5L7WA

17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
254
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title First Structure-Activity Relationship of 17 beta-Hydroxysteroid Dehydrogenase Type 14 Nonsteroidal Inhibitors and Crystal Structures in Complex with the Enzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 254
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l7wA00
4CL3A 1ORRA 4Q3NA 3HB4X 4E2ZA 2Q49A 4XYGA 3V8BA 3UGKA 4GBJA 3PFFA 1D1SA 3DAFA 3L0DA 4CODB 4WLNA 4FFPA 1R0KA 1GDHA 1JQBA 2RHCA 4Y67A 4JLWA 4DGSA 2B36A 3JQFA 1P1IA 3JV7A 1LDYA 3BTSA 4CLXA 4FJ2A 4M1QA 5DNAA 3WIEA 2X4GA 3JQAA 4U6QA 1Y7TA 3R3SA 2D5CA 2DBRA 3AOEA 1Y1PA 3PHLA 4RDIA 4BO2A 4D0RA 2CF5A 2NWQA 3WYEA 4E3ZA 2WD8A 4HV4A 2FSVA 3ADPA 5COQA 4FPXA 3IKTA 2WD7B 2CF6A 2DLDA 4CMAA 3K2BA 1A72A 2FWMX 4Y6RA 4CJXA 1NASA 3JQ9C 2OP1A 4KZPA 4WEQA 1IZ9A 4BS9A 1R4NB 2GN6A 5L53A 1Y81A 1E7QA 5KVQA 4B7CA 1LA2A 3ZV3A 2IODA 2YDYA 3AFMA 4LK3A 1NVMB 3QHAA 2JD2A 3ZNOA 3HQ4O 2X9VA 4WLVA 3TQHA 3OQ1A 1BSVA 2AE2A 1X0XA 2PZLA 2QHXA 4GX2A 2IYPA 1BW9B 1EUDA 2ZK7A 3MJSA 4J1QA 3E03A 4IJUA 3DB2A 1HLDA 2D8AA 4XR9A 4NG5A 1M75A 4ZGWA 1E3LA 2WTBA 1XHLA 1T26A 3GR6A 4J2OA 2HK7A 2YQ4A 5F5NA 1PU2A 4L4RA 3HWRA 4YBZA 3HB5X 4N54A 1L1FA 4BKRA 2DUUA 1HDYA 1P1JA 4MKZA 3DEYX 4BO4A 3AY6A 4YJGB 5KCZA 2XAAA 5AXDA 2OBYA 2OO5A 4GVXA 5K6AC 4NBTA 2G1UA 4QO7A 1V3TA 2ZKLA 2W98A 4LCJA 2EP7A 4PLFA 2Z1NA 1AXEA 1NP3A 1U3WA 2VTEA 2ZTVA 4GPD1 4II2A 1U2DA 1EK6A 1LRKA 2CDCA 1PGJA 1UP4A 3L6DA 3AWDA 4MKXA 2OL4A 4BMNA 3JQ6A 2O7SA 2BKAA 4OXYA 3INTA 1NHWA 5JYDA 1LDEA 4URFA 2I5PO 3V2HA 1QP8A 3PLRA 3PP8A 4CL8A 1NQOA 3R6DA 4RZIA 1XU9A 2PFGA 2W90A 1EQ2A 2PZJA 4Z6KA 3PEFA 1E7SA 3M1AA 1BDMA 1KVRA 2I67A 1ZEJA 4RVSA 4IGEA 4J16A 3RSHA 3RUIA 4F45A 1DIGA 1WZEA 4JP2A 4RV9A 5JXWA 5B12A 1LLQA 4FFOA 4R16A 3ONFA 4AG3A 1NHGA 2DM6A 1A7KA 1IPFA 1ZK0A 2GN4A 4U0KA 2IE0A 2NTJA 5FI5A 1YL6A 3KYCA 3U62A 5IDYA 1U9JA 4GSLA 4YEDA 5B4TA 4R9SA 1YB4A 1HLPA 3KYBA 3HDQA 4XYMA 1Q7GA 3RC2A 3UCEA 4NBRA 3FSRA 1I0ZA 2DPHA 4NK4A 4RF5A 1H2HA 4UUPA 5T57A 1CWUA 4MP8A 1YS4A 4D46A 1GEEA 3DBLA 1YH3A 1HE5A 2CMDA 3FHLA 1E7YA 4Q3AA 4RQUA 1NPDA 4PIVA 2NQ8A 3P2YA 1DAPA 4EI2A 1F12A 2BMAA 2DAPA 2EG9A 2Y1DA 3C8MA 2A94A 5IN5A 5A9SB 4YAIA 2Y1CA 2I9PA 2Y1FA 3JD1A 1E7WA 1WVGA 1MP0A 5IAAA 2IZZA 5KJEA 4XIJA 3ZWCA 4LMRA 5EESA 2GN8A 3UOGA 1XA0A 1I33A 3OJ0A 1X7GA 3LF1A 4YQYA 3C1TA 3AUSA 4RPGA 5AXBA 3ZU3A 4PG6A 3NV9A 2NU7A 2GZ1A 3MCVA 4DXHA 1A9YA 5GZ3A 4IDFA 4S3MA 2DT5A 1Y5MA 1C0IA 3C1AA 3KV3O 1PS8A 2GZ2A 6LDHA 4IIVA 4UVGA 3QVWA 2PGDA 2EWMA 1UDAA 5CEFA 4K9DA 1PJ3A 4G2NA 4L9RA 1HDXA 2ZTUA 3K30A 1D7OA 4FC7A 2VUSA 4WPGA 3P19A 1U4OA 3RBVA 5ICMA 1T2DA 3AK4A 1R4MA 3I9JA 2Q4BA 4M89A 2P9EA 3D4OA 5CAEA 2HMUA 3BMCB 2E37A 2VHZA 2EKPA 4OOFA 4Q9NA 3L4BC 5JDCA 4J3FA 3P7MA 4IXTA 4F6CA 3X2FA 4NR0A 4L76A 1EFLA 3G1TA 3WTCA 3MWDB 4NBWA 1BGVA 4TKMA 1TEHA 2E82A 2EXXA 5CEEA 5C7LO 4LVUA 3HDHA 4HFMA 1XWFA 3QWFA 3AOEC 5KNLA 2FR8A 4BQRA 3GZ4A 2PNFA 1FDTA 2DPGA 4MP6A 3DBVO 1P3DA 2AA3A 2P5UA 3ZU5A 3WSWA 3K31A 4S1VA 1GCUA 4J7XA 4CMHA 3NJ4A 1KVQA 3IAHA 1SB9A 3H5RA 3WQSB 3DTTA 3FNFA 1ZVMA 1V3VA 2C20A 3DBHB 4DQXA 3HHPA 3MZ0A 4HWKA 4IJWA 3E9QA 5HWSA 4BNKA 4RCVA 3PHHA 2ZQYA 1TB4A 2IRWA 3OETA 1DLIA 4CV3A 2ZTLA 1V9LA 3ITDA 3SXPA 4DPKA 5JMWA 1GUYA 2X0IA 1FK8A 4LN1A 3UN1A 3JQ7B 3CKYA 1OAAA 3Q3CA 3FF4A 2DBQA 5MDHA 4WLUA 3AU9A 4JJFA 5CG1A 4YAKA 1HYGA 3ETDA 3PLNA 3DHYA 4E31A 3PJDA 3RUHA 1VC2A 4B79A 4BHTA 4GX5A 1E6UA 1T4BA 1V35A 4YT4A 2LDBA 3R1IA 1XGKA 1EMDA 2D4AA 3FRJA 1GV0A 4ZICA 2GCGA 3RU7A 1T2FA 2HU2A 4P4NA 5IZCA 4X54A 3TFOA 1C1XA 2EV9A 2JD1A 4NFSA 3ZNNA 1DHRA 4A10A 3F9IA 2BGMA 1ZSYA 4IM7A 2HSDA 3ZCXA 1N1GA 4RVFA 1PGOA 1MX3A 1X7DA 2X1HA 3OQ6A 4RVGA 3D3EA 3S8MA 4EBFA 3F46A 4OXKA 3MJCA 3WOHA 5IZ4A 3L4SO 5MGBA 1T1SA 5A06A 3BMQB 3PDJA 1PJBA 4DLBA 3ZWAA 1Y8QA 2QQ5A 3LC2O 4YJGA 4RVUA 2Q99A 3JQCA 4BNXA 2GPTA 3CSDA 2BGLA 4ESOA 3U4DA 4CMJA 4GKBA 1PS0A 3G1UA 4XD2A 1HZZA 4FFLA 1YWGO 4KDFA 4UUNA 1KC3A 4U6SA 3KLPX 2X86A 3IJRA 3AI3A 1ONPA 2PKRA 1YRLA 3RUEA 5HA5A 1SPXA 3W8EA 1Q7BA 4MVJM 5ENDA 2P2SA 3CE6A 1Z7BA 2IZ1A 5ES3A 1N92A 5DCWA 1YO6A 2VHYA 3WQQA 1HDOA 1MG5A 1AUPA 1XLTA 3PWZA 1NPTO 3QVXA 5KIAA 4YJFB 1WDKA 1VJTA 3FNEA 4UEOA 1I2ZA 4A03A 3ZU4A 4PVCA 2Y66A 2BF7A 5CDTA 1ULUA 2FN7A 4RLSA 4WASA 3PJFA 1V3UA 4YQZA 2BFPA 3W6ZA 2Q4EA 2O3JA 2O7QA 4MOWA 3PFWO 1X1EA 3BTUA 1QMGA 1E1MA 2VNSA 1IY8A 1GZ6A 3NDJA 4HNGA 1W8DA 2W2LA 3TRIA 3CXRA 1D3AA 1H6DA 2VYND 3IP1A 3PGXA 1VRWA 3E1KA 2VQ3A 4HXYA 5JCXA 1LQTA 4GLOA 4UEKA 4R3NA 4AJIA 2DBVO 3RBZA 5COAA 3JQ8A 4AJOA 4BMSA 5EQDA 2OFPA 3SC4A 2IDZA 3UCFA 1Z82A 2X6TA 4CMIB 1XELA 1GCOA 4JBGA 1UDCA 4PLTA 5GZ1A 4CR7A 3WFIA 3ZNQA 4MVJD 1GZ4A 2CVQA 1A5ZA 2X22A 5DBGA 1TT5A 1YONA 5IF3A 4ALNA 3R0IA 3VPFA 3HJAA 1LI4A 4L74A 4J4BA 4R5MA 4DREA 1PJSA 5ITVA 1RJWA 1K3TA 4IJKA 4JIGA 3JQAB 1U8XX 3C7DB 5JDCC 2UVDA 4YTEA 1JTVA 2YZ7A 3ZWVA 4D45A 2NV6A 3AI1A 3HADA 5TSDA 2CNBA 2HLPA 3H9UA 3TPCA 2TMGA 2YUTA 2B37A 1K5HA 1IB6A 2X9GA 4I1IA 5HS4A 1LDGA 2WE8A 1S7CA 3EVNA 3MTGA 4Z3KA 1VSUA 1F14A 1U2GA 