1UJMA

Crystal structure of aldehyde reductase 2 from sporobolomyces salmonicolor aku4429
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
342
structure length
342
Chain Sequence
AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDMLKQGAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldehyde reductase II
publication title Crystal structure of aldehyde reductase 2 from Sporobolomyces salmonicolor AKU4429 at 2.0 A resolution
rcsb
source organism Sporidiobolus salmonicolor
total genus 116
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ujmA01
1GTMA 3BHIA 3PJEA 1YOVB 1T2FA 4XIJA 1BWSA 1MFPA 3R6DA 5CHEA 5JC1A 1ZIDA 4HV4A 4G2NA 4L4RA 4XQEA 2ZTMA 2AA3A 4A26A 3KB6A 1UZLA 2O48X 4IJKA 4KP7A 5GY7A 2XF8A 5T64A 3ZNPA 3IJPA 3V2UA 3ITDA 2W2KB 5IZCA 2VOEA 2VWGA 5IDYA 4EEXA 4FFOA 2WM3A 1LSJA 4GSLA 3ZV4A 2CUKA 2E49A 4DPLA 4ND2A 4CODB 1NPTO 1Y8RB 4ALIA 2B5WA 1DB3A 1ZH8A 3DBRA 4E6PA 1ZSVA 3G1UA 2PKQO 2DTXA 1CQIA 3K2EA 2QRJA 5JAIA 2GDZA 2QW8A 3E82A 1F17A 3UXYA 4OQYA 2W4QA 4ALNA 5HM8A 3R0IA 1ENOA 4GMFA 3V1TC 3DXFA 4K6CA 3TZHA 2ZYDA 4DPMA 3IKTA 3COSA 5ENVA 3TDKA 1P45A 4J0FA 1ZFNA 1BDBA 4YWJA 1HRDA 1KVUA 1W0CA 5HWSA 3I83A 3LT0A 4MVJP 3TNLA 1KEWA 2VHVA 2C07A 4GVXA 3VDQA 2D5CA 3C1TA 4PZDA 2X5KO 1ID1A 4W7IA 4XB1A 3MWDB 4YRBA 1JVBA 2YUTA 2GNAA 4XDZA 2Q2WA 2IRWA 3H4VA 4B3IA 2IEDA 2FR8A 2ZIZA 2CVZA 4B7XA 4WGGA 2I6TA 3G1TA 3MWEB 5ES3A 1AE1A 4YJFA 3BXXA 4R3WA 1K3TA 2EWMA 2GUGA 3T7EA 4IDEA 3INGA 2UAGA 5COQA 5JY6A 3BYZA 4XD2A 5A3VA 2VWQA 3D4PA 4U7WA 3CKYA 4D79A 2BFMA 3HDYA 2H63A 2DBQA 2RBEA 1NX6A 2X9VA 3U4DA 4W7HA 9LDBA 3EHEA 1E92A 3GY0A 3EAGA 1ZJZA 2X23A 3QLJA 4S1VA 1R4MA 1U9JA 2R00C 2IXBA 3TN7A 2FWMX 5I9LA 1W6UA 1Q1NA 1Z6ZA 2I67A 3P19A 4BNGA 3F5SA 3TQHA 3ZWPA 4I8XA 1I2CA 1EVIA 5TF4A 2ZQYA 4KMSA 3LYLA 5GZ6A 4AJNA 3IUPA 1BVUA 3NEPX 4DIFA 2ZJ1A 4H7PA 3LZ6A 2FHSA 4FSHA 5CEJA 1CYDA 3JQGA 2QHXA 5EQFA 4FBGA 3L9XA 2OP0A 3BMNA 1TT5A 3WGHA 1O94A 4BMNA 4O0LA 2EKPA 5B4UA 3JD3A 3Q2IA 5T8KA 5U4QA 4MP6A 3TZQA 5L51A 5T67A 2GN4A 3H2ZA 3DBVO 1PL8A 3RFVA 1IYZA 4ZRNA 4R41A 2PTGA 2J8ZA 2BFAA 3LDHA 2D3TA 2HK7A 1DIRA 3CUKA 1X0VA 4HADA 5A5EA 5KVCA 3LT1A 1HXHA 5K6AA 3ZNOA 4RJTA 4CR6A 2H1SA 1Y5MA 2HU2A 3GDFA 3GEGA 3OEWA 1HDYA 3KSDO 3GDGA 2G5CA 2VZ9A 4CM5A 2I76A 1OOEA 5FI3A 3DR3A 3MTGA 2XPCA 3MZ0A 4RVUA 3U4HA 5KVSA 5JW6A 3GZNB 1P77A 1PU2A 2J5RA 1AHIA 3DBRB 4J7CA 3GGPA 4JROA 4PRKA 4YACA 3PZBA 3RU9A 1H93A 4B8ZA 2OORA 3E03A 5JSFA 3KOUA 1HYEA 4GBJA 1ZSNA 4NFSA 2IDZA 2JCYA 3UW3A 3JD1A 2Q45A 3FNEA 5GZ1A 3TZKA 4BO1A 1OC2A 1EUDA 1DHTA 1B7GO 4YYZA 1SPXA 2FMUA 3A4VA 3MOGA 5JDIA 3V8BA 3QW2A 3HE3A 4MIEA 3FBGA 4CQMD 4URFA 4MIYA 4LN1A 3WYCA 1N2SA 4I1IA 4R16A 1UDBA 2V6GA 1NPDA 4E5PA 1S7CA 3LVFO 1UJMA 3CZRA 1U4SA 2PV7A 4RGBA 5KJFA 1YO6A 4BV8A 1E7WA 1ONNA 2HMVA 3FTPA 3OICA 4D42A 1O89A 3K5PA 4QUKA 1L7EA 2C0CA 3AU8A 5EJ2A 4QT0A 4D0SA 1U3WA 4IPTA 1LDEA 2PGDA 3CXRA 1PJSA 2CVQA 3GUYA 4U8GA 2AQHA 3JD2A 4XQCA 4P8RA 2Y93A 3VH3A 1NQAO 3ZHBA 4DIBA 3SEFA 1VSVA 4M8SA 4MVJE 1EEHA 5ITVA 4P38A 2GD1O 1R4MB 1WMAA 1Y81A 3WNVA 3X2FA 1EFLA 4GSKA 2O3QA 4PGFA 3H5NA 4K6FA 4QX6A 3EMKA 4K28A 2GZ2A 3AU9A 3KLMX 1I5RA 2Y1OA 4HWKA 1WMBA 3JYLA 5BSFA 1P44A 3U3XA 3WGGA 3PIDA 3VZPA 4E31A 3ICPA 4GX5A 3KXDA 4BGVA 3D4NA 1FDVA 1ZSYA 2P9CA 5EN4A 2I65A 1YL7A 3JQGB 2F00A 4AJ2A 4EJMA 1H9BA 2YJZA 2ZB8A 2O7SA 1M76A 1YL6A 5L7TA 1GY8A 3OBBA 2P4QA 1D8AA 3BMQA 3OJOA 1EE9A 4EJ0A 1I33A 1Y9EA 4CM6A 3JYOA 3M6IA 4OOFA 3QVSA 5ICMA 1MXFA 4YJGA 3KYDA 4FFMA 3DEYX 4FW8A 3VDRA 3WQRA 3ASUA 4M55A 4Y9DA 4CUJA 1DIAA 5CG1A 1LSSA 4YAEA 2IEBA 2YV1A 1JAXA 3R3JA 4CJXA 2NV6A 1LSOA 2WEKA 2FPPA 3L6EA 4WLFA 3UN1A 2PD4A 1VRWA 3PLRA 4BNTA 1PL7A 2IYOA 4EZBA 4F46A 1QYVA 1NWCA 1BG6A 4GGPA 5TC4A 4CV3A 4GX1A 1R37A 2HUNA 4TRJA 2O7QA 3KETA 1RYEA 3JQ6A 4W99A 4UULA 1D1TA 2WMDA 3DO5A 1EDOA 4IM7A 4II2A 1JA9A 1DIGA 1OMOA 1UUFA 3RC2A 5HRUA 1BW9A 2O3JA 1UAYA 2AG8A 2NU7A 1YDEA 5ER6A 2DUWA 4UVHA 1JKJA 2E82A 1R0LA 3SVTA 1Y6JA 3OA2A 3QA9A 3QHAA 5AOVA 1Z82A 1HE4A 4B3JA 3GGOA 4BNVA 4G81A 3PJFA 4IQ8A 4YAIA 3STHA 3AM3A 1LUAA 4R1TA 4Z9YA 3UAGA 1Y5RA 4ALLA 3GGGA 1N9GA 1H5QA 1T2EA 2EGHA 4ZQEA 3GNQA 1AN9A 3V1UA 4Q3EA 4S3MA 2NM0A 2WWRA 2ZATA 4JBGA 4J49A 1FDTA 5F1OA 2GN8A 4DA9A 2WYUA 4BNXA 1E1LA 2NU9A 4WOKA 2JJYA 4ESOA 3DAPA 1HDOA 4Q3DA 2WYWA 1HSOA 3G49A 4HFMA 5THKA 4MVJF 3ROQA 3B1FA 5CPFA 5C37A 1DRWA 4IXTA 1SOWA 4WUVA 3GMSA 3GH3A 5I7VA 5IZCC 3TJRA 2J5QA 1ISFA 1E3IA 3INRA 3LQFA 3OMLA 5KKCA 4RZIA 1P1FA 5ADHA 1BSVA 1GPDG 1HE2A 4EYEA 3PFFA 3DQPA 1XCBA 1YBMA 4JLWA 5U1PA 4LVCA 2BFPA 3RKRA 3DMTA 1V35A 1NBOA 1B0AA 3ZWOA 1ULUA 4IJUA 4GKVA 4RF2A 3ZWBA 1GPJA 2DC1A 5H81A 3R3SA 3F47A 3FSRA 3SXPA 2DUUA 3FCOA 4RF3A 2CF5A 3JQ8A 2DPGA 5DCWA 4GGOA 3C1OA 3WQQA 2QIOA 3OQBA 5TLSA 1LEHA 1DLJA 2JD0A 3BMQB 4HNGA 2E48A 3KO8A 4OKIA 4OXKA 5JYEA 4R69A 2IZ0A 3LU1A 1E3JA 4YJGB 1ZKMA 2C82A 3VTFA 3ITKA 1XKQA 2IZZA 1E7QA 3NRCA 3QWAA 1SEPA 1C0PA 2R00A 3MJTA 2ZYGA 3GHHA 2OOSA 4BS9A 3RBXA 1ZBQA 2DVMA 1B26A 1PGQA 1TB4A 3GZ4A 4JQCA 2X22A 2AMFA 1DJNA 2BFOA 4DBZA 4D44A 3W6ZA 2DM6A 4A03A 3PHGA 4Y67A 5JY1A 1UZMA 1VL6A 2POQX 