXRA 3PVZA 3W4JA 3DONA 1N5DA 2PKQO 1F8GA 5IXSA 3JQ7B 4AG3A 3F1LA 5DN9A 1B2LA 1YXMA 4MO2A 3OETA 4BNKA 3Q2IA 3WMWA 1ZXBA 5AVOA 5JAIA 5EESA 3ZN2A 1JKIA 2GCGA 4E5KA 2C7GA 4CV2A 1DC5A 2EJWA 1OZAA 3U4CA 3ZWWA 1P31A 3UN1A 1BW9A 2VHWA 2O7QA 3G1UA 5JAQA 5KOIA 4XD2A 3GLQA 2UDPA 4HNHA 2XAAA 5AXCA 4FDAA 2CD9A 2PKQP 2E4AA 4PG8A 3GG9A 2FPPA 3RU7A 1VKOA 3WB9A 4B7CA 1UJMA 2E49A 3TF5A 4J1SA 3EUWA 3AI2A 1BTOA 3PIIA 3HDYA 3F9IA 1ZMTA 1GAEO 4I5EA 4RVSA 3BMNB 1KVQA 1GQYA 4MIYA 1XIVA 2EG9A 2EP7A 3FR7A 2WD7B 2X5KO 4YB8A 1FDSA 4QQRA 1SNYA 2V7PA 3D7LA 2AXQA 1CERA 1YS4A 2HO5A 2YV3A 2ZQYA 3GZNB 4N5NA 2I66A 3D0OA 3AM5A 5THQA 3VDRA 5DBIA 3FI9A 3ZWNA 1RJWA 4N5MA 4IZIA 3R3JA 4NU5A 1X7GA 3AK4A 1GYPA 1N9GB 4KWHA 2X86A 3PQEA 1O5IA 2G82A 2AQ8A 4XZ3A 5DOZA 5H83A 4Q3EA 4XB2A 4XYLA 4R68A 4B3HA 3I9KA 2J8ZA 1E92A 2WEKA 4OOFA 4H7PA 1QR6A 2C07A 3BMCA 1RKXA 2FR1A 1RM3A 3M1AA 2JCYA 3JQ8A 4CLEA 4CV0A 1XR3A 1M76A 4JLWA 5U9CA 4A73A 4INAA 2IXBA 3Q11A 5TF4A 2YDXA 4WLFA 4LW8A 3HB5X 4JK3A 4J3FA 1N8KA 4GQAA 3WGYA 1NQAO 2IXAA 5AQ1A 1QV6A 4GSKA 1R66A 3T7CA 4TZTA 3IMFA 5K6AA 3QRWA 5COAA 1Y8QA 1EUCA 1HRDA 4NBVA 2O3UA 3PFFA 4XKJA 3WDSA 4KTVE 2E6UX 2QRJA 3H6KA 1FMCA 3AY6A 1PZGA 1R16A 1A4IA 1NHWA 4Y8VA 1D1TA 2P4HX 4QTZA 4A03A 4XB1A 4R01A 3ZU5A 2AQIA 2Z1NA 2DFDA 1B15A 4CMIA 5CG2A 4J9UE 4WCDA 3BHJA 2PWZA 5HTOA 1YDEA 1T2CA 4PLPA 2VYVA 2VZ0A 3RBVA 3EVTA 3ZWPA 4IBOA 1U3VA 3RUDA 1W6UA 5IZCA 4DGSA 1K0UA 3JQDA 4G5HA 1EUZA 3I3OA 1E3SA 2R6JA 4DC0A 4GMGA 4IDGA 5A05A 3S55A 3TL2A 1R6DA 3BXXA 4Q3AA 4WEQA 3BIOA 4E21A 5BQFA 4IINA 2PA3A 4KWIA 2YDYA 4RVDA 2NU8A 1P1FA 4GVLA 2GLXA 5HS6A 4FGWA 1HWYA 2B69A 4GBJA 2UYYA 2G1UA 1U8XX 1KOLA 2HSDA 1YBAA 3EVNA 1QV7A 4UAGA 3WWYA 3ETDA 3F47A 3DMTA 1ONNA 1AXGA 1ZNQO 2CF6A 4Y6RA 4CM8B 5L95A 1PJ4A 1YWGO 3AOEA 2A9FA 5JC8A 4R51A 3L6DA 4YBZA 1B14A 5MGBA 1LDYA 1JVBA 5C7LO 3IL2A 3LYLA 1IZ9A 3WYEA 5T57A 2B37A 2AQHA 4E5NA 5C5IA 1Y6JA 2OO5A 2YFHA 3GZ4A 1UP4A 4FJ1A 1K5HA 4BQRA 5MDHA 2QRLA 4G65A 1NAIA 5I9MA 4OL9A 1V3TA 1DJNA 3JQBC 2VHYA 3L77A 4ILKA 4A7PA 1QKIA 1DC4A 3AM4A 2GN6A 4BKRA 4JJGA 4EJ6A 1DLJA 2Y66A 4FN4A 3UH1A 3AUUA 4DA9A 9LDTA 2BF7A 1ZJYA 3AU8A 5A02A 3MJ4A 5ER6A 2BFMA 1I10A 4E2ZA 1G6KA 4FR5A 2ZQZA 1HEUA 2DVMA 3BTUA 3QWHA 3ZNNA 3TFOA 1Y5MA 3JYPA 2PV7A 2VWQA 3JQAD 2ZKLA 3DBVO 1R12A 4BKPA 2VHXA 1NWHA 2GZ1A 5EMHA 3GRKA 4ZRMA 2HRBA 1GEGA 3D1LA 2NTVA 3DAPA 3G1TA 3OMLA 2WWRA 1MP0A 5J23A 1WZEA 5CDGA 3C85A 2Q50A 1UXJA 3W8DA 1NQOA 5KIAA 4HKTA 1VPDA 4RQTA 1LSUA 4LMPA 4PLVA 4HV4A 3EW7A 5A9SA 3PQFA 4RPHA 4Y9DA 2ZCVA 1E3IA 4DMLA 4BNIA 4H3VA 1VSVA 1JW9B 2FPIA 2PK3A 4AJNA 2YYYA 3DZKA 4BOYA 1B26A 1MX3A 2NSDA 3KZVA 3MJEA 5CDTA 2B5VA 1JAXA 1U2GA 1EVJA 4AJ4A 1DIBA 2ZATA 4R54A 4RQUA 3GFGA 4W9NC 2JHGA 2YFQA 3EC7A 5IG2A 1H5QA 1YQGA 3VTZA 1LLCA 4IQ0A 4K6CA 4G81A 2Y1EA 4CUKA 1LXCA 1VKNA 1DRUA 1O95A 2BI7A 1EQUA 3RI3A 3QWFA 4A2CA 1E3WA 2NU7A 1C1XB 5CDYA 1WMAA 1SB8A 2A92A 3GK3A 3SC4A 1QSGA 4Q39A 1JTVA 1NVMB 3ZHYA 1KY4A 1YOVA 2FP4A 4IIVA 4NDNE 4CMJA 1CWUA 2FHSA 1XG5A 2DTDA 3WGOA 1B16A 2Q46A 2WTBA 1OI7A 3H9JA 2O3QA 3HFGA 5A04A 4LMRA 9LDBA 1Y8QB 