2P4QA 3PIDA 1S6YA 4I5FA 4WJZA 4HFJA 2JAHA 2BI8A 3PZBA 2WE7A 3ORFA 2GYYA 1PJ4A 2D0IA 1N2SA 3FPCA 4PG7A 3PI7A 1P77A 4ZRNA 1Y8RA 4CUZA 1A4UA 2P9CA 1EQUA 1WMAA 3L9WA 4GMGA 1SEVA 3IP3A 2A9FA 2FZEA 4J0FA 3RQSA 4GGPA 3AM5A 3Q6IA 3TNLA 4R69A 3WICA 1NVTA 1B8PA 1DDOA 4AJJA 3TZCA 1I01A 1H9BA 1ULSA 2HAEA 3WYCA 3JQ9A 3E5RA 5ICSA 3PHJA 4BNIA 3D3WA 4WOJA 1GZ3A 4R5HA 4OSPA 1WDLA 1IPEA 2EW2A 3ZWWA 4DC1A 4BNZA 3GAZA 3H5AA 4MPDA 1RYDA 3A4VA 3LZ6A 4BGUA 1MC4A 1WXDA 2PKQO 4YRAA 3GEGA 4Z9YA 3U4CA 2OHXA 3P2OA 2GD1O 1GPDG 1ZK1A 1FXSA 1QYWA 4CLRA 2OMEA 1PGQA 1Q0HA 1UAGA 4XYEA 3I9LA 3ZV5A 1BVUA 5IDXA 3H2SA 5G2OA 1UH5A 4OJNA 3NDRA 1YDWA 3MWEB 1PS9A 5IZCC 3VC7A 3AW9A 1HDZA 3QVTA 3FWZA 4XQGA 4RO0A 3OQBA 4WLOA 1ZK4A 1O9BA 5KTKA 3VZPA 1C1DA 2AW5A 1RWBA 2GZ3A 4XGKA 3GEMA 4TRJA 3AI2A 4FFRA 4ALMA 4CQLA 2YFQA 2NACA 5AQ1A 5K6AA 1BWSA 3H9QA 3D5TA 3NTQA 1HYEA 5BR7A 4JXKA 1UP7A 3KVOA 3QVOA 4BV9A 5T6BA 2FPGA 2PWZA 5A05A 3IJPA 4IIUA 1I3KA 4BO7A 4XB2A 4TVOA 4G5HA 3KYCB 4MIEA 4MVJE 1UZNA 2PK3A 3UKOA 1JAYA 3KYDA 3PWSA 1F06A 2HQ1A 2CY0A 2AEFA 3NAQA 5U9CA 3DXFA 4HFNA 3RKUA 2VCYA 3UICA 1JKIA 3ASUA 4ND1A 1PJTA 1I2CA 4NBVA 1WW8A 5G4LA 5B1YA 3G17A 4IZHA 1KEPA 1ISFA 5U4QA 2ET6A 5JC1A 4B3IA 5I7VA 1V0JA 2ZIZA 3IQDB 4A27A 1HSOA 2X5JO 1GD1O 3DBLB 1EFKA 3KHUA 4YCAA 4EUHA 4PRKA 4GI2A 5TT0A 3D64A 1TXGA 2FY8A 3VPSA 4BNTA 1P74A 1MA0A 3RUDA 2NADA 2O2SA 4TKLA 4E30A 2WYVA 4NQZA 3NDIA 3K73O 3BMQA 1I3NA 4EEXA 1M66A 1U28A 2PD4A 3BXXA 4CMGA 3BTVA 4XRGA 4I5DA 5C7IO 5DOZA 3GLQA 1E6EA 4BO5A 3A1NA 4ZQEA 2EJWA 4PG8A 3INRA 1UXIA 4UAGA 5CDSA 3WDSA 3HSKA 2J3KA 1BXZA 4D44A 1O8CA 1Z74A 3PGJA 3S55A 1DSSG 3ITKA 1YQGA 1ISIA 4GGOA 1YGYA 4MDHA 1C3VA 1YB1A 1XKQA 2QX7A 1H9AA 1DIHA 5FYDA 4E4YA 3CZRA 1E0DA 3OICA 3H3JA 4DVJA 8ADHA 1PJCA 3KLMX 4CM5A 1CEQA 5KVSA 1P45A 2GRAA 1VKNA 3DC2A 4E33A 2OORA 4HY3A 4ND4A 4DYDA 4I08A 4ZQFA 3QP9A 4JN6B 1I2BA 1R4MB 1O5IA 1BRMA 3DOCA 4AFNA 1IOLA 4XRRA 2IEDA 2G0TA 3SJUA 4F46A 1KBZA 1LX6A 1U8FO 4YT8A 2QW8A 5EMHA 3PWKA 4BGEA 1HEUA 2FSSA 1C0LA 2A92A 3GG9A 5JAIA 1A4IA 1XU7A 2DC1A 3DZBA 1LJ8A 4CLHA 1SB8A 4HUJA 1UXGA 5JSFA 2P91A 4RLHA 2Y1OA 4BNGA 3KXDA 2VNAA 4DA9A 4G81A 4BKQA 1U3UA 3CUKA 4WLFA 4E5MA 3KRTA 3EY4A 1T4DA 1CERA 2GR9A 3GVCA 1B16A 4AJLA 1NAHA 2B4QA 3ICCA 3O8QA 5K9ZA 1GL3A 2RCYA 3H3FA 2JKVA 4MVJH 2C7VA 1YJ8A 4M86A 3L4BA 2D2IA 3GC6A 3DZFA 3UW3A 4TZTA 2EKQA 2UDPA 1PJLA 2FHSA 4J7CA 2J3HA 1D4FA 5G0VA 3RASA 3I6IA 4O5OA 1JVBA 4C7KA 4GX0A 1B2LA 4HKTA 3PTZA 1KEWA 3CIFA 3WR5A 2Q2WA 5CP8A 3NUGA 4RGBA 4QT0A 4O6VA 5CG2A 4EUFA 3OF2A 4FFNA 3C85A 4MKRA 4YT2A 3IDSA 4DLLA 3F1LA 4QUKA 4AJ2A 1GEGA 3QWAA 1E1KA 1EE2A 2QYSA 2VZ0A 3B6ZA 3O4RA 4NFYA 5TC4A 3U49A 2VRCD 1X7HA 3BHIA 5DF1A 3GUCA 3WSVA 3FBTA 3C7CB 2HJRA 4XIYA 3VKVA 2WMDA 4BO0A 3CEAA 1C1XB 3DFUA 3IMFA 1JW9B 3ZHYA 4LW8A 2E4AA 3PK0A 3GUYA 2PR2A 1ISHA 4YAEA 1BG6A 4QEDA 3ASVA 4IS3A 2GO1A 4O1MA 3TL3A 5JO9A 4TWRA 4L75A 3FTNA 4XJTA 2CZCA 1ZBQA 5HS6A 1IULA 5DP2A 2PD3A 3DTYA 4XB1A 2EW8A 4BO6A 4CM4B 1J5PA 1PQWA 1Q1NA 1P1FA 3GPDG 1UAYA 1KEUA 3FNGA 1Y8QB 4GVLA 3CH6A 4I8XA 1I36A 4CM9D 1GQ2A 4XWYA 3HE3A 1E3EA 4DIBA 2ZQZA 1YQDA 3KETA 3WQRA 1OBFO 5L4NA 1SBYA 4O63O 4OM8A 1UXKA 1QR6A 5DCYA 1EVIA 3WGZA 2RAFA 1XIVA 3EZYA 4UULA 5A1TA 2JD0A 4CQMD 3RIHA 1RKXA 2G82A 2J6IA 1NAIA 1PL8A 1ENZA 1P31A 3DDNA 4BIIA 3LVFO 2VWHA 3RU9A 2VYNA 5G4KA 3T7CA 1MC5A 3OH8A 3RFTA 1R0LA 3DOJA 4XQ9A 1E1LA 1I3LA 4PLYA 1AE1A 5DCUA 1B8VA 2X0RA 1HDGO 3INGA 4WOKA 1WWKA 2V65A 3GH3A 4R01A 4M55A 1ARZA 3IIEA 1DPGA 1HT0A 4MVJA 5JMPA 3ZW8A 2OOSA 1H94A 3DZKA 4FS3A 2C2YA 2VHXA 2HK8A 3W8DA 5JCJD 4R51A 4BNJA 2C82A 5F1OA 2UAGA 4PVDA 1E5LA 2O4UX 1AHHA 1UXJA 4BNUA 1U5CA 4ZQGA 3JQ8B 3F3SA 4IZIA 4YVFA 4YRBA 3KTDA 4ZJUA 4HP8A 3RBXA 2D59A 5GY7A 1CDOA 3U5TA 3TF5A 4DRYA 2PV7A 2C5AA 2GUGA 3VPGA 1TT5B 4WCFC 4GQAA 4U8GA 3UUWA 4L0QA 2H6EA 2Z1MA 1WAMA 3HFSA 3B1KA 1SAYA 1HZJA 2JFGA 3ONEA 3LT0A 3E48A 4A0SA 4Q3DA 5B4VA 5L7WA 1YVEI 1C0PA 3C7AA 3I9NA 4O59O 5CFZA 1YOVA 2NU8A 5T8KC 4WLEA 3JQEA 4H3VA 2CVOA 4BNLA 1TLTA 3R3JA 3D7LA 2Z5LA 2OXIA 1HETA 4DIOA 4YWJA 2IEBA 3VH2A 4GX1A 2X58A 3Q2IA 3TZQA 3I5MA 4L8VA 2H9IA 4WEOA 4EDFA 3QE3A 5COBA 2BLLA 2GERA 3PYLA 2H1SA 3GEDA 1QLJA 3PJEA 2BGKA 5IXSA 1YL7A 3BMNB 1EVJA 3N7UA 1J0XO 3BMOA 3M6IA 3VVBA 1X15A 5TT1A 1MFZA 3PRJA 1LEHA 1DFHA 4LGVA 2DFVA 1MG0A 2GN9A 2C54A 4R1SA 1A71A 5BNFA 4BB5A 3AUTA 1Y8RB 1DIRA 4E21A 4ALJA 2HMVA 3K96A 4I5GA 4IJVA 1IZ0A 1HL3A 1BTOA 2VHVA 4EITA 5L4LA 1R0SA 3GT0A 5F1PA 3RD5A 3EZLA 2HCTA 2R6JA 4KUHA 4E5NA 4F6LA 4KWIA 2HO5A 5TF4A 1NPYA 4WECA 3D3WB 4R1UA 4MVJG 3RROA 1LLCA 4ALLA 3NKLA 1QV6A 4B7XA 1EZ4A 5G0UA 1E1NA 2AEMA 3JQGA 4E2YA 3QV1A 3JQDA 3TWOA 3GG2A 4WE3A 1F8FA 1WNTA 2HK9A 2ILTA 3GVIA 4CLRB 1HYHA 3AFNA 1LRLA 1DIAA 2AQ8A 2YW9A 3GVHA 1ID1A 3I4FA 2GASA 4B8WA 3GFBA 1FDWA 3RI3A 5G0SA 3WLFA 3ZWMA 1PTJA 5JYEA 3E18A 3FWNA 1FMCA 5H82A 2Y0DA 4CMBA 1WPQA 4RZHA 3ZWYA 3L6EA 1R66A 1C1DB 3GDFA 3COSA 3GGGA 1PX0A 2CUKA 3JD4A 4WNCA 4JP3A 4CUKA 5L9AA 4CQLB 1PJQA 4R41A 2OP0A 2VT2A 2AG8A 3VH3A 3QA9A 1OI7A 3QWIA 4PRLA 3EW7A 4J1SA 1B8UA 3RC9A 4PLVA 3KSUA 1ZJZA 3AJRA 