5L7WA

17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
254
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title First Structure-Activity Relationship of 17 beta-Hydroxysteroid Dehydrogenase Type 14 Nonsteroidal Inhibitors and Crystal Structures in Complex with the Enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 254
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l7wA00
4E13A 3ROQA 1CETA 1DAPA 1HEUA 3WGTA 1LLDA 1YVEI 1L7DA 5A3JA 1R4MA 9LDBA 1Y8RB 3PEFA 4EBFA 2I6TA 2FOIA 1HYEA 2G17A 5ICSA 1TXGA 2NQ8A 1BMDA 1XCBA 4CMIA 5A9RA 5L51A 1PQWA 2VT3A 3VPXA 4CLEA 5IXYA 1PS0A 1RWBA 2O7QA 4MP8A 4NBVA 4BQPA 3JQFA 2WYVA 3GGGA 4FFMA 5HBRA 2C29D 4WE3A 4A5OA 1NR1A 2GZ1A 3HDYA 1C1XA 2B37A 1C1XB 1BHSA 1RM4A 2DBVO 4RVSA 3SXPA 1Z74A 3WLEA 4FJ0A 5IN5A 4EZBA 1MFZA 4EJ0A 1YL6A 4IDFA 4PG8A 5FEUA 3DZIA 1YQXA 3P7MA 1DRVA 1IB6A 1U2GA 2OHXA 4M54A 4TRMA 4PVDA 4BO0A 3EHEA 4OL9A 3TN7A 2V6GA 2C2XA 3AY3A 5DBGA 1FMCA 2OP1A 4KWIA 1MG0A 1QP8A 1ULUA 4CQLA 2E49A 1HF3A 3FPCA 1YBMA 3ITKA 4FC7A 5T6BA 2DKNA 3D4NA 3FPLA 4GWGA 1EFLA 3QHAA 4XYMA 4XQGA 3BMCA 4DPKA 1VM6A 4P38A 4Z0HO 4MVJE 3HWRA 3WIEA 3VH3A 3UICA 4BNUA 3C7AA 1SZJG 2OL4A 3JQCA 3WJAA 3QWHA 5EESA 3B70A 4A27A 5DCWA 5I9LA 2Z1NA 3QP9A 3ONEA 4GAEA 1PZHA 1YONA 4HNHA 2E6UX 1L7EA 2JFHA 3LC7O 1WZEA 5A06A 4Z0TA 5ICMA 1IZ0A 1EDZA 3L77A 4TQGA 2UUOA 1IHXA 4K6CA 2HRBA 2AMFA 3RAJA 1I33A 2EKQA 4D0RA 1PEDA 1W0CA 4EUFA 3KHUA 3JQFC 4PG6A 4L8VA 4D3FA 5DBFA 3U9LA 1DHRA 2GNAA 3BMQB 4ID9A 5EJ2A 5KVVA 1R6DA 2Q99A 2ZB8A 3BTOA 3KM0A 4RF3A 4RORA 5I8ZA 1HE5A 2WE8A 2C0CA 1O89A 1ZCJA 3DOOA 4RGBA 2JKVA 2NLOA 2I66A 1CQIA 4DQXA 4AL4A 5TJ9A 1O95A 2LDBA 1YBAA 2HO5A 1HSZA 3QVXA 1X7DA 1QMGA 1FDVA 4GKBA 1DO8A 4ILKA 5L7TA 5GZ6A 4B3JA 3RD5A 4AG3A 3B1FA 1OFGA 1I0ZA 2NTVA 3AFMA 3NTQA 1VJTA 3WFJA 2OUIA 3HDHA 5BSEA 3LC2O 4BKRA 3I23A 2EV9A 5ER9A 2CZCA 3PFWO 4RQTA 1EUCA 4XQCA 3RFVA 3GNTA 1I3MA 4GVXA 4RPKA 1UDBA 4IDGA 2AA3A 1KYQA 2C54A 4GVLA 3M2TA 5I7FA 2VHYA 4CM5A 3GAZA 2NTNA 1NVGA 3JQAB 3WIDA 4R9SA 4URFA 3L4SO 3PYXA 2X9GA 3GPIA 3QE3A 4S3MA 1UZNA 1YKFA 1GFSA 3LDHA 4FW8A 2ZTLA 4J9VA 1P1FA 3IP1A 1E1MA 1H2BA 3V1UA 3C7CB 5EN4A 2WM3A 3A1NA 1WXDA 4AJKA 4DVJA 1GCOA 4R5HA 3O26A 4PRLA 1QV7A 4PIVA 4ZQEA 2PFGA 2VOJA 3T4XA 2B5VA 2HMWA 4XA8A 3S2IA 5CDTA 5HM8A 4PRKA 3ASUA 2FP4A 4E5YA 2GLXA 8LDHA 3DZBA 3F46A 5T57A 5A05A 3HADA 2RIRA 1SPXA 2CD9A 5CEFA 4R54A 5FWNA 3ZWPA 2CF5A 3B20A 1E7WA 1XLTA 4DBZA 3H3JA 4LISA 2H6EA 1G1AA 1I3LA 4MVJH 4OGWA 2JCVA 4AJLA 4CM7A 1PWXA 1FDSA 2G76A 2X9VA 3FBGA 4FFPA 4RZIA 3ZZNA 5JO9A 4I1IA 1Z45A 3V8BA 4DLAA 3LYLA 4UVGA 2FR8A 5JY6A 3VH4A 3BAZA 4DQVA 3ZU2A 3ABIA 4ALJA 4LSMA 4CMEA 1GYQA 2RH8A 1CJCA 5AQ1A 3QV1A 3ONFA 4DWVA 1E77A 3V2UA 3K31A 3LK7A 2D4AA 4FR5A 4WCFA 4BB5A 3ZDFA 1LDYA 3RQSA 3GDFA 5F5LA 4DL9A 1WDLA 3DXFA 3DWFA 1P9LA 1MA0A 3RVDA 3NEPX 1BW9B 2G5CA 4ZQGA 2HQ1A 4IXTA 4LRSB 3L6DA 4ND1A 7ADHA 3Q9UA 2HUNA 1DBVO 2HMSA 1NP3A 4HKTA 1I5RA 3P5SA 4CM8A 4C4OA 3K5PA 4XX0A 1DFGA 3VKUA 4DXHA 1D1SA 5K6AA 4PGFA 4BKOA 2YFHA 4YT4A 4U8GA 4GSLA 3H2SA 3RC9A 4FOSA 4RQUA 1HE2A 1X7HA 3UCFA 2IXAA 1NFQA 3JYNA 4CM4A 2XOXA 1CQJA 1DC4A 4R3NA 1DRUA 2JCXA 3PRJA 3HB4X 4CR8A 1LTHR 3GZ4A 3A14A 4Y67A 1IY8A 4XIJA 3TPCA 3KB6A 4I5GA 2GO1A 5H81A 4L4XA 4YJHA 3TQHA 3LF2A 3GGOA 4GH5A 3OQ1A 1V9LA 2BD0A 2X0NA 1PGOA 4CR6A 1E7YA 1LRLA 1ZK3A 4NJMB 3PVZA 4Y6RA 1I10A 4XEHA 3IC5A 2HDHA 2QYTA 3KYBA 3G1UA 3E9NA 1LJ8A 2GN4A 4JBGA 3PZBA 4IJKA 5BSGA 4IMPA 1YQGA 2PZLA 2DU8A 3OIDA 3GPDG 3VC7A 4PZEA 2YHIA 5I7SA 3RSHA 4A10A 1B16A 2Q50A 1PGQA 3RUFA 1ZEJA 2WDZA 3R0IA 2RHRA 4NIMA 3HB5X 3MTJA 4TZKA 4AJ2A 3Q6IA 1LUAA 1HWYA 3CMCO 5JCJA 1JN0A 4NFSA 3ZWBA 4N18A 1GZ3A 5K6AC 4CLOA 1DIRA 3AI2A 3PJEA 2IRWA 1JWBB 4IINA 1HDRA 4KP7A 5JDIC 1KEPA 4CLHA 2JAPA 3E9MA 1HTBA 3TOXA 1EBUA 2RCYA 3KOUA 1ZZEA 2B4TO 2VYNA 3FSRA 5GZ3A 3WQSB 4AJHA 5C7OO 5JDCA 1ZUD1 4NPCA 1BGVA 1LLCA 2NTJA 2YV1A 4I9HA 1GR0A 1Y5MA 5JCXA 1EVJA 1HYHA 5COAA 5DDIP 1HLDA 1ONOA 2DM6A 1U5CA 2VHWA 1WVGA 2UVDA 1XSEA 1WMAA 1LQTA 1XU9A 3LLVA 3ULKA 4RDIA 2OORA 3INRA 5IG2A 3K2EA 3O4RA 3SLGA 2AHRA 2HU2A 4Q3NA 2F00A 2CNBA 4FCCA 4W7HA 2GZ2A 4BO2A 3PK0A 3UH1A 1T4DA 3WWZA 3BMOB 3FI9A 4P22A 3H9GA 2PA3A 2Q3EA 3EK2A 1AXEA 2NVWA 3Q9NA 3T7CA 1SB9A 1I3NA 1GYRA 3KVOA 4TMFA 1JQBA 4XQEA 4GL4A 4IS3A 5A4DA 1K0UA 2NVBA 3PPIA 4FSHA 4XB1A 2W90A 4GPD1 2BKAA 3BHJA 2OXIA 5K9ZA 1P77A 1P0FA 3DBLA 3DBVO 1PJQA 4A7PA 2JAHA 1T25A 3VZPA 2AQ8A 1QG6A 4E30A 4CQMA 3ETGA 3UF0A 4KTVE 1PL7A 3I9OA 5CPBA 1N1GA 4OAQA 2VHVA 1X0XA 4BNGA 1EVYA 3QY9A 4N5MA 4Q3BA 5CEJA 1LDBA 2AQIA 4ZHSA 4R51A 1ZK2A 2Q45A 4J4HA 1TB4A 1LC0A 4YAEA 2PNFA 4BB6A 1EZ4A 1HXHA 2RAFA 3E48A 3L4BA 3RU7A 3H3FA 2QW8A 3VVCA 4QUKA 3GR6A 3SVTA 1XG5A 2X0IA 4YRDA 1N9GA 4DC0A 2GSDA 3E5MA 3F47A 3D64A 2C7VA 4O5OA 4RLSA 2PGJA 4XDZA 2FPIA 4LMPA 4KQXA 2Q49A 3X2FA 1ADBA 3NT5A 1KVQA 1B3BA 3S2FA 2VTDA 3RIHA 2VYND 2VUTA 2DLDA 3TZHA 1KOLA 4BNVA 2HKIA 2XAAA 1UH5A 4I5EA 3GDOA 5G0UA 1M67A 3EW7A 3TZCA 3OH8A 4LW8A 3O8QB 1B26A 3D3WA 3JSAA 4GBJA 2HJSA 4BMVA 2FN7A 2HJRA 3DTYA 1M75A 1QYCA 5ENDA 4EI2A 1ZIDA 1K6IA 