3FF4A 1PEDA 5COAA 4R68A 1HEUA 3L07A 4W82A 3NUGA 5DBIA 3ZHXA 3QE3A 2V6MA 4CV1A 1BW9B 5I7FA 3JD4A 3ZV3A 1NPYA 1ZXBA 3QVWA 3F5QA 4CMBA 1H94A 3ETGA 3VH2A 1D7OA 1SNYA 3HN7A 1PZFA 3HFSA 1NVGA 1SOVA 3D5TA 4FPXA 4WCFA 1X1EA 4ZD6A 3BHJA 5IAAA 3LT2A 3RBVA 4A0SA 4ZJUA 3WGTA 2GN6A 3OF2A 1Q7CA 1U5AA 2P68A 1DAOA 2DBZA 2EP7A 2VT3A 4XWYA 2QX7A 1ORRA 4CLOA 2F1KA 4N5NA 1A27A 1ZW1A 4Q3NA 2PWZA 5C7IO 4IQ0A 5T8KC 3VH4A 4Y98A 4YJHA 4BNWA 3IDSA 1DAPA 1KVTA 5JBIA 3PJDA 4E32A 5IZ4A 4J4BA 4MKRA 1LSUA 2Z95A 3DFUA 4BKRA 3VAZA 5K6AC 1JKIA 1T4BA 3GDOA 3G3EA 3MEQA 1LQUA 1H6AA 1LNQA 3GPDG 2V6BA 4XZ3A 3BTOA 3QQPA 4R9RA 1QORA 3GVXA 1GEGA 3GR6A 4CMCA 4XCVA 4IBOA 1H6BA 4Q9NA 3C7DB 3U62A 3RUIA 3ULKA 3MCVA 4B4WA 5A9SA 4ZGWA 3OEYA 5AXBA 4NFYA 3KV3O 1J6UA 4JIGA 4MDHA 5TSDA 4XA8A 1E7YA 2BRUA 2CDAA 4BNYA 4JP2A 4NNJA 1A7AA 1WDMA 1UP4A 3PHIA 5DT9A 2HQ1A 2ZK7A 3ZW9A 4KTTE 4B7UA 3ZH2A 4ALMA 4I5FA 3PLNA 4FFRA 1YJ8A 3WBBA 1U4OA 2C7GA 4B4OA 2RH4A 2ZTUA 4Z9FA 3PYMA 4XB2A 3SC4A 3VZSA 5I7EA 3ON5A 5JDIC 3ZCXA 4A27A 1I01A 1JKFA 1GUZA 4GPD1 5CP8A 3CEAA 4YXFA 4JXKA 1LDBA 1XDWA 4CLEA 3DTTA 1QKIA 4ND1A 4NG5A 2DBVO 2J3KA 1LDNA 1PZEA 3PFWO 1ZXLA 3WDSA 1WDLA 2OL4A 4KUEA 4YQZA 3M1AA 4R5HA 2NVUA 1G0OA 4W6ZA 4AJKA 1TA4A 4E4YA 4BO6A 2G17A 1ZCJA 2Y66A 4JP3A 9LDTA 3I9MA 5BNFA 4IJWA 4J43A 4DPKA 4UEOA 3UGKA 3H9UA 5EINA 2HRBA 1LRJA 4RORA 1DDOA 3M1LA 3EVTA 1ENYA 4BO0A 4M86A 3DL2A 4HP8A 1A9YA 3WOHA 4MO2A 1M6WA 1X13A 1BXZA 1SBYA 3KLPX 3ZWXA 3F46A 4MJLA 5BSGA 3E5RA 4HKTA 1ZMTA 1D4FA 1PJ2A 2RAFA 4PLTA 1UR5A 4MVJG 3H9GA 1E3WB 3G17A 3RWBA 1MC4A 3WGOA 4PLCA 2VQ3A 2CMDA 3H6KA 4IGEA 3PJGA 4Y6PA 1GYQA 3K92A 1XR3A 5JMWA 1ARZA 5G0WA 2B5VA 1SB8A 2Q49A 2B4TO 4IMRA 4XR4A 2B36A 3PP8A 3SC6A 4FJ2A 1LTHR 1N92A 3OECA 3WGIA 5JDCA 2PR2A 5EL0A 4EUHA 5U9CA 4ZVVA 2D0IA 1DJQA 4O5OA 3TWOA 3HB5X 2VNAA 3L4SO 2OXIA 2Q2VA 4R54A 3CPSA 4ZQGA 3NAQA 1U2GA 2FR1A 4YJHB 1UDAA 2OO5A 3I3OA 4MIOA 1F14A 4NJOA 5JXWA 2A35A 3FRJA 3IAHA 4BKUA 2ZKLA 4BB5A 1GQYA 1W73A 5T6BA 2G76A 4RF4A 1L1FA 2SCUA 4CUZA 4QSMA 3FR8A 1VE9A 3KYCB 3LSYA 3ZU4A 4HXYA 1WZIA 2HLPA 1IB6A 3SLGA 4NMHA 4FFLA 1MB4A 1N1EA 2Q46A 3JQEA 4LSWA 4IIVA 3I4CA 3Q2KA 2QYSA 1SCUA 3DZFA 3UCXA 3Q3CA 3DZGA 4JN6B 1RKXA 3NDRA 1GAEO 2JAPA 1LLCA 3CZMA 3MJ4A 1RM4A 3HUDA 2FSVA 4OSOA 3LLVA 3OP4A 1P0CA 1E3SA 2NNLD 1ZVMA 3AUTA 1PR9A 4KQXA 1GQQA 4BKPA 1YQDA 1EDZA 2GN9A 3L6OO 1T24A 2QZ9A 1ZJYA 4AJOA 1B8VA 4L76A 4II3A 2V65A 3K30A 4RLHA 3VVBA 1XHLA 2DLDA 5MGBA 1K5HA 1MP0A 1YBVA 1CIVA 3ZWCA 3GOHA 3DZIA 1A71A 3PXXA 2X0NA 3JQFC 5G4KA 4BGEA 1U2DA 3ORFA 1T2DA 3HDJA 2RIRA 4ZA2A 4MKZA 1MUUA 4PCVA 3OSUA 4YA6A 5CFZA 1JQBA 1HDZA 3EK2A 2NVUB 1F8FA 2XOXA 1XU9A 2O4CA 3BA1A 4GX0A 4PVCA 1CF2O 5FF9A 1G6KA 4RV9A 5CDTA 4TRNA 4Y6RA 3U4CA 4MINA 5F5NA 1I32A 1JTVA 1UH5A 1AXGA 3WBFA 2PD3A 5B4VA 4Z0HO 4M1QA 1U28A 4WLOA 1DC3A 3LC1O 2FPIA 4YVFA 3UFXA 4YT4A 4P4NA 4NFHA 3ROPA 1L7DA 4H15A 4D0RA 4DC0A 3A1NA 1J5PA 1JLLA 3FPCA 2CVOA 5BT9A 3BMOB 3DMTC 3FN4A 4PN3A 3MJVA 2A92A 2TMGA 3WGZA 4BOYA 5EESA 4H16A 1HL3A 2UUOA 3E48A 3GC6A 5JO9A 3ONFA 1E77A 2NTJA 1R4NA 4CLDA 3AY3A 3DC2A 4J2OA 3QVOA 4KOAA 4BNIA 4GL4A 3ZI0A 4IGFA 2I9PA 2PKQP 3A06A 3Q6IA 4KWHA 1FF9A 5KJ6A 2C59A 3KUXA 2C20A 3VPHA 1DPGA 3WNQA 1RPNA 1H9AA 3IL2A 4UVGA 2C2XA 1D1SA 1BRMA 1BXKA 1QYWA 4DMLA 4RLSA 4D45A 4RCVA 3K96A 2PLAA 4O59O 4XGIA 1ZK4A 2PGJA 1R16A 4DLBA 3PQFA 3EGOA 3WGQA 4CUKA 1R0KA 5BNTA 1GR0A 1ONPA 5DZSA 4KTVE 1XIVA 3PYLA 1GZ3A 1WLYA 2EIHA 3UF0A 1X7GA 1CJCA 5I9NA 1HDGO 3EUWA 3DTYA 3D4OA 4NK5A 3IKVA 4DIOA 2EW2A 4XGNA 2PY6A 3IC5A 5DOVA 1EE2A 1V0JA 2AE1A 2Q1UA 1ZUD1 2UYYA 2X7HA 3GLQA 5L53A 2ZB7A 3AJRA 2D59A 4DUPA 3QV1A 4BV9A 1ULSA 1WNTA 3I23A 4EBFA 1E3EA 4NIMA 3GK3A 3QSGA 3NX4A 4Y8VA 2VTDA 4CMAA 4J7UA 2FY8A 2ZB4A 1PZGA 3H5RA 4WCFC 1IPFA 2VUTA 3PHHA 1GD1O 2DFDA 1UZNA 3UKOA 4BO5A 3L4BA 3NTOA 2VYNA 2EERA 4AJ4A 1ZZEA 2VT2A 4FC7A 1LC3A 3DZHA 1XQ6A 5G4KB 5KJ1A 1YDWA 3K6JA 1P74A 1ADCA 4NI5A 1X7DA 4D41A 2GCGA 2DFVA 1LLDA 1YB5A 3L6DA 3O8QA 2PZMA 2NADA 4BMSA 3FWNA 4BO4A 4RVHA 1HYGA 4BNJA 4PZCA 2OHXA 4OMUA 4XYEA 3WG9A 2X0RA 5ILGA 3OJ0A 3PEFA 1PS9A 4D46A 1GU7A 3HHPA 1AHHA 7ADHA 4RVFA 1WZEA 1I3LA 1HE3A 3GA0A 1EBUA 3U49A 4L4SA 2E6UX 3U0BA 1C14A 5FYDA 4XX0A 2YY7A 1NM5A 4CMKA 2WJPA 1LLUA 1U8XX 4EJ6A 3CIFA 3HDHA 1TLTA 5DP1A 3KRTA 3ZWWA 5A02A 5IN4A 3S55A 2A4KA 1VKOA 3DZJA 4J2HA 2GPTA 3ANMA 4TRMA 2VZ8A 3GVHA 4WKGA 3JYNA 2GYYA 5HBRA 2YDXA 3RUFA 4CR7A 2ZJ0A 4KZPA 2Y1DA 1NVMB 3HADA 2AEFA 4WLEA 4D7AA 4UUPA 2Y1CA 3NYWA 3ZWYA 4E30A 4BQPA 1R4NB 5HS6A 1DC4A 1KERA 4YJFB 1O95A 4WLUA 4CPDA 1OZAA 3GAZA 2XXJA 4BNMA 3B20A 2IODA 4J90A 3TZCA 4FS3A 4BMVA 1SO8A 1Z45A 2G82A 5BR7A 5GMOA 5JCXA 1Z7BA 2IE0A 4KWIA 3RC7A 4EGFA 3MJCA 1P1KA 2NQ8A 2C54A 1TVEA 2YFHA 5JNLA 3UCEA 4A73A 1OAAA 1ZK3A 1XWFA 4FIZA 4BO3A 3K9QO 1I3MA 1E7SA 4FGWA 1BHSA 2Q1WA 4K26A 3KEQA 5DCUA 4ZICA 1YJQA 1EUCA 3B6ZA 4M89A 1XSEA 3Q9NA 2AQKA 2NSDA 1F8GA 3QWFA 4Z0TA 3JQ7A 3RUEA 3AW9A 1MX3A 2H6EA 4ITUA 5L4SA 5JMPA 1GZ4A 1RM0A 3JQ9A 3BMNB 4RPHA 1IHXA 1TT5B 3JQCA 3WJAA 3PHLA 1NFFA 3I5MA 4IQGA 1Z75A 2J3HA 4OL9A 2YV3A 3KHUA 1JAYA 4FJ1A 1PGOA 5KJEA 3S2EA 4TKMA 