3BIOA 1E3SA 4HNHA 4J9VA 3ROPA 4NZ9A 3DFZA 2X0NA 4YJHA 1PR3A 4BKUA 2P5YA 4EW6A 3KYDB 4LVCA 4IDEA 3V1YA 1K6JA 3B1JA 2C5EA 3M2TA 3F5QA 4JX8A 4JJGA 2NTVA 4CM8A 1YBMA 5THKA 3K2EA 5L45A 5BSHA 3EHEA 1N5DA 3WYBA 2ZCVA 4OQZA 1U5AA 4XX0A 3WGTA 3GDOA 1JKFA 3HDYA 4ALKA 1VE9A 2YHIA 3GMDA 2VWQA 3GPIA 2C29D 1P0FA 1P9LA 2NSDA 3LU1A 4CM4A 2Q3EA 1DOHA 2YV3A 5CDYA 1ENPA 5JC8A 1OZAA 3NGXA 1QKIA 1VL8A 3LYLA 3VDRA 4R68A 5GZ6A 1NNUA 1DJNA 5KKCA 3Q0EA 4QSMA 4NJMA 4P38A 4OSOA 3QLJA 4RPLA 3WGYA 3GGOA 2GGSA 1Y9AA 4FGSA 4M54A 1PGNA 1BHSA 5BT9A 2J5QA 2G17A 5KJ1A 3ETGA 2J8ZA 1FDVA 3ONDA 2FPPA 5EN4A 5IN4A 4Z0HO 4D79A 2QZZA 2VHWA 4IQ8A 2E48A 4E5PA 4AL4A 3W4JA 2POQX 1DB3A 3FI9A 1LSSA 1NFFA 2B0JA 1MXFA 1LNQA 4B4UA 2AMFA 2V6FA 4UEJA 2GF2A 4H7PA 2HDHA 4N5MA 4WCFB 5TJ9A 3VZSA 4FR5A 5L3ZA 1HE4A 2JFHA 2WWRA 3OEWA 5CPBA 2FMUA 1R15A 5ILOA 4NI5A 3E5MA 4XQCA 2J3IA 3ZH2A 3ENKA 2EEZA 3V2UA 2NUAA 3I4CA 1SZJG 3BAZA 5KOIA 2B5WA 3SC6A 2RIRA 4CLDA 2AQHA 2P9GA 5I7SA 1H93A 1ZNQO 3NT5A 3U9LA 4CUJA 2DU8A 3GMSA 4E13A 1XDWA 1LBEA 2WSBA 1GUZA 1O6ZA 3EC7A 4FFMA 1EVYA 3DMTA 4PLCA 4Y9DA 3WB9A 3GQVA 3KEQA 4GSKA 2AQIA 3UF0A 4PCVA 3VTZA 1HRDA 2ZB7A 3GVPA 1UZMA 2Y93A 4TQGA 2BFAA 2BH9A 1GQQA 3WXBA 3EAGA 4OHUA 4ALIA 4RL6A 3GZNA 3D5QA 2HKIA 5ER6A 5T64A 5A02A 4IUYA 3Q11A 3TL2A 1QYCA 3CMCO 2JHGA 1JWAB 3O8QB 3DBRA 3U09A 1KVTA 2W8ZA 3KSZO 2J5KA 1R37A 3DWFA 2B69A 1YB5A 3D1LA 4YB8A 1ZMTA 1FDSA 1ONOA 3ZGYA 1GR0A 1CQIA 3Q2KA 1LLUA 3QVSA 4DLAA 2E49A 2NTNA 4NH4A 4ZRMA 2PY6A 3A28A 1K2WA 3T7EA 2YV1A 4E2WA 9LDBA 4GMFA 4BL5A 3GNQA 2VRCA 3T4XA 2P68A 1DFIA 3V1TC 2O48X 2C7GA 3I23A 2IYOA 1PZEA 2Z95A 5THQA 1Y6JA 3ETEA 3OM9A 3T4EA 4PLPA 1GYPA 3VPHA 4JGBA 3N74A 3NTOA 3DZGA 3H5NA 5FEUA 5DOVA 2OGUA 1E3JA 1QLHA 5DULA 2PTGA 3HNPA 3BMNA 5EPOA 1B7GO 2Y0CA 2FZWA 2XF8A 3IUSA 1LDBA 3O38A 1EDZA 4XJSA 2Q1TA 3U0BA 5LDGA 3HG7A 1Q0QA 3LC7O 5TX7A 4AVYA 3KEOA 5ITWA 4CM9A 2HRBA 4BMVA 5JPIA 4BV8A 3JTMA 3NYWA 1EDOA 4Q39A 1Q2XA 1RM5A 1L7DA 4ILKA 2IXAA 1PZGA 3KUXA 4WKGA 2A35A 3TN7A 1V8BA 1ZSNA 1EBUA 4YYZA 1I24A 3AY3A 3VPXA 1FJHA 4FJ1A 1XR3A 1BDBA 1F0YA 3OIDA 2H63A 3UH1A 4CQMA 4W82A 1LSUA 4YT5A 2VWGA 4OAQA 1J6UA 3A9WA 1FF9A 3OHSX 5F3RA 4FB5A 1JWBB 1D8AA 2X5KO 5C7OO 4DQUA 4GLLA 3LT2A 1JU9A 1K0UA 8LDHA 4H16A 3WS7A 3QWBA 4NIMA 5EINA 1E77A 3ULKA 1K6XA 5T5QA 2H5LA 3UHAA 1Y9EA 3H7AA 4EYEA 2ZJ1A 1Q0LA 3NGLA 1BXGA 2D1YA 3OFSA 4IGFA 1NVGA 4UVIA 4U7WA 5TRTA 1F8GA 4BUCA 4J90A 4Q3BA 3UCXA 3FPLA 3VTFA 3C24A 2R00C 1RM4A 3G49A 5K0ZA 4FQ8A 3F6YA 5G4KB 5JW6A 3EGOA 3C3XA 1DLJA 4K28A 1R6DA 5JCJA 3PDUA 4YJDA 1JA9A 3GDGA 4K1LA 3FR8A 4J1TA 3TJRA 2G76A 2NQTA 5KWEA 4EJ0A 2DTEA 3VVCA 2V6MA 3GRKA 2CDAA 3ABIA 3H65A 5EJ2A 2TMDA 1ZK2A 4R4JA 4YRDA 2CSUA 4RJTA 2C07A 3WNVA 2UV8A 2XXJA 4ID9A 4FN4A 3DONA 2Q1UA 3RCBA 3LT4A 4J4TA 1PZHA 4FC6A 5T67A 3ZV4A 1U4SA 4DBVO 1PWXA 2PGJA 1EEHA 1WMBA 5L95A 1I5RA 4OL9A 1YBAA 3AUAA 3U3XA 1QV7A 2QRKA 3KBOA 5HM8A 1MB4A 1YE3A 1Q7CA 2B5VA 1Z73A 2WYWA 1VI2A 3NJ8A 4NJOA 1KIFA 3GHYA 3SVTA 4IMPA 1MFPA 4UREA 1ML3A 3V1UA 2QYTA 3TOXA 1IHXA 3NX4A 4D3FA 1CIVA 5C3MA 4KMSA 3EDMA 1DHTA 4BGVA 1YOVB 4LCEA 2O3TA 1H5QA 3RUFA 4CMCA 5DDIP 4JJIA 3Q9UA 1H6AA 4W99A 4XQEA 3D0OA 4M49A 3ENNA 4DPLA 2ZB4A 3I1JA 1B0AA 4Z3DA 3DMTC 3H9GA 5CHEA 2WYUA 5G0TA 1VPDA 2PLAA 4B8ZA 5EERA 1NFQA 2VT3A 3BMOB 3WTBA 1BXKA 2X7HA 4PZDA 4XR4A 4WCFA 3WNQA 4AJKA 3VZRA 1HDCA 1JDJA 4MO2A 3JYLA 3DZHA 3FR7A 4XA8A 4B3HA 5IXYA 4RF4A 1GAEO 3HN7A 3ZZNA 3KM0A 1BMDA 1FDUA 1LUAA 1IL0A 1GFSA 1VSVA 5L40A 4CM3A 5T8KA 3LC1O 3TZ6A 2GNAA 3E8XA 3K5PA 3JYPA 1JKJA 4CPDA 1F17A 3AY7A 3PQDA 3TFQA 1EUZA 5AOVA 1QYXA 3DAPA 1L7EA 3JQBA 9LDTA 4Z0TA 4OH1A 4MIYA 2PA3A 4W7IA 4AJPA 4A7PA 4D3SA 3OSUA 1RPNA 1ZW1A 3AM3A 1P44A 2VUUA 4PLZA 3S2IA 3W1VA 5JAMA 3JQGB 3QWHA 4W9NC 1ZZEA 4B4WA 4BO9A 1KVUA 4IY1A 4J4HA 1M76A 1M2WA 4D43A 4AJHA 4YAGA 1PZFA 1WLYA 2HUNA 4ITUA 3WGHA 4NPCA 1DIBA 3CTMA 4TZKA 2Y0EA 4YPOA 3RUCA 3PJGA 4P4LA 4Y98A 2Y99A 5CDUA 5H81A 5A4DA 3RC7A 1RM0A 3PPIA 3X2EA 5L7TA 4KWHA 1U1IA 4E2XA 2DTDA 3KB6A 4DTIA 2EGHA 3I9OA 4IDCA 2O3SA 3ZV6A 1HSZA 4WUVA 3GRPA 2O50A 2CD9A 2W2LD 4CLOA 1B14A 2Y67A 3VH4A 3OMLA 1E92A 4EJMA 1VLLA 1Z45A 3H9EO 2EP5A 2NVWA 4P4GA 1OC4A 4DMLA 3IC5A 1EUCA 4ZVVA 4DL9A 4II3A 3K92A 2YV2A 4GH5A 1ISMA 3PXXA 4M8SA 1W73A 2ZATA 4YJHB 5IDWA 4CM6A 4NHEA 4IQ0A 1ADGA 1UUFA 3MOGA 2FR1A 2VZ8A 1PEDA 2PZKA 4XGIA 2EHDA 3H8VA 4CM8B 1QYDA 3HUDA 4DMMA 2F00A 1NYTA 4ZA2A 1ADBA 5AYVA 3VKUA 1P1KA 3JD3A 2Y1EA 4YAJA 4PN3A 3EVTA 3GOHA 4CV2A 1CETA 3QQPA 1P1HA 3IS3A 5EIOA 4BO8A 2AHRA 4IINA 1IE3A 2RH4A 3QRWA 2YHIB 3QSGA 2QIOA 5KJCA 4ZHSA 1CYDA 1GYRA 3MJEA 4WGGA 2HRZA 5AXCA 1E3IA 4WK6A 1NXQA 3PQFA 4MIOA 3UAGA 3OJLA 3OJOA 3WG9A 1I8TA 1OOEA 2NNLD 3SLKA 4BKPA 2EERA 2XOXA 2VZ9A 1Z75A 4Y8VA 4DBZA 5JFOA 4NJMB 2PD6A 5HBRA 5CDGA 4J2HA 3JYNA 5BQFA 3ADOA 4FOSA 1ZIDA 2BFOA 2NLOA 4O0LA 4ZN6A 3ROKA 3E6AA 5LDHA 1VJ1A 3TSCA 2HMTA 1LTHR 2GSDA 4U0JA 4Z9FA 4TVBA 5A3JA 2EF1A 4DWVA 3ZI0A 2JCYA 4OMUA 3G3EA 4TRNA 4IDAA 4FGWA 4N5LA 4KP7A 5I9MA 4PFJA 3JYOA 3H6KA 3RJ5A 2I6TA 5KKAA 3RKRA 5BSFA 1DBVO 3F1KA 4EEZA 3MEQA 1XEAA 3JD2A 4J43A 