3I4CA 4P4GA 4PLZA 4BB6A 1M67A 2NQ8A 5COBA 3E18A 1CYDA 4BNWA 1Y1PA 2Q1TA 1WZIA 1SMKA 5LDGA 3M2TA 1LLDA 5A9TA 4ZVVA 4BV9A 3I6QA 4TVOA 4Z3DA 1PGPA 4YT8A 2Z5LA 4LVUA 1ZK2A 3BAZA 4BB5A 4RF3A 2ZTLA 2X22A 1DC3A 1IULA 4D46A 2R00C 3VVBA 3GGGA 3RU9A 1PU2A 3GHHA 1LSOA 3Q2KA 4MJLA 4DRYA 3V2GA 2GO1A 1KVRA 3NJ8A 3ZWCA 1QYDA 1WW8A 2W2KA 3GVCA 3JQGB 4WCFB 3U4IA 1R0LA 3DTTA 3KO8A 1OFGA 4KZPA 1PZEA 4MIOA 4KOAA 2VHVA 5EINA 2P9GA 4RO0A 4CQLB 1OBFO 1LUAA 3WLEA 4EEZA 3K8ZA 3E5MA 3JSAA 3JD2A 3CIFA 5EERA 3VZQA 3BMOA 5I7FA 1DHRA 4PIVA 2QZ9A 3IJPA 5B12A 4YACA 3AUAA 4WKGA 4CMEA 1LSSA 2P9CA 4FW8A 3KOUA 3K6JA 1WP4A 1E7SA 4B7XA 3KYDA 4Z0PA 4ALIA 4B4UA 4CM6A 3MJCA 1GUZA 1NHGA 3TZ6A 3IUPA 3UGKA 4CMAA 1PJSA 1ADBA 1NVTA 1Z73A 2W2LD 1PJ3A 3WQRA 1LSJA 2W90A 4YJHB 1JDJA 2FZEA 3ETEA 4UVEA 3SLKA 4A5OA 3VPSA 2J3JA 4TRJA 1B3BA 1YO6A 3BHIA 2P91A 4YQZA 1SBYA 3NDIA 4QSMA 5JNLA 2LDBA 3RFVA 2A4KA 4OIMA 5CFZA 1SOVA 1MFPA 4FOSA 5C3MA 2WSBA 1GYRA 3ITKA 2JFFA 1SAYA 4PRLA 3I6IA 4RVFA 5ADHA 3ASUA 3I52A 1U3TA 4I8XA 4MDHA 1GQ2A 2BFOA 1K6JA 2RHCA 5T5QA 3HUDA 5CEFA 2VRCD 3KSZO 2ZJ0A 1Y8RB 1XCBA 3WQSB 5TLSA 4CLOB 1H6BA 4PGFA 1GQQA 1G1AA 1GY8A 1LC3A 3EY4A 2VZ8A 3RUFA 1GYQA 4F3YA 1ZIDA 3PWZA 4QECA 5L53A 1Q2XA 2BI8A 1HT0A 5I8WA 4R5MA 4DLLA 2QW8A 2I67A 2HMWA 2NLOA 3WS7A 2QZZA 2HK7A 5JXWA 3G3EA 3ONDA 5IDXA 3CKYA 3Q1LA 1U2DA 5FYDA 4MVJG 4YJGB 4R1UA 4XYMA 1KEPA 1Y7TA 5AOVA 4RPLA 3VZPA 1XWFA 1YBMA 5C7IO 2VTDA 1SCUA 1XU7A 4KQWA 4MOWA 1DDOA 1NR1A 1TI7A 1Q7CA 3TWOA 3LT2A 2VOJA 3LT1A 1ZBQA 3ASVA 2CF5A 4JCOA 3TZKA 2DAPA 5BNFA 5HBRA 3HQ4O 4CM3A 2JD1A 2DPHA 3FPLA 5KNLA 3PTZA 3PZRA 2OFPA 4II3A 3IJRA 1HZJA 3K9QO 1QYVA 4OH1A 1PJTA 2QQ5A 4FB5A 4Z0HO 5TJHA 4PG6A 4YXFA 3GN1A 2HMUA 5G4KB 1XEAA 3OEWA 3GVXA 3ZWVA 5JBIA 5AXBA 3T7EA 1BHSA 2VZ9A 4L75A 4DYVA 2QYTA 3PJEA 3DZJA 4BS9A 4BO3A 5L51A 2C59A 1PL6A 3JQAA 4OM8A 3S2FA 1LEHA 2O48X 1DB3A 1P74A 3TZQA 3GQVA 2FR8A 3RFXA 5L9AA 2C2YA 1TEHA 4HX5A 4K26A 2HRZA 5U1PA 3U9LA 5KJFA 1HETA 3LVFO 1UXGA 4IMRA 3L6EA 1PTJA 3ZV5A 1SZJG 1X1TA 4EUFA 3WG9A 2Z95A 4RLSA 2IYOA 4CV3A 3IP3A 1GPDG 2WYUA 4QUKA 5L7YA 4F46A 3T4XA 2DBRA 1GZ3A 1XSEA 3O8QA 2GN4A 4IXWA 3RWBA 1MGOA 3PPIA 4DQXA 3LT4A 2C5AA 4D43A 3MTGA 2O2YA 1D8AA 5ICSA 1BWSA 4Z6KA 1CJCA 3MJSA 5KVCA 3VDQA 3QVSA 1EDOA 3V1TC 1ZW1A 1EUDA 3S2EA 5DBFA 4IUYA 4XJSA 5AXDA 1YL7A
chains in the Genus database with same CATH superfamily
2VDWA 1WEKA 1KVUA 3FOCA 1MKYA 3PJDA 3O82A 3V8BA 4FJ2A 2BE7A 4D9NA 2XTMA 4UBNA 1QMPA 4OHZA 3WMGA 1KK3A 1T1EA 4U2GA 2Q9BA 4HTFB 3PEFA 3C3AA 3H2SA 3PSHA 1YS9A 16PKA 5IAGA 4V0NA 1QGUB 4KXFB 4ZZ0A 3JWHA 1W88A 5LXTA 1OGYA 3CJQA 1FYEA 1X8XA 2P9EA 3TQFA 5A3QA 4REOA 3AR2A 3GG2A 4NFSA 3W77A 2I34A 1FW8A 3P9NA 4Y3UA 1G16A 4HP8A 1QJCA 4DLYA 1KTIA 4YCLA 4LC0A 1C1YA 3WNBA 1NYLA 2JIQA 3SC6A 3WC4A 4MS1A 2GEKA 1ZD8A 3SXPA 2IE8A 2XMDA 3TTYA 2NT4A 3T1QA 4ALLA 2V5UA 1P62B 2DJIA 4PU0A 1OKKA 1EFRA 1T8TA 2ORED 2X9LA 1NAHA 2CL5A 3EWSA 4FSDA 4V0KA 5H9VA 1U0BB 2EWWA 4DEVA 3OSUA 1G20E 1W25A 2ZI5A 3OA0A 3OP4A 2AMYA 4XUGB 2Z04A 4G1FA 1R3UA 4JBWA 3NHLA 4KGVA 5CA0A 4MVWA 3H1TA 3H7IA 3WV4A 