5L7WA

17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
254
Chain Sequence
b'GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
molecule tags Oxidoreductase
source organism Homo sapiens
publication title First Structure-Activity Relationship of 17 beta-Hydroxysteroid Dehydrogenase Type 14 Nonsteroidal Inhibitors and Crystal Structures in Complex with the Enzyme.
pubmed doi rcsb
total genus 92
structure length 254
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l7wA00
1IUKA 4NFYA 2GPTA 4BO7A 1U4OA 4O0LA 4Q3CA 3ZU5A 4EUFA 5A02A 2PH3A 1I32A 5J23A 1EUDA 1Q0HA 2QRLA 3VKUA 3BTOA 1E7YA 1RM3A 1AHHA 1JKFA 4FGSA 3W8EA 4RVHA 5JC8A 5JXWA 4ND1A 2E6UX 3C3XA 4W9NC 2D0IA 2B4TO 1ID1A 4K26A 4A7PA 2V6GA 3DMTC 3UN1A 1P1IA 2VWPA 1E7MA 4B7XA 1PX0A 4BOYA 4GAEA 5B4VA 3KB6A 1BW9A 3HE3A 5K6AC 2FHSA 3IUPA 4PLZA 4UVEA 3G1TA 3HB4X 5G0SA 4PLYA 4GI2A 4JBGA 2UV8A 3H9GA 5CPFA 1OFGA 1ZCJA 3ZV5A 1KEPA 3FN4A 5ICMA 5IFLA 2EW2A 4BNMA 2VOEA 4YB8A 3ONDA 3RASA 1KIFA 2E49A 2G1UA 4MJLA 1E3EA 3IMFA 3RU9A 1ADGA 3JQ9A 3RC1A 4B8ZA 4D79A 4LVUA 4F45A 2LDXA 5DULA 2O4UX 2IXAA 3U0BA 1HDRA 2NU6A 4QT0A 4XDZA 2EJVA 3RAJA 1KVSA 2VZ8A 2VRCD 4GVXA 4XYGA 3V2GA 3AM4A 5FYDA 1KOLA 3UCXA 4E33A 2Y1OA 2X0NA 5ENVA 2X0IA 2FPGA 4PG6A 1ZK0A 2DC1A 4OYRA 5COBA 1HKUA 1V3TA 4FFMA 4Z6KA 4MKZA 4J4TA 4HKTA 2HJRA 5GY7A 4CM5A 1H2HA 2OL4A 5IXSA 1RM5A 1PJQA 2XXBA 4I08A 1T2DA 1P1KA 3WSVA 5L3ZA 4OIMA 2QQ5A 3HDHA 4GLOA 5FEUA 3PLRA 1U2GA 1JDJA 4GH5A 4D3SA 1P0FA 3UCEA 2IXBA 1A9ZA 4MVJP 1ZK1A 3JD4A 4R3NA 4W99A 4BMVA 2H9IA 2VUTA 1ISIA 2XPCA 2Q50A 4NJMB 4BNJA 3GGOA 4J1QA 5TS3A 4WCFC 5ER6A 1P1HA 3H9JA 3ENKA 3I9KA 2GF2A 2UUPA 1DIGA 4AL4A 1KY4A 1CEQA 4Y67A 5BNTA 4CMCA 2YDYA 2C7VA 2BRUA 2R6JA 3UCFA 1YJ8A 3WIDA 1EBUA 5ADHA 4BKUA 1GZ3A 3G79A 3OQ6A 3RQSA 3WBFA 1UZNA 1DC6A 4OKNA 5TQVA 2BI8A 4YRDA 2VHWA 4E21A 1F8GA 1LRKA 3PXXA 3INTA 1YONA 1LSJA 3QWBA 3FNFA 2UDPA 4NBWA 1ONNA 1YQXA 2NU9A 2PWZA 4NR0A 3AW9A 3O8QB 1EQUA 3WQQA 2BGLA 2JHGA 4BMNA 5A5EA 1V0JA 4GX5A 3V1YA 2C7GA 1I2ZA 2B5VA 5GZ1A 3FI9A 2AQKA 3OECA 1C1XB 2Q1UA 3TN7A 4YQYA 2HO5A 4OL9A 2AHRA 1XG5A 3DOJA 5I9LA 2A94A 4LCJA 3HSKA 2O3TA 2VYND 3UFXA 2YQ5A 3PFFA 4RF4A 3F1KA 1LLUA 3QA9A 3QW2A 2V7PA 4CLRA 3EZYA 4J7CA 1MXFA 2OBNA 2WWRA 3BTUA 3HN2A 4CMEC 1P31A 1PWZA 5LCXA 1HF3A 3ON5A 4BKPA 4R1TA 4Z9FA 1MUUA 2R00C 5JS6A 3CPSA 1VKNA 3JQ6A 3CMCO 5JYDA 1QR6A 1VL6A 1KVUA 4RV9A 4B4OA 3OQBA 5IAAA 5K6AA 4CMIA 5FF9A 1ISGA 3F5QA 3PJDA 3RKUA 1ISMA 4E5PA 2QYTA 4J16A 4NBVA 3ZWWA 1PL7A 1DFIA 1AXEA 1EUZA 4L8VA 3RFTA 1PJ3A 4R5MA 2YFHA 4O63O 5DF1A 2Z1NA 1YB4A 2BF7A 1KYQA 3HWRA 5JCJA 1YO6A 2W98A 4NH4A 4OJNA 3DXFA 4XGIA 3PIIA 1DAPA 1XIVA 4IGFA 3C24A 4LISA 5T64A 4IINA 3WWZA 5G0VA 5A5FA 3KEQA 2QX7A 5T8KA 4LGVA 1E1LA 3D4OA 4NPCA 3RJ5A 1B8PA 4BNNA 4MIYA 4EITA 2YV1A 3STHA 2PZLA 4BS9A 4JGBA 5GZ3A 3ZGYA 1T24A 3B1JA 4L9RA 1PSDA 4NU5A 4XCVA 5KIAA 2V6FA 1R4MA 5IDWA 1JAYA 1O0SA 1QKIA 1BHSA 4YBZA 3WBBA 2PD6A 3KSUA 3ICCA 2GZ3A 1C0KA 4I5DA 4XX0A 1NBOA 4DBZA 1E1MA 3LF2A 2HJSA 2X6TA 4YJHA 2D5CA 3CIFA 4OQYA 3DAPA 4A27A 4W9NA 1M6WA 4IDGA 3AM5A 4JCOA 3TZCA 1BXGA 2JFFA 4RVDA 4RPLA 4NBUA 4GMFA 4RDHA 5KVCA 1IZ0A 4DMLA 3QJ5A 3WFJA 4TROA 1FXSA 4OMUA 1UP7A 3DZJA 4K28A 2IODA 1WLYA 2PZJA 4FJ1A 1YH3A 1BW9B 1VSVA 3B1FA 4CM4A 4E2WA 3D7LA 3KETA 4YTEA 2WMDA 4QXMA 3TZHA 3RUIA 4CV1A 1D4FA 4ND5A 3F3SA 4XWYA 2NTNA 4MPDA 3ZWVA 2AG8A 5DOVA 3WTCA 1BRMA 3TJRA 3MCVA 5T5QA 4GX1A 3QRWA 1J0XO 2D2IA 4EGFA 3ZHXA 4D3DA 3GFBA 5CG1A 2C5EA 5TF4A 3ZWYA 3SEFA 2CUKA 2Y1DA 5LDGA 1SC6A 3WGIA 3FBTA 4Q39A 3ADPA 3HZZA 5A3VA 2ZTVA 1KBZA 3NAQA 3AY3A 5JCXA 3PDUA 2VHYA 1A5ZA 3G3EA 4R16A 5L95A 3KHUA 4CM3A 2W4QA 1QSGA 2CDCA 1F8FA 4FR5A 3WWYA 4ILKA 3OIDA 4IDDA 4QO8A 5DBFA 4FOSA 4U0JA 3VPSA 3H2SA 4DUPA 3ZWBA 1NQAO 4OQZA 2J5RA 3QLJA 4L4XA 2ZJ1A 5IZ4A 3WS7A 3PWKA 1DIHA 2C2YA 4DLAA 4JBIA 2D4AA 3TL3A 4PCVA 5MGBA 3OBBA 3Q3CA 3FCOA 5CG2A 3W8FA 2FRDA 1O89A 3HG7A 1YXMA 1WNTA 4XQCA 1E6UA 4BGIA 2WD8A 4J0EA 1UXHA 5JC1A 3DFUA 2WJPA 4MKXA 3BMOA 5AXAA 3OMLA 4BO3A 3JQCA 5HBRA 4KQWA 4BQRA 4LVCA 3COSA 3E9MA 4MP3A 3EAGA 1NR1A 3RROA 1QLJA 3VPFA 3IS3A 2FP4A 2HRZA 3IUSA 2X9NA 3DBLB 3BMQA 4CMKA 4E30A 4CMAA 1TT5A 2Y68A 2JFGA 2WE7A 2YY7A 4UUOA 4II3A 1JWAB 3IAHA 1HLDA 5L45A 5C37A 3L77A 1TEHA 4GQAA 5JCJD 3IDSA 1DAOA 3I9LA 4P4LA 1FF9A 4RORA 3RI3A 2ZTUA 1OZAA 2J5KA 4XYEA 2VWQA 4WOJA 3UH1A 4B8WA 1Y7TA 4K6FA 4BV8A 2FZEA 1ZO8A 2C20A 3TOXA 1DOHA 1YBAA 4CLEA 4DQXA 4GKVA 1H0KA 4DIOA 3BHJA 3LT1A 2EP7A 3OETA 4QQRA 1IL0A 1DIRA 4E4YA 4U5QA 1I33A 1PS0A 3ZW8A 5CDUA 1H9AA 1BVUA 4ZJUA 2C07A 2CDAA 5IN5A 2X86A 1EBFA 2G82A 4TRNA 4XD2A 3TOZA 4KUGA 4BVAA 1RM4A 1M67A 3PVZA 1XWFA 4G65A 3QVTA 4XJSA 4QFCA 1N2SA 1I30A 3GR6A 4OXYA 3U49A 1LSSA 3E9QA 4RVFA 4A2CA 1M6HA 4J4BA 4BHTA 1NFQA 1H9BA 1EEHA 3PLNA 5AYVA 1E3WB 1U28A 4GX0A 1A9YA 2EGGA 3SX2A 4LCEA 1F14A 5KJEA 1TB4A 1HLPA 1PJ2A 1RJWA 2RBEA 2ZKLA 4MVJF 4FDAA 1Q0QA 4R4JA 4CMEA 4DQUA 1E3WA 1V35A 1HE2A 5BNIA 4FBGA 4BKRA 2PNFA 3TQHA 3ZWCA 1ARZA 4DXHA 3WGGA 2NWQA 1M76A 2Z5LA 3F47A 3GAFA 3H3FA 3JQGB 1ZFNA 4BO4A 3WFIA 1AXGA 4J7UA 3ZV4A 1KY5A 3IL2A 