4ZQBA 4BQPA 2D5AA 1C0KA 2OZPA 1TT7A 4D0SA 3WLEA 4YR9A 1U7TA 2J3JA 3RWBA 2JFFA 1ZO8A 4XCVA 4IMRA 3Q1LA 3I83A 2YQ5A 2X9NA 1OC2A 2DKNA 4R9RA 1GV1A 1O0SA 2NVUA 3GHHA 1GY8A 4KTVE 4E5YA 4Y6PA 2VYVD 1G0OA 4JBIA 5KVCA 1VL0A 4EUEA 5G0WA 3QY9A 4RPJA 1LQUA 4BNFA 1P1RA 1EK5A 1GPJA 5A03A 4RVHA 3S2GA 3SEFA 4NFHA 3GZNB 2QRJA 3B20A 6ADHA 3AU8A 3WWYA 4NBUA 3FN4A 3PYMA 4Q3CA 4EZBA 4G65A 4ND2A 3DBRB 5TJHA 2PKQP 2W2KA 4FD3A 4AJ1A 1N9GA 2YJZA 3FCOA 4RPKA 2Y68A 4P8RA 3D4PA 1C14A 5ER9A 2QRLA 2I66A 3VH1A 1R12A 1I32A 1E7MA 1HWYA 1KETA 1QXSA 4QFCA 5IDQA 1SMKA 2ZB8A 2PH3A 4LSWA 3HZZA 4B4OA 1ZH8A 4Y6SA 2WEKA 3O9ZA 2ZCUA 4FOOA 2GLXA 3S2EA 2Q45A 4MP3A 3ZWPA 1CF2O 2ZTMA 4L4SA 3ZNPA 4OXNA 1X14A 2JJYA 1DXYA 4AJ4A 2I3AA 3B1FA 2P4HX 5CPFA 4XYLA 1ZCJA 3OJFA 3BHJA 3U4HA 1X0VA 3JQBC 1HXHA 3L77A 1GU7A 4DYVA 4RVDA 3ZWOA 4NDNE 3ZHZA 2HJSA 4CM7A 4DC0A 4NMHA 1ZMOA 2WDZA 4KUEA 2V7PA 1T1RA 1NTOA 2DFDA 2O3UA 2W4QA 4IPTA 1KOLA 4PZCA 3IKVA 1D1TA 4KUGA 1MXHA 1T25A 4KQWA 1P33A 3DZIA 1W0CA 1XSEA 2I65A 4PLWA 4MVJF 3WMWA 3LLSA 1PJ2A 3L9XA 4FBGA 4BKOA 2JCXA 1NR7A 4M87A 5HTOA 4BOYA 5TNXA 2UUPA 3GAFA 1NWHA 2BD0A 2Y1GA 4RDHA 5AXAA 1DC4A 4B3JA 3VHRA 2ZYDA 3CPSA 5JY1A 4CQMB 5F21A 3BHMA 4ZD6A 4TMFA 1ZKMA 2ZYGA 4TROA 4UVDA 3STHA 3LLVA 1QYVA 3KOUA 2X23A 4J91A 2WM3A 4HADA 1ZJYA 3EMKA 1DRUA 4E32A 3UFXA 1NQ5A 3V2GA 1MUUA 4BNHA 2QG4A 4PLHA 4YXFA 5J23A 1AXGA 1DRVA 4R1NA 1CQJA 3BA1A 4A73A 4BNNA 5JDIA 4JQCA 1E3WA 2FPIA 4XEHA 4WCDA 2G5CA 3E82A 4L4XA 1H6CA 2NVBA 3WWZA 3ZN2A 3EK2A 3JQFC 4JROA 1BXGB 2FP4A 5A5FA 3OA0A 1UP6A 3BZUA 3E9MA 3DHEA 1DFGA 3F47A 4PLGA 7ADHA 3IOYA 3H2ZA 4ZU3A 2O3QA 1PQUA 4QQRA 4MVJI 1XCBA 5A3VA 3G79A 3K9QO 3WGGA 2BHLA 5TS3A 3LSYA 3GF4A 5L4SA 5TLSA 2DQ4A 3A06A 3IUPA 2JCVA 2QZ9A 1UXHA 3VZQA 2FR0A 2XPCA 1HTBA 5DZSA 4CV1A 1E5QA 1KVSA 1O95A 2VRBA 4XDZA 3BYZA 3G0OA 2VUTA 4DUPA 1ISGA 1U7HA 3ANNA 1Z7EA 2AG5A 1WP4A 1PL6A 2Q46A 4BNWA 2JHFA 4NNJA 5JAZA 1SO8A 1NBOA 4AJNA 1AHIA 2ZJ0A 4C7JA 4MJLA 1YQXA 3VAZA 4D42A 3ROQA 3L07A 1AN9A 3MJ4A 4I5EA 1JN0A 2VTDA 2I3GA 4HX5A 1BVRA 4QO8A 2R00A 2X5OA 2X8LA 4QTZA 4QECA 5CEJA 2FOIA 1LSOA 4Z0PA 2O3RA 3MJVA 4QX6A 4I9UA 2WD7A 3HDJA 4BO3A 5AVOA 5JE8A 1KS9A 4BNMA 4C4OA 2HMWA 4D7AA 1E6WA 1PWZA 1ZK3A 1UDBA 3OECA 1N7HA 4BGIA 2I76A 1LDNA 1HE2A 1R4NA 4J7UA 4Z9XA 1GTMA 3JQAD 4BNYA 4XDYA 3OEYA 2VOEA 4LSMA 4LRTB 2BELA 2Q2VA 3M1LA 4BNVA 3NT2A 3D4NA 2J5RA 2AE1A 2Y05A 4R54A 5I8ZA 4L73A 1U3TA 4ROSA 3TDKA 1TI7A 3I3OA 5L51A 1BW9A 3ZWBA 2Q2QA 1T2AA 1HE3A 1KC1A 1W6UA 3GN2A 4TRMA 5BNTA 3GNTA 3ZWNA 4ND5A 4OYRA 5I9NA 2VOJA 2VWPA 1XQ6A 3WBFA 3M2PA 3ZDFA 2CDBA 5BSGA 2ZYAA 5KJFA 4AICA 3PHIA 3PHGA 3MOIA 1OMOA 4IS2A 1XG5A 3PZRA 4D3DA 1LSJA 4CR8A 4GKVA 4IBOA 2C2XA 4PG5A 1H0KA 5ILGA 4NU5A 1IHYA 3MTJA 2O23A 1DAOA 3VOSA 5F1KA 1N1EA 1PQPA 5I7FA 1KY4A 4RORA 5DBIA 2NM0A 1ZEMA 2OBNA 2EIHA 4XZ3A 1I10A 4DIFA 4UVHA 1PR9A 3KSDO 1WDMA 2BFMA 5I8WA 1NM5A 5LCXA 2XXBA 3DMYA 4QFDA 2V6GA 2HMSA 3W8FA 4IQGA 1T24A 1TA4A 1SOVA 3FTPA 2YFHA 5BNIA 1W4ZA 5JS6A 5B4UA 1QORA 3A14A 4R1TA 3QJ5A 4W6ZA 4W7HA 1VM6A 5EL0A 1QSGA 4MVJP 3CMMA 3I52A 4OIMA 5C5IA 3TOZA 4GL4A 4IDDA 2PZMA 1DO8A 2EGGA 4KOAA 1PGPA 3N58A 4FW8A 2AEJA 2ZB3A 4HFRA 2YHUA 3LT1A 1IYZA 3I6QA 4EJ6A 1J4AA 1JLLA 4MINA 1A7AA 3PVZA 3RFVA 4BVAA 1EE9A 1GUFA 1MGOA 2LDXA 1E7RA 1B26A 5DP1A 5FI3A 1SC6A 3RC1A 3ANMA 1GYQA 1YBVA 1GQYA 2O4CA 3LDHA 4UUMA 2YYYA 3KZVA 2EKLA 5TQVA 1YJQA 2Q1SA 3WGQA 3ANLA 5JNLA 5DT9A 1WZIA 4CLOB 2R2GA 4LRSB 4CLEA 5A9SA 1ZFNA 4FDAA 1A27A 1NQTA 1VJ0A 1X13A 3CINA 3LF2A 4EGFA 4CMEA 2OUIA 1B3RA 2PGLA 3WJ7A 1A9ZA 4W9NA 2GDZA 1X1TA 3KO8A 4INAA 1HDRA 1UZLA 1HF3A 1U3VA 2JL1A 3LK7A 1V6AA 5KJ6A 3GNSA 3LQFA 4OKNA 4F3YA 3FD8A 3WMXA 1QG6A 1NWCA 4NU6A 3WJAA 3OIGA 3HFGA 4A2CA 4UVEA 2E6UX 3B70A 5JDIC 2RH8A 2JAPA 3GY0A 4PG4A 3AM4A 5B37A 3ZWXA 1DC5A 4TSKA 4K6CA 4B4VA 1PL7A 5JBIA 2BI7A 1R16A 3GK3A 1JVSA 4E12A 1XQ1A 1ZXLA 1SOWA 1OFGA 4PGFA 1LRJA 3RVDA 1MLDA 1O89A 1SCUA 1ZXBA 2B4TO 3L6OO 1ADFA 5FF9A 4U5QA 1ADCA 3H9JA 2PH5A 1MV8A 1KEVA 3DOOA 5TIIA 1DEHA 3GGPA 3UXYA 1NFRA 3BMCA 4I9NA 1NX6A 1G1AA 1YL5A 3RAJA 1AGNA 1RM3A 2IZ0A 4XGNA 4PZEA 4DQVA 4J9UE 1KY5A 1B3BA 3JCZA 3NTRA 3O03A 4P22A 3W4IA 4OKIA 1H2BA 1T2EA 2B4RO 4KTTE 4OGWA 3CZMA 1H6BA 3WFJA 5JY6A 5A04A 4D41A 3IL2A 1IUKA 3FBGA 4Q3EA 5LC1A 3GA0A 3OJEA 4FSHA 4W4TA 1LDMA 1ENOA 4JCOA 2UUOA 4BB6A 1LLDA 1I30A 2WJPA 5U1PA 4OO3A 2VYVA 3ZU2A 1LXCA 3WX0A 4DPMA 3DZJA 4IXWA 5A9TA 3OA2A 2Q50A 1T2CA 3ON5A 3ICPA 2DVMA 3DBHA 2BRUA 2YDXA 3FNHA 3AUUA 1N8KA 5JAQA 3I9MA 1LC3A 1JAXA 3P5SA 5DN9A 3HN2A 1ONNA 4A5OA 7MDHA 2SCUA 1DC3A 2V6BA 4WNIA 2CVZA 3W4KA 3U4IA 1LC0A 2NVUB 2A4KA 1QRRA 3PQEA 2D3TA 2AQKA 1YKFA 4I9HA 3SJ7A 4H15A 1M6WA 3OP4A 3JQ7A 4K6FA 3TZHA 3DR3A 1GADO 4E5KA 3ROMA 4AJEA 2UYYA 3I9KA 5HRUA 5A9RA 1M67A 3QW2A 3QIVA 4XKJA 1CJCA 4B7UA 5I7EA 2RBEA 3S1LA 3C1OA 4N5NA 3GVXA 3ZHBA 1K89A 4OQYA 3DO5A 3K8ZA 3WBBA 3OBBA 1YDEA 1HKUA 3SBOA 5TGDA 4KQXA 5IFLA 2W2KB 4LISA 3K6JA 4K26A 1P0CA 1N9GB 3S2FA 1Y5RA 2AXQA 4CV0A 3V5NA 1YXMA 3MJTA 2CFCA 2DUWA 3JYQA 4KDEA 5A5EA 5FWNA 2VN8A 2B35A 3UVEA 4LMPA 1XYGA 3ZW9A 2IXBA 2I99A 