4MGZR

Selective activation of epac1 and epac2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
total genus 41
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgzR00
1E2IA 2YWGA 1FQJA 4DDVA 2J0VA 2W0SA 4TSFD 2R65A 4KU4A 3ZQJA 1KI3A 4ZCLA 4RJLA 3TAUA 1LF0A 2VHUA 1W49A 4UJ3A 3ZVMA 4ESVA 4PC3A 2YKGA 1CRPA 1QBKC 3GLHE 1W44A 2RGEA 1D2EA 4WXPA 3MGCA 1W4CA 1P6XA 4ASUD 2WTUA 4FCTA 3SEAA 2E87A 2CHQA 2WWYA 1COWA 2ZREA 4I99A 1DAIA 3CPHA 1WBBA 1VHTA 2G1KA 1UBGA 2ONKA 1GVNB 4HYYA 4WA7A 3P27A 2YNMA 5CDFE 5H68A 3LNCA 3U3KA 3QF4A 2ODBA 4X8OA 3CZQA 1S9HA 5HKKD 2QROA 2Z6VA 5C4MA 1MO4A 2DWQA 3WYFA 4JVLA 1HQYE 1X8KA 2WJGA 3QKSB 2ZVPX 1N6PA 2BEJA 1XF9A 4GOJA 3F3YA 3A36A 3NIBA 3DKPA 2FMXA 5CM9C 1BYUA 3U7HB 2DFTA 1MO3A 5DIFA 4BZQA 2WWXA 3G82C 2CE7A 1KI6B 3RS2A 4DB2A 4C7OB 2P5TB 2NQ2C 3FE2A 2CVFA 4QFMA 2X77A 3A58B 1KSHA 3VR3A 3SN6A 1ZUNB 1N0WA 1A2KC 5EXXA 2GTPA 3DZ8A 1U0LA 4AWXA 1NVVQ 3BAFA 1XPOA 2CK3D 2IXEA 4QGHA 4G01B 4C0JA 1E6CA 2VPPA 2VF7A 3R9XA 4NCIA 4Z8XA 3WY9A 2VQSA 1EK0A 2ODNA 2PCLA 1R7RA 2QP9X 3U44A 1OLOA 2QRZA 1N5IA 1SVLA 2JGNA 2FE4A 3SQWA 5AUOB 3VMFA 2I1VB 1XRJA 4DT1A 1GKYA 1P9RA 5D3MB 1IONA 2QMEA 3IHWA 3WHKA 2J59A 3RS4A 4B48A 4A2WA 4IDOA 1X3SA 4OI0A 4HAXA 1E2MA 2EU8A 2H16A 2FN4A 1TF7A 2J45A 1FMLA 3FMIA 4NCHA 2Q21A 3OIWA 4NHOA 5K8TA 5FOVA 1XXHA 4TQAA 5AUPB 1Z3IX 3K0CA 2J9RA 3K70B 4OKSA 5CYPA 3ZYCA 2C95A 1AA9A 2ZYUX 1UAAA 2D74A 1CR4A 1SVKA 4EFNA 3FMFA 4KVGA 3KQLA 3TMKA 3Q7QA 5AJYA 1G3IA 5C46F 5CM8B 1UF9A 4UNQA 1KI1A 2LKCA 1KY2A 3K0AA 1H8HA 2YC2C 2R62A 2JJ1A 5JSZA 3TRFA 2B8TA 2WM9B 4PZYA 2F1RA 4OHZA 1LVGA 4HAVA 2OBNA 1W2GA 1K5GA 3AF0A 4DLUA 2JLWA 3V00A 2QQ0A 1E2EA 2A5JA 1QRAA 2YV5A 2J5XA 1X8JA 3U3RA 2C98A 3ONWA 1ZNZA 2QAGC 3MAAC 4FCVA 4UXJA 1P61B 4AURA 3L2OB 2IYTA 1OH6A 4G5GA 3PR1A 3QPUA 2B7CA 4P4SB 4F38A 1XEXA 3QBTA 3HP1A 1KIMA 4PO1A 2W0MA 3ZIAA 4CDGA 