3EDMA 4YB8A 4F3YA 1PJBA 4RF5A 3ICCA 1D3AA 4Y6SA 5JDCC 3RBZA 3EVNA 3OJEA 1XA0A 2PH3A 1GUYA 1H6DA 1B8PA 3RU7A 3WMXA 1FDWA 4C7JA 1K89A 4INAA 5CEFA 1WWKA 4HFRA 1DC5A 1HDCA 2WD7A 1E6EA 4J6FA 5DDIP 4YT2A 4Z6KA 2PZKA 3VZRA 2G0TA 4L9RA 1H0KA 1XLTA 2VCYA 3GAFA 2C5AA 1B3BA 2VRBA 4MOWA 4YTEA 5F21A 3F4BA 1CWUA 3OFSA 5T57A 3OQ1A 1MG0A 1T2AA 3DAFA 3AUAA 4AJHA 4NK4A 4XQGA 4PLFA 2WD8A 3GUCA 2B35A 5A06A 2HK8A 3CSDA 4E12A 4UUMA 1X7HA 4GQAA 5JC8A 1RYDA 4I9NA 1M6HA 2EF1A 4Z9XA 1SZJG 1ZEMA 1I2ZA 3EZYA 3RUDA 1KY4A 2GF2A 4BNHA 4YPOA 3M2TA 3NDJA 4WECA 2EXXA 4B4UA 3Q9UA 4KUHA 4NBRA 1C0KA 4ND5A 4RDHA 5LC1A 4P4GA 3W1VA 1QRRA 5CEEA 4YJDA 3HDQA 4J1SA 1LC0A 4OHUA 4O63O 3V2HA 2BD0A 1LJ8A 4LCJA 4MPDA 3AUSA 4Q3CA 2EW8A 3JQFA 4TRRA 5B37A 4XRGA 2W2LD 3NDIA 1HDRA 1IZ9A 1N5DA 2WE8A 2I99A 2X6TA 3OJFA 1P1RA 1ML3A 5EERA 5T5QA 2X1HA 3TOXA 3JYPA 3ZWAA 4LMRA 3NGXA 3R1IA 5G2OA 1VL8A 1X1TA 1ENZA 2ZCUA 1IL0A 1A4UA 1R12A 3B1JA 4LMPA 2HK9A 5JYDA 1QMGA 2O4UX 4JBIA 1NFQA 5H83A 3C7CB 2EP5A 4JNKA 5KKAA 3GMDA 2GO1A 4RO0A 1KOLA 4ALJA 1LX6A 5L95A 1KEUA 2DQ4A 3G79A 5CAEA 1T2CA 3I9OA 5JFOA 4N7RA 5L3ZA 5JS6A 3JQDA 3DBHA 3OH8A 1K0UA 1SMKA 1JWAB 4DRYA 4E13A 1ZMOA 1GYRA 3QWIA 1Z74A 2HDHA 4YT8A 3EW7A 3DDNA 4J1QA 3GRPA 4NBWA 1G1AA 5CDYA 1I30A 2B69A 3JQ7B 5DN9A 1XG5A 2NTNA 1Y7TA 2EKQA 4NBTA 4HNHA 3JSAA 2JFFA 1CEQA 4IMPA 1NNUA 2EGGA 4ILKA 5L40A 5IFLA 2Q99A 1LU9A 3ABIA 4CM9D 4R3NA 2FOIA 4MVJI 4E5MA 1C1XA 4LW8A 3TL2A 3EY4A 3I52A 3OM9A 2BKAA 1J4AA 3AFNA 4N5MA 4RVGA 4PG4A 3IIEA 4J91A 3N74A 1RM3A 3FD8A 3KYDB 1P1IA 3ANNA 5TT0A 2JD1A 1YQGA 4OIMA 4YAJA 1XYGA 1UP6A 1UXKA 2C29D 2YHUA 3K31A 4RVDA 3HQ4O 4BNZA 3H3JA 1I2BA 2HMWA 2V7PA 2YQ4A 2CY0A 2D5AA 4PLGA 4WLNA 3GVPA 5AXAA 3UOGA 4R5MA 4CQLA 5I8WA 3WFJA 2GRAA 1E6UA 3I1JA 4I08A 3P7MA 2QRLA 4BL5A 3VPXA 3S2FA 1ISMA 4MVJM 1O5IA 4QECA 1GUFA 4R1UA 5A4DA 1QYCA 4PLYA 2VZ0A 1DLIA 3F3SA 4X54A 1AGNA 4PVDA 4DYDA 1XELA 2J3IA 4QFCA 3RCBA 4J0EA 4XYGA 1PJQA 3V1YA 4A5OA 2P9EA 1N1GA 1ZK1A 4HFJA 1YKFA 1GADO 5KWEA 4DXHA 5G0TA 5FWNA 1PZHA 1N9GB 1RWBA 4R01A 4JGBA 5I7SA 1Y1PA 3D3WA 4PRLA 4NHEA 2PZJA 2GSDA 3DWFA 4OXYA 2VTEA 3DONA 1YBAA 3L4BC 4D3FA 3FR7A 4UVIA 4MVJD 1QYXA 1I8TA 1A7KA 1NQ5A 4J16A 3S2GA 3SJ7A 3LC7O 3QY9A 1TI7A 3PHJA 1A72A 1DOHA 3EYWA 3ZHZA 3WB9A 2BI8A 1R0SA 2Y1EA 3I4FA 5DOZA 1EVJA 2EKLA 1NR7A 3C85A 4GMGA 2Y1FA 3WFIA 5LDGA 1JN0A 2DPHA 4GH5A 1K6IA 4BQRA 6ADHA 2GR9A 1P31A 5DCYA 3D64A 4ZQBA 3DBHB 1KIFA 4XEHA 4CQMA 4L0QA 2Y99A 2OFPA 3VVCA 1ZK0A 3GT0A 1V8BA 2P5UA 1IHYA 4XJSA 4CM4A 1WW8A 1DFHA 3V5NA 1Q7GA 2FSSA 4IDFA 3NT4A 4WASA 5CG2A 4XKJA 3ZU5A 4K9DA 3AUUA 2OBYA 3NTRA 4N5LA 1CERA 4UEJA 4TVBA 4XR9A 5ILOA 3UUWA 1NP3A 3JQ8B 3DHYA 3ANLA 1K6XA 4UUOA 2JCVA 4BNKA 1C1XB 1VJ0A 4PLHA 4EUFA 1H2HA 1K6JA 1DO8A 3LC2O 2O3UA 1TXGA 1YXMA 4NJMA 3GN1A 4RZHA 3RUHA 1IZ0A 4UUNA 4NH4A 4HFNA 1EVYA 3FBTA 4YCAA 3AOGA 4FFPA 1Q2XA 1JW9B 3L77A 4IIUA 4PFJA 3AM5A 2HSDA 4IXWA 2PFGA 2W8ZA 3F4LA 4I5EA 1VLLA 2FP4A 2YZ7A 2UVDA 1RM5A 2OBNA 3GFBA 3FNHA 1F12A 5KOIA 2W2KA 3BMCA 2YW9A 3MJEA 4EDFA 3E18A 3U4IA 3W6UA 1U3UA 1PJCA 2O3RA 3KM0A 5L4LA 2HMSA 3IP1A 4CM7A 4HBGA 3AI2A 2OP1A 3W4JA 2AE2A 5TGDA 4WCFB 4W9NA 4LGVA 5IDWA 4HY3A 2Z1MA 3HFGA 1MLDA 3CE6A 1HT0A 1Q7BA 2O3TA 2PK3A 1LDMA 3WLEA 2AQIA 4QQRA 3PDUA 5TRTA 1J0XO 1JWBB 3JQ9C 4JK3A 4CLOB 4A2CA 3W8EA 3LT4A 3D3WB 1CRWG 4ZU3A 5L45A 1JU9A 2VNSA 4KDEA 1GL3A 1HSZA 4Q3AA 4PG8A 2J5KA 1B14A 3CMMA 4QEDA 1DSSG 4PLZA 2J6IA 1O0SA 3PYXA 2ZTVA 3RROA 4TVOA 4AICA 4BO9A 3GFGA 4BNNA 4UVDA 2Q2QA 4HX5A 4GVLA 4XJTA 2A94A 2YYYA 1YS4A 3A28A 4MP3A 2B83A 5DBFA 5F5LA 2E4AA 3WQSB 1WVGA 2TMDA 4AJIA 3GF4A 4MKXA 1E1NA 2FZWA 1PJ4A 2XXBA 5A9SB 3WR5A 1ZNQO 1AUPA 5JAQA 2VWHA 4CQMB 3ASVA 1LRLA 1OC4A 3PWSA 4CM4B 3FNGA 4F6CA 5C7LO 1FXSA 5BNIA 4LRTB 3HB4X 2AHRA 3PQEA 4AVYA 5DF1A 4FDAA 2NVBA 2DU8A 3LF2A 4B8WA 2RCYA 3T7CA 3H9QA 2Q3EA 1E0DA 1GDHA 5B1YA 4P22A 4QO7A 1IY8A 3DB2A 4NDNE 1X14A 2GERA 4QTZA 4RPGA 5IN5A 2YDYA 3HSKA 4GWKA 1IOLA 5B4TA 4F6LA 1F06A 1KC3A 4OO3A 2IZ1A 4NJMB 2PZLA 3NJ8A 1B15A 3IJRA 4MVJH 1Q0LA 1A4IA 1QLJA 1MV8A 2X9NA 3I6IA 4IINA 4ZQHA 3RQSA 3SLKA 2JKVA 1YWGO 4LK3A 4CV2A 1PX0A 4OQZA 3NT2A 3WWYA 4U0JA 4WPGA 3E9QA 3N7UA 3OQ6A 4FOOA 3U9LA 3WIEA 1ONOA 4BO7A 1E6WA 3RI3A 1SB9A 1UXJA 4OXNA 3W4IA 4CL3A 1DHRA 3X2EA 1LLQA 2CZCA 1LI4A 1A5ZA 1A9ZA 3MTJA 3O9ZA 1KVRA 4I9HA 4WNIA 4A7PA 5AQ1A 4ZQFA 1LDGA 3C8MA 3BMCB 4JCOA 4IDCA 2BLLA 4CM9A 3IP3A 4BUCA 1NYTA 3O26A 4BB6A 2E37A 1V3TA 3GZNA 3BZUA 4N54A 1PQPA 2YQ5A 1V6AA 2B4RO 1MA0A 3RUAA 4ZHSA 4YEDA 2PNFA 4BO8A 2FRDA 2GLXA 4XYBA 3DOJA 1QP8A 4J4TA 1N7GA 3W8DA 4EW6A 6LDHA 5TNXA 2WYVA 3KBOA 3PQDA 2C7VA 1VKNA 1FDUA 3P2OA 1WAMA 1YRLA 3CH6A 4U6QA 4E5KA 1IUKA 5L4NA 3RFTA 1PGNA 1Z7EA 2CNBA 3GN2A 4NU5A 1DFGA 4TZKA 5F1PA 5AVOA 3O38A 4CR8A 4IY1A 3UCFA 1WPQA 3PPIA 4J4HA 4QFDA 1JDJA 4PZEA 3PDJA 1HF3A 4PLWA 5THQA 4B79A 2R6JA 2BGLA 3WSVA 3ZN2A 1KY5A 4ID9A 4TROA 2B37A 2C5EA 3WICA 3AY6A 1T1RA 2GGSA 2Q1TA 5FFFA 3QVTA 4ND3A 4LCEA 4AJPA 1E5LA 2JD2A 2VOJA 1M2WA 1MFZA 2Z5LA 4IZHA 3VH1A 3PI7A 5C5IA 2GASA 2D8AA 4CMEA 1QV7A 1PS8A 3KTDA 3E8XA 1MGOA 3I6QA 1ISJA 1V9LA 1DC6A 2CF6A 