5ADHA 1EVZA 3ST7A 5GMOA 5F5LA 5H83A 3W6UA 3EYWA 2X0JA 4YA6A 3VDQA 5ENVA 4GWGA 5L7YA 3BTOA 5FFFA 1DC6A 2O2YA 3E9NA 3PIIA 2Q1WA 1UJMA 3H4VA 3JD0A 2NU6A 3TZKA 4FJ0A 4CM1A 5I9LA 1KYQA 4E0BA 4IDGA 4J0EA 4XYBA 1ZSVA 1SNYA 4IDBA 4QXMA 4ZQHA 3F5SA 1B15A 4YACA 4J49A 4OOEA 4CR6A 4GWKA 1LU9A 1J49A 3RUAA 2YY7A 3SX2A 5IG2A 1KERA 2EJVA 3O26A 3NT4A 2RHRA 1PSDA 3WGOA 3ZHXA 1DRWA 1G0NA 3NRCA 5C37A 1UR5A 4CMKA 3DAGA 5KVVA 5JLAA 4JBHA 4A26A 4HBGA 2C59A 1I3MA 2FRDA 3GN1A 1CRWG 4J6FA 4UUOA 1PIWA 3F4LA 4E6PA 3EUWA 5EQFA 2F1KA 1K6IA 1NQAO 3NEPX 1TVEA 4ND3A 4ONEA 3RJ9A 1SEPA 1VKOA 4YJFA 3RFXA 5BSEA 4JK3A 2B83A 4FIZA 3DHNA 4RPHA 1RYEA 3WIDA 5DBFA 4BO1A 4CMEC 1ISJA 4R3WA 3OIFA 3Q9NA 1ENYA 4RQTA 1E3WB 1NR1A 2NU9A 3GFGA 1ZUD1 3WGIA 1M6HA 2C0CA 4J1NA 4TRRA 1N7GA 4FCCA 4YDRA 1EBFA 5IJZA 1G6KA 1DJQA 3F4BA 4GAEA 4RF3A 3SLGA 1O94A 3DQPA 1VL6A 5JO0A 3PYXA 3JSAA 2DBZA 4N18A 4JNKA 3AOGA 4NK5A 2DTXA 1Z6ZA 4N7RA 4RF2A 3DL2A 4CMIA
chains in the Genus database with same CATH superfamily
1I4DD 3OKCA 1O6GA 4CL3A 1JIVA 2FWPA 2NQ2C 3OEHD 4H7EA 2YY5A 2GH1A 1E1DA 3MQFA 5DLEA 3T52A 3V8BA 1L5SA 3LO8A 4KITB 1IN4A 3ZQ4A 1OBCA 1TA0A 3L0DA 2ASEA 4X24A 3OF5A 4BVLA 3BIJA 4WLNA 1R0KA 5D6OA 4HDKB 1RZVA 5IUNC 2ID8A 3UFBA 4TMXA 3EGDA 3JQFA 1P1IA 4X41A 4BUJA 3N2GA 4EG6A 4D9NA 2FZCA 1V2HE 3C8DA 2FSHA 3G8YA 2R3SA 3NM5A 4LE0A 1OV4A 1ZRMA 2FWJA 1L4NA 2ZBUA 3DP9A 3R3SA 5AHXA 3R7LA 4FVTA 3PHLA 4K40A 1WABA 4P3OA 1ID8A 3B3GA 3EQ2A 3EC1A 4RHTA 2Z9DA 3WYEA 2H4FA 4FYIA 3TLMA 4JI7B 4I6EA 2Q5IA 5COQA 1IXSB 1SR8A 3G82C 1LLFA 4KIFA 5JEEA 4PZ9A 4GYWA 2IS6A 2JIPA 1KGSA 2JVJA 2QTWB 3R0QA 3EGEA 2C8VA 1L3IA 1XRSB 5J40A 1UFOA 3J81A 1QC5A 4KLCA 1BA3A 1GARA 3QV2A 5DWQA 4M0PA 3PC7A 3ESDA 3AFMA 4GXRA 3QHAA 5LOVA 1E9BA 3QE0A 3SF8B 4P6VF 1EWYA 1Z38A 1UWKA 1Z4IA 4TTTS 3WY9A 1QE5A 3UA4A 2AE2A 1X0XA 2DLNA 2BRUC 3DA8A 1X7XB 1F8UA 1A50B 5JU6A 1BW9B 2O2DA 3W34A 3QF7A 3DB2A 1ZHHA 3CEMA 3IT1A 4NG5A 3ZZMA 4ZGWA 1JSRA 1XRMA 5BV1A 1DQNA 4L07A 1OWNA 1E3LA 1GKIA 1IAVA 3GR6A 5JVDB 2BFWA 2YQ4A 3KDAA 1OHHD 1PU2A 4PZPA 1SXJA 1JU4A 5TEVA 1N3IA 3BN3A 4BN4A 1Y89A 3WLSA 1ZJ4A 2CXOA 5HE9A 4BKRA 1TZCA 5B30A 5KCZA 5AK6A 2O8NA 3HY3A 4GVXA 5K6AC 1XI2A 2I80A 3EG5A 2ZJYA 4K9MA 4FLFA 1C5KA 1V3TA 4QO7A 4A15A 3PDIA 3LHSA 1C9KA 2H1WA 2DUJA 3I04M 1F5SA 1MT0A 1XU4A 3TMAA 4OBBA 2XDYA 4FU0A 4OV6B 4RH1A 3UMBA 5ADWA 1ZN8A 1KO5A 2ZTVA 1RRGA 3O9VA 4GPD1 4Z4QA 3PGVA 1EK6A 2QIPA 5D6NA 2ZBPA 1E6CA 3PKIA 1OKKA 3AWDA 2OL4A 1W59A 3HCFA 1W44A 4EB8A 5LP6A 1KDOA 2V74B 4YO8A 2I4TA 2QVXX 3FW1A 3AKYA 3ZBQA 1NHWA 2X77A 2OHJA 3RANA 2I5PO 3QYFA 3NHMA 1RLOA 1XCGB 1XVUA 2QD5A 3KZMA 3MUOA 3PLRA 5FL3A 5K1ZA 5ELLA 5A04A 4P08A 1Z68A 2F2TA 2PZJA 4G01B 4NMLA 1OFUA 4V0ME 1TTHA 2SHKA 3ELBA 4H0FA 3C39A 1E7SA 3RSHA 4GZMA 1ZEJA 2PRSA 3ZGOA 2I4LA 2V3CC 4JP2A 4OHKA 5JXWA 4QXPA 1YOBA 2FLWA 2HWXA 2PVCA 3DE0X 4LMAA 4MYDA 4CEHA 3KZOA 5B12A 1F3OA 4FFOA 2PL3A 2QTVA 5LQJA 4R71A 3HZOA 3ONFA 1NHGA 1QO0D 1KFBB 1THMA 3CLRC 2VP9A 5ALFA 3IEVA 3L7AA 1QX4A 1AA9A 1G4UR 1FCJA 5B4TA 4YEDA 2ZVJA 2ZI9A 5EIFA 1Q7GA 3MWJA 4KQEA 3WBJA 4AF8A 3FSRA 4HQRA 3LFTA 3T12A 2MMCA 5T57A 1UEIA 1YS4A 2JJ2D 2XB9A 4AN1A 1RLTA 1R6UA 1WG8A 3DBLA 1YH3A 1HE5A 4RELA 5DNCA 3P9XA 5KYXB 3AXTA 4KMRA 4Q3AA 3SBEA 1J8DA 1NPDA 4PIVA 3QBVA 4EI2A 1Q0SA 1OXXK 3ACBA 2BMAA 1JB9A 2DAPA 221PA 2GVDC 5IN5A 5DN6D 3SDSA 1R6AA 2OCLA 3N2YA 3O8DA 3THOA 1WVGA 3H4TA 1S4MA 4D9JA 4GPEA 2ZRKA 2XQVA 4K6GA 5KJEA 1C2TA 2P0YA 2YJTD 2Q3JA 4O08A 2HJ9A 5ECWA 3ZWCA 1OGYA 4N7MA 2ZITA 3UUEA 2GN8A 3QLUC 2CLMB 3C5EA 3I01A 4KYTA 3SKVA 4KE8A 3RE1A 1WW3A 1X7GA 2BGIA 1FFBA 3LF1A 5CB6A 4U8HA 3C1TA 2J59A 4JLOA 1UJ5A 3GOQA 3ZGYA 1N57A 4HEHA 4KSBA 3UWSA 2GZ1A 4YYEA 1EFHA 4CT5A 2AFVA 1BCRB 4S3MA 4DV5B 1RRMA 2LP4Y 1E6KA 2WABA 4OFBA 5K4HA 1HPLA 3VPCA 4UVGA 3RC8A 2H5EA 2ZGVA 5IAOA 3A2KA 5D7BA 5CEFA 5KB3A 3A1VA 3QOXA 2IIQA 1FNNA 3HABA 5AKHA 1GZHB 2SKDA 5EMKA 5F64A 1O94C 4Q19A 2ZTUA 1VJCA 3SZOA 2OV3A 4C20A 1D7OA 4FC7A 1XMVA 5DHUA 3EOAI 2QPAA 1W4RA 1X1AA 5F3DA 3SF0A 5ICMA 4L51A 3SX0A 1T2DA 3AK4A 5HOQA 1UOEA 1PV4A 4Q4LA 1VZ3A 3E61A 4EH1A 3UXMA 2O1SA 2P9EA 4JSRA 2HMUA 4YP0A 3RRFA 3WLTA 2DPXA 2VHZA 2UVPB 3ZGLA 2WSSD 3L4BC 4Y2UA 5GJCA 4AK9A 4C88A 2ODPA 2C5SA 2PFSA 4CF5A 1EB9A 4RIFA 3ODPA 4FYJA 2QF7A 5CMLA 1S3FA 4CKBB 1XOIA 4CGYA 3MWDB 5LIRA 1V9CA 4N76A 1UIRA 2VF7A 2EXXA 2JAXA 4QYXA 1XALA 2HJVA 2JGNA 1GSAA 4B76A 3FPHA 3A58B 2FK7A 4C3VA 5HMLA 5KNLA 5FPHA 3M9WA 1FYEA 2DPGA 4UNSA 3R20A 3FCAA 1P3DA 4KHPB 3LXXA 4MULA 3VJKA 3JAWB 3L7MA 5H70A 2HNBA 5DSXA 3K31A 2BEVB 3E53A 5DCLA 4F3CA 4PS1A 1KVQA 1QS0A 1S8FA 4UNPA 3SYNA 4M0DA 1A2OA 3T41A 4QPCA 3G1WA 2R84A 3H5RA 4QBTA 2IVZA 3DTTA 4EVQA 1IXRC 1IZ7A 1KHTA 1V3VA 4UHKA 5EXPA 4N01A 3UOWA 3GP5A 4JODA 3EIXA 3MZ0A 3QKRB 3CNQS 4YGYA 2YWJA 1B00A 1LW6E 5KQPA 1TB4A 2BMJA 1N3LA 2IRWA 4AQYB 3ZWDA 1JT9A 2M6SA 3ABOB 4MICA 2ZTLA 4CNQA 2CN1A 3SYTA 5FNVA 3SXPA 3WI7A 4RTOA 4DPKA 5JMWA 4N5IX 3K70B 1GUYA 5J4VA 2X0IA 4I55B 5JADA 3RSLA 3JQ7B 3EXAA 4WX2B 1G17A 3DUWA 5C80A 3GD7A 3M5PA 3PCRB 4O4JF 4QM6A 1TZJA 1XZFA 1MF7A 3D6NB 4G2TA 4OFWA 3FPGA 3A1UA 