1UJMA

Crystal structure of aldehyde reductase 2 from sporobolomyces salmonicolor aku4429
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
342
structure length
342
Chain Sequence
AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDMLKQGAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aldehyde reductase 2 from Sporobolomyces salmonicolor AKU4429 at 2.0 A resolution
rcsb
source organism Sporidiobolus salmonicolor
molecule tags Oxidoreductase
molecule keywords Aldehyde reductase II
total genus 116
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ujmA01
2WYVA 3GVXA 2PH3A 3HNPA 1R0KA 2LDXA 1XWFA 4FCCA 4ID9A 5IG2A 1NBOA 1LU9A 3HWRA 3KYCA 3S2FA 1U8FO 4E2WA 4XB1A 3M2PA 1YB1A 4CMEA 4QFDA 3BMNA 2Q1SA 2VNAA 1X13A 4BQPA 2GGSA 4W9NC 1X1EA 4N54A 3RCBA 2VNSA 1KOLA 3DHNA 3WLEA 2HAEA 3K30A 3OF2A 1UXHA 2G17A 3WGZA 3BZUA 4LVCA 4NK5A 3IOYA 1GZ3A 1HTBA 5FEUA 3DL2A 3HDJA 3WMXA 4W99A 1LBEA 3UKOA 4E5PA 3JV7A 1HDGO 1P45A 4JXKA 3ZN2A 4RCVA 2BKAA 3L07A 4E5MA 4BNKA 2DT5A 1MXHA 5I7EA 3D4NA 1CF2O 3RASA 4DIFA 1VSVA 3JQ8B 2E49A 4KTVE 3OJFA 3GLQA 5L7WA 2VHVA 3BMNB 3OJOA 3Q3CA 5ITVA 6LDHA 1I36A 3RC7A 3DZFA 4I8XA 3G17A 4QECA 1QORA 3BMOB 4A2CA 1B7GO 2A35A 3BYZA 5U1PA 3W4KA 4FJ0A 2O4CA 2EGHA 1Y9AA 3IUPA 3E5MA 4E13A 3VDQA 2NVUA 5KOIA 4FFMA 3T7EA 5A5FA 3OA2A 4XYEA 1VKOA 1HDCA 1HDOA 3A06A 3JD0A 5IDXA 4KQWA 4CLEA 2EJWA 4WLNA 2EXXA 1HZJA 3FPLA 1E7WA 1LX6A 3GRKA 3DZIA 3PGXA 2JHFA 4NBWA 3WWYA 4E32A 3O9ZA 2FY8A 1E7SA 2X86A 3QVXA 1J4AA 4JN6B 2Q3EA 4IJKA 3U9LA 1DB3A 4R1NA 3I9NA 3TOZA 5I7FA 2OFPA 1Y8RB 5K9ZA 3JQFA 2PKRA 4D44A 2Y0EA 5C7LO 4OOFA 3ETGA 4URFA 3D3WB 3HN2A 4MVJG 3TL2A 1GQ2A 2C7VA 2ZJ0A 2D0IA 3OM9A 1RKXA 4JLWA 4P22A 1Z75A 1XIVA 2UV8A 4R1UA 4BGIA 2UUPA 3WNQA 4IS3A 3TJRA 3JQGA 3FNFA 4R51A 1AE1A 3KO8A 3MOIA 3NT2A 4MKRA 5DBIA 1NR1A 3ZV4A 5CEEA 3RU9A 3EC7A 3DZKA 1XELA 2NU8A 4CLHA 4J91A 1KEUA 5BNFA 3TF5A 3F46A 4TRNA 1DLJA 4AVYA 2VYND 1UZNA 4LW8A 5GZ1A 1OAAA 1CQJA 4GMFA 4XB2A 3F1LA 3B1FA 3DOJA 1N5DA 2YV1A 4DREA 3GVCA 3CXRA 1HDRA 4NH4A 4P4NA 4PLFA 7MDHA 3CZMA 4ALMA 1BDMA 3PWZA 1GL3A 4OAQA 5F21A 2YHIA 4XJSA 2PZLA 2HK7A 3Q11A 1SZJG 4JGBA 2BMAA 4H7PA 1NHGA 5ENVA 3WYEA 4CV1A 3UXYA 1E7MA 2O2SA 4RQTA 2CSUA 2DVMA 1F8GA 3P2OA 2NLOA 3EUWA 1UXKA 3SBOA 2AEJA 1RM3A 3L77A 4YT4A 5JDIC 3ENKA 2P91A 5KKCA 1E92A 3G0OA 3KM0A 1W8DA 3MZ0A 4MVJM 4LCJA 2GR9A 1CJCA 2Q1WA 4WLEA 1K6JA 4Y67A 5F5LA 3C7CB 5AXBA 1BVRA 2DPGA 3ZV6A 2FPGA 1ZSVA 1YB5A 2CY0A 3WYCA 1LQUA 2P9CA 3LSYA 1E0DA 1WWKA 4IINA 1LSJA 5KVQA 3WWZA 4CM9A 5L45A 2JHGA 1EQ2A 4NR0A 1D1TA 1NASA 3PP8A 2NV6A 3GFGA 1EVJA 3GN2A 2FSVA 3FI9A 2W2LA 4IDDA 3UCFA 4NBVA 3RQSA 1V35A 5HTOA 1U5CA 1JU9A 2G1UA 3C7AA 3I5MA 1YS4A 3UF0A 1SB9A 4ZU3A 1LI4A 2B37A 2RHRA 4J1QA 1EMDA 3S55A 1C1DA 3AM4A 1IOLA 1ZMOA 5G4KA 3ASUA 4DQUA 5BSFA 2OBNA 4RVDA 4DIOA 1XSEA 2O3TA 1DJNA 4YRDA 2I65A 4D3DA 1EEHA 3HDYA 4XDZA 3QV1A 1IULA 1SEPA 2Q4EA 1GEGA 4QSMA 1C0IA 4OQZA 3MWEB 1I24A 4DPKA 3GY0A 4R4JA 5DOVA 1JLLA 4HWKA 2BI7A 4UVDA 4IJVA 3IKTA 4ZQFA 2AW5A 5A3VA 1HLDA 4ITUA 4M1QA 3IJRA 3TZ6A 3PYXA 2EERA 5JE8A 2BLLA 3U62A 2CVZA 4KDEA 1N7HA 5AOVA 1B26A 1K6XA 2VYVA 2J3IA 3QP9A 2ZQZA 2JFGA 4R5MA 4WOJA 1U3VA 1N1EA 3Q9NA 2FWMX 1YBVA 1YONA 4J49A 1ISMA 2NVWA 1P1FA 4IDFA 3H2SA 2ZQYA 1GCUA 3GPIA 2ZTLA 4Y6PA 1O8CA 2Q45A 3LT2A 3UN1A 4RLHA 2NACA 3GRPA 4D3SA 3VHRA 4XWYA 1RYEA 4MDHA 4E12A 2UAGA 3M2TA 1DAOA 1YL7A 2CVOA 1B8UA 1M66A 1MX3A 1E1KA 2Y0CA 1IHXA 1T25A 1U7HA 3WB9A 1ISIA 3FN4A 4BO9A 5EPOA 3GMDA 2GPTA 4OM8A 3A1NA 5ICSA 1I3MA 1YDEA 2Y1OA 2C0CA 5BSEA 3GZNA 5F1PA 1LSSA 1AUPA 1YOVA 4IBOA 3VH3A 3PRJA 4YJFB 4AJNA 1U28A 3AUAA 3W8FA 3ZV3A 1U2DA 3LQFA 5JAQA 4UULA 1YL6A 1GV1A 3HUDA 2YHUA 1CEQA 4M87A 1HE4A 4FDAA 3ROMA 5G4LA 4TRRA 5JNLA 1NFQA 3EMKA 3JQ7A 1GD1O 3M1AA 4O59O 4CMGA 5KVCA 2RAFA 3DMTA 4PG5A 3L4BA 2QQ5A 4CR8A 1GV0A 2JD0A 3H9JA 3PIDA 3VDRA 4RPKA 5A9SA 1GQQA 2YV2A 3AOEC 4ALNA 1HKUA 3UCXA 4PLVA 1JW9B 5C3MA 5ADHA 4UEOA 3CSDA 3AY3A 4BB6A 3GVPA 1H2HA 4GMGA 2O3UA 2GZ3A 1MGOA 1LQTA 1I8TA 4TVBA 2AEMA 1B15A 5G2OA 4J4HA 3SLGA 4WASA 5JY1A 5JS6A 3AI1A 3C1OA 2Y1EA 1Y1PA 4IUYA 1HSOA 1W4ZA 1PGOA 3JQ9C 3QIVA 1ZIDA 4P8RA 3EVNA 2UUOA 1VJ0A 2B4RO 3ASVA 2BI8A 3TZQA 1B16A 1LEHA 2C54A 4UAGA 1U7TA 1XQ6A 3PHJA 3D4OA 3WLFA 4CMJA 1JTVA 3SVTA 1RJWA 2P68A 5JDCA 1NVMB 3RKRA 3K2EA 3RIHA 2C2XA 1L7DA 3RD5A 1ENZA 2ILTA 1QLHA 4L74A 2QYSA 1GTMA 1GYRA 3OH8A 3DAPA 2J3HA 1J6UA 4Q39A 3CMCO 4PLYA 3WNVA 4B8WA 4B3HA 1KVQA 2EHDA 3VVCA 1R12A 4DPMA 1F12A 4D3FA 1GCOA 3WYBA 4DLBA 1LA2A 5LCXA 4J7XA 5JYEA 3PQDA 2DBZA 2PR2A 4WJZA 3TZHA 4BMNA 4HY3A 1EFLA 4R69A 3OHSX 4QO8A 5COBA 2OGUA 1FDSA 3LDHA 4Y98A 3FBGA 2YYYA 4A73A 3ZGYA 3KBOA 1JVBA 1JQBA 4JIGA 3H9UA 4UEKA 2NUAA 1VI2A 4E3ZA 3JQ6A 1ZUD1 2HQ1A 3D64A 5FYDA 4TZTA 4BMSA 4IY1A 3ZWXA 3KUXA 1PL6A 2E4AA 3H9QA 4RGBA 4BO6A 4U0KA 3JQCA 2I3AA 1K5HA 3K9QO 1R15A 4FJ2A 4WK6A 2CUKA 2GO1A 3NEPX 5I7SA 4K6CA 5DBFA 1CRWG 5IAAA 2C82A 5B1YA 4D7AA 3ZNPA 3LLVA 1SPXA 1A9YA 2B4TO 5AXAA 1IB6A 3RU7A 1PJQA 2QZ9A 3CKYA 4FN4A 4UVGA 4FD3A 3LLSA 4O6VA 3QJ5A 5L7YA 4DVJA 2FMUA 4Q3NA 3KETA 1IHYA 1P31A 1DFGA 4XGKA 1FDTA 