2W8ZA 4Q3DA 3BXXA 1CETA 5T6BA 4HV4A 1SEVA 2IEBA 4YT4A 5TIIA 3V5NA 3MTJA 3K96A 3WXBA 5DP1A 2DLDA 1HT0A 4M1QA 4M89A 4Z0TA 3CXRA 1YWGO 1XEAA 1JWBB 2PZKA 3PZRA 1PL8A 1RPNA 3RFVA 2YV3A 1LEHA 3S8MA 1P45A 1EDOA 1N92A 1QMGA 2Q46A 3BMCA 1IY8A 2YZ7A 3VZPA 2BI7A 2GN6A 2Q1TA 3GMSA 4MINA 1Q0LA 4WEQA 4ZQEA 2ZCVA 5I8ZA 4MVJA 4FFOA 4JP2A 5I7EA 9LDTA 3AK4A 3ONFA 2ZYGA 4CMHA 3DHNA 1PR9A 4BNXA 4R1SA 4WGGA 1A72A 2JL1A 4KP7A 1HDGO 2GLXA 3UAGA 2NVUA 2NLOA 1AE1A 1TT5B 4IQ0A 3ENNA 3GNSA 2RCYA 2PGJA 2O2SA 3DZGA 4H15A 4DIBA 4DMMA 3PHGA 4IMRA 3HQ4O 3UICA 4IS2A 3M2PA 2FR1A 3CZRA 2JKVA 4JJIA 3SLGA 5THKA 4J1TA 4Z3KA 1C0PA 1KVRA 2X8LA 2Y66A 2HSDA 2JCVA 2Y1CA 3VTZA 2P9EA 3AFMA 1BTOA 2O4CA 5CEFA 1SBYA 3D0OA 1UAGA 4D41A 1NPYA 2RHRA 2GZ2A 1HL3A 1I3MA 3NGXA 2VZ0A 3U4DA 2Q4BA 3G17A 5A03A 4CM8A 1UZLA 3GN1A 3PZBA 4CLRB 1P1FA 1SMKA 1YOVB 1NTOA 3TNLA 3GUYA 1I24A 4J2OA 3RWBA 1HE5A 4JK3A 2G0TA 1NPTO 3NTOA 3EY4A 4XQ9A 3VAZA 5KJCA 5U4QA 1DB3A 4UEKA 1IPFA 3UOGA 4PG8A 4Q3AA 3RC2A 2BFMA 4C4OA 2Y0CA 3QP9A 3GH3A 2A92A 4WASA 3C85A 4CV0A 2C59A 3AFNA 3E9NA 3G1UA 1EE2A 3H7AA 4IDAA 1ZJYA 3WB9A 3DBRA 2WD7A 1GPJA 1OMOA 5K0ZA 3PYXA 4NFHA 1UZMA 1CYDA 3NT5A 4YAKA 1WDLA 3JD1A 2ZB3A 5CDSA 1SB9A 1HWYA 3PP8A 1KEVA 3OEWA 2X22A 1GD1O 1PGNA 3ZZNA 2GSDA 5B4UA 3WGZA 3JQ8A 3I9MA 3IC5A 4RLSA 3KEOA 1P9LA 2JAHA 2UVDA 5A04A 2Y1FA 4NJMA 5B4TA 4JIGA 3LT0A 4DQVA 1H6BA 3U09A 3ZWAA 3H2ZA 3RUCA 4E2YA 2HCTA 1PWXA 5EMHA 1S7CA 3DBHB 4CV3A 1BXGB 3OP4A 3CH6A 3VC7A 4ALLA 1SEPA 4WUVA 4B4UA 3VDQA 1NYTA 2DKNA 5KKAA 1EVJA 4K1LA 3A06A 4JX8A 1DRVA 2VN8A 5ES3A 2DPHA 3MJCA 3CTMA 5JLAA 4CR6A 5C7LO 1CQJA 5U1PA 4XRGA 5LDHA 3R0IA 2GR9A 5G0TA 1R4MB 4B4VA 4MVJE 4D46A 1NX6A 1SAYA 3W6ZA 3WGTA 3PDJA 4AJPA 2OO5A 2CVQA 3PJGA 2FOIA 4JJGA 2Y1EA 3PEFA 3ROMA 5IN4A 4BL5A 5GMOA 1HETA 1JKJA 3UW3A 4ZGWA 1PIWA 3E48A 1KERA 4FC7A 2J8ZA 4YT2A 5CDTA 1B8VA 1K3TA 3BTSA 1PZHA 1T4DA 2VWHA 4NK5A 8ADHA 1LQTA 3NJ8A 2AEFA 1VPDA 4BNTA 4TRJA 3LT2A 3H9QA 2G5CA 3PYLA 1Y1PA 3WLFA 2ZB8A 3RC7A 1B26A 2AEJA 3GG9A 5CPBA 4YJFB 4EJMA 1PU2A 4CMIB 3ZI0A 5JDIA 4GWKA 3I6QA 1P1JA 3NKLA 3TFQA 4BKOA 4RPGA 1GCUA 3FRJA 1T1SA 4RGBA 3HFGA 3QY9A 4E0BA 2P5YA 5BSHA 1MB4A 4OAQA 4RVUA 4Z9XA 1YB1A 5CHEA 4BO8A 2DT5A 2GN9A 4UEJA 4BB6A 3IIEA 2Q1WA 1DC3A 4KTVE 5KOIA 2HMUA 1YDEA 1N9GA 5U9CA 1BWSA 3OM9A 2BELA 1T1RA 1W6UA 1Y5MA 1ZNQO 4PLGA 5CP8A 4HWKA 5B37A 3P19A 3KYBA 4FFPA 1Z6ZA 4YJDA 1E3SA 1ENZA 3DFZA 1PR3A 3G0OA 2QZ9A 1ZH8A 5EL0A 3LQFA 2HMSA 5ENDA 2GDZA 4D44A 3AUAA 5CDYA 4BGEA 2FMUA 5EESA 5L4SA 3QIVA 4WLFA 2CY0A 4AJLA 3WYBA 2ZTMA 1LC3A 4AJHA 5A06A 1HSZA 3MJSA 3RFXA 5AQ1A 4L73A 3GF4A 3O8QA 5K9ZA 5A1TA 1P33A 3W4IA 1NQOA 2NTJA 5DCWA 2CVZA 1PS9A 4DLLA 2VT2A 4PIVA 1HDYA 1MV8A 2HK9A 4MVJD 1NNUA 4Y6SA 4L74A 3QV1A 1P3DA 3HDYA 3MTGA 2OOSA 4OXNA 4HFJA 2VUUA 2BKAA 3PJFA 1ZMTA 3E18A 1R37A 2AQ8A 2X7HA 1I0ZA 4I9NA 1SZJG 4WLNA 1D1SA 1QV7A 4BB5A 3WQSB 4XRRA 2ZYAA 1GYRA 4BGUA 4RZIA 1KEWA 4W4TA 4CM7A 4RCVA 4RPJA 4N54A 1FDSA 2YHUA 4BQPA 1I5RA 4I1IA 4MVJG 4HFRA 2DM6A 4N5NA 5L4LA 2BHLA 4Q3NA 7ADHA 3FPLA 2IE0A 1E3JA 1EVIA 4E5KA 2EKPA 4CR8A 3ST7A 4JXKA 2HK8A 1NFRA 2ZJ0A 4CR7A 3GGGA 5TC4A 1R4NB 2B0JA 3BHMA 4IDCA 4DRYA 2NTVA 2D59A 3C8MA 3VTFA 1DPGA 5IF3A 3PGJA 2FZWA 4XYBA 4XYMA 3K2BA 5MDHA 1BXKA 3AI1A 1X14A 5HA5A 5CDGA 5JMPA 2DTXA 4NDNE 4KWIA 3VPGA 4R1UA 4CL8A 1JU9A 3AJRA 4AFNA 4RQUA 1LSOA 4PN3A 3I9JA 3U5TA 4M55A 4J0FA 4URFA 2EV9A 3OJ0A 1BDMA 5L53A 1H6CA 3GN2A 4J6FA 2P91A 1JAXA 2QHXA 4L4RA 1PEDA 1UAYA 1LDEA 3H4VA 4PLFA 4UVGA 2DTEA 2E37A 2BH9A 4NNJA 5DP2A 2YW9A 4R9SA 4P38A 4RPKA 5DCUA 5JMWA 1I2BA 1ZK3A 4GKBA 4NFSA 2IYPA 5KCZA 4BO9A 3JQFC 3F9IA 2DAPA 4OM8A 1PGJA 1DXYA 2ZCUA 2X1HA 1IHXA 1F0YA 3UKOA 1LX6A 2CVOA 2P5UA 4I8XA 1XDWA 2X58A 5COAA 3KYDA 3EGOA 4TWRA 4YAIA 5DNAA 2A35A 2R00A 1GQQA 4ZA2A 3RUFA 4E13A 2H6EA 4WNCA 1HRDA 2QZZA 4FN4A 4NMHA 5IDXA 4D7AA 3FPCA 1EZ4A 5JAQA 4CLXA 2WTBA 4EBFA 2PZMA 3LC7O 5HWSA 3VH3A 3C7CB 4FGWA 2SCUA 1R6DA 4R69A 4BKQA 2OUIA 2Y0EA 3ZHBA 2NUAA 1I3KA 2JD0A 4TZKA 2JFHA 4RVSA 3RBVA 4E5MA 4YR9A 1YE3A 2O23A 4LW8A 4XGNA 3TF5A 1UXJA 3PFWO 1DO8A 3KBOA 1M2WA 2D3TA 4P4NA 4RPHA 4G5HA 1ADCA 3U4CA 3O4RA 5EINA 1YBMA 1Z82A 2A4KA 1IOLA 2WSBA 4CLOB 1X1TA 3W4JA 3DOOA 2NVWA 3BMNB 2AA3A 3KM0A 2OBYA 1GQ2A 4M8SA 1B14A 3D64A 3CE6A 4FFRA 3Q6IA 2AXQA 1LLQA 3FWNA 2X5KO 4WCFB 5KVQA 1GADO 3DB2A 3FNGA 4BGVA 4JROA 4OKIA 1E6EA 3PGXA 3TZ6A 1YS4A 3DWFA 1B16A 1T2AA 2HQ1A 5A3JA 1ZSYA 2JAPA 1UDCA 3LYLA 3GT0A 2O3SA 4MIEA 4WNIA 1DJQA 5JPIA 3EUWA 1SPXA 2O7QA 1GUYA 1DRWA 1VLLA 2JCXA 3JQAA 2W2KA 1LDYA 1I2CA 4ONEA 1RKXA 4QO7A 3I4FA 4CM4B 2CD9A 3QWHA 1U5CA 1GZ4A 5I9MA 1XCBA 4R5HA 3BYZA 4A03A 2B37A 5F3RA 3MJEA 3GZ4A 4Z0PA 3NRCA 4O6VA 3LSYA 1VJ1A 3EK2A 3ZNPA 3Q9UA 4NU6A 3K73O 4YJGB 5H82A 2EJWA 3FNHA 1PL6A 3JQ7B 3ANLA 3S1LA 1Z74A 1D1TA 1FDTA 1O5IA 3GEMA 1P74A 3K92A 2W90A 3IOYA 4XEHA 3OH8A 3SC4A 2VTDA 1V3VA 3DDNA 1MG5A 5KTKA 4YJHB 4A26A 3WQRA 4CPDA 2Z95A 4NHEA 3P2OA 1GV1A 3I9NA 2EKQA 4OH1A 5EIOA 3OA0A 3W6UA 1VJ0A 3UHAA 5A4DA 3GDOA 3LVFO 5T57A 5KWEA 1N1GA 3PQEA 5JO9A 5JY6A 5IZCA 4KUEA 5BQFA 5JAZA 1E5QA 3KOUA 4GX2A 4WK6A 3O38A 