4U5QA 4OM8A 3GZNA 1LLQA 1E1LA 2DTDA 5TSDA 1E5QA 1UDAA 3IMFA 5ILGA 4L75A 2Q46A 4JQCA 1WNTA 5JNLA 3MJTA 2ZQYA 4CMGA 5K0ZA 1EQUA 1Q1NA 4RPLA 4B4UA 1N2SA 1Y9EA 4L76A 1E3IA 2FZWA 2J5QA 5IZ4A 3G3EA 1FK8A 1C0LA 2W8ZA 1QLJA 4L4SA 3U5TA 3NRCA 4JBIA 1Z82A 1A71A 2DFVA 5KJCA 2I9PA 2DAPA 5KJEA 2HK9A 4PN3A 3L4BC 3W4JA 4JXKA 4LVUA 3D1LA 1ORRA 4Q9NA 5LC1A 1GZ4A 2ZIZA 3L0DA 1VKOA 2GD1O 1ARZA 2X4GA 3I9KA 1NNUA 3RFXA 3FHLA 1TVEA 3W4KA 3KYDA 3DMTA 4E5NA 1LSUA 3JQBA 1DJQA 4FD3A 1A9ZA 3VPFA 3NT4A 4XGNA 3GVPA 2BRUA 4CMAA 3TZ6A 1CYDA 3PI7A 1I30A 3JQEA 3NDRA 2BI8A 3RJ5A 3PYMA 2WD7B 3K6JA 5MGBA 1E3EA 5TT1A 3K96A 3H9UA 2NVUA 5F1KA 1QYWA 4W9NC 3H9EO 3QWAA 3E8XA 1Y8QB 3C1OA 1ZSVA 3W1VA 2P5YA 3KTDA 4YRBA 1ZNQO 2ZQZA 3KZVA 3ZNNA 4YQYA 1ADGA 1G0OA 3Q1LA 2X58A 3ZN2A 5A9SA 1GQ2A 1KETA 2I99A 1E92A 1Y81A 3I9JA 3CH6A 3T7EA 1ISFA 1FDUA 1GV0A 4YPOA 4W7IA 4FGWA 3FR8A 4AFNA 1WLYA 4XYLA 3C24A 4RJTA 1X14A 2A35A 4R4JA 2VZ0A 4FJ1A 3PP8A 2EXXA 4OO3A 2FRDA 2AXQA 4ND2A 2WTBA 3L9WA 3BTSA 4YJDA 5B37A 1XR3A 5FFFA 4HBGA 1QSGA 3CZMA 1W8DA 4YT2A 4OHUA 3U0BA 3U3XA 2RBEA 4GQAA 4J2HA 4ZGWA 3O9ZA 2NWQA 1H94A 2BHLA 4DYDA 5B4VA 4XJTA 4BV9A 3SEFA 3DMTC 3WGHA 4N5LA 2C2YA 1PZEA 2DBRA 1SO8A 4II2A 5LDGA 2PKQO 2QX7A 3BMNB 3EAGA 3N7UA 5DOZA 3WDSA 3CE6A 4ZRNA 4IZIA 4H7PA 4YVFA 4NJOA 5KOIA 4AJ4A 3W6ZA 4OXNA 2XXBA 5TT0A 3AJRA 3C1TA 2CDCA 4BNKA 4EJMA 2GYYA 2HMVA 3C7DB 3ZNOA 3N74A 1NQAO 3FBTA 1XWFA 1HDOA 4YAJA 3H5AA 1K6JA 4CM1A 4J4TA 5BNTA 3KETA 4E3ZA 3TRIA 1PJ3A 3C1AA 1U3WA 2O7SA 4TRNA 3WG9A 2YV2A 4L74A 3I9MA 4ZQFA 3OJOA 1FJHA 4II3A 3DAFA 4D45A 1DFIA 1E5LA 1GV1A 5DZSA 4EUHA 1ZSNA 5KNLA 1LXCA 3FF4A 5JAQA 4UVDA 4O59O 4XGIA 2BGLA 3E6AA 1R4NB 4BNIA 2J5KA 3TZQA 2VWGA 4J16A 1OZAA 2Y1EA 1JW9B 1T2DA 4J1QA 2ZTVA 4MIYA 5MDHA 4J2OA 4H15A 4DTIA 3MJSA 3ZU3A 2Q1WA 3ZHBA 4CM9D 3SC6A 4DRYA 4BOYA 1IPFA 2VRBA 3RJ9A 2E37A 1KY5A 3UW3A 3AWDA 3MOIA 4RVGA 2NUAA 5GZ1A 3G1TA 3S55A 3ZWVA 1DJNA 4CM6A 4MVJI 3F5SA 1F0YA 3NUGA 4I9UA 4EYEA 5JMPA 1E7SA 2Z95A 2NV6A 1EVIA 3IKVA 4U6QA 3PGJA 4O1MA 3O03A 4GSKA 4ZVVA 4E5MA 3DFUA 2ZCVA 1RYDA 1BVRA 3ONDA 3HG7A 4KUGA 1OC4A 1Y8RA 2TMGA 3FR7A 4ITUA 2I67A 1ISIA 1N8KA 5TF4A 1F06A 2VZ9A 5AYVA 4YJFB 1WDKA 3DBRB 2FSVA 3P2OA 3QLJA 3S8MA 4BNZA 5G0WA 2GPTA 4UVHA 4CLXA 4R01A 3ENNA 3M2PA 2EHDA 5A5EA 3ZWWA 3R6DA 1HZJA 4MVJM 3DBHB 1IZ9A 3VPGA 1D7OA 2AEJA 4IMRA 4D79A 3GNQA 1U3TA 4MIOA 4Z0PA 1SOWA 3GGPA 3RI3A 1K3TA 4NU6A 4IJWA 4OQZA 1EFKA 4WGGA 4DA9A 4Z3KA 3OJEA 3GEGA 2PV7A 1ZW1A 3DZGA 2BFPA 2NU9A 5IDQA 1GY8A 1W73A 2B35A 1IULA 3EVTA 4R68A 5EMHA 1BDBA 2W98A 2B83A 4OSPA 1OI7A 1HSOA 4QFDA 3I4CA 3ZHYA 1YGYA 3ZW9A 4DIOA 3VHRA 5IDWA 1GAEO 4Q3DA 4PZCA 1WDMA 3DZFA 3RC2A 3GRKA 3HJAA 4LCJA 1H9AA 1ISHA 3MJEA 4BNLA 3ROMA 1DC3A 3QVOA 4FB5A 3GF4A 1Y6JA 2OFPA 2VWHA 4WJZA 4ZA2A 1ENZA 1EVZA 1UAYA 1LQUA 1N1EA 5KWEA 3HQ4O 3H8VA 3RBVA 1H0KA 4PLWA 2YFQA 3ZCXA 1GPJA 2HRZA 2O50A 1TT5B 4CLRB 1QR6A 1A4IA 3FNFA 1I32A 3H5NA 5THKA 1MC4A 4AVYA 4AICA 1B3RA 3BMQA 1WZIA 5DP1A 4PG4A 4I8XA 1CRWG 4KDEA 4YR9A 1EE2A 1PJTA 2J3HA 3HZZA 2WEKA 4J1TA 4D44A 1E3LA 1ZVMA 2FR0A 3PLNA 2PZKA 1XEAA 5L9AA 3ITDA 2AW5A 3UFXA 2IZZA 2CF6A 1LNQA 1MG5A 3WTBA 5L40A 5FF9A 4P8RA 1PJBA 5A04A 2JD2A 1OBFO 4WECA 2P9CA 3VZQA 3HE3A 4GMFA 1JWAB 1T2CA 1PJSA 4RV9A 2WD8A 2FPPA 1N7HA 2GRAA 1I01A 4GX2A 2HK7A 4LGVA 3ZHXA 3D4OA 3P2YA 4KMSA 1ZKMA 3K8ZA 1P1KA 1IE3A 2P68A 3V1TC 2BGKA 3UXYA 4B3HA 4DMMA 1U2DA 3MWDB 1P1IA 5JPIA 4RF5A 3WGZA 3OQBA 5A5FA 2Q4BA 4NBRA 1ISJA 4OQYA 3W6UA 1UXJA 4R1SA 3AM4A 3PWZA 2Z1MA 4E2XA 3ZWXA 4XZ3A 3TSCA 3BA1A 4Q39A 2VNAA 4BNFA 3JQAA 3OEYA 4R41A 4BGIA 1LDGA 3NJ8A 3BXXA 1HL3A 1AHHA 2AE1A 4JX8A 5B4TA 5EINA 1KIFA 3KLMX 4YBZA 2B69A 4IDBA 4RF4A 2IODA 1ONPA 4J9UE 1ZK4A 4XGKA 4NHEA 4IJUA 3WWYA 4AJ1A 4E5KA 4QSMA 4IPTA 3TNLA 1IUKA 3K2BA 3OP4A 3PHGA 4GI2A 2E48A 4NBUA 1I3KA 1A7AA 2PH3A 3IP3A 5AXAA 3VAZA 3ZWYA 4CV3A 3ZU5A 4YA6A 3UN1A 2VZ8A 2GN6A 1LRKA 4P4LA 2PD6A 2IEBA 4BNWA 1YBVA 3NTRA 2OP0A 2Y67A 1NQTA 1NHWA 1JAXA 4F6CA 1DC6A 1P31A 2X5JO 2BMAA 4B8WA 1PTJA 2HK8A 5CDGA 3P19A 4OH1A 2VNSA 1GL3A 1R0SA 3EVNA 3M1LA 1EEHA 3WICA 4YQZA 4BIIA 3DEYX 2O23A 3WMXA 3ZV3A 1M76A 2C5AA 3E9QA 3GRPA 4YAKA 1ISGA 2W2LA 1RPNA 3VKVA 1PL6A 1H6BA 3ANMA 2V65A 2D3TA 3BTUA 5J23A 2GN8A 1C14A 3GEDA 1UDCA 1KVUA 1ZK1A 3GT0A 4PCVA 1T2FA 2AQHA 2NADA 4K28A 1DSSG 1LA2A 3VOSA 4E5PA 1LLUA 5JXWA 1A72A 1BW9A 3A28A 4PLHA 1JKIA 1VJ1A 2Q1UA 2FWMX 1GQQA 3DFZA 2CVQA 4LRTB 5JC1A 3G0OA 1E3WB 4ND3A 4HP8A 4WEQA 4ALLA 3FCOA 5U9CA 2ZJ0A 3FN4A 1Y9AA 1I2CA 3ANNA 1XU7A 1RJWA 2WYWA 1ULSA 3JD4A 3AI3A 4KOAA 4CODB 4A26A 1U4SA 2BFAA 3SX2A 1IYZA 1ZEMA 1MFPA 3LT4A 4NNJA 4R9RA 2OO5A 3JQDA 1T4BA 3JQAD 4H16A 4WNCA 3D5QA 2JL1A 5ITVA 4UUPA 3SBOA 4BKPA 5KIAA 3PHIA 1P1RA 3WJ7A 2PWZA 3I5MA 1HYGA 4MIEA 5TNXA 1Q0LA 2JFFA 2W4QA 2DUWA 1EUZA 3EYWA 1GUYA 4DPMA 5JMWA 2ZJ1A 1UZLA 5HWSA 4J7XA 1P3DA 5A1TA 4XQ9A 2CFCA 4A03A 4D0SA 2JD0A 4NJMA 4BV8A 1UUFA 2ZK7A 1F14A 2C20A 2X7HA 4CMEC 5THQA 5C37A 3I9NA 5BSFA 5C5IA 1SC6A 1PX0A 4PFJA 3KRTA 3PFFA 3VPHA 1VRWA 3OICA 5B1YA 3ST7A 1XGKA 4WCFC 1NPDA 1GQYA 4L9RA 1BXZA 4UREA 1R16A 3DC2A 