3W6ZA 4EZBA 3TQHA 1KVSA 3ST7A 3IL2A 2C07A 1PTJA 3PFWO 2Q49A 4OSPA 5TLSA 2OZPA 2XPCA 4NZ9A 4YACA 3RJ5A 3PXXA 4Z0PA 5THKA 1A7KA 4EUHA 3GUCA 2FPPA 1OFGA 1XCBA 4NK4A 2YUTA 3MTGA 9LDTA 1ZK1A 4AJEA 3IC5A 5IN4A 5L53A 3AOEA 3JQAB 1MC5A 2C5EA 2X9VA 3QRWA 4PFJA 3ZWNA 1I0ZA 5DN9A 1H0KA 2V6BA 2ZCVA 3QWBA 4DIBA 4IIUA 4S1VA 3FNGA 3R6DA 4PLHA 5DDIP 3GGOA 2ZB8A 4QTZA 3LU1A 3D3WA 1O94A 4J2HA 3AY6A 4CLOB 1T2EA 2CD9A 4E33A 1GUYA 3GFBA 4IGFA 1L7EA 1Q7BA 3O38A 5EJ2A 3NDJA 4FBGA 1VJ1A 3PJDA 4BNGA 4DYVA 1LC0A 3H6KA 1LLDA 2D3TA 3K31A 2AMFA 3A28A 4WEOA 4KUHA 4RF5A 3SC6A 3W6UA 1UAYA 1Z7EA 3EY4A 4NHEA 4OO3A 2HMTA 2WD7A 4B4OA 3DONA 4E5NA 4QFCA 4ALKA 3R3JA 1DFIA 4AJOA 2GASA 1FJHA 4PZEA 4NFYA 1RPNA 5THQA 4EDFA 1GU7A 5G0UA 1MFPA 1ZO8A 3EVTA 4RVSA 3FHLA 1YQDA 1ML3A 3QWAA 4A26A 4CM4B 2DFDA 4CMKA 1LTHR 3F1KA 5A5EA 1HDYA 3QHAA 4NNJA 1EUCA 4A7PA 2WD8A 4ND4A 3EK2A 1ENYA 1C0LA 3KYBA 1TT5A 3WJ7A 5JMPA 3PHLA 3ZU3A 4BNIA 1WPQA 3ULKA 2ZTVA 4M89A 1NFRA 4HP8A 3SLKA 2WMDA 2D8AA 1ZBQA 3CIFA 1JAYA 4II2A 1EVYA 1ORRA 1ADFA 3DFUA 3TL3A 3ZWBA 8ADHA 4NMHA 3ADOA 2EG9A 4GKBA 2O48X 2C20A 4ZRNA 4NPCA 4JQCA 2DTXA 2EF1A 3JD1A 4PGFA 3DZGA 5ILOA 3GN1A 4FQ8A 1DAPA 1PJSA 1QYVA 1GUZA 1YQXA 3W1VA 4AJ2A 2RHCA 2PGJA 3KLPX 2HUNA 5C7OO 1YJQA 1NQ5A 4UVEA 4M49A 1NPYA 4R3WA 3O8QA 3UH1A 5I9MA 4DYDA 4RV9A 1P0CA 3D7LA 1E3JA 3KHUA 4MVJD 1UJMA 3FPCA 2DQ4A 2AQHA 3OA0A 3ADPA 2BD0A 3ZWVA 5A06A 3RKUA 3GG9A 1UP6A 1UZMA 3DMTC 4QXMA 1F8FA 3V2GA 3RUDA 1SMKA 1S6YA 5FI3A 3UHAA 3JYOA 3FBTA 3SC4A 2E6UX 3GDOA 5TGDA 3CTMA 1P3DA 4FFLA 4GX0A 3QW2A 4GLOA 1BXGA 3MTJA 2VWGA 4GSKA 4GSLA 2W2KB 4EJMA 2JFFA 5F1KA 1YWGO 4WCFC 4KZPA 3UW3A 3C1AA 5JC1A 2R2GA 2OP0A 1LDBA 2WJPA 2GDZA 4D46A 4EW6A 5TS3A 4WCDA 1ZVMA 2D59A 3EZYA 4HFMA 3DBLA 1F17A 4O0LA 3VZQA 1OC4A 1P0FA 4BO1A 3WJAA 4DPLA 4FS3A 1QP8A 4ND2A 4E4YA 1W6UA 3U0BA 4HV4A 3KYCB 3WQRA 1LLCA 2PZJA 1O89A 3DO5A 2J6IA 1NTOA 4K6FA 3CE6A 4O63O 2VHZA 4RDIA 1F0YA 2Y66A 1EFKA 3PLNA 2X23A 2RH8A 4GBJA 3ZHZA 4GKVA 3PFFA 5JC8A 2AQKA 3HHPA 4XQEA 5I9LA 5K0ZA 5TIIA 4PG7A 3WGQA 5JY6A 4WGGA 4XIJA 4LRTB 5LDHA 2HLPA 4BGVA 1NXQA 4R3NA 1UP7A 1JKFA 4BO3A 5KJ6A 4X54A 4MOWA 4N18A 2BRUA 4I5EA 1DLIA 3GQVA 1PR9A 1X1TA 3IDSA 1YB4A 1BVUA 2FR0A 2Z95A 3N58A 3BHIA 5TJHA 3OBBA 3G1TA 4NBRA 5C7IO 3X2EA 5U4QA 4IZHA 4DXHA 3HADA 1Q1NA 1Y8RA 1E6EA 2HJSA 5DCUA 1EQUA 2NM0A 3DZJA 4BNUA 3AOGA 4OYRA 3RUFA 1B8VA 1IUKA 1TA4A 3OECA 2JAHA 1TT5B 1H5QA 1V3UA 4IXWA 4AFNA 1WMBA 4LK3A 3PWSA 4BKPA 2ZTMA 1C0PA 4IMRA 2CDAA 4U6SA 4H15A 4BNXA 4YVFA 1GDHA 3WFIA 2XAAA 4HFJA 2PZKA 1QV6A 5DP1A 2EW2A 4YQZA 4FPXA 4E2ZA 3U5TA 3GHYA 3E48A 1X7DA 5JMWA 2NSDA 1PS8A 4IQ0A 2YY7A 4YAEA 4BNVA 3AU9A 2AA3A 5T6BA 3W8DA 1P74A 4IZIA 1DBVO 3OIDA 4RVFA 1EUZA 1I3NA 4E6PA 1GADO 2NQTA 3E1KA 2I76A 5EIOA 1DRUA 4RPHA 4WNIA 4F6LA 3H9GA 3ZH2A 2PH5A 1GPDG 3OQ1A 1WP4A 3PQEA 4DWVA 4PG8A 3VVBA 4XR9A 1YOVB 3FTPA 3VC7A 1MFZA 4BNWA 2JCXA 4BO2A 4AJKA 2R6JA 4MKXA 3WGHA 5IZ4A 5ILGA 1KEPA 3U4HA 4J3FA 1JVSA 4UEJA 4JK3A 2A9FA 4AICA 3A4VA 4IIVA 3ITDA 4JBGA 4XQCA 5CEFA 1M6HA 2DKNA 3KTDA 3SJ7A 4BNYA 2D1YA 2RIRA 2X5OA 1H6BA 2E82A 4BV8A 4CMAA 1XG5A 5B12A 4ZD6A 3FNEA 3KLMX 3K8ZA 2Y05A 5TX7A 2XF8A 3AW9A 3VZSA 1JKJA 1JAXA 4TSKA 2VZ8A 1DC3A 4XJTA 2VQ3A 4CM8B 2O3QA 3BTOA 3S1LA 1GQYA 5AXCA 2HRZA 4BNZA 3ZWPA 1KBZA 3JD4A 3F9IA 3QSGA 3JYQA 5EINA 1LDGA 3BXXA 3FSRA 3OICA 3PDJA 5CPBA 3JQFC 1DJQA 5ENDA 1F06A 1ZJYA 2BFOA 2YQ4A 4CQMD 4BGEA 2P9GA 4CR7A 3ZHYA 5BNTA 1UH5A 2YFQA 4K26A 4WECA 2CVQA 4HNGA 1I01A 3EW7A 1A9ZA 1PQWA 4P4GA 5L9AA 4J2OA 3ZV5A 3SEFA 1H6AA 2Q4BA 1R16A 3C85A 5G0TA 3NT5A 4YWJA 2GCGA 4Z9XA 2NTVA 1NFFA 3IP1A 4B79A 3ZWCA 2I99A 1B8PA 2NU7A 1XHLA 1G6KA 2YZ7A 1PU2A 4KOAA 5C37A 3JQAA 1ONNA 4JBIA 5KJCA 3B1KA 4CQMA 4OGWA 1U4OA 4C7JA 1OI7A 1EK5A 1I3LA 4CM8A 2A4KA 4YJDA 3UOGA 4CL8A 1DOHA 5KTKA 8LDHA 3R3SA 2RCYA 4FSHA 1EE2A 1GYPA 3GVHA 3M6IA 4QT0A 1H6CA 5I8WA 4GPD1 1X7GA 4FJ1A 3L6EA 2Y1DA 3SXPA 2X6TA 3G1UA 3ZWWA 1NPTO 5JFOA 5ER9A 1I2BA 2UVDA 4D43A 3Q9UA 2ZTUA 4CMBA 1DRWA 2Z1NA 2ZJ1A 2J8ZA 2OOSA 4TMFA 4D0RA 1D7OA 3IIEA 2VOJA 3AK4A 4IDCA 1CYDA 3QVOA 3UICA 4AL4A 4YBZA 1NNUA 3CMMA 3WTCA 4WOKA 1FDVA 1DIAA 1HF3A 5CG1A 5KJ1A 4XYMA 5KKAA 4MVJP 1JKIA 4ND1A 1E1LA 2PFGA 4NIMA 1MG0A 4C7KA 4MP6A 3FR7A 5IDQA 4W9NA 4W4TA 3UUWA 2YFHA 1Y8QA 2PZMA 3VZRA 3DBVO 3JCZA 1U2GA 1PR3A 2EP5A 3JSAA 4GAEA 5T5QA 4GH5A 1HE5A 5AXDA 3U4CA 4DBZA 4FOOA 3ORFA 3TSCA 4ALIA 4BHTA 2PGLA 1QG6A 5A3JA 4G81A 1CWUA 1M6WA 1HWYA 4IDEA 1EUDA 4K1LA 1U4SA 3DQPA 1BW9B 3MJVA 4Z6KA 1QMGA 2O7SA 4JP3A 3ITKA 4HXYA 3ANNA 3GC6A 4FFOA 4UUNA 4OHUA 2HDHA 2H63A 2P2SA 4WLUA 4CLRB 1Q0HA 1XEAA 1ZK0A 1DO8A 5GZ6A 3WGGA 3Q2IA 2J5KA 2B69A 4MVJF 4EGFA 4J1NA 2W90A 4CJXA 3SJUA 3DC2A 4ALJA 1U8XX 4LSWA 4OJNA 1K0UA 2DC1A 1V8BA 1QXSA 3EYWA 3JD3A 3LT1A 4P38A 1E3EA 2HK8A 4W6ZA 3K96A 1NM5A 3NV9A 4YEDA 1OMOA 1MA0A 4N5LA 1PL8A 2WD7B 1MV8A 3EZLA 3JYLA 1FMCA 5TT1A 5KIAA 3NT4A 3DZBA 1SOVA 1GZ4A 2IRWA 1ULUA 4RORA 4I1IA 3M1LA 5LC1A 5TT0A 3KYDA 1K89A 3BA1A 3GDFA 3QWIA 4WE3A 4BV9A 4D42A 4WPGA 4H16A 4RLSA 3HB4X 4BNFA 4Z0TA 1H94A 2VUSA 3KOUA 4DUPA 4XX0A 4Q3BA 1Q7GA 4EJ0A 3HQ4O 4AJLA 3AM3A 