1Y81A 1N1EA 4OXKA 4J90A 5DCYA 2DBVO 3ABIA 3P2YA 4TSKA 3FHLA 1EVYA 2DUWA 4NG5A 3LDHA 4DPLA 5F5NA 2I3GA 5T8KC 1ZK4A 2P4QA 3TSCA 3WOHA 1H94A 4YACA 2C54A 1LI4A 2O7SA 3L07A 1YRLA 1R12A 1Z45A 3KYCB 4IQ8A 4HXYA 4H3VA 8LDHA 3WGQA 2FSVA 1QYDA 2JJYA 1IHYA 5JSFA 1GV0A 2GNAA 5JY1A 3D3EA 3MZ0A 1GCOA 4CJXA 1UR5A 2BFAA 2QRJA 1B0AA 2YHIB 3CUKA 4DLBA 3BA1A 2XOXA 4GVLA 2JHFA 4LRTB 4M54A 3DBVO 3DL2A 1QV6A 4PLWA 4DBVO 1ZZEA 1ZW1A 2DBZA 4DC1A 3TWOA 4MP8A 4ALKA 2YJZA 4UUPA 2I65A 3NYWA 4M87A 2V6MA 3B1KA 3WG9A 1GUZA 1E3IA 3MWEB 1V9LA 4R68A 4PVDA 1V6AA 1KVTA 3KZVA 3EDMA 4HUJA 4F3YA 2PKQO 4YVFA 1CRWG 1XSEA 2W2LD 3RBZA 5F5LA 3I9OA 4R01A 4W7HA 1MGOA 3HDJA 4YT8A 1NWCA 3TRIA 2X23A 3IJPA 1I3NA 3KV3O 2E48A 4UVHA 1NWHA 4FJ0A 4ALNA 3I1JA 5F21A 2Q99A 4GGPA 1S6YA 2VRBA 1IPEA 3PRJA 4XGKA 1U3UA 1E7QA 4BNFA 1NVGA 1ISHA 5ER9A 1WZEA 1E1NA 3PHHA 1XA0A 2PA3A 4EEZA 4P22A 2FY8A 2I3AA 1I01A 3AOEA 3OJEA 1TLTA 3WMXA 4DIFA 4NIMA 1NHWA 1ULSA 2GUGA 3JD0A 3F6YA 3QVSA 3JYLA 3ZWPA 1ONOA 4A73A 1J49A 4H16A 4U6QA 4Y6RA 2Y0DA 1I3LA 3PJEA 2WE8A 4A0SA 4PG4A 2YHIA 5F1KA 4N7RA 3BZUA 3F5SA 3GOHA 4Y9DA 3A9WA 5COQA 4NZ9A 3FR8A 4UVIA 1WDKA 3D3WA 1LRJA 2GZ1A 3K6JA 5IZCC 5JBIA 4B4WA 1BDBA 1RM0A 4LSMA 1ULUA 3OFSA 2Y99A 1CJCA 5DBIA 3FNEA 4IIVA 2E82A 5H81A 2X5JO 2UAGA 1DHRA 4PG5A 3NGLA 3GA0A 1DC5A 2R2GA 4CMBA 3V2HA 4D0SA 1WMBA 3JQ9C 4B7UA 1Y8QB 3U4HA 1PQUA 1WMAA 4RL6A 2YFQA 2G76A 4Z9YA 3KTDA 4LSWA 4ALJA 4FOOA 3I52A 4IXTA 2EEZA 4D42A 1W0CA 3JQBA 4IGEA 4E2XA 5ILGA 5C3MA 1DLJA 2OP1A 4DWVA 1U5AA 5L7WA 4ZVVA 4I5EA 5L7TA 3R3JA 3DEYX 1TA4A 2CF6A 4E12A 2GO1A 3GGPA 1ZSVA 1JQBA 4U6SA 1VE9A 1FK8A 4XA8A 4CQLB 3L6DA 1P1RA 4LMPA 4LRSB 3SLKA 1QYWA 1DJNA 1OC2A 3EZLA 4B3HA 1D8AA 2EGHA 4QECA 3V1TC 4WJZA 3GDGA 1LDBA 4AJ2A 1X15A 2VYVD 1H93A 2Q49A 2X5OA 4QFDA 3JQ7A 3T7CA 4XKJA 3H9UA 4Y8VA 4CLDA 1EK5A 3GHYA 4TRRA 1F17A 1VJTA 3Q2KA 4BNKA 4Y98A 3V8BA 3S2IA 1F06A 3T7EA 2GYYA 5L51A 1LNQA 1AN9A 2IEDA 1TI7A 2IZ1A 3INGA 3PWSA 3AI2A 4RO0A 3ZH2A 2A9FA 1FDWA 3PWZA 3VH1A 1AHIA 2XXJA 2O3RA 3W1VA 1KVQA 1UP4A 3GNQA 1R66A 3INRA 4FQ8A 4M49A 2RIRA 4ZQFA 3L6OO 2HUNA 2D5AA 2O48X 1X13A 4I5FA 2IZ0A 1U7TA 1G1AA 1R0LA 1X7HA 2OZPA 3AM3A 2ZB7A 3LU1A 4A5OA 5BSEA 2E4AA 3X2EA 1PJLA 4E6PA 1Y8RA 4LK3A 4XR9A 3ROQA 3JQEA 3EW7A 3FD8A 4ND2A 4D43A 4ZQHA 1MA0A 3OJLA 1IZ9A 1XR3A 2NSDA 3ETDA 4WCFA 3ROKA 3QWIA 1M75A 1UXKA 3VVBA 1XQ1A 3AY7A 3I3OA 2NV6A 1E0DA 3SVTA 3MWDB 3T4EA 1C1DA 1IB6A 4FPXA 1NAIA 4CLOA 2TMDA 3GZNA 4ID9A 1NPDA 2GCGA 4ZRMA 2AG5A 5G0UA 1LBEA 4BO2A 4CM6A 3I23A 1ZIDA 3IKVA 3ORFA 4ROSA 3ONEA 1O95A 5JNLA 4ITUA 1WAMA 2DVMA 4N5LA 3MOGA 2EKLA 4H7PA 4GSLA 5F1OA 1EQ2A 4IBOA 1FJHA 1I10A 3D1LA 4BIIA 4TZTA 4PLPA 4HNGA 3QE3A 3P7MA 1N5DA 2IRWA 1X0VA 5AOVA 1PJBA 4D0RA 3GRKA 3TPCA 3WICA 4GMGA 1VI2A 2PV7A 1U8XX 3GPDG 4E5YA 2FN7A 2Q2VA 3BMQB 2HKIA 3DTTA 3EHEA 4XDYA 4DPKA 3DC2A 3BAZA 3O9ZA 3DO5A 4IUYA 3HN7A 1DIAA 4CLHA 5L9AA 1MC5A 1DC4A 1L1FA 2DFVA 3AWDA 1NQTA 3L9XA 4UEOA 3UUWA 4CL3A 5KVSA 3L4SO 4WLUA 1VRWA 2C29D 3T4XA 3GVXA 3VH2A 3JYOA 1NFFA 1B7GO 1DEHA 4IZHA 5TRTA 5FI3A 5I7FA 4G81A 4J49A 4CQLA 3MJTA 4CUJA 4IM7A 4YYZA 4HX5A 1GEGA 3G49A 4UVDA 3VVCA 4E2ZA 4G2NA 1GTMA 1PJTA 2V6BA 5JDCC 4EDFA 4HBGA 5C5IA 1T2EA 3GZNB 4MVJI 3GRPA 1LTHR 1QG6A 4FFNA 3JQDA 3RBXA 3AY6A 3PHLA 3M6IA 1E7SA 1PJ4A 1Z75A 1PZGA 1Y6JA 2EP5A 3VPHA 4U0KA 1E92A 3ZWMA 1ZBQA 3GVHA 1Q7BA 4KOAA 1BVRA 4F6LA 2NVBA 5B1YA 4WECA 4J9UE 5JDIC 4II2A 2AEMA 3KXDA 4WEOA 4FD3A 1SNYA 1B15A 1PQWA 1CERA 1U3VA 2ZB4A 5EN4A 2Y05A 1ENOA 2FPIA 4IJVA 4NK4A 1G0NA 1PGPA 3M2TA 4XB1A 2VNSA 4GBJA 5TSDA 1JKIA 2I76A 1MP0A 4O5OA 1RWBA 4OGWA 3DZFA 3ITDA 4AJEA 4W6ZA 4NQZA 3AOEC 1NQ5A 1K0UA 4ESOA 3HJAA 2X9VA 5DBGA 4TMFA 1LRLA 3E6AA 3VZRA 3H3JA 4C7JA 1R16A 3UF0A 3QWAA 1E3LA 5TJ9A 1C0LA 3H8VA 3C1OA 3L4BC 5ILOA 3RKRA 3JTMA 5JW6A 3N7UA 3FSRA 1UXIA 2ZQYA 4I9UA 1U2DA 4F6CA 1BG6A 3ZHZA 3E03A 1WXDA 4L4SA 3ZWOA 4CM1A 1EFLA 1KS9A 2HDHA 9LDBA 1EDZA 3MEQA 3Q11A 4R54A 5HS4A 2VYVA 1ZJZA 1D3AA 5TT1A 3RUDA 3H65A 3LT4A 4XQGA 5DZSA 1LSUA 1YOVA 2Q1SA 3JQBC 2WYWA 2PFGA 1P44A 3Q0EA 3UVEA 3WX0A 3NT4A 2BLLA 5THQA 1XQ6A 1YL5A 3A14A 3HFSA 1KETA 4JBHA 5FFFA 5HM8A 2VUSA 1LA2A 1FMCA 1ZKMA 4XYLA 2P68A 1YQDA 4CUZA 1SB8A 3W8DA 3F46A 2Q45A 3A4VA 4XB2A 1KC3A 2OORA 2BMAA 2QG4A 5BSGA 2BD0A 4JN6B 5JDCA 4IPTA 3RCBA 5DOZA 3AU9A 2I99A 7MDHA 4GL4A 1XLTA 3GAZA 1Y5RA 3IJRA 4KTTE 3U3XA 1QLHA 2NVUB 1E77A 2HRBA 4WKGA 1IULA 4PZDA 1OBFO 1K6IA 3PI7A 3TZKA 4KDFA 3ZDFA 1EMDA 1VKOA 2P9GA 4DREA 3OICA 1UJMA 3I4CA 4GWGA 2AQHA 4E3ZA 1HSOA 4W7IA 5I8WA 3BIOA 3V1UA 4BV9A 4BNUA 1Z7BA 1VSUA 4R51A 3E5MA 4RF2A 1A27A 3H5RA 3NUGA 4Y6PA 1UH5A 3S2FA 1K6JA 2HK7A 2JD2A 4J43A 1UXGA 1ZXBA 4ZICA 4R41A 4CUKA 3A28A 3UXYA 3V2UA 4Q3EA 3C7DB 4MIOA 4TQGA 4ZQGA 2H1SA 3JYQA 4FB5A 1JVSA 4EJ6A 1ZEJA 2GERA 5JO0A 5A05A 5HRUA 3RUAA 1DSSG 3I6IA 2PKQP 4QSMA 3DMTA 2EF1A 1ADBA 1BXZA 5C7IO 2P4HX 3OJFA 4BNHA 4CQMB 3TFOA 1F12A 4YJGA 4XJTA 1MFZA 3ZW9A 3WLEA 2VT3A 5AXBA 4DC0A 1ISJA 3PHIA 3FF4A 5IDQA 4PZEA 5KKCA 3OF2A 4AJOA 4J2HA 5JYEA 1R0SA 4JP3A 2PGLA 1KC1A 4Z0HO 4YEDA 1J4AA 1E7RA 5CAEA 1U7HA 1HTBA 3OA2A 4QX6A 3F4LA 