1OOEA 1HKUA 2QZ9A 5G0SA 4ROSA 2NACA 3PJFA 2EG9A 2Y05A 1D1TA 5FYDA 4F45A 1TEHA 3TOZA 3WGYA 5L3ZA 2Y66A 2Y1CA 3M6IA 2DTEA 2W2LD 2ZCUA 3RUAA 3DHYA 2X5KO 4DBVO 3OEWA 1XQ1A 2I5PO 1YDEA 2XXJA 4RVDA 2V6FA 1BSVA 4OIMA 1QLHA 2CVZA 2IYPA 4RVHA 2O4CA 5TLSA 3DMYA 1QRRA 3OHSX 4W99A 4D7AA 1VI2A 3WX0A 5CPFA 1YXMA 3KYCB 3NKLA 3MJCA 4N7RA 3EC7A 3CZRA 5COQA 4E33A 1DIGA 3HHPA 4WLFA 3DHEA 3WQRA 2IZ1A 4G81A 4UUOA 4WKGA 1WW8A 1V3VA 1Q7GA 1R66A 5U1PA 1QYVA 2BLLA 1JKFA 1V3TA 3ON5A 3LU1A 4M86A 4Y9DA 2O4UX 2AG5A 1PJCA 3WSWA 3C85A 1L1FA 5C7LO 1BDMA 2GR9A 4KUEA 4U0KA 4BNMA 1U1IA 3D7LA 3EZLA 5KCZA 4ZQHA 2VRCA 5TC4A 1JA9A 4GGPA 1UXKA 3AOEA 4NFYA 4TRJA 4BO1A 3K9QO 1GU7A 3STHA 4DUPA 4FGSA 5ITWA 4J1NA 4E2ZA 4R3WA 4K26A 1U9JA 2VWPA 4D42A 1NPTO 5JBIA 1XYGA 1I24A 3BMOA 5JY1A 4JJFA 4PLPA 2DBZA 4I9NA 2PH5A 3DAPA 3AU8A 1DIBA 3HDQA 5DCUA 3AK4A 4HADA 4MJLA 1NXQA 4QQRA 1PL8A 2X0JA 3AM3A 3GNSA 2IE0A 1PQUA 2C07A 2NU7A 2AQKA 4IM7A 1GCUA 5DNAA 2QRKA 5TQVA 3K92A 1F8FA 2VN8A 1GPDG 2X23A 3DAGA 3WMWA 4FQ8A 1C0IA 5DOVA 6LDHA 3JD3A 4UUMA 3HSKA 1SCUA 1XDWA 2ZB3A 4M49A 4FC6A 5ER6A 1OC2A 2DBQA 3HFGA 4YACA 4AJOA 3JV7A 5JW6A 5JDCC 3UGKA 2PZMA 1T24A 1PU2A 2HMTA 2Y68A 4PG7A 4Y6SA 4ZJUA 1QYDA 3ZV6A 1YJQA 5CDYA 3GUCA 2QG4A 1SAYA 2AEFA 3UKOA 1MUUA 3RU9A 2I76A 3ZWCA 4CMHA 2X6TA 1R37A 2EGGA 4BVAA 3ZWOA 3UCEA 2Y1FA 1NVTA 1LDNA 1RKXA 3PQEA 4HY3A 2Y0DA 3D3EA 2EGHA 2PGDA 2ZB7A 3WGOA 1U28A 1GUZA 5AXDA 1ISMA 2PKQP 3D4PA 4OOFA 3ENKA 3H65A 1NR7A 4TSKA 5I7VA 3O8QA 4JROA 2UAGA 1VL0A 3A4VA 3OSUA 1E1NA 2QYSA 3B6ZA 3MTGA 4FN4A 1UP6A 5KKAA 1CF2O 2VRCD 2UV8A 4YJGB 2O48X 4YTEA 5IZCA 3BYZA 1UXIA 1TI7A 3GH3A 4B7UA 1IL0A 4O6VA 4EEXA 5L4NA 3PTZA 5T67A 4B4VA 3I83A 4NBTA 1RYEA 2Q4EA 3GDGA 4TZTA 5JFOA 3Q11A 4MVJD 4NFHA 5DP2A 4E2YA 4QFCA 4J90A 4GKVA 3ZWAA 5B4UA 1TA4A 3QQPA 4WASA 1LI4A 2PK3A 3IQDB 3NTOA 2IEDA 2PKRA 4I5FA 3NAQA 2YDYA 4M55A 3L07A 3RFTA 5CFZA 3WGQA 2CY0A 3VDRA 1YH3A 2DPGA 3VDQA 4Z9XA 3U4HA 4FPXA 3VTFA 5DULA 1AE1A 3SLKA 3LF1A 4KUHA 3QVWA 2A4KA 4UAGA 2O2SA 3KEQA 4TROA 4H3VA 4F46A 1C3VA 2UYYA 3ZU4A 1CIVA 3Q0EA 4IGEA 4XCVA 5JO0A 5LDHA 2J3JA 1MX3A 4IIVA 1TLTA 1VKNA 1DPGA 1HDGO 4CV0A 3WYBA 4MP6A 4DREA 4YAIA 1UAGA 2AEMA 2B4RO 4WLUA 1VLLA 3OMLA 1LEHA 1PQPA 3ORFA 1JDJA 1DB3A 4BKQA 1HETA 3L9XA 4XIYA 3WBBA 2Y99A 3EDMA 3PWKA 5DT9A 4Z9FA 5C7IO 3WNQA 2AE2A 2Q2VA 1NQOA 2WD7A 2FR1A 1EQ2A 3IJRA 2IDZA 1QV6A 4Z6KA 3WBFA 5BR7A 3E03A 5HS4A 1Z75A 4IGFA 4W6ZA 2NSDA 1DHTA 4NU5A 4JJIA 2BFOA 1Y8QA 1YL5A 1GDHA 1Q2XA 1AXGA 1NVMB 4PLCA 4CM9A 4MOWA 3H2ZA 3WYCA 4RLHA 4LCEA 1RM3A 4J6FA 1JAYA 2YZ7A 3AM5A 3GFBA 1BXGB 7MDHA 3GC6A 1HZZA 1T26A 2O3QA 1P0CA 3GQVA 3ZWNA 1YQDA 4JLWA 3U09A 3RBXA 3DQPA 3KO8A 3BIOA 1VPDA 4U7WA 2E82A 2JFGA 4TRRA 2FZEA 4ND5A 3C3XA 3IIEA 2VHZA 4HUJA 1K6XA 3TDKA 5TJHA 1ZO8A 3GHYA 1P44A 4EITA 2O3UA 5G4KB 2FPGA 3GHHA 1ENOA 1GZ6A 5ADHA 4MO2A 1LBEA 3UCXA 4PLTA 1BWSA 3JQ8B 4K1LA 2O3JA 5CDUA 4DIFA 4I08A 3UOGA 2HMUA 5I8WA 1R12A 4Z9YA 1QKIA 4NK4A 1NAIA 3JQBC 2FSSA 1C1DB 1SEPA 2CDAA 3ZV5A 2FHSA 3BMNA 1HE3A 1E3JA 3VH1A 1NASA 2SCUA 4OXYA 4PVCA 5G0TA 3CPSA 4YWJA 3DZHA 2P9EA 3FNHA 1M6HA 1B8UA 1Z7BA 1J6UA 2R00A 1HDYA 4XR9A 5H82A 3OETA 4Z3DA 4MVJP 1NQ5A 3WB9A 3TJRA 5EIOA 1QORA 2PGLA 3RKRA 2X0RA 3PIDA 1WPQA 2PR2A 3R3JA 5DF1A 4OSOA 1PJ4A 4PLZA 1E7MA 1GD1O 3IUSA 3A06A 3JYPA 4JP3A 4RCVA 4F3YA 5CAEA 3PHLA 5CP8A 1P33A 5CHEA 1NYTA 3V2GA 5BQFA 1WWKA 3GVHA 3WQQA 3H9JA 1YWGO 3M1AA 1R4NA 3AUTA 4Y6PA 1PJ2A 3PLRA 1DOHA 1SB8A 2VYVA 4EDFA 1BXKA 3F6YA 3GK3A 4YRAA 3QVSA 3IDSA 4ALNA 4DQUA 3CEAA 4W4TA 2E4AA 4QEDA 1UJMA 1V35A 1XA0A 3V2HA 1ONNA 1JTVA 4J3FA 5KTKA 4YXFA 4HFMA 3EMKA 4IDCA 4BUCA 5I7EA 2I3GA 5L95A 3ZV4A 2X8LA 1A9YA 1U5AA 2PD4A 2YYYA 2B5WA 5ENVA 4AJNA 2V6BA 4J7UA 4BO3A 3BHMA 1K2WA 3EY4A 4BGVA 5ILOA 4IQGA 4M87A 4TKMA 2Y1DA 3PWSA 2YQ5A 4RDHA 1XQ6A 5A02A 2BGMA 4GLOA 1I2ZA 3NJ4A 2H9IA 4Q3CA 5F1PA 1CEQA 2OZPA 4IY1A 3PHJA 2RHCA 3OF2A 1R15A 2GF2A 3Q3CA 1WMBA 3EGOA 4FFLA 1C0KA 4L73A 4E21A 1MLDA 4YJFA 3JD2A 4MKRA 4Q3EA 4B8ZA 3DBRA 3QW2A 3B1KA 5I9MA 4BQRA 1DFHA 2EW8A 4CMKA 1B8VA 2GGSA 4DMLA 2WMDA 3U62A 4UEJA 3KXDA 3PZRA 3AOGA 4XKJA 3OJLA 4BO5A 1NFRA 3IUPA 3GAFA 2BELA 4IS2A 4R16A 1CERA 3RC7A 2OGUA 3EUWA 3DBHA 3GFGA 3MOGA 1R4MB 3WGGA 5FI5A 1UXHA 2ZKLA 3GVIA 4ONEA 4WUVA 1NAHA 3OECA 4CMIB 5ES3A 2A9FA 1I8TA 2YJZA 3SC4A 2P2SA 2CMDA 4N5NA 1PGNA 2PY6A 3OM9A 3PIIA 3ASVA 1ADFA 1J0XO 3PYLA 4X54A 4WPGA 4ESOA 3GMSA 2O2YA 4JP2A 1EBFA 1E6WA 4RZHA 1BRMA 4MKXA 4M89A 3AI1A 3I6QA 5F1OA 4RVFA 2Q1SA 4U6SA 2VYVD 5IDYA 3RWBA 5IXSA 2J8ZA 4QX6A 4IJVA 1D8AA 2DQ4A 1CDOA 5IJZA 1DRWA 1YRLA 3I9LA 3FNGA 4CQLB 2I3AA 2Y0EA 2BFMA 5JYDA 1PS9A 3INGA 3E5RA 3PDJA 3DDNA 3NYWA 3INTA 4QO7A 2PD3A 5EL0A 2P4QA 2RH4A 3GVXA 2A94A 3F4BA 1ZJZA 3BMCB 1F17A 2BF7A 1Q7CA 3FWNA 1FDTA 1FDWA 5TX7A 3GA0A 1TT5A 2HCTA 2UUPA 4CLRA 4DLLA 3COSA 3WGIA 1U3VA 1JKJA 5GMOA 3QWIA 4IQ0A 1I2BA 3RUDA 2CSUA 2DT5A 1W6UA 4UULA 4HFRA 5EQDA 2Q2QA 1U8XX 1ZXBA 3OFSA 3WFIA 5JAIA 2B4QA 3ZHZA 1UP7A 5T5QA 3VTZA 3CTMA 5AVOA 1Z7EA 4EEZA 1YO6A 4WNIA 4MP3A 2WWRA 3LVFO 4HXYA 4WLNA 4J1SA 4AJEA 3SJ7A 2ILTA 3RCBA 1NWHA 