3F6BX 3IR7A 2I2DA 1VP9A 1N34B 3DE0X 4ER0A 4F2GA 2ZITA 2Q7OE 1VKHA 3S1AA 3VH3A 2JW5A 1LI7A 3DOJA 1CJKC 1RQ7A 3C14C 1HE1C 1NUTA 3H2BA 1ZH6A 1NP6A 4XGRA 3WIDA 3SOPA 3WTBA 1CIVA 4FQ8A 4B0OA 4DVGA 1SD2A 2PZAA 3PFIA 5JY6A 4P3OA 2PMWB 3OTGA 4U7WA 1HLDA 2AGVA 1N7GA 3GBPA 3RFUA 4ESHA 3OEEA 3B78A 4JSYA 2YJNA 4DIMA 2FH5B 3IURA 2WTMA 1AQIA 2J6HA 3IV7A 1WEHA 3OZTA 4JR2A 4TTTS 4BNGA 4AAYA 1RXUA 3TLGB 2N47A 1RJ9A 2WM3A 1I7DA 1KQOA 3I9LA 3M6MD 2HU2A 3BREA 3M3HA 1BVYF 1DWUA 4LDNA 1PR3A 2B82A 1G8SA 2MINB 4S2UA 5GY7A 3HVRA 2W2LA 5REQA 1M0SA 1IBMB 1ZCJA 4AX8A 2A1UA 1TRHA 1Z0ZA 2I4IA 4U4AA 4BO1A 2GJAA 3P2IA 4UQOA 5JMWA 4R1SA 3ZE7A 5K8UA 2GJ4A 3CB2A 5I9BA 2JL1A 2EXXA 1HO3A 3VOSA 3C24A 4RTMA 1OT5A 1MIHA 2B2CA 5IDQA 1EGQA 3VKUA 2YQ4A 4TKVB 4M87A 3G02A 4KN5A 4K40A 5IPFA 1Z8NA 2X0JA 1KKMA 1MIOA 3LPLA 2PLFA 2OD9A 3IQXA 3JYNA 4TM8A 4YAOA 2ZSHA 1EX9A 3BGDA 1D2GA 3KZ1E 1WR8A 2WG2A 4PPYA 5AJHA 2JGDB 2OBNA 4PZ9A 2NSYA 4JLAA 1NBME 2DG2A 1ZEJA 2D1QA 2QAIA 3EGXB 4L8FA 5ABPA 5G3ZA 1MG0A 3HFRA 1JAYA 4FLFA 2YV1A 4FOTA 4IDAA 1F4VA 2DBQA 3PCTA 3GA7A 3G0CA 1ECCA 1IZ8A 1UXIA 3OA2A 3O8NA 4HZGA 4KPUA 1SUWA 1SVUA 3WK5A 1QDLB 4ENVA 3NH6A 1A8IA 1E2EA 1EZ1A 2H1OA 5LNK6 1B43A 3WWZA 4FGUA 2IIBA 2IYNA 4LHEA 3X2EA 4AY6A 4MDYA 3GCWA 1X1EA 2H59A 2IKSA 2PQ6A 1P4GA 3SQXA 2HU7A 4ND8A 4KWEA 1IQPA 3E9ZA 4PICA 4HZIA 4HVTA 4EPYA 4QXPA 1O0BA 3EQ9A 5AOCA 4C7OB 1G59A 3E9QA 1POXA 1E6WA 1DBQA 2WMDA 4HH1A 3RSGA 4ZHSA 3PWKA 3TTXA 5IS2A 2VDKB 1GZSA 1QOPB 4RA9A 5PGMA 1CEQA 2JZNA 1EGMB 4OHFA 5AKLA 4ZANA 1Q50A 1ZM7A 3LXMA 5CT4A 5D3MA 2B1GA 1I01A 3O90A 3TEJA 1A8PA 1C4OA 2HUPA 4I08A 2X5OA 4XVRA 5DGHA 3IAS1 5EP1A 7MDHA 5HWSA 2NVOA 4GGPA 1KK0A 2PXXA 3HPRA 3P26A 4UM8B 3VU1A 1LRJA 1NX6A 4D8XA 4LYJA 5IWAB 4G86A 2B7LA 4L0QA 1GQRA 2HW8A 4KSYA 1QP4A 3A6LA 3B12A 2FSFA 4M22A 1KEKA 2JAOA 3GQBA 3OCYA 4ENQA 2TMKA 221PA 4QM7A 4MV6A 1NMYA 1WOMA 3V42A 4RK1A 1XMOB 3ZWKA 2PUFA 3G49A 2WWXA 4LXTA 4RCYA 3AF1A 2IEDA 5BSRA 5BVHA 2BTEA 2CWWA 2XZLA 2W2VA 3U1TA 4CTJA 1W2GA 4RDHA 5FWNA 2YFKA 3TX2A 1VMAA 1Q1BA 5HIAA 4JBHA 2P4SA 2XGSA 3CQ9A 4GOOD 4IWYA 1JWAB 2OHFA 4DUGD 4R8LA 1CD5A 2CUKA 3VSEA 2CXTA 2OORC 2JHFA 3OCJA 2WJPA 1JSXA 2OVBA 5CU7A 1G66A 1YK1A 2HNKA 5HCNA 3UT5B 4DR4B 3BHNA 3U9SA 4AI6A 2IYZA 1BE1A 2PSEA 4BY9E 2C3YA 3QYAA 2AR0A 1FSGA 4E2XA 4WK0B 2HQOA 1LH0A 1XQYA 3PHCA 3RC1A 2MSEB 2IEZA 2VHZA 1N2SA 5FADA 2CV0A 4LQDA 3UJ9A 4NEHB 1FMJA 1O95D 1U3DA 3I2KA 3OFJA 3NX4A 1PJ8A 1W49A 3LLUA 4S12A 1NJ1A 1YQDA 1NJ5A 2Z9BA 2VBIA 4OLHA 621PA 1IOZA 2IV3A 4E32A 2AD5A 5BV0A 4QARA 1QO0D 3OQIA 4O4IB 2BI4A 2Q6LA 1E0KA 2QNRA 2FPGA 2QYHA 2ZRJA 4ARUA 4EFMA 4F11A 2QTRA 1PWYE 1WL8A 1Z0AA 1C50A 3NHWA 4MARA 3K2QA 3TOZA 5HUQA 1ZFNA 4DV4B 5TJ9A 4X1IA 4TTIA 1CUHA 1LFDB 1BDBA 1U6IA 1PX0A 1XEWX 4R2MA 4F0JA 2UV8A 5I5EA 4RH1A 2ASEA 3IMEA 5LOVB 4TLCA 4FR2A 4BVLA 4D2IA 2Z57A 1YIDA 3SZRA 3E1SA 4ZEOA 4H59A 2W2TA 2AZXA 2V65A 3IP5A 3QEKA 1A50B 2R6GA 2V4ZA 4NMMA 5DW3A 3B8HA 2XUFA 3W9SA 4EHFA 3CO0S 5JCOC 1BQ4A 1H8HD 2GPJA 3HVIA 3O1IC 3HJAA 1NNUA 1YNOA 5FOUA 2R97A 2LRHA 3QKSB 4QFBA 3DW1X 1M34A 1QP7A 1X7YA 2PSDA 