3JQAB 3GVCA 3U9LA 2FWMX 5IDYA 3JD3A 2VHXA 3R6DA 4IDFA 5EQDA 4FW8A 1B3BA 1JA9A 3VHRA 1T2CA 1QP8A 1NASA 1SOWA 4EYEA 2XF8A 1EK6A 1QYCA 1HZZA 1ZVMA 4LMRA 2CSUA 2RAFA 2X9GA 1N8KA 1EE9A 4O59O 4GLLA 1X0XA 3DBRB 2CFCA 5BT9A 2HU2A 3WJ7A 3X2FA 3PPIA 3ZCXA 3WSWA 5DT9A 4ND4A 1DFGA 1UDBA 5ICSA 2PGDA 4ZQBA 5TX7A 4DVJA 4RF3A 1EVZA 1PS8A 1XHLA 5LC1A 5EPOA 3D5QA 4BO0A 4PG7A 1XGKA 4FFLA 1W8DA 1N7GA 3WYCA 3VKVA 2LDBA 3WNVA 1GFSA 1LUAA 3EYWA 2I9PA 1U4SA 4BNWA 3L0DA 2NQTA 4J4HA 4UREA 4KWHA 3KO8A 3GC6A 4PGFA 5CEJA 5KJ1A 2YQ4A 4R1NA 2EHDA 3WIEA 5FI5A 2WYUA 2FSSA 1XELA 1ZMOA 2PLAA 3GMDA 2F00A 3NTRA 3FWZA 4R9RA 3S55A 4NJOA 5JFOA 3LLVA 4IY1A 2VNAA 3C1AA 3HDQA 3M1LA 3GLQA 5TGDA 2GD1O 2RH8A 3NV9A 2CZCA 4EW6A 5G4LA 3SJUA 1LQUA 1XU9A 3ZU4A 5T67A 5H83A 3WR5A 3KSDO 4RJTA 5A9RA 3B6ZA 5L7YA 4C7KA 1Q7GA 2Q2WA 1K2WA 2NU8A 1ORRA 1YJQA 1P0CA 2YV2A 1OC4A 5AXDA 1V8BA 2NNLD 1MX3A 2Z1MA 1X1EA 3H9EO 2I6TA 2YYYA 1A4UA 5IG2A 4HFNA 3WNQA 2C2XA 1MFPA 4GPD1 1GR0A 3GK3A 4DL9A 3ASVA 1OOEA 3TL2A 6ADHA 4D3FA 2J6IA 1QORA 1UUFA 1R15A 3K31A 1CF2O 3BMCB 2EXXA 4HP8A 4MVJM 1HDXA 3C7AA 1GDHA 1ML3A 2CMDA 3ZU2A 5JAIA 2J3KA 3FTPA 4TVBA 4KDEA 4WOKA 1OI7A 4A10A 1YL6A 2JD1A 2DPGA 4EUEA 1LDMA 2GN8A 3SXPA 5L4NA 2DBQA 4BNVA 3GQVA 2O3JA 1VL0A 3Q1LA 1O94A 1JW9B 1R4NA 5BNFA 3I5MA 4AG3A 1CDOA 1Y8RB 2Y67A 4U8GA 1SOVA 4N18A 3PTZA 4AICA 5I7VA 3ETEA 4ZU3A 2GGSA 2VQ3A 3DZIA 1P77A 1Y9EA 2WYVA 2V65A 2OFPA 2CF5A 3MJVA 3S2EA 2DFDA 3RJ9A 1TVEA 1JLLA 2D8AA 5I9NA 3RUEA 1YGYA 2Y93A 1ZUD1 4HFMA 4YAJA 4HY3A 5BSFA 4S1VA 1GUFA 4FS3A 2OMEA 3PHJA 1EFKA 3KLPX 2WM3A 3QQPA 1G0OA 1KEUA 4HADA 2UUOA 1VC2A 3K30A 1HXHA 3CEAA 4OHUA 2EW8A 5IJZA 2EIHA 1HYGA 1C3VA 4XQEA 3VZQA 4E32A 1WVGA 4UUNA 3JQAD 3ZV6A 4GGOA 4AJIA 4YXFA 1NVTA 3DAGA 2DUUA 1XKQA 1I8TA 3TZQA 2OP0A 3O03A 1GAEO 1XU7A 3EC7A 2B83A 3DR3A 4IDEA 5KNLA 4J1SA 5FWNA 3Q2IA 4TRMA 1JTVA 2B36A 3VZSA 5DDIP 1MLDA 4FSHA 4MVJH 1K89A 3RU7A 1WW8A 5A9SB 2NQ8A 1N7HA 2B5WA 1HDZA 3R1IA 1T2FA 4CMGA 4BNYA 2X0JA 3OQ1A 3GNTA 2JCYA 2FPPA 3PK0A 5EJ2A 4XZ3A 4IQGA 1M66A 2GASA 3DZHA 2XAAA 4RF5A 1YDWA 3ICPA 2ILTA 4YCAA 1GYPA 5TLSA 2Q4EA 1Y9AA 1LDNA 3PYMA 4DGSA 3VPXA 3QVXA 4W82A 1LJ8A 2GRAA 2Q2QA 1N9GB 4IJUA 4RDIA 2VCYA 2ZQZA 4BO1A 1Z7EA 3F1LA 4Q3BA 3D5TA 2AMFA 4KMSA 4AJ1A 4AJNA 2BFPA 3GG2A 4N5MA 4TKMA 1K6XA 5HS6A 1WWKA 3MOIA 4EJ0A 2EG9A 1RYEA 1W4ZA 2QRKA 3ADOA 4DYDA 4AJ4A 3DBLA 3OIFA 4QUKA 2DTDA 1HZJA 4ZN6A 2IYOA 3AI3A 5KJ6A 1LC0A 1T26A 1SCUA 5CFZA 3NX4A 1MC4A 3JYNA 4XR4A 4PLCA 4IZIA 4K6CA 1J5PA 3GPIA 4TKLA 3GFGA 1U1IA 4PZCA 4PLTA 2HLPA 4MO2A 4B3IA 2VHZA 2X0RA 4UULA 2F1KA 2GN4A 4B7CA 1VL8A 1HEUA 1PTJA 3RC9A 2PH5A 3KVOA 3NDRA 1CWUA 2NM0A 5G4KA 4O1MA 5ITVA 4OO3A 1GL3A 1DDOA 4PLHA 2DU8A 1YVEI 2WDZA 3DOCA 3HNPA 1HE4A 4RZHA 4EUHA 3MJ4A 1O8CA 1NHGA 1T25A 1ZSNA 4PVCA 4BO5A 5KVVA 1HDOA 3L9WA 5GZ6A 4BNZA 5CEEA 4IS3A 1C1DB 2NACA 1NR7A 1C1XA 4D45A 1A7AA 4FJ2A 3AU8A 3ETGA 3O26A 3GVPA 1BGVA 3LLSA 1QYVA 2RHCA 3NDJA 2TMGA 4IJKA 3WJAA 4B3JA 3NDIA 2VHVA 1K5HA 3N74A 1UP6A 2WEKA 3C1TA 4BNGA 3LF1A 4RLHA 1WPQA 3GEDA 4YPOA 3ZNOA 2C82A 3DBHA 2OHXA 3HADA 3K2EA 4J7XA 3RUHA 3RVDA 3IQDB 3QVOA 3K9QO 1GEEA 1U9JA 4AVYA 2B4QA 3AUTA 4U7WA 6LDHA 1NP3A 2J3IA 1O9BA 3ZV3A 3JQ8B 1PJSA 4IJWA 3F4BA 1YQGA 4WLVA 4AJKA 5IXYA 3WGHA 1H5QA 2BFOA 2IDZA 4L75A 1E1KA 4UAGA 1NXQA 3QHAA 2H63A 4ALIA 3JSAA 1H6DA 3RD5A 2DBRA 3VDRA 4YJFA 3OJOA 1H2BA 1X7GA 1GU7A 4CQMA 4KQXA 3ANNA 4ZD6A 1X7DA 4PLVA 4QEDA 1Q2XA 4JLWA 5HTOA 1H6AA 1ZXLA 3KYCA 2B4RO 3BHIA 3Q9NA 3ZWNA 2POQX 3E5RA 3EVNA 1T4BA 3KRTA 1QYXA 5G0WA 3CSDA 1W73A 1YL7A 3FR7A 4YDRA 3SC6A 2PKRA 5EQFA 2HMWA 4BNLA 1WZIA 5G2OA 2ZTLA 3W4KA 1CIVA 5DN9A 1YBVA 4J91A 4UUMA 4YAEA 4J1NA 4PRKA 3IKTA 3GEGA 1NAHA 4KUHA 3L6EA 2D1YA 4E5NA 1ISFA 1VM6A 4YAGA 1DHTA 3SJ7A 4F46A 4OOFA 4YA6A 1PZEA 3IP1A 1Y8QA 3CZMA 1E7WA 4BNIA 1GQYA 3NEPX 2EERA 3VH4A 2AE2A 2QIOA 5AVOA 2ZYDA 1MXHA 1PZFA 3ZHYA 2HMVA 4WLEA 2Q3EA 4CM9D 3DTYA 1A7KA 4JQCA 1LU9A 4MP6A 3ZWXA 4FIZA 1IYZA 3TDKA 1L7EA 3E1KA 5L40A 2B35A 3D4PA 3D3WB 4ZHSA 3DZBA 3GVIA 4R3WA 1V3UA 4FCCA 3K5PA 4IIUA 4ND3A 5EERA 4XIYA 3ULKA 1LLCA 1PQPA 3RIHA 3QSGA 5ITWA 4DTIA 2CDBA 1R0KA 2YDXA 5I7SA 2AW5A 2ZK7A 4MOWA 1WDMA 4GSKA 3ZNQA 4K9DA 3JQFA 4BUCA 3S2GA 3HHPA 2VWGA 2W2KB 4INAA 4WLOA 4L76A 2VTEA 1DFHA 3FBGA 4B79A 4I5GA 2VYNA 4PRLA 4L0QA 3LK7A 3H5NA 1D7OA 3U62A 1ZEMA 3R3SA 1XYGA 1GY8A 1WP4A 4IMPA 2QYSA 5AXCA 4X54A 2WD7B 1LLDA 1JN0A 2QW8A 3CINA 2NU7A 3D4NA 2BGMA 4CM9A 1ZK2A 1QRRA 2CNBA 4EZBA 4NI5A 3DAFA 2X4GA 1CQIA 1GYQA 3CMMA 5JAMA 2FR8A 3KUXA 4PFJA 4JNKA 3BMNA 1O6ZA 4Q9NA 2I5PO 5C7OO 2H5LA 3JCZA 3WMWA 3WTBA 3WGYA 1A71A 3HB5X 2ZATA 5TNXA 1L7DA 3DONA 1EUCA 3I83A 2I67A 3DMYA 4XIJA 2PD3A 2FR0A 3ROPA 3WGOA 4J3FA 4IXWA 1YB5A 2HMTA 4OOEA 3ZNNA 4CM8B 3VOSA 1FDUA 3PQFA 5G4KB 1NVMB 1MG0A 4IDBA 3DQPA 1B8UA 4LN1A 4MDHA 1SO8A 4ZRNA 1DRUA 1TXGA 3GUCA 1GPDG 1RYDA 3EVTA 3GY0A 3JYPA 4TVOA 4CMJA 2YUTA 1B2LA 3A1NA 3QWFA 1A4IA 3ANMA 4WCDA 3OHSX 4BO6A 1JVBA 3LC2O 3IP3A 2PD4A 3ASUA 2HAEA 2UYYA 5TJHA 5KJFA 2NADA 2ET6A 2DQ4A 2J3HA 4OSPA 1G6KA 3JV7A 3B20A 3U4IA 1ONPA 3L4BA 3ZU3A 2VZ9A 3PIDA 4FC6A 3KYDB 