3AUAA 4TVOA 1DLJA 3MWEB 4BNNA 2VTEA 1N5DA 2QRJA 3U4DA 1YOVA 1YOVB 3I3OA 2WYUA 4E2WA 1P1JA 3FRJA 4NG5A 3RKUA 2IZ0A 4NZ9A 2EEZA 1U7HA 1ADCA 4YYZA 3AY7A 4MKZA 4YCAA 3O38A 1H5QA 3AY6A 2G82A 4KDFA 1O6ZA 2WJPA 1QXSA 2HLPA 2QQ5A 5JS6A 1MV8A 4E12A 3GY0A 1LSOA 3S2EA 1U3UA 1B15A 4OMUA 3DZJA 3KBOA 2R6JA 4FBGA 4GLLA 1NBOA 4UVIA 3PXXA 2HAEA 2UDPA 4LVCA 3JD0A 4QTZA 4FIZA 3KSZO 2O3RA 2H1SA 3GLQA 1S7CA 4PZDA 2VHXA 4CM3A 2D8AA 1LSSA 5L7YA 2QRLA 5L45A 1ENYA 4WOJA 3VPSA 4FOOA 4W82A 3RASA 5KVCA 2JD1A 3GVCA 1KS9A 1K5HA 4S1VA 2D5CA 3NDJA 1DDOA 3DOCA 2EKLA 2GERA 5JE8A 4B7XA 1HDZA 2QZZA 3ADPA 2CUKA 1NX6A 4P4GA 1DXYA 1B14A 1VE9A 3ICCA 2J5RA 4D46A 4E32A 4CV2A 4WCDA 3QWBA 4OOEA 3G49A 1PGPA 3NDIA 3KSUA 2C82A 3LC1O 3GUYA 4JCOA 1RM5A 3DHNA 5LCXA 4R5MA 2POQX 2D5AA 2G0TA 1E7QA 3HDJA 8ADHA 3ZNQA 1O5IA 5KVQA 2J3KA 1OMOA 1PZFA 1YS4A 1ZSYA 2OBYA 3JYLA 5B12A 3JQ7A 3JQ7B 4MVJG 4HV4A 4BO4A 1Q0HA 2JCYA 1A5ZA 3B1JA 3R1IA 1W4ZA 3AUSA 3DO5A 3ETDA 3V1YA 3WR5A 4O0LA 2DTXA 1E6EA 3UUWA 4RL6A 4A2CA 3FWZA 1BG6A 4WLOA 1KY4A 4G65A 1SEVA 3GN1A 4MINA 3ETEA 3RUCA 1E3WA 1F12A 2ZYAA 3FD8A 3H7AA 3WSVA 1ZFNA 1E7RA 1BTOA 2B0JA 3PJGA 4WCFB 5AOVA 5AXCA 4R69A 3D5TA 1RM0A 4B79A 3MZ0A 3TL3A 4CJXA 1DIHA 2YQ4A 3OQ6A 1VJ0A 1HLPA 1LSJA 4LSWA 1MC5A 4WK6A 1C0PA 3ZNPA 1U8FO 4ZQBA 4JNKA 4AJIA 5BNIA 2J3IA 5KKCA 4ALKA 4CM8B 3FNEA 5HS6A 4F6LA 2ZATA 4AJJA 1PZGA 4KZPA 3N58A 4HWKA 1IHYA 3ZI0A 2ZB4A 3ZW8A 3FTNA 3PGXA 5IF3A 4GMGA 4ZU3A 5JDIA 1TT7A 2V6MA 3X2EA 1X13A 4BO6A 3CINA 4IDEA 1VC2A 2I65A 4TVBA 5C3MA 3TL2A 2CVOA 4UEKA 1H6CA 1KBZA 4HFJA 4IDAA 4BGEA 1X1EA 2QIOA 4IBOA 3RUIA 3IL2A 1UZMA 4CM4B 3W8EA 4RPJA 1AHIA 1KEUA 1B8PA 2WSBA 3W4IA 1O9BA 4GX0A 4FS3A 5L7WA 4CL3A 5CG2A 4BKUA 5JLAA 1R0KA 3LZ6A 4BL5A 4L4RA 4CUKA 2DVMA 3PQFA 3V5NA 2EP5A 3L6EA 2A92A 4YJHB 1ZXLA 4NI5A 2NU8A 1ZJYA 3ROPA 2G1UA 2D2IA 5EERA 1Q7BA 1WP4A 1F8GA 2EF1A 2V7PA 3U4CA 4K6FA 2YW9A 2O3TA 2JJYA 1E3SA 4G5HA 3E18A 1KVRA 2Q2WA 3AUUA 3CKYA 4HFNA 4GWKA 5DCYA 3QIVA 2D59A 4INAA 3QVTA 1AUPA 2QHXA 3DOJA 2VOEA 4LK3A 4R1NA 4BO7A 3WTCA 2X86A 2YHIB 5U4QA 2XF8A 3RUEA 2YUTA 4N54A 4B4OA 4ZN6A 5L4SA 4RPGA 1KVTA 4DIBA 4CMBA 2X9NA 1JU9A 1EK6A 3KYCA 5HRUA 1SBYA 1N92A 1EMDA 3E1KA 3QJ5A 4XWYA 4O63O 3KEOA 3LT1A 5JAMA 3KUXA 1NPYA 2D1YA 2OMEA 4U0JA 2PZJA 3JQ6A 4DC1A 3W8FA 4CLOB 4XDYA 3DTTA 1Z6ZA 3NT2A 4YEDA 1D4FA 3CSDA 3DZKA 3I6IA 1DC5A 3IS3A 1XHLA 1X1TA 2YDXA 1ML3A 4PLVA 4FDAA 2DC1A 5G0VA 4R1TA 3Q2KA 1NM5A 3LT2A 1PS8A 1V3UA 4GGOA 1J4AA 3WLFA 1PGJA 4GX5A 4MVJA 3OA2A 4FJ2A 1IPEA 4MPDA 2ZTMA 4PLFA 3NGLA 5KVSA 4NH4A 1GEEA 4XJSA 3KSDO 4J0EA 3ADOA 4GX1A 2EIHA 3U49A 3PQDA 1SOVA 3GN2A 2NNLD 4YAGA 3IAHA 5TRTA 4PLGA 2YY7A 1YDWA 1E1KA 2IYOA 2AG8A 2F1KA 1AN9A 5KJ6A 4D43A 5CG1A 1MXFA 4JBHA 3RUHA 4ALIA 1J49A 2C5EA 4NQZA 4EW6A 5G2OA 1VSUA 1KC1A 4XYEA 2IXBA 5IFLA 2FMUA 3OA0A 4XB2A 1ZBQA 3ANLA 1A27A 4WOKA 4NMHA 2XPCA 3WNVA 3VZSA 1J5PA 2OBNA 4BHTA 4YB8A 1H6AA 1XKQA 1YL7A 1LDEA 2C7GA 4JGBA 1QYXA 3W8DA 3JYQA 3TFOA 3IKTA 4QECA 4IQ8A 2ZTUA 4BO9A 4RO0A 4Y8VA 4CPDA 2BI7A 3F1LA 3VZRA 3SJUA 1ZK0A 1T2EA 3JQGA 1M6WA 3DBLB 3JQGB 1EE9A 3D0OA 1XELA 2ZYGA 3LT0A 3F1KA 4ALMA 3T4EA 1B7GO 1G0NA 1NWCA 1GUFA 1GEGA 1SNYA 1YB4A 2Y0CA 4D3SA 4E4YA 9LDTA 3HNPA 5COBA 5IDXA 4BO8A 4CQMB 3AOEC 3CMMA 1A7KA 1X0VA 3PHHA 1HDXA 1PR3A 5BSHA 4J91A 3MCVA 1HT0A 1H2HA 3AFNA 5T8KA 1H93A 3GEMA 1UXGA 1HRDA 1YB5A 2WE7A 3H9QA 3IJPA 1V0JA 2NU6A 5JCJD 2GZ3A 5T64A 1OAAA 1HE4A 4BNTA 1GADO 1I36A 2NM0A 1N9GB 3G17A 3E82A 3ZGYA 1LDMA 4QT0A 2EERA 2EJVA 4OYRA 1PIWA 4HNGA 4YJGA 5GY7A 4G2NA 1IOLA 1KEVA 3F4LA 4B3IA 4KTTE 1H9BA 4NBWA 4IXWA 3ZH2A 1P45A 3QA9A 4OXKA 2JHGA 1EUDA 1NFFA 3JQ9A 4ZD6A 5TIIA 3S1LA 3I1JA 2H63A 2DUUA 1JLLA 3D3WB 4YT5A 5DN9A 1DEHA 4IZHA 2C59A 3I4FA 4W9NA 3GZNB 3OJ0A 4XYGA 3GMDA 3KLPX 2VQ3A 4JIGA 4YT8A 3UAGA 2OOSA 1JVBA 1Q0QA 1NHGA 4LN1A 4UUNA 3IOYA 1UR5A 5IAAA 1X15A 3UVEA 3GOHA 1XIVA 2R2GA 4BGUA 1NTOA 2EW2A 1Y1PA 1O8CA 4CUZA 2VWQA 4R1UA 4ZICA 3GG9A 5CDSA 1Y7TA 2TMDA 3WOHA 1T1RA 5JYEA 2PTGA 3NV9A 5IN4A 1PSDA 5TS3A 3QSGA 1MP0A 2GCGA 3K73O 5A9TA 4J0FA 3JD1A 4L0QA 5T8KC 1EDOA 1K89A 4CL8A 4YDRA 2P4HX 1S6YA 3L6OO 3ROKA 2P9GA 4ZRMA 3TZKA 3UHAA 3MJ4A 3RC1A 4I5DA 1MB4A 3TF5A 2BH9A 4NR0A 2VUUA 1FF9A 1O94A 1YB1A 5A03A 3KYDB 5IZCC 1A4UA 1DLIA 4TWRA 4CQMD 3CXRA 4JK3A 3F9IA 2EKPA 4J7CA 1YE3A 4OKNA 5DBIA 4BS9A 4IIUA 1X7GA 1EK5A 1T2AA 1H6DA 4IDDA 2VUSA 3OBBA 3JQ9C 3MJVA 3WXBA 3KV3O 1BXGA 1E0DA 3VH2A 5CEEA 4C7KA 2Y1GA 3CUKA 2EWMA 4HX5A 4RVUA 4JJGA 2NVUB 2H5LA 3DL2A 1UP4A 5L53A 2P91A 4CMJA 1MXHA 3A9WA 1U7TA 3TFQA 4XRGA 3HN7A 4P4NA 4J43A 1YJ8A 2Y1OA 2GN9A 5L4LA 5HA5A 1KC3A 5G4KA 4XD2A 2LDXA 3BTVA 5A9SB 2JHFA 4PG5A 2X22A 4M1QA 4BMSA 2Q1TA 3JQ8A 4Y98A 6ADHA 4DPLA 4NK5A 3U4IA 4CV1A 2FY8A 4EJ6A 1HDCA 1SMKA 1KEWA 4BNJA 3DR3A 3WYEA 1AGNA 1C1DA 4E6PA 4FFOA 2EP7A 3AW9A 1GTMA 4UVEA 4E0BA 3HUDA 4MVJF 1KERA 1G6KA 1VL8A 3GG2A 3LQFA 1ZH8A 3MEQA 4OJNA 4BMNA 4QXMA 2YV3A 4NDNE 4CR7A 4CMCA 5JSFA 5A3VA 1CWUA 3PJDA 3FTPA 3QRWA 1M2WA 1VL6A 3JTMA 2J6IA 3DONA 3NGXA 5AXBA 4E31A 1VSVA 4RPHA 4QO8A 4D3DA 5I9NA 2ZYDA 3EZYA 1WAMA 1ID1A 1PR9A 3BHIA 