3CMCO 5L9AA 1U5CA 3MJSA 3AM4A 4YRAA 1PQWA 3TOZA 4LRSB 3HJAA 1IULA 2NVWA 2V6FA 2CDBA 3H65A 3PTZA 4FJ0A 4IZIA 4JJIA 2X9GA 1ZEJA 4MVJA 1HLPA 2X5OA 2VHWA 3DOCA 3HNPA 5AYVA 5TX7A 3JQBC 3GVIA 4XQ9A 3RUCA 3VZQA 1EVZA 1PL6A 3ONEA 4ZN6A 1CDOA 2AW5A 3VPSA 5L7WA 4PG5A 4GI2A 1NVTA 3I9NA 1VC2A 4KQWA 4RQUA 4AJJA 2HO5A 3ZWMA 4L73A 3BTVA 4AFNA 3DHNA 1LRKA 1I10A 4RDIA 3DMYA 2ZTLA 3RIHA 2H5LA 1DEHA 4I5GA 2NQTA 1R15A 3HG7A 1QR6A 1EK5A 3E6AA 1EBFA 3WSWA 3PGXA 3BHMA 4UAGA 2HCTA 2ILTA 2Y1GA 5G0UA 1BMDA 3ZHYA 2Z1NA 2X58A 3EZLA 4B4VA 4ND4A 4CMIA 5JCJD 4P4LA 2EV9A 4MP8A 1GV1A 1E3LA 3ZGYA 1OI7A 1DXYA 1VPDA 4DBVO 4RPJA 5KNLA 3D7LA 3O03A 1C0LA 4PLVA 1U3TA 4W4TA 4YAKA 3DBLA 1U7TA 3E1KA 3ENNA 3GHYA 5EMHA 1FDSA 3RVDA 3ZDFA 4CLXA 3H2SA 2UV8A 4JBHA 1HTBA 4M87A 1KVSA 1V3VA 2O2YA 1HETA 5H82A 5F1KA 5C7OO 2GZ3A 4F45A 3PWKA 2HRZA 4BNLA 4G65A 3WMWA 1LBEA 1GCOA 4AG3A 1YB4A 4FN4A 3NT5A 3GEDA 3K2BA 4ONEA 4KUGA 3RASA 1YQXA 2QYTA 1JVSA 3NKLA 1NR1A 1VI2A 2VUSA 2HMUA 3AK4A 4L75A 3BTSA 4E2XA 2JCXA 3TSCA 4CM8A 5BSEA 2O2SA 1HE5A 1HYHA 5BQFA 4GLLA 1Y8QA 3Q1LA 5JO0A 2B0JA 3TPCA 4L8VA 3JQAD 2JHGA 4OH1A 3SBOA 3I9KA 1NASA 3A9WA 3ZNNA 1W8DA 4XYLA 1ADFA 3GPIA 3IQDB 5IXSA 3FWZA 3KSUA 4LISA 4EITA 2NUAA 4RPKA 5CPBA 3B70A 3PK0A 2WE7A 1ISIA 1NAIA 3E5MA 2PGLA 5HA5A 1VL0A 3ROKA 1WDKA 5ENDA 1U3VA 5JAZA 4OM8A 5L7YA 1W4ZA 2O3SA 2VHXA 1NHWA 2AQ8A 2FR0A 1NAHA 4M49A 2R2GA 3F1KA 3KEOA 5CDSA 4DMMA 5A9TA 1KS9A 1PQUA 4TZTA 4CM1A 1EMDA 3L9WA 3H9JA 5EIOA 2X5JO 3WS7A 5TJ9A 2P2SA 4JJGA 4U5QA 2BGMA 5K9ZA 4IS2A 2ZYAA 4W9NC 2VRCD 1UXIA 1XEAA 3U5TA 3RC9A 1YONA 3LK7A 1HWYA 1YGYA 4E21A 1Q0QA 3H7AA 4IDBA 4U6SA 2CSUA 1N7HA 1T26A 1E1MA 3AOEA 1EFKA 1GV0A 2Y05A 5LDHA 4J9UE 2OMEA 4E0BA 2QZZA 1C0IA 1M75A 3O8QB 4E2ZA 2JAHA 1HLDA 1KC1A 1QLHA 3A14A 5F3RA 5HTOA 2HJRA 4DVJA 2VHZA 3BAZA 2RH8A 1ISHA 1H2BA 4M54A 5LCXA 1K2WA 1EUZA 2DT5A 1O9BA 4BNFA 5DNAA 2QQ5A 4BHTA 4WOJA 1LXCA 1BGVA 5CDGA 1P33A 1NWHA 1PS0A 1DRVA 4XIYA 1E1KA 2QG4A 5A03A 2XAAA 3O4RA 2ET6A 2JL1A 4QO8A 4B3HA 4CMIB 4DGSA 3HZZA 4YT5A 1QXSA 4J7XA 4AJ1A 3AI3A 3DAGA 4AJEA 4YR9A 5BSHA 1TEHA 3T4XA 1P1JA 1GZ6A 4ALKA 2OUIA 1FMCA 1I24A 4BVAA 3C24A 3DBLB 1QYDA 4N18A 1VJ1A 2RHRA 1H6CA 3F1LA 4FC6A 4J9VA 1NXQA 2VYVD 4XYMA 2EJVA 3AWDA 3PVZA 1C1DA 2X86A 3ZU2A 4J3FA 4G5HA 1KEPA 1S6YA 2BH9A 3WWZA 3ADOA 1I0ZA 1WP4A 2YFQA 4UREA 3IMFA 1OFGA 2AXQA 4JX8A 4WEOA 3NGLA 5A05A 3UHAA 3AY7A 1BXGA 1M67A 1SC6A 1X15A 2DTDA 3ADPA 3KZVA 3VC7A 4DLLA 1TT7A 4OSPA 4WK6A 2J3JA 3VHRA 1UAGA 1ENPA 3OIFA 4FD3A 4NU6A 4CM8B 4DQXA 3PZRA 3FTNA 3GG9A 1RJWA 1Y8QB 3GRKA 2EEZA 2UDPA 4PG7A 2VN8A 3AI1A 1Y9AA 5A5FA 4NZ9A 3K73O 4IUYA 4OAQA 3CINA 3JTMA 4RVSA 3TFOA 1LDYA 1N8KA 2DAPA 2RHCA 3OIGA 1U7HA 2EG9A 3INTA 3QJ5A 4Z3DA 4UVEA 3RAJA 2D4AA 2DTEA 3GVCA 2I3AA 2ZCVA 3C7AA 1I3KA 5IXYA 7MDHA 1GQ2A 3P5SA 1PIWA 3VKVA 3BIOA 3H9EO 2CD9A 1YE3A 1IE3A 1C3VA 3QWHA 3ZNQA 1ZO8A 4BIIA 2AEJA 5DP2A 5AXCA 3EC7A 4I5DA 5HS4A 2HKIA 1M66A 4IDGA 4Z0PA 3RJ9A 1LA2A 1SAYA 3E9MA 3PWZA 4XRRA 1GCUA 2P91A 1IPEA 2JFHA 3UICA 3ROMA 2WTBA 5C3MA 3I9JA 1KETA 3C1AA 3WJ7A 3H8VA 3G0OA 4D43A 1EZ4A 3JCZA 2W98A 3S2IA 2BF7A 1AXEA 2WD7B 4LSMA 2NU6A 3FNFA 3VOSA 4EEZA 1KBZA 2X4GA 4H3VA 1EQ2A 4YDRA 4LVUA 5G4LA 1YH3A 3NTQA 4NBVA 3ZW8A 3FPLA 3LF1A 4NBUA 2BMAA 4HUJA 1J49A 3GG2A 3S8MA 1KVQA 4TMFA 3F9IA 5G0SA 1DBVO 3OJLA 4ZRMA 2EHDA 4O6VA 3VPGA 5MDHA 4I9UA 3IUSA 1I36A 4R51A 5DBGA 3D0OA 3AFMA 4BGUA 1NTOA 5ITWA 4BO2A 1P0FA 4DC1A 2Y67A 4IJVA 5TJHA 3ZZNA 1VM6A 2X0IA 3DFZA 4ROSA 5IDQA 3UVEA 4CMEC 1YB1A 1VJTA 3JQBA 4XDYA 5J23A 2VUUA 4WEQA 2OGUA 4CMHA 2YHIA 1O6ZA 4C7KA 5IJZA 1ADBA 3C3XA 4WCDA 3IOYA 3SX2A 1DRUA 2Q1SA 3TL3A 2Y0DA 4BKQA 4CV0A 4E2WA 2O50A 4L74A 1C1DB 4FB5A 2JHFA 5KVQA 1R66A 4GWGA 5FI5A 3D1LA 1X0XA 3WX0A 3P2YA 1E3WA 5EQDA 5JLAA 2I66A 5EPOA 2ZB3A 1E7RA 4CL8A 3Q11A 1BXGB 1U1IA 1YL5A 5KVVA 3WYBA 3TZ6A 4DREA 4D3DA 4K1LA 2D2IA 1ISGA 2NU8A 8ADHA 2X8LA 2CFCA 5A1TA 2BGKA 3GNSA 3LLSA 1ADGA 4IDDA 1CQJA 3S1LA 5JCJA 2X0JA 3WTCA 1HKUA 4OKNA 2EJWA 4FFNA 4Z3KA 4D3SA 2HJSA 2VWPA 5GZ3A 2CDCA 1PSDA 1FJHA 4CMGA 3WXBA 3KYBA 4KDFA 3HWRA 4YAGA 3WYEA 4DTIA 3KVOA 3TRIA 5JAMA 4NQZA 5I8ZA 2BHLA 2PKRA 2IXAA 5JPIA 2YV2A 3CTMA 5TT1A 1P9LA 4YRDA 1E7MA 1BDMA 2D1YA 2BELA 2ZQZA 4DYVA 3OIDA 1YVEI 4OJNA 4BNUA 4E5YA 3KYCA 2VHYA 2NWQA 2VYND 3MOIA 5IG2A 2NACA 1FK8A 2NTVA 1P3DA 3WTBA 3W4KA 3WIDA 3B1KA 3GNTA 3SJUA 3ETDA 4E33A 4CLRA 1PTJA 3W8FA 3K8ZA 2I5PO 1DIBA 1XQ1A 2AEMA 1DIHA 3I9LA 1DFIA 1QV6A 1T25A 4TKLA 5KIAA 3DZBA 5G0VA 4E2YA 3RKUA 5IF3A 3GEMA 4JJFA 1U8FO 2UUPA 3VTZA 3M2PA 3JQAA 3ZWVA 5B12A 2P9GA 1HZJA 3JYQA 5I9MA 2Q50A 2A9FA 2FN7A 3DHEA 3NV9A 3QWBA 1F0YA 1R6DA 3DZKA 3RC1A 2H9IA 4L4XA 4A10A 1PWZA 1P1HA 4C4OA 4CMJA 1UXGA 3E9NA 4RPLA 1O8CA 2WDZA 4R1NA 4DQUA 2HMTA 1G0NA 1GYPA 5KTKA 1UP7A 5DULA 4B7CA 1YOVA 4AJLA 3FI9A 2QRKA 3IS3A 4OGWA 2GZ1A 4PG6A 4WJZA 2B4QA 4BKOA 4TWRA 4TSKA 4NPCA 3TF5A 2FZEA 4CQLB 4Q39A 5KJCA 4R1SA 1NQTA 4E5NA 2Q4EA 4DQVA 1EQUA 4DWVA 4CM3A 1PWXA 1B3RA 3ST7A 1OBFO 3Q0EA 2BI7A 1Y8RA 3NJ4A 2O23A 2VRCA 4IS3A 4R9SA 5K0ZA 3H5AA 1T4DA 3QVXA 4GLOA 4GX2A 2W90A 1Z73A 3PIIA 4PLPA 5A9RA 3TFQA 