1M8PA 3LY5A 1SVSA 3DPUA 4EFMA 3MWLA 5JFGA 1GAJA 3S1AB 2VSOA 3E70C 3QEOA 4KJZA 1U8YA 5FTNA 4D4KA 4NYMQ 2QENA 1U8ZA 3U7FB 3CH4B 1G41A 4AG5A 1HE8B 1G3RA 4LV5B 4TQ9A 4P4SA 4K81B 1DAHA 1T3HA 2FEOA 3KL4A 3KKOA 4LBVA 5DN6A 2JLZA 4I81A 4DDTA 2F1JA 4M1OA 2XZPA 3LLMA 1ODFA 3LW8A 1T9HA 2RKOA 2XNDD 1R6BX 5JEDA 4JVSB 2OHFA 4MYTA 4EFLA 3GJ6A 1Z0JA 3L0SA 4NMMA 1P7CA 4PAQA 4Q1DA 4LJ8A 3LBIA 2FA9A 1DBSA 1JAIA 1NLYA 3CLVA 3CZPA 1NBMD 1MRSA 2ZRPA 1OF1A 4KXFB 3VHXA 4HLCA 4JLMA 1LY1A 4GP6A 2ZSBA 1Z0KA 1R5OA 2JIZA 2XSZD 2REOA 3ZVNA 4TLEA 5FOTA 1GL7A 3SNHA 3Q9LA 5L3SA 2IX3A 1EFCA 4XIGS 4CW7A 1XJ0A 4CZ2A 2C9OA 2Q9CA 4AIIA 1W5SA 2VHJA 5KUTA 4A82A 2DCUA 2F9MA 5J5CA 4MUBA 4G5SA 3SBEA 2ZUDA 3IBYA 1NP6A 4EQ6A 2GJKA 1N3BA 2FZLA 1M2OB 3FOZA 3IDQA 4FXPA 4MRSA 1N5JA 1DEKA 2N42A 3EZ7A 4QGGA 1KSGA 3LD9A 4PSAA 4Q1FA 4LHYA 3ECCA 2NPFA 4PC6A 1JJVA 2A3RA 3IGFA 2P6NA 4DB4A 3THYB 5BWMA 1DVRA 3UMRA 2WWWA 1E9FA 1Q1QA 1R2QA 1US8A 4XD7D 2A5DA 1MH1A 3EZ2A 2NGRA 1F2UA 3OESA 4W5WA 1YR7A 4ACBA 4B73A 2Z5FA 2FGKA 2Q9BA 1E2NA 1Z83A 5KPJA 4JBXA 1W4RA 4P31A 3AF3A 1DARA 3W90A 3KDSE 3OAAA 2WSSA 3KJIA 4G5RA 4Q1BA 4GFDA 4OL0A 2ZSFA 1RPZA 3QKUA 2IYLD 1W47A 2FFBA 3TJZA 3CF2A 3MRSA 1ANKA 4JLOA 3KFXA 5FUVA 3RYTC 1JQLB 3CX8A 2NG1A 4DUGA 2D7DA 2GK7A 3EAQA 2WKQA 3QEJA 2V3CC 2YWHA 5AWFC 3AKDA 3OIUA 2GVZC 521PA 2GEUA 3WBKA 2VP6A 3O8RA 3CH5A 1TEVA 3EZ6A 3EG5A 2AR7A 3DO6A 4HB0A 1OFHA 4V0OA 3TR0A 4DBLC 4FMCB 4MRNA 3THWB 1NY5A 1U0JA 1OXVA 2FNAA 4LWZA 4F7WA 2AN9A 2ZJAA 2ZI9A 4HSEA 1SVIA 1F60A 3TUIC 2JLUA 1L2TA 4TT3A 2GF9A 3QXHA 4MKFA 5JMTA 3FKSD 3IO3A 4IFBA 1GL6A 2J1LA 2XAUA 3M0EA 4LX0A 2IW3A 5LB4A 1NVVR 3OFNA 2IYSA 2DWPA 4PQYA 4MUAA 3CM0A 1AS2A 2G88A 1XCGB 2QI9C 3GJ4A 1NRJB 1CTQA 1JEEA 4IVQA 4XSGA 5G41A 4KI0A 4DDUA 2GCPA 3RRNA 4O3MA 1BIFA 4JYBA 4IDHA 4R98A 3M4YA 4BFUA 3EPHA 1EFHA 4QNRA 1XB2A 1RYHA 3FKQA 1XX6A 1XD9A 