5JTUA 3OPVA 4YAKA 1HYGA 1V48A 2VPXA 3PLNA 2FE1A 4YRFA 5CH5A 3TLBA 2C95A 4MGZR 4P7GA 1VC2A 1WPXA 4BHTA 4GX5A 1V35A 5DSZA 4DLXA 1HT3A 1RRFA 3DDWA 4L6AA 1EMDA 3L7IA 3CRQA 5ED4A 3EA5A 1V5EA 5JSZA 1A5SB 3H42B 4BAGA 1FP2A 3A4TA 1L6IA 2ERYA 3NC4A 4HNRA 4BC0A 3FPSA 4JKIA 5M5BA 2HU2A 1E9EA 3VI3B 4LQ4A 4OPMA 5IZCA 5M7EA 2B1JA 2QTFA 3JARB 5FJJA 5C1DA 3V4PB 5LZ7A 2JD1A 1RPJA 3REOA 4GQBA 5CB4A 1BNCA 1MNQA 4EYSA 4HDQB 3GLGE 1C1HA 3QM1A 5JNRA 3EVZA 1N1GA 3KKNA 3OMXA 4B9EA 4HWGA 2Q5QA 4DR6B 1XAHA 1JHVA 1MX3A 1X7DA 4G0MA 1JIJA 4P84A 4RVGA 1WCIB 3F46A 5DHRA 3WOHA 2OBMA 4G67A 3QVGA 2ZREA 4M8IA 2IYLD 4RABA 5A06A 3KDPA 1G8SA 3PDJA 1PJBA 2WWWA 3ZJTA 2NU6B 1WCV1 3EWSA 3W79A 4C05A 1Y8QA 1HDIA 1BJRE 3WLAA 4HXGA 1KAGA 1CDZA 5EE3A 1XJ5A 3LTNC 1GIAA 4QOGA 3I37X 4A2PA 4QUHA 4R7GA 2VHJA 2WJJA 2N46A 1WB6A 1E1RD 2OCDA 1KZ9A 3D7NA 3K1TA 4MMXB 4MYUA 4CMJA 1PS0A 4GMXA 4L6CA 4XD2A 3ZHOA 4KDFA 2HZ7A 3X1DA 4R98A 4D9GA 1JPJA 3GH1A 4EZIA 3G88A 4NQRA 4MNTA 2CGEA 5FR2A 2O1EA 2BEUA 1XEXB 2PKRA 2GK3A 1ZISA 5LP1A 1ZLXA 2RK6A 2XTMA 4WH0A 3RUEA 2F67A 5HA5A 5AW4A 1XCPA 3W8EA 5HKBA 3CE6A 2IZ1A 2ZI3A 4F8EA 3IAEA 4AAYA 3NC1C 2V58A 1DU4A 2Z6VA 4AF7A 16PKA 2AC2A 2H3EA 1XLTA 2VA9A 3AB7A 4Y2RA 4Q4HA 2YZNA 1NSFA 1VJTA 1WDKA 1GFIA 1I2ZA 1LCIA 1Z6YA 2YL2A 3LUAA 4A03A 4P58A 2BKEA 1NRXA 5CB0A 3I2JA 1IBLB 1XJQA 4FD2A 5KYWA 4WASA 1P9NA 1V3UA 4KREA 3ZXYA 4QU9A 4PFSA 3IBTA 4MRSA 4ZO7A 5FNZA 1X1EA 5FX2A 1KZ6A 2DJ5A 2DWUA 3BTUA 3UOAB 1XZGA 2PA0A 4GPIB 4RK5A 1IY8A 1GZ6A 1NXVA 3PNBA 1FP4B 1QGUA 1U2PA 3PA8A 3ZQKA 1D4OA 1BIFA 5DM1A 1THGA 4JENA 1FL9A 3TRIA 4Q24A 2WOJA 2HCBA 2MT9A 3OEHA 3O2NA 5HKAA 2VFAA 1YJXA 3E05A 3IP1A 2C8KA 1ZM3A 1YKGA 3R9IA 1P4SA 2ZE7A 1LQTA 4GLOA 3TIVA 2GX6A 4LF5B 2WPDD 4R3NA 3FXAA 3EPHA 5D3KA 3D8BA 3RBZA 5COAA 2BOVA 4MWGA 4I6JA 1SC3A 2W43A 4DMHA 3GPBA 3A9RA 3BS4A 5EQDA 3G7UA 1TO2E 4LYAA 1U1GA 4PC3A 3SC4A 3X0DA 1T3TA 3IUYA 2YX1A 1AGRA 4B48A 4CMIB 4CF3A 4PQFA 4ME6A 4PLTA 1GAJA 1F0KA 2O06A 2FQXA 5HFJA 4CR7A 3WFIA 3ZNQA 1RQGA 3SNHA 5AIAA 1G6Q1 3CXUA 2BR3A 1SU7A 2N3ZA 2HRRA 4PXAA 3ZK8A 4D9IA 4EJFA 1VLQA 2ZTHA 4MITA 2WF7A 4YJ2F 2OYRA 1P2TA 2IYZA 3EQ8A 5F1YA 2ZSKA 1Y48E 3BXEA 1RBMA 3EGDB 3FUWA 3OHMA 5CURA 5ITVA 2EZ8A 2ZAMA 3BH7A 1EIWA 3WE7A 4LJAA 4EB0A 3MOSA 1U8XX 2AR9A 5CA1A 3GLKA 5DIFA 1NUTA 3BIWA 4YTEA 3RTAA 2RC5A 4G9BA 3WAGA 3L1IA 3ZWVA 4Y6OA 4TXMA 1G3QA 2NV6A 5CT5A 3T7KA 1SWWA 4ACBA 3HADA 2CNBA 2FSFA 5J1TB 4CTJA 3WZ2A 3O8BA 3EDQA 1IWPB 2FEOA 4ZALA 1C80A 2B1IA 3M6VA 3WHLA 2WIJA 4WNAA 1K5HA 4CGZA 2X9GA 5JASA 4C2UA 1UBNA 2GFIA 2GHTA 1IRXA 1BMQA 3EVNA 1M2EA 1T9AA 1VSUA 2JATA 4HDSA 1F14A 4TGLA 1U2GA 5DTJA 4Z3KA 3K05A 1QC5B 4DKJA 3PSAA 5E2AA 3F78A 4WJZA 1QZXA 1OHHA 4JH0A 2WE7A 3TIXB 4LAFA 5LOVB 5M04A 1XBTA 2VBGA 5KTRA 4J94A 2PDAA 4QVGA 4A0FA 1W93A 4KU4A 1TEZA 1NVFA 1KMIY 3TSYA 4FZ3A 3LX4A 4XQ0A 4PG7A 3PI7A 1P77A 4ZRNA 4GOLD 1IMJA 5KPDA 2HNKA 1A4UA 2QG6A 3IPCA 1NW4A 1QUFA 1A9QA 1P60A 1ZOOA 5KOJA 1SEVA 3ESYA 1KJYA 2FZEA 3IP3A 3TNLA 1AJEA 3R7WA 3CZAA 3BDIA 1NVTA 4LXYA 5CCBA 3A04A 2PBLA 3LMKA 3TZCA 1J8FA 1I01A 1PJ8A 1SXJB 4LBWA 4MXDA 3K4PA 1U94A 4E1AA 1J5EB 2QX9A 3JQ9A 1XYVA 3IQFA 2OC9A 2LWIA 1JR3E 4MLPA 4WOJA 4TXHA 3O82A 1B6SA 1AY0A 1GN8A 3AR7A 1L8OA 2JFPA 5DYGA 3ID6C 4C6RA 3PDIB 4BE7B 1JHAA 1R64A 5EUCA 4CDGA 1IVSA 3BXPA 1Z0FA 3JZMA 1NV8A 1QNFA 1IEQA 3H5AA 4MPDA 1CNMA 5ALDA 4BGUA 1MC4A 1L7PA 1BH2A 2HIHA 2PZBA 5IRCD 3RO7A 2FPMA 3GEGA 1U8EA 4Z9YA 2OHXA 3LV8A 1NP7A 1ZK1A 2R96A 4TYWA 3WL8A 1FXSA 5H3HA 4ZT5A 4CHGA 2LIVA 1UAGA 5AI9A 1QFZA 1JKXA 1SUBA 2NZXA 3I9LA 4OBWA 5LP6B 3RS9A 4KQGA 4ENSA 5C4IA 1L5MA 1ML4A 3DVAA 2Q8QA 2HMAA 4JSTA 4OJNA 2IEAA 2OV6A 1F6DA 3N7AA 1DCFA 1QO0A 1KDYA 3ICVA 4RVCA 3WGMA 3QVTA 4DIEA 1CQPA 1SBIA 3FWZA 4MZXA 4XQGA 4RO0A 3FGZA 3AR5A 4PO8A 3MAAC 3UA3A 3GP3A 1VB5A 1AU9A 2P65A 2Q62A 3HRKA 2GZ3A 3L1UA 4FOPA 5KTKA 1WMDA 2KMLA 4TRJA 1L8QA 4FFRA 2P1DA 1CJVC 3B3QA 3GPCA 3BA6A 2GCIA 3H9QA 2JJ2A 1Z18A 3D5TA 4UHEA 2QTVB 3DR5A 4MVWA 3PBKA 1C9DB 5BR7A 1LS6A 2NNWB 3KVOA 5LNK1 1TD1A 1M6EX 1QRAA 2DQYA 5ALIA 5LYJA 4BO7A 2V59A 4TVOA 3DOFA 1L9KA 1P62B 4FX5A 1UZNA 2PK3A 3MGKA 3MWFA 3LRPA 5DGHA 5DN6A 1N6LA 3ZCPA 3KQHA 2HQ1A 1XQXA 1ORTA 5BT8A 3PEWA 4QUJA 2VCYA 3RKUA 3IOBA 1JKIA 1R5NA 2AXPA 4LNAA 1I2CA 4JJ4A 4M53A 4ND1A 3QXJA 5ALTA 5B1YA 1K0FA 1BX3A 1ISFA 3GDWA 3DXYA 4RZSA 5U4QA 4MUFA 5KQMA 5I7VA 4QARA 3FAKA 1CUHA 4A27A 1HSOA 2ZRBA 1GD1O 3DBLB 4IXNA 3D6AA 5HP4A 3WL4A 1FW6A 3CVXA 1CUJA 4HH3C 1NF8A 3SLRA 1JA0A 4DV3B 3KQQA 2MR6A 2WSYB 3F9RA 3P71T 3DZCA 3EYAA 4TKLA 4D1YA 2C42A 4L5IA 2CNOA 4H1VA 4XD7D 4NQZA 4DIKA 5AVZA 5JJLA 1TGVA 3G9QA 2GEJA 1C50A 3K73O 3M5DA 3H05A 1Z6QA 4GRIA 1A5AB 3BMXA 4ES6A 2PD4A 3BXXA 1C7IA 4ZDIA 2DUMA 3CQ9A 4XRGA 1F0PA 5DOZA 4ND8A 4Q9JA 4UBIA 3T3OA 2X2OA 1E6EA 1ULHA 2IYTA 2XMBA 4PTYA 4ZQEA 1AUOA 1QP0A 1UXIA 2J9ZB 3GJTA 4DMFA 1JQKA 1W0JD 3HSKA 5H80A 4E88A 2BFCA 1SOMA 4A4DA 3BCRA 3E22A 3ZZUA 1LB1B 2O0KA 2HI0A 2CLFB 2J3KA 4RC9A 3H1EA 1KEZA 4V2IA 1KJ9A 5TXGA 1NQWA 4AZ3A 1YGYA 1C3VA 2WSSA 1OSNA 2FG6C 5FV7A 1CY0A 4BTVA 1H9AA 1EBBA 5I6DA 4Y2HA 4LRUA 4MAFA 2PUDA 