1NFRA 3RJ5A 1XU7A 1UXHA 3ZV5A 1WXDA 1E5QA 3L0DA 1B16A 3H3FA 4FCCA 4FOSA 4U0KA 5TIIA 1B2LA 2YHIB 1BTOA 2IYPA 3F6YA 1MXHA 1PJTA 4DL9A 8LDHA 1PGJA 4NR0A 5KCZA 2Y0EA 5TS3A 1I3NA 1PGPA 4UEKA 4QXMA 3T4EA 4GAEA 4GKBA 3RFXA 3ETEA 4CLHA 1QG6A 3VPFA 3ZV6A 4J1NA 2DBRA 1EK6A 5A3JA 3U09A 2G1UA 4DLAA 3BMOA 4WLVA 5ICSA 1T1SA 2WSBA 2Y0CA 3GQVA 2Y68A 3DOOA 2C2YA 4OOEA 3JD0A 5JE8A 3V2GA 1GFSA 3AOEC 3QIVA 4AL4A 4E3ZA 5A04A 1BVRA 3D5QA 3ONDA 1KEVA 1HZZA 1XGKA 3QP9A 2DKNA 4IDAA 4XGKA 1KYQA 1MG5A 2PD6A 3BTUA 2Q4BA 2NLOA 3WLFA 4PIVA 4RQTA 1LQTA 3VKUA 1GEEA 4FQ8A 2JFGA 5CDUA 4TQGA 4R4JA 4FR5A 5AXDA 2PA3A 2P4HX 2VYVA 4OYRA 1NHGA 2I3GA 3ZWNA 4BGIA 2W2LA 4YQYA 2FPGA 2HAEA 1V3UA 4O1MA 2P5YA 1Q0HA 4CLRB 3ENKA 1PJ3A 2LDBA 3OETA 4EUEA 5IDXA 3UH1A 3PRJA 1PR3A 3JV7A 3KSZO 3N58A 5TQVA 2AG5A 4RL6A 2PH5A 3OA0A 1PJLA 3PGJA 4EI2A 4FGSA 2LDXA 4YBZA 3WGYA 3HN2A 1UDCA 1CETA 5COBA 1HDXA 3JQAB 3QRWA 3OHSX 1B8UA 1ZK2A 1NQOA 3ZU3A 5ER9A 1MC5A 3FHLA 3RSHA 1SEVA 3RD5A 5FEUA 2OZPA 3D3EA 4WE3A 1QSGA 4J1TA 1VSUA 4Q3BA 4WNCA
chains in the Genus database with same CATH superfamily
5F78A 2C9OA 2H2IA 2I2BA 4LHYA 1CPYA 4ZJYA 4AYWA 3D0RA 3I01M 2EKDA 3NYRA 2G09A 2PPLA 5CHEA 5KPJA 3SIRA 1RXVA 5IMSA 2DH6A 4L4RA 2H2WA 1PDOA 2HHAA 1ADYA 1L1RA 4YRMA 5J2UA 1E2KA 1T1GA 1UZLA 1RWMA 3UAXA 3ZNPA 3V2UA 1X8JA 2W2KB 5ITSA 4LJ8A 4MQ5A 2FZ5A 4BLOA 5JXJA 2OLKA 5DH9A 1CDEA 3K20A 2CUKA 1FLVA 3H04A 3H6HA 4DPLA 4F4CA 1LK5A 1L3BA 1S01A 3RJMA 2B5WA 1P7CA 2X19A 3LCJA 3QVGA 3IQFA 1DEXA 3CISA 5PGMA 1RHRA 1WCIB 3B9PA 3HUUA 3LIIA 4QZVA 2PKQO 2DTXA 1DBRA 4M0DA 1EPUA 4M22A 4QE3A 1VMDA 3K2EA 5JAIA 2WPNA 5K4HA 4KLCA 1NXWA 4QVKA 5D3KA 1F17A 2F6RA 2VHUA 3QLTA 1XOIA 4OQYA 4ER3A 4DANA 4ALNA 4MZXA 4R7TA 2H29A 3DXFA 3ROXA 2VA8A 4Q3KA 3WLQA 1Y3BE 5FUXA 3WXMA 4NYJR 4JQOA 3L8HA 1P45A 5DKFA 1DG1G 1ZFNA 2PPVA 5JNSA 2J9GA 3WWOA 5IH7A 4EHIA 1X3SA 2Q1XA 2AF3C 4LDPA 1KEWA 2VHVA 2ZS7A 4N5IX 3AVUA 1UANA 4RM2A 4WINA 1U5BA 2ZS8A 2OV3A 1KQGA 2FN8A 1AHNA 2CFTA 5DGCA 2IEGA 1QV9A 1Q57A 2J9ZB 2OZKA 2YUTA 3QOFA 3PFCA 4D4KA 4BBAA 3GLVA 2VJQA 1N0WA 2Q2WA 3QXSA 2FPUA 3NDPA 3AGPA 3D8HA 3MWGA 4R6WA 2GM9A 2ZWMA 4KN5A 3WL3A 2QKYA 4FMCF 4ETMA 3II6X 1CQZA 2CVPA 2CV0A 2GUGA 5JNTA 4F5WA 2CHQA 3CC8A 2UAGA 1U8UA 5JY6A 2LCQA 4AURA 4KODA 2VTBB 1RRGA 1OROA 2FJUA 2WNHA 2IYYA 4UM7A 1LKZA 4EKIA 4N3AA 1SBCA 4D99A 2W43A 5LNK6 4P36A 2VWQA 3AVTA 3DLCA 5ECGC 1NJ1A 2G3YA 4F7WA 4JUAA 1W96A 3UXEA 3IKMB 1GNRA 2EARA 5K6TA 5ED4A 3GJ0A 3RRJA 5ALTA 4I8IA 4TUYF 3KLOA 4B09A 1TVMA 4WOPA 3OP1A 1W36D 2R1VA 3GLHB 1ZX1A 4LXIA 2IL1A 4B6RA 4Q4HB 1XUOA 2F2TA 3ESCA 2TYSB 4FCWA 3ZY3A 3K0AA 2NW6A 1ZJZA 1WB5A 2X23A 3QLJA 3VU8A 1AUOA 2F1RA 4RL4A 3OAAD 1N5RA 2R00C 4LMAA 5AJHA 3MM4A 5LMUB 1OASA 1Q1NA 3EDOA 4A8PA 1C7IA 2I67A 3P19A 1IQPA 4H6WA 4L16A 1C5KA 4PONA 3PUVA 2ZRDA 1WCWA 3FAKA 4KMSA 1YNOA 5J4KA 1Z0UA 2ZSKA 2PUVA 1A8UA 1N0VC 3VVLA 2ZJ1A 1V16B 3HEAA 4G8JA 4DIFA 1HBJA 3LPAA 1W34A 1L4EA 1Z12A 5D86A 4XDHA 1E3QA 3C48A 5EQFA 4FBGA 4O2BB 3WV4A 4FZJA 1OIXA 3EF0A 4L85A 1Q91A 1QIEA 4O0LA 3JD3A 2AOUA 3KSRA 3Q2IA 5U4QA 3O4GA 3I34X 1ZMRA 3P71T 3H2ZA 4ZEXA 5TGZA 2IHZA 4FWTA 3T41A 1EK2A 3RFVA 4KB5A 2RH5A 4ZRNA 3IT0A 4QBHA 4XVUA 2D3TA 2X42A 4PYMA 2JIZD 1DIRA 3CUKA 2QJWA 2IEIA 4HADA 1TVKA 4JVMA 4TL6A 5DEIA 1HXHA 5A5EA 5KVCA 3ZNOA 2MJLA 3DCYA 3NHZA 1Z06A 1ZRMA 1EXVA 1KRHA 3GEGA 1Y5MA 3D4LA 3ETJA 3VO1A 5KC9A 1HDYA 1HO3A 1X19A 3LOPA 4OQPA 4JVLA 3WIOA 2VF5X 4R1PA 2I76A 1OOEA 2F8LA 2IU3A 3DR3A 2IHTA 5M34A 1QDLB 1A2BA 5KVSA 2EQ5A 1PKXA 2Y77A 1DJOA 1P77A 1PU2A 4YNBA 1KE1A 3WB0A 2J5RA 5AVVA 1RQPA 1EFAA 1AHIA 4B34A 4R40A 3L0IB 3SJCA 3GGJA 4JS0A 1X42A 3QKIA 5F4ZA 1S96A 4IVNA 1CQIB 4WBSA 1ES9A 1S3IA 1YOBA 3IKJA 5T4FA 3EG5A 4K05A 2NT4A 3TM4A 4RMNA 2OO7A 4B8ZA 3ANSA 3SMQA 3EPKA 4GBJA 2AKYA 2IDZA 1KDZA 2J3QA 3UW3A 1KP9A 3JD1A 2Q45A 2GRJA 4L5IA 1WDWB 4N40A 1YJ5A 1E4EB 1FU4A 2ZAGA 3TZKA 5EHXA 4PO3X 1OC2A 2OVBA 4P7BA 2P77A 4PC2A 1IBMB 1E1RD 3ADBA 4US2R 1YDFA 2ZOSA 1DHTA 3CS3A 3H0KA 4R8SA 1OE0A 4XWKA 3X3HA 3SS8A 4CW7A 1J2TA 3A4VA 3N6XA 4MW6A 2GBPA 2FUG6 2ZM6B 1EXWA 4K0RA 3HE3A 1TUGA 4K9QA 1XZMA 5DGTA 3EMBA 2XKAA 4M1SA 4CQMD 1L4FA 3GGCA 2QVGA 1M6VA 2GK4A 2ZIWB 3I32A 1N2SA 2EHJA 3BORA 5ERGB 3E1SA 4I1IA 4R16A 4WNYA 4ZXPA 3ZEAA 4L6IA 1S7CA 1FRFS 3LVFO 3CZRA 3G1WA 1DAMA 2O8DB 3NBAA 4RW0A 3SVZA 3RB8A 1GAXA 3RRZA 5AW6A 3P9SA 5D6OA 2V1XA 1Y42X 5E0KB 4JJZA 3FTPA 2VATA 1FL9A 5K51A 3BH7A 1PJRA 3AUXA 3PUKA 4KXNA 4AO8A 2LNDA 2QR3A 5EJ2A 2PX4A 1GKLA 3G2QA 4POOA 1G7TA 1MVLA 1U3WA 3S28A 2IU4A 1LDEA 3GUYA 4U8GA 2HC9A 4L0CA 1Z0FA 2DH5A 4F9EA 1MT3A 2ZIXB 1EAYA 1JXOA 3CR8A 1ECJA 4RS3A 5FAXA 3H1TA 4PY2A 4B84A 4YXWD 4I1SA 4JB3A 4XJVA 3R74A 2DWQA 2H1VA 4F92B 2XZPA 4JJAA 5F7XA 3WDLA 5DWVA 3A2MA 2PRJA 2GD1O 2VAXA 4KVFA 1Y81A 1UQUA 1SWVA 3WNVA 3X2FA 1EFLA 2NYRA 2P9YA 5FR2A 2HIHA 3HO1A 4PGFA 1FS4A 1OILA 4K87A 4O2BF 3H5NA 4LGMA 2GO7A 2YNMA 1OB2A 3EMKA 4N7BA 5TS2A 3AHCA 4X65B 3EXAA 5HOEA 3OE1A 2I1LA 1VJ5A 2PLWA 3VR6A 4B3MB 3DT9A 1WMBA 2QSYA 3JYLA 3PHBE 3C14C 3D6NB 5EXPA 3USCS 3WGGA 5DM60 4DLTA 4E31A 4KR9A 4BGVA 1DMRA 1FDVA 2P9CA 4PFKA 5EN4A 2IH4A 