1TNDA 1LU9A 3OKPA 1PTJC 2EQ5A 3BRWA 1Z28A 4BO8A 3Q6NA 1RCUA 4BKQA 1V25A 3S8MA 4JYBA 2ZIAA 1TC1A 2J3KA 4HAZA 4QPNA 5BPFA 1ZINA 2B1QA 1N9KA 1VJRA 2P7HA 1R5OA 1EQAA 2YN4A 4LG1A 4MA5A 4O2LA 3I2IA 4G0OA 4F96A 4HCJA 3FJ1A 4GYWA 2JHPA 2O8CA 4MRVA 4AP6A 5EHXA 2Q07A 1PF7E 4Y0NA 2AWNA 3ZBTA 2WJGA 4UXIA 4DSTA 1H3NA 4M1QA 3WFZA 1LPAB 3MJVA 3ET5A 3TTVA 2P2LA 1RAIA 2GLUA 4D9FA 4KV7A 2KB0A 4HS9A 4K6FA 3HA5A 1ZG3A 1O94D 1BO6A 2OQ2A 3WKBA 2QBYB 5AH0A 2QJTA 3M6WA 1DX4A 4ROSA 2ZGVA 3QWAA 5LUBA 3REGA 4DPLA 3K7EA 4YRNA 2FFQA 2OM6A 4ZZ3A 4BLPA 3GVIA 4RMNA 2FPMA 2CVPA 1KETA 2JLBA 2O2GA 1OH7A 5DP1A 2QV0A 4K8RB 2P2GA 2RK6A 1SN7A 4MS4A 5K3FA 5JY1A 3ESRA 2O8EB 3HYTA 1T13A 4DREA 4CTOA 3B3JA 2GZSA 1FMFA 1N1EA 1SA0B 1XMIA 2HOQA 3PIDA 4ZCTA 1PGOA 1ZL0A 5JS8A 2PEYA 4ITUA 1SUCA 2L82A 5E9QA 2PNJA 3OEYA 3QF4B 4ARBA 2ZB7A 4G8CA 1NJ2A 4DR5B 1M1UA 4BNNA 2WIDA 3C3MA 1CRZA 1RWMA 2NVBA 4G8BA 4JGGA 1ZAYA 1Q15A 1TEVA 1W4BA 3LYHA 4HQ6A 3GWZA 1XXHE 4Q3BA 3FROA 2Y0CA 2GTPA 1QB8A 5G1OA 3CUKA 1P0FA 2BR4A 3AVPA 4X41A 5LKRA 2D5AA 4HQOA 2ID7A 3D6AA 4NBWA 4ZHQB 4O2BA 5DX0A 4X45A 3SEQA 4F5WA 5H02A 1C3LA 2SECE 3DMFA 1DRWA 2REXB 3FNGA 3K1JA 2P5SA 3KM0A 3ZHBA 1I2CA 3L7IA 4G89A 3O8OA 1AKNA 2RFLA 3LPMA 5F9FA 4IOJA 3M7IA 4FCCA 2BC9A 4D41A 4W1QA 4QNMA 2HPZA 3QA9A 4BX9A 4EFDA 5LZ2A 1Q77A 1WQ1R 4P7KA 4I7EA 4HB4A 1NLFA 4M0LA 3ORSA 4XQ0A 4ZYLA 2DGDA 3LHDA 4LNUB 2Q0HA 1XDZA 1CT9A 4A26A 4B5LA 3DE1X 5GJVC 3ETNA 3RR2A 3K5WA 4J16C 4K86A 1GNLA 2H63A 2AR9A 1GPLA 2VKQA 1JEAA 3C97A 1BW9B 2EC5A 3WZMA 1NE2A 2XKAA 4ZVQA 1D2EA 3EIFA 4DQDA 1GUDA 1M6EX 2F1OA 1P29A 4GFDA 3IOEA 2C8JA 4UBMA 3WBBA 1NQWA 2XD4A 4UTRA 4I1RA 4AYWA 1B7GO 2W8BB 3IV6A 2ZPUA 1JQ3A 2NU9A 3CMCO 3OG9A 3L8YA 4KHZA 4FGSA 2WWFA 4AC9A 2XXAB 1CF4A 4QICA 5HUHA 3DV9A 2PTHA 3PYMA 4YS6A 3SJAA 2I99A 1TM2A 3DV2A 1LDGA 1JNYA 2GRAA 1QBGA 2YWEA 1GVHA 3FBTA 3Q0IA 1GWNA 1RZVA 1V95A 1NRXA 1T35A 1X42A 5GONA 3NBQA 1A9QA 1R0XA 3QTTA 4KXWA 1PCXA 1WUTA 4Q3CA 2QHXA 4Q0MA 5E6SB 5EPOA 3WHIA 3VAAA 1S3SA 3L9WA 2GK6A 1ZXLA 2B5WA 3LU1A 1QAQA 3DAFA 1J00A 3LDAA 3HNPA 2JHCA 1YKFA 2O8BA 5BWOA 3TD9A 4EYKA 5DX1A 4M8LA 1ZN7A 1R0YA 1TD1A 2P27A 4G5GA 2X8BA 4N76A 4URFA 2WYVA 4C06A 3Q8KA 2ANBA 4R3UC 4M9RA 1GA1A 1Z0DA 2NGRA 4HQFA 4GVXA 3Q7QA 2ON6A 2IY7A 4I2NA 3G5LA 4O25A 1XLVA 2ZB8A 3FTDA 2IH4A 1YDMA 5JT1A 1IMOA 3L4BA 3UBMA 2CMHA 2XE4A 5K3AA 2OHVA 4L4YA 1H2HA 1UM8A 2C0CA 3CJRA 3GUZA 4IJUA 4BJ5A 4CF5A 4U3JB 1EEHA 1X13A 1BE0A 1NXXA 3KP1A 2QLBA 3T5DA 2AZ4A 3BMCB 1E2BA 2D3WA 3QSGA 3EVCA 4UUQA 3QLJA 3FN4A 4MLPA 1X9GA 3QFSA 4L73A 2J30A 2ZB3A 4TLAA 4ENPA 1ZSYA 4L0DA 1M2VA 3B6JA 1KQNA 4MICA 3UJ6A 3C4QA 2CKMA 3AF6A 3BIXA 3CURA 3K31A 2ID8A 1R6AA 2EZ9A 2Z58A 3W2TA 2QTWB 2POQX 4LCEA 1Z0FA 1EPUA 3JX9A 4LRQA 3T9CA 4B6RA 1FMLA 3OPVA 2BPOA 4JT2A 3SHQA 1S3IA 3K1AA 4UTXA 4ZXPA 1B0UA 1T6XA 3N2ZB 4EBFA 3ANXA 4DWWA 3CX7A 1X7XB 2IYFA 1KYVA 3ANLA 3N74A 4QBKA 4DKJA 2R86A 1CV2A 1H2XA 1U94A 3F74A 4R8VA 2HAEA 2V7TA 4C7JA 1K8ZB 1UMBB 2FMIA 2OCAA 2P3QA 1RYHA 3ZHXA 1C9NA 1OF1A 1OIXA 4IHAA 1HORA 2VOEA 2XTJA 1T4MA 4RK6A 5IF9A 5HFJA 4G0UA 3GAFA 5BVGA 1N0VC 