1CEQA 5KVSA 1BQ4A 4JL8A 3DC2A 2EX1A 2OORA 4HY3A 2YV4A 1K4KA 3CZ4A 5B1DA 4M7OA 3TLAA 1I2BA 2ZOSA 2O19A 1BRMA 3H5VA 1FOEB 1Z2NX 1MB0A 2O2XA 4AYWA 1GZ7A 1DXQA 2AFIA 1RAHA 4F5DA 1X39A 2C58A 2X0FA 2IEDA 2G0TA 3SJUA 4AD8A 1YCDA 1LTQA 4FYPA 1KBZA 1U8FO 1J0CA 5IP5A 4XTCS 3ZS8A 4V03A 4ESHA 5EMHA 5A4KA 3L7KA 3EZNA 1ZHOA 2A0KA 4LS3A 1JT2A 3SC2A 4A2WA 2FSSA 2A92A 1WXQA 1BWRA 1E63A 2HSGA 4YMTA 2OAGA 3AYXB 4XOUA 4LOHA 4WUTA 4E70A 5THXA 2DC1A 2UZ4A 4RMHA 4CLHA 2ZI7A 1SB8A 2BJVA 2VKQA 2X7JA 3DDSA 5T3YA 2XA2A 1L7AA 2Y1OA 1DE0A 3B38A 4KKXB 1RYFA 4BDTA 4LBZA 3RODA 1GPLA 2JAOA 1U3UA 3CNOA 2XTJA 3L0YA 4G81A 3SPXA 4JI1B 3KRTA 2PXHA 4CG1A 2YQZA 3EY4A 3WLLA 2H00A 3KEGA 2RHTA 2X76A 4IKOA 3DCJA 5AVXA 1QS0B 1TLLA 1E89A 1ZA1A 2CXUA 2HO4A 3V7FA 3QUBA 3RVQA 2B4QA 5K9ZA 4H27A 4AN0A 3DV2A 2GTPA 3H3FA 2WBLC 4MVJH 4TV8F 2P67A 4F0JA 1Q95A 2E4WA 3IAM6 5ILQA 4O29A 3GC6A 1UC8A 3F9CA 1T35A 3IO5A 5EXEA 4ZMBA 4NCIA 4D9HA 2ZKIA 4B3GA 1PJLA 3W9SA 2PMFA 1FPQA 3G8BA 4J7CA 3SCZA 4ZC1A 2J3HA 1D4FA 3M8KA 2WJGA 3RASA 1M83A 1HMPA 1IVYA 2FPXA 4JI5B 4GX0A 4HMPA 3CWZA 1IM2A 2P5TB 1GR1A 3E35A 1O03A 3CCBA 2IYEA 2W0SA 1ZP6A 1P3Y1 3EBPA 3ML1A 3WR5A 4FT4A 3PITA 4HUQA 1Z0SA 3B1WA 1UOOA 4HWTA 5CP8A 3GLSA 2EFGA 3IQHX 4QYIA 5EMNA 4O6VA 5E3JA 4LYEA 2CYAA 5CG2A 4KQ9A 4IVQA 1DNPA 2QJTA 1FP7A 1Q7TA 3UXHA 4FP9A 4X9XA 5KNBD 4FFNA 3C85A 4YT2A 4I1RA 1I4WA 4OHZA 2X7XA 3II6X 1WXWA 4QUKA 4DLLA 2JFBA 4UDOA 2OWDA 2H2WA 1E1KA 5TC4A 3O4RA 4NFYA 1KQOA 1W88A 4YP5A 1KNXA 3QUQA 5CIWA 1KP2A 5ICFA 2VZLA 1X7HA 3MPUA 4EKNB 2YRXA 1CLUA 3C7CB 1N2CE 2DHQA 4FWTA 2IHUA 3QBDA 3CX6A 4PAWA 3DFUA 5EPUA 1UBGA 2JJMA 4OYYA 1O9GA 3MMPA 3AF1A 4BZXA 4DRZA 4HTAA 5KZMB 1WMSA 1IQ0A 1ISHA 1Z2CA 4J03A 3AQIA 2XZPA 4NDZA 5DYTA 1GTL1 1E1RA 4QEDA 8GPBA 4O1MA 1FYDA 1YJAA 5IJ9A 2WUEA 1EGAA 4CCYB 4GBED 4ARVA 3LKBA 1RYZA 3SFVA 3W9BA 5HPYB 4D4MA 3R77A 2CZCA 3ISJA 3QVGB 3ONWA 4PYJA 2H65A 4Y2JA 1F8XA 1VG1A 2OAP1 3GO4A 4YCJA 5DPMA 5ENZA 3ROTA 4W5NA 3NUQA 4ZO4A 2B4YA 3FCSB 1UAYA 3FNGA 3AP2A 1Y8QB 1ZD1A 2R87A 1I1HA 2XCIA 3BC1A 4I8XA 1UJNA 1FRNA 3BJRA 2B8EA 4N0EA 1D2NA 1U8UA 1YQDA 5L8VA 1S3SA 3ZDXB 4R0MA 3FWPA 1V39A 3OZ7A 4FINA 4M7WA 5EVCA 3FDZA 3WQRA 1OBFO 1C8VB 3NCHA 5LQSA 1N7JA 3I62A 4EQ6B 3MM4A 5HCNA 2IU6A 3NHAA 4BQIA 2O0JA 3ZS9A 4ZU6X 1QR6A 2AVNA 2NV2B 4DZZA 8OHMA 2W37A 2BEUB 2WKWA 1XRJA 4WY2A 3KALA 1YNSA 1QK3A 4C4ZA 1UQRA 1YRWA 2GHRA 2V0GA 1KDPA 2ZYIA 5DTIA 2LKCA 3I45A 1KI1A 1NDUA 2J6IA 5E4YA 1ENZA 3HVKA 4BIIA 3OZTA 2YCLA 1Z36A 1BE1A 3GL9A 4U7FA 2EJUA 2C1ZA 1ZI8A 4ZXPA 2VWHA 5I9TA 4Q4HB 1MC5A 4J0CA 1P3JA 2ZBVA 2LXNA 5EGNA 4FYHA 4NHOA 4XLTA 5KYWB 1MEJA 5EWJA 3INGA 1OYYA 3N87A 1GRQA 1FFYA 2BTQA 1ZAYA 1NLMA 3EZ9A 2BFNA 2IYSA 1B0ZA 2II6A 4M1SA 1QGUB 4D9CA 4RTLA 1U28C 1V8ZA 1ARZA 1JMKC 1KBOA 1TMKA 3RRZA 1DPGA 4QEZA 3C3YA 3ZBTA 1NN3A 1D09A 4FS3A 5LU8A 2ZJ4A 1MOPA 4ZT6A 4R51A 2VYQA 2EDAA 4LYDA 4BNJA 3HYTA 4QOHA 3B53X 2C82A 4GPBA 5F1OA 3LPCA 2GCPA 2VZEA 4PVDA 1UXJA 4F3NA 1GG9A 4IO1A 1EE1A 4GP9A 1EJ6A 1YB7A 2J45A 4QYWA 1Q14A 1TRHA 2B61A 2FFBA 2JLBA 1JQAA 4IZIA 4U2KA 1E2DA 4IGIA 1DGQA 4IFEA 4GZ3A 1E9VA 2HJWA 3I61A 4IL5A 1NZFA 2YFKA 4Y2QA 5IC4A 1T8WA 3TF5A 3H04A 5DI9A 4DRYA 5FAKA 1DX6A 1KR2A 1RXCA 4I36A 2C5AA 1BFUA 2YJNA 1NRIA 3BICA 3L1KA 4WCFC 4DB4A 2I4IA 1GKYA 4WBXC 1A76A 2F7SA 2QK4A 3E81A 4HLQB 3HYRA 4FFSA 4Q1EA 4RVNA 1NVXQ 2GBFA 3B1KA 4A0RA 1SAYA 3ONEA 4ZPJA 2PNJA 2C4VA 4N9WA 3U39A 5CA1B 1TW3A 5I4IA 4QYMA 2B1RA 3F71A 4GNRA 4HEA1 5CFZA 1H0HA 1X7YA 2NU8A 3UT6A 4F12A 1T0HB 2JLZA 3AKZA 3ADBA 3MS7A 1TLTA 1GCAA 3AR2A 3R3JA 2Z5LA 2OXIA 2CJWA 5JD4A 2GVNA 3D59A 5ERXA 3I6ZA 1U4NA 4G3XA 3VH2A 4EPYA 3EFHA 3TZQA 1SVMA 3I5MA 4EDFA 4I3HA 3QE3A 4TZ6A 2R6ZA 2YOGA 3GGCA 3HPQA 1Y3FE 2P3LA 4HQFA 4HDSB 1QLJA 3PJEA 2HEGA 2ATIA 2E85A 3ENQA 3RF7A 4A5SA 1OXSC 3E70C 4C5BA 1J0XO 3M3PA 2GEVA 1X15A 1MFZA 4OCZA 4D3YA 2RGNC 4EWLA 5A3RA 4DV2B 1MG0A 3GJQA 1YQUA 4IYRA 2C54A 3NHBA 1FRFS 1RVDA 3DLHA 1NQVA 1M2VA 2BDUA 1QVRA 5BNFA 1V1JA 4L2IA 3AUTA 3GRUA 2DFNA 3N8NA 4ZT3A 1NV9A 4QUEA 3ZDYB 3HUUA 2DH6A 4FYWA 2HMVA 3K96A 5KOJB 1TAUA 3R4VA 1IZ0A 4KXXA 1ZC3A 2PEZA 4ZTBA 1HL3A 4G5GA 3R7WB 2P40A 5F7OA 3FNIA 4EITA 5L4LA 3OKAA 2JEOA 2DKFA 2XR1A 1T6YA 4MRRA 3CX7A 4RY2A 1OROA 421PA 3BILA 3EZLA 1XF1A 4ARCA 2M32A 4E5NA 2P69A 2JLUA 2NXEA 3WV5A 4WECA 2XBMA 3PDWA 2FWBA 1KYZA 1G5QA 2GUWA 5JBQA 3ZDEA 1K2VN 3I0MA 4LQLA 4TLAA 4ZAVA 4QU0A 3S6JA 4DXAA 1GPUA 1EZ4A 1E1NA 4G8JA 3U1BA 2JGLA 2AEMA 3V7UA 1QIKA 4JEMA 2IFTA 1K7YA 3GNLA 4WE3A 4D26A 2B9EA 4DLZA 1F8FA 3LGAA 3TLZA 4FHDA 1U98A 1SC9A 2HK9A 2VUHB 3GVIA 3M49A 1LRLA 3AHFA 2XMRA 2AQ8A 2YW9A 1ID1A 3DVAB 4QPPA 3VNSA 3V4ZA 3LE8A 2NO1A 2HQRA 2P77A 3COWA 3PFIA 4LGYA 1Y4UA 3GJ3A 4UFNA 4DS3A 1PTJA 4XVRA 3E18A 3FWNA 5G02A 1V6CA 3OZCA 3U37A 2CDNA 4D02A 1FQJA 1R3DA 4EY3A 1LJLA 3K8QA 4PAOA 3VR2A 2RH9B 3ESCA 4RCZA 3GDFA 1TQ2A 3GGGA 4MV0A 5BUZA 5K2OA 4CUKA 4D9KA 5L9AA 2WR8A 1R6XA 3PL1A 1S01A 1TMOA 2OP0A 2VQSA 1YZ3A 3NRJA 5K5EA 3BD9A 1K9SA 2C5LA 4Q82A 3QA9A 1OI7A 3RYHA 1RIIA 3MMZA 1W1WA 2YKGA 3CH4B 3KSUA 3B2QA 1C30A 4WW0A 1Z12A 4KQMA 1KY3A 1E3SA 4HNHA 