5L7WA

17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
254
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title First Structure-Activity Relationship of 17 beta-Hydroxysteroid Dehydrogenase Type 14 Nonsteroidal Inhibitors and Crystal Structures in Complex with the Enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 254
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l7wA00
5U9CA 3B1FA 2XOXA 4FIZA 3JQGA 1EE9A 3RI3A 1NQ5A 3LT4A 4R54A 2D3TA 2D1YA 4R4JA 1VL8A 2EV9A 2JKVA 4IJUA 1V8BA 1DFIA 3GQVA 4EJMA 5AQ1A 2D59A 3BMQA 3GC6A 2Y1DA 3E6AA 3JQ9C 1B7GO 4QEDA 1N9GB 2Z1MA 4KQWA 4N7RA 5JO0A 1E3LA 3A1NA 1ZKMA 1EVYA 4ZRMA 5BSHA 1H6BA 3NT4A 1GEEA 1U2GA 4L0QA 2OP0A 2Y1CA 5F3RA 5DN9A 2VHYA 3PJFA 2EJWA 4N5MA 1ZK4A 3D3WA 3HJAA 5B4UA 5CDGA 2PD6A 2Q2VA 1W8DA 1V35A 1VJ1A 3DZIA 2QQ5A 5KJCA 3E18A 3PQEA 1GCOA 2AMFA 4CM4B 4TRJA 3RIHA 4C4OA 2O2YA 3IMFA 1T2AA 2P91A 4L4SA 5ITWA 3ZNNA 3RUFA 4OXYA 5IZCC 1T2CA 4TZKA 5T6BA 3IDSA 4BV9A 3C7CB 5G0TA 3WSWA 4ZU3A 1EBUA 4W82A 4ZHSA 3COSA 4YRBA 1GV1A 5U1PA 1DHTA 5L51A 2W2LD 1UDAA 1C0PA 4CQLB 1V0JA 1U3VA 2D2IA 1U3TA 4RDHA 3UICA 3NYWA 1E3EA 2Y93A 2UUOA 4GKBA 4FBGA 2O3RA 4PLWA 5DBIA 2PK3A 3JQ6A 5IDWA 1A72A 1CIVA 3KOUA 1NASA 4NBRA 4LW8A 1GL3A 3WYEA 1T4DA 3V2GA 4ILKA 3DMTC 4BMVA 4WLVA 1DIBA 2O2SA 3EAGA 3ENKA 1AXGA 3DFZA 4DBVO 5JYDA 5TS3A 1Y9AA 4KTTE 1I01A 2PKRA 1U8FO 2ZCVA 3VTFA 2EHDA 4UVDA 1H94A 3GFBA 3H9QA 4IDBA 1XQ6A 3D5QA 1JVSA 4R69A 4U6SA 2NTVA 3QIVA 3K5PA 1DIRA 1HDYA 3H2SA 4RLHA 3UH1A 1HL3A 4FW8A 4WOKA 3OIDA 3DOOA 4B4WA 5I7VA 4JJFA 2EJVA 5KOIA 4IGFA 3UN1A 4GX2A 5KCZA 1VL6A 3H4VA 1E0DA 4KWIA 3TL2A 1OOEA 4ZQEA 4KMSA 3RD5A 1P1FA 3ITDA 3D3EA 4BNZA 1MLDA 2NVBA 2Q1UA 2H1SA 5L53A 3H5AA 2QRLA 4OOFA 3FNFA 5IAAA 2O23A 4HFJA 3I9NA 1YL5A 3KYCB 5A3JA 1DEHA 1XGKA 4I9HA 1LX6A 4RVUA 3WFIA 3UFXA 2OMEA 1HXHA 1V6AA 2Q1TA 3PVZA 2DTDA 4Z6KA 1ZSVA 4Z0HO 1I8TA 3SLKA 4BO0A 4L76A 3HADA 1N1GA 3OETA 1CERA 1B8VA 3RUAA 3RKUA 3VPFA 4RVGA 3HDQA 3HDYA 2PR2A 1CYDA 1WZEA 4FFRA 1PJ3A 3IP1A 4UUPA 4N5NA 1L7DA 2PGJA 3BA1A 1DIGA 2JJYA 3K9QO 3E1KA 3H9UA 2W4QA 3KLMX 2X4GA 1B3RA 3LC1O 3ZNQA 4OXNA 5I7FA 1XHLA 3S2FA 4IJVA 1VJTA 1FF9A 2Y68A 3GT0A 3QW2A 1E7MA 4MIYA 3VVBA 4DMLA 3C1TA 1ZXBA 3V2UA 5H82A 5A04A 3AUUA 3RCBA 4IDFA 1U28A 5DBGA 3NTQA 2FPPA 3B6ZA 3GNTA 4I5EA 5IN5A 2EEZA 3KHUA 3GGPA 4QFCA 3ADPA 1VL0A 1LC0A 1Y8RB 3GZNA 2VNAA 2OUIA 1Y7TA 3CTMA 1A7AA 4FOSA 3MWDB 3AI1A 1BSVA 4NFYA 1BXGA 3BTUA 5HA5A 1KOLA 3E03A 3TJRA 2DT5A 3JCZA 1DBVO 4YWJA 1SZJG 4CV3A 1UDCA 4FFMA 3C85A 1LI4A 4IZHA 1B16A 4QUKA 1L7EA 2C82A 4OXKA 4DVJA 4CQMA 5BQFA 5JC1A 4LVUA 3RU7A 4GAEA 3U9LA 3H6KA 5I8WA 3CKYA 4GMFA 3LT1A 3IJPA 3D7LA 1E7RA 1C0IA 5A03A 4MINA 1TT5B 3LLVA 3SBOA 2HLPA 5EINA 3ZNOA 4AJ1A 1EUDA 3Q2KA 2IZ1A 1ZSYA 2QYSA 1I2BA 3OP4A 4BNUA 4QFDA 5CDYA 4PLPA 2ZKLA 1Y8QB 1P31A 2JHFA 4MDHA 3UUWA 5ICSA 4IMPA 3WLFA 5B4TA 1VM6A 4IXWA 3UAGA 1YDWA 3X2EA 1YXMA 2VRBA 3OMLA 3AM4A 3DB2A 2DQ4A 3O4RA 1PZGA 3B20A 2Y0CA 1Q7GA 2WD7A 1NR7A 4RPHA 1IHYA 1ISJA 4TVBA 3TPCA 1PJTA 3R1IA 4NBUA 1D1TA 3PLNA 4OMUA 4CLDA 1O5IA 4CV1A 3ONDA 4WKGA 3T7CA 3RJ5A 2VWHA 3UKOA 1C1XB 3PQDA 4JX8A 3ICPA 3GEMA 1YOVB 2HMSA 4YXFA 1VKNA 3AUAA 5MGBA 2JHGA 2VHWA 2ZIZA 3IKVA 2R2GA 3MOGA 4IDAA 4D46A 4YAGA 3ASUA 2H5LA 1FDUA 4W7IA 4A03A 1EFKA 2EXXA 5CEJA 4WNCA 1IUKA 1C3VA 1YL7A 4OYRA 2VHZA 4FDAA 2WMDA 1ZVMA 3UCEA 4JCOA 3PJGA 1CQJA 4XDZA 4I8XA 3ZWAA 1R4NA 4CUKA 3HNPA 1NAIA 4CM8A 4DYVA 1ISHA 3DOCA 4IDDA 5TLSA 4OL9A 2BGKA 3WG9A 3WS7A 4J4HA 1T24A 1WMAA 2Y0DA 3QVOA 4MVJG 3KLPX 5KNLA 2Y0EA 4NR0A 3BTVA 3EMKA 4XX0A 4I08A 1N1EA 4M87A 5CDSA 1DB3A 1E1MA 5BR7A 5CDUA 5JMWA 3HN2A 2C5EA 2V6MA 3D0OA 4FGSA 1V3TA 4ROSA 4E5MA 3M2PA 3U09A 3TFQA 3GDOA 5TSDA 3ROPA 4INAA 3UCXA 3QSGA 3K96A 3W4IA 1GPJA 1ZK2A 1OC4A 1HYEA 1R12A 1E1LA 1I24A 1HLDA 4U6QA 3SEFA 4YB8A 4BNXA 1LEHA 4I5FA 1LQUA 4WGGA 4NI5A 4MVJD 4XIJA 2PGLA 3STHA 4XYEA 2VWQA 4CM9A 1DO8A 1JWBB 4FGWA 3SX2A 4TZTA 1X0XA 3GUYA 4D3FA 5A9SA 1H6AA 2I67A 1ZK1A 4J7CA 2HMVA 2C07A 2VHXA 1ZNQO 1LA2A 3FCOA 1I2ZA 1YVEI 2I76A 4DPLA 1PJBA 3JYOA 3OA2A 1EK5A 1YB4A 4F45A 2BRUA 3LDHA 3BAZA 2QZZA 1AUPA 3GNSA 4F3YA 4PG4A 3WGYA 2Q99A 3FWNA 4RPLA 3QVTA 3NX4A 1Q2XA 4PGFA 4O1MA 3ADOA 3X2FA 3DO5A 3W4KA 3KYBA 3ZWYA 3B1JA 3WGTA 3G1TA 4CMBA 1RM5A 2CDAA 3I9MA 1Y5RA 2DBQA 4PIVA 5MDHA 4D7AA 3ZWWA 4BGEA 3TZ6A 1DRUA 1U4OA 3OEYA 1ZMTA 2Y05A 4PVCA 4R41A 1WDLA 4D45A 3OIGA 3I23A 1IYZA 2H6EA 3ZWVA 1P0FA 3DZFA 3HDHA 3MTGA 3DEYX 3HWRA 3NKLA 4L4XA 4CMIB 1VC2A 4BUCA 3C24A 2FR0A 3BZUA 3D4OA 1A4IA 2WTBA 5LCXA 1HDCA 4ALMA 4WECA 4J4TA 4Y6SA 2PZJA 4HADA 3A06A 2RCYA 3QWHA 3JV7A 3OEWA 2VYVA 4GBJA 3ZW9A 3HN7A 4XYGA 2E48A 4YBZA 2RAFA 3KB6A 2CDBA 2GO1A 5TC4A 2NU8A 4XA8A 1OZAA 3F3SA 3INTA 4YAJA 4BNWA 2RBEA 3D4NA 3OA0A 4IQ8A 4JK3A 3A9WA 1XDWA 3R3JA 3WBFA 2YDYA 2D0IA 4ZQFA 3OHSX 1VPDA 5DP2A 5JCXA 4HFNA 5DDIP 1NQAO 2DC1A 4J91A 3ZU3A 1SEPA 2C29D 4ND2A 3AU9A 4B3JA 4EDFA 1IPFA 4NPCA 1PSDA 1LSOA 3PXXA 1N8KA 1B0AA 1EEHA 3KZVA 2WYUA 2R00A 5IDXA 3IQDB 4UUMA 1ZEMA 3BIOA 1ENZA 5CHEA 2C2YA 3WYBA 3TOXA 1U5CA 1Z6ZA 2Q2QA 1NQTA 2Q1WA 