2BM0A 5EPUA 5JFTA 1PJCA 1H94A 3VU9A 3GFVA 4FX2A 4Q6BA 4YONB 4EPRA 5BV7A 4JQOA 3UAZA 3NNNA 5AJVB 4D9HA 1UDRA 3MSCA 2OAP1 4Y2RA 1LLQA 1A9RA 1POWA 1WPXA 1Z6QA 3G13A 4D9GA 5L6MB 1OKKD 3EZ2A 1C9JA 1W8DA 3DWIA 2DERA 4OHYA 2R8XA 1TT5B 1LVHA 3GMTA 4G84A 4MVJP 1CY1A 2WFAA 5ISMA 2OCYC 2RG7A 3FZNA 3MNFA 1ODFA 4CLRA 4D79A 1WXEA 4U9UA 1IUNA 1OPXA 1XHEA 2ZW9A 5HIKA 2GZRA 3IB3A 2G7ZA 1EJ6A 4OJNA 1XLWA 4KREA 3TLEA 2JFVA 3AF5A 3F4BA 1W6RA 3VZQA 1L5ZA 3KJXA 5IW8A 3KHTA 2Z83A 5C1PA 4RC9A 3GLGE 1FEZA 2RGDA 4MIKA 5EZSA 8MHTA 1A9ZA 1IUKA 4TT3A 4NMHA 2D4AA 2CNWA 3KOYA 4B71A 4CCYA 5AW0A 3ZD7A 3G0OA 1QCZA 3RJZA 2APJA 3X1KA 4PFKA 3TZLA 1XA3A 3T7AA 3IUSA 1WMDA 4YDRA 5D86A 3VYRB 1CQZA 3RGWS 1AKYA 4DFDA 821PA 1NULA 4HY3A 4J7XA 3ICCA 3BULA 4RY0A 1YCFA 2IYWA 3L3BA 4FCVA 5AW3A 4A1OA 5JSZA 2NPOA 1AU9A 3LUHA 3DLCA 1MO2A 2J3MA 1OTXA 5KYWB 4RK0A 2YWDA 1HF3A 4QTTB 4TTQA 5B3AA 1XNJA 3VZDA 3BZWA 3E5NA 2PMBA 4HMOA 4C14A 2QJWA 4EITA 5ITZA 1K6IA 3JQPA 3QUSA 1PWZA 1T5LA 4G4GA 1U1IA 4WA7A 1WHSA 3HH8A 3C5HA 4X5OA 4KBYA 3RRJA 2NUPA 1EFKA 3KKKA 3SF0A 2V7WA 2JLCA 2R5NA 3GX1A 1M1NA 2V7VA 4NYIQ 1W9HA 3CLUC 1UUFA 1QP8A 3T5TA 5H59A 3UIEA 5BN4A 2XDYA 3OTOB 5A0TA 1AHHA 2DYKA 3JCZA 1JJVA 4IIUA 1V0JA 4LSGA 1N5RA 3QOFA 1MV8A 1TZ2A 4ENWA 3DDSA 1XRQA 4LXUA 4ZQIA 2P2CA 5BMVA 1E60A 1JYEA 2WHEA 1FBTA 3F97A 5E1OA 5JS1A 4DGQA 3LZ6A 2D7CA 1WU7A 1X0VA 3ZHZA 1JKXA 4HLNA 2ATIA 2G9UA 4JJFA 2XT9A 1IBSA 1SCJA 2UVDA 3MUFA 3NAMA 1TJ4A 1MXFA 1JG4A 1SFRA 1G6Q1 1UKZA 3EQ2A 1T2DA 4HAOA 3V1LA 4EHDA 3QG1A 1R37A 2J3EA 5EE5B 1PUJA 2IEBA 2M32A 2UYGA 1M8FA 1G38A 4YUZA 5KJCA 1DIAA 4RH3A 5A62A 3WGVA 4U7GA 4YGYA 1ZNXA 1EEXB 4D8TA 2W42A 5A4IS 1BKYA 2GASA 3IV9A 2DBYA 4OYYA 1RXWA 4XR4A 3Q8WA 2WP0A 2Y9PB 5CB4A 1ZSVA 1WPQA 4Q37A 2OUKA 4B4WA 4DQLA 1EU1A 6ABPA 1J8QA 2EL7A 2VAVA 2FQWA 4FGJA 4Q7KA 5FOVA 5A9SB 3ZJ5A 5LA6F 4R6XA 4RVGA 5EKTA 2ZJZA 3BT7A 1E3TA 2CNOA 1Z5WA 1FFYA 1HDXA 2J67A 4QYTA 1G4UR 3A1UA 3GJ0A 2J6CA 2JGFA 3KU4A 3MJDA 3QEMB 2R62A 4QREA 4DJEC 5IYZB 2OCXA 3K4HA 4NFYA 4YJ3B 3WLOA 5K3EA 4B34A 4B33A 4PLCA 2EARA 1UJ6A 5B7QA 2W6NA 2GPTA 3PXDA 2YXDA 1B6RA 1RRKA 3PDUA 1SG6A 3EBPA 1I6KA 1ZR2A 1DVRA 1N5MA 3WFJA 2AFHE 4PNZA 1OAAA 2XXBA 5DOVA 1Z07A 3VSCA 3A9UA 3AJDA 3OQMA 5JYDA 1Y7PA 1H4QA 4GXTA 1B8VA 3URMA 2AI2A 3GRVA 5KEIA 5TMBA 3QLUC 5FA8A 1MABA 3DCNA 4KIJA 2QL5A 2GYUA 1E3WB 1LDNA 2PZMA 3PWTA 4KEAA 4H2DA 1A7KA 4PY2A 2B25A 1HYQA 3IR5A 3W5IA 2FPUA 3BFXA 1A9SA 1EVQA 4EKGA 2ZTUA 2I78A 3Q15C 1FNSA 2BFWA 4XDZA 1JSCA 2X1HA 1Q6ZA 1YOVB 1LZKA 2BN4A 4OATA 3HYSA 1B8PA 1XUOA 2AJ8A 2CUZA 2QU8A 3LGXA 1K6EA 4J1QA 4D02A 4UAJA 2CLFB 4Y9SA 3EGDA 3RVMA 4L9SA 4G4SP 4KVGA 2XY4A 2FUNB 2YJZA 5THKA 2A6PA 2WKRA 1S8NA 4DLWA 1IHXA 1FNNA 1QYCA 2Y77A 4TYMA 4EG3A 5C5EA 1IUPA 4BMSA 3SHOA 1YACA 1GILA 1W59A 4XD7A 4CM5A 2D2XA 1QS0A 3TFWA 4DLAA 2ISCA 2QR3A 1ORWA 4IKOA 4ABYA 3CN7A 1QFJA 1SUDA 1UM9A 2YV2A 3F8SA 3HUTA 5EZQA 3ZD6A 3U39A 5AMXA 3AFGA 1JVSA 2HFJA 1CDOA 4GX0A 3I83A 4FDMA 2TSYB 4DV0B 1OA1A 3DZGA 3A1EA 4BVGA 4TXNA 3VDMA 3K6SA 1FFHA 3RC7A 3M9WA 3DBRA 3AM1A 2GCIA 2QMEA 2J32A 2ZU6A 1VLMA 2GVDC 4QU5A 