2VP5A 4OYHA 1G3MA 2GDJA 4LJ6A 2GXSA 2YZ2A 1UKEA 4B75A 1KDOA 4WIAA 4M1TA 2WPDD 4F93B 2BIFA 5KO2A 3NH9A 3D8BA 4P3YA 1G17A 1E9CA 5G40A 2ZRJA 3QI2A 3QG5A 1IY2A 2IC5A 5LB2A 1E0SA 4NE2A 1ZP6A 1BH2A 3LDAA 2OXRA 4HZUB 3W6PA 121PA 3CWQA 3MLEA 5CIQA 3A1SA 4JBYA 2ZR0A 4CF7A 1I4DD 3HDTA 1FTSA 4A6XA 1MOZA 4DLWA 3W5JA 1E0AA 1WQ1R 3X1YA 4QBHA 5TARA 4AC9A 2REBA 2ZJOA 3BBPA 3IPXA 1GRQA 3O47A 5FUXA 3AF1A 3NDPA 3UIEA 4R2IA 4RD3A 4IFEA 2MMCA 2ZRCA 2AXNA 3RRYA 5FFMA 2ZSEA 3P26A 2QTFA 2EWWA 4D25A 1S8FA 2PT5A 4HAZA 3UMFA 2W2VA 2FFQA 4V0KA 2J41A 2QL6A 2Q6TA 3B9QA 3AUYA 3EW9A 4FINA 5BYKA 3PUXA 4WZAE 3EX7C 2RH5A 2JAQA 2IEZA 2C9CA 3KKQA 2GESA 2ZE7A 4Q18A 4BEJA 2HYIC 3SR0A 1P73A 5JJKA 4O2LA 1N5LA 1Q21A 1AQYA 3EC1A 1CP2A 1IN6A 1S1CA 3LWNA 2NO7A 3MWYW 2AK3A 4IEIA 1KSFX 5JRZA 1XTKA 1RE0A 5LD2B 1B23P 4QL3A 2GJAA 3GLHB 2CNWD 4C0KA 1LTQA 2WJVA 4A8JC 1E9AA 1P2SA 4IDQA 1TPZA 4CVNA 3GP8A 5DHFA 5EP3A 1R4AA 3NG1A 1OXXK 1G7RA 2RGBA 1EWRA 4Q4JB 2MSDB 3AP3A 1TADA 3LO5A 3NDBB 3L0PA 4A8JA 1IJFA 1UPTA 4MDEA 1KI9A 3GLHA 4URWR 1DPFA 1KKLA 4PTLA 4DLTA 4LHZA 2ZJBA 4Q7LA 5H1YA 3QENA 4QOSA 1I4TD 2WZQA 3UWKA 1VCMA 3FPAA 2J0UB 2G9NA 4PHGA 5CDFA 4R71A 1G20E 4MGKR 1KZGB 4HDCA 4PSVA 3REFA 4BECA 4JLJA 4P4UA 1E2LA 4ZPXA 3N5CA 1CJKC 3QQ5A 1L4YA 1TQ4A 4Q9JA 1II0A 2FSFA 4XVRA 3QOFA 2QE7A 1VPLA 2IHBA 5JZVA 2QBYA 2KB0A 4BFYA 4LRWA 2Z43A 2FSHA 3THXB 3AKCA 1FMJA 1JPNA 4NYIQ 5FBWB 3MD0A 2GJ9A 4M8NE 4QGFA 2GJ8A 2CXXA 2D3WA 5E7JA 2C78A 4EDHA 3K0FB 3RC8A 4GP7A 4CEHA 1FUUA 5GADl 3TAHA 4V0NA 3OF5A 2A5FA 2N1BA 1F3OA 6Q21A 1ZC3A 2G0TA 2J46A 5E4FA 4DRZA 2EFGA 1NLZA 2IK8A 1UADA 3RSOA 2OILA 3GLGE 1AS3A 4GL2A 1AJEA 4R9UC 5K8UA 1OHHD 1GILA 3BB1A 3QJYA 2BMJA 3K0FA 4HDOB 4TMZA 4C3ZA 1N6KA 2XNSA 1ZC4A 2BJWA 2GZHA 4JMPA 4QJ5A 5SZJA 2IEYA 2QG6A 4ZDIA 2RCNA 4ZO4A 3AVVA 4TYNA 1EX7A 1SGWA 3D31A 3VX3A 5FI1B 3LRPA 4EKDA 3GPLA 3DMDA 