2I65A 3OIYA 5IBQA 5IVDA 1R0CA 4LOLA 4JA0A 3F3MA 2XZOA 5ALRA 2O7SA 5NLLA 4LOIA 2Q6KA 4KGDA 3LW7A 1IHUA 1M8GA 1U0JA 1WSBA 3AFHA 3QKUA 3WMEA 3OJOA 2XB4A 2X1VA 2I8AA 4DV4B 4FZVA 4N7MA 3JYOA 5NULA 1KJ9A 1E1QD 3M6IA 1Z16A 3B36A 3ZDXB 3QVSA 1CVIA 5G1PA 4ENTA 2IH2A 1HT2E 4YJGA 3KYDA 1X7WA 3DEYX 4FW8A 4P34A 3REGA 5ELXA 4E5SA 1T10A 2QR5A 1XEFA 1HZZC 1Z2OX 2ZRGA 1DIAA 1R00A 3I73A 4Y9DA 1LSSA 2C9DA 1IC6A 4RULA 4DT1A 1K68A 2P7HA 3FX2A 1K4YA 4LF6B 3DUFB 4BFTA 3SAJA 1UBNA 2FPPA 4Y0VA 1E9VA 3PJRA 1B1CA 4WMLA 1WMEA 3M70A 1WXEA 4TWJA 4UTPA 4TQ9A 3I8SA 3IBFA 1L4YA 1KGSA 4FKMA 5DNVA 4GX1A 2EBHX 3QBDA 3K0EA 2O8CA 3AB3A 3JQ6A 4W99A 4JLOA 2A59A 2Q5OA 2Y0BA 2BMJA 3BE6A 1XNJA 4BP3A 4II2A 4IM7A 3GARA 1DJMA 1JA9A 4D02A 3ILHA 2VP9A 5ICGA 4MRNA 1VKHA 3AL3A 3IURA 2CUZA 1QH9A 1Z83A 1BW9A 1X1CA 2GNOA 1VP3A 2BFWA 3ECAA 1UAYA 3I8XA 3PNOA 1CNMA 1TUBA 1EUDB 1YDEA 1SC4A 4MW5A 4G1MB 2REQB 3PFKA 4QLOA 1IZZA 4QKQA 3SVTA 2GEKA 5BPFA 1D9ZA 2C9CA 1DL5A 1HE4A 1PO7A 2I03A 4HAZA 4BNVA 5EXDA 2VT6A 2Y2VA 4ITVA 4YAIA 1M2OA 4R1TA 1LFDB 1XWIA 2BR4A 2HGSA 4Z9YA 2IUYA 1QZUA 4IDQA 1U7WA 4X66B 4ALLA 3GGGA 1N9GA 4BEVA 1H5QA 1T2EA 1ZG3A 2NZVG 2Y1LA 5CM8B 4ZQEA 3GNQA 3BCHA 3TMYA 5I3ZA 5DHFA 4J1TC 2NM0A 2QE6A 2KHZA 1D2MA 4I8DA 2AS0A 2ZATA 1G8JA 4UJ3A 5FA5A 4J49A 1FDTA 2NO6A 4KMRA 5F1OA 4YQFA 4GQBA 1OHHD 4PYOA 1E1LA 4F2DA 1XDDA 3SFZA 4JOBA 2AK3A 4J0IA 3QYFA 2NYVA 1NMQA 1Z0SA 3DAPA 3IQXA 5GPBA 2WYWA 4ESOA 5K0BA 2VXYA 3IUMA 4HFMA 4MVJF 4R1MA 4A0RA 2OG1A 1JPJA 4KL8S 4RABA 1T5SA 2GRUA 2R7KA 3AKDA 3GELA 1SOWA 1CY7A 3C0KA 2PZ8A 1Z7GA 5I7VA 1JJIA 2G4VA 1D6MA 1WJGA 3INRA 1E3IA 4J29A 3D0KA 1N6PA 4I55A 1KOFA 4V0QA 4AMVA 4YCSA 1CBUA 1MJHA 4FX2A 5KKCA 4RZIA 3CKKA 3H2IA 3ZW7A 5JSZB 4XUEA 4QPJC 4KXLA 1VQ1A 4UEWA 1GPDG 1HE2A 3BQMB 2HRQA 3GJ4A 4RZSA 3PFFA 4HGRA 5FFNA 1QGDA 4R1OA 1XCBA 1Z8NA 1P62B 1IAQA 5D3ZA 5B3KA 3L93A 5DEOA 3HCDA 4AC9A 3DMTA 2XHZA 3FNQA 1GPJA 2DC1A 4S1WA 3R0JA 1IVYA 3UAVA 4DR1B 1J2JA 3R3SA 4GRAA 4E22A 2G67A 1NLFA 1SQ6A 1XEXA 3F47A 4LF5B 5EFOA 1H1LA 3NHRA 5A4AA 2XE6A 1CUZA 1GVNB 5KX5B 3HVKA 5BN5B 2CF5A 4WBNA 1QS0B 1SD2A 4ZCPA 5DHPA 2ZRQA 2QIOA 4RTJA 2C0PA 3SR4A 4MDFA 2FMIA 5TLSA 5CH8A 2B21A 3P9YA 5K3EA 2BGWA 5J3JA 4Z5XA 4L50A 2PSSA 4L2IB 1XB2A 4O8CA 2BHRA 1Y5LA 1MORA 2IZ0A 3PUHA 1H0RA 1ZKMA 2JHPA 3GLRA 3OAAA 4WD3A 4E7PA 1H22A 4QJIA 1XD2A 1M6YA 3NZEA 4NOLA 2FSFA 3V97A 2IZZA 1E7QA 5J1SB 1BFUA 1E59A 1QGAA 1S3GA 2IHBA 5KAPA 5J63A 1NT4A 4G0OA 3QWAA 1R6XA 1C0PA 4UD6A 1LLFA 4JD5A 5DNCA 2ZYGA 3RBXA 2DVMA 1DIOB 1P3JA 1S7GA 4XI9A 1QBKC 1BMTA 3IPCA 3GZ4A 2VAMA 2AMFA 3V4FA 3BREA 4EYOA 1A96A 4P7FA 2G4LA 3W6ZA 5CFNA 2I91A 1UXOA 4WIAA 4WV3A 4KRYA 5EYPB 1T4CB 4KVZA 4M8NE 1PEDA 4ND7A 3TOCA 5DBIA 1HEUA 1RHJA 1CVLA 3ZHXA 5FXMA 4LZZA 2V6MA 4NABA 5E4TA 4YFVA 4F9TA 2OXFA 3F5QA 3VH2A 1N5IA 1V7CA 5L95A 1SNYA 1MAVA 3IIJA 1NJ8A 2EU8A 2FW0A 1JEQB 1XQVA 2JARA 2JIZA 3OZRA 4LEIA 2QN3A 4B3BA 3F8TA 2C7OA 3SF8A 3CJTA 4UCQA 1F4PA 3BHJA 3KTAA 5IAAA 3NUZA 4A0SA 2Q27A 4B2PA 2AJTA 5IJAA 3GX1A 3OF2A 3RBAA 4CVNA 2N75A 3L4EA 4QFMA 2EP7A 2DBZA 2P68A 4DDWA 2XCIA 1PN3A 1ZLYA 3C5CA 3EH1A 4EF5A 4N5NA 1A27A 5FBWB 2J6CA 3OWOA 1GGVA 1YB6A 2Y1WA 3ICWA 5T8KC 4KXFB 4OBEA 4IKPA 5B2EA 1WW3A 4YRZA 3VH4A 3T0FA 4Y98A 5FI0B 4YRPA 4QRHA 3H5TA 4BNWA 5IDVA 1QIDA 2NU9B 3SF0A 3THRA 3T54A 3A6KA 1FDOA 4M4SA 2HJWA 4E32A 5IZ4A 4J4BA 5JBIA 1M2EA 5LP6B 4OHCA 1LSUA 2Z95A 2GZMA 3DFUA 4ITRC 2P9TA 2QMHA 3RYFB 1JEJA 3TO5A 2EJCA 3G3EA 3MEQA 4CKCA 3GPDG 1I13A 4EB6B 2W6PA 2V6BA 1Y1LA 2OY0A 3DF7A 4XDGA 5AVQA 4A15A 3QQPA 4E6EA 3RTEA 3TTSA 1KOJA 3GVXA 1E1RA 1TU0A 4I50B 3GR6A 4CMCA 4EKYA 3OUZA 1H6BA 2OZEA 3RUIA 2QV0A 3H3XA 3ULKA 6GPBA 2R68A 4G0PA 5KX5F 3F49S 1KR5A 4ZGWA 3F78A 3KV3O 4AP5A 1E2EA 3NPMA 4GS5A 1TK2A 3CT4A 3SM9A 3UYKA 4A5SA 4BKMA 3PC6A 2IHNA 2OORC 3A7EA 2FMHA 1JP7A 3D7RA 4IJ5A 4IXNA 3DJFA 2XYVA 1V1RA 3K0CC 4JI5B 1GPKA 3KPWA 1KEEA 4B3FX 4LXYA 4LZLA 3M83A 3IVRA 1I7QB 2HQ1A 4X1YB 4DDUA 1SVUA 3QOWA 3IT2A 1ZU4A 4FHDA 4B7UA 5AKYA 4NMLA 3ZH2A 4I5FA 2XJ9A 4FFRA 5E3IA 3L6UA 1U4OA 3E7XA 3STXA 1BEZA 3TZBA 5IVPA 3ZD7A 3LA6A 5JDIC 3UXMA 2XUZA 4KAXA 2E7ZA 1I01A 2G83A 1UK7A 5FNVA 3C3EA 5KYXA 1POXA 5DYIA 3WYAA 3GJRA 1ZOSA 4JXKA 4YXWA 5A62A 1XDWA 3W5DA 1U2TA 2D13A 3F67A 3BGSA 5KTSA 2ZT6A 3PUZA 4YP1A 1FRQA 3BULA 2QVCA 2H07A 3CNNA 1QKIA 3ZVKA 1RLOA 4NV3A 5DYWA 1IJEA 3PEUA 1K08A 4B4KA 4Q34A 3S8EA 2J3KA 3D2CA 3PFWO 4H7EA 1ZXLA 2A9QA 3WDSA 4B35A 2OL4A 3SY8A 4BFLA 2BGUA 4YQZA 3M1AA 5F1YA 4LBYA 1SQGA 4M99A 4W6ZA 4ZO9A 1T8YA 4DAOA 2G17A 5IH3A 1U7XA 3VR3D 4DCSA 4P53A 1BHJA 1WL8A 4J43A 4BAGA 5BSKA 3H9UA 1VA5A 4M98A 1IQ0A 3CKMA 1ZJ6A 4TLEA 2B6NA 4ZCLA 5JYCA 3RYCB 2CNOA 4IIBA 3TCXB 3PQ3A 3ZZTA 3F6SA 3N2GA 4QG3A 1FLDA 5D5QA 3UAYA 1X13A 3ZXIA 3CVYA 1BDJA 1SBYA 1SCIA 3ZWXA 2UYHA 3BH6A 3AR7A 1O97C 1R4AA 1GZSA 1ZMTA 5CHYA 1D4FA 1PJ2A 3MSXA 2RAFA 4IZOA 4L1KA 5T4BA 3DA8A 1Q15A 3GV0A 1SK9A 3HMKA 4YWHA 1QRTA 3CNHA 1UMCB 2A14A 3T3EA 3WGOA 4F5ZA 4M21A 2YY6A 1BJTA 1PJZA 3GFVA 4H77A 2OXTA 5J43A 4HRVA 3W79A 5KSPA 3K92A 5CNIA 5F35A 4H1UA 3SC6A 2Q49A 1GTG1 1SB8A 5C8ZA 4DEXA 4JJEA 1AZSC 2QD3A 1ZM2A 