1UIMA 4KJZA 1KAQA 3TSAA 3V80A 1FUEA 1Z0KA 2NYAA 2EW8A 3WLSA 4BIIA 2CMDA 3RTAA 2F3QA 3KQQA 1GAJA 3ZGLA 3T1NA 3OHPA 3PVCA 1T3GA 2P6PA 5AKIA 2J9YB 3I9NA 4B3CA 2D5IA 4DCSA 6GPBA 2WF8A 5IDYA 4DAOA 3O8LA 4FOLA 4TMZA 3IVXA 2BD0A 2IK8A 4RVUA 1RYBA 5EJGA 3USCS 3H4VA 1TECE 4AS3A 1S2OA 2IYEA 1FP7A 1YC5A 5JAZA 3NPAA 5IJZA 3D7RA 1M9NA 3KPUA 2XUHA 3MQFA 1HTBA 1IY9A 3ENQA 4FYWA 5A7HA 2P2NA 1QORA 1NSTA 4BC1A 1VMDA 5KJ1A 1XD9A 2OC4A 4E4YA 3ONEA 3G2NA 1XZEA 2D0DA 1Z7GA 3KYDB 3QFRA 2ZJ4A 2E89A 3IOYA 1M66A 4QGBA 1N3IA 1F06A 3T3PB 3ZXXA 4B3JA 1K8QA 2RHHA 2VAMA 4EG4A 3IEVA 2E18A 3CX8A 1HK7A 4DDTA 2CJWA 3BMNA 5F2NA 1ZIOA 4DA4A 4E4TA 3CCFA 3JQCA 1W46A 4PAWA 3FZGA 2CLDX 2WD7A 2JFHA 3JYLA 4OHOA 4RAQA 3TKYA 4CIBA 1DIRA 1TW2A 3L7LA 3C7TA 5AVUA 1U7HA 3FYUC 4WINA 4Z2AA 4LBWA 2DX7A 4QDUA 3H2KA 5AI6A 5HR5A 3GZNA 2QI9C 3ZZ1A 3HCOA 3W5CA 4ZVOA 1AV6A 5AVRA 4FYKA 1UAAA 2BYTA 3KXIA 5CVVA 3ICQB 5C8DA 2ONJA 2PRYA 5EEGA 4DA8A 2FDXA 2WJVA 4JNKA 4JP2A 3T7SA 1NQTA 1O0SA 4WKNA 4YIHA 4JKIA 3GLHE 1GO2A 4E5PA 4ENRA 3PT9A 3A4MA 2I1QA 4OQZA 1K89A 2Q5JA 1SULA 2OZPA 3LF1A 1GQFA 1KI6A 4TRNA 3VX4A 2WF5A 3VAZA 1W4ZA 3K0HA 1OC2A 4HDMB 4Q21A 4D25A 1V7CA 4XVQA 4KJXA 5CDSA 2QRVA 4NPCA 4PC6A 3G5MA 5KPJA 3BKWA 4RBNA 2V0NA 1TX4B 4GL4A 4IEFB 2R11A 2C83A 3NHKA 3B3QA 1IVSA 1CF9A 1WA5A 3ZDCA 1GNSA 3CR3C 5AUPB 5K0ZA 1JLKA 3Q9NA 1O87A 4P2BA 4C4AA 4ETMA 3CY6A 1Z7YA 1N32B 3II6X 1Q0SA 2ET6A 1QE5A 4X20B 4F6CA 2WU8A 4M46A 1I30A 4UU7A 5CVTA 3INYA 5G1PA 2QGFA 2OBMA 2QX7A 1T0IA 4M9SA 2PUEA 3ECSA 4YCJA 3EDQA 2FEAA 3AR7A 3R3ZA 4WBSA 2PQ2A 3DDNA 1E4OA 1DWOA 1H4TA 4BQEA 5BXYA 1U5AA 4MQFB 3TJMA 2EFDB 4B6GA 3ER6A 1XQWA 4YRDA 3MG9A 4W9RA 3E84A 1K7XB 1G7SA 3OQOA 1GPH1 3OX4A 1UJBA 5HMLA 5B6IA 3OEHA 3S2UA 5JH7B 1GT91 1THGA 3JQ9A 5JVDF 4ZI3A 3CVVA 3HI4A 1XWWA 2Q4RA 3FPEA 2F55A 4LN1A 1TCVA 3M49A 3K9WA 4OQYA 4UUPA 4F6LA 4LHVA 4D1YA 2PO5A 2WNIA 3O31A 3M89A 1NN0A 2CVHA 2W48A 1YQTA 2CJYA 2RI1A 1O57A 1RLJA 4TV8A 4F2PA 3GPLA 1PQWA 2HXSA 1PJQA 4F1JA 4TS4A 1DAKA 1O6ZA 1P75A 2C9YA 4ZYWA 1ZZGA 4CMGA 2VTKA 1W5SA 4Y9TA 1D6NA 2WJJA 2X2EA 3AUSA 3O2QB 4NMXB 2JGEA 4PZPA 4QRDA 1F2TB 5EJ2A 1RWKA 5A3VA 5D00A 3AWIA 2WC1A 4P8RA 2AWOA 1ODLA 2OTCA 3OOWA 5FBRB 1I9CA 2AN9A 4H08A 1F7UA 4HLUA 2PT9A 4KYUA 5EIEA 1ZVQA 2AZMA 5I7RA 3TDKA 4FE3A 5IX8A 2F1JA 3RD5A 4PYQA 5IAAA 4F4IA 1CB7A 1ZRHA 3UOGA 2HRDA 4Q18A 1YHNA 5CIQA 3HXLA 1L5GB 4GSYA 5SICE 3SBOA 3ZHTA 1OHHD 3ENWA 2XKBA 3SQWA 3OZRA 3E8XA 3G7NA 4P0PB 2JFYA 3F5DA 2LE0A 2HDHA 2PAAA 2YY6A 1Y9JA 3JYHA 1K2VN 3KG2A 2X0RA 4LBVA 1WG8A 1QCDA 2O5VA 3QJ5A 4U2CA 2ILTA 4UCQA 5KTSA 3P2YA 1C9EA 4L27A 4C4TA 2VDUE 4CM8A 5A3RA 2GXAA 5GADl 2YWGA 3V8VA 1DUIA 1U63A 4MWEA 1H85A 1UIRA 4ZJUA 4IQFA 3JAKA 4FR0A 4R83A 1XRMA 1E77A 1KQPA 1KYZA 4RPGA 4KQCA 4NX2A 3SQNA 3U3KA 4Z7OB 4GU5A 1ZK0A 4B3SB 2C5HA 5FOWA 2C5FA 2EDCA 3DEIA 3PYLA 2O19A 1WE2A 4YCCA 4ZVRA 2VI5A 3NEPX 4YEDA 1RIFA 2WHQA 1BRMA 5CEEA 1KBZA 1YFZA 3PXXA 3EARA 3EPJA 1GP2A 5EC8A 3EW9A 3Q5GA 1Z4JA 3T7KA 3CTMA 3DP7A 3DUFA 3KVVA 4J0JA 1AK9A 2UZ1B 4B82A 2GXQA 3OT1A 4MROA 4N5LA 1M72A 4JITA 1B3RA 2EX0A 1RWVA 3COPA 