3PLRA 5CDYA 5JO9A 4YAIA 2IE0A 4BL5A 2V6GA 4OSOA 5DULA 4BO4A 1JWAB 4IMPA 4ZA2A 5EN4A 4IJWA 1V3VA 4UUPA 1PQUA 1XLTA 4NJMA 3LYLA 4NDNE 4U5QA 3KZVA 3PI7A 3KB6A 4R1TA 5T64A 4Q3AA 1P1JA 1I33A 2PWZA 3E5RA 3E8XA 3I1JA 4IJUA 4RVHA 2GSDA 2DBVO 4GL4A 1HZZA 1V9LA 5T67A 1MP0A 4HUJA 4MP8A 4CM4A 1WNTA 1WMAA 2AHRA 3BMQB 4WEQA 1AGNA 1HLPA 1I10A 3PHHA 4BNNA 3RFXA 3PHIA 4CLDA 1UXIA 4M8SA 4L0QA 3FCOA 4TROA 3AI2A 5A9TA 1N2SA 3ONDA 4YDRA 3V2HA 3QVTA 5DCYA 4YJGB 1DC5A 5B4VA 1PJ3A 1VPDA 2LDBA 4NG5A 4Q9NA 3BTVA 2HMWA 3H2ZA 4KTTE 5HWSA 1KY4A 1I2CA 1PGPA 3V1YA 2W8ZA 1TVEA 1BXGB 1RM5A 4ZICA 4IPTA 3VPSA 1Z45A 1X7HA 4BKUA 1YL5A 4RL6A 3H4VA 3H65A 4CLOA 4ZRMA 1J49A 1PGQA 1DIRA 2FZEA 2YW9A 4W82A 5DCWA 4J90A 1ZMTA 3CZRA 3JQBC 2ZYDA 3MCVA 3S2GA 3NYWA 3BTUA 3D5QA 3ANLA 3KVOA 3L6DA 3KSDO 2AE1A 1KS9A 4RF3A 1QR6A 1LSOA 2CF6A 3QWHA 5BNIA 1C1XB 9LDBA 2I9PA 4TRJA 2PKQP 4L9RA 1BDBA 4F45A 5IDWA 4J0EA 3JQ8A 4DGSA 1MLDA 3ZWMA 1ISHA 2YDXA 3C3XA 4KWHA 3GVIA 3INGA 3ONFA 4K28A 4ZGWA 2BGKA 3WSWA 2EP7A 3BAZA 1GEEA 1F14A 2GLXA 3HDHA 3TWOA 4WCFB 2JD1A 1V6AA 1DIGA 4O1MA 3Q6IA 4OXKA 4I5GA 2A94A 1LLQA 3PIIA 1JWBB 1VLLA 4RZHA 1H9BA 2Y0DA 5CDSA 5K6AA 1QYWA 1MUUA 2ET6A 4YJHA 5ITWA 2XXBA 4J16A 4ND3A 4BKQA 3I52A 4EJ6A 3L6OO 2R00C 3KEOA 1NAIA 1C1DB 3K92A 1E5QA 2VUTA 3GMSA 3QVWA 5KJFA 1GUFA 1U3WA 3DEYX 5IXSA 1M75A 1EVIA 3I83A 2O50A 1T4BA 1WLYA 3W4JA 3IAHA 2P9EA 3ROKA 1Z6ZA 5IXYA 1T26A 3MJTA 1G1AA 4ESOA 4YRAA 1KVRA 4J1TA 2WYWA 1P77A 3NTRA 3OQ6A 4XA8A 2JCVA 4Z9FA 1I30A 5JW6A 4R41A 1Z7BA 2GN9A 1N7GA 1NAHA 3RROA 1R0SA 3JQGB 4XYGA 3QY9A 3ROQA 5KVSA 3AFNA 5AVOA 1YBMA 1U9JA 1SB8A 2OORA 2QRKA 2Y1FA 3WQSB 3ONEA 1O0SA 2V6MA 3HZZA 1Y6JA 2VZ9A 3DBRA 1XYGA 4PLCA 1HETA 2H9IA 2C59A 2XXJA 4LISA 4EEZA 1VRWA 4FC7A 1QSGA 5JBIA 1ZK2A 3QWFA 5FFFA 5BQFA 3GZ4A 1XKQA 4CR6A 1BHSA 1OZAA 5L51A 5EERA 1R4MA 3GHHA 2Z1MA 1E3LA 4RPJA 2FN7A 5CPFA 3ETEA 1NP3A 1A5ZA 4QQRA 1E5LA 4DQVA 1B2LA 1IZ9A 3ZHXA 3EDMA 4FFRA 1ADGA 1I3KA 1UP4A 1UR5A 2C2YA 2ZYAA 3LK7A 1DHRA 2R00A 3FF4A 1PJBA 3PQFA 1O95A 4M86A 4BS9A 3DBLB 2WEKA 3K73O 2E48A 4E0BA 1LDMA 2PTGA 4R1SA 4YT5A 5CDUA 3PZRA 4XYLA 1ISJA 3X2FA 1P33A 2GZ1A 2HMUA 3BMOA 1SAYA 2X4GA 3VZPA 1A72A 3F6YA 4CODB 4J1SA 5A9RA 4Z3KA 1P1RA 1YE3A 1YRLA 3FRJA 4GI2A 5HS6A 4E5KA 5LDGA 2IDZA 2YDYA 2NVUB 2AG5A 5JCXA 1KYQA 3H9EO 4CM1A 4RVGA 2CDBA 5TNXA 2FHSA 3H3FA 4DQXA 1ONOA 5G0WA 4BB5A 3RC1A 4JROA 4TZKA 1H93A 3G3EA 1ZNQO 1AN9A 4A0SA 2FPIA 3GGPA 2BGMA 4FW8A 4CM3A 1PWZA 3PDUA 1Z82A 3KSUA 4ZN6A 1CQIA 3MJEA 4EBFA 1K3TA 4R54A 4B4VA 3MJCA 3K5PA 5TC4A 3STHA 2P5YA 3TFOA 5COAA 4DMMA 1WAMA 2PA3A 5KJEA 3WOHA 4LSMA 4A5OA 1GAEO 3HJAA 5K6AC 2FP4A 4IDBA 4R5HA 4DLAA 3I9KA 5CHEA 2Y99A 5IDYA 2FR8A 3PWKA 1ZZEA 3V5NA 1NYTA 1ARZA 3LVFO 1E1NA 4U0JA 4DRYA 3FTNA 1WDLA 2OUIA 3OMLA 4LGVA 4PN3A 1PJ2A 2E37A 1UAGA 1ZSYA 3OJ0A 3GZNB 3HSKA 3U4IA 1PGNA 5GMOA 3LT4A 1Q2XA 3TZCA 1O5IA 2FRDA 1UDAA 4N7RA 4ZQHA 1D4FA 4CMHA 1HE3A 5A4DA 2DUUA 5TF4A 2UDPA 1X0XA 3ETDA 5I9NA 2TMDA 1E7RA 1Z74A 1HT0A 1MC4A 2W98A 1N92A 3JTMA 4GQAA 1WDKA 5FWNA 3RBVA 4Q3EA 5TQVA 5L4SA 3L0DA 3BHMA 3I6QA 4BNMA 3F3SA 4BGUA 5HRUA 1PS9A 1SNYA 2J3KA 3FWNA 1DSSG 3QLJA 3GOHA 4PRKA 2D5AA 1VKNA 4XR4A 2Y1CA 4PZCA 1N9GA 2H1SA 2Y93A 4GLLA 4RJTA 4JJGA 2QX7A 4YAKA 4HFNA 1RWBA 1FDWA 2JJYA 3I4FA 3EAGA 3F47A 3WFJA 1PS0A 1HDZA 1DXYA 2OHXA 3DDNA 4RDHA 3D0OA 3DMYA 4CQMB 2J3JA 3GPDG 1QLJA 3PZBA 2ZK7A 2DTDA 3LC2O 4NI5A 4XCVA 2B0JA 2X22A 1VL0A 3WG9A 4NFSA 1T2FA 4HNHA 4ONEA 1YGYA 1ZKMA 2V65A 2X1HA 4OXNA 4AG3A 3I6IA 3C1TA 2AQIA 2VWHA 4F3YA 5A9SB 4PG6A 4BO5A 2WE7A 5JDIA 4BQRA 1KERA 1E7QA 3HE3A 5DOZA 2VCYA 4CQLA 2SCUA 1J0XO 1XR3A 1NHWA 3VH2A 2WM3A 1WVGA 2CNBA 4XGIA 5JPIA 4GWKA 2VRCD 2I66A 2O4UX 1YKFA 3W8EA 3PEFA 3LC1O 1O9BA 4CMIA 4CLRA 3JD2A 3GR6A 7ADHA 5MGBA 1A4IA 1SEVA 1T1SA 2PV7A 4CPDA 3DAGA 2P4QA 5AQ1A 3PVZA 4PCVA 3KRTA 3T4EA 4Z0HO 2O23A 4PLPA 4ZQEA 2GN8A 4YCAA 1IY8A 3GNSA 3LF1A 5EESA 3S2IA 3F4BA 4YA6A 3CPSA 4PIVA 2RH4A 3K6JA 3VTFA 1ZEJA 4LRSB 4QO7A 5G0VA 3OETA 1E3IA 1PIWA 5F5NA 5ICMA 1L1FA 1NQOA 2NTJA 4ALLA 3WDSA 2P5UA 3PPIA 3TFQA 5JSFA 3V1UA 4AJPA 4MO2A 2EKLA 3HFSA 3BTSA 1TT7A 5HS4A 1V3TA 3ZU4A 2NU9A 4JX8A 3RUIA 1GR0A 4CMIB 3INTA 4EEXA 3RWBA 4UREA 1KETA 2GERA 3W4IA 1I32A 1KVTA 4RZIA 4GX2A 3DXFA 3NGXA 3AUTA 4B7CA 5CEJA 1IPFA 4E31A 4UUMA 1KEWA 4Y9DA 1VM6A 3DR3A 1DPGA 1LUAA 2O3JA 4H3VA 3CH6A 3ZNQA 1CERA 1HYEA 1TLTA 4B4WA 1LC3A 4RPLA 4CQLB 3COSA 2J5RA 1WDMA 4F6CA 4XKJA 1N1GA 1NWHA 2ZKLA 1M2WA 1PWXA 1Y5MA 4LMRA 2I6TA 4DA9A 1O6ZA 2QRLA 5EL0A 3AWDA 3U09A 2B36A 4YB8A 2WE8A 4AJJA 3E6AA 3WX0A 5L4NA 1HL3A 1E7YA 2Q1UA 2Y68A 1ZH8A 3OJEA 1UUFA 2NNLD 3I23A 4DC1A 2DLDA 2Q50A 4RO0A 4OKNA 3ON5A 2VYVD 1IE3A 2O3SA 3OFSA 4NJOA 3PGJA 3AY7A 2EIHA 4K9DA 1VC2A 4CV3A 3OSUA 5EQFA 4BNJA 1DRVA 5L95A 4FFNA 1H9AA 3DFZA 2Q46A 4KP7A 2J5QA 3E18A 3PYLA 1VL6A 1N9GB 2PNFA 1T24A 4N5MA 2VZ0A 5FF9A 4BVAA 1W0CA 1BXZA 3L4SO 1UZLA 1VJTA 3HB5X 1PZHA 5L3ZA 4ROSA 4AJ1A 1HYHA 4PG4A 4PZDA 2O7QA 2YV3A 2O3RA 5CDGA 4IGEA 3WR5A 1P1HA 3MWDB 2VHYA 1XU7A 2NU6A 3DHEA 4CMEC 2X0NA 2NQ8A 1Y8QB 2A92A 2GZ2A 5IN5A 2GF2A 2PD6A 1W73A 1TB4A 2PLAA 3D5TA 