1WY5A 5FUYA 1N92A 1AS2A 4C07A 5LP6F 3A2LA 3LX6A 3SZLA 3WGIA 3WYDA 1E8NA 4EUHA 3E2MA 2JCBA 2NPIA 3PNBA 1K8YB 3FDJA 2ZITA 4Y9SA 2JK1A 1KYXA 4I50F 2GT1A 4OFZA 1D8TA 1EVQA 4ZQGA 3TR5A 1U2GA 1VL5A 3EOAI 4YJHB 1FC0A 3I3OA 1A7JA 3AEZA 1DBQA 3THSA 4E14A 1A5SB 4C0WA 4GI3A 4XWGA 5LYYA 1EJ6A 3IFSA 5I4CA 4UHFA 2G76A 2NZJA 3AUJB 5T6BA 3WB1A 5G1NA 4EKGA 4Q05A 4UBLA 2BC9A 3LCUA 1Y5NA 4WZAA 5AM1A 3CBGA 5JQWA 1VJGA 1B73A 3KYCB 3LSYA 1M7GA 2A33A 1E3DA 2HLPA 2J0UA 2Q3MA 1QFZA 2Q4DA 3LO5A 4HXYA 3HUEA 1MX9A 5ALHA 1MB4A 2ORYA 3SLGA 3R9WA 4LSWA 1ZJWA 4IIVA 3D7KA 4N6GA 2QN6A 1YHNA 2QYSA 4X7RA 4XW2A 2ZYHA 4S24A 1UC5B 3ACDA 5LQMA 521PA 3DZFA 3UCXA 5CGZA 4KHPB 3Q3CA 1AM4D 3SP1A 1X7YB 2XMRA 3HB7A 1GCGA 3LUKA 3NBFA 4HDKB 4XOIA 4P35A 5FR1A 2JAPA 3CONA 3GXBA 3I05A 4EG7A 1LLCA 1P6QA 2K87A 2JAUA 3CZMA 3BXGA 5CVCA 4ZVKA 3SYRA 1B0PA 1W5EA 4MWCA 3I0NA 1RM4A 1M2VA 4RHUA 5FBZA 4WFKA 4AZ3A 2WVHA 3DXYA 2Q6LA 2O2XA 4OSOA 3LLVA 3OP4A 2NNLD 2DG2A 4P3YA 4AQ7A 2Z04A 3AUTA 3EDQA 1GQQA 1PBTA 4NS1A 3OBIA 3CLHA 4BKPA 1YA8A 1OBOA 5DIFA 1AKRA 1OHHA 3CRVA 4YRIA 2C92A 3RRMA 4KFTA 1RBMA 4FHGA 1GRNA 1L8LA 4AZ0A 4CKWB 1B8VA 1KAEA 5A1JA 4II3A 4MIKA 4YO8A 5IWCA 4RLHA 3VVBA 1EJ0A 3W7AA 3F4KA 2JIDA 2OOKA 3ZUPA 1F2VA 5B7PA 3HJGA 4FB4A 3EN0A 2G72A 4ND8A 5HRAA 1SH7A 3GOHA 1ORVA 2YCBA 2IFTA 3JQFC 1KIMA 3TX6A 4COKA 1U2DA 4EB8A 1JH9A 2RIRA 1RDFA 1E9DA 1X2EA 2DECA 4C7BA 1U3GA 2NXEA 5FOSA 2P9ZA 2G9QA 5BURA 4YA6A 4DFDA 5CFZA 5IBPA 2R48A 1BFKA 4DAEA 2NVUB 4OQMA 4HGQA 2XOXA 1XU9A 4KACA 1KMHA 2ST1A 2BKUA 4GR5A 4NBSA 2PRSA 5DLQC 2DOKA 2UZ3A 2WOJA 3ZIUA 1MTZA 4Y6RA 5D3MB 4GPTA 4W5JA 2REBA 3Q8MA 3KKMA 1CS0B 3OE7D 1AKQA 3B60A 3IVGA 1JHRA 4L15A 3KSMA 1T5BA 1Q2UA 2R84A 2WHPA 3N2KB 4BVGA 3LBIA 1RRCA 2FZGA 4NKRA 4Y2YA 1AXGA 1JUDA 2IPOA 2D2FA 3G5UA 5B4VA 2IWHA 1KE2A 4M1QA 2YXPX 1JLMA 3G02A 5CVUA 3LC1O 2KMLA 4QASA 5J47A 3OT1B 2IOYA 2YMQA 5FA8A 2XZLA 2G40A 2V7WA 1U9YA 2RH9B 3T1QA 4XE5A 2CVOA 2ODTX 4LQDA 2H85A 4LFAB 5DRTA 5BT9A 4Z4HA 3DLAA 3BZBA 4OQNA 2QTVA 1KHTA 2P6NA 1E0KA 3KB8A 4K6MA 1XDZA 4C87A 2DFTA 2TMGA 4BOYA 5HIJA 1B93A 1G3MA 3K70D 3GQBB 5BN3B 3LFUA 4F8YA 4UHKA 1DWOA 2O8EB 4NXNB 4DKXA 1E77A 2PS0A 1V37A 4CLDA 1K7FB 3DC2A 4UU0A 2BYTA 3OUTA 2X76A 3QVOA 1L5HA 3WK9A 1UBMS 3A32A 1ZM7A 2GI4A 2PKQP 4IGFA 4MEAA 3QZUA 3O3NB 3T4PA 4LWQA 2W2PA 5AVXA 2IXFA 3ITEA 2VEOA 1XAGA 5TEWA 2KWIA 4JKOA 1EH5A 5EE1A 5C52B 3HGTA 5CD1A 4ENVA 1OIVA 1WSWA 3QYJA 1NZDA 3GO4A 4FHZA 4QBKA 1RPNA 2B3TA 2PMDA 1J06A 3DMHA 5FUBA 3WNQA 1D1SA 3TD2A 1P9OA 2I6GA 4Q3BA 1YTLA 4RLSA 4DMLA 4AN4A 5CX1A 2FX2A 4JUCA 2FZKA 2SCUB 1GL7A 4XGIA 5KYGA 1OGIA 4L6AA 3EE6A 1R16A 1AK1A 3PQFA 4KIJA 2JLVA 1R0KA 3S2SA 1ONPA 3ISJA 2I3ZA 3DP9A 4KTVE 5JUWA 3PYLA 3KNZA 1GZ3A 3BWBA 4ZI7B 5JXHA 4FMBB 1WLYA 2GM3A 3Q2OA 1SCUB 3CLSD 3V8EA 3P2IA 2H4ZA 2I9KA 1W85A 2OBBA 1NN5A 2YV5A 1I5EA 4ZPJA 1HFKA 1P73A 3S1SA 2FMKA 4RMHA 2CMHA 5FO1A 4C4SA 4K3UA 2PO5A 1G42A 1NU6A 1RKVA 4XGNA 3IC5A 4Y0NA 1XQWA 1EE2A 1YI1A 4YRKA 5K3OA 1TKBA 4OGLA 3D81A 3AJRA 1ODJA 2D59A 2Z2KA 2R7NA 3T3IA 4BV9A 3N0TA 1E3EA 4B48A 3LOUA 1I80A 4R0VA 3W5BA 1Z62A 3DOHA 3NX4A 5AW5A 3OCXA 5KS2A 1XPJA 2GTHA 1T8RA 1GPMA 2HCJB 4J7UA 5KDLA 821PA 3I12A 3GT4A 3M4XA 5AD1A 4JB8A 1Y82A 2VUTA 3BPSA 2PKXA 1IMOA 3LHSA 4DSNA 3QUQA 3TINA 1UMDA 1PHPA 3UHOA 3KXKA 5J2UB 1PJAA 5G4KB 1I6LA 1A9PA 1PT6A 1S3SA 1YDWA 3BCRA 5JD3A 5HILA 1SC1A 4D41A 2QBYA 2WF9A 3KT3A 1PFYA 3F6BX 4AK9A 1REQA 4LRXA 1CHNA 2QTHA 1LV7A 2Z4RA 3RG8A 4BO4A 4D4HA 2WIFA 2XA2A 1U7UA 2GJKA 3QVGB 4RTQA 1JDPA 2C42A 1DKOA 2QX8A 2X0RA 1Y7LA 3DD5A 4XYEA 1OAOA 3AVWA 1E1CB 1Y9ZA 3PEFA 3U7JA 1GU7A 3HHPA 2IGTA 1AS3A 5IM5A 3ZUGA 3WK8A 4BTLA 3VR4D 3U49A 1EBUA 4ECAA 4A8JA 3LNTA 3TSYA 2XOKD 1JG2A 1NVDA 1MN6A 1SHLA 4FZRA 3U0BA 4NCIA 3TGWA 4DN6A 4XX0A 3RIGA 4CMKA 1LLUA 4IYRA 3NLLA 3ER9A 4NOJA 4F91B 4Y1RA 1BU5A 3HDHA 1TLTA 3R44A 3KRTA 4FNOA 5EWLB 3ZWWA 2D7DA 3K9GA 1IIBA 4GMKA 2JFQA 3W6PA 2QUJA 5LLTA 1P2UA 2EVWX 1XTBA 4J2HA 1U5BB 3ANMA 3PQ2A 4RESA 2VZ8A 5LB2A 5C32A 4CV2A 2RDMA 4OU5A 4P4TA 3BCSA 2GCNA 5K8JB 1WCV1 4KZPA 4WLEA 1NVMB 1RIFA 4DJTA 4ZI3A 1TZ2A 3B6IA 5HKAA 1SCBA 2HADA 1XMXA 2Y1CA 5BW8A 4E30A 4S12A 3TVDA 5HCIA 3Q3GE 1QH1A 4DLKA 3H16A 5HS6A 2RG7A 2Z6UA 1RJ9A 1HEYA 3NR2A 3VR3A 4AYTA 2P1RA 3K7EA 3R2JA 1J09A 4HEHA 4R3UC 1PNOA 2J46A 4CPDA 5HJ7A 3CRW1 1JPNA 4U3JA 4ZI7F 2B7BA 4BNMA 3B20A 4JBYA 4FS3A 4BMVA 1CP3A 1XRMA 1SO8A 1AKYA 1I1HA 1T8TA 2HRRA 4Y18A 5GMOA 1FP4B 1L9KA 5CTJA 3RC7A 5BORA 3W78A 4JB2A 1JEOA 2IHUA 3RVLA 3RYHA 5IYZA 4CL0A 2HSWA 2B4YA 3KWFA 5IKPA 1GP2A 1QJ4A 2NQ8A 1D4OA 1TVEA 5TQ0A 4PTZA 1IHDA 1V71A 2ZUCA 3UCEA 4A73A 5LXTB 1FMJA 3AVOA 5BOVA 2WB4A 1MQSA 4BO3A 4Z1MD 1DAEA 2E2WA 3REFA 1I3MA 5EUBA 4MJ7A 4ZVMA 1KK1A 1TMGE 4WY2A 2XTJA 4FGWA 4N3CA 4EY3A 3NP7A 3CIOA 1JA1A 1F0PA 4KK4A 1HORA 4LSZA 1F2UA 2O20A 4NBLA 4IH9A 3B6ZA 1UOOA 4EH1A 3Q9NA 3B78A 1F8GA 3VU0A 1Z26A 3L7DA 3PNMA 4PRZA 1M0EA 1JB9A 2YVLA 3AW9A 1CK4A 1E0JA 1MX3A 2OYRA 2H6EA 4J8PA 1G3UA 3LC0A 3URMA 4BCBA 4TTJA 1JHAA 4DMFA 5J2UF 3OQIA 5JMPA 5L4SA 3G59A 2ATEA 1A5TA 1X8KA 3E81A 1PRYA 1IHXA 1TCAA 4R83A 4R81A 1XQXA 1D0SA 3JQCA 3WJAA 4CG2A 5AI6A 1NFFA 1QG4A 4JSYA 2D7CA 5DGDA 1TCBA 3FLAA 1H2YA 1OT3A 2GEFA 3O4FA 5ALNA 3IAEA 5F76A 3OCWA 3H5LA 4LZOA 1JAYA 1IXZA 4H0FA 2XF2A 4G25A 4ESEA 4MW4A 5K8IA 3TEMA 3EDMA 4RF5A 3U3DA 5JDCC 4Y6SA 1KAQA 4EPRA 4P3OA 4DR5B 4PYKA 1J1IA 1OYVA 1Z4MA 2PH3A 1LPBB 2MSLA 2QRMA 3HV0A 3T1VA 3V4ZA 1W1UA 1FDWA 1RRFA 1R9MA 1RTTA 1UJBA 4INAA 4BC0A 4EHLA 3T5DA 1WWKA 5KQMA 4QUBA 1HDCA 3AUYA 2IDJA 1K8RA 2OO5C 2P5SA 2PZKA 1WP9A 2G6TA 4Y2QA 3TRFA 3UMGA 4BASA 1WTCA 2J33A 2O0LA 2IOFK 5IU6A 4MARA 4C4RA 3OFSA 5T57A 5BV1A 3EX7C 1RLJA 4DV1B 4YX9A 3WA7A 3DAFA 3AUAA 3R3ZA 5A06A 5LIPA 2WD8A 4P5EA 4KBYA 2HK8A 5ALJA 4TV9B 4PX3A 1MPXA 2NSJA 4FGLA 4UCXA 2H8GA 4P4SA 3N75A 1D7AA 1JA0A 1Z07A 4BBJA 1ZEMA 4IAOA 1OJ7A 1W75A 2VA9A 1FUIA 5KMGA 4YPOA 2ETVA 4KO3S 3HKDB 1OXXK 4B4UA 2EYUA 1NRIA 3CZAA 1C0KA 4YHHB 5KYVA 4P4GA 1T6YA 2JFYA 3W1VA 1KI4A 3AV0B 1VLQA 3PXAA 4JC0A 4KFUA 4YJDA 1Z4LA 4JDPA 5SY4A 4OHUA 3LECA 2ZAMA 3A6HA 5T6MA 3OFKA 4W5RA 2Y71A 2Z57A 3CURA 4R8LA 3STTA 3UMBA 4AUMA 4L51A 4BQQA 5C80A 2D8MA 3AUSA 4ACBA 4B82A 3ZS9A 2J3LA 2EW8A 5TV2A 4GXRA 4QGBA 4CKZA 1XVUA 2QM8A 1N5DA 2I99A 3OJFA 4LOAA 3PQ5A 5EKXA 3HJUA 3LX8A 5GP1A 1EWYA 2KYRA 2XY4A 3EVCA 3JYPA 5LXTF 3ZZMA 4C06A 4CIXA 2Z3ZA 4PYLA 3OE7A 4NAUA 4U2FA 4XTRA 1EEXB 1AV7A 2E87A 3NGXA 1ESNA 3B9RA 5C7OO 1XHFA 2RGYA 1VL8A 1MIOB 4HH1A 1ENZA 4G37A 5DLEA 4F60A 1KO1A 4DHWA 3QF4B 3P5BA 1R12A 1O0BA 2V58A 1T9GS 3N1UA 5FBKA 4B4DA 2D1TA 2DUNA 4JBIA 4Y2PA 1BROA 3I2IA 4KXUA 4IH4A 5H83A 4JNKA 2B1IA 4XD7D 4ZT5A 3QX9A 2PNJA 3GMDA 2GO1A 4RO0A 2X0DA 1LX6A 3QG5A 3SD7A 2NGRA 1FXWA 1O4VA 4ADSG 1R0ZA 5CAEA 2Q8NA 1XZDA 2IYWA 2ENUA 2WI8A 4P81A 4BZXA 4E7OA 4RY2A 3RADC 4LKRA 5JS6A 4Z53A 1KR2A 5CURA 1IN6A 1NA5A 1K0UA 4HATA 4UTOA 5CGQB 5J40A 2EJBA 3DL4A 3OX2A 4KH1A 3BD6A 1EUCB 4KE7A 3OWHA 4YT8A 3EW7A 1W2GA 2BTQA 2HL6A 3GRPA 4NBWA 2R25B 2NN3C 2CCGA 3BJMA 1U28C 4UM5A 1RP1A 2BHSA 2ACKA 4OATA 5CIQA 3OTQA 3AF0A 5DN9A 2CUNA 3RS4A 4NBTA 1RC8A 3LCMA 3M6XA 2ZBUA 1Y7IA 3ABQB 4W1SA 3RT1A 4HX2A 2EGGA 4Q24A 1Y1QA 4BECA 4C03A 4CN8A 1P91A 3Q9LA 2FOIA 4MVJI 4OMCA 1QX4A 1CE8B 4R3NA 4AS3A 5FYQA 4E5MA 2HZBA 5KWSA 3D6TB 3I52A 2BKAA 3ZLBA 2VDOB 1XYVA 3B2QA 3EQZA 4G6ZA 4LNUA 3A1FA 2JAQA 3NHYA 4LRUA 4M8KA 4W8GA 5EZYA 5KYWA 5K8UA 3GRZA 1YF3A 3E3AA 4UHCA 1CR4A 2Q4TA 3ED1A 2Z1DA 4PG4A 3UH0A 4AROA 4EFKA 5IX8A 3DTVD 5IXJA 3KYDB 1F48A 1P1IA 1RBQA 3VRHA 4DV7B 1YQGA 2V8BA 4TV9F 1MQAA 3AKYA 3DH0A 1T3HA 2DWCA 3RS9A 3SU8A 4EQ6A 5C8VA 1E2QA 4ZI5A 2NZYA 5AWFC 2ID8A 2FPPB 2BUBA 3EXG2 1G8PA 1VCMA 2HMWA 2IU0A 1Z4NA 4FGKA 2CKMA 4ZEWA 2C4WA 3FYCA 4XLZA 5AK5A 2YQ4A 2ZUDA 1QBGA 1UJ2A 2BTOA 3KOWA 1TC1A 2E4XA 1KMQA 3GVPA 4PLGA 1JHYA 1Y6QA 4UQOA 4WLNA 3KJIA 4ZAWA 4O4IB 4WW0A 2QP9X 1TFUA 1WMFA 4RJLA 1YRHA 3MW8A 5CLIA 3VC2A 1XP5A 3KV1A 2EZ4A 3QVJA 4QA9A 4AG5A 3IOBA 3ABOB 2W6CX 3ECCA 5DISB 4CIVA 2M98A 5K6RA 1GUBA 3RIXA 3UUFA 2NMVA 1GUFA 1JBEA 4R1UA 2ZJFA 4R2XA 2VCHA 2W00A 3IAM1 1K4KA 1ZIOA 2JZOA 1C9NA 3HJBA 2OK8A 4JKYA 1TUBB 3HBNA 5BRJA 4G67A 4JVOA 3DNFA 4MQBA 4H4CA 4MW1A 2KJQA 3M33A 3MUOA 3IQWA 5DHTA 1PJQA 2VBCA 2Q3JA 2OCAA 3EZGA 4Z54A 1M2OB 2YR0A 3KZCA 1L5NA 5KWEA 1UINA 2H1RA 3D8TA 4DXHA 5C53B 2P75A 5E8RA 1SY7A 1VDZA 2HU7A 4GLJA 1PZHA 1N9GB 1VE7A 2EFHB 2JH9A 3K1TA 3OCJA 3KQNA 4JGBA 1Y1PA 3U9SA 5A3RA 2ID7A 4PRLA 1JBQA 4KXVA 4TKUA 3QM1A 2PR7A 1CUGA 2AI3A 3E9ZA 3HM2A 4PIPA 4TSFD 4WXHA 1PLKA 3DONA 2OBXA 2EG5A 4RPCA 2Z56A 2ZWPA 1YBAA 5AKEA 3FLEA 1FXUA 3VR4A 1QYXA 2YX1A 3S2GA 1A7KA 3EAQA 1D4AA 4GXQA 3PL5A 4J0QA 3I2KA 2XOKA 3MMNA 4J16A 1FP1D 5ALQA 3SJ7A 1DX4A 4RZXA 2WKPA 1KU6A 2LV8A 2VHEA 3OIUA 5LBIA 4RA6A 3T5TA 1PNVA 3QI2A 2I8LA 1QTIA 2RGUA 3W6NA 3MWLA 3WB9A 3VNUA 4I55B 5IVKA 2E0IA 3G2LA 3PPYA 5DOZA 2XWBF 3ZHCA 4OLBA 4C0QC 4O4LB 4TXLA 4EECA 2HR1A 3CEJA 3WFIA 4IZ6A 4GOKA 2ZYVX 4PAMA 2DY0A 1K6IA 3RVNA 3QE4A 1P31A 3L5KA 3D64A 2HRCA 1CVRA 4OYLA 4QOJA 1EHYA 3ZI4A 2VPYA 3Q40A 3DP7A 2Y99A 4L0QA 4OHWA 4P4UA 4RGQA 2GBIA 1RIIA 2P5UA 3U44A 3PD7A 4YRQA 5HZMA 2PQMA 1Q7GA 4EKEA 1I7PA 2QU7A 1UBRS 3A1EA 1JIXA 1M1NB 1R6TA 2OECA 2CLHB 1SC3A 4HWSA 1Q11A 1L5WA 3KQWA 1L7VC 3C3MA 4K9DA 5LIRA 1GTVA 1H1LB 2ZBDA 4UEJA 5KNDD 2XZDA 4PINA 3UUWA 3AHFA 4WBNB 1H8HD 1M34E 2V6IA 3G0CA 4MTCA 4UHDA 5FT9A 4RAOA 1N1MA 4BY9E 4G36A 2ZZNA 1TGYA 2I7VA 3NFYA 3AQIA 3LQQA 4BNKA 3TBFA 5CFRA 3EEBA 3G5LA 5IANA 3EPJA 1W36B 1DO8A 2ZJYA 3EQ8A 3OTWA 1YXMA 1Q20A 1D03A 1OX5A 2GVNA 2P8JA 2DCUA 3GN1A 4V2IA 4Q9IA 3ROEA 1JDUA 1NATA 1NBMA 4Q7QA 4RNCA 4ZYTA 3DDOA 1KI3A 4NH4A 5CIYA 4Z1MA 4MCHA 1ODKA 2X3YA 1GILA 3L1IA 4HOYA 3RVMA 4Z4QA 5F9FA 2WMYA 1WULS 1HX7A 1LPNA 5AVJA 4DJ5X 5IUJC 1NRXA 3LP6A 1BNCA 3MWYW 4I6JA 4PFJA 4X44A 1Q21A 4IXWA 4L72A 2W8ZA 3RK0A 1QCCA 5JECA 3F6EX 2PH1A 5HJ2A 5DM1A 2OQRA 5CB0A 2UVDA 7AT1A 4J76A 2WJZB 4Z8YA 1OFIA 2XMGA 3ZCSA 3HU5A 5KOIA 4Q21A 1MX1A 4G0QA 3E18A 4U7GA 3IXLA 3RJZA 1GDDA 2H4WA 2O3RA 2XH8A 4REOA 3K9LA 4HRAA 3DMGA 5DWDA 4U2GA 3LW8A 3K6KA 1YS6A 5FV7A 4F0JA 2HMSA 4X3OA 1YA6A 1JIIA 3LGSA 3MLAA 1U1DA 1DAFA 3MSCA 5BN1A 1QP4A 2DHEA 3C6YA 3JVVA 4ID3A 4XEUA 2JK0A 2Z2YA 2ZRAA 4C43A 2O3TA 2V5AA 1YZKA 1PFGA 3WLEA 2HW8A 2V7EA 3SSMA