4J9VA 3ROPA 5LYJB 2PU7A 1EYZA 1MD9A 2X0NA 3TI7A 4BKUA 4DF3A 2AK2A 3LXUX 3DH0A 1PK7A 3B1JA 2H5JA 4XD7A 5E1DA 3LW8A 3SEQA 4KBFA 4BMYA 1Q1AA 4EW2A 1AA6A 4KLZA 1K3UB 3CUYA 3EZXA 3H2JA 1DS6A 3L7YA 1NOIA 4JX8A 1V43A 4CM8A 2EEPA 2A67A 3RAGA 1QVWA 3UV6A 3MINA 3VR6A 2GFHA 3R3WA 4BP9A 1KI6A 5TMDA 1JDZA 1H4SA 1C7QA 1QONA 3ABZA 4X97A 5ELMA 1U5AA 1Z2AA 3KKLA 4KFUA 2AJTA 2XDQB 2CD7A 5CRIA 5IT9A 1W0JA 2D1QA 2F8MA 3FA2A 3KP1A 3Q8WA 1KZHA 5IJAA 2IV7A 4NBNA 3EDCA 1Z5GA 3NBXX 3FZGA 4M7PA 2LZ0A 5IC5A 4ALKA 5B2FA 1EDEA 1BC5A 1EFVA 1PF7E 2HLHA 3GMDA 3V4LA 3EEYA 2FQ1A 4NFLA 4UARA 1YI1A 2AXEA 1U0FA 2W6PA 2YJ3A 4G0ZA 2YV3A 4MJXA 4JUFA 4PO3X 4YMSA 5C1PA 2W5UA 2BM0A 4ND8B 2NO5A 4U3JA 3OM0A 5JSKA 5IWCA 4JQYA 5GZ6A 3R7NA 5KKCA 4MV8A 1EQAA 4RAOA 4NG4A 3LHDA 2ZUVA 5L6MB 1P9RA 3WGYA 2BFCB 2VCEA 1ICIA 1R6TA 3GFTA 3WYDA 3E22B 4JOQA 3BE4A 3EHDA 3STWA 4MR7A 2J8ZA 2NO7A 4MWCA 1W94A 2XMPA 3W2HA 2YBDA 3GIDA 4AZ3B 4B74A 2VHWA 3T6KA 3Q12A 4MW2A 5JSUA 3KOXA 1YR1A 1ZH2A 5FLKA 3MF4A 1LPAB 2O5RA 2VCHA 2NGRA 1E59A 2Z2IA 3WRXA 4DBLE 1YQEA 1NFFA 3B9QA 4IMJB 1F51E 1VLMA 2XITA 4Q7JB 1HKHA 3RVJA 4D9FA 1VE1A 1G9SA 2V6FA 3H13A 5AWFC 5BQ5A 4D4KA 1CZLA 2KPOA 3HXQA 3W2EA 1J1ZA 2HDHA 1IY1A 2WHPA 3VZSA 3KLBA 1DEAA 3I5AA 5I45A 1B1AA 4OQ4A 1K1EA 2AFIB 1E4YA 3M6WA 5CPBA 1Z6PA 5ILOA 5EHGA 5BYKA 8MHTA 3ZH2A 1LBHA 4L9WA 3TRFA 2NUAA 4M1KA 5L3RA 1SZJG 2W9XA 5REQA 4F1WA 2B5WA 3DLIA 4MCJA 4CLDA 1Z88A 2QTAA 3LW7A 3L43A 4MUYA 1H93A 3KXLA 3NI2A 3ZJ5A 4BECA 5JD5A 1J00A 1E2BA 1P2VA 3E7WA 4YALA 5IBRA 3EVCA 2F59A 3VOAA 4DG5A 1WZ2A 2OESA 1CDDA 1XDWA 2ZPTX 1O6ZA 3EC7A 1SVKA 2XXAA 3T5TA 2ZB7A 1XYYA 2C2HA 1A9XA 1YHNA 4V0NA 1GQQA 2WMOB 3GELA 4ALIA 4TL7A 4ZKEA 4YRMA 3FGPA 1WHTA 3D5QA 2HKIA 4JA2A 3FUCA 3Q11A 4TSFD 1QYCA 2RG7A 2ZSHA 2PXAA 2JHGA 3CMCO 7REQB 1JWAB 4JS0A 2JGMA 2F8TA 1ZESA 4DCJA 1G41A 4CHTA 2NZ8A 3FTCA 3HR8A 1GGVA 2MR5A 5ALKA 4D8TA 3G5UA 3KSZO 4U4AA 2QR2A 2VXOA 3I4LA 2O1WA 4B33A 4YRSA 5KNDD 3LY8A 2Q07A 3AT1A 2B69A 2WMYA 5JALA 1TIPA 1A2QA 5KNBA 1MRZA 1AV7A 3H2HA 4FMDB 1GR0A 3GEIA 4LYGA 1V11A 1A96A 3I1IA 4M8LA 1RXSA 1JNYA 2CLEB 2E49A 2OTCA 3E3MA 2HC9A 1EVLA 3E9RA 1QGED 1YJ5A 2PY6A 3F5DA 3A28A 1K5PA 2GJAA 2I1VB 3T7EA 2YV1A 2VHCA 4E2WA 4GMFA 9LDBA 4Q6WA 5IXJA 4B3XA 1Q7RA 3PLAE 4I1PA 4HUQB 1F2VA 2AFHE 3R5HA 3WLPA 4PSCA 3ZIAA 4UOEA 5B2ZA 2IYOA 5BVGB 1PZEA 3ETEA 5DLYA 2YC4C 3IMEA 3T4EA 3WNCA 2ZROA 3WYFA 4B3DA 1GYPA 4F85A 3DPUA 4JGBA 3LDAA 3N74A 3TDMA 3H5NA 4F3RA 1DBQA 2C84A 5HUJA 1RYNA 5DOVA 5MFZA 4AKTA 4WNYA 1E3JA 1NBWB 4Q4AB 4KR2A 1JFFA 1TJ3A 3UTDA 1B7GO 1NURA 3DMFA 1NMXA 1HNNA 1UM8A 2XF8A 3O38A 2P11A 1NJFA 3P0JA 5DH9A 1LBQA 5LDGA 3FHCB 3KEOA 2G7ZA 3BXFA 4KIUA 4LHEA 4IHAA 1RAFA 5I9SA 4Y9SA 4BMVA 4C78A 3C41J 5JPIA 1JEYB 4EHFA 1Q44A 1TM2A 1PFQA 1IM5A 5JECA 3VSEA 3AEKA 1Y6QA 4K1XA 3TN7A 1UBTS 3KDSE 4WKGA 1GSHA 5IJ9B 2Q4DA 1C7ZA 1QX3A 1V8BA 1ZSNA 3CLTC 3L0IB 4RAQA 4AIRA 2B7BA 3S81A 1Q15A 3QEAZ 3PQ4A 2FWIA 4D5GA 3NHWA 3IFSA 4KHZA 1Y3CE 4BFVA 4YMIA 3EIHA 1IB0A 4L8FA 1TC2A 2X5NA 4RK6A 5KBYA 1J6UA 3KB1A 5AJZA 4V0KA 3FMFA 2QW0X 3KKKA 5C7OO 2Z5GA 5DX0A 1MH1A 5DLQC 4GLLA 2JFVA 3LT2A 1KEEA 3RYIA 4XM0A 2PWPA 1K0UA 3B2NA 5IJWA 1USIA 3BWEA 3FDZB 2BHRA 3UW1A 3KSBC 1WKBA 4DMKA 3MCZA 5EINA 1K6XA 5T5QA 3SP1A 4MKGA 2XD9A 4LRXA 3QOYA 3FX2A 3KZNA 1CQXA 3LKZA 4EYEA 1Q0LA 2PBZA 1EFPA 4HZIA 1BA2A 1CULC 1NVGA 2VF4X 3DEHA 2BUAA 4IYJA 2C5FA 3KT8A 4UVIA 3SQWA 1T5OA 2W58A 3FVRA 2AR0A 2RC6A 1CY8A 3FPLA 2G0AA 3SZLA 5IS2A 3C24A 4NULA 4XPZA 1PAUA 3QU7A 3I2GA 4DHWA 1T8TA 3MXOA 2AVDA 4FQ8A 3RIXA 3V34A 4IXMA 1Z13A 3PX3A 3U44A 1ZWKA 3PDUA 1KO8A 5ADVA 2WVJA 5JNUA 1W5SA 3RADC 1JA9A 4HAVA 3AP3A 3FR8A 4J1TA 3ND7A 4YIKA 5EWJB 2A0WA 1KZYC 3TJRA 5LD2B 5TGTA 4EJ0A 2BTQB 2AN9A 4HQLA 5H5JA 4C4PA 4EHDA 5LDDC 3M9XA 2CL0X 2IBSA 5EHIA 4JR0A 2DJIA 2A9PA 1H9CA 1G21B 3M4XA 3OU7A 3SR0A 4EJSC 4MQFB 4DABA 1X7WA 4HQKA 5FWYB 3QMVA 3B3FA 621PA 1VXRA 1Z5VA 2QUAA 3EXIA 1Q16A 4QDKA 4R4JA 4WQMA 1OYWA 1L7BA 2CB0A 2SKEA 3UGJA 1BFDA 3PENA 3P9RA 4EUKA 3DONA 1NG1A 3LT4A 4GIBA 3P9YA 2VVTA 4G23A 3HJHA 4LG1A 3TBHA 3ZV4A 2FWAA 2PM8A 4OKSA 2XUFA 4DBVO 3FIUA 4KRGA 2ZR9A 1V16B 3DV9A 4Z4CA 1NVVR 1QB8A 2C7RA 1WMBA 7MHTA 1LZKA 4G09A 1A97A 3P52A 4CDRA 1YBAA 4PBTA 3U3XA 1JFSA 4HCJA 1QV7A 4NYIQ 5KO2A 3KQLA 4EATA 1KFCB 4LFCB 5GJWC 2K6GA 2Q27A 1YE3A 4MRVA 5HG0A 1Z73A 1JDBC 1WTCA 2ZJ3A 5KWSA 2Q2OA 3A2LA 3NJ8A 4FS8A 3FFXA 1G5RA 2QTGA 3JRXA 4NJOA 2V7QD 3ESXA 5FI0B 3H75A 1GJRA 1NNEA 1TVKB 2GJ4A 2X8JB 5ALRA 3TOXA 3B85A 1H85A 2X2PA 3K0AA 721PA 5FWAA 5JR3A 3HTXA 2JH9A 3QMPA 1CUZA 1NT2A 1SWVA 5C3MA 3IURA 4IIYA 4KMSA 3EDMA 3ZXXA 1X7YB 2NU8B 4MMYB 3NO4A 1H5QA 1ZL2A 5DDIP 4JJIA 2ASVA 4REOA 5HM6A 3B6MA 2CJWB 3AVYA 1MJNA 1DIOB 4HL6A 2D1TA 3UICA 2H1CA 4M49A 3ENNA 4DPLA 5JHHB 3HCOA 3U3DA 5EIEA 1KI4A 1E3QA 2E5WA 4G5OA 1B0AA 1F2UA 3LDGA 1BD3A 4QQ8A 4Z3DA 5CHEA 3WK5A 3OTWA 4BJ1A 5IZCC 1W46A 1VPDA 4IEEA 3FOEC 1N3YA 4QTYA 1JZQA 1VLZA 4CNBA 3DLBA 2X7HA 3WNQA 2ZE5A 4NYMQ 2NUTA 4B3HA 4MGIR 4KPYA 1TAGA 4B7ZA 1GAEO 1M2VB 5SZHB 5KYYB 1BMDA 1FDUA 1AS0A 3ORQA 3K2QA 1IL0A 1UPFA 1G3IA 3IMCA 4L2IB