4URHA 4F12A 5B58C 3OPNA 3EXFB 3MILA 4IEEA 4JL6A 2CJXA 4DT1A 3SYRA 4P4LA 2GKGA 3KT6A 2P9YA 2C9BA 3BWEA 3O0DA 1L5RA 1NW9B 4K3VA 1QHGA 5KDLA 3W2IA 3LYUA 5IDWA 3HXMA 4YWHA 4Z4HA 7ADHA 1K9SA 4JIMA 1ESEA 2XQKA 2L0XA 1VJCA 5ALMA 1P5FA 1R0SA 1ECFA 1TKRA 1VB3A 1VTKA 1QRRA 2X1VA 4BNXA 2WQ7A 2BZ0A 2FW8A 5FHRA 1VA5A 3MAJA 1OIWA 4A0RA 4C9BA 4P4SB 3M5PA 2CK3A 3GJ7A 2VDQB 4UUMA 5DCWA 5KSZA 4GBGA 4U6QA 4JBXA 3HV2A 3SSOA 3BM5A 1WF6A 3L82B 1WB9A 2R8EA 1DBVO 5FPPA 5JAUA 2UZ4A 1HZZC 2XYRA 2ZCUA 3DAYA 3DT8A 3M9LA 4EI2A 2UUOA 3KOMA 4ZCIA 3RFTA 2RG1A 3QX8A 2JK1A 1VBNA 1EWYA 3T38A 3CVXA 1V6SA 7REQA 4YALA 2VPIA 2P6NA 3AG5A 4WEOA 2Z8YM 4J3JA 3BWBA 3ESBA 3Q7RA 2C1XA 1L9KA 3OIVA 1DEHA 1YDWA 2JJQA 3L18A 5I4KA 1F0YA 4BLWA 4EHLA 4HGYA 3L07A 2JASA 2D8AA 1QPBA 2O6HA 2X19A 5C5CA 1SR8A 5SYMA 4PXSA 1N9ZA 3WIBA 3BE6A 4TT3D 3UCFA 3A6ZA 1M2HA 3AVUA 4XYBA 5BSHA 5LUAA 4HAIA 1TUEA 2NWQA 3HCWA 3Q88A 3ROFA 4DA7A 2AEEA 3B5EA 3BQ9A 1C1XA 5J2TF 3WB1A 3VYWA 4MIEA 2CXQA 4JP8A 1R8QA 5I7VA 1H4SA 1FPMA 3R7WB 3TTWA 5LMUB 1SQGA 1DU4A 1JDPA 3OWOA 5T8KC 2WABA 5B4VA 1ZMXA 1JXQA 3S68A 5A4JA 3OZSA 5LVAA 4ED9A 2F8TA 3E22A 4J91A 1P2VA 3BE5A 3AMVA 3V8EA 1XDSA 5KYNA 4IS2A 4KXLA 1G291 1KY3A 1L4NA 4FFWA 2RGUA 4RAOA 3JD1A 1Z37A 2GN1A 3QLVC 1JHQA 1WABA 1CY6A 4YLEA 3ITEA 4DS3A 1SRQA 4TTAA 2XITA 2Y1DA 1ELOA 3E82A 5FULA 3GEBA 5FV7A 1FRVA 5DTJA 5BT8A 1TCAA 2FW9A 3ZH2A 4BJ6A 1LI4A 2OSVA 4RTKA 1D0IA 2P75A 4YAEA 4LJ9A 1K6MA 1PFQA 4RPIA 4EKDA 1YULA 2DFNA 3WAGA 1ORDA 5BWCA 3BXPA 1O1YA 3V2HA 4HSEA 4K9LA 2X8JB 1TVEA 3NGLA 2MDTA 4KRXA 3NHMA 2AFVA 2ZZKA 2P5UA 4L9RA 1PZFA 4KHPB 5F7OA 4OGFA 3RQIA 2DLDA 2EDAA 3NEJA 2OXRA 3K4QA 4IDNA 2MR5A 4L6IA 3RF7A 1YVRA 5CAEB 1HDIA 4DQ0A 3U3JA 2A1TR 1T9ZA 2JFPA 1GGEA 2CCGA 1E5VA 3ID6C 4ITRC 2AV6A 4H4DA 3M82A 4RXTA 4XVCA 5HK9A 4CTNA 2OB1A 1L4MA 5JMTA 5FTJA 2P41A 3F0TA 4RHXA 8LDHA 4CQLA 4UEJA 3OTHA 3G2QA 3SQLA 1VI5A 3UMSA 3RHTA 3U09A 1WKVA 4XX0B 3NR2A 5J43A 4Z99A 3TQCA 2OL4A 4LXIA 5LQCA 1ACJA 1F14A 1VSUA 1K4MA 4FMDF 4MRMB 4RFVA 3S7TA 4HBGA 3SYMA 4Q9IA 1FPQA 1XHLA 4LECA 3UG7A 3H2YA 2HU8A 1KSGA 3R5XA 1AIPA 4OMCA 5A5EA 3KSRA 3HEAA 4NYMQ 5HFAA 3A4IA 1UK8A 4MUBA 1WM1A 3PDIA 1Q1NA 2XMSA 2D5LA 3NBKA 3I73A 5JDCA 1ZUIA 2PWBA 3EGOA 1HDZA 1YI1A 3FF4A 3ZJYA 4P4TA 5LLDA 1FFGA 3MTIA 4YJHA 3FUWA 5KSPA 4DLNA 2I2XB 3ZWYA 1VKRA 1O08A 2CUNA 1T1GA 3AFNA 1XA0A 4BMCA 1U1CA 5ECDA 3BXGA 2M1ZA 3NQ41 5LCXA 3IUNA 3W8EA 1HDYA 3NBYC 4CWAA 4O8CA 1NKVA 2BFEA 1GTJ1 3RC9A 2VAWA 3JRNA 4R9SA 2A88A 2AH5A 2NVWA 4OQMA 3FNBA 1Q11A 3PNYA 4J0DA 3JQQA 2J87A 2ZWVA 4LV5B 4O4JB 3ZU2A 5H4HA 4IDFA 1CC1S 4ZT2A 1M1ZA 1K66A 2NADA 3UUEA 2ZETA 4DMHA 3WE7A 2X58A 4LXQA 4PZEA 2G5GX 4YPFA 5ICEA 4PQFA 2FKAA 2I5PO 1JIIA 5KSOA 4IWNA 1SXJB 2GBGA 5I9SA 1QHEA 1TKAA 5T6BA 4EKYA 4L51A 4OU4A 1Z6GA 2NVUB 1N6KA 2OGTA 3X2FA 1SC3A 1Y8RA 2A0YA 3GT0A 3AO0B 3HDVA 4C7XA 5DNCA 2VXCA 3LQ2A 4MB6A 3WX0A 4X92A 3QW4B 3H04A 2Y68A 3RKUA 3WYBA 3WLLA 1JEYA 3SKYA 4DZTA 1E94E 1D1PA 1Y5IA 2YICA 4D8VA 1WU8A 1QG4A 1MOPA 3PNMA 3TXAA 2G17A 1DQSA 3H4MA 3ZI7A 1CTQA 1ULBA 4AKGA 4P31A 5KX5F 5D1HA 4F4CA 3CO5A 4E7PA 