5GY7A 1G0OA 3CINA 3L9WA 1BMDA 3GNTA 3NDIA 3DAFA 2B5WA 4CM9D 1WZIA 3D3EA 2G82A 5FI5A 3I9OA 3PHGA 4L4XA 3JQDA 2PD4A 4CUKA 1TXGA 5CFZA 2WWRA 1BTOA 4QUKA 4J0FA 2JAPA 2B5VA 4JJFA 1PJTA 2D5CA 3I9JA 1LRJA 1PL7A 1WZEA 3DWFA 1SCUA 1YH3A 1LXCA 3IJPA 1IZ0A 3RVDA 4KUEA 3PJFA 2P4HX 1Y5RA 3NX4A 1E6UA 1KVUA 2BGLA 1LJ8A 4L4RA 4ZJUA 4S3MA 1V0JA 4BIIA 5A1TA 1E3WB 1LRLA 2HRBA 4INAA 2DFVA 3IQDB 4PLGA 3DB2A 4YQYA 4YAJA 5HBRA 4CM5A 1LLUA 2QIOA 3H5NA 5F3RA 3C24A 4OOEA 1RYDA 4CUZA 2EWMA 3PJEA 3K2BA 1P44A 3RBZA 1ID1A 1ZCJA 4HFRA 2Y1GA 2VTEA 3VAZA 3R1IA 3PYMA 4JCOA 4TQGA 3WQQA 1R37A 1NWCA 3JQBA 4XYBA 4XRRA 1E6WA 1DIBA 1QV7A 4N5NA 4R9RA 3BMQA 1KC3A 1C14A 4Z3DA 3H8VA 3ZU5A 1P1KA 1P1IA 3GAFA 4LCEA 4FB5A 5MDHA 1B3RA 3O8QB 4RF4A 5DBGA 2GNAA 4MINA 3C8MA 1AHHA 2QG4A 2VTDA 1LSUA 2BFPA 5GZ3A 1X0VA 4E21A 3JYNA 4NBUA 3DZHA 3ZNNA 4BO8A 2OMEA 1YVEI 2GN4A 3NKLA 5A02A 5TRTA 1YQGA 4YJGA 5JO0A 3U4DA 5T8KC 3TZKA 2B4QA 4IDAA 1HSZA 3NTQA 4FR5A 2JCYA 2HCTA 3U49A 2IXAA 5B37A 1DIHA 2GUGA 3Q1LA 4J6FA 5TJ9A 3QE3A 3RFTA 4CLXA 5EQDA 5CDTA 1BG6A 1Q7CA 4IDGA 2VT3A 4BKOA 2I5PO 1H6DA 1A27A 3R0IA 4ZHSA 2D2IA 3E82A 3GT0A 2W2KA 4IS2A 3KXDA 1DC4A 3D4PA 2VWQA 3NTOA 3RAJA 2VUUA 3H5AA 2Z5LA 3RUEA 4DTIA 4P4LA 4U6QA 3RC9A 4HX5A 5CG2A 1HXHA 2C7GA 5CP8A 4NQZA 4WNCA 4EYEA 3RUAA 2BFAA 1QYXA 1E3WA 4M55A 1QYCA 5BSGA 4JBHA 2HSDA 4ND5A 1B14A 4G5HA 5G4KB 4DLLA 3AFMA 1DEHA 1U1IA 4MVJH 1PZFA 3BMCB 1CDOA 1UDBA 5DP2A 1YJ8A 3BHJA 4L75A 2X9NA 1DC6A 4MVJI 3WSVA 1UXJA 3QVSA 2X0IA 4XIYA 4EUEA 3ZHBA 3FD8A 3RUCA 3VKUA 4U7WA 5L40A 3VKVA 1B0AA 1R4MB 2X8LA 4E2YA 1ONPA 3I9LA 1YBAA 2PK3A 1KC1A 3B6ZA 4Z9YA 4DC0A 2AG8A 5ER6A 4BNTA 2W2LD 4KMSA 2G76A 4LVUA 1ZK3A 5A05A 2H5LA 4R68A 2ZB3A 4OKIA 3RUHA 5A03A 2CF5A 3OQBA 4R9SA 2B35A 3IKVA 4Q3CA 4WUVA 2JD2A 3H3JA 4XDYA 4QX6A 4WLOA 1LNQA 4M54A 2DTEA 3UVEA 3CEAA 1Q0QA 2AEFA 1VSUA 3GF4A 4Q3DA 5DZSA 1GFSA 3WBBA 1A4UA 1D3AA 2B83A 1QYDA 3DOCA 4FGWA 1E77A 1SBYA 3B1JA 4WCFA 3RJ9A 1KY5A 1AXGA 1NPDA 3E9MA 2C29D 3QA9A 1ZW1A 3FR8A 2G5CA 2UYYA 5H81A 4EI2A 1CETA 3VOSA 3KV3O 3AM5A 1PJLA 1ENOA 2FR1A 3VPHA 5U9CA 1IPEA 3A14A 3V8BA 1BWSA 2PGDA 1LDNA 2EKQA 2GN6A 3VH4A 4YR9A 4MIEA 4YJFA 2CMDA 2Y67A 3MJ4A 4U8GA 1EZ4A 1QKIA 2ZB4A 4FGSA 3WMWA 1H2BA 2HJRA 2HMVA 4GVLA 1K6IA 4WLVA 3B70A 3BMCA 3O03A 2VRCA 3OJLA 4J9VA 1G0NA 4BNLA 4BO0A 2YJZA 3I9MA 1ZFNA 2D4AA 2Q99A 3O4RA 1PJ4A 1ZSNA 4TKMA 1VL8A 2PD3A 1MB4A 4II3A 4Y6SA 2YQ5A 1R0LA 4TVOA 5B4TA 1XGKA 3ANMA 2OO5A 3WIEA 3GGGA 4HKTA 4CL3A 2VN8A 4ZQBA 1P9LA 4E5YA 2NWQA 3LC7O 5HA5A 2ZIZA 1LDEA 2VRBA 1PQPA 4RQUA 4FOSA 1N8KA 4J43A 4L4SA 4XQ9A 4BMVA 2OBYA 4L8VA 1EK6A 4YT2A 1Q0LA 2YHIB 3DTTA 4XRGA 2GYYA 1T1RA 4ZQGA 2TMGA 4BUCA 5JYDA 2G0TA 4G65A 2X5JO 2IYOA 5BT9A 4ILKA 2ZB7A 1AHIA 2CDCA 2DU8A 1BXKA 3MEQA 4IQGA 1XDWA 3P5SA 2C5AA 4D79A 4YTEA 4BNHA 4B3IA 1IL0A 3ZCXA 3MOGA 1MG5A 4NFHA 3WGOA 3Q0EA 3DBHB 3NUGA 1SOWA 2GD1O 4GVXA 4OH1A 3FNHA 1OC2A 2BH9A 4R16A 5JCJA 5BSHA 2QW8A 2H6EA 2AXQA 4PVCA 3AUUA 4HADA 4YAGA 5HM8A 4FFPA 4JNKA 4BKRA 1VE9A 4FIZA 5I7VA 1NX6A 4YXFA 1LRKA 2DM6A 1NVTA 2DAPA 1ZXLA 3HN7A 3PJGA 4TWRA 2X7HA 4W7HA 4JJIA 2ZATA 3ZWYA 5JAMA 2HKIA 3P19A 1M67A 1Y7TA 2IZ1A 4UVHA 2ZYGA 3RFVA 4CUJA 3G49A 3H7AA 3T7CA 1CIVA 1I5RA 1EE9A 2BFMA 2WTBA 3NJ4A 4NU5A 3ZI0A 4AJHA 4MVJE 3UGKA 4F46A 4KUGA 1ADCA 2X58A 3AI3A 4GX5A 4J7UA 1KEVA 4AJ4A 2CZCA 1T4DA 1FDUA 4I9NA 4J9UE 4GWGA 4UUOA 4I9HA 3E03A 5H82A 1ZJZA 1ZXBA 1C3VA 2QRJA 4CMCA 1HDXA 3DBHA 3P7MA 5IJZA 3S2EA 3WICA 1ADBA 1HYGA 1ZEMA 2EW8A 4XZ3A 3HFGA 3DBRB 1NQTA 1E3SA 1S7CA 3EHEA 1FK8A 2VOEA 1GPJA 3GH3A 4KQXA 5T8KA 3UAGA 3TPCA 2BF7A 4HBGA 1GY8A 3ZW8A 3VTZA 2NVBA 4MKZA 3HG7A 3ZW9A 4D0SA 5JCJD 3SX2A 1JA9A 3HDQA 2Q1TA 4RF2A 1HE2A 1KIFA 4E30A 2POQX 1PZGA 1MXFA 5G0SA 2V7PA 4A03A 2F00A 1XQ1A 5DF1A 1PGJA 2X0JA 2VHXA 4J4BA 5IZCC 5A04A 4I9UA 1BRMA 3DOOA 3VPXA 5DNAA 3WXBA 1QRRA 2VYNA 5IZCA 4MIOA 3VH1A 2IXBA 4IQ8A 4IXTA 4GGOA 4C4OA 1DHTA 3ICCA 4MP3A 3AUSA 1ENPA 2IEBA 2OL4A 4TRMA 4RPGA 1U3TA 5L7TA 3GDGA 5DT9A 1Z73A 3AU8A 5JDCC 1ZK4A 3O26A 4EITA 4IM7A 1JDJA 4A10A 5KCZA 1SO8A 3VPFA 1GZ6A 2AE2A 5JAIA 2EEZA 4L73A 2OXIA 2F1KA 3LT0A 2GRAA 2WSBA 4I5FA 3NDRA 2I67A 2EJVA 2FOIA 1R6DA 2W4QA 4A27A 4R01A 2PKQO 4TKLA 3OIGA 2XOXA 3I4CA 5I8ZA 5KVVA 3TN7A 3GNQA 5JXWA 1DDOA 1TI7A 1Y81A 3GEDA 4OXYA 1OOEA 3ENNA 3WBFA 4QEDA 4B3JA 4DBVO 1OBFO 3RBXA 4MJLA 1R4NA 3INRA 3TNLA 3TRIA 3ZDFA 2IZ0A 3WGTA 3JQAD 3UFXA 5H83A 4OMUA 3FWZA 1J5PA 1FXSA 3E9NA 3G79A 3C7DB 1EVZA 4B7UA 2FZWA 3ZWAA 3GAZA 4JP2A 4CM6A 4PLZA 2HO5A 4XD2A 3ROPA 3PTZA 1EDZA 3N74A 4XEHA 1GYQA 2NTNA 4DL9A 4XGNA 4NJMB 5J23A 3I3OA 3GEMA 4CV0A 3ICPA 2WDZA 2JKVA 4UVIA 3L4BC 2CFCA 1PX0A 3WIDA 4LMPA 3NRCA 5JLAA 3WS7A 4EUFA 4PRLA 2JL1A 3KYDB 1SC6A 3NGLA 3PK0A 2PY6A 2Q2QA 3TDKA 3MJSA 5F1OA 1R4NB 2I3GA 3WGIA 4PLWA 3KSZO 3KEQA 2EKPA 4D45A 1EDOA 2IZZA 5TSDA 3U3XA 3NJ8A 1EBUA 1WXDA 1RM0A 3JQ9A 4GGPA 3DHYA 1X15A 4WLFA 3GA0A 4O5OA 4WKGA 4G2NA 1BW9A 3VPGA 4YRBA 4KWIA 2EGGA 1U3UA 1ULSA 3IP3A 2QZZA 5ES3A 4OIMA 2FSSA 1T2AA 1UXGA 4I5DA 1JN0A 1NR7A 3OEWA 3IUSA 1RM4A 1UDCA 3CUKA 1LDYA 3TOXA 4B8ZA 2X5KO 1HEUA 2WYUA 3F5QA 4B7XA 2EV9A 4J4TA 