2GZ1A 3ZHZA 1LLCA 4LRTB 4MVJP 1U9JA 1KY5A 5L7WA 1JW9B 2GZ2A 1NPYA 2C2XA 4R68A 2PD3A 1R4MA 2NLOA 4Z9FA 4YT8A 4B8ZA 1WVGA 3ZV6A 4AJKA 5L4SA 2ZB4A 1F0YA 1G0OA 3CSDA 1E5QA 3TN7A 4J7UA 1E7YA 4QO8A 1LDYA 3U49A 2O3UA 3JD4A 1KC1A 3ASVA 3JSAA 4BVAA 2BELA 2DBRA 3PLRA 3AUTA 4BGVA 1Q7CA 2B5WA 5JC8A 3DBRA 4Y98A 5TT1A 1IL0A 9LDBA 3OQ6A 1TXGA 3F47A 2VZ0A 3K92A 1KBZA 1B26A 1Q0QA 2X0JA 2PZKA 3QRWA 2J5QA 5BSGA 3I9KA 3G3EA 1B14A 9LDTA 4MPDA 4F46A 5K6AA 5IN4A 2EW2A 1B15A 1DHRA 3RASA 4KWHA 3PIDA 4O0LA 1PQWA 4OAQA 4WEOA 2IRWA 3AK4A 3ZI0A 4KDEA 4XD2A 5JYEA 1I33A 4LISA 2BD0A 4FS3A 1U7TA 2YHUA 1T1SA 1QYDA 2P2SA 1E3WA 3L77A 5EQDA 1JDJA 4AJIA 4UEJA 4LCEA 2C54A 2VHVA 2G0TA 1W0CA 5DOZA 2B37A 1HDXA 3DBHA 4OQZA 1J4AA 5EL0A 3WTBA 4JBIA 2AE1A 2NSDA 3JYNA 3KSDO 4Z9XA 1P1IA 2P68A 3PFFA 4MJLA 3WGQA 2BGMA 4Q3NA 4RCVA 4IZIA 3WXBA 2DM6A 3EW7A 3RFXA 4CM7A 5KJ1A 1VSVA 3ZWMA 1UH5A 4KQXA 4ZRNA 4BB6A 4ZD6A 3CZRA 4ZA2A 4DPKA 2YJZA 4K9DA 3BXXA 5ENDA 4A0SA 2C0CA 2BFAA 2I65A 5FWNA 1IOLA 4AL4A 3F4LA 5JLAA 2J8ZA 2NVWA 1C1DA 2VTDA 4EUFA 1XEAA 2P4HX 4D79A 1NVGA 1J6UA 2BKAA 4K26A 5T64A 3BMNA 1NTOA 1QRRA 4L73A 3K73O 3D64A 1M76A 4IDCA 2GCGA 1ML3A 1D1SA 2IDZA 1U8XX 1NYTA 2HRZA 3RJ9A 4RPJA 4CMHA 4EZBA 4A5OA 2PLAA 1U5AA 1S6YA 4XWYA 1ISIA 4FC6A 4JGBA 1WW8A 1I3MA 1X7HA 5ES3A 4AJ4A 3F1KA 1R0KA 5JSFA 4R1SA 1UP7A 4GWGA 2ET6A 3LVFO 3DZJA 1YBMA 1A5ZA 3LK7A 4YJGB 3U62A 2Q2WA 3U3XA 3DFUA 2O7SA 2X0RA 1UZMA 3GH3A 3D4PA 2BH9A 3QVSA 3H8VA 4CM1A 2I99A 2ZQYA 2RH4A 1KVSA 3GR6A 1ZH8A 4W7HA 1PR3A 1X13A 2HK7A 3L4SO 4WCDA 1DJQA 1T2FA 3PP8A 4XJTA 2CVOA 4YA6A 1S7CA 4YT4A 4BS9A 4E5PA 1ZBQA 2YYYA 4CMGA 3EUWA 4A27A 5G4KA 1QORA 1G0NA 5FI3A 3DBLA 1YONA 3JQBC 2W2KA 1LSUA 3PWKA 4O5OA 1EZ4A 1G1AA 2GASA 3DONA 4BIIA 3QV1A 4WCFB 1B8UA 3PYLA 5JMPA 1NHWA 1Z45A 4IY1A 3VVCA 3V1YA 4GPD1 3ICCA 3OQBA 5ILOA 4AJHA 4B7XA 3H3JA 1UZLA 2QW8A 3L6DA 3PFWO 3LLSA 2HRBA 4U5QA 2FP4A 4UUOA 5COQA 4B4OA 1E5LA 2DAPA 3WMWA 4RORA 2YDXA 5DT9A 2AQHA 1PGQA 1F8GA 1HYHA 1MFPA 3BMOA 4MP6A 3ZZNA 3GRKA 3PQFA 4UVGA 3WQQA 4EBFA 1M6HA 3H5NA 3PJDA 1NR1A 4PLTA 4URFA 2HMUA 5IDYA 2ILTA 3MTJA 3RSHA 3DHYA 4HFRA 1EVIA 1AHHA 2C7GA 4PLYA 3BMCA 4RV9A 3TZCA 3ZWCA 5JW6A 2X6TA 1XR3A 1Z7EA 5B1YA 1H93A 3UW3A 5JS6A 4CM6A 4CV2A 1WZIA 2B83A 3EY4A 2UUPA 4OHUA 1BXKA 4CM5A 1FDVA 4R9SA 4S1VA 2NADA 3VPSA 5C7IO 3WFJA 5CPBA 1FDTA 3D5TA 5JDIA 3FNHA 3PYXA 3I9LA 2PGDA 2HKIA 2B36A 3F46A 1SNYA 1E92A 3JQGB 2QX7A 4ALKA 3PZRA 5HTOA 4FFNA 4GVLA 3EHEA 1GQYA 4D0RA 1VKOA 2WYWA 1VRWA 1N7GA 5IF3A 1PTJA 4GVXA 2NNLD 1P44A 5BSFA 1PGJA 4BO1A 3KRTA 2C7VA 3BMQB 3EZYA 5KVVA 3SC6A 2UAGA 4DLAA 1ZZEA 1JKIA 1O9BA 1I10A 1Z7BA 4RF5A 3OH8A 4CLRB 2PY6A 2I6TA 4J4BA 1I36A 1TB4A 1C14A 2IXBA 3HB5X 3LF2A 5CEFA 3OSUA 4MVJE 1XQ1A 3BTSA 5L3ZA 5IZ4A 4WJZA 2PD4A 2G76A 3JYLA 1T25A 3JQ8A 3CINA 4U8GA 1LBEA 3L6EA 1IHXA 4E5NA 1GR0A 5KVSA 3D3WB 1GYPA 4NZ9A 1LDEA 3FNGA 4WLUA 1PQUA 3LF1A 4RLSA 4NU5A 4EUEA 1KC3A 2ZTVA 2O50A 2Q4EA 2VYNA 4CPDA 2ZCUA 2HO5A 2OO5A 3A4VA 1K6XA 1O94A 4Y9DA 3GG9A 3P5SA 3LT2A 2FY8A 5I9NA 3FHLA 5JFOA 4IS3A 4BKRA 4IDGA 1O6ZA 3TRIA 1BDMA 5KKAA 3KM0A 2DUUA 2Z5LA 3MWEB 2X7HA 1K6JA 5T67A 3SC4A 4CMEC 1ISMA 4NIMA 4RZHA 4NBWA 2X22A 3DQPA 4H3VA 1LDGA 3RC2A 3TZHA 4PFJA 1E6WA 2W2LA 1JVBA 3OFSA 3QQPA 4J1TA 1O95A 1GEGA 3DAPA 4PLZA 3N58A 1UP6A 4DMMA 4TSKA 3VKVA 6LDHA 3UCFA 3MZ0A 4NK4A 1A27A 3RAJA 5DCUA 3T4EA 3ZV5A 4BKUA 3AFMA 1JA9A 3NJ8A 1QLJA 4E21A 3NEPX 4W9NA 4Q3AA 1YJQA 5JO9A 2IEBA 1U1IA 4YACA 5L7TA 1JQBA 2FPGA 5TQVA 5FEUA 3WGZA 5JNLA 3CMCO 1X1EA 3F5SA 2NTNA 4HP8A 2WJPA 4YQZA 4HBGA 2JD2A 3S55A 1EQUA 2DKNA 2YV2A 3I52A 2F1KA 4XYLA 1DOHA 3QJ5A 4NBVA 4YJFA 4BNYA 5COBA 3SVTA 5G0WA 1EUCA 5L40A 3O8QA 5TNXA 5ITVA 4TKLA 3S1LA 1FMCA 1R0LA 4R1NA 1KVQA 4WCFC 4AVYA 4BO4A 3GVXA 1ARZA 1E1KA 4BV8A 1FXSA 2B4TO 1T2DA 4ND3A 2JL1A 1EVJA 3GGOA 1JTVA 4K6FA 2PZLA 5JDCA 1AN9A 4RF2A 3ZHXA 2D8AA 2W8ZA 2X58A 4YT5A 1KERA 2UDPA 1E7SA 4B3IA 3WIDA 3MJVA 3ZU2A 5BNTA 4WUVA 1MG0A 3CXRA 2NTJA 1RPNA 1F06A 2DTXA 3DAFA 4L4RA 5THKA 4DQUA 1SC6A 1QG6A 2YFHA 1K5HA 5ER6A 1BDBA 1DSSG 3GGGA 4MP8A 3FR8A 2GN6A 2JCXA 1ENYA 2IE0A 4R9RA 4JROA 3ZWBA 2V6GA 1DFGA 4BO8A 1GQ2A 4CQMD 4ZVVA 2HQ1A 1W4ZA 4CMJA 3K6JA 5DULA 3JD2A 3DHNA 1NP3A 1QYVA 1JWAB 4BGIA 3PHLA 3P2YA 1DFHA 4E2YA 1V9LA 2QHXA 3A14A 1QSGA 3V8BA 2DU8A 2O7QA 1IE3A 2VZ8A 4BNGA 3S2IA 4YTEA 2DVMA 7ADHA 3TQHA 4KZPA 4PLFA 1GD1O 3Q9UA 2J5RA 3I3OA 1HE5A 5G0VA 3TZQA 4BL5A 2ZB7A 3PGXA 1BHSA 4FD3A 3GZNB 3W1VA 3NUGA 3I4FA 2X5OA 4UVHA 1G6KA 4DRYA 2CVZA 4GKVA 4IM7A 1BXGB 1LSJA 1OFGA 4J2HA 2DFVA 1X14A 3VTZA 2J3KA 1TA4A 2AEFA 5JAQA 4FR5A 4R1UA 1H5QA 3AOEA 4MO2A 5U4QA 5C5IA 3QVXA 1R37A 3UF0A 5TRTA 1NVMB 1ZK3A 4LGVA 4CQMB 4NMHA 3L9XA 4DBZA 1DAOA 3ENNA 3GMSA 3OQ1A 4FSHA 4J16A 2AEJA 2HJSA 4E31A 3E5MA 1RKXA 4J43A 1GDHA 1Q0HA 3TNLA 4ZN6A 2ZB3A 5G4LA 3TDKA 1FJHA 4J49A 4A26A 4BNIA 4NU6A 4RJTA 2VTEA 3KSZO 5BNIA 3G0OA 4NJMA 3GEGA 1LJ8A 1NHGA 1PIWA 1PR9A 1SOWA 2B4QA 3GDGA 3H65A 4JXKA 5EERA 3WDSA 1YB1A 5CP8A 2OBNA 4Q3BA 1XYGA 2IODA 3JYPA 3V1UA 1D7OA 1P1RA 2V65A 2J3HA 3O03A 4C7JA 1HF3A 1ZJZA 3NGXA 4MIOA 4OQYA 1B8PA 