5F1PA 3QVWA 1LDGA 1Q1NA 4DA9A 1IE3A 3HUDA 5A9TA 4CQMD 3NTQA 2B69A 1J6UA 1PJCA 1YKFA 3RSHA 4YQZA 4S3MA 4OSOA 2J3JA 1I36A 1TT7A 3OEYA 2EWMA 2G17A 1BSVA 2BGKA 1ENPA 2I66A 4E31A 1DIBA 3GDFA 1U8FO 4Z3DA 1AUPA 2O3QA 4M86A 1Q7CA 3P5SA 1ENYA 2P2SA 1HDCA 1DBVO 3DZKA 3AOGA 3E8XA 5A9SA 2RH4A 3EMKA 5BR7A 3ZN2A 1LXCA 3FTNA 2VOJA 2PY6A 2VRCA 5B12A 3KLMX 4NBRA 4YWJA 3H5AA 3WDSA 2PTGA 1B3RA 4BMSA 3AUSA 3SBOA 4DYVA 1PGQA 3DHEA 1C0IA 2PR2A 4QTZA 1E5LA 1GZ6A 3JQGA 3K8ZA 3UGKA 4HNHA 4J9VA 4CODB 3OIGA 3WYEA 5JE8A 4RVGA 3ITKA 4WPGA 4ALMA 2OGUA 1DLIA 2Y1GA 4I9HA 3BMOB 4JJFA 4KZPA 1HYEA 3NJ4A 4EEXA 2IZZA 1U3TA 2OXIA 2ZIZA 4MKRA 4DPMA 1QXSA 4WE3A 3B70A 4P4GA 5TT0A 1ADFA 2PK3A 2J5QA 1HE3A 4CV2A 3PQDA 2P9CA 1U3WA 1FDVA 1UDAA 3CKYA 3LZ6A 4EI2A 2O2YA 2O3UA 3M1AA 4YRBA 2O50A 2AQIA 4YRAA 2AE1A 4RQTA 3N58A 1BMDA 1E6WA 1HYHA 1OAAA 1PGOA 3AUUA 3KSZO 3GHHA 3DHYA 4NBTA 2C0CA 3BTVA 3JD2A 3NT2A 1AGNA 3E82A 1C14A 1Z73A 4YT5A 3LC1O 4AJJA 3H6KA 1NM5A 2C5AA 2W2LA 4P8RA 3OSUA
chains in the Genus database with same CATH superfamily
4ZARA 4PNZA 5BRNA 2H2GA 1IG0A 4BO7A 2VZEA 4C4AA 2AZMA 2BW0A 3DJYA 2R1VB 3KCQA 3MGBA 2WSIA 1EH5A 2QTBA 3NCHA 4Q3CA 3H8SA 4EUFA 5A02A 1FVHA 4JY7A 3SQLA 3V33A 2VKTA 2YY5A 3O6VA 4L7VA 3ZHRA 1FFHA 1FVOA 1Y80A 4TS4A 3K8OE 1QP7A 3VKUA 5LP1A 2AFIB 3BTOA 5KOYA 4P0PB 1AHHA 1JKFA 1MDBA 4RVHA 4W9NC 1IJBA 4LE1A 4NBLA 4Y7CA 3BFVA 3I2JA 1YS1X 4IOMA 2IH5A 2C77A 3OCXA 3QELA 1T1JA 1M0SA 4G1UC 4NJEB 4B7XA 1E7MA 5G41A 2KI5A 4BOYA 1T36B 3QPCA 1JHZA 5B4VA 5KAPA 3AHCA 4HLCA 1OSNA 3I5UA 4DSOA 4FNOA 2NU8B 3KZOA 3LRXA 3H0KA 2FHSA 5K6AC 4FMDB 1KBOA 1ORIA 3G1TA 3LVRE 4HRYA 4UVEA 5G0SA 3UT0A 1GUAA 2A4MA 5TQ2A 3ZVLA 1XJCA 5CPFA 5A2GA 1NNSA 2NZVG 4ZOAA 1OFGA 1Z5UA 4EHLA 1AJEA 1ZCJA 1NJ1A 3ZV5A 2LV8A 5IEBA 3D3NA 4KODA 3DDSA 5BSKA 5KNCA 4BNMA 1BDHA 1FBTA 2CMKA 1TM4E 3K53A 3MT0A 4YB8A 1ECJA 5E8RA 2I2AA 3NHFA 2KX7A 3COZA 2A9QA 3MGGA 2ZSKA 3FZQA 4H6VA 3AF5A 5TMEA 1LPAB 2IUTA 1ADGA 4P7FA 3JQ9A 4C2BA 4D79A 3DEIA 5DULA 5EA2A 1VHWA 2XXAA 4EF5A 5FO0A 1UOPA 5HQ3A 2KB0A 2IS4A 3QJGA 2O0HA 2NU6A 2ZJ7A 1JSLA 2EJVA 5BXQC 1NP6A 4QWMA 4Y9UA 5EKDA 5ICEA 1KVSA 2VZ8A 1KE2A 2V7EA 4BUZA 4BZPA 2Q7DA 2I54A 2QDXA 3WJ2A 2FUG6 5FYDA 1KOLA 1PT7A 1IY0A 1G2PA 1QO0D 5AOCA 2X0NA 2UVPA 1GVNB 2PLFA 1S2MA 2FPGA 2KM1A 2XYQA 5F35A 3H1GA 2QL6A 5FWXB 2YOFA 3EPRA 2DC1A 1IOZA 2E6KA 5COBA 4EDHA 4U2DA 3NXKA 1WB5A 1RNLA 4FFMA 4JXZA 1W49A 1RRPA 4MKZA 5GY7A 4BQOA 5DMHA 5AKYA 1H2HA 2OL4A 2VT7A 5I4BA 1RM5A 1KI1A 4ZV9A 2XXBA 3ZBPA 1C9EA 1OWMA 2MU1A 4IJ5A 3GBVA 4JS0A 1P1KA 1QM5A 1UADA 1YU9A 2C96A 4Q1FA 5EC8A 1SBNE 3WSVA 2I7DA 4OIMA 1PKEA 4M99A 4GLOA 1O9HA 4N12A 3ENVA 4C7VA 5FEUA 3PLRA 3TCNA 4GC9A 2PT7A 3K6RA 1I5EA 4M7WA 1ZK1A 4X7MA 1U0HC 4GT1A 2QKYA 1Y1SA 1ISIA 2QD3A 4OM7A 1ZMRA 3LHIA 1A0OA 2XT0A 4IUCS 1DADA 1P1HA 3PEUA 3QOWA 4CQJA 5EHGA 2ORYA 3I9KA 3EHDA 4PRZA 2JKYA 1COWD 1XNHA 2GPJA 4Y67A 1JQAA 2QXYA 3F74A 3KD2A 2YDYA 5KWVA 1EJ6A 5GVRA 2VCEA 1VL2A 1T4CA 4JQSA 1M6EX 2R6JA 4US1R 1XLVA 2QGFA 2Q3LA 1YU6A 2FCRA 2LCFA 2RG7A 2QNRA 2VQSA 2Z4RA 4LVNA 3A9CA 3LHFA 1USVA 1M2OA 4IDHA 4WBNB 1DC6A 5AW6A 5TQVA 1YQWA 1B74A 5AM3A 3L01A 3PC8C 2BFCA 1LRKA 1BE1A 1UKYA 2ODPA 3PXXA 3AHHA 3WAJA 3QWBA 3CLKA 3HZOA 4I6JA 1ZUIA 1QQ7A 3IMEA 4BEJA 1TQHA 2VHQA 3AIMA 1DTWA 4IP0A 2VVTA 4QGHA 1NVXQ 2C2MA 1PFGA 1YQXA 4O4JF 2Y76A 4V3CA 3O8QB 3IHWA 3PPXA 3ANTA 4HX2A 3WQQA 1XMJA 1YJAA 4PPNA 2RC6A 2JHGA 1CQIB 4V39A 2RHGB 3U3MA 2O8DB 4RETA 4FCWA 3BK1A 2BBSA 3OKFA 1Z7WA 5JNSA 2I2CA 4PZAA 2B5VA 1SKYB 5D01A 3TSOA 3CVWA 3FI9A 2PX8A 4B71A 3IQGX 1NZJA 5AW2A 5FOQA 3QYAA 1AQJA 1XG5A 1I7QB 3DOJA 5I9LA 3AM1A 4LCJA 2JIQA 3OPYB 1O97D 2VYND 2CVPA 2X2FA 3AF4A 1CTQA 2YQ5A 3PE6A 3B7GA 3PFFA 1NA5A 3QA9A 4JGIA 5IUJC 3QW2A 1OLXA 4IDOA 3TG8A 2OBNA 1CZKA 1NKTA 2D7CA 4MR7A 3VM6A 3T1QA 1PWZA 3UO8B 1EFTA 4PNPA 2GEUA 3VPDA 3FYHA 4GM4A 3IAUA 2GYVA 1EINA 1VKNA 4KGZA 3JQ6A 4EO7A 4Q15A 3VNUA 4Z2AA 3D1VA 4UNIA 1ABBA 2FSIA 1VL6A 3FPFA 4KIGA 5LDDC 5JJLA 5EVJA 3WK6A 5FF9A 3M70A 3SQMA 5BVHB 4TMZA 1Y3AA 3PJDA 4P93A 1ISMA 1R0BA 4E5PA 1PNVA 1VSBA 4NBVA 5IJ0B 4OB6A 3ZWWA 1DFIA 2QROA 5J2TB 3L7YA 4FYVA 2BEVB 2CN1A 4L8VA 4JIMA 1PJ3A 4UE2A 5CUQA 3RFTA 4O2LA 5IC4A 1SZPA 2Z1NA 1W0KA 1YB4A 1KYQA 2BF7A 3NANA 4PANA 4RKYA 5IANA 1VLHA 3WRWA 3AY0A 2V97A 1QHIA 1DAPA 1XIVA 3PIIA 4IGFA 3WK8A 4KQ6A 4BMYA 4JL6A 4OUDB 5SYNA 3OCVA 4OI1A 3U39A 4A0RA 5T8KA 3ZUPA 3PQCA 1E1LA 5A3SA 1ES9A 5K3AA 1CVIA 4DMHA 1J2TA 4LY9A 3STHA 2UVPB 4JGBA 3QE4A 2C5FA 3P9QA 3UHPA 2A3NA 3MUNA 4IEFB 1A7UA 4XCVA 2ODNA 4EI9A 5KIAA 1KORA 1OUMA 4GZMA 2XTJA 1EM8B 1CR6A 1NULA 2H4XA 1JAYA 2V6FA 1JDZA 2R8YA 1BHSA 2YBDA 1R8QA 2MYPA 3GROA 1Y82A 1SC9A 3HL0A 1GKIA 4HVLA 1DO2A 3PD1A 4C7OB 3H17A 1U8CB 3WBBA 5KSPA 1UCFA 2F64A 3PNMA 4R0MA 1YQTA 3GFPA 4HQNA 3KD3A 4RK5A 5F12A 2GZ3A 1FIUA 1FFSA 1EGAA 2CWWA 5GOZA 3P26A 3CN7A 4GKJB 3P9IA 1RC1A 5AJVB 2ABWA 4LBWA 3BB4A 4LDRA 2I1LA 1KJIA 2QSJA 3LF2A 4RS3A 5DX0A 2HWUA 2X6TA 2PNJA 3ILSA 3N39C 3DAPA 2WJYA 3N0WA 1SCNE 1Z0DA 3UAXA 3D6TB 1UKVY 1N77A 2P6RA 1SKBA 5DEIA 1T3TA 4IDGA 1GQSA 2X15A 4RVDA 4AZTA 3BIXA 3KPVA 3R0XA 1GPYA 4RPLA 4NZMA 3RUPA 1G5HA 1LBHA 5DTRA 4DMLA 3M89A 3MYYA 2YVLA 3QJ5A 2LGJA 5TQ2B 4TROA 3KKEA 1FXSA 4B81A 2NAFA 4C0JA 4F3NA 5JAHA 3FH0A 4XVRA 3FUVA 1XBTA 1Y3DE 2FW0A 3BULA 2CLLB 4AUEA 1YH3A 1S96A 5K3FB 5I45A 3O3NB 3WNCA 5J43A 1BO6A 1A1VA 4REOA 1SXJE 4J7AA 1U8ZA 4ZMBA 5H7XA 4YTEA 4HH4A 5JS7A 2BBTA 3EEYA 5KMGA 3WWDA 5FAXA 4GLJA 4CV1A 3UMMA 3GCXA 1SU4A 2BEJA 1ULZA 3KBBA 2JH9A 2ODEA 3ZWVA 3OEED 1P2BA 1UK9A 3FFAA 4EGCB 1N8TA 4EGFA 4G0YA 1V1MB 2FW1A 2M6RA 2XMPA 1FX1A 3GFBA 4F3CA 2C5EA 3HPRA 2RAPA 3AF2A 4EGQA 5A1JA 5SZKB 2Y1DA 3PKZA 4YQFA 4AULA 3WKBA 5AVQA 1SC6A 3AHFA 3F7NA 1SJ9A 1Y4UA 1MPTA 3ADPA 1VIDA 2DECA 2ZRHA 3HZZA 5AKXA 5EGSA 3VC2A 4AO7A 2CVFA 5I6DA 1QU3A 4DQLA 4TUYA 1GNSA 5EMLA 2YN4A 4DLRA 2XBMA 1Z0AA 4QGSA 5JD4A 1U80A 4LHEA 4AY5A 1PLLA 2IE8A 2TS1A 3A0UA 4YO7A 4RZQA 4UATA 2CDCA 3TB6A 4K2AA 5BOSA 1D1PA 1T8SA 3GCDA 3U3DA 1DTEA 1V7ZA 3QPWA 2BJWA 4FOSA 1XK7A 4I99A 3UMVA 4DUPA 2ZJ5A 1IUOA 1X86B 3AL3A 4YAOA 1SUSA 3PICA 3L49A 4ZI7F 1N5MA 2ZJ1A 2ZAYA 4RXMA 1XAJA 1L7QA 3VJMA 3GLIB 2HSWA 4BP8A 1DIHA 4MQEB 1WY7A 1E89A 2Q62A 3MMPA 4EG8A 2BFEB 1FQOA 4CCYA 4JD5A 1B8OA 3QLUC 4LDNA 2OHJA 1XRJA 2WYIA 5IP5A 1YVUA 3AW8A 1Q20A 3L8EA 3Q3CA 3RVPA 3VAAA 1DBSA 1YHNA 3K9CA 2WKSA 2BFBB 3GWZA 4L8GA 2HCBA 5BP7A 1C7JA 1WNTA 4AMBA 5JARA 3Q15C 1E6UA 2OPBA 3KKZA 4LXUA 4BGIA 5ANRB 4GOJA 5K3CA 3TYXA 1JJBA 2X3FA 1EP2B 3M83A 1YVDA 1ILWA 1KK0A 4M1MA 3A6JA 4D96A 2R7KA 3JQCA 3S7TA 1NF3A 5HBRA 4B0PA 4BQRA 2LW7A 4ENVA 1Y4DE 1NR1A 2X19A 3EAGA 3VPFA 1JEDA 4B7AA 3GA5A 4ERXA 1BHJA 2GVDC 3BB3A 3LJKA 4I14A 4KNVA 1KI7A 2HBZA 1V2GA 3SS8A 2X9NA 2CL5A 4ZK2A 3U1VA 4AX4A 4G24A 1NN1A 3HO1A 2Y68A 4E88A 5I9BA 4EQZA 3IAHA 1HLDA 3THYA 2FWJA 3NP9A 5E7IA 3WO0A 4JC5A 1B73A 1H2EA 3A9VA 3IB3A 1PFVA 2I2DA 4RORA 1HI9A 2SBTA 2ZI9A 3FIUA 2J5KA 1E8MA 1ESEA 1VCOA 3NHBA 4WOJA 3UH1A 2JF0A 4RGQA 3K05A 3MAJA 3B9BA 1PZMA 1E64A 3LD9A 4K6FA 2I7CA 3W1WA 5C5EA 2FZEA 1FBNA 4C4SA 2C20A 1YBAA 1B41A 1RRFA 1YZHA 2IY8A 3OF3A 1VMAA 3LO5A 1XRSB 1WCXA 1W93A 3LPCA 2QS9A 1H0KA 1GAWA 4Z99A 3W0LB 5AVXA 4YHHB 1DWPA 2FPWA 4QQRA 5CXXA 1CULC 5BN1A 3IVXA 3FI0A 1ZIPA 2OBFA 1VYHA 1XWIA 3C8DA 4JYBA 3T1OA 3NETA 4U5QA 2PZFA 3BQNB 3ZW8A 4D9HA 3GRVA 4QPDA 2IZ5A 3LUFA 5FPPA 1EBFA 4BASA 1CQXA 5AKLA 4YCNA 1QAQA 2A78A 1Z5GA 3C8UA 3SNKA 5TXGA 3UQZA 1QAOA 5LSAA 1DI0A 4QFCA 2IYWA 1FU4A 3ISJA 3U49A 1YNOA 1LSSA 5IAOA 2Q9AA 2YZNA 3S5UA 4A2CA 4DWOA 2WU0A 2ZU0C 1H9BA 3EBPA 5IKMA 2HWXA 5AYVA 1E3WB 5DGDA 4F11A 4HZGA 5JMTA 2OY0A 2MINB 3ZBQA 1KU0A 4QHSA 1CUUA 3QKUA 3L8ZA 4B46A 1MN6A 1DWQA 4LPKA 3L7DA 4FE4A 1P0PA 4MQ6A 4EI7A 2CHUA 4L07A 1HLPA 2DUJA 1RJWA 2RBEA 4LJ9A 3KG2A 2ZKLA 4M8IA 1M2VB 4MVJF 1WUHS 3BDVA 4Q9AA 2NP7A 2WNHA 5TV2A 1BXRA 1QPZA 3IPYA 1E3WA 1L5HB 1IN8A 1V35A 3BMXA 3WRVA 1G7SA 1HE2A 3HDGA 5BNIA 4FBGA 2H16A 5DTQA 1FRVA 1NJGA 1QQ6A 2I78A 4G07A 1T35A 4II7A 3IBFA 1S0UA 2PZEA 2VPPA 5CM9C 3SQNA 4QU5A 4JOBA 3JQGB 3H3FA 1Z68A 2OKCA 3GAFA 1WW3A 4B45A 1ZFNA 5IAKA 5E1OA 1WCV1 1K2VN 2BZSA 1AXGA 3QVVA 1VSTA 2E4XA 2GYUA 1IQUA 1HG0A 3B3FA 3WLAA 1DP4A 3E7XA 5AVUA 2WABA 3VKFA 4NCAA 2IEBA 2HPAA 2FYTA 4F85A 1XXHE 3FWKA 3K96A 4DV3B 2QX4A 3Q3GE 5DP1A 1HT0A 1DDIA 4Z0TA 4CFSA 4OIFA 4ZOBA 1XEAA 2PZKA 2ZZKA 4FHEA 4M9XA 1FP4A 3RSSA 1RPNA 4B6JA 1RZRD 1LCIA 1LEHA 4IIJA 1QMGA 2Q46A 1NI3A 1G7CA 3BMCA 2Q1TA 4NEQA 2HA7A 5F1YA 2ZCVA 3N3BC 4MS1B 5I8ZA 1VCIA 4RPIA 3UHJA 2X2PA 4RMNA 4DJAA 3THXB 1N5RA 1OGJA 3AK4A 4I0WB 4OHPA 3UEOA 1JE0A 2ZYGA 2MYTA 4CMHA 3C15C 3ILXA 1UK7A 3VXKA 2AUNA 2VPQA 2ZAGA 2ZVJA 4KP7A 1HDGO 4B6PA 5KTSA 1AD2A 1K3UB 3UAGA 1AE1A 3HJRA 4IQ0A 4QPZA 1KQPA 2HCFA 3GNSA 4RFVA 5EE0A 2PGJA 3D2CA 3JVVA 4BDSA 2QTMA 4DLXA 2I4TA 1K88A 4IMRA 5EHQA 2OV3A 2XMQA 3DE7X 4JA0A 5FH9A 5FJIA 4LNUB 3KFVA 3K1YA 5IJ0A 5FRDA 3SLGA 3ZQKA 2HH9A 3AWIA 3OIYA 4OYLA 1D0SA 1U2RA 1KVRA 3HCDA 4EHJA 5JSHA 4Y2SA 3K0FB 3SIRA 3NAMA 3WMFA 2P9EA 2ZSUA 5DM1A 4C87A 3W5UA 5IF3A 2ZJ2A 5BW8A 1BTOA 2O4CA 4B83A 1O6BA 4UNQA 5CEFA 1NR5A 1CSEE 4XTCS 2JGJA 3HJTA 5KX5B 1UAGA 3TIIA 1NPYA 2FDCA 3WWEA 1Y6FA 1HL3A 3DMGA 1GA1A 2VZ0A 4P31A 2W8BA 3G17A 3K4PA 4AMGA 3TNYA 4ZAFA 1UZLA 2GFIA 4JJAA 4ZYLA 3MWJA 1YOVB 4R6WA 2OAGA 5KQGA 2XCLA 2C95A 3O4JA 3TNLA 2BJHA 4J2OA 3AJAA 1HE5A 2FG6C 1XAIA 2NXJA 1NI5A 2G0TA 3DO8A 1C3JA 4JK3A 1IXKA 4OYYA 4EHHA 4EY4A 4CKEA 5LMZA 1C3EA 4H18A 2OCXA 1PNTA 5U4QA 2C58A 4WJKB 3UOGA 1L8OA 4HDSB 3R8FA 2UYHA 2BFMA 1DKRA 4C4OA 4OU5A 2KBEA 1JQJC 3IUEA 2IHVA 3VUFA 3LUPA 5LA6F 2SHKA 2H5JA 4TT3D 3OAAA 2WWYA 1NG1A 1WVIA 2C59A 3E9NA 3COPA 1EE2A 1ZQ1A 2CJFA 1ZJYA 3L7CA 3NBYC 3DBRA 3ESXA 2BH2A 2OFWA 3JVDA 4MB0A 4EJSA 1FQWA 3L8FA 3R3XA 1OX6A 3CUWA 3TDNA 4JB2A 3G1WA 4G0ZA 1FQJA 1V43A 4DT1A 2FVYA 1SELA 2P6MA 3P9KA 1QBGA 1ZD8A 2F9FA 1QGOA 1OZHA 2Q0HA 1X9HA 2QT1A 3JD1A 2OZKA 3FYDA 4OMFG 4C6TB 1BS2A 2IUSA 2XE8A 3C97A 4MVXA 3BFXA 1JT2A 5KTNA 4ZOLB 5HF6A 5JJCA 5E38A 1BWQA 4O4IA 4OJQA 4ZYZA 1ZM3A 2WSSD 3KEOA 1W2GA 1P9LA 1Y37A 1AQYA 3GU3A 4X41A 1OA1A 5KHAA 1WSDA 3OEHA 5B4TA 2WWVD 3SYKA 4BQIA 4YV7A 4QG3A 1QQBA 3A4YA 1Z5OA 1EX7A 1SR8A 3G5AA 3ZWAA 4ILEA 4DLSA 3LPMA 4DM4A 2HCTA 2OGSA 3HYCA 3UPDA 4XUDA 5I01A 1WBBA 1BXGB 3AVXA 2W6NA 1Q3TA 1SEPA 3KFXA 4MA4A 4B4UA 2FFAA 2RFLA 4O2BF 5DHQA 1KE1A 1EA7A 5BSWA 3WK5A 1E79D 3B3JA 4TTVA 3UXEA 4JX8A 4URZR 4EGJA 3TLGB 4R05A 1CZLA 2DPHA 2C5BA 5JLAA 4ZTUB 1H0RA 4PHGA 3N2GA 4HDOB 5C7LO 3ADCA 3CCFA 4UBMA 4G0UA 4JP5A 4XPIB 5FWDA 2C4HA 4YLGA 3V00A 2VDWA 5B2EA 4B3MB 4XRGA 4ME6A 5LDHA 2HNBA 3L0ZA 1MC1A 3CJQA 3VX4A 3R0IA 1M5UA 1GHTA 4FGKA 4ZEVA 1RE1A 3LOUA 4YRIA 3O8BA 3W6ZA 3WGTA 1KDTA 3SI7A 2CVQA 2FRVA 2FOIA 4X3OA 3WAKA 1NGSA 1TKCA 4JVLA 1KEEB 1E6LA 3WK9A 3JTEA 2JLZA 1FJ2A 3B9PA 1QZZA 1QIEA 3G5TA 1SIWA 4TLMB 4QT4A 1U65A 5AM4A 5ES4B 3H04A 3AEKB 2YRFA 1GG8A 3BTSA 2WTUA 4KXYA 5HIMA 4D02A 3A4MA 1SD5A 3WSTA 3ORHA 4NK5A 5JD5A 2ZRMA 2O8NA 1LQTA 2SNIE 1N9KA 2AEFA 3USCS 4BNTA 5HQJA 3T34A 1FU7A 2XGMA 4WXMA 4NE2A 2JJ2A 5HZKA 2NSHA 1E0KA 2R44A 3AYZB 1AS3A 3QX7A 2L17A 1YFLA 5FYQA 2QV0A 4YCSA 3ES9A 1MQ9A 3RC7A 1EXNA 3H0EA 4MDYA 3BSYA 5CNIA 3DOIA 1PSWA 4I2VA 2DPXA 1KR2A 1KZ6A 1MBZA 3G7NA 4KBGA 3P27A 4K0KB 3TFQA 4JUCA 1GCUA 1NMQA 1ACMA 2FP3A 3JARA 4RGBA 2O7NA 4E0BA 3L0PA 3WKDA 1B6GA 1MB4A 4OAQA 4TVKA 1JH9A 4Z9XA 3FLAA 2D0OB 1TYZA 1JL3A 1JG3A 2E5FA 4JH0A 4UEJA 3PX2A 2QLBA 3IIEA 4RQBA 3CONA 1CB0A 1IXSB 4KZKA 1DC3A 5F2KA 1YASA 1YAJA 2NTYC 2YY6A 4Y2GA 2PH1A 2JIZA 5FLKA 3VR5H 2BMEA 2OK8A 1R88A 5ELXA 1J2JA 1Y5MA 3TK1A 3WB2A 2P77A 1XPOA 4HWKA 5H1YA 3PEVA 4MYUA 2QSUA 4UUAA 1OB2A 1E3SA 4NCKA 3LBIA 1PR3A 2N0SA 3GJTA 2QZ9A 1ZH8A 4JJZA 1RSZA 4LWZA 4Q12A 5A0TA 4UHFA 5CDYA 3ZDEA 2FMUA 1BN6A 4HYEA 5L4SA 2CY0A 2H1WA 2PUJA 4Q24A 3WYBA 2VF8A 4NYMR 2V6JA 2W0SA 3ETCA 5AQ1A 3O84A 1DAGA 2X40A 4HWGA 4LYHA 4L73A 3RFXA 3O8QA 3TD6A 5BVGA 1KK1A 2G6BA 3ORSA 3DPIA 4X1KA 2DHDA 2WOOA 3UMJA 4XOUA 3KB2A 3AP2A 4F1JA 5JCPA 1G8FA 4WKPA 1WHSB 2VT2A 3G8DA 4MPPA 2JFPA 3GLIE 4P58A 1YR8A 4MVJD 1O6GA 2AVNA 4L74A 1P3DA 3HDYA 2HSJA 2GOYA 4BTVA 5HXAA 4HFJA 2KQUA 3KOYA 5G1OA 1M1NB 3I72A 2AK2A 2WA1A 3HUFA 5JRZA 1V3QE 3R7FA 2MSNA 3V1LA 2A8YA 3E7DA 1D1SA 1QV7A 4BB5A 4MHOA 2ZYAA 3EZ9A 2QLFA 4FKMA 3NEJA 4CW7A 1H22A 1GDTA 2NG1A 3CQ9A 1N2ZA 3QE0A 4L0DA 1MDFA 1QCYA 2ZIGA 3N76A 4FNAA 4W4TA 3PI6A 5CLLA 5EP2A 4PC6A 3SZUA 4NU0A 1EFVA 1FDSA 4OQXA 4BQPA 1I5RA 4KQFA 2HO4A 1BMFA 5C18A 3RYCA 5L4LA 2II6A 2QK4A 4KXWA 9ABPA 3NHKA 2AVDA 4Q3NA 3VBEA 4YR7A 2IE0A 1N2HA 1E3JA 1WSBA 3DCIA 1EX6A 2EKPA 2PWYA 4O2AA 1R9MA 2HK8A 1B2RA 2H2DA 2XDWA 4I8DA 2Q3MA 4HNRA 1L4LA 4Q7EA 3R8XA 4RJKA 3NFYA 1TA9A 3V1NA 3HY3A 1EK1A 3BHMA 3QG1A 3IOBA 2QPLA 2BFFB 1M83A 3NOOA 4QL3A 3SIXA 2VAVA 3KPUA 3MRSA 3VTFA 1XDZA 3NORA 1W4CA 2YNMD 3PUKA 4OHXA 3DXZA 4XYBA 4FOLA 3I64A 5BMVB 2XTNA 4LFAB 1GZ7A 1I4TD 1Y1LA 3SC2A 2O8DA 3C1UA 2GXQA 5ETJA 1BXKA 3AI1A 1X14A 4WUTA 4KXUA 3HRKA 2H4FA 1G20A 3I45A 3K16A 3C3MA 2AJCA 4KWIA 3EXEB 4RIFA 3TNFA 4R1UA 2WTAA 3PL5A 3WY9A 1LSOA 4UAJA 1ZNZA 4BRUA 4M55A 2JC3A 1RJEA 1W85B 1A3CA 2EV9A 2R5WA 4J0FA 4I8IA 1H6CA 1NW9B 4JLMA 1EAMA 2ISCA 4WACA 5ALNA 2P91A 1VMDA 4C3VA 4L4RA 3FTCA 1UAYA 3ABSB 3PF8A 4P3YA 5E4YA 3IAM6 1ECBA 3V8QA 5BV1A 2DWPA 1U98A 3K32A 4B09A 2WJHA 3FNBA 1I13A 2OQVA 4RPKA 4L08A 4KR7A 1M33A 3JQFC 1XZDA 1XFDA 4KYUA 1A69A 5LBUA 1DXYA 4G41A 4ID3A 1LX6A 1JIXA 2PT5A 3KDAA 4I8XA 1YR3A 5AJXA 3IUNA 1XF9A 2YZGA 1FUEA 2JGDA 4ZO9A 4TWRA 1VG1A 4YAIA 3WKAA 3U4MA 1UJ5A 1T6XA 4D4KA 1HEYA 1ND5A 3A4IA 2R00A 3KQPA 4MUYA 5KQSA 4J29A 4QNNA 3QELB 2QZZA 4D98A 1GWNA 3OT5A 1ZISA 5AHWA 1GXSB 5EPUA 5ILQA 2X6RA 5JAQA 1SXJA 4OFZA 2GX6A 2H2HA 5HWSA 1Q0ZA 2CDRA 4RSRA 1ZNWA 2SCUA 1FVXA 1N34B 2WZBA 2C9BA 1A76A 4KFTA 4LS3A 4QLBA 1I3KA 4O0MA 3T41A 4M0FA 4CKYA 3O31A 1ORVA 3RBVA 1QC5A 1ETUA 1ZM2A 4LW8A 4BCDA 5ED4A 3IO5A 1UXJA 1U9YA 3PFWO 1DO8A 5B7PA 3FZYA 1LPNA 4RPHA 1ZC4A 2H2AA 3BH7A 4P4NA 3U4CA 3UGTA 3IO3A 3L8DA 3QA3E 3UUFA 3RW9A 4V0KA 5JU6A 1R6AA 4KEAA 4I1PA 2PUCA 1EZZA 1M8GA 4FZRA 1JJVA 2Z4SA 2XUJA 5FWYB 2XUQA 5AK0A 3PPWA 5THXA 2J07A 4QOJA 5LYJA 4DG9A 2OBYA 5B3KA 5ENZA 1DE0A 1XZMA 4FFRA 4RA9A 1LLQA 4AWXA 1K1EA 1V39A 2X5KO 1GADO 3CG4A 1ZM9A 3H75A 2NZ8A 3I34X 4MGKR 5KVQA 1ZRNA 3ZWKA 1JPVA 1QP4A 4OKIA 1YZLA 2R8ZA 2V58A 3TZ6A 1XTBA 2EFEB 2WUGA 1XRQA 4EHIA 3I6MA 5TQ0A 4B32A 1YS4A 3DEZA 1B16A 4INOA 5CNKA 3SSOA 2HQ1A 4D4GA 2JFYA 5D5QA 1E2JA 3EARA 2ZVDA 3EOBI 3UAYA 3KJNA 1UDCA 3NV7A 4GIBA 4MIEA 3C8ZA 1JYFA 3Q3IA 1DUVG 1U2SA 4CEJA 5BO5A 1SPXA 1DKMA 2H0QA 4EFKA 2FQXA 2M6SA 1UQTA 2V0CA 3JRNA 1N2IA 1T9KA 4XVCA 2ZS9A 2JCXA 5FBWB 2FEOA 3GFOA 2PSDA 2A9RA 4PC3A 1B1AA 3RABA 1P2GA 5A6SA 1L4NA 5IVIA 2NXEA 5LU8A 1G21B 4TS1A 1XCBA 4A03A 2AJTA 3TQOA 5F3RA 3REQB 3MJEA 4IG4A 5MHTA 1GNRA 2JI6A 2FB9A 3W2GA 1P72A 2Z8ZA 2EJWA 5LD2B 3JQ7B 1E4EA 3ANLA 1AC5A 3KKMA 4US0R 3S1LA 1D1TA 1FDTA 3RS9A 2HA6A 3IOYA 1JNYA 2WHPA 3SFZA 2VTDA 3LQKA 5KTKA 2QD4A 4KH0A 2BJVA 3PXDA 2C7PA 5H4GA 4NHEA 4JENA 1TMYA 2Y27A 2EKQA 4OH1A 4PSAA 5E6SB 1WKCA 4DIUA 2OENG 5A4DA 1FFDA 4BFSA 5B64A 3TN7A 3G9UA 5I7OA 3PQEA 2LCIA 3GCZA 4DABA 2Q4TA 2VPYA 3I9V1 4JL5A 5JO9A 1BKDR 1PP4A 2Z3VA 2JFVA 1E5QA 4D8XA 5JAZA 2BCJQ 2C9OA 2JGAA 4NDZA 2QRMA 5BV7A 3O38A 1WXWA 3L06A 4HUQB 2BGRA 1RJDA 2BEUB 3IGFA 3KWJA 1O94C 2DBVO 1OI4A 3A58B 4QBGB 1N6HA 2C9DA 4YRCA 3P2YA 2N47A 4E07A 7REQA 4KPYA 2PT6A 2ZYSA 2DUWA 3RYHA 2XVAA 5CYFA 1W48A 1VCNA 3AUJB 1XQXA 2VLIA 3VPBA 5T8KC 3W9SA 1KOGA 2I6XA 4Z1OA 2P4QA 2XB4A 2AI2A 2O0LA 3EVFA 4YACA 3TW4A 1G18A 4Q9JA 5CBKA 4PPYA 5KPDA 3MCUA 1U3DA 1C2YA 2Q3CA 2FSVA 2JJYA 3IDZA 1YK0A 1JG7A 1N2CE 1P2DA 1WCWA 4JA2A 5B1IA 5JSKA 2A5GA 3SQXA 2GNAA 3DW1X 10MHA 2CLKB 3ZQJA 1J23A 2IIPA 4NVRA 2K7FA 1V48A 3DLBA 3CF6R 1B0AA 4UXHA 2HTEA 4HDRA 3BA1A 2XOXA 1CY7A 4OLJA 5AM2A 1JA1A 4GVLA 3IV9A 4M54A 1E3MA 5M34A 4G97A 4DBVO 2Z2IA 4M6WB 3N2EA 1ZW1A 1J7JA 5DRYA 2VK2A 5BWOA 1U1GA 4J03A 2C9MA 1A98A 2V3WA 3NYWA 1JFLA 2V6MA 5JASA 2GCIA 3B1KA 4OHKA 1KIAA 4EHFA 1BAPA 2I62A 3MXTA 3OPQA 4ZCSA 1E3IA 3Q10A 4CEJB 2UUCB 1BMQA 5JS2A 2DFPA 1BWPA 1TLFA 3NBFA 1KVTA 3KZVA 4D9IA 4UTNA 1N0HA 1ZMBA 3MELA 3EDMA 4RK7A 1GUDA 1Z0KA 4OYHA 2JKZA 5HPYB 4RY8A 2NUPB 3L0CA 4AXBA 5IEJA 4NHOA 2QU8A 1GA4A 4X66B 3OUUA 4ACAA 3CEMA 4IWYA 2D0DA 3GRZA 3I9OA 4J3JA 4R01A 5AQEA 1RZRA 4CIBA 4MRRA 1MGOA 3I8SA 4XXHA 1SVSA 4H77A 2KBFA 4UZSA 3RM3A 4CI9A 2FUCA 4D26A 5JFGA 5LYJB 4D81A 1J0BA 1V37A 5JJKA 2AEEA 5DNYB 1XMPA 2WSMA 4G25A 1P4HA 3UW1A 3TFWA 4FJ0A 2H48A 3LY5A 1B6SA 3I1JA 3UMCA 5DHAA 3V7UA 3HWSA 1SXGA 4MMXB 1FP2A 5FOUA 5SZHB 2P35A 2V0NA 4O3MA 2QVBA 2ZBUA 1E7QA 3ENQA 5K8LA 3SZMA 3AT1A 1PD1A 1ISHA 3EG9A 4LOKA 1E1NA 4DFDA 2FX5A 4NCIA 2XNCA 2YRWA 2ZBDA 3PHHA 4WV3A 2PA3A 1HQYE 3BJMA 2QTTA 4IIEA 2FY8A 4DIFA 1T0PA 1QIJA 2O8FA 2FPXA 1WF6A 2G9NA 3KT3A 4FYKA 1HDEA 2PAAA 1ZCBA 4C4PA 4G1CA 4H16A 4IVRA 5FL7D 4LJ7A 4Y6RA 5BRJA 1KJ8A 2JCSA 2Y0DA 3PJEA 1PFWA 4A0SA 2ODWA 2OR3A 4XVQA 5LQUA 3CKMA 2P7HA 2R66A 5CVDA 3ROTA 1JS1X 3HKDB 3F5SA 2R5NA 4UBJA 5EI5A 2MTBA 1VYUA 2FHPA 3A9WA 4NZ9A 4OGKA 2P1ZA 4Y9DA 4EHDA 2G4CA 1NMSA 3GP3A 3G59A 3WIVA 1N6OA 5FX2A 3PXEA 2JHAA 3OFSA 4FT4A 1DT5A 3UNXA 5K4HA 3ZD9A 1CJCA 1YJBA 3NIGB 3OVMA 5DBIA 1TJYA 4JVSB 1E5VA 1DJOA 4QTXA 2UAGA 4ZT2A 4L3VA 1GTVA 4GRDA 4LY6A 1DHRA 4PG5A 2BGUA 2Q1XA 3CB2A 5AW9A 6PFKA 1DC5A 1JF8A 2O8EA 3E70C 3R3VA 3JQ9C 5FWNA 3AR7A 1UC8A 2VQFB 2GAIA 3H1TA 1U0NA 4DLNA 4AQ7A 2IEZA 4FOOA 2EEZA 1W0CA 3G7SA 3ZCUA 5ALVA 3JVIA 1E59A 1BNCA 1I4DD 3DZDA 2OP1A 4MV6A 5CH3A 1CJUC 3R3JA 3TS1A 3LNCA 3ADKA 1X8LA 1TA4A 2CLIB 4E12A 1OT3A 3RNLA 4JT2A 2ZI3A 4UAVA 2FWIA 1VE9A 1CRQA 3VR3A 1TZCA 4JVNA 2PLRA 5AKJA 4Y9TA 2JAXA 1P1RA 1TYBE 2I8AA 4LMPA 4LRSB 1C0EA 3SJZA 1OC2A 1KO5A 3GNLA 2FWAA 3EH2A 4QRDA 1C3LA 1QPGA 3OLWA 4R0NA 3VNQA 4WJZA 1G5FA 1LDBA 3TZLA 1FZTA 1JQ3A 5HGJA 3AETA 5L3QB 4QFDA 1HTWA 1LVUA 3IILA 4KH1A 4TWZA 4LV5B 4XKJA 3T7CA 3UK7A 5AKGA 4EA9A 1ZN9A 1VLMA 2DHEA 3H99A 2IYXA 1J1UA 1CS0A 5T6MA 3SCZA 2HCJB 3D6AA 4Y98A 3VR5A 3WGKA 3PVSA 1DVRA 4BNKA 2XCIA 1TK2A 4G9EA 3EFOB 1AGXA 3BRSA 3UKDA 2XGJA 2YHAA 1SBZA 1QS0B 5IT0A 3K4HA 3L04A 4Q82A 4P83A 3F6RA 2DQSA 3F97A 4X20A 1ODSA 1RVDA 2QE6A 4Z9BA 4YN3A 3TB4A 4M49A 4O4IF 1JFSA 3DNMA 5LKRA 1KR5A 3L6OO 4F92B 1XMIA 2OXEA 2WW8A 4AY3A 2W6CX 5FJJA 1C1YA 4IFBA 1UBTS 2HWWA 5DNEA 4K2HA 3R75A 2BRUC 5C35A 3AM3A 3AHJA 1EU1A 1SU7A 1VL1A 4A5OA 3X2EA 5AI6A 1AA9A 4BECA 3KQMA 2G83A 3AZQA 3BVPA 4LK3A 4XR9A 2WJ6A 3EW7A 4TL9A 1UJ6A 1MA0A 1YB2A 4KO8A 1ZHFA 4ZQHA 1KJ9A 1Y1RA 1IZ9A 2NSDA 4WCFA 1XC7A 1JR3D 4Y9RA 1M75A 2IWHA 4EY3A 3AR5A 4HXGA 3IVRA 5KJFA 1XQ1A 1JT9A 2AR7A 4M1OA 5KYNA 5LOVA 1GA6A 4OX9Y 5FWYA 3VR5D 3MWDB 1FJGB 4C0AC 3X3HA 4FPXA 5CCDA 1NAIA 1XD9A 2TMDA 5GTDA 3OC0A 3R3YA 4NCBA 2Q9CA 5BUZA 3PEYA 4CM6A 2WT8A 1J8FA 3IKVA 1E5TA 3VU1A 3FKSD 1O95A 3WADA 1ZNYA 3EY9A 4CETA 1T0BA 4ITUA 2HHHB 2ONKA 1OYWA 1SA0A 3TLXA 1XTRA 1V8FA 4IBOA 4X94A 1I10A 4XIIA 3QG5A 4NCNA 4TZTA 4G4GA 5DYWA 2PKWA 3FPAA 3P7MA 1N5DA 2XB8A 3L4EA 3K15A 3VHXB 2NT3A 3OE7A 1X0VA 3FYSA 3L05A 3SZRA 4D0RA 4D2IA 3U6BA 3DCYA 9GPBA 3G9QA 4QBKA 4V1CB 1SXQA 1X3LA 3CF4A 5EIFA 5KYVA 1JJAA 1LV8A 2C0QA 4EENA 4US2R 2FW8A 4KR2A 2H51A 1JLMA 1M72A 2B94A 3DTTA 1EAYA 3EHEA 1SRQA 1WMFA 4MW9A 5FR2A 3S28A 3ZGVA 4S35A 3D43A 3DO5A 4IAOA 2BMFA 5D1NA 4BLQA 4BTLA 2DBYA 1JDTA 3U6KA 3DLPX 1FRZA 3VYSB 1DC4A 1B00A 2GK6A 3QPDA 4UEOA 3E84A 2NXNA 1S8FA 2WKQA 3L4SO 3PXUA 3MWLA 4WLUA 3UIEA 4CL3A 1XDBA 4E7PA 5LP6A 1QCDA 2FV8A 3VH2A 3NDBB 3HU5A 1NFFA 3PC2A 2WY2D 2FQYA 1POXA 1TQ8A 2Z2ZA 5I7FA 1MOSA 5CX4A 1IK4A 4CQLA 1RD4A 1PLJA 2OCDA 2JFQA 3E9YA 4MJ7A 4P3OA 2VI5A 3CF0A 4MGHA 2FMTA 4MV7A 2ZTSA 1GEGA 4WN3A 5L6LB 2W2MA 3KOMA 1E2PA 1XPJA 3MF4A 4HZUB 4DTCA 2ODAA 3FYUB 2O1WA 5CIQA 3OLXA 4WZAA 5I5GA 1PJTA 1DQRA 2A67A 4R7GA 4HBGA 3H11B 3K0AB 2ZEJA 5C5IA 1F8XA 3E9CA 4MQ5A 1OZ0A 3ILHA 4E70A 2ZRGA 2AS0A 3FOEC 4JI6B 1K3FA 5FI1B 1ZH2A 4TTQA 3M6IA 2RGAA 2TMYA 1H1LB 3TR0A 4WMLA 4KV7A 4Q18A 5HUHA 3KT0A 4KSYA 1ZCZA 3A3NA 3IT3A 4TZ6A 3LUBA 1E92A 4U0KA 1M6NA 3CZCA 5JPDA 2RGEA 1E0SA 3FLEA 2WKWA 3GVHA 4WRRA 2NVBA 4EA8A 3CLRD 1THTA 4KRGA 3AZPA 3NQ41 1XMOB 4KXLA 4MQLA 1XYYA 3C6YA 3QLEA 4GP7A 3NC4A 2AJ8A 3MS7A 1OFUA 4Z5XA 1PQWA 1QJCA 2XA1A 2V45A 5ITZA 4IEEA 2H92A 1X77A 3NHMA 4NK4A 2G77B 1ZIYA 2WHEA 3JQPA 2W2PA 4Y2VA 1ZI6A 1MH9A 2VNSA 3DL0A 4IHKA 4RADA 3UBMA 2D5BA 4DCJA 3YASA 1ODCA 3N8DA 5LWQA 5B1HA 4LYEA 4Y2UA 3VDNB 1ZD1A 3T3HA 3ESQA 1XT6A 2EGUA 4ZVQA 1E1DA 4MW5A 3TDMA 1IXZA 2JGRA 1O96A