4M0LA 1Z28A 3IBGA 2ZRLA 2QEQA 3I32A 4CEIB 1O87A 1NMYA 1Z2AA 1K8RA 4GZLA 4GZMA 1S0UA 2W58A 1P2VA 1SXJC 4JBWA 2HCBA 4B3FX 2WKRA 4BFXA 4EPYA 3B9PA 5EP1A 1CJUC 2X19A 4PANA 1TUIA 5G3ZA 4EJSB 1NMXA 4Q00A 1NBME 1KAGA 2EW1A 2PCJA 4NONA 4YDSA 4E22A 2Z83A 5JHHB 4DHEA 1NN1A 2WJJA 1IAQA 2BBOA 2XGJA 1ZCBA 4Q5IA 4L8GA 3EZFA 2KWIA 3K0EA 5FTMA 4X8MA 4IVRA 3ADCA 1J99A 4OI4A 1W36D 4A6PA 3TQFA 4G3XA 1OFIA 1GUAA 1WXQA 1IBRA 3IKJA 4BLSA 1GIAA 2P67A 3TE6A 3EIQA 2F1IA 3WMEA 1XTQA 4NH0A 4DCUA 2F3TA 4Q48A 4HEJA 1NJFA 1OXTA 1LS6A 1II8A 1TL7C 2W2TA 4IOLA 1XMIA 4CIDA 3MG9A 2ZRKA 3OZXA 4PZZA 3KJEA 3ASZA 2WHXA 2QT1A 2VP0A 4BLPA 3W5IA 3VHLB 1AKYA 2VSXA 3OEED 1T0HB 2H17A 5JS7A 3NBYC 1E79A 2WJYA 3B5JA 3QXCA 1WCV1 4L9SA 3VR2A 1P4SA 3U7GA 1J8MF 1JB1A 4LGMA 1F48A 5TV2A 4S2EA 2IYUA 1YKSA 3CUEF 3HU1A 4TMXA 4ZIRA 4ZCMA 4JLAA 3KTAA 2TMKA 1AM4D 2ZPTX 1ZNXA 1Z63A 2AX4A 3RRZA 5L8VA 3AH8A 3BGWA 2VP4A 5B57C 4I1VA 1KHTA 1OKKD 3ZLJA 3CKLA 4HI0E 4QHYA 2QSYA 3IILA 5BN5A 3EPJA 1SVWA 1YE8A 5F98A 3A1TA 5EQTA 1OFUX 3ADKA 1E1QA 2GHIA 5EZ6B 2R2AA 1ZW6A 4N1AA 4Q1AA 3SJCA 3WHLA 5KYKA 2GAAA 4U02A 2QNRA 2IYXA 4Z1MA 3WMFA 4LOAA 2VA8A 2C77A 3GJXC 5AJXA 1UKVY 1PLLA 4MQBA 4MYHA 1COWD 2KJQA 2OEPA 5DI9A 3VU9A 2VRWA 4D4LA 4QJ4A 4C9BA 4M9SA 4BEBA 3VNUA 2WWIA 1KK3A 1Z07A 3IUYA 3UMSA 1N6OA 1OIXA 1TMKA 1NL3A 3U61B 2L0XA 2BM1A 1G64A 1KDTA 5AJWA 3B1YA 1Q3HA 5EXPA 4M9ZA 2RGCA 1E96A 3PUWA 2GZDA 4GOKA 2CLSA 4PSKA 3W6OA 1E2HA 4P4TA 721PA 1AGRA 1GWNA 4AG6A 3FFAA 3BB3A 2GF0A 2CL7X 4C0HA 2BEKA 1XNJA 4H9GA 3H84A 4HAYA 4W5JA 3RDPA 4JJZA 1GG2A 4W9MC 1AKEA 4HLDA 1E99A 1S4QA 1N6IA 2FSIA 4JKYA 1BKDR 3L43A 1KO5A 4E09A 3KJGA 4XJXA 2IHYA 5L3VA 1YRAA 3NTUA 1DOAA 2NZ8A 4G0NA 4RCZA 4UNSA 1S3SA 3UWOA 1LW7A 3LQQA 2AL7A 2F43B 1E9RA 1D9ZA 4JLPA 2WV9A 3C5CA 3OE7D 4HDQB 1F5NA 3H2YA 4Y0AA 3K09C 1N25A 3MFYA 3AF2A 4S35A 2OLJA 2HJVA 1UM8A 2YVUA 