4XRRA 4G81A 4FOOA 5A9TA 3RROA 2Z1NA 4K1LA 4EGFA 3E5RA 1P9LA 1XU9A 4J2OA 4BKQA 3VKUA 4BNMA 4CLOA 1LLQA 3FTPA 1FDSA 1A7KA 4DGSA 3KYDA 1ENOA 3WWZA 4JIGA 4J1SA 4ND5A 5H81A 3R6DA 1NWHA 2WD7B 4FFLA 3GEDA 3VH3A 1E6UA 4JJGA 4E5KA 4II3A 3GF4A 1XELA 2X5KO 5JAMA 4J0FA 4BMNA 4ALIA 3GPIA 4W4TA 5AXCA 3PHHA 2P9CA 2QRKA 3G1UA 3GVPA 3PDJA 2FN7A 4BKPA 1EMDA 4BO3A 3UXYA 3R0IA 4HY3A 1LRLA 4YJHA 1HRDA 1MFZA 1UUFA 4QXMA 2YQ5A 4RO0A 3HQ4O 4M8SA 4E0BA 3NRCA 3AY3A 1CWUA 4Q3EA 4Q3DA 3GDFA 1EQ2A 3BHIA 1N7HA 4UVEA 2ZTLA 1QLHA 1KEPA 2CMDA 2WM3A 4EI2A 1WAMA 4DA9A 3MJCA 2OGUA 4OKNA 2G82A 3K30A 1PS0A 4CM9D 4LN1A 2AQ8A 5FI5A 1ID1A 4ITUA 4ZQGA 4XEHA 4II2A 2WD8A 1ULUA 2GD1O 3ETGA 1QV7A 1P1JA 4N18A 4NDNE 4O6VA 4UREA 5T8KA 4BHTA 3HZZA 4CM8B 4EEXA 4L74A 1HSZA 2J6IA 4BMSA 1MP0A 2NU7A 2CVQA 1MA0A 4XZ3A 1SMKA 2YW9A 4GQAA 1T26A 1XKQA 2O48X 1PS8A 1PJSA 3ANNA 4IIVA 4JNKA 4ALLA 4XCVA 3VC7A 3JQFA 4J6FA 4RVSA 3L4BA 4AJEA 4IDEA 3L9WA 3G17A 1AXEA 5F1OA 3IP3A 4IMRA 4Q9NA 4J1QA 4YYZA 4J0EA 2J3JA 1LDMA 4CR7A 1ZW1A 1PL7A 1YGYA 4W6ZA 5A02A 5L45A 3ZN2A 1EFLA 2E6UX 3NT2A 4E2WA 3FN4A 4J90A 2VN8A 4B3HA 4QECA 3Q9NA 4B4UA 3FR7A 3CIFA 4ID9A 5DNAA 2J3IA 1UXGA 3AJRA 5JCJA 4GWKA 1GADO 2VCYA 2O3QA 4MVJI 1R0SA 1QR6A 1UR5A 3SJ7A 5A3VA 2IEDA 3DAGA 4EW6A 2A9FA 2OORA 3PWZA 3R3SA 2VYVD 2B0JA 1KYQA 2JD0A 1E3JA 2PH5A 3OJ0A 4MVJA 1P3DA 3FWZA 4S3MA 5HS6A 4DIFA 4E6PA 2I9PA 1GZ4A 3NT5A 5K0ZA 3HDJA 3NDIA 1O0SA 3LC7O 4FQ8A 4HNHA 4JLWA 1XA0A 4Y6RA 1Z82A 5CDTA 3KEQA 1HDGO 4BO9A 4C7KA 4DREA 3I6QA 4BNTA 1KIFA 1PGOA 3AY7A 2AEMA 4FFOA 3K8ZA 3GN1A 5ENVA 1UJMA 1TVEA 4CUZA 5CG1A 2BLLA 3RU9A 4MVJH 2PTGA 3JYQA 3P7MA 1TI7A 3KTDA 4WASA 5JY6A 4YR9A 1Z74A 2NQTA 1PU2A 4J7XA 1BW9A 2BGLA 1C0KA 2X86A 4E4YA 4P4NA 3F4BA 2VRCA 1DC4A 2BFMA 3M1LA 3FNEA 3HB4X 1LXCA 2ZQZA 3RBZA 2LDXA 4Q39A 4EUHA 1QYCA 3QWFA 4WPGA 1GFSA 3KSUA 5G2OA 1XCBA 1GZ3A 5F1KA 4R16A 2VUUA 1I2CA 1HEUA 4DQVA 1PZHA 1V3VA 5GZ1A 4Y67A 1T2EA 5ICMA 5L7YA 4PN3A 2FZEA 3GNQA 3HG7A 4FJ1A 4M55A 3WB9A 1ZCJA 1RWBA 3KXDA 2DFDA 3I1JA 4K6CA 3AI3A 1UZNA 1ZIDA 1I32A 2YY7A 3AY6A 4LK3A 4TROA 4D3SA 1WXDA 3UGKA 4EJ6A 2FZWA 2NVUA 3HSKA 4RGBA 5TJHA 1H9AA 1H2HA 3CZMA 3ZW8A 4OH1A 5HS4A 1WLYA 2AG8A 3M2TA 1D8AA 5JAIA 1H0KA 1YRLA 2GR9A 1KVTA 1NWCA 1YQDA 1ZK0A 3PGJA 1A4UA 1UDBA 3DBVO 3JQ9A 4YCAA 4BKOA 1LDBA 4ESOA 3GVHA 5G0SA 4FN4A 5ADHA 2OP1A 1U2DA 2DBVO 3GLQA 1KVRA 3PRJA 5ER9A 3I83A 4YAIA 1GTMA 2FOIA 3VH1A 2Q50A 3JQAA 1ZJYA 1Z75A 1DRVA 2GDZA 4UEKA 4H15A 4NBTA 2XF8A 4HV4A 4OOEA 5I9MA 3BHMA 2VUTA 1R4MB 3A28A 3LC2O 4GX0A 3P19A 3CMMA 5L4NA 1F12A 4EITA 1BGVA 3RUCA 4E5YA 3L0DA 4OKIA 4ND4A 1CQIA 1GUYA 4BO6A 3I4CA 1E1NA 2R6JA 4GGOA 3H9GA 3U4CA 1PX0A 3ZWNA 3WTCA 3BHJA 3NV9A 5F5NA 4GSLA 5CAEA 2V6FA 1YJ8A 4GX1A 3DBRB 2JFHA 4HX5A 1M6WA 3AFNA 4DLBA 3CH6A 4DC1A 5AVOA 1VJ0A 2TMGA 5HM8A 2VQ3A 2H9IA 2P4QA 4OSOA 3SJUA 4E2XA 4MIEA 3NJ4A 2XXBA 2JD1A 1JN0A 2FHSA 5BT9A 4YVFA 5BNFA 1U3UA 3NDRA 2CFCA 5TX7A 2GUGA 1YQGA 1O8CA 1P77A 2YHIA 3JQ7A 1V3UA 3DMTA 1ZUD1 2PKQP 1E3WB 3DMYA 4FC7A 4IJKA 5C7OO 4ZQBA 2A92A 4QSMA 1U3WA 4EJ0A 4CL8A 3GMDA 4UULA 3C7AA 2VUSA 2O4UX 3ZHBA 1P1HA 1R66A 1ORRA 1UXIA 3DBHB 2OL4A 2C20A 1ADGA 1LSSA 2WE8A 2IYOA 3PHJA 1HE2A 1ONOA 4CR6A 2TMDA 4KUHA 2EERA 4WLEA 2CDCA 4P4LA 1PEDA 1L1FA 3JTMA 1KETA 2ZK7A 1BRMA 4D3DA 4YRDA 1HDZA 1YS4A 3ONFA 2JFFA 4YJDA 4IINA 1B3BA 3VZRA 2NQ8A 2DTEA 2YZ7A 3QE3A 3B1KA 2RIRA 1E3SA 4GX5A 1EUZA 1C1DB 3ONEA 1BG6A 4XYMA 2AE2A 3OECA 4FJ0A 1JAYA 3BMNB 1K2WA 4WLOA 3ZCXA 1SB8A 4KUGA 1T1RA 4MOWA 4B79A 1VI2A 2FRDA 1DC5A 4RQUA 1P74A 2RHRA 2D4AA 3OIFA 2XAAA 3GG2A 4PLGA 4WK6A 1Q1NA 4EEZA 4BNHA 1PJ4A 3MEQA 2CF5A 4FPXA 3Q6IA 2YQ4A 2CY0A 1EBFA 3ULKA 1E7WA 3UOGA 5A9RA 4RPKA 1HETA 1DPGA 5EN4A 3RFTA 1LNQA 1QYXA 3GPDG 1HZJA 4MKXA 5T57A 3JD3A 3PPIA 3WQSB 1N5DA 1KVUA 1MG5A 1LLUA 1X1TA 1EVZA 6ADHA 4CL3A 5EQFA 3WJAA 3VHRA 5G4KB 5IDQA 1UXKA 4RF4A 3DBLB 1HLPA 4MVJF 1UAYA 2BHLA 3I9OA 1YQXA 4WNIA 2W2KB 1Y9EA 2GGSA 5COAA 1UXHA 4LRSB 1DC6A 4GL4A 4QT0A 4CODB 2HCTA 4JQCA 2FPIA 2D5CA 8ADHA 3NDJA 3W4JA 4P22A 1PZEA 4TRNA 1NFQA 3VDRA 2BF7A 1P45A 1SO8A 3ZV3A 1N9GA 4FB5A 2GNAA 4QTZA 4LMPA 1DRWA 2X9VA 2R00C 4R01A 2BI7A 5AOVA 5I8ZA 3AM3A 2AHRA 4HXYA 3CEAA 1PL8A 1PWZA 2PNFA 4BGUA 5HBRA 1O89A 2EF1A 3O26A 4LMRA 1PZFA 4BO7A 1QMGA 3HHPA 1MV8A 3PI7A 5HRUA 3BMOB 4TQGA 4CLXA 1WDKA 4LSWA 3UHAA 3K2EA 1A9YA 1WNTA 2A94A 4NFHA 3W6UA 1QKIA 2F00A 4E2ZA 3CUKA 1HWYA 3DWFA 2E4AA 4TKMA 5B12A 2OZPA 2ZJ1A 4CM4A 3BMCB 2I3AA 1I5RA 1JKJA 4XB2A 1DXYA 3DDNA 4CLRA 5A05A 3AW9A 4DWVA 5JPIA 1CF2O 4I1IA 1Y1PA 4XIYA 1GZ6A 3ETEA 2JCYA 4IBOA 2VYND 1DIAA 2J5KA 1GQQA 1BXZA 4CQLA 5I7EA 1PQPA 5CEEA 3AUSA 2W98A 4AJOA 1YE3A 3ROMA 1ADFA 4AJJA 4RQTA 3S2GA 5K6AC 2GPTA 1B2LA 2C5AA 2BI8A 2QZ9A 3FTNA 1YDEA 1ADBA 4UEOA 3H2ZA 4P38A 5TF4A 1HSOA 3RC9A 3QA9A 1T4BA 3OJFA 4L75A 1HE4A 5EPOA 3WLEA 4D44A 1WP4A 3ITKA 3OM9A 4RVHA 5EJ2A 3WNQA 4HNGA 3RC7A 3VPGA 2WSBA 5THQA 5EIOA 1F14A 1XLTA 2P5UA 3JQ8B 3NTOA 1GYQA 5B37A 5GY7A 1MC4A 3C3XA 3IAHA 4O63O 5T5QA 4IS2A 2X9NA 4DC0A 4WEQA 4E30A 1LC3A 4NHEA 1YO6A 3JD0A 2A35A 2YV3A 4B4VA 5KJFA 1NAHA 2Q45A 3E9NA 