3A9WA 5IFLA 2DPHA 4Y6RA 3ABIA 4OL9A 4E2XA 3JYPA 1NQAO 4PLTA 2OP1A 3GG2A 1WW8A 5BR7A 3T4XA 5IF3A 2DUWA 3F5SA 1A71A 5EMHA 3OEYA 1T2CA 4KDFA 4XQGA 4MVJA 4MIYA 4LN1A 4DMLA 1I2ZA 3OIFA 1C1XA 2VT2A 5B4UA 4W7IA 5COQA 3IMFA 4ZVVA 1FF9A 4YPOA 2Q2WA 2IEDA 3H5RA 4J7CA 4OQYA 1AXEA 2QYTA 3N7UA 2HMSA 3S8MA 3RC2A 4CM7A 2IYPA 3OP4A 4PVDA 2BELA 4Y8VA 2Q2VA 2X0RA 3WTBA 4B4UA 5JAZA 2O2YA 1BSVA 5CAEA 3ZWOA 1B3BA 3EGOA 1E1MA 3BIOA 2BHLA 1EBFA 3GUYA 4NU6A 5AYVA 4RVUA 3UCEA 2VWPA 3JQ7B 3AJRA 2RBEA 3V1TC 3NAQA 3DTYA 4D41A 4MPDA 1IYZA 1PSDA 1YXMA 1U5AA 1D8AA 1ISGA 3P2YA 1T2DA 2JFHA 1DFHA 3RI3A 3WGYA 3ZNOA 4BOYA 4CV2A 3QQPA 4AJIA 2IODA 2DBRA 6ADHA 5L4LA 5C5IA 2VHWA 1BGVA 3LF2A 1HRDA 3ZU2A 2X9GA 3IS3A 3D1LA 1TEHA 1ISFA 5KWEA 2HU2A 1A7AA 4NBTA 2ZCUA 1XA0A 1YO6A 1M76A 1Y9EA 3L9XA 3B20A 2HK9A 2QHXA 4FC6A 1PEDA 1NVGA 3JQEA 3ZZNA 4GX1A 1PJCA 1X14A 1C0KA 2V6FA 3V2UA 5KNLA 2DBQA 2AQ8A 1K2WA 4I08A 4L76A 4BO7A 4YT8A 1PZEA 3GK3A 2NADA 1D1SA 3GEGA 1R66A 3E9QA 3F4LA 1YDWA 3RSHA 5T57A 3Q2KA 1XU9A 3LZ6A 4YYZA 4YJHB
chains in the Genus database with same CATH superfamily
3LXUX 3KJIA 3HNPA 1R0KA 4PC3A 1XWFA 2YN2A 3DBOB 5FWDA 1C2TA 3WNBA 3C5EA 5EIEA 3LGAA 1LU9A 2VG8A 4HC4A 4EY6A 1B6SA 1UM9B 3VMFA 4E2WA 1Z62A 3VBEA 1XLVA 4LF8B 1YDHA 2HOQA 1XRQA 2G77B 3BWCA 1SHUX 3EQ6A 4Q19A 2GGSA 4FCWA 1JBEA 2G5TA 4N54A 2NVOA 4XASA 2YL2A 1MH1A 4FI3C 2G1PA 4N0DA 1FMLA 2G17A 2PEYA 3AP2A 3FBWA 1JQAA 4OHPA 4UARA 3WGZA 1PG2A 1VP9A 4NK5A 3N2IA 1GZ3A 2BL4A 4B34A 5FEUA 2V74B 3DL2A 3E3LA 3P0RA 5K0FA 1IJEA 1S8NA 4R6XA 1LBEA 5HILA 4G5OA 1KH2A 1U3DA 3L07A 1COWA 4P08A 5CIWA 3I6BA 2DT5A 4E5MA 5I7EA 5M7EA 1V7CA 2XCTB 1KBQA 1EU1A 3RASA 5HKAA 4DIFA 1VSVA 3O82A 4EI9A 2HM7A 3K1TA 3KZXA 3OJFA 5CX1A 3VOBA 5JSZA 3PEYA 2VHVA 2UXBB 3PXBA 5ITVA 6LDHA 3K6SB 1N0UA 5IH3A 3FWPA 2VLBA 1FBNA 1C3JA 5JVDF 3EODA 1VYTA 3MXOA 4JL6A 1H8EA 3UWKA 4JBLA 5U1PA 3W4KA 5JAHA 1XK7A 4FJ0A 2XWQA 5JNWA 1A1SA 2EGHA 3CGWA 3LRTA 1Y9AA 4BV3A 1FFBA 1A98A 3LL7A 5DYWA 3AETA 2FP3A 4JVLA 4O2RA 2PT7A 1MABA 3W3AH 4K9NA 4HPJB 5IC6A 1JQDA 4FFMA 1NLFA 2NU6B 3IO3A 5HUQA 3IT0A 1HG1A 4YUXA 4D81A 2JLYA 1D6JA 5C5DA 4O4HA 2FF5A 1R0BA 1GL6A 3FFWA 4RXTA 4URUR 3FTCA 2Q7OE 3LUFA 4DAEA 4EB3A 5IDXA 3T9CA 1MR3F 4KQWA 4CLEA 5J4YA 5D3KA 4C30A 5IT9A 2XUOA 3HB7A 1FJ2A 4WLNA 1XRJA 1L5HA 5BR4A 2DR2A 1HZJA 3F5DA 5ALDA 4H7EA 3C5VA 3QYFA 3LBFA 2YCBA 3LY9A 3N5CA 4NBWA 3O9ZA 4IH9A 5E3IA 1KEKA 3HSSA 5EHGA 1JI3A 3L02A 2FY8A 3TZEA 1E7SA 2X86A 3N0WA 4TKVB 4MS3B 2G9ZA 4U63A 4I99A 1BE1A 3Q41A 4FGKA 2X7JA 4IJKA 2ZYHA 2DKOA 2HYDA 2QTTA 4AG6A 3TOZA 4FDTA 1M7HA 2OFPA 1UC5B 5K9ZA 1F4VA 4D44A 2EAUA 2Y0EA 3T5MA 4OOFA 4C78A 1UEIA 4RFLA 4URFA 2AN9A 4WBSA 3C3CA 3TL2A 1GQ2A 2C7VA 1B42A 2WIDA 2ZJ0A 4F97A 4R1UA 2UV8A 1CBUA 4Q18A 1GUDA 1AKMA 3QUSA 4N3AA 4X1KB 1CF9A 3WNQA 3PFKA 3EVEA 3E3OA 3FNFA 2PX0A 1L7BA 4XWWA 4MDFA 5T4EA 3LUCA 4MKRA 1LFAA 4Y7DA 1EGAA 4G23A 3OX2A 2DJIA 5DBIA 3EC7A 1RDFA 4N47A 4AWXA 5KOHB 1UIRA 3IVMA 4CLHA 4HWSA 2CLEB 1KEUA 3KVNA 2HT1A 4RMIA 1VLQA 4PX3A 3F46A 3OLVA 3T95A 3ERCA 2J87A 2R6ZA 1NE2A 4Q37A 4AVYA 1NU6A 3B5IA 5DYIA 2M6SA 3TOCA 1GFWA 4GMFA 3QSYA 4FYPA 1EM8A 3BX1A 4IUDS 2VK1A 1VHLA 1T8UA 3B1FA 1E9CA 1TADA 1L8XA 4K6MA 5AVZA 4PLFA 1AS3A 4AKTA 2G04A 2IYTA 4C3OB 1GNPA 4PXYA 5EHQA 3UK1A 1P91A 2YHIA 3VXKA 5AFSA 1RI3A 2ZIXB 2ZYTX 3I2KA 1MABB 4MS1A 3RSZA 3W0LB 1FVHA 3V8VA 5LB2A 1I7SB 3UXYA 4AXBA 1POWA 4UNPA 1P29A 1E0SA 4KHPB 3OCVA 2CSUA 3BFJA 2YYSA 4IHJF 1NF8A 5DMXA 2R62A 3DFMA 3S5JA 3PJRA 1L8AA 3I9V6 3R0XA 3IQEA 3SBOA 4MUNA 1ST2A 3L77A 3QXJA 4PO9A 5D1NA 4B6FA 2NYVA 1XMSA 3M4YA 5CT5A 1H2YA 4XWAA 2FWRA 2H7VA 2GPAA 3DD1A 3R0QA 2WIBA 3FNQA 1QFZA 3UPDA 1BDIA 3KM0A 4XFDA 3LY5A 1W8DA 4MVJM 2YZNA 2FEAA 1N2BA 1VKHA 2Q1XA 2Q1WA 3HKEA 4WLEA 5F5LA 1OHHA 3ZZ1A 4LF5B 4D3YA 1TCBA 3ENWA 1VE3A 2IV3A 1VMAA 1HZZC 3QFHA 3N0TA 1SCJA 1U99A 2DX7A 5DSXA 3ZV6A 4F9TA 2AHOA 3N2LA 2CY0A 2OHGA 3ETJA 4RV5A 3QBJA 3SSNA 4C4PA 1GDTA 2BGGA 5AHWA 5A5GA 3ICVA 1DCFA 5ESRA 4YCDA 3VR1A 2J33A 5KDLA 3RTDA 2DMRA 4Q9JA 1BYIA 1RYNA 1WP9A 4IINA 4LJSA 4WNAA 1HH4A 2JIMA 3WWZA 4AM8A 2E3JA 1JB9A 1P5HA 3GJYA 1DO2A 4AMYA 1G8FA 5BN4A 4H59A 5EE0A 1NASA 4N01A 3EVGA 4HGYA 3GFGA 3GN2A 1E6LA 1MOSA 3DUFB 5I3ZA 3FI9A 2W2LA 4IDDA 5D5HA 4U5XA 4DLYA 5DW0A 3D6MA 3RQSA 5L6LB 1OAOC 2R11A 2YNMA 1F9EA 3I73A 3NM6B 1JU9A 4QA9A 1L5GB 3ZI7A 5BRNA 5LQUA 4MGKR 4P83A 7REQA 1TQHA 2D2VA 4OQPA 2R9VA 1HDIA 1IN5A 1K97A 2LR0A 5EWJB 2QRMA 2KLHA 1C1DA 3K5IA 3HA3A 5JYBA 1ZMOA 3S27A 2AVNA 1QDEA 2WSSD 3RVNA 4F4FA 1E0JA 1XSEA 2BKVA 4P35A 3VJRA 3H1BA 1J8YF 3EG9B 3JATB 3HDYA 2LP4Y 3QV1A 1ZXXA 2EKZA 3E0XA 1SEPA 1SKBA 3ILVA 1GEGA 4DSUA 5K45A 1AC5A 1C0IA 1JHQA 1K8RA 4DPKA 4R4JA 5DOVA 1RI2A 2FE4A 4HBZA 4ZO8A 3VR2D 1QRUA 3HLKA 4RDCA 1TTTA 2FW9A 5EXEA 4IYJA 3HJTA 2OBXA 2J4FA 2B1GA 1OXTA 1N7HA 2QUJA 3GP5A 4L4UA 2GHRA 3N1UA 2HTEA 4OF4A 4QASA 2FWMX 1JUDA 4MQFB 5B58T 4DA6A 4KE7A 3WYAA 4J49A 4ARAA 4J94A 4YV1A 1JDVA 5K3FA 2QM3A 4KE9A 3RSOA 3LUGA 4IDFA 3BXHA 1C3OA 4V24A 3H2SA 4Y6PA 2DFKB 2Q45A 4ZDJA 3DMNA 5JIBA 2IHNA 2NACA 2ZCJA 4JEHA 5CD9A 4EG6A 3U3MA 4L02A 2HREA 4ZT2A 4D96A 1YR3A 5KINB 1ZCBA 2CVOA 2NSYA 1JQJC 4LWOA 1ZD1A 1M66A 1TUEA 3A6DA 1MX3A 1SUPA 1TPZA 5DM60 1E1KA 1UFVA 4BFWA 1TEZA 1QS0A 4PU0A 1IHXA 2QKYA 4TL8A 2RH5A 2D7CA 1U7HA 2XWSA 3LMKA 3WB9A 3QOYA 3A4LA 3M4JA 4BO9A 3Q98A 4EHLA 3GMDA 4YQFA 1USUA 3ZH9B 3A1NA 2DUJA 2IHYA 1FW8A 3QKRA 5ICSA 3DWIA 4FNAA 4IIJF 1NMEA 5K8IA 5F1PA 1LSSA 5AOCA 5HKKD 1CXZA 5LU8A 3GLFE 3VH3A 1IG0A 1HUQA 1MN6A 3E1SA 3QPUA 3AUAA 2VSNA 4IWXA 4JLDA 4AJNA 1OX4A 1K8XB 1NV8A 1MX9A 4R7TA 5JAQA 1CR0A 3NHMA 4PTLA 5JUWA 3HUDA 4RVOA 3ACBA 3FPKA 1DO0A 4EYGA 4TTRA 3U6KA 3T9FA 5CMLA 2H1VA 1NOIA 5G4LA 3CRW1 3JQ7A 5IJAA 4AMUA 1LS1A 1GD1O 5EZYA 4CMGA 4EG5A 4ENTA 5KVCA 2JFUA 1P8AA 3QJYA 3ZS8A 1F51E 3KALA 4PIMA 3LQ1A 2NG1A 1UJ2A 3QQ5A 4WFKA 1KQGA 1U31A 3H9JA 1JWLA 3PIDA 2I4RA 3TW8A 1M8FA 3NFRA 1BMFD 3UCXA 4IWYA 4PLVA 1JW9B 5C3MA 1E1CB 2JLQA 3HYLA 2H1WA 4OXQA 2CXHA 2FNAA 3K09C 3AY3A 2A0FA 4UEOA 4CF7A 1QOQB 2G06A 3FDZB 1BXRA 4GMGA 2HIMA 4ND6A 1P39A 1MGOA 2PUCA 1LQTA 4KN8A 3X1KA 4QM7A 2E6KA 3B82A 2VK8A 2WSSA 3OT4A 1XEXB 1T9HA 2AEMA 1B15A 4OCZA 2ENWA 4UBNA 4WASA 5JS6A 4OP3A 4C4RA 2ZIWB 4M6WB 4B83A 3T3OA 3ME5A 1Y1PA 9ATCA 3GUZA 4EW2A 1PGOA 3QIVA 4AT1A 1S1CA 1SZCA 3EVNA 3ASVA 3HZHA 2C54A 1U7TA 3BE8A 2ORED 3LH5A 3D4OA 4CMJA 1JTVA 1NT4A 1QHXA 2VHUA 1GNVA 3LFHA 4JP8A 3QGMA 1XA4A 3LUHA 4X24A 3ELUA 2BM1A 1IBRA 2C2XA 1L7DA 3PUHA 3RD5A 4L3WA 4K9SA 2QYSA 4FWTA 2WHEA 2G0AA 4D4MA 1GYRA 1O57A 3L04A 3LI2A 3WNVA 2XWBF 3CMCO 1J2JA 3MGGA 4PLYA 1Z36A 2ZJAA 1KSHA 3OE4A 2C4HA 4RIHA 4M0PA 4B8WA 1R12A 5B55A 4B3SB 2HC9A 4DSOA 4R0NA 1G63A 5BSKA 1LA2A 5LCXA 1HO3A 4J7XA 5JYEA 1RBYA 2DBZA 1ESNA 3NYQA 4BMNA 4JYZA 2IOHA 4HY3A 1EFLA 3BAFA 3PPWA 3QG5A 3W7VA 5JXIA 5SZHB 1EDBA 4BWYA 2CUNA 4PPGA 2C2MA 2ONCA 1JSZA 1PJAA 4ZJPA 2FUNB 3FVVA 4UTNA 4NU0A 4JIGA 4UEKA 4N0MA 3NXSA 1O58A 2V5VA 1X1BA 3GA5A 5J1SB 3TBKA 2F3UA 2BV3A 3BB4A 1SY7A 5FYDA 3S70A 4TZTA 4ZO4A 4MUEA 4IY1A 3ZWXA 4D98A 1PL6A 2E4AA 2IHJA 4BO6A 2CLKB 3JQCA 5BUZA 5EUBA 1RWQA 1W9HA 2G0NA 3K8QA 4WY2A 2GI4A 3D8BA 2Y2UA 3AVWA 5BN1A 1R15A 3G68A 3R5TA 3RYIA 4WK6A 2CUKA 4RJJA 3NEPX 2W2QA 3RWMB 4JU9A 5I7SA 4KFCA 3MT7A 1CZRA 1NXOA 4MEBA 5E6UB 1OB2A 1LVHA 1H0RA 2HIAA 2V0GA 3KQSA 1XZ8A 4LECA 5B1YA 5AXAA 3DDWA 3MWKA 2V3VA 1SUAA 3RU7A 1RQLA 2J4DA 1II0A 3F6EX 2XV1A 5EP2A 3IAM6 1QQ6A 1Z4KA 4DM3A 1BWRA 2G70A 1QIEA 1K0FA 2QTVA 5ELMA 3AHCA 3OWOA 5GONA 1RADA 3OT5A 5DNWA 3RUPA 5LR6A 4DT1A 3IURA 1FU8A 3IP9A 2YFYA 2WHPA 4ZCPA 1ZQ1A 1ABFA 1I9GA 3HVHA 4JGGA 1E4EB 4ME6A 3IL2A 3H3XA 1QPZA 4IXNA 3RJ5A 3PXXA 4JWTA 2OENG 1DAEA 3X1ZA 2WJ4A 5THKA 1A7KA 1RMTA 3GFVA 3L06A 4G0NA 3WKAA 1OFGA 3RYFB 1AIPA 3IAEA 3MTGA 5EOVA 5HTKA 4M9CA 1ZK1A 1XDBA 5BN3B 3QPDA 4L8FA 3H5TA 5ADUS 3MGAA 4JCCA 1XLWA 4DR1B 3EZNA 4DIBA 3CO0S 3AR8A 1A8PA 4ZDWA 3K2IA 1A50B 5BOSB 4KIUA 5EYPA 3PDIA 3FDIA 3GGOA 4QTZA 3LU1A 4TKUB 4GQIA 2V1XA 4O2BF 1G5TA 2MSDB 3DVAB 3IDQA 2A0UA 3G9ZA 3CHYA 3PF8A 4BIMA 5C8VA 1FFHA 1L7EA 1Q7BA 4U2DA 2QE6A 3MTBA 2W9XA 5IP5A 3REGA 5LDDC 5EJ2A 5DGDA 2IEIA 3NDJA 4IUCS 1KZGB 3VGPA 4ZREA 1FX0B 1P2GA 4GYKA 3H6KA 2E4UA 2A3RA 2FFHA 3SM3A 1A5BB 2D3TA 2P2LA 1PYDA 5LVAA 5I51A 2WJYA 4RF5A 2BHTA 3AF6A 3OFJA 3W6UA 1UAYA 2E1RA 1Z7EA 3EY4A 1FFEA 1SQ6A 1UKBA 1MTZA 2HMTA 3ZK8A 4B4OA 3L1JA 4E5NA 1CQJB 1W0JD 4KXQA 3N2EA 5ERYA 8ABPA 4JLKA 5HFNA 1DFIA 1JS1X 2RHGB 4UDYX 3A9TA 1VRVA 4I50A 5C9ZA 2RG7A 4MWDA 2HBQA 4NFYA 3EY9A 2C4MA 5KDOA 4LRUA 3NVMB 2VAWA 3PE3A 1KRXA 1J0EA 4LJ6A 3WLTA 1QR2A 2DFDA 2Q62A 4CMKA 3EGEA 1PT6A 2PBRA 4NNJA 2ZRIA 1KYYA 1T34A 2H4FA 2QUKA 2WD8A 3H1GA 4XD7A 3S1SA 1BCSB 3EPJA 3NIWA 4LMAA 4W8HA 1A8HA 3H2IA 3HRHA 4FSXA 1P7ZA 4QC2A 4CIVA 2CXTA 3NS7A 3ONVA 1RPJA 1A2BA 3WJ7A 5IJ0B 2XJ9A 3BXZA 1TCAA 1WOYA 3CEMA 1FFCA 4G0VA 2Z6UA 3FZQA 3ZIAA 3PB3A 4BLUA 3ULKA 3DLIA 5B1EA 3KQTA 2EDCA 2R8XA 3UV7A 2ACWA 5A0TA 1ORRA 3GI1A 5CXXA 3NHSA 1DJLA 1Z4QA 2PX3A 3RIEA 4TKVA 2BTQB 2CHFA 3IIJA 4H31A 1NI4A 2O8BB 1QRAA 4BFCA 1E2MA 1K4KA 1ESZA 2COKA 4ZRNA 4KFRA 2ZVJA 4NPCA 5B1IA 5I9IA 4PGFA 3DZGA 4PWZA 2AFIB 4WINA 2OSBA 1OZ0A 2JIBA 2WB4A 3K9HA 4EQZA 4FQ8A 3ZYZA 1U2SA 1USIA 2PJDA 4QULA 3IERA 1PJSA 5K8UA 2QSUA 3ZQUA 2IOFK 4NEGA 1QYVA 4V03A 2DF8A 1KP2A 3AEKB 4I1PA 3NETA 5I7UA 3MQ4A 1YJQA 3H97A 3ILSA 1MNQA 3FOCA 1JLRA 4M49A 3MWJA 4O8CA 1H9CA 4TPKA 2BHNA 1CFJA 3O8QA 4C0WA 3G7SA 4V3CA 3X44A 1Z5ZA 3UA4A 1VXOA 1GN9A 2DR0A 3KHUA 4MVJD 5EZ5A 5IMSA 3ORHA 2AQHA 3KC2A 3G8AA 1VDZA 1VJRA 2BD0A 2HA3A 2HWYA 3EVZA 2I4NA 2YIDA 4ODIA 1S2IA 4R3UC 5GJVC 3SFZA 1UP6A 1UZMA 3KHSA 3OOWA 4QXMA 4XUCA 1F8FA 1FEZA 4J6EA 4ZT6A 1SMKA 3ETHA 4IO1A 4BUJA 3JYOA 2YOGA 1RQGA 3LCCA 4S12A 1UMBA 4EWLA 2A30A 2G9RA 1YZKA 1BXGA 2QU7A 5CNIA 1J06A 3V2IA 5J4VA 2HI0A 4V2UA 4A2WA 4U9HS 2ECPA 5TE9A 4WCFC 4QBFA 4U7HA 4ZMSA 3MRVA 1F60A 1T5BA 4S0XA 1QVWA 2Q27A 5JC1A 2VA8A 2WJPA 4EPTA 1T36A 4KSCA 4RZ2A 3M70A 4DV5B 4B3TB 4MAAA 1U8CB 3Q12A 5B1DA 3T61A 2EFJA 3DBLA 2ST1A 3VZQA 4YHHB 1OC4A 3FG9A 4BLRA 4X6LA 3F5FA 2XMRA 1JSRA 2JBHA 1XNJA 4JVOA 4LFCB 4D57A 3JARB 4KI7A 5EC8A 1L4MA 3TTXA 1LLCA 3WQRA 2PZJA 3CKKA 2BR4A 5LWHA 2V7QD 4W5TA 3C3JA 3MS7A 2ZQ5A 2Z2KA 3DO5A 4BWFB 1JHMA 2J6IA 4JNCA 4ZXPA 3UJDA 5EMJA 4CHTA 4O63O 2VHZA 4RDIA 5L8VA 4E22A 1F0YA 3PLNA 2EC5A 2F8SA 3AIKA 4QODA 1LPBB 1W87A 3CX3A 3MELA 2LNDA 4IGKA 4K6GA 1P2BA 1PDOA 4GKVA 4Y0VA 3RS2A 3L8HA 3ZHZA 4FZ5A 1OXBB 1QQBA 1EGQA 3H84A 1KZ9A 5I9LA 1M1XB 3E22B 1ZLXA 2FEKA 1B73A 1NI5A 4IAOA 3ZUPA 1U0OC 4E70A 5K0ZA 4O4HB 3P2JA 1GLNA 4XIJA 1FYDA 1E8NA 4HXFB 4B3GA 2WAOA 1M8GA 2HU5A 3ESAA 1IATA 4JQZA 5FORA 4Z2YA 4WZAA 2ZI6A 3TGWA 4CTKA 1TO1E 5EWMA 4BO3A 4MNTA 4X54A 1JHYA 4RZSA 1PR9A 1X1TA 3A9SA 4JBYA 1NLUA 2YXLA 3HB1A 3IDSA 4YMVA 2AYZA 3O2JA 5B1SA 5GVSA 4FE3A 4TMZA 1VMKA 2IY7A 3K9LA 2WHQA 2JAQA 4IDQA 3T54A 4BYGA 5K4GA 3IPYA 1COZA 2WJIA 2O2GA 1ZHFA 3FJOA 3HCNA 5U4QA 2ODPA 4IZHA 4TVKA 3H17A 3FPAA 3K1JA 4JXZA 3NHWA 3DV2A 1Q1NA 1Y8RA 2EATA 2OV4A 2CEKA 2R87A 3QA3E 4AYWA 4QFMA 1K3FA 3A0RB 1O6CA 1AQIA 3AOGA 1M2OA 1UBTS 3HJUA 3Q7IA 3EFHA 2XBLA 3NHPA 3NYIA 1FP6A 5FP0A 1TGVA 2QT0A 1UPFA 4HI0E 2DT8A 2GOYA 1TT5B 3AYZB 3UMFA 1JEAA 3UJ3X 4AFNA 3L8MA 4PXSA 4Z54A 2R60A 4YAWA 2Z3WA 4DV6B 2VPXA 2IVZA 1OBOA 4AWAA 1EYZA 4IMRA 4RLFA 2CDAA 5EKXA 3NAGA 4CGZA 5K6TA 4BNXA 4CL0A 3OSZA 1RRGA 3LP5A 5DI9A 2ZJ4A 2XAAA 1SIBE 4HFJA 3J7AC 3TTUA 1QIKA 2QAGC 4FPXA 3U5TA 3GHYA 4J0DA 5KTYA 1KAMA 1Y82A 1WHTB 2J45A 3OQVA 3E48A 3I05A 1DADA 2QLBA 1E2GA 1FQWA 1KI6A 1PS8A 4YAEA 1Y80A 4B2YA 3NVKI 1YS7A 2H29A 2ZDHA 4D4IA 4MCAA 1DAMA 1T35A 4AZ3B 4PN7A 2JFWA 4QYXA 4C22A 4E6PA 1PV1A 3W1WA 1DRUA 2IXGA 1FLAA 2CXQA 1N3BA 1VBFA 2J5XA 2YJTD 4QYTA 1V47A 2EFEB 2PH5A 3O8DA 3ZH2A 3RPEA 4EJ2A 1CHNA 4ROTA 1WP4A 1ZCFA 3ORRA 2IZ7A 2ZE8A 3PQEA 4DWVA 1FFGA 1FNCA 1OXXK 1YOVB 3UFBA 3O8LA 1FFDA 3VVBA 2ZR9A 2OUKA 3OM1A 1NMSA 3QXSA 4G0YA 3VC7A 2X2PA 3MUFA 4RS3A 1MFZA 2CK3A 4BNWA 4C87A 2JCXA 5KTTA 3KQUA 4AJKA 1G20A 4FFVA 2IIBA 2R6JA 1VTKA 2IF0A 2VJKA 1KEPA 4Q3LA 4P9NA 3E0QA 3ROTA 3TQOA 3U4HA 4H1VA 3MTQA 4AICA 3A4VA 4IIVA 1FS5A 1ONSA 3DCIA 4JBGA 4DJEC 5K0BA 4LC0A 4DY4A 1M6HA 2DKNA 2B82A 5KU1A 4EK9A 1N0VC 1ML4A 2E82A 2CB9A 1XG5A 4BV8A 5B12A 1DGQA 2AXPA 5CA0A 1M7BA 4D5EA 2O8EB 1FNBA 3HBMA 3O4GA 2QR5A 5LP1A 1TKCA 3U44A 1PE0A 5TX7A 2WQ6A 3D8NA 2ZUBA 4PM4A 1JAXA 3IUQA 2ZETA 5FLYA 1GGHA 4QJ3A 3ZJUA 1HQDA 5I9BA 3H1FA 5A0FA 3WLSA 2WPNA 4ZV9A 2VQ3A 2DY0A 1ZX1A 3RHFA 3PKJA 1D1PA 1MEJA 4P3OA 5DNCA 5TGZA 4DHWA 3NGMA 1M9NA 5F78A 2QR2A 4BNZA 3JD4A 3QSGA 3CY6A 3A2MA 4FYJA 4JYPA 2OYCA 2XOEA 1R1DA 3FSRA 4FYXA 1RBZA 3H16A 3AJDA 2WC1A 1R5JA 3HUFA 3JQFC 3K35A 3K9WA 4KK3A 4XH9B 1Z5PA 2YQ4A 1DXQA 4CQMD 3LPCA 1VKZA 2P30A 3GAAA 2O0KA 4CR7A 5KMGB 1JKMA 1MO3A 1T3ZA 2IE8A 1IXRC 3UIEA 4BX0A 5FI0B 4PZLA 1ZD8A 4RD4A 1WHTA 3Q1KA 2ZXEA 4WECA 3C3WA 5IASA 1EHIA 4HNGA 4JDUA 3GMIA 1A9ZA 4P53A 1UOOA 3IDOA 1E3DA 3ZHQA 5EZ6B 1RWMA 1XCGB 2QT1A 4M1WA 3NT5A 4YWJA 1B6GA 2FVYA 1OWPA 3TTWA 3MPOA 3KOXA 1ZOOA 2HHLA 4V0RA 3PPYA 1NBME 2NTVA 2X7XA 1E2EA 2PGXA 4BNDB 1XHLA 2AMJA 4U7PB 1PU2A 4TWAA 4KOAA 4V1CA 3PX7A 4A82A 4K7JA 1F6WA 3M82A 1P0IA 1PK8A 3QU2A 3AVXA 2XVMA 1I3LA 3ACDA 2QL6A 1N3IA 5KNBH 3VU9A 1R5BA 4TLEA 4AD8A 2I8CA 5DI3A 3TLXA 2YICA 4CL8A 5JARA 1UANA 4OQFA 4F3TA 3QOFA 4P7JA 1EE2A 3D3NA 3ZQKA 4G09A 2Q4OA 2WOOA 1WCYA 2YWEA 3NCHA 4OHBA 5H3CA 5I8WA 1G8PA 2PBLA 3AR7A 3MCWA 2NZYA 3N59A 4F5EA 4FJ1A 2H52A 3UOAB 2Y1DA 3NIFB 5JOQA 1U0LA 1CCWA 2Z09A 2UVDA 3UYLA 4D43A 4RFSA 3KQYA 5HDQA 1G8KA 1WXXA 1IBLB 4X85A 1RHJA 1TOAA 1BMQA 3BN3A 4IQ4A 2Z1NA 2ZJ1A 4BMYA 5JD4A 3OKAA 3HY4A 4TMFA 1VPLA 1Y3DE 3O75A 4O2BB 4D0RA 3UJPA 3OZGA 4N1AA 2A9QA 2BVNA 2O7RA 3IIEA 3QVJA 3AK4A 3UTDA 1C9NA 1CYDA 1RZUA 3L0CA 2JVJA 4YO7A 4IIXA 4MW6A 3STUA 4EHDA 2NU7B 3WGVA 3ZBTA 4KVAA 4WOKA 1DIAA 5CG1A 1V8PA 5AVQA 2P9QA 3EASA 2F48A 4ZT4A 4XYMA 5IDVA 4AI6A 3ZD9A 4FE7A 1RYFA 2X8AA 4IJMA 2JIZA 1MG0A 4OX9B 1M1YE 4C7KA 2FWIA 4ZT5A 2XQGA 5EGSA 2QVZX 4KXVA 4W4TA 1KK3A 4PZZA 4MW5A 4D9NA 4X3PA 2YFHA 2ZUVA 3V1MA 3LDFA 5KYYB 1KI6B 2ISSD 2DFTA 4CQJA 2JCGA 1YC2A 1RYBA 2W71A 3JSAA 3IUJA 1I1OA 2Z9DA 1I0LA 1HE5A 4MITA 5AXDA 5DPMA 4D6PA 4K6KA 1YD7A 1DL5A 3WGMA 3ASZA 4K3UA 1CUSA 4FOOA 1N2HA 3F7MA 2XRFA 3TSCA 4BHTA 5FTLA 1YHNA 1QG6A 1Z0KA 4WK0B 1C4WA 2JJMA 1CWUA 1M6WA 1C7EA 3MBIA 4IICA 3UMCA 3CVWA 4K1LA 3MQFA 2R8RA 2C83A 5L3QA 4Z6KA 2YMQA 2R4TA 3DT9A 3VJKA 1HY3A 1QMGA 4UFPA 5KX5F 5REQA 2VP6A 4F4DA 3WK5A 3ANNA 1T3SA 5HK8A 4FFOA 1NQUA 1FTYA 1EQAA 1EA7A 1G20B 2CFIA 2H63A 2YR0A 3ANTA 3GJ8A 4I4TB 4PO1A 3WL5A 4TV8A 2FK7A 2P6NA 1XEAA 4DDHA 1DO8A 2NO0A 2V7TA 4YMGA 4XGRA 2CZGA 3SR4A 3VQTA 2FPOA 2J0UA 2J5KA 3KNZA 3Q2IA 4POAA 4ZHQA 4N9WA 3CLSD 2VQ6A 2W7TA 2W90A 4CJXA 2XCOA 3MT8A 1T1GA 3LUJA 4MHTA 3MHPA 2MIIA 1BJKA 1F1JA 2P9ZA 4OJNA 1BMTA 3DMGA 1G5PA 3EF3A 5KYTA 2YZ2A 5DLDA 1JHXA 1DCTA 3OZFA 2ZJ7A 3EYWA 3OIYA 4OLJA 3WYFA 3ZZ0A 4BRSA 1K7XB 3G9QA 5K51A 2CVFA 3AR2A 3LYAA 3NV9A 1NM5A 4W6ZA 6ABPA 2P9HA 1O0BA 1MA0A 4N5LA 4KZKA 3R8FA 1NVDA 2IGTA 3TRFA 1JDBB 3G2NA 3UK7A 1MV8A 5JRJA 1W2GA 1IZZA 1FMCA 4U00A 3DZBA 5BWLA 3VHQA 2QDKA 2IRWA 3HYTA 1ZU4A 4IJQA 2MHCA 1ULUA 1RE1A 3N3BC 5HGXA 1QGDA 1JDBC 1Z35A 1AKYA 3ICEA 3QKWA 2HA0A 3OX3A 4BV9A 2C4UA 1ZUNB 2H3HA 1C7RA 2V4ZA 2PTHA 4Z4HA 4XX0A 4EJ0A 1Y1TA 3M7IA 2P2NA 3STYA 4RQAA 4DQLA 4YP7A 3RTBA 4NBSA 3ROZA 1QS0B 3H6HA 3NBFA 1JJIA 1Y4ZA 3HEMA 