4WFKA 4QPZA 5DH9A 1BVRA 4ACAA 2O8FA 3CEMA 1FDRA 4GI3A 4B83A 1RZRD 1BA3A 1RKBA 3F71A 2O4CA 4N7RA 2QVZX 3B82A 5TQJA 2EX4A 1XMSA 3WBJA 2GF0A 4YMTA 1G5FA 2ZRMA 2ZYIA 3E48A 2ZR9A 4CMCA 3JQRA 5KOJA 1PL7A 2OBBA 5D8DA 2PPVA 3AEZA 1KNXA 4HO1X 4HN4B 2DBZA 1LQ2A 3QVXA 1Z47A 3RVJA 1R0BA 3L2OB 5K4HA 1UBRS 3OM1A 4PLGA 2IUSA 1KEVA 4PG5A 1V5IA 4Q34A 2IIVA 4DJDC 1YZ3A 2G67A 4MGZR 4MULA 3SBEA 3GPIA 4BBJA 4J0CA 5GIPE 3I30X 4IVRA 3IDAA 3PITA 2BHRA 4Q4CA 1QPZA 2QGNA 4V0RA 5ENVA 2Z5FA 1JMYA 3L7NA 2CC2A 2XB8A 3QHAA 1VMEA 2EF0A 2M1XA 3EXHC 1WBDA 3QVTA 3LBNA 3T41A 4WBNA 3R6TA 5AXAA 1OAOC 1OLUA 5CM8B 1OZHA 1AHIA 4GXRA 4OJQA 4ZAVA 2D7DA 4M0FA 1SBCA 2YCLA 5FWDA 5FNVF 3SR4A 3SY8A 2D59A 5B3KA 4HNTA 5JFGA 1WDTA 4OG2A 4RHEA 4FYIA 5DSXA 1N57A 1S8AA 2A9PA 3BGIA 3M70A 4YCSA 4FI3C 2B4TO 2XD9A 2FYTA 2JK0A 3DT9A 4XQGA 4MINA 3BHMA 3ZTYA 3A04A 4CFZA 1KIFA 5G0UA 1Q5PA 2I4OA 2G72A 2H2FA 2ZJYA 1G2OA 2PVSA 1O5TA 3KJIA 4DAEA 4YI3A 1MB9A 4E09A 4XWKA 2WM8A 3L7OA 1UQUA 4MYHA 3RREA 1S2LA 4KBGA 4PYNA 4J49A 5CYOA 5FPTA 4IUBS 1I1HA 5IBRA 3WLMA 2F8SA 3IBCA 1YZNA 1MO5A 4I4TA 3GDFA 5IH3A 3D8BA 3R4VA 4BCDA 2AOTA 3B13B 2L2QA 4ZN6A 3NT2A 4KQ6A 2AXNA 4BJ3A 4WZBB 1EHCA 4IGEA 5LR6A 1GV0A 1CJUC 1JDBB 1QFYA 3O4HA 4NONA 3QLEA 4P35A 5J4HA 5F3DA 5JQGA 3DXYA 4O5AA 2K6GA 3MFQA 2ST1A 3K71B 3H9UA 5DI3A 2Q27A 2HHHB 1X9IA 5JJCA 4QC2A 2WQ6A 3ZZTA 2O50A 3FSEA 3KELA 1FRFS 1U4NA 2ZSEA 5KVQA 1ZI6A 2WV7A 4XTCS 5G4LA 5ECGC 1IHPA 4MK4A 5A9RA 1SKYE 5BSFA 3H2HA 3GMSA 5HS4A 5T41A 1IZZA 2FSPA 4G1UC 1BEEA 3S2IA 4B7UA 4EWLA 1ZA1A 2VT3A 3MERA 5GWXA 1BJKA 1EVIA 1W52X 2Q6TA 1EINA 1X80A 5EXXA 1U9ZA 2E4VA 4R4JA 2R1TB 3A1VA 4LTNA 2A7QA 4IRUB 2R3SA 5HTKA 2YZKA 4LF4B 3L41A 4J4HA 2W6PA 1QVVA 4PTZA 2AHOA 3KFXA 3ICVA 4NJOA 3CNEA 1Y8CA 2AF3C 3ZE8A 3C5WP 5AVWA 1KZ9A 2UVPA 1LJ8A 4IKEA 4IS3A 3LQ1A 4TTSA 1MNQA 2XRMA 1DZIA 3WYCA 2P4QA 1ULZA 1K27A 3WA7A 1XEXA 3KBBA 3V4RA 4WN9A 4OK5A 4XRRA 5C8VA 1HQKA 1TO1E 1WXQA 3EHEA 3MELA 5EIXA 1WXXA 1GDTA 4IHJF 4L2IB 1ZK1A 1JEJA 2Q2WA 2RK4A 1X1AA 3KB8A 1M0TA 3I2GA 3UICA 5BW5A 3HCRA 1IDN1 3MTQA 1SKAA 2GO7A 4NJEA 1PS9A 2CGEA 3OIFA 5AIAA 4GP9A 1E6EA 4ZI7A 3UY4A 1Y4AE 3K8QA 3THWA 4MVJD 1GA4A 4M60A 4DXAA 5K0LA 1MMFB 3AKEA 1BWPA 1MGPA 1N92A 3OFSA 1BXGB 1E3EA 2QKYA 2TECE 4LTDA 1P1RA 4OCZA 1IPEA 2PSJA 1NJFA 1J90A 4I9HA 1YRAA 3SHWA 1C7EA 3AR6A 3GJXC 5K6AC 2E1PA 2QG4A 4H0NA 4IQ8A 4W1RA 3ZY5A 1RACA 2QV7A 3BX1A 4FFSA 5DHRA 5K45A 4AY4A 4K5QA 2YYAA 5E8RA 2VJPA 3Q9SA 5CXXA 4M1ZA 4P7BA 1ZN9A 4FUQA 1FTQA 3A4YA 4QA9A 5TT1A 1EGVB 3VFDA 5ITVA 1PR2A 3FDJA 1JLHA 4ER6A 1OV4A 2BGLA 4LOAA 3ZDDA 2CN1A 4ZA2A 2PFGA 4Q48A 3RYFB 5J4LA 3DQPA 1A5BB 4QDKA 2NUAA 1A27A 3ORQA 3INRA 2Q7XA 1CR0A 2XVXA 2F3RA 3H87A 3M0EA 4CEHA 2BL4A 1UDXA 4M3NA 3WWDA 5C18A 5FV4A 1NJ6A 2DPYA 2YHIA 4I50F 5IXYA 4W7IA 5LN1A 2R6CA 3LTEA 1P0QA 3PF8A 2REQB 4KGDA 4C89A 4H6WA 3L9XA 5BV2P 3E81A 1DTSA 1P2BA 3AHEA 5IZCC 3ZBQA 4ZQEA 4KLZA 3ZZ0A 2EZ4A 4GQBA 3I5MA 3BCHA 4JS0A 1K2WA 3H7AA 2XDAA 3W6OA 2HK6A 3F5FA 3MLBA 3MRVA 4WCFC 4JI2B 3WQQA 4G4SO 1UOPA 2FQQA 3LIPA 5DGTA 5BN3A 3V46A 2VWPA 3QKTA 3UF0A 4ERNA 2A86A