5JXWA 2IZ0A 3IUPA 3S2EA 1ONPA 2PH3A 2NV6A 1RM3A 1OAAA 2ZATA 4GLOA 3W8EA 3NGLA 4E32A 5KVCA 1ZO8A 3Q0EA 2GF2A 2IYPA 3I6IA 4NNJA 4A2CA 3GVIA 1VE9A 4ALNA 1PWXA 4BOYA 2D5AA 1QV6A 3MJ4A 3GY0A 4GLLA 5AXAA 2C59A 4NG5A 4XR9A 1ENPA 4J3FA 3KYCA 5A1TA 1F17A 1CJCA 4GSKA 2GZ3A 2X23A 4OGWA 1P0CA 2UVDA 2CZCA 2E37A 2P9GA 1N2SA 2VOEA 5IJZA 4R3NA 2GYYA 1WMBA 2DLDA 3FBTA 3DZGA 1JKFA 3VOSA 3M1AA 4Z3DA 3IS3A 3ZDFA 4DQXA 3IL2A 4XQGA 4BNKA 2OBYA 4P4GA 4KTVE 3WMXA 3GAFA 4CUJA 2Z95A 2DBZA 3WGHA 3HFSA 2EWMA 3WR5A 2POQX 1KEWA 3MJTA 5TGDA 3GOHA 4N5LA 1OI7A 1IB6A 3DHEA 3DZHA 3AWDA 3GA0A 3JQDA 3ZH2A 3VZQA 1NXQA 1TT7A 5A06A 1BMDA 1EE2A 3PEFA 3VZPA 5A4DA 3VZSA 2P5YA 3RC1A 1DIHA 1H6DA 1KEVA 2HSDA 2PWZA 4WLNA 3INGA 1F8FA 3MJEA 2GN8A 2HAEA 3PIIA 1H9BA 4AJNA 1HT0A 1ONNA 3K31A 3C7DB 2VZ9A 1AE1A 4YJFB 3RUEA 1D3AA 3O8QB 5LDHA 2AG5A 2I5PO 3GFGA 2JFGA 2NACA 2GRAA 1Y8RA 1ZEJA 2FSVA 2FSSA 4IQ0A 4PG7A 4BQPA 4DIOA 3RBVA 3E9MA 3NTRA 3G79A 1K89A 3AU8A 4MP3A 4MKRA 5F1PA 3ANMA 1PGNA 3BTOA 1ZMOA 2PV7A 4UAGA 2HU2A 4HWKA 2E49A 4MVJM 3KBOA 1E3IA 3G49A 1SB9A 4ZQHA 4JJIA 1Y5MA 4XGKA 4DIBA 1GAEO 4CMCA 3OF2A 5EESA 4GGPA 2W90A 4AJPA 3FRJA 2B5VA 3KETA 5CPFA 3LU1A 4PCVA 5F5LA 2SCUA 3WQRA 5B4VA 4U0JA 4KP7A 2FR1A 3WIEA 3DXFA 4FJ2A 4ALJA 1TT5A 1PJCA 4TWRA 1E6EA 2ZYGA 1U7HA 3DL2A 3DTYA 5IXYA 5L9AA 1Y8QA 4UUNA 3LT0A 1ZFNA 1UAGA 4X54A 5JDIC 3RQSA 4Q3CA 1JAXA 4BO2A 4MKZA 2WWRA 2NU6A 1QP8A 2HUNA 2X0IA 4R5HA 4D42A 3U4HA 3RFVA 4IJWA 1LRJA 3E8XA 4HFMA 4ND1A 2EW8A 5DBFA 8LDHA 3ZNPA 4PG6A 2Y1GA 4PVDA 1PGPA 4R3WA 4NFSA 4E12A 1KEUA 1GCUA 1SEVA 2AA3A 2XXJA 2O4CA 4PLHA 3P2OA 1WPQA 2FWMX 2WYVA 4ZICA 1AHIA 3GVCA 3ANLA 4CMAA 1KY4A 5L4LA 1C1XA 1YWGO 2Q4BA 2X0NA 4Z9YA 4YQYA 3S8MA 1ISGA 3VH4A 4BNLA 1YOVA 3F9IA 1UP4A 4YAKA 1M66A 4BNVA 4H16A 3U5TA 1R6DA 2V7PA 7MDHA 3OJLA 4GH5A 4EYEA 1JU9A 2PFGA 2HDHA 1I3LA 2G1UA 4Y8VA 5DCWA 3RUHA 1GY8A 2UV8A 3VDQA 4D41A 4XQCA 3TFOA 2JAHA 2G5CA 3DOJA 1XSEA 4HUJA 1W73A 2VWGA 3GZ4A 2ZTMA 3OBBA 3V2HA 1BVRA 3O38A 4PLVA 1HZZA 1OC2A 3N7UA 4A7PA 4LSMA 3OICA 2O3JA 3KVOA 4G2NA 2I3GA 3GK3A 3HFGA 3E48A 4NJMB 2X8LA 2H63A 1R16A 3O9ZA 1J49A 4N54A 2Q3EA 1PJ2A 3SXPA 4AJ2A 1J0XO 1FDWA 3EYWA 4OM8A 4BB5A 4YAEA 3INRA 1MXHA 1AGNA 1GUZA 4DL9A 3KUXA 3OJOA 4CLOB 2Q1SA 3ST7A 4UVIA 2HK9A 1M2WA 5H83A 4IXTA 3KYDB 3V1TC 2IXAA 5KWEA 4RF3A 1LQTA 5KVQA 4J9VA 1MXFA 4XYBA 1DAPA 3DZBA 2CD9A 2NM0A 1Y6JA 2EKLA 3IJRA 1EDZA 4L9RA 4CR8A 2HMWA 1SCUA 5C37A 2AXQA 1VLLA 1C0LA 1R4NB 2NUAA 1PS9A 5CG2A 5KTKA 1NPDA 5ILGA 4I5GA 4TRMA 4YJHB 3GAZA 3AI2A 3C1AA 3BYZA 4W9NC 4Z0PA 3MOIA 3EK2A 3AOGA 5CFZA 3W8FA 5GZ6A 4OIMA 3U0BA 3FBGA 1CETA 4AFNA 2PA3A 4DXHA 4DUPA 5HWSA 4OO3A 3EC7A 1Y81A 4F6LA 2ZTUA 3QWBA 1ZSNA 3QVWA 5I9LA 5JCJD 3VH2A 1BWSA 2BMAA 1A71A 5LC1A 4DLLA 5KJ6A 4XRGA 2EIHA 2OHXA 2B69A 1OBFO 5IXSA 3W8DA 4W99A 1X7DA 2OFPA 4JBHA 4U0KA 3WSVA 4PZCA 3QWAA 1LTHR 4BNJA 1X7GA 4FCCA 3SLGA 2CNBA 4YT2A 3WNVA 5TT0A 1LU9A 5JDCC 5A9SB 4D43A 2UYYA 4M54A 3VPXA 2Q49A 2QG4A 1I0ZA 3WYCA 2QIOA 4QQRA 4AG3A 4AJLA 2Y67A 1GUFA 2ZYDA 3HE3A 3DZKA 3UVEA 3ROKA 3F6YA 4CMIA 4D0SA 1LRKA 4NJOA 1I3KA 1CEQA 4KDFA 3RKRA 2EKQA 3WX0A 4PG8A 3HUDA 3H9JA 4ZGWA 4M86A 1BTOA 1X0VA 2VRCD 1IZ0A 3E9QA 3H9EO 3Q3CA 3Q1LA 1I30A 1ADCA 2FMUA 3KEOA 4H7PA 4R5MA 1LUAA 1XU7A 3W6ZA 2CSUA 4ONEA 2QRJA 3IOYA 2GN9A 2X1HA 3ON5A 1NNUA 3TF5A 4LCJA 1NFRA 5A5FA 3JQBA 1SPXA 4XDYA 4G65A 4CJXA 4RL6A 4WLFA 4PG5A 4RVDA 3TZKA 3T7EA 2VT3A 2O3SA 5C7LO 4IQGA 1CDOA 4K28A 3FI9A 1A9ZA 2GN4A 2ZJ0A 1HYGA 3VAZA 5AYVA 3GRPA 3C8MA 3QLJA 2Y1OA 4PRLA 5EMHA 1WWKA 1P1KA 1MX3A 4HKTA 4PRKA 1QXSA 1PJLA 1I3NA 3H5RA 3I9JA 2LDBA 1NPTO 3PK0A 4BQRA 4I5DA 3AOEC 5DP1A 1GPDG 2V6BA 5DZSA 3L07A 4CLEA 1BW9B 1NVTA 2WEKA 5BSEA 1GV0A 2NU9A 2AW5A 1XIVA 4TVOA 2DPHA 4Y6PA 1RM0A 2Y66A 2OOSA 5G0UA 3JQAD 4F6CA 3WGOA 3DC2A 2BFPA 4RPGA 1PL6A 3AM5A 4JP2A 3TOZA 1CRWG 1P33A 1TLTA 2DPGA 4FFPA 4PLCA 4KOAA 1R15A 4XGNA 4QO7A 4TMFA 2JAPA 4CM3A 2G17A 1YL6A 4NH4A 4IPTA 4XQ9A 3ZGYA 1GU7A 1NM5A 4L8VA 1MUUA 1H2BA 4OSPA 3Q11A 5JY1A 2GSDA 2JCVA 1SAYA 1XWFA 4E13A 2NVUB 3QWIA 1PJQA 4M89A 3PWSA 4NQZA 4I9UA 3FD8A 3GHHA 4U7WA 4KUEA 1MGOA 4E3ZA 3WOHA 3ZWPA 3OJEA 1IULA 1KS9A 3V5NA 1JLLA 4JN6B 4OJNA 1ISFA 1FK8A 1QYWA 4XGIA 5LDGA 4A73A 4M1QA 3LQFA 3PTZA 3PZBA 5IFLA 1HKUA 4I9NA 1SBYA 1LLDA 5L95A 5K9ZA 2GERA 3H3FA 4DTIA 1NFFA 1NX6A 3IKTA 5IZCA 3WWYA 5C3MA 4YEDA 1HDOA 3VPHA 2YV1A 5DCYA 3T4XA 1TEHA 5FF9A 2VT2A 1YKFA 1RM4A 3JQAB 4XR4A 2WDZA 3C1OA 2CUKA 2AQIA 2X5JO 1J5PA 5A5EA 1DJNA 2ZB8A 3F1LA 3JD1A 1W6UA 2HJRA 3MCVA 1D4FA 3F5QA 3E82A 3QHAA 3ZU5A 1RJWA 1XG5A 3CE6A 3ROQA 5TJ9A 3RVDA 5GZ3A 3EVNA 2B4RO 2Q46A 4YPOA 5AXDA 4B7UA 4O59O 3NAQA 4GMGA 5FFFA 3WGGA 4Z3KA 4DYDA 1WDMA 2PKQO 3QP9A 1DC3A 1MC5A 2EKPA 5T8KC 1K3TA 5I7SA 5IG2A 1Q7BA 5JE8A 3H7AA 1IY8A 2I66A 4CV0A 3PDUA 1K6IA 4TRRA 1GYRA 2FR8A 1YH3A 2AQKA 3QY9A 1Q0LA 2P9EA 4XB1A 1LDNA 4J9UE 4CMEA 3ABIA 3JQFC 4IIUA 4WOJA 1DLIA 3TSCA 1DDOA 2EP5A 4CMKA 1RYDA 2XPCA 3L4BC 3PHGA 4JP3A 3L6OO 3N74A 4P8RA 4Z0TA 3WJ7A 2WE7A 4WE3A 5KJEA 3DR3A 3ETDA 1Z73A 3IC5A 3RWBA 2NWQA 2OXIA 3WBBA 4E33A 4IUYA 1U4SA 2RHCA 4PZDA 4RDIA 4A10A 2YHIB 3JQ7B 5F21A 4GI2A 4RVFA 2HK8A 2CF6A 1MB4A 4BNFA 2YFQA 3K2BA 3U4IA 5DOVA 3TWOA 4CLHA 4YJGA 1EDOA 2BFOA 3WGIA 3WICA 3ORFA 1IPEA 1X15A 1K0UA 3FSRA 3RUIA 4B7CA 2EGGA 1VSUA 5JAZA 3LYLA 1M75A 3I5MA 3FPLA 4YRAA 5KKCA 4ZJUA 3KV3O 3MJSA 3GHYA 3M6IA 3Q2IA 3FF4A 3EDMA 2Y1EA 4R51A 5JBIA 1NBOA 2E82A 3EGOA 5GMOA 1HE3A 4J1NA 1ULSA 3JQEA 3ZU4A 3CPSA 4PZEA 2PZMA 3DTTA 3ZWXA 4M49A 2EP7A 1H6CA 5DF1A 2VOJA 4WCFA 1OMOA 2QYTA 4LVCA 1E77A 4B8WA 2B35A 3GN2A 3RBXA 2HMTA 1NQOA 4BNNA 2EG9A 1YB5A 2RH8A 4AICA 2A4KA 4XJSA 2YUTA 2Y99A 1E7QA 3PHIA 4YDRA 2O3TA 4XKJA 5J23A 1N92A 3FPCA 1RYEA 2X9GA 3ZV4A 3GUCA 4NK5A 1EK6A 2DUWA 2GLXA 3RUDA 4DPMA 3B70A 4R1TA 4JBGA 3JQCA 1YBAA 3IUSA 4G5HA 2EGHA 2ZYAA 4RZIA 1HDRA 1BVUA 3LZ6A 2VNSA 3U4DA 1DLJA 4BO5A 5KIAA 3IIEA 5FYDA 3TL3A 3PJEA 1IZ9A 1M67A 3ZWOA 2IZZA 1YBVA 2VWPA 5AXBA 4QX6A 3ZHYA 3KO8A 5TIIA 3D1LA 1HTBA 4IGEA 4XQEA 3EVTA 2Y1FA 3LSYA 1UXJA 3EZLA 1SOVA 1ZXLA 3PYMA
chains in the Genus database with same CATH superfamily
1WOMA 1ZA1A 4YAWA 4I46A 1MDFA 2CK3D 1VJRA 4A8HA 2XCTB 3K70C 2PCJA 3BE5A 3KUKA 3NIFB 1BXRB 4FILA 5JEDA 1I4TD 3RI3A 2XMZA 1NQ5A 4V03A 3N53A 1UKYA 4KL8S 4U1RA 5EZ6B 4MRMB 3Q0TA 2EGUA 5HFAA 1C5KA 3OX1A 2AOUB 2BHRA 5DLEA 3KPJA 2IBSA 1SUIA 4HZUA 2AI1A 3RRZA 2CLMB 1B8NA 2Y1DA 2CZQA 1BQ3A 2YHBA 3E6AA 2PL9A 3LLUA 3SCZA 1RCFA 2O2HA 4QEDA 2Z1MA 5EFZA 4RIIA 3UXMA 4KQWA 4N7RA 1VSBA 1E3LA 2R96A 4TVSA 1ZKMA 2WAOA 5JO0A 2O19A 4I2NA 2WJVA 1EVYA 4F9EA 1A2QA 1Z5WA 1RPZA 1GEEA 1U2GA 4LXXA 5JD3A 2O8CA 1G6Q1 1ZN7A 3AZOA 4IF6A 1ZDMA 4XUEA 3FNIA 3V3KA 4B75A 1POWA 3VR3D 4UE6A 3PJFA 1OIXA 1RI2A 4PV7A 3ZGZA 2G5GX 3D3WA 1EYZA 3LCVB 3HVIA 4WFQA 1RE0A 4I6EA 2QUZA 2G9RA 5FULA 2J3EA 3DZIA 5SY9A 2AFRA 3E18A 3TS1A 5KJCA 1IRIA 4CM4B 3RIHA 2XHEA 1JT2A 1QONA 5E4YA 3T5TA 2B9EA 4WGFA 4EX7A 4RESA 2YYZA 2CL5A 5M34A 2OHOA 2P91A 1HKHA 3BSSA 2EJTA 4BX3A 5IZCC 1U8ZA 5DBHX 5FTMA 4YV0A 1SVNA 1TYEB 4IJQA 2VF7A 3EZ9A 3IESA 4ZU3A 3WSWA 4YUZA 4ZHSA 4QU9A 1XZFA 5HSGA 2CNWA 1G8FA 2QX6A 2XTJA 3D8TA 2E7ZA 1MW9X 2W2LD 3K9HA 3LPAA 4GMXA 5L51A 3LVRE 4DIKA 5JS7A 2XUQA 4C4PA 2FWAA 5CB0A 3U7EB 3KQPA 2DHQA 3HU2A 3LUAA 1Z0UA 5D3KA 2POCA 1CVRA 3UICA 3LQ4A 4M2LA 2IDJA 3KEGA 4M9RA 1G42A 2UUOA 3AO0B 2C1ZA 1EQAA 1Y7LA 4Q82A 1AA6A 4HMOA 1WKCA 1QRSA 1UT8A 3A27A 4IUDS 3O8OB 2N9UA 1RRPA 2WVGA 5IDWA 1UF9A 4F12A 1A72A 3E27A 1NASA 4RJ2A 2OHGA 1W49A 1P7ZA 4N3GA 3V2GA 3ZY4A 4CG2A 2R1ZA 3GJ6A 2O2SA 4WLVA 2V4MA 2XRYA 4N47A 4DBVO 1E2BA 5JYCA 5E9AA 1Y9AA 1PZXA 5MN4A 2PKRA 1HI9A 3I6YA 2ENWA 4AAYA 1RYZA 4GP6A 2J4CA 2W6IA 3H04A 1H94A 4QAJA 4V1CI 3R41A 4C0LA 1ODIA 1XQ6A 4R69A 1JVSA 2PLNA 3O95A 1E0AA 3CZPA 3K94A 4NCNA 4DLYA 4B7AA 3MVEA 5TV2A 5FR1A 4FW8A 4NAUA 2WM8A 5GONF 4A8JC 3I6ZA 4YGXB 1VXRA 5I7VA 3QXSA 4X3OA 3C3MA 2ZSFA 5IJ9A 4MV9A 4MQ5A 3RS7A 4GX2A 1JB9A 3NWOA 2OZKA 3SIXA 1E0DA 4KWIA 1FE8A 1U11A 4TMKA 1OOEA 4ZQEA 5F51A 5BWCA 1P2BA 2FDCA 3RD5A 1XVIA 4P83A 3EWAA 1R7RA 4BZQA 4K9NA 1Q3KA 4HXEB 4RY8A 4EW1A 2QRLA 5J43A 4K3VA 1CBUA 3QPBA 1N6LA 2Y9PB 3TLAA 2ZAGA 4HGZA 3I9NA 3Q7PA 3IILA 4ZOAA 5F7ZA 1JALA 5FA6A 3SBDA 1DEHA 3IAFA 5A3JA 1SCBA 3OCVA 2D1RA 4RWZA 3SJAA 1LX6A 4GHWA 5BUQA 3UFXA 4P33A 2A1TS 4G01B 4HQKA 1UJCA 3ZTTA 1HXHA 2Q1TA 2PV0A 2XKJE 3GWGA 4GXQA 4Q4HB 4Z6KA 4QE3A 1I8TA 2IP1A 4ZCSA 1L5GB 3RS5A 4BO0A 5JT1A 5KTRA 1N1GA 2WYHA 3OETA 3ZJYA 3RUAA 4L3WA 3MCWA 1IBLB 1QQ7A 2RCNA 3HDQA 4G0QA 2Z5FA 5JU6A 3EFBA 1IY2A 3CA8A 5TQ0B 3S8EA 3L1KA 3V97A 1CYDA 2HYIC 5HUQA 5EJ9A 1G4UR 2G1JA 4WA8A 3IEUA 2HSWA 1N2GA 5FBRB 3D54D 5BV7A 4MUYA 2BFDA 1L7BA 3TI7A 4BB9A 4ZHQA 1JMVA 2PGJA 5EJFA 2XSZA 4D8YA 1VJDA 4JB8A 4MW7A 2JJYA 5DSTA 3T95A 4CE6A 3K9QO 1QP0A 4OGFA 2W4QA 1OXMA 1B3RA 3B7GA 1VJTA 1Z25A 4N9QA 2Q3CA 1RPTA 3LHIA 3N7TA 4XLLA 2BTQA 4UUAA 3HVJA 1KSFX 3GT0A 3VVBA 3EUEA 1E1QA 1QRDA 4X5OA 3T94A 4X1KA 4ACAA 1XCJA 3O0DA 3O93A 2H2IA 4Z4HA 3RCBA 5KTSA 2R4TA 1NRWA 5FO1A 3FMPB 4BNDB 1T9ZA 3NTQA 2I2CA 2OBXA 5HGJA 1SQ5A 4A6PA 2MSCB 3B6ZA 3SX4A 4ACBA 2P3QA 3TJMA 4D4LA 3RSOA 4B09A 3PF9A 4P0PB 3KHUA 4POOA 2O57A 4IDHA 1RWWA 4ZO6A 3VJMA 4N9WA 3PEYA 4O2AB 5DRTA 1ZU4A 2F1IA 2ZJ3A 3FFBA 1SQGA 2PZ8A 5HJEA 4I1UA 1J8VA 3EC1A 4PQGA 2PZAA 3BTUA 2A0UA 3L8HA 1UWVA 3G5MA 2LCIA 2OFFA 1BJTA 4P1ZA 4PZZA 3ZZUA 1CQWA 4EECA 3RKSA 4DLVA 3TQCA 4S1PA 3L8ZA 4CV3A 4RA9A 1UDCA 2D7DA 3E4CA 1II0A 1CRZA 3K32A 1B16A 4YUXA 1VTKA 1FYEA 1XTSA 4LVUA 3JWIA 3RU7A 1GILA 1UDXA 4DUZB 4DA0A 1KH3A 5EE9A 2CNDA 4JI1B 3HJUA 3FPSA 2XTNA 1N5OX 2SCUB 3BE4A 3IOCA 5IAEA 3IJPA 2CV1A 1FZTA 4JITA 3RJMA 5KNBA 1C0IA 1TT5B 4ASUD 5EINA 3OZTA 3T4UA 3ZNOA 4D8TA 3CSSA 3DW3X 1OH5A 4HAYA 1WE2A 2IZ1A 2PE5A 1JGTA 3UB2A 3BXHA 4L8WB 1ZICA 4LZWA 5DYYA 1G20B 2N46A 4PLPA 2AI3A 5ESDA 3RF7A 1W85A 2GWHA 1H5UA 2H2GA 2JHFA 3TGLA 1N33B 3R4CA 5ICSA 3FIUA 5DHFA 3OHMA 4FEYA 4OK3A 2GWRA 3WLFA 2AB0A 3OQVA 4NLLA 1IEVA 5JAUA 4BGDA 4LZZA 4IXWA 1ZWLA 4JR0A 4MUNA 1GPYA 3NOXA 3X2EA 4TOIA 2FCAA 1YXMA 2XMQA 1GA1A 4Z54A 1MO6A 1L4KA 1F8UA 4LJ4A 2QMQA 3UHPA 3RNLA 4MI1A 4OHFA 3LDUA 3M89A 3GLIE 2C9YA 1Q7GA 2O0KA 2WD7A 1M1ZA 1KP2A 5B1HA 3A3OA 1Q0PA 1ISJA 2G07A 2VPTA 4I4TA 4QICA 3TPCA 1PJTA 2P9QA 3UO8B 4NBUA 5AQEA 4IJ6A 3K0AB 1ZIYA 2VYFA 4MGKR 5FWYA 5M7EA 2WNIA 1OT3A 2I0FA 3CVJA 4OD0A 3FCAA 3T9BA 4BX9A 3T7CA 3ZK7A 1G8KA 2ZM5A 1M7HA 4LI3X 3PQDA 3TAXA 3VZCA 4F4FA 5EHZA 5KYXA 1QYIA 1ZD1A 2F1JA 1VMEA 3LIPA 1HGXA 1X7XA 1SG0A 3CEJA 2ZAIA 4K9RA 2VHWA 4IDAA 5DW3A 2O8NA 3H4MA 4YAGA 1T29A 3IE1A 3ASUA 1D2GA 1XROA 4QREA 5AI8A 5EVCA 1FDUA 1M72A 1USGA 2CXUA 2EFEB 4JC4A 2KM1A 4BP9A 1BQ4A 3HTXA 2Z1DA 2ZETA 1Q6YA 3HDGA 4TLEA 3VM6A 1XPRA 3P32A 2N1BA 5D5QA 5CEJA 2ABWA 4YN3A 4WNCA 2Z4RA 1C3VA 4U02A 1VIMA 2QYHA 3EF1A 4OYRA 4D9KA 2JZNA 3AKDA 3LTEA 2WMDA 3QNMA 1UPFA 1W59A 5IFKA 4JD5A 3TVDA 1U8EA 4LX0A 4XDZA 4YFVA 3BDAA 4RJIA 3VR4H 3F0TA 3FYUB 3ZWAA 4OREX 4C4TA 2OGZA 4PYIA 5ULLA 1N6HA 5C4MA 1HFJA 2BZGA 1OZFA 4MV4A 4X7BA 5K0EA 4DYVA 2PANA 3MQ4A 3PD1A 3QFRA 4KR9A 3DOCA 2WU0A 1FBNA 1Q3HA 3KT6A 4X63A 2I1VB 3LUHA 1TD1A 3EZNA 4MVYA 4KR3A 5F52A 1QH1B 3KLPX 2IU6A 5LWQA 1RWKA 1V48A 3H5WA 2O5VA 2F64A 4PS0A 4Q05A 4JR2A 2BKVA 3ZKWB 4D4HA 1U90A 2EX1A 2PMFA 4EY6A 2IHJA 2DERA 3FCUB 2L0XA 4LDAA 2XF2A 3BXGA 3PR2B 1H69A 3HN2A 5EJ5A 2C5EA 5A5GA 3AFHA 5I45A 4KN5A 4ZVPA 2G6TA 3AEYA 4E5MA 3I45A 4FCTA 3P52A 3HC7A 3KOOA 5SYNA 4ZU6X 1OAOA 3U60B 1XMIA 5SV2A 1L4FA 1U9ZA 1NY6A 1ZRSA 3K96A 2OV6A 1R88A 4DEVA 4XM2A 1E1LA 1I24A 4MPRA 2NUAB 3SEFA 3LKVA 3P20A 2R86A 1J00A 1P60A 3ZQUA 3PITA 1D8TA 4WGGA 4NI5A 2RHDA 2X5NA 4XYEA 1XJQA 4CM9A 3G6WA 3GUYA 5FA5A 4LJ7A 5HJ2A 4YX9A 4K9KA 4YRCA 2QNIA 5LOVB 4FZVA 3AKZA 1FSZA 2QRVB 1GSAA 5BURA 4XE5A 4UFPA 4X8HA 2JLVA 1QF6A 4WY2A 3W5IA 3VC3A 4X6LA 4LDRA 5HKKD 3OA2A 1ST2A 1YB4A 1AKTA 4A1OA 2OZVA 2WHPA 1OREA 5BN5B 3BAZA 4WXEA 2QZZA 4UW9A 3ACCA 1C4XA 3A36A 4N5HX 2PRKA 3BGWA 2J9FB 4UXIA 2MMGA 1SK9A 4DCVA 1JDVA 3C6QA 1SQFA 1K6EA 1OVMA 3I72A 1F2DA 1SHZA 2BR5A 4PGFA 1H4SA 2O6HA 3ADOA 3NUZA 1OX4A 3PF8A 5FPSA 3DO5A 4BATA 4B81A 1E2EA 2OGTA 3KT0A 2A5FA 4G5SA 3B1JA 5A7GA 4EVIA 2P6MA 1U4NA 4NWIA 2CEKA 1KZYC 5TEWA 3OLYA 3UMCA 5MDHA 4XPZA 4D7AA 1JX6A 1SBIA 4JEIA 3ZWWA 2R6CA 2CXRA 3TZ6A 1I2DA 2IHNA 2Y05A 2WTXA 1Z4MA 3Q9SA 2C9OA 4D45A 3OIGA 1RP7A 1JHXA 4MROA 1U28C 3DPUA 3ZWVA 4MWEA 1MQ9A 1C3LA 1P0FA 3U6BA 3CW8X 1U0HC 3PXCX 5IYZB 1DBIA 3NKLA 3LA8A 1T9GS 4L4XA 1QHFA 2IUSA 1VC2A 2ONJA 1GDTA 1LK7A 1CHNA 3C24A 1ZD8A 3MS4A 4KNWA 5BVHB 4R8MA 3BZUA 2DH6A 2WRZA 4KE6A 3WOVA 1VHQA 3DXYA 4HDCA 3K70D 4LOJA 1E6CA 3NLLA 3W3AH 3AONB 4J4TA 2C2WA 3AHEA 2BIFA 4BFVA 4QDUA 2RCYA 3JV7A 2VSQA 3ZW9A 2YJ5A 4EMBA 2HXGA 3MFQA 1KAOA 1XJCA 4N1AA 1Z0JA 5LA6F 5H3CA 4O4LB 3ORHA 4YBZA 3JWHA 2RAFA 3B8EA 4PYJA 3EGIA 1C7JA 4O25A 3UYLA 1OZAA 3F3SA 3VR6H 3GRFA 3U31A 4BNWA 2GAJA 4K87A 3BFKA 2FRXA 1DADA 1XDWA 2DLNA 3R3JA 3T52A 4PQYA 3GAAA 5DP2A 4HFNA 3KQNA 2FEAA 3QEJA 1NQAO 2ZJ4A 4J91A 2C29D 3NHAA 3D7SA 2GPJA 4JJ6A 4OMFG 3KE9A 4YRQA 4EDFA 3WDMA 1BWQA 2JI4A 3OY7A 1XF1A 3GEHA 1GGMA 3GLFE 2E5LB 1XMXA 1MO4A 3AEUA 3SAJA 3VYWA 1B0AA 1U5BA 2AJ8A 4FMCF 1N3IA 1G3IA 5IDXA 3TVTA 3IQDB 4NECA 3VNBA 4JU8A 1QH9A 3BIOA 1E2MA 2IOQA 4F7WA 5BP7A 4UTNA 3IJEB 3U3JA 5LLDA 2ZIGA 1UCFA 2GPWA 4G0NA 4B2PA 3C3JA 4QEKA 4C7MA 1Q3TA 5J4KA 1KI6A 3CJQA 3PQ6A 5K8TA 1EVQA 2I62A 2IPXA 1MVNA 3KTFA 4LRTB 3DNMA 3KJFA 4Q9IA 3SOPA 4E03A 3TRDA 5H9WA 2NU9B 1CEXA 5EZSA 3WLLA 2RGDA 1U0OC 1W1UA 4Z9FA 3IXMA 3SYLA 4CGZA 1VA5A 2FQQA 4YT8A 4B8ZA 5LMCA 1WVGA 5L4SA 1XVVA 1OLXA 1XTQA 1PR6A 3IELA 1F0YA 3P45A 5EHIA 2XLBA 3OU6A 3RG2A 3EASA 3AR2A 4KFSA 4QO8A 3FYUC 4UAJA 5CXXA 5HFJA 5IUJC 2O3UA 3BD9A 4OBEA 4OP2A 3VAAA 1LK0A 1RT9A 4LHWA 5E95A 2ONCA 4OB7A 3GXOA 4U2EA 1YTLA 1TA9A 1T9CA 2ZE6A 5JC8A 2H17A 4N82A 1Y4ZA 2FWPA 3HMQA 2Z2JA 5DN6D 2Y1KA 1H2WA 1TXGA 4K8RB 3EFEA 2VZ0A 1KBZA 2X3UA 3P9KA 1N0HA 4LNHA 5AVRA 2PZKA 3N6VA 3QRWA 4JI2B 5TQ2B 2DWOA 3IHWA 1SIOA 2OCDA 2HC9A 4F46A 1JLSA 1QIDA 3ORYA 2EW2A 2PYDA 2WIAA 4I4TF 1DHRA 4PO9A 4KWHA 1J33A 1I6WA 3V2IA 4HLUC 2YNMA 3V55A 4OAQA 4DSTA 3SSMA 3A1VA 4BVFA 3NR2A 3GLSA 3UMSA 2FB9A 3BT7A 2G1KA 2BFCA 1C7EA 4JJEA 5DI3A 2YIMA 1I33A 1O96B 3JVDA 2IXTA 2QV7A 5SYMA 2HH9A 1TRKA 1E3WA 4LOHA 3PNBA 1JDJA 1S2DA 5T3UA 5BQPA 1IBKB 1BX1A 2XEXA 1NUSA 2C54A 2OVFA 3H9CA 3MMSA 2XITA 3O83A 4MR8A 3TVYA 1MJ5A 1S96A 1W0CA 3AB3A 3N0VA 3AIKA 1F4LA 3RGWS 5I7OA 3GLGA 3DM5A 2XMPA 3KCQA 1GT91 3DFKA 3LBIA 5AKLA 5H16A 3V8PA 3WY9A 3KSDO 4GPAA 3FLMA 3C43A 1P29A 4ZOEA 2BGMA 4MRNA 1WHSB 1WPGA 4GXNA 4IZIA 2DM6A 4HO1X 4NH0A 4S1WA 3V6MA 4BVJA 2RE8A 2D2EA 1VSVA 2WJWA 4FE3A 1R8YA 1UJNA 3CYFA 2IZ6A 5AI6A 5DGHA 3ZWMA 3G8BA 3RQIA 4BB6A 4ZD6A 1G17A 1BCSB 3GIDA 1XC7A 4IH1A 3D0RA 2QW0X 1QDLB 3BXXA 2K7ZA 2Z8YA 2J4DA 3HPQA 2HZ7A 1DX4A 2C0CA 2BFAA 3HXTA 4A0SA 1QQBA 1L8LA 4WNYA 3S1AA 4P3KA 2PKEA 4RYDA 1Z22A 2JKZA 2NVWA 2YV4A 3NHJA 2I7DA 2AOTB 4K26A 1YDGA 4JDUA 3K5IA 2PX6A 1NTOA 4OI2A 4V0OA 4EKDA 1QRRA 1OYYA 1KXJA 4L73A 5IAGA 4IDCA 3LL4A 4OQFA 5I4CA 2XGOA 1LGYA 1XVAA 2B0CA 4OLFA 1MAVA 2VF5X 2D4HA 4GR4A 3W9YA 1GTRA 1FTGA 4WL0A 2OUKA 1SHKA 3KTOA 2F3RA 5C4GB 1HT3A 2QTFA 4U7JA 1E99A 1DWQA 2FN8A 4F9FA 5IKXA 3FETA 4OK5A 3I6BA 2HT6A 5JALA 4LF6B 2QT9A 5ES3A 3HCDA 3TCKA 2I80A 1G21B 2QF7A 3QBDA 1M1YB 1UP7A 3C3CA 4GWGA 2ET6A 4H7JA 4TM8A 3S3TA 1SUWA 3FJ1A 2WILA 3HSYA 4Y6OA 1AHPA 3ZDEA 2PEYA 1BOOA 4GGMX 5BV8A 4QM6A 1NRXA 1D6NA 1DQZA 1V96A 2Q2WA 2WJAA 3AETA 3GJZA 4XSHA 5IAKA 4ZAWA 5IT0A 1A96A 1BS1A 3LG2A 2G7MC 3OTGA 4MQBA 3GR6A 1CZLA 5K45A 4QGHA 3OURA 2CVOA 4YA6A 2I8LA 2REOA 3G2QA 3WL5A 3ZJ5A 4WINA 1ZBQA 4C0HA 4BS9A 4H7DA 5CW1A 4HWGA 5ITSA 1QORA 4EH1A 4HS9A 1J25A 2ATVA 2K2WA 4OXQA 5LUAA 4EENA 4R84A 1YOBA 4ZVMA 5EOVA 1HTTA 3PWKA 4O5OA 1MEEA 4IKPA 1UKEA 1G1AA 3IH5A 8OHMA 4QHSA 3DONA 1P7WA 4JASB 1QQ5A 4YHHB 3J81A 3QV1A 4WCFB 4R8KA 2D6FA 3IDQA 1M6VA 2TMYA 3I39X 4KSBA 2E18A 4IY1A 2P2LA 3AHGA 3V1YA 2DPYA 5KYWB 3HU5A 4WY5A 3VX3A 2PXCA 4KXNA 1X9IA 3I1FA 2QVZX 4GWLA 3KELA 2YZNA 4B7XA 3L6DA 1UZLA 5B58C 3ZK9A 5DSZA 3CWZA 4FYIA 3TNYA 2FP4A 3ZOZA 1LCIA 1V47A 2J9RA 2OFWA 1E5LA 4KODA 3WMWA 3FFXA 1DU4A 2AQHA 2WB2A 3IT2A 2JI8A 3OZUA 2HF9A 3ZZNA 4MP6A 2J09A 4UVGA 2QXUA 1MCZA 1L5WA 1X7ZB 4WDQA 3PCTA 2RI1A 3HRHA 3O2JA 5HE9A 1CCWA 3H5NA 3RRBA 4AZSA 3OKAA 1E1CB 1KDTA 1NR1A 4MI3A 2C9CA 3EBLA 4P3OA 2FQXA 5FL7D 5IDYA 2LCQA 4DA8A 5BVGA 5F4BA 2YIJA 4QBIA 3CUWA 2C7GA 4H7IA 1ZOSA 4OLAA 1XR3A 1GKUB 3CJRA 1H93A 3UW3A 4DUGD 4XI9A 3WC4A 5JS6A 1L3IA 3BSFA 3G0CA 5I5GA 1IWPB 2UUPA 4CKZA 5IWCA 5JD4A 1IXRC 1D07A 1P5ZB 4Q01A 4CM5A 2HRQA 5CLFA 2VNJA 4R9SA 5KSZA 4YCJA 1WXIA 2QD4A 4CTOA 5IBCA 4Y6QA 3DDHA 3WFJA 4PZAA 1FDTA 1TQ6A 1IJKA 1LVUA 4OYYA 1O58A 1AS2A 5BPFA 3F46A 1OXSC 1XZNA 3A6JA 1SNYA 2HUPA 3FFTA 3VI4B 4ZMRA 1E92A 3EWNA 2QX7A 4ALKA 3VDMA 3EY9A 3SSNA 1CP3A 1DTSA 1MHPA 2GLUA 4JJ4A 3WGMA 4D0RA 1VKOA 1Z0ZA 1N25A 3O3NB 4RGVA 1KYVA 2Q4DA 4K6KA 1VRWA 4QOIA 3R7SA 4RK5A 3SF8A 1U6JA 2ZIWB 3P97A 2WZBA 1Q7TA 1XK7A 1GPBA 3KRTA 2C7VA 4Y2VA 2MSLA 2WSLA 5LMNB 1PG2A 2D1SA 1U0NA 2UAGA 1F8XA 2W2OA 4NDAA 1RWPA 2R7AA 3TYXA 4BFTA 1Z7BA 3QFSA 2HM7A 1MPXA 4QJ5A 3JAMA 4IXNA 1GQFA 1T6YA 4J4BA 1Y6GA 1C14A 2VTKA 3LF2A 2IL1A 1RI3A 1MRNA 1XQ1A 3C5EA 5FTLA 2W8BB 2O8CB 1GG2A 3JYLA 3FHJA 3JQPA 5DBEX 4MV8A 5BOVA 3TW6A 3CINA 5AW4A 4IKOA 3KKQA 5CYFA 3L6EA 3U1VA 1IHXA 2IU4A 4QDZA 3WB2A 4E5NA 2ZU6A 2JFWA 1SVWA 3D3WB 4KWEA 4MW0A 5FNVA 2IFTA 1ONBA 3UKJA 3ESCA 5KTPA 4BNUA 1LDEA 2G4LA 3FNGA 1E61A 4AU1A 4UTVA 1GUAA 1H8HA 4O08A 3I42A 3LF1A 3NO4A 1H1LA 3A9TA 4JYPA 1SCAA 1Q44A 2OC9A 5AW1A 4C0JA 4GIBA 1EXVA 3DE6X 1EVEA 2I6FA 3LKDA 3HV0A 4YWHA 3FTQA 1U2SA 1E3TA 3S27A 1RKVA 3P5SA 3NM4A 3T8YA 3V48A 3EBOA 5IEJA 2O5EA 1YCHA 2PBRA 2X6RA 1P2TA 5I9NA 4LQDA 3NAMA 2QM0A 1WCYA 1GP2A 2YN2A 1QQ6A 1D03A 5IKPA 2AS0A 1IU9A 2FR8C 1RYHA 3W77A 2E85A 4V02A 2L42A 2NVOA 2DUUA 3QI2A 2RBKA 2R6R1 2Z5LA 4RNDB 1ZIXA 2ICAA 2ZYWX 2X7HA 1K6JA 2I9KA 5T67A 1R3DA 3PDHA 1QS0A 1S2NA 1ISMA 3SC4A 4NIMA 4P82A 4RZHA 4K9OA 2GETA 3QELB 3Q87B 3L7YA 2OD9A 2AZ4A 2X22A 3QF4A 5AM1A 1YJCA 4N40A 3TZHA 1Q0RA 1KYYA 2O8FA 1HT2E 2A2ZA 3QQPA 5EHNA 4BFCA 1TYAE 2CXHA 4LDNA 3II6X 2PGAA 4Y2UA 5I7AA 1VLZA 2WYIA 5A7HA 4BECA 3VKVA 2P2GA 3UCFA 1DKLA 3MZ0A 3UWSA 1YFJA 3BRQA 3ZV5A 3ITNA 1LPAB 3AFMA 3F5DA 1RYYA 1T4MA 2W2XA 4J0QA 1W4RA 2ZJ7A 3K72B 3LWBA 2JGMA 4MTLA 2Z04A 3A58B 4H08A 4TLMB 1AX9A 1YJQA 4RQBA 1R9NA 1T10A 4JI5B 3KU1A 2W42A 1NIPA 4Y9SA 3IR7A 5EZQA 3ONNA 1EWQA 3MB8A 3CMCO 3F5SA 1Z4PX 4O02B 4WMLA 1QHNA 4QYWA 3G9XA 2JD2A 5AJUA 2MIIA 3S55A 4LWPA 2FDRA 1GCIA 1TECE 2DKNA 2HIAA 2Q0QA 1NOJA 2A8YA 2C0PA 2WHRA 4DZTA 2PBLA 1BWRA 4HRYA 4XYLA 4WOPA 3U4GA 2G7ZA 4NBVA 4EO9A 1EFAA 2JBHA 2JI9A 4CYMA 4YJFA 3T7SA 5K8JB 1ZHOA 5IJ9B 3OIUA 1J8DA 3O8QA 2DHRA 1U9YA 2ETXA 4F7DA 4K6GA 3HS3A 2I3BA 2K5UA 4MA0A 4WCFC 1KVQA 1AKUA 2BH2A 4BO4A 3NWEA 5A6SA 3BD6A 3DHVA 1ZITA 2PS1A 4XWGA 3RWOA 3SC2A 4QYIB 4ETMA 2X9QA 4KWTA 1QU3A 4WRRA 4H2DA 1X87A 2JL1A 3IMGA 2OT3B 2WLTA 3DUFA 3RVOA 2AUNA 1Z7YA 1OHHA 5KMGA 2PWAA 3I30X 4YPFA 4PBTA 5KQRA 4GEKA 4P35A 3UFXB 3B9PA 3Q5DA 5CLQA 3CLSC 4G9BA 2UDPA 4HC4A 4DLWA 1A2KC 4DB4A 3G5UA 3MJVA 3N5KA 5BNTA 5CBKA 2PS9A 2RARA 3P9QA 4RDCA 2IF0A 4N7MA 1ZQ1A 4QYTA 3TQOA 1BE8A 1SXIA 1PJZA 1SC6A 5KYUA 4EG4A 3LAWA 5ER6A 1DG1G 4PXAA 3LRTA 4ETWA 2VF8A 4A23A 2PX0A 1XALA 2CXSA 4GE3A 4D9FA 3TNDA 1DX6A 3ETHA 3GDHA 4ZVKA 2GN6A 3I8XA 4BN4A 4UUBA 3IFSA 4JROA 3RVSA 4KB5A 2FPOA 2MTBA 2V6GA 1DUVG 1SFRA 3CZ5A 2BFDB 1K7CA 4M7RA 3AP2A 4ZHQB 2HQ1A 4IIJA 1W4ZA 4BU0A 3Q41A 1NP3A 1QYVA 2BHTA 1W46A 3HB0A 1PFWA 5GP1A 5J5AA 1HDIA 1XWIA 2A58A 4KU4A 3USCS 4HRVA 2ZUSA 1D2EA 2PBZA 2BTQB 4PYNA 4U63A 4C4SA 4EJSA 4EHJA 1MPTA 4IIXA 4PSKA 4GOMD 3ZGVA 1P0QA 2DU8A 4A0QA 3HO1A 1MB9A 1RR6A 2HJGA 2R97A 4K7JA 2P6RA 3HKCA 3S2IA 4U2KA 1FFYA 4ME6A 4KIWA 4YTEA 1AUOA 1DARA 1R8QA 3D8BA 3TQHA 1G7TA 3ZJ4A 4LHXA 5BOSB 5A0TA 2I6UA 2V7BA 3JY6A 4LZJA 4YRFA 4ECAA 1GD1O 4YUAA 1YE8A 2YIVX 3I3OA 4G9GA 3BB4A 5CA0F 1ONSA 3FZYA 3S7ZA 4MLZA 2W2NA 3PGXA 1BC5A 1IJBA 1QFJA 5FI1B 3EQ2A 1J56A 2QRMA 3NUGA 2JZCA 4UVHA 3RAPR 2ZUEA 1RXCA 1QG0A 2BISA 1ECBA 2M9MA 4FMCB 4GKVA 4IOMA 4OFBA 1CUBA 2IS2A 1TMGE 4MI9A 1QE3A 2BUBA 3V32A 4ZEXA 1DZ3A 4XTCS 4KYVA 5KX5A 3OTHA 3ZBTA 2PX2A 1DV1A 2FQWA 1BD3A 3OU7A 2HA5A 2PT6A 3DCJA 4J2HA 4YXWA 3VTZA 1U2GC 1EM8A 2AEFA 3TXYA 2M32A 1GRCA 5U4QA 3AOEA 4RA9B 1ZN9A 5C5IA 1Y4DE 1G1MA 3VC2A 2BAGA 5TRTA 4JLAA 3IE0A 2H1VA 5D01A 4LGVA 4L6IA 1US8B 2VVTA 3NNSA 4NMHA 2X3YA 4TX1A 2E0IA 3B53X 3FJOA 4FSHA 4V0LA 4P4TA 3PXDA 1LW7A 2IEIA 3UMMA 5F3DA 3OQMA 1UPCA 4J43A 4CIVA 5AW0A 4U9HS 2UYHA 2I2XB 4ZN6A 4NXMB 1A9XA 3GNLA 3TDKA 1FJHA 3PD0A 4H3SA 4M37A 4FZJA 1YZFA 2L82A 1AY0A 4BMPB 4QBHA 5BNIA 4X90A 4ZAGA 3KB1A 3G2KA 2GS9A 2VJKA 2IYAA 2XBUA 4X44A 1W85B 2KW5A 3GDGA 1H8EA 4PC6A 5EERA 3EGEA 4UOQA 1NW3A 2IODA 1YUMA 1Q1QA 2WFLA 2V65A 2DGDA 4S0XA 3AIIA 1CEYA 1HF3A 1B8PA 3RROA 3D5EA 4N7JA 4K1LA 5DK6A 1EB8A 1D2RA 5KNCD 4UHHA 3PC8A 3WK5A 1ANKA 1AZWA 3ONWA 2BKUA 5ALSA 2NXCA 3PEVA 1FDSA 1L7QA 2ZDGA 5GINE 3KYDA 4MPTA 3GD5A 1ENOA 3WWZA 3HNOA 1NWHA 1U0FA 2WD7B 3G2IA 4MR7A 4TXLA 3TXAA 3ZCVA 4E5KA 5KQGA 4I4TB 2E1PA 4V2UA 2FU5C 4W5OA 5AICA 2A67A 5FWYB 5K3BA 5DX0A 2OO5C 4R2LA 3F9RA 4NICA 3TRKA 3D6TB 4PAOA 1PUJA 3QPUA 1F20A 5KYXB 2P9CA 2R85A 4YMVA 1X7XB 2EBHX 5K3FB 1KNQA 1VE1A 4TWJA 1NOIA 3GGSA 3R0IA 2AIRA 3UXYA 1A9SA 1W2WB 4GG1A 1HRDA 1GRQA 5TPZA 1NW7A 1XT6A 2YQ5A 3OJXA 1PR5A 3HQ4O 4RO0A 4E0BA 4F96A 5FNVF 1CWUA 1TUEA 3NBYC 1A69A 1V7PC 4FE4A 4Q3DA 3LPDA 3GDFA 3PX7A 2G9ZA 4XSGA 4N76A 4LMAA 2ZTLA 1XOIA 4YMGA 4ZVUA 2ZZKA 4DJ5X 2FK7A 2PBFA 4IVNA 3ABQB 4DA9A 2G82A 1J2YA 3NBZC 2VAXA 2JJ2A 3FPJA 4Q0MA 4JOBA 5J9FA 2VFAA 5FI5A 4GO1A 1EEXB 2WD8A 1ULUA 1XAJA 4LTDA 2WHQA 3UUEA 1XJ5A 2QPTA 4AY3A 3RAEC 2ZI9A 3KWFA 4OHMA 5T8KA 4O6VA 2CFTA 5E0KB 1HSZA 1P5FA 3C3YA 4BMSA 4EA7A 3V7WA 2CVQA 3MUNA 3QKSA 3EH2A 4XZ3A 3WLKX 1SKBA 2JDIA 2YW9A 4P36A 1U80A 1NXXA 3CSUA 5CNIA 4EUNA 4F4JA 4XJXA 3IAS6 1TK3A 2W6MA 2Y71A 4ALLA 1UFOA 3VC7A 4Q4DA 3JQFA 3L7CA 3PU6A 3ZGNA 1FJXA 4BPRA 3L4BA 1VPEA 2IHKA 3HXKA 4A2QA 4QNRA 3L9WA 5C8DA 3ZWKA 1AA9A 3R6LA 4IMRA 1V41E 4ESHA 3GUVA 4B5LA 2V5AA 1LPOA 2YL2A 1ZW1A 1BVYF 1PL7A 3SYTA 3B38A 4KNVA 2FYTA 1JLMA 1S3FA 1TF2A 2J9YB 2YRXA 4FEEA 1DJMA 1PR0A 3VQTA 3AF4A 1N6PA 4XVUA 4B4UA 1UXGA 5JCJA 3WRXA 2O3QA 2Z6VA 1DEKA 1QR6A 1UR5A 3AF2A 3BG5A 1JZTA 3ZE6A 4C2TA 4ENQA 3HZHA 3ZLUA 4LIPD 3I4LA 1QOPB 2FEKA 4M0EA 1L5ZA 3UFBA 3J81k 2ECQA 5EKXA 2QTTA 2ZVPX 3B36A 3ZIUA 1KWKA 2CLLB 2A9FA 2H3HA 5TR9A 3NMUF 4L6CA 2IYWA 3R3SA 3TMYA 3WWCA 2VDPB 3PFBA 3ET5A 2JD0A 1VDMA 5LJLA 3OLQA 4AC9A 3FSEA 2C9BA 3KP1A 3K1ZA 1E3JA 2PH5A 4LHZA 4MVJA 2KPOA 4Y1RA 3QMWA 1P6XA 1ULAA 1UZUA 2WHPB 3VV2A 5BR8B 3BHNA 3NT5A 3GA7A 2WJGA 1O0SA 4FXPA 4FQ8A 3C6BA 4FQ5A 4MEJA 1DXHA 4XPIA 5K3CA 4BZXA 3IB3A 1P5HA 3DLIA 3M83A 4FD2A 3T12A 4BFWA 4BO9A 5CDTA 5FBLB 1OX4B 1KIFA 3C3WA 2JI7A 3O7WA 3AY7A 2WMNB 4FFOA 4JXJA 3K8ZA 4MQEA 3RYCA 2YRFA 1SD5A 1ZS9A 2VPWA 2FG6C 1E9CA 4L50A 1OIVA 5J2UA 1RBZA 3WGVA 4BIMA 3OIYA 5I01A 3P7MA 2C5SA 4CF5A 1TI7A 1Z17A 2AFIA 4Q7QA 1Z74A 4TM7A 2NQTA 4J7XA 2NO4A 4M4SA 1C0KA 3QZUA 5KQSA 2X86A 4DDUA 2H0QA 3ZX4A 3F4BA 2VRCA 1CFZA 4O4JA 3SSOA 1G9SA 1QFSA 1L7RA 1LXCA 1YV9A 2J33A 2ZQZA 1GTVA 3HB4X 3HCPA 2V7EA 3RBZA 5L6MB 1P9WA 3H8WA 2ZI7A 3KSUA 3I8SA 4YV2A 2LIPA 4IIJF 1XCBA 4TTTS 3K1YA 2P2NA 4DQVA 4B6OA 1VFNA 4GBGA 4Y67A 5FWDA 5ICMA 5L7YA 3T1NA 5LVAA 3GUZA 4M55A 3WB9A 5HKLA 1ZCJA 3SQWA 4XUGB 1L0BA 3CX3A 4K6CA 1A76A 4V0MA 1QLWA 3EVAA 3OTIA 3MIZA 3A70A 3LQ2A 3PUIA 4TROA 4UEQA 3RREA 4TKUA 3H4TA 1WXDA 1B76A 1JHYA 1XJWA 5ISMA 3UMYA 1YS1X 4PO8A 1RC0A 4UBKA 4K40A 5TJHA 3ZW8A 4PPGA 1CZUA 2PMCA 2O7RA 2H1LA 5HS4A 1D8AA 1MENA 1N2EA 4HQ6A 3X43A 4LXYA 1EA5A 4D9NA 1IZ8A 2JLSA 3D4BA 2GHRA 3DBVO 1Z6QA 5GAJA 3AEUB 3JQ9A 1FDIA 5MGNA 1U5BB 3CZQA 1WABA 1KAMA 3FH0A 1HLFA 4QARA 4ER3A 4I4NA 5AVXA 5KX5F 1YCFA 4ZJPA 2L69A 2R1VA 2W37A 3V80A 4BMZA 5T3YA 3V42A 3ASYA 3OPMA 5B6IA 2OP1A 5ADHA 1U2DA 2DBVO 3EA0A 1ADJA 4D26A 1EGQA 2EKBA 4YAIA 1KI6B 3PNKA 4URHA 2QV0A 2BKXA 2QUKA 1NXSA 3W5AA 2WNHA 1ZJYA 2VAVA 1DRVA 2DKOA 3FCYA 3PVCA 3V4LA 1J9EA 3FDZA 4UEKA 3DJYA 1L3BA 2K87A 4H15A 5AKYA 5C7YA 4JQSA 2IOHA 2B7LA 1YDHA 4TVKA 2UZ1A 1RXUA 3T5CA 1EHIA 3BHMA 2WIBA 3A28A 4LYAA 4J3JA 1FB5A 4DLSA 4ND6A 1K7SN 4OFWA 2P9TA 5JHGB 3L7DA 1ESMA 1OLXB 3A6FA 3HH8A 4JBNA 1T8YA 6GPBA 1CQIA 1JAZA 1EX9A 1GUYA 4BO6A 3I4CA 2O0HA 1OI2A 1E1NA 1L1EA 2X77A 3H9GA 4GM1A 4XVRA 3SQXA 3PGKA 5EJIA 1HE8B 3ZWNA 3FKSD 4PSDA 3WTCA 1E79A 3BHJA 2WT9A 5DYTA 4L8YA 4P54A 1JAIA 3Q7EA 4JY7A 4GX1A 5JSKA 2SHKA 5F77A 2JFHA 3QIAA 1V1MA 1FP7A 3AFNA 3FM9A 1HFWA 3KSRA 4HUQA 2WUFA 3M70A 5TVGA 5CDFE 3C16C 4L95C 1Q50A 2XDQA 3C4VA 3NJ4A 1JN0A 2FHSA 2OEPA 3ET4A 5FA8A 5BYKA 1G20E 3RS8A 4BKMA 2GM3A 4ZI7A 5L3SA 1YZHA 2P7HA 3BX1A 5BNFA 4CKBA 1XAIA 1KYZA 1LS6A 2EAUA 2CFCA 1G8JA 2QM8A 2RH9B 2VRWA 2GUGA 3AFOA 3TDNA 4HAUA 5LIRA 1JHVA 2BFCB 1RXVA 5DI3B 2B61A 1T8TA 1OAOC 4U7GA 5CXSA 4ARUA 2ZIAA 3TM4A 2D5BA 5JD5A 5KQLA 3HCRA 1L5FA 1E3WB 2IE8A 4FC7A 4IJKA 5JTUA 2DR2A 4K3UA 2FUG6 3NTXA 2EKDA 3JVVA 3ZHBA 3UGJA 1W2HA 1R66A 3GLGB 1ORRA 3AF3A 4Q37A 2C20A 4PCLA 3RAFC 3GP5A 1XRJA 1YR6A 3SJZA 1E4YA 4DLKA 4P4LA 1Y9JA 4BASA 2G9VA 2CLOB 1UOQA 3WBJA 4GVPA 5I48A 3O3MB 2JEYA 5FH9A 1FYFA 1H1DA 1JZQA 1HDZA 3ONFA 4KGXA 2J67A 1FDOA 2DETA 1Z8DA 1ATIA 3OO0A 5IPFA 3S68A 1KMIY 3T7DA 3C3PA 4Z51A 3VZRA 4JQYA 2NQ8A 3SZGA 1DOAA 2HDOA 3B1KA 5HMLA 2JRLA 3LRXA 2OQVA 4QBTA 3VHLB 5EPUA 2FG5A 3DC7A 5CD1A 2FSHA 1J5EB 4JJ7A 2YWHA 4NBSA 1UBNA 3BIXA <