1NNEA 2JJ8A 2PMKA 2H7VA 1G1MA 1CJMA 1UFQA 4TWZA 1IN7A 4YDHB 5CITA 5JJIA 1T5LA 3UANA 1D2MA 2I1QA 2RMKA 1E0JA 1FX0B 3K09A 4URZR 1QDEA 2F43A 2O8DB 4ARZB 2EFDB 2ZAMA 2QGZA 4NYIR 2IYQA 421PA 3R8FA 3GQBA 5FUWA 1DS6A 2ZRHA 4Q4AB 4UNNA 4P32A 2WSMA 1SVOA 1ZM7A 4CYMA 1HEIA 4PHFA 1H8ED 4LSGA 5HPYB 1U2RA 1JAHA 1QHYA 3QUSA 2J3EA 4B34A 3RRMA 1KK1A 3K9HA 5FL7A 1NVWQ 3I1FA 3PENA 1NSTA 2XOKA 2N46A 4FN5A 4O25A 5DE3A 1CBUA 1G8GA 2GK6A 4FW9A 2YOHA 3PCRB 4IKEA 4JVMA 2R6GA 1Q0UA 2W6IA 1H8HD 1KMHB 4FMDF 4RZ3A 4DIDA 5UKDA 2DBYA 2QY9A 3QKSA 4HUQB 1FW6A 4KITB 1W0KD 3FGNA 3W9YA 1M7BA 1QG2A 4AI6A 4IEEA 1NKSA 1E2JA 4L15A 3E2IA 2HLDA 3N70A 2WMOB 2BCGY 2CCKA 1KI6A 4C7OA 1KMHA 3DDCA 1KDPA 4OJKA 4OHWA 5KSPA 4B3BA 1XTJA 3ZVLA 4HUQA 4BFWA 2JA1A 4TSFA 3ZIAD 2FZ4A 3KUCA 2XJ4A 1CS4C 1NKTA 5JI3E 2FPMA 1W0JD 2DR3A 3K0CC 3UG6A 4EAQA 5JWOA 3NC0C 4IOMA 1NN5A 3ETLA 4G5OA 4WXRA 3VR1A 4Q7MB 1O3YA 1PLJA 4Q01A 4DCSA 4QKQA 5C18A 4HLQB 5HE9A 5IDVA 1XEFA 3O8DA 3AKEA 1G4AE 3J81k 1FFHA 2C9YA 2IXGA 1DG1G 1ZM2A 1S1MA 2DWOA 5D3MA 2EFHB 4ZV4A 3A37A 3Q8XB 1YZGA 1P9NA 2AKYA 1Y63A 2HYDA 5C4GB 3NHBA 1UBFA 1AK2A 3E1SA 4KV9A 2IYYA 4MGIR 3ZS9A 3K70C 1IXSB 3AVTA 5FBLB 1FP6A 3T15A 2Z0MA 3ICQB 4F4CA 2Q3FA 2QRNA 2V6JA 2W6JD 4W7SA 1KO7A 4NYJQ 5EE9A 4MKIA 621PA 3K9GA 4RFVA 2BBSA 3FMOB 4M9QA 3PEUA 5TY0A 3HYTA 4DCNA 4HB2A 1L7VC 1E1RD 2JIZD 4U7DA 2CVHA 2XEXA 4JT2A 3D6TB 1Q1EA 2HJGA 5JRJA 3ZS8A 3IHLA 2HDNB 2NO6A 3U6KA 4ILEA 1YZLA 1SHKA 3HR7A 1RFLA 2QMOA 2FDCA 5F9FA 1EWQA 1CU1A 2Q9AA 3NBZC 2SHKA 1W4AA 3T1VA 2H8KA 3BXZA 1OJLA 1Z6TA 1Q20A 4HLUC 2WICA 4MYCA 1OB2A 1TU3A 3LQRA 4HATA 3NVAA 5L3QB 1QHXA 1R8QA 3BOSA 2RGXA 1IY1A 3KZ1E 3QSYA 3D7MA 5KNBA 2BJVA 3G0HA 2WAXA 3U4QB 1PVOA 1TUEA 1BYIA 2MSCB 2VHQA 4HLUA 2JLRA 5EP4A 4DLVA 3TGPA 3S1AA 4KHZA 3RWOA 2BBWA 4C0AC 4I1SA 4B43A 5J4VA 4KCGA 3WNDA 3OAAD 4U5XA 2C99A 3TBKA 2I3BA 2WSSD 