3IALA 3VR5A 4BL5A 3R5SA 3ONNA 5GV7A 1Z6AA 3OOJA 1ZPDA 4H7DA 2AL7A 2F3SA 2NT4A 4MB6A 1ZJJA 4QDUA 4IJWA 1WZ2A 1MO6A 1PQUA 1M6YA 2AOTA 4KQGA 1XLTA 3IH5A 3EMVA 1K7EB 4UNIA 2BGNA 2O0MA 4OTZA 3ZLUA 4DW8A 1KFJB 1O87A 2UVQA 1P1JA 3E5RA 3U7GA 3OY2A 2REOA 2SKCA 4QNNA 5H3LA 5BMVA 2FZ5A 3EBOA 2UZ1A 2QL7A 4ZV4A 4GL4A 4W63A 1HZZA 1V9LA 1MP0A 4JB3A 4CM4A 5HQ3B 3U4QB 1IHOA 1HLPA 4JOCA 4OHXA 4TMWA 3RSCA 4DZRA 1UXIA 5BYBA 2PWYA 1EX9A 5CNKA 4QLAA 5HOQA 4ARIA 4MUMA 5A9TA 5KYXA 4YDRA 3O84A 2HU7A 2O9JA 4MV6A 4EFNA 2JLWA 4QQNA 2DCUA 4OQEA 2E21A 3X0DA 4CEIB 1E9AA 1VPDA 2XGOA 3C0KA 3UYKA 3BPSA 3X1XA 4ZYVA 3H2ZA 1FNSA 1VYUA 3R2JA 4KTTE 3X43A 4QUBA 1YC5A 2I6SA 1I2CA 1PGPA 1ZCZA 3V1YA 1NN1A 4LQDA 2W8ZA 3C1UA 3EE6A 3AJ9A 1Z45A 4BKUA 3OQNA 1YL5A 5AKKA 4LZZA 4LZOA 4EHKA 3EPHA 3H4VA 3EB9A 5LJIA 1JQ3A 1XZDA 3BH7A 3M4XA 3WOVA 4ZRMA 2ZRDA 3NC1C 5ALMA 5E4JA 5F2OA 4NCBA 2PUHA 4EL0A 4ER7A 1FDOA 5KX5B 1YQQA 3K6RA 5DCWA 4N8EA 3KR0A 6REQA 5FUQA 1ZMTA 3JQBC 4C6SA 2H3EA 2Z2JA 3BTUA 3D5QA 4LZPA 4C7OB 3KVOA 4M8LA 3HU2A 3QENA 1KS9A 3N87A 4LGCA 1U2TA 3UWMA 3QWHA 1RNLA 1CLEA 1VECA 3L79A 5DK6A 4E88A 2ZZNA 2I9PA 1JIQA 2RE8A 1NXVA 2RI1A 4L9RA 3T52A 4F45A 5IDWA 5KYUB 3JQ8A 4IZOA 1N9ZA 3IO5A 3ZWMA 4ZAZA 5H5JA 4ZHQF 3O5AA 3DXZA 3INGA 3O7MA 4K28A 3WYGA 3CNEA 4ZGWA 3P9IA 1U6IA 3RSQA 2ZWOA 2EP7A 3B9BA 4B9AA 1BE6A 3TWOA 4F2GA 2H65A 2IYXA 2NUPB 4KKXB 1DIGA 4O1MA 1IRIA 3Q6IA 4DNPA 5J2TA 2W5UA 5CVUA 1LLQA 2IYYA 2KSQA 2Z3ZA 1JWBB 3FYDA 3O8NA 3PIIA 1H9BA 2AMLA 1TIKA 2QXUA 1IWPB 2GPJA 5KDDA 4F06A 2QJRA 1JXQA 1EWKA 3U4GA 4PC2A 1ORHA 5ITZA 5JS1A 2JGDA 1F5SA 3LC0A 1U5BB 1IB0A 3MLBA 5ITWA 5EJ6A 3OCZA 2H2WA 3UJ8A 4C1BA 4DQDA 2F7SA 2ZWMA 5EJEA 1LZLA 1CS0B 1A9TA 1SC4A 1WBBA 5T3YA 3I52A 3UKDA 1TQ8A 5B5SA 3DAYA 3RHTA 3KEOA 4EJ6A 5KZMB 1A9XB 4BYMA 3TKYA 4M1TA 1C1DB 2AFHE 4MGIR 4Y30A 4C88A 1C3XA 4H3SA 3K92A 4HLNA 4Z4GA 6PFKA 4LRQA 3CBQA 2JGJA 3NVAA 4PSDA 1MRZA 1M75A 4Y1RB 4FBMA 1EVIA 7GPBA 4O2LA 2ONZA 4MQ4A 4DJJA 3E7XA 1RWNA 1SXJB 4GP6A 3IAHA 1AB5A 5IXYA 3IQIX 5T7BA 1TMOA 5TXGA 3MJTA 2WRZA 3UQYS 2CHQA 1KVRA 3FRIA 3ES9A 3GCZA 1R00A 1YZUA 4L9SA 1PWYE 1DC7A 3AL3A 4JOQA 5G53C 1B1AA 1GM5A 3V4OA 3OQ6A 3ADKA 1HQCA 4XA8A 2CCGA 3RFCA 4YV2A 5CK5A 1I30A 4L57A 3PDCA 3V7NA 3OJXA 1Z7BA 2GN9A 1N7GA 5EMKA 1R10A 5KVSA 3JQGB 3ZCRA 4XYGA 1Z17A 3MW8A 4U39A 1U9JA 5B6IA 3PT9A 2OORA 2Y1FA 1PN3A 3WQSB 3GRAA 2Q3DA 2V6MA 3VPAA 5LZ8A 1J9ZA 2VZ9A 1SIOA 2ZAOA 3ETNA 4PLCA 1EM6A 1HETA 5AOBA 4EFDA 2OWEA 1Z4MA 5DGTA 4ENVA 2P0EA 3Q88A 4L2IB 1EG2A 1PEYA 3LWDA 2GPNA 3AJAA 5FUVA 1FMFA 1VRWA 4LOHA 4BZZA 1I51A 3R7BA 1ZK2A 1BD4A 5BQFA 4CR6A 1BHSA 2GZRA 4PBTA 1N33B 1A8SA 3IAAA 4I50F 4YR7A 1QLWA 2Z1MA 4UE3S 4JLOA 2FN7A 2OE2A 4LXTA 1ISRA 2JATA 4MLZA 3SLRA 4UTOA 3E70C 1KWKA 3NANA 3JRNA 1ZVVA 4GNKA 4L7VA 4S04A 1E96A 1XVLA 3QOWA 2ZUUA 4MQMA 4Q47A 4AAYA 4K6HA 3ZPXA 4QQRA 5ITZB 4QDKA 1IZ9A 3ZHXA 1G64A 5BQPA 5EJ7A 1WXEA 4JUAA 5EFZA 4BPRA 4M76B 1G59A 3HKEB 2NYRA 3Q40A 2R00A 1PJBA 3HLYA 4BRWA 4Q1DA 2Q6KA 2WEKA 1OZFA 3U40A 2CN1A 5HM6A 3QE9Y 1LDMA 1KZ7B 2IKQA 4HNAB 4R1SA 3RBAA 1CD5A 3PZRA 2JAOA 2WM9B 3VRHA 4GI3A 1MGPA 3AJEA 2JIQA 2GZ1A 1EK2A 1SUBA 1TJ5A 2AC7A 3IP7A 2QUIA 4G37A 4YRRA 3S29A 1ZZGA 1Z26A 3SYLA 1P1RA 1YE3A 4GI2A 4Z3KA 3SBEA 5JH7F 1E9RA 1FRZA 3L1KA 4PAOA 1VB5A 1KR2A 2YDYA 2ZRNA 3WL3A 5SYNA 1OVMA 3B5JA 3SP1A 2R3SA 1WXWA 4OFBA 5AWFC 5C53B 2OCLA 2WVHA 1S89A 1KYQA 4AZTA 2YINC 3CG0A 2CFSA 5J63A 5F64A 4TXHA 2FHSA 1GPBA 1Q7EA 2WPDD 1DMSA 2VP2A 1KDYA 3RC1A 4EMSA 3FCYA 4JROA 3KKQA 4F5ZA 5BPHA 4D74A 5FQNA 1AN9A 3GGPA 3Q7RA 5BV2P 4CM3A 2NZWA 3PDUA 3WB2A 3JWPA 1CQIA 1N9KA 1UIMA 4GPAA 4LNUA 1R6TA 3A1TA 3WWOA 2ZRAA 4WXHA 3G5MA 3ZXIA 5TC4A 5MFZA 4IQFA 1PNTA 5A1JA 2P5YA 3FDJA 2NT3A 4DMMA 1M74A 1WAMA 2PA3A 4E3WA 4A3SA 3D7MA 1SU4A 3RYHA 2WFZA 3A0UA 3G2HA 1T0UA 4HNQA 4DOMA 4N48A 3AF4A 1PG5A 4MO9A 1GR1A 2FP4A 4R5HA 1RJDA 1TGYA 2GD0A 3H2KA 5BSUA 3K0FA 5CHEA 1G7TA 4IOMA 1ZN7A 4A0QA 1ZZEA 5HW0A 1ARZA 4U0JA 4NG4A 5D51S 1YR1A 1Y6ZA 3FTNA 5JJIA 2QI9F 5H80A 3B6KA 3SSMA 4R1QA 1Q57A 4NV3A 5FX2A 1QWOA 3EIWA 2LBPA 2E37A 1UAGA 4B3XA 3HSKA 3HKDB 3M1IA 1DEXA 3L7JA 1N7JA 3FMGA 3W2FA 3FGOA 3BZBA 1A9XA 2F9LA 3C4VA 2ZROA 1W5TA 2FRDA 1UDAA 2LIVA 3OZXA 4I4TF 4N7RA 1U0RA 4ZQHA 5A4DA 2XMPA 1YUBA 3RREA 3K9CA 2YWGA 2LIPA 3I8OA 4PSCA 4Z1MD 2J6BA 3PUZA 5I9NA 2AD1A 2Q29A 1P60A 2DZDA 5JRDS 2FP4B 2RGUA 3A6FA 3HJGA 1MC4A 3FFTA 4PYKA 1AMUA 1VJDA 3P9ZA 1QP4A 1WDKA 1PZNA 5CK4A 3THWA 2OXCA 1LBHA 3M5WA 5TQVA 3OZIA 5L4SA 5JSKA 5J59A 1J2YA 5LNK1 5ED4A 3IQGX 3FHTA 3JQPA 1IHUA 4G56A 1P4AA 3CG4A 4O08A 4QYWA 1PS9A 4GUDA 4KQ6A 3FKSA 1G5RA 3GOHA 2D5AA 2QTWB 3IHKA 3I2YX 3U3OA 4XR4A 2Y1CA 4RA9A 4PZCA 2W58A 4HYTA 3CFYA 2OBBA 4GLLA 4WW0A 2FN4A 3HC7A 2O52A 1MVNA 2Y71A 2QX7A 3ND9A 3PC8C 3TZLA 4YAKA 3BD7A 3BL6A 2GKSA 3I4FA 1RQ2A 1Z7GA 2I62A 3EAGA 3OCUA 1PS0A 1HDZA 1DXYA 4RL4A 3C3PA 3T1QA 1TC2A 4DV0B 1IJKA 3D0OA 2TRSB 3L7DA 1XD2A 5E4FA 1LW7A 2G08A 3PZBA 4MEAA 3FYTA 2R85A 2OAGA 3LC2O 4HNSA 3JPWA 4TS4A 5DX0A 2UYOA 4B4DA 2B0JA 2FK8A 4L72A 4BVFA 3OKCA 1G3MA 2V65A 2AUMA 5AK5A 3CEPB 1JZTA 4KYIB 1QF9A 2O5CA 1UJCA 2C96A <