3NX4A 4K9DA 4XRRA 1PJLA 3HN2A 4XR4A 3PDUA 4DGSA 1R0LA 3OIGA 3TWOA 3DB2A 4KWHA 3C8MA 3JYOA 4MDHA 3VVBA 5JC8A 1FXSA 1ZMTA 2Y93A 4TKLA 2PLAA 1LU9A 3H4VA 3RBZA 3ICPA 2W2KA 3WS7A 2W2KB 2D0IA 4B4WA 5BT9A 1GYPA 4EGFA 3F3SA 1LRJA 3AU9A 4M8SA 4J49A 4FFNA 1DAOA 1Y5RA 1B2LA 1T1SA 3BZUA 3H5RA 4D41A 4J4BA 3K30A 3LSYA 5BNFA 3S2GA 2B36A 2P5UA 1E6UA 5TGDA 5EQFA 4WEOA 3JCZA 2Z5LA 4LMRA 4A0SA 2ET6A 4ND4A 5KJFA 4CLDA 1V6AA 5EPOA 2CDBA 4B7CA 3HFSA 3F5QA 1MGOA 2GUGA 3CIFA 4Q3AA 4WLVA 5F21A 1ZMOA 4A73A 1N7GA 1Z73A 3H6KA 4DLBA 2GASA 2GDZA 4RF2A 1LC3A 1JVSA 2VT2A 3Q2IA 5HTOA 1LX6A 3OJFA 4AJPA 2X1HA 1D3AA 5H83A 1B0AA 5FI3A 4EUEA 1BVUA 1DIAA 4PLYA 4BNYA 2R00C 3I52A 5KJ1A 5F3RA 1P74A 1PWZA 5G4LA 1M66A 2EJWA 2O3SA 3OIFA 3LLSA 4JN6B 3RROA 5JAZA 1P1HA 2HSDA 2X5OA 4WLEA 3G79A 4IUYA 4OKIA 1ENPA 5F5NA 4UEOA 2YHUA 4KQWA 2VCYA 4CUJA 2DFDA 2NQTA 1V8BA 3ZWMA 1KVSA 1U4OA 4DYVA 1O0SA 4C7JA 4FFRA 4BNXA 3QWFA 4XYBA 4BNHA 2DPHA 3R3SA
chains in the Genus database with same CATH superfamily
4HI0E 1HQYE 3VUFA 4CDGA 5J5VA 1PZNA 5DYTA 1UPAA 1N2BA 5SY4A 1JHPA 1L7DA 1PG5A 3K94A 3PXAA 3QVJA 3UBMA 9LDBA 2JJ2D 1EJ2A 4RNCA 5ICSA 1FA9A 1VSTA 5L51A 1JA0A 2NQ8A 4OLFA 1XRJA 4LFAB 2DHCA 4G41A 4ACBA 1M1NB 5JNTA 1PRYA 2H59A 4A0FA 4BQPA 1MIOA 4I50A 5A2GA 4JUDX 1JBKA 1NR1A 3RDPA 2I6SA 5FO1A 5KYKA 2B37A 1JIQA 1BHSA 4FXOA 1PD0A 1XTKA 4YAFA 3UV6A 1CVLA 1E66A 4J3JA 4EZBA 1FP1D 2JCGA 2PGIA 1MFZA 1FOEB 3NETA 1YL6A 2SKCA 1EGVB 4EJ0A 3QOYA 1WXGA 1MC8A 3DZIA 3N2KA 5TQ0B 4DNXA 1KDOA 1YQXA 1DRVA 2J7PA 3IP7A 3PNQA 3TRKA 2EZ9A 2JAQA 4TUYF 1S0UA 3OE7A 4BB0A 3BEOA 1TO2E 3TN7A 2XTZA 1CUDA 2C2XA 4K9SA 4UBLA 2XW6A 2OP1A 1AMOA 4Y0VA 1ULUA 3N2GA 1HF3A 3T06B 2XT6A 3ITKA 1AJEA 3MQ2A 1M0TA 1DDIA 1BXRA 3D4NA 4RTSA 2Z5GA 2B21A 4C3OB 4HQNA 3FPLA 4MAFA 4GWGA 1A5TA 5JD3A 3VMFA 3HTXA 1SU6A 2H4XA 2C3PA 3GJ8A 4C89A 4E46A 2IEAA 4XQGA 4DPKA 3AB3A 1HH4A 4P34A 1ZX1A 5A4JA 3THXB 4L5AA 1DWUA 3HWRA 5BQ5A 3HB1A 4OIFA 3IAAA 4ASUA 2JRLA 3TOCA 1C2YA 5EKTA 5FOSA 3UICA 1RRKA 1XEXA 3JQCA 3RB8A 3N2YA 2R8RA 4ENUA 3A3OA 2ZIVB 4RXTA 3RO7A 2VRWA 5E7JA 1P19A 2QE7A 3QP9A 3ONEA 4WZAE 1X1SA 1SH7A 2WJ3A 3VKFA 1WZEA 4KXUA 4JLBA 5BOSB 5IBQA 1GARA 2B7CA 2WLTA 4Z0TA 4B81A 1EDZA 1KQ3A 1YZ3A 4TQGA 1IHXA 1VGQA 4AP6A 3C6MA 4GE3A 2QE6A 3CRRA 1LVUA 2CE7A 4HAOA 2AMFA 1ECLA 2C2GA 1W0CA 2DZDA 4BIMA 4EUFA 3KHUA 5KAMA 4IH1A 5CX1A 3JQFC 5ANRB 5C52B 5DBFA 3A37A 1FUYB 4DCOA 1W30A 3BE5A 2OB1A 1DXHA 1NJSA 4HWTA 2W6CX 3MJHA 1XP8A 2QWXA 4EABA 4RORA 1Z17A 2EIXA 4BJ3A 2OCDA 2IA5A 4E5UA 1PZXA 3KFXA 4DDHA 3EZ7A 5BRNA 5AI4A 4XDHA 4ENQA 1NW5A 2Q8NA 4H77A 4RGBA 5EOVA 3L7KA 4CKXA 1UAAA 4MRRA 3UFXB 3G7SA 2NLOA 2I66A 3AVQA 3N0XA 3R0ZA 1G8GA 3HA5A 4AL4A 5TJ9A 3PFHA 3PRYA 1HSZA 2R79A 4ADSG 4EYSA 4EF6A 3ZDDA 3VNUA 4RY2A 5D00A 1M6VA 1CZHA 3F96A 5JCZA 3FAZA 3ICOA 4L3VA 4MV6A 4NARA 5I4IA 3BCSA 3PR3A 2F43B 2D74A 3B1FA 1HL7A 5JWOA 2PFSA 3NTQA 4LBYA 4LMBA 1H0RA 4JWTA 1VJTA 4RTRA 4MQMA 3G8DA 4EFLA 2I7TA 2PVPA 3RE1A 1RMQA 3M82A 3OT5A 3KJGA 1QHSA 5ER9A 1NC3A 2CZCA 4HGRA 1P81A 3RVMA 4MQEA 3TQFA 1V25A 4X85A 2NPFA 3AEQA 1UDBA 1DAGA 3R20A 2Z5FA 4HF7A 2C54A 5DHSA 1KO5A 5I7FA 4CM5A 4DG9A 1NVGA 2IYEA 4D4JA 4BLWA 4EQ6B 4YMUA 1P5JA 5IH7A 3N59A 5F33A 5FUQA 2P7IA 2I9KA 5HX7A 3U3DA 3REQB 1J24A 3IHLA 2I22A 1HURA 3DYBA 3EIQA 4FW8A 4MKGA 1H3EA 3S0JA 4J9VA 1YR3A 1KWGA 1ORVA 2QB5A 5FQOA 2N0SA 4BJ1A 3CCBA 1XLUA 2X2FA 4YRMA 1RSZA 4XGRA 4RELA 6AT1A 4GIBA 3O26A 1Q22A 2I1QA 4HQRA 4ZQEA 2PU7A 2VOJA 2ZYSA 2OGTA 4MA4A 3KQUA 1PDOA 4OUDB 2ZAIA 1JHQA 5UKDA 3UMJA 5HM8A 3ASUA 5J1TB 3R44A 4E5YA 1W7AA 2DERA 2REQB 4FNAA 8LDHA 1WO8A 2J32A 3OF3A 2RK4A 1M9NA 5IC4A 5GOZA 1OTHA 2MYPA 2Q5JA 3F46A 4JKIA 1W0JA 5A05A 1QYIA 5T57A 3VO2A 5CEFA 2CF5A 3MXOA 1LTKA 1DRJA 2QL5A 3AG6A 3H3JA 4LISA 1WOYA 4B3RB 1I3LA 4OGWA 1IVSA 1IAQA 1H5UA 1XZKA 3DQQA 4RZSA 3PBKA 4FFPA 2X9VA 1K7SN 3OY7A 4RZIA 4PBSA 3GU3A 3V8BA 2J3LA 1T4GA 4M9QA 3T6KA 2R1VB 4U2DA 1KJQA 2WNHA 4HXGA 4MCHA 3ANSA 4HH3C 4JBXA 2FR8A 3V7NA 1QP7A 2H7XA 3HO6A 3ABIA 1ZLYA 4N7JA 1GYQA 1JSXA 4HH1A 1R00A 1JR2A 3QMMA 3I0NA 4DWVA 1WZUA 3B89A 2D4AA 4BB5A 3VSBA 4OJKA 4ZKDA 3K9HA 5F5LA 5TF0A 1QS0B 3DXFA 3P9YA 1P9LA 1YIAA 4FGJA 1MA0A 1VYVA 1IN6A 4CL0A 3FZQA 4X66B 1PJZA 1U0BB 5EIAA 3RARA 5JFGA 2HQ1A 2C7QA 3OKFA 1V8DA 3FNBA 2H5JA 4LRSB 4EHLA 2FEMA 2OGSA 2HUNA 3Q9UA 7ADHA 4H7DA 4X1KB 3E70C 2WA1A 3O3MB 1TZMA 3P5SA 4M6WA 1QRDA 4PYKA 3OQMA 3HCFA 1TYDE 1WCYA 2G9NA 1NYLA 3AEXA 4IKOA 3ANYB 3K70B 1PJRA 4RZUA 4QOGA 3ABQB 2XTMA 2HGSA 2Z2XA 3AHEA 2XQJA 2QTBA 4PO3X 2Y3IA 1IMJA 1QE0A 2FPKA 2W2OA 4YMSA 1N6LA 1X39A 3EEFA 1K9VF 2C3YA 3TK1A 1CQJA 2Z98A 1DC4A 4TTJA 1KDVA 6Q21A 1DRUA 3PRJA 5CFNA 3HB4X 4MWSA 1LTHR 3GZ4A 2MINB 3VU1A 4BY9E 1BQEA 3DP7A 1IQ0A 4I5GA 4P58A 5H81A 2ECQA 5K45A 5DM2A 2GEDA 1JZSA 1U9IC 2CLLB 3F71A 4L4XA 2ZWOA 1ZIOA 2R7MA 4RLFA 2EAUA 2XQIA 5HILA 2G4LA 4DV7B 3O4IA 4MRSA 4C4XA 1ZD2P 1QKJA 1SY7A 4FE7A 2ZWVA 4DAOA 3AB7A 4FYYA 3BRCA 2A5JA 1S3SA 1Y1SA 1PNQA 2ZUCA 4QBGB 5HXAA 4AI6A 3ZHQA 2XMGA 3IC5A 4BLOA 2Y6UA 5K4HA 1EAYA 1P2BA 2GHQA 3VV3A 2BDEA 4IIXA 1N1MA 3X1YA 4NE9A 1JHMA 4JI1B 1OA1A 2BTEA 3ABOB 2W8BA 3HJGA 3GPDG 3OIDA 4HZUB 5BUQA 3VC7A 4PZEA 3D7MA 2ZZNA 2YHIA 1MW8X 2UZIR 3AP1A 3RSHA 1XAIA 4BXOB 3UQYS 3LBIA 3K0CA 1YK0A 3UUFA 1SN7A 2BSAA 3PPYA 2RHRA 4KFTA 3ZCVA 2FDRA 4BTLA 4TQ9A 3T9DA 4HNTA 4RK4A 3CX7A 3EVZA 3Q6IA 4L02A 4JXXA 3TZEA 1HWYA 5JCJA 2I29A 4FGKA 4C07A 3SDSA 5CLQA 1N6KA 4CDRA 1OB2A 5H70A 4LKRA 2C4KA 4F2HA 4CLOA 2D6FA 3U7QB 5E4YA 1C8KA 3CLRD 4O2RA 2VAVA 1TO1E 2GD6A 1E61A 3AUXA 3BN3A 4KYVA 1KEPA 4MV5A 3T5DA 1RQXA 5LM3A 2C7PA 3E9MA 2GBLC 1DCTA 4BC1A 4DTCA 1RE0A 2RCYA 2YOHA 4KQEA 3TNYA 4MW0A 2B4TO 2UYQA 1K68A 4LS3A 4CCWA 2WKQA 4F1JA 5GZ3A 2IGTA 1XZHA 1K86A 2VHUA 221PA 1TTQB 1L5FA 1HYQA 4NPCA 2HN9A 2JLZA 5GGXA 2YOGA 3NQ41 4A4DA 3QUSA 5HJEA 3WIOA 3EOAI 1HLDA 2DM6A 3QBTA 4JLDA 1G20A 4YBRA 1YMUA 2WAYA 1XSEA 1UBHS 2N47A 2VR1A 4U2GA 4WNAB 3GLFA 3IELA 1FFDA 2WM2A 4N3GA 4KE9A 2AUTA 2OORA 3INRA 4OXXA 5BMVF 5I6DA 5IG2A 5FLYA 1RXVA 3OOYA 3UAZA 4L50A 1E1QD 4WVFA 5LNK1 2CNBA 3VZDA 3KE8A 1CUZA 4FCCA 4W7HA 4RK1A 2CWDA 3HU2A 1B6TA 1FDIA 1FU7A 1VB3A 2BP7B 2YVQA 3B1WA 4HR7A 2C7RA 2HV9A 2VFAA 2WA2A 3FPJA 4OU4A 5IM5A 3I3SR 3K53A 1H0SA 4O4LA 1TUIA 1AV7A 4X84A 1YHZA 3FI9A 3T9BA 4F85A 1KHHA 2PA3A 4IG9A 5LWQA 3IYLW 4GMXA 4Q05A 4ZHQA 3Q9NA 1AXEA 1EX1A 1MT0A 1WEHA 4JVMA 4Z86A 3HNOA 3IPAA 2A4MA 3Q7IA 1Z28A 4CCSA 3NG1A 4ZGBA 2ZGVA 3BAFA 4XQEA 2L17A 4H0NA 1CULC 2P2ZA 2NU7B 4G0NA 4XTRA 1K0UA 1UFOA 3JAWA 3EDYA 3MOSA 4UW9A 2C4WA 3PPIA 4YCSA 3UWMA 5ALZA 4RKEA 1I7SB 1IN7A 2W90A 3IE2A 1BA2A 3LX5A 1DL5A 3KXLA 4RL4A 4WV3A 4X93A 3UV7A 5JBNA 4PSVA 2VF4X 2JAHA 3HPQA 1T25A 4MI1A 1NJGA 4MAAA 3VZPA 2DHQA 3M6XA 1QG6A 1R2QA 1FSPA 4CQMA 1IM5A 1KSFX 3CUVA 3ETGA 3Q6NA 5CPBA 4HNRA 4DFDA 4JVSB 4O4IA 5IHPA 1NXPA 3WVNA 2FJ0A 2KWIA 5A0TA 1LDBA 5IUNC 1NR5A 2PT9A 4LYHA 2GJKA 1TB4A 4YAEA 5J2TA 2C2KA 4BB6A 5KDDA 1GITA 1TKCA 2RAFA 2CLDX 3DUFB 3E48A 3L4BA 1J8VA 5EG5A 2FFHA 2X9LA 2QW8A 3IX7A 4ZAGA 3SAJA 1L8XA 1V8ZA 4UZEA 1UKBA 3BWYA 3SEAA 1JKMA 2AC4A 5E4TA 4BEWA 3P1JA 4E08A 4Y1RB 2BC9A 4JBLA 2C7VA 2XNHA 2ZJ7A 4O5OA 4UNNA 3WMGA 4XDZA 1ZH4A 1MO4A 4ZEWA 4DMCA 2DLNA 5HIMA 4JC0A 5IULC 4RJKA 1F60A 2OM2A 4M1WA 4Q93A 3RIHA 3GCDA 2DLDA 3HH8A 5E3JA 3FOWA 3PC4A 3JWPA 5E2AA 4DLVA 5LQJA 4LF4B 3ADBA 5HJ2A 4BNVA 1O77A 2D2XA 4BVHA 3GDOA 2AMVA 5G0UA 3O8QB 2P2LA 1RKUA 2WICA 3JSAA 1IXYA 5LYJF 4HTFB 3DTYA 5AR1A 8ABPA 1NQUA 5JQWA 2GKOA 2H1FA 2WTMA 5KMGA 4OM8A 3GZNA 2NZYA 2QR2A 1M34A 2XD9A 4OU5A 1U5BA 1WMDA 1WBBA 2MSKA 1XTTA 4MEJA 2ZUUA 5ILGA 5A7GA 1RI4A 3TE6A 2XYPA 3MJTA 3R4CA 4MUNA 2ZQYA 4RC9A 1LH0A 1CVIA 4KGDA 1A82A 3SF8A 5KNBH 1V4BA 1FZQA 4YJKA 1V71A 3FUVA 3QEJA 4XARA 1Y9EA 5JSYA 1RHKA 2AXEA 4XCQA 1QZZA 1E3IA 2ZT5A 1QWSA 2ZRAA 4RY8A 3NVAA 1Z0ZA 1ECCA 4H7IA 4AC9A 4BP1A 1FFWA 1C0LA 5ULLA 1SOUA 1J9GA 2CFTA 3R5SA 4ZIRB 5IWCA 2CNWD 3K1TA 3NRCA 4AUEA 1OILA 3GLUA 4GICA 4PS1A 3DLIA 4U00A 1PF7E 1XTZA 1Z82A 2EBWA 2GK7A 5JVDB 4EKEA 1FL9A 2DFVA 4Z1OA 1UOPA 2I9PA 3AKDA 1SHZA 3ACCA 2YTZA 3LUFA 4XXHA 5D84A 1JDTA 1T1IA 2HK9A 2VQ6A 4LZZA 5EIFA 5ALEA 5L3VA 1QRTA 4U6NA 4ERNA 1FU4A 1W0KD 2H52A 1F8YA 5BN4B 2ZAOA 2PWBA 4KAJA 1VKOA 3EY9A 5D3MB 1ARZA 1IC6A 5CB8A 1WM1A 3L7AA 2ODBA 3OM8A 5KPJA 3HM2A 4AQDA 3TTUA 2V55B 2RGCA 4LOKA 4XGNA 2DB3A 1KBQA 1V5WA 3A1VA 1TQ6A 3KWJA 3MMZA 4N03A 2VNKA 4ZVPA 2CB9A 2WAMA 3BJEA 3PX7A 2XRZA 4UQPA 4DXAA 2BI8A 2Q6IA 5B7NA 4TT3D 3OLQA 1XV5A 2I80A 4MMXB 1U04A 2XYGA 4BP9A 5B6PA 5EMNA 1Y63A 3QYJA 3NCTA 2ZJ2A 3R5TA 4M0EA 2NVUA 1RZUA 2OK8A 1JSRA 1TVKB 4QDOA 2QN7A 1EFRA 2XDYA 3L1IA 3M7IA 2AOVA 1QG4A 1YRAA 5FTLA 3E8XA 1P7VA 4KCGA 1KJYA 3C1OA 5A5GA 3A0UA 3FPAA 1LCIA 2P5YA 4TS3A 4WA7A 4L9AA 5EHIA 4F91B 3U6BA 1OWOA 4JEIA 3TW8A 4YQYA 1MQAA 4JI0B 1G0OA 1GKKA 4YXWA 5T4BA 4D5GA 1RQGA 1XJQA 3FFBA 4V0NA 3RVRA 4QC2A 2VHTA 1L5NA 4TVKA 4PCUA 3VR4D 1Y81A 3I9JA 1ISFA 3PHBE 3ZU6A 5HKAA 1XJ5A 2HPHA 2A5LA 2ZI7A 4XB6B 2VK8A 1XC7A 1YR8A 3BJZA 5B1IA 5NULA 3OEHA 3LCVB 5JAOA 4RFSB 1JTFA 2NO0A 2WF9A 3TW4A 1QIEA 4WBNF 3LX4A 3RAFC 1G63A 4NHOA 3GP3A 5BV2P 1J8YF 4NJEB 4K1XA 1G59A 4UBMA 2K6GA 5CFPA 5JROA 2XJ4A 1W8DA 1AQIA 3DWEX 3O9ZA 1QC5B 2NWQA 5BN5B 3VU8A 2WU8A 3ZCUA 4XJTA 1QB7A 3QBJA 4BV9A 3NJRA 4MVXA 2DBRA 5GIPE 2RFLA 4E5VA 2PKQO 3LPCA 3TRJA 3MRVA 3LS2A 3P0FA 2JGDB 3WO1A 3CE6A 1H9CA 4ZRNA 1KFCB 3NI2A 1OB5A 4H7PA 4NJOA 5EIBC 3UQZA 1KO1A 5TT0A 1BCRB 3TLCA 4I6EA 2RARA 3H05A 3Q5EA 2PX0A 4II7A 2HMVA 4LZAA 3C7DB 3I1IA 2O8CB 2BM9A 2VJDA 1XWFA 3OM1A 3PNKA 1KI8A 1LFDB 2V0CA 5AVXA 1Q7RA 1Z83A 2I3BA 1JIJA 1K6JA 1NUPA 4N0QA 4PC3A 3V2IA 1E3QA 4CM1A 4ZV4A 5BNTA 5KC9A 3PNPA 5FOWA 5H3LA 4ENTA 2VDWB 2CKMA 1PJ3A 1NJ1A 4RSRA 3H6GA 5DEIA 3CNBA 4WADA 4XVHA 4L74A 1BWQA 2EYQA 1DV2A 1TJYA 1WR8A 3P4UA 4H3HB 1T1JA 4RM3A 4ZQFA 4DM7A 1FJHA 1X7ZB 5JQGB 3HK2A 4BLPA 3JATB 4L72A 3ZWQA 3C5CA 1E5LA 4EUHA 3E35A 1Z18A 2CXOA 3IBGA 5CAEB 1YQUA 1Z5PA 1JQKA 2CLOB 3N8HA 4ND8B 2VDJA 3T4PA 1E1RA 1ORIA 2BGLA 4XGIA 1F0PA 3PX3A 4OSEA 2ZSUA 1KF0A 3GCWA 4NECA 4TMTA 3KAPA 2Y1EA 2G3YA 4DGQA 5K3CA 2ZRPA 4QIHA 4MIYA 3SIPA 2WIAA 3V8VA 1CZNA 1BQ3A 2X8JA 4FINA 2FRDC 3V46A 4C0BA 3NMUF 2Q1WA 1E69A 2XA9A 1NW7A 3KZ1E 3LY7A 1EWYA 3ZEIA 4XDGA 3SC6A 1Y82A 4BOYA 1QX4A 3K4HA 1IPFA 1SWWA 3RJ9A 3ED1A 1FW8A 2E37A 3AERA 3AWDA 1ICIA 1DXQA 2NT4A 1GPYA 2W00A 1QHEA 4CEIB 5CA0B 1RBZA 2QPTA 1O7JA 3LGXA 2C7BA 2QTFA 3IKLA 2Q4DA 4I9UA 2C1EA 4BFLA 3V4SA 4EYEA 5JMPA 2YJ3A 2Z95A 2FEPA 2H51A 1X3SA 4JVOA 1UKAA 2ZWPA 3IKVA 4X24A 2Z4RA 2QTVB 4C7XA 5L3QB 3NP9A 4QM6A 3HBLA 4MUJA 5H7XA 1SXGA 4JQYA 1SC3A 4MA5A 4ZVVA 5LXTF 1EPUA 1PVDA 4WTOA 3EC2A 1WUKS 5ECDA 2DKFA 3RS7A 2ZM5A 1Y1LA 2XQGA 3HG7A 4G6ZA 4KUGA 3VAYA 1OC4A 2ZIAA 3VV2A 2W6MA 4DRXB 3TD2A 4DR6B 4ETNA 1EXVA 2YMLA 4TLMB 2I67A 1ISIA 1N8KA 4GUAA 5D87A 1EH5A 4YJFB 3UPDA 4YS6A 3U3OA 4WSOA 1P0IA 4ILEA 4U2CA 3UK0A 1LQ2A 3CCFA 4D4MA 3A9SA 3S8MA 4QELA 5B2EA 2IOYA 2UXDB 4WERA 1GTVA 2Z9CA 4L4UA 4Y1GA 3UKJA 3GCZA 3TEMA 1DJOA 5IDVA 1SZPA 2CXNA 3UMYA 1DEAA 4MJ7A 5AHXA 3MCTA 2C7OA 1QBKC 2Z58A 3FYUB 3M2PA 1SFRA 2EHDA 1A9XB 5DI3B 5JVDF 3CWQA 1JKXA 3B1ZA 5TQ0A 3V8QA 3DV9A 4HMOA 4TYPA 1XZIA 4WN9B 1T0IA 2WW8A 3HKBB 3HKEA 4IMRA 1T36B 4D79A 3TTWA 1U3TA 4MIOA 3MPOA 3GGPA 3PUKA 4NU6A 5CT9A 2J9FB 4C6SA 4NG4A 2HRDA 4QBHA 3OJEA 4JBNA 5KNCD 5KYYB 4BEVA 1G291 3B9QA 1GAJA 1WQ4A 2SKEA 3NH6A 5IAGA 3OP1A 3RADC 1FP2A 1MEEA 2K87A 4N41A 2B25A 2IBSA 2NX2A 3MIZA 3IQGX 4XASA 3A4YA 1XQ9A 3EVTA 4YY3B 4K86A 1AURA 4Z4QA 2W98A 1KL7A 1P18A 2WJWA 3EZFA 1OI7A 5KINB 3W79A 1QAQA 4U3JB 1PBNA 4XPZA 5F7JA 3CWZA 4DA8A 1Y7HA 4IWYA 4H1VA 4XW2A 5F51A 5T4FA 4Q7QA 4OFBA 4RTMA 1OLOA 3KALA 3VHRA 4Q3DA 1IG0A 2LNDA 3PT9A 4FMDB 1G9TA 2Z3WA 3OZRA 1RCTE 4OH7A 3NEAA 4LCJA 3MJEA 3GF4A 1Y6JA 3SF0A 2QRZA 4H31A 1NXTA 4POAA 5DYGA 2VWHA 4XDYA 1H69A 4ZA2A 3RIYA 1EVZA 1UAYA 4RTOA 3KVNA 3NYQA 4G8DA 3O8CA 5BOSA 3BXPA 2PS1A 3HQ4O 4FEGA 4HAWA 3A1WA 5LDDC 1NN5A 2J9XB 4AY6A 2YFQA 4OUKX 4GKKB 2DQSA 1JXOA 3V8EA 2VJNA 2BYTA 2QTWB 4CLRB 1MJNA 1A4IA 4M83A 3FNFA 3TEJA 3VM6A 3YASA 3H5NA 1FLNA 4BWVA 4CKBA 1AMUA 3DT9A 3OLCX 5ESDA 3R9XB 1V9CA 2RGRA 4UBJA 1HGXA 5LOVB 5LQCA 3SVZA 1Z4NA 3N2NA 3KOZA 3MM4A 2J3HA 1PJTA 1QJCA 2OAP1 3C8HA 3W2FA 4D44A 2Z0MA 4DEYA 2YICA 4ZCSA 1AQNA 1Y7PA 1ZVMA 1CNMA 2FR0A 2IDKA 4OQDA 5ICCA 5JI3E 3FMVA 2AKYA 5AKGA 1OU4A 1XEAA 1OPXA 3KQTA 3WRYA 4C7VA 3UFXA 2IZZA 2CF6A 4Y6OA 2Y71A 4A0GA 1R6XA 3BX1A 5G3YA 5LQDA 2HCJB 3ZKAA 3W77A 5AKYA 2IUSA 5L40A 3GDWA 3QG1A 4NOLA 3T3PB 3SZGA 4F4HA 2F3SA 2C2MA 4GMDA 4ENSA 2JD2A 4EFMA 3UJ8A 2DECA 4JSYA 1U8YA 1I2MA 1PJSA 2P9HA 1A8IA 2OA0A 2QDKA 1N7HA 2F8MA 1I01A 2GRAA 2R6DA 3PGA1 4H18A 4IFEA 4LGVA 3PQ2A 4WY8A 3UZUA 3WWEA 5EP2A 1P1KA 2QG9A 3FLMA 2DFTA 2BGKA 3UXYA 3RS4A 2H2IA 4B3HA 1GSIA 1U2DA 3ZE8A 1CRLA 1P1IA 2RK6A 1LTQA 3A04A 3GEIA 3MWDB 5EAIA 4DT1B 1Z37A 1UBEA 2EZTA 3D2BA 2Q4BA 3D1VA 1UJCA 5A5FA 4NBRA 3DD1A 3CF4G 3UFBA 1ISJA 2CC2A 1FTNA 4R1SA 3AM4A 3WIUA 2X8BA 1H8EA 4UCQA 4C04A 5GTDA 4Q39A 2IEIA 5JBQA 3KKNA 1I4LD 3VBEA 5DKFA 2WAOA 3D4LA 4ZEOA 1V5IA 4EHJA 3SYLA 5JCOC 3K05A 1Y80A 3REQA 5J4HA 4I55B 2W7TA 2H4WA 3A36A 5EINA 2I1VB 4DOMA 1KIFA 5B4TA 3LA8A 2A33A 2C04A 2BUCA 1QHNA 1FNCA 1ZK4A 5B3LA 3U16A 1E2DA 3FPSA 4E5KA 5CUQA 4MW7A 2YJ6A 2G6BA 3QXJA 2AYYA 3K2BA 3PHGA 4GI2A 1BZYA 5DMHA 2ATVA 2DR0A 5JT1A 2E48A 5BV8A 3D4IA 2FLKA 1YRBA 5LA6F 1ABFA 3EUAA 3COVA 4GYYA 4IOLA 1PCXA 3BGVA 4QJBA 3AIMA 2REQA 4Y2RA 4DLUA 3LGAA 3ZU5A 2WJYA 4JR1A 2O2IA 5C31A 2ST1A 1LRKA 1OIVA 2EX1A 2Y67A 1R50A 4GQIA 1NBME 1RXEA 1NQTA 4JXZA 4YIKA 4QOHA 1D9ZA 2CN1A 1P31A 2FPSA 2HSJA 3BK2A 1PTJA 2FN8A 2H4YA 3ZY3A 5CDGA 4GPIB 2PV0A 1BHO1 2OYRA 3M1LA 4OFZA 4O3MA 1G8HA 1VHQA 1QH0A 1QGUB 1NVWQ 5FJIA 2R751 2NG1A 3FLAA 3KKLA 1F2VA 4YQZA 3FKQA 3WMXA 1E2UA 2C5AA 2KLHA 2G72A 4UHBA 3ZXIA 2W2LA 4Q4DA 4D57A 3VKVA 1HQCA 2C5LA 4YCJA 3UAYA 1BFUA 1QPZA 2CHGA 4W63A 1QOPB 2VH1A 1S1CA 4ZANA 3AETB 1F4PA 1SXQA 2ZRJA 4GR9A 4E5SA 1C14A 3GEDA 4I1RA 2DEUA 2AFIA 5EE3A 2G8NA 1OVGA 2CLMB 2NADA 1QS0A 4ZALA 4UTNA 5G02A 4NONA 2WIKA 4Z1MD 2LWIA 3ICEA 4FI3C 5AI5A 5KWJA 5GV7A 3O3NB 2JKZA 3L1VA 1NF2A 5AI9A 5J2UF 3HJBA 1GAXA 1JIIA 2Q1UA 4QU9A 5IVIA 3B3QA 1KI9A 3IDOA 4X1KA 1A50B 3U81A 4BP8A 4LJ4A 5CFOA 3BG5A 4D5EA 4HNUA 4WEQA 1HKHA 5CT4A 3FCOA 4MV7A 5U9CA 3FN4A 4MWTA 3NP7A 3P5BA 2XECA 3MRTA 5AM0A 1PQYA 2GAOA 1MB2A 4GT1A 3V8NA 4C3VA 4D4IA 4Z7JA 4UQLA 5JSQA 2OXCA 2OMKA 3ZWWA 3SP1A 1IN5A 3T3IA 4LRWA 1TECE 2BMWA 2WYWA 2X1LA 4KOAA 3AI3A 3IDAA 4CODB 1U4SA 4PIPA 5H4GA 1YR9A 4BZZA 2WT9A 4X60A 2GB4A 4C4YA 1JR3A 1TF7A 4IILA 1MFPA 4PXYA 4QUDA 3LT4A 4NNJA 1AMNA 2FFBA 2OO5A 4QGSA 3UJ6A 4ENRA 2OOKA 3O5AA 3CZ9A 2QLFA 2MINA 5ITVA 1LGYA 2CFIA 4OXRA 5CJ2A 3TSZA 5KIAA 4K46A 4E6EA 4HB3A 5BR8B 2PWZA 4DA0A 4DLTA 2JFFA 1UPCA 1MNAA 2FG5A 5JSKA 4DPMA 3DE7X 1LX7A 5JATA 5HWSA 3WI7A 2COKA 2I7DA 4D0SA 2BV3A 3G2LA 2EWWA 2AJBA 2B8WA 3LXRA 3QEMB 2PS3A 4IJ5A 3TIGA 2ZK7A 2AFVA 4DV0B 1F14A 5JTTA 1DXOA 4CMEC 3RRJA 1TW2A 5C37A 1G38A 3E2MA 1PX0A 3CLRC 1EXDA 3PFFA 1GKYA 4LY0A 4PR0A 2DQYA 5I7WA 3CF4A 2PJUA 4HBZA 4H0FA 3ST7A 4FMCB 1GQYA 3L02A 1BXZA 3N3AC 1R16A 3BQ9A 4HZUA 4L9RA 4F3CA 3KYJB 2GUWA 3D7SA 4HDAA 4C3UA 1HKUA 4BFYA 4DHWA 4E7OA 1VA4A 2H7CA 3VR4H 3WLRA 3DH0A 4L07A 5FYDA 2QNRA 4DR2B 4F3TA 3HZHA 1MAHA 2CMHA 5F64A 4A3SA 5PGMA 2GM4A 3W3ZB 1XZGA 2PPVA 4Y2XA 1VKZA 4ZJYA 3OD1A 4B17A 1VL1A 2Y66A 5L3ZA 4QXOA 1Y9ZA 1Z4IA 2RI1A 1ZMXA 3C8ZA 4ZO4A 1ZD9A 3AONB 3U7QA 2BE9A 2J3DA 3G0DA 4M8KA 3K6RA 3I6BA 2GCIA 2XXJA 2V6FA 1BSVA 2PL5A 4OIMA 4KQHA 1MAUA 2IYPA 3UENA 4CIXA 3R5HA 1P5FA 4PM4A 3VSCA 1VI2A 3WX0A 1LPOA 1F6DA 3L0YA 4PF1A 4RQAA 4F04A 5CH5A 1B6RA 2OZLB 3D6UA 1V5EA 4E33A 1DIGA 2AC7A 4WLFA 3EFOB 3DHEA 2E4YA 3O4HA 1U7ZA 5U1PA 1SBQA 3TBKA 1QYVA 4M86A 3SEQA 5E4FA 4YRKA 3W7AA 4HUQB 2GK4A 5C7LO 1Q11A 1NX9A 3QVGB 1WD7A 4U0KA 3GLVA 4BNMA 3F8WA 1JS1X 2VRCA 4WNAA 1MH1A 4ZQHA 3TNJA 1JA9A 3WGVA 4KMRA 1JIXA 1XQYA 3K71B 1ZR2A 3T3MB 1OHHA 4EVQA 4TRJA 4DUPA 2AZ4A 4UCFA 2GPNA 3LGSA 1U9JA 4C3ZA 2BP7A 3SHOA 4TLAA 3D9QX 4L4ZA 5M5BA 4BBZA 4JMLA 2PDAA 1ETUA 2ZTSA 2TRSB 3BWBA 4JJFA 5JNRA 4I9NA 1XRQA 3DAPA 1DZIA 3AU8A 1OVMA 3A2LA 1H3NA 4MW4A 4MJLA 3VC2A 1NXQA 3HWX1 3BK7A 4HQLA 4UTPA 3T1HB 1ZNXA 3AM3A 4GYKA 3ZJYA 1ZVJA 1BS2A 2IE0A 4ARSA 4Y2SA 3PC8A 4MI3A 3EXHC 2MCFA 3HDVA 1JQ3A 2NU7A 2AQKA 2XVXA 3W2IA 2DLCX 3KXIA 1GCUA 4L0MA 2QRKA 4R3UC 5CIQA 3BC1A 4J03A 4FN5A 1P5ZB 2QMUA 4I4LA 1KP9A 1N8NA 1F8FA 3U17A 1GPDG 1JFTA 2X23A 3DAGA 1Z2EA 3N2IA 1C0IA 1X8XA 2YWHA 5K0BA 4EG6A 4XJXA 1NE2A 1Z33A 4HDNB 3ORYA 1CJUC 3PNYA 1V16B 2VDMB 4B46A 3B1VA 3BK1A 4Z7OB 1L0BA 3LE8A 3PQ6A 1XOIA 2GOYA 4TXMA 2CT8A 2GH1A 3EEBA 5ER6A 5FUYA 1KH2A 1THTA 2JASA 4RJLA 1EM6A 4DZTA 2JCSA 2PZMA 1KI6B 3RS9A 4Y6SA 3UGKA 3ZLVA 3QK7A 2BSXA 1QYDA 3QQ5A 4LHWA 1NOJA 1YJQA 2O0LA 3DUFA 5BVGB 3GUCA 1JQJC 2QG4A 3R0XA 2YJTD 4BRUA 2AEFA 2XIJA 4BJHB 3SKYA 1NGSA 2QVXX 5EUCA 1HG1A 3HSYA 1YZFA 1JG4A 1U80A 4JJKA 1C0EA 1R37A 4Y1RA 2I55A 4M0CA 1LZKA 3M5PA 3UCEA 2AV6A 3W5SA 4OX9B 5IP5A 3PQEA 3HYNA 4HY3A 3WLOA 2IYNA 2H11A 2ZRMA 3U4GA 4IFBA 3QLEA 2EGHA 2PGDA 3E8MA 1OTXA 2ZB7A 3GPBA 4LTNA 5DVZA 3OKPA 3WGOA 3KOMA 1BGWA 1SVNA 4R6WA 5D3KA 3NYRA 3RVSA 2ZYTX 3KU1A 5IK2A 4C0WA 1BU8A 2PKQP 1E20A 2GFIA 1RYHA 2PXAA 2VYCA 3AXTA 3ENKA 3H65A 3I04A 4OOFA 4WD3A 5LMUB 1X8LA 1TMGE 4AU1A 4G01B 3KNZA 2ZETA 3O8QA 5I3ZA 1OX5A 5CH3A 4HTFA 2UAGA 1B43A 4KJZA 1R3DA 3D7KA 3KT6A 4DLRA 3G68A 2PBLA 3B6ZA 5K0EA 3CNEA 1UJ2A 1VCNA 2XCTB 5KKAA 2LE0A 2UV8A 3PFCA 5AI0A 3R7AA 4TKUB 1TUBB 4DM3A 5IZCA 4OQFA 2XUGA 1UBGA 1PEAA 2JIZA 5DM4A 1XLVA 4U5XA 1T10A 2ONCA 5L4NA 1TVMA 3OCJA 2C2WA 1RWXA 4B33A 3IQWA 3PTZA 1OT5A 2Z5VA 5T67A 4B4VA 2O54A 4NBTA 1SXHA 1FUKA 3GDGA 4TZTA 4UHDA 4MVJD 5DP2A 4NS4A 3TIVA 1L5OA 4GKVA 2AB0A 4M36A 4OMCA 4DMRA 1TA4A 2AOUB 1GCGA 4QXQA 2BFBB 2PK3A 3IQDB 3FPKA 1JPNA 4WASA 4KR3A 4B31A 2CL7X 4ZMBA 4M55A 3EGXB 3L07A 4X3PA 4ZIRA 4ZYTA 2CY0A 1G21B 4ZT3A 3UMCA 3WBKA 1YH3A 3P8ZA 5JVDA 2R7KA 3VDQA 2XCRB 4UEQA 5DULA 1L7XA 1T5BA 5BXYA 1ZD4A 2QA5A 1WCIB 2D5IA 3DV2A 3JY6A 4KUHA 4A91A 2DRIA 2PKCA 1D0SA 3EXEB 1M2FA 3DUWA 2ONJA 2R6HA 4S1OA 4F2PA 1EVKA 4UAGA 2EKDA 2E1RA 2P9QA 4TROA 3RVBA 4MPTA 1SKMA 4KE7A 3HCCA 1F38A 2B78A 2W2QA 2GBFA 4F46A 5BN4A 5D3MA 3PF8A 3C41J 2G36A 3UT5B 1OYOA 1Y37A 4X6YA 3WBJA 5LDHA 2J3JA 3KQVA 4J7AA 4UE3S 3G6WA 3AL3A 3OWHA 4JB3A 4CV0A 5CJPA 3WYBA 3U3ZA 3FGNA 3MIIA 2B1IA 1VLLA 1A9PA 2ZZKA 1PQPA 1ZUWA 4WH0A 2C98A 1ZY2A 1ZOSA 1JDJA 1DB3A 4K2AA 1HETA 4BKQA 4QG3A 1L1EA 2F55A 4LYDA 4BQNA 2O52A 2V1XA 2Y99A 1BX1A 2JJQA 3EJWA 1A8HA 3PWKA 4Y2JA 2VPPA 1C4OA 2DSNA 4FBMA 3WNQA 2KI5A 1NLZA 2VCEA 1RYNA 1HLFA 3U19A 2PZAA 5DGIA 2IUFA 4HJRA 1W85B 2IDZA 1OXBB 2DJ5A 5HUJA 3LWDA 4W5NA 1WCV1 4IGFA 1NYQA 4W6ZA 5C9ZA 1I94B 1U0GA 3SMQA 2LXNA 3EQ9A 3F67A 3AKYA 4I6JA 5E9AA 2B1QA 1KMQA 3TSWA 3UWDA 3I92A 2BFOA 1YL5A 4B7ZA 3IQFA 1QP0A 3BKWA 1NVMB 2FG6C 3C6BA 4MOWA 4J0CA 3MGKA 5HUQA 2JIMA 1N5KA 4RLHA 5K2MA 3WYCA 3DKVA 5BUZA 2I1WA 4FK8A 3SWWA 1GZ7A 3P52A 1GA6A 1QX3A 4A6XA 4HRXA 3SS9X 4RKQA 4DWOA 3HUFA 4M37A 3BORA 4L16A 5E2BA 4ISCA 3HV0A 4D6YA 2ZR9A 3C5WP 2C2ZA 4TSRA 1EVQA 2C5GA 3MLAA 2V9CA 3LK6A 3TCKA 3ZBQA 1YQDA 3E7WA 3KQMA 4LY6A 1W34A 1YDFA 4RFSA 5G1NA 3DQPA 1CXZA 1OXSC 3BIOA 2EFGA 3MVEA 4FFBB 4MZXA 4U7WA 5AKIA 2E82A 4EPXA 1TCVA 1RWPA 1IJBA 2VHZA 3T15A 4NJEA 1YBFA 2O3UA 2ZITA 1IZ8A 5ADHA 3CONA 4D9CA 1L7OA 2ESRA 2GXSA 2CMGA 4FYXA 5A3SA 3UCXA 4PLTA 1N3LA 3ZYZA 2O5EA 1T5OA 2O3JA 3CUTA 4BB9A 3UMBA 3Q85A 1QC5A 4I08A 4QPZA 5BN5A 2E18A 4BU0A 4RD4A 2ZE8A 3QKWA 1NAIA 3A6LA 1C1DB 3DTVB 5CR9A 1EP2B 4HATA 4U2EA 4EH1A 4HXFB 1RP7A 1AS2A 2HWUA 1DT3A 1IXSB 2JGDA 5ALGA 3T1NA 1VZ2A 1R6TA 2BUBA 1NNLA 1NASA 2X76A 2XUQA 1G18A 2ABWA 3ESAA 4MVYA 3VH1A 3MSCA 1MVNA 3DOHA 3ZDYB 1BCRA 4FLMA 3DZHA 4HAIA 4YRPA 3FNHA 3MC1A 3GRUA 1RW4A 5DT2A 5IJ9B 2HF2A 3P9SA 4ZAZA 3ZDCA 2R00A 1CW2B 2XE8A 3PUJA 4OLHA 1ECBA 3MJDA 3G6KA 1MABB 3AW8A 3EA0A 4S0ZA 4EMUA 5EIOA 2QZPA 1L5MA 2VDWA 3OOJA 4FLEA 4HGZA 2PVCA 3RKRA 3TCNA 2H2HA 4NF2A 5FT9A 4DSUA 3LPLA 2Y2UA 3SQDA 2PR2A 1Z0FA 4QBKA 2ZPUA 2XITA 5EKDA 5JMOA 4OSOA 2JAXA 3GYGA 1X7ZA 3NTUA 3C3JA 1GD1O 5LP1A 3JATA 3IUSA 4P6VF 2JI8A 1DS6A 2P9ZA 4JP3A 4KRGA 2X40A 2XUOA 3PEVA 1JG7A 2AD1A 1P33A 1QDUA 1NYTA 3PHLA 4TQAA 5CHEA 4ND8A 5CP8A 3V2GA 3WQQA 3H9JA 5IYZB 2HO4A 1HUQA 1N2XA 1GL9B 4HN2A 4OYLA 5HNKA 2Q3JA 1PJ2A 2P2NA 3F2IA 2P0EA 3SHWA 3PLRA 2QP3A 3HEAA 4PX9A 1X77A 3UUEA 4JLSA 1T2NA 4G0OA 3LW8A 1SM4A 4AY2A 4PZZA 4YRAA <