4US0R 1I4LD 2CMKA 3I8XA 3TW8B 4N3NA 1DAGA 3UKDA 5G3YA 3F0TA 3I92A 2XTMA 1E2GA 5GVSA 1QF9A 1SKYB 1PUJA 2XX3A 3U4QA 1NVXQ 2PX3A 2CDNA 3VR4A 3K9NA 2O8FB 4DIEA 3RVBA 4JS0A 4DUGD 2PBRA 2QTVB 1W2HA 1T4GA 4IXMA 3KXLA 2FG5A 5FBRB 4RFSB 2AXPA 3HYRA 1UBCA 3MJRA 4LYHA 3GLFE 3DZDA 1PUIA 1V43A 2BDTA 3F5FA 4TTRA 1ZBDA 3CWZA 3LBHA 4QG7A 2OCAA 2JJ2A 3IPYA 4NCJA 4KO8A 3GLGB 5J40A 1KO4A 2B6HA 3BFVA 1IN8A 1RRGA 5EE0A 5KNCA 4LJYA 2IWRA 4TT3D 4YQFA 1H65A 3TNFA 4DVGA 5TXGA 4M1KA 1WP9A 4AYXA 2ASEA 4GDFA 2JATA 4B35A 2MSEB 2GCNA 2FFAA 5B58C 1OYWA 2C03A 1LB1B 1Q3TA 2VTKA 3W8RA 3GLGA 1ZINA 2EQBA 2HXSA 2RGGA 4UKDA 4BLTA 3JZMA 2CCGA 3CBQA 4TYWA 1NI3A 4FD2A 4YMSA 1TX4B 1XD2B 3T1OA 4TMWA 3THYA 3OHMA 4LJ5A 4Q7KA 2E9SA 4JLNA 1UKYA 5HZKA 2VYFA 1E9BA 4C4PA 4B3GA 2E1RA 1UBEA 2VH5R 4KFUA 2QM7A 2GXAA 1Q12A 3VFDA 1LV7A 3U5ZB 1TEXA 4RCYA 3KKNA 5JEEA 1T91A 3RAPR 3TH5A 3V4RA 5CJPA 2XNDA 4IOJA 4YMUA 4OHVA 1N2CE 2QT0A 2PMDA 4B74A 3TUJC 1PLKA 1N0UA 1W7AA 1IXRC 4D81A 3EWSA 2CBZA 3SJAA 4M4SA 5K8IA 1NBMA 2PJRA 3RS3A 4PHHA 3SS8A 1RC8A 3B60A 1P60A 3CRRA 3FMPB 1HTWA 3A4NA 2V55B 5HR5A 2QSZA 3I4LA 3T12A 2I4IA 3WRXC 2DB3A 2VP9A 4O2RA 2ZI4A 3T5DA 4POAA 2QORA 2PT7A 4M1WA 4FMBB 2IF0A 4KLNA 4P0TA 1A1VA 4DDWA 5L3RA 3T1QA 3LBNA 1K5DA 5FH9A 2OFOA 1KMQA 5CYOA 3A1UA 3T35A 3THWA 3C15C 4F91B 2J87A 3CF0A 4D0NA 4Z51A 3L82B 5JBQA 2IS6A 2JCSA 1W1WA 2OAP1 1Z0IA 1CKEA 4YONB 2O5VA 2WIBA 4QM7A 1YR8A 4X8LA 2R6CA 5FUYA 4H1VA 4JLBA 3KX2A 3C7KA 5DYIA 1DAEA 3X1DA 3ADDA 3IIKA 3B6EA 4LK2A 1N5KA 4TTPA 1KJYA 2BMFA 3IIMA 4B33A 2O0KA 4US1R 3NH6A 1ZRHA 4LBYA 3SJBA 4OJQA 2D7CA 3V9PA 4LV6A 5JI2E 2NIPA 2ZSDA 3SQXA 3ZZTA 2D2EA 3LFUA 4XOIA 4A0FA 1W5TA 2VBCA 3K0SA 2MMGA 2RGAA 5J4LA 1YZQA 1VYVA 1ZD8A 1X8LA 1JEDA 3U6BA 2DY1A 2HUPA 3CO5A 3PIRA 5F2EA 2IF2A 3QPVA 4EPWA 1U90A 1YRBA 1T0JB 3JVUA 1VHLA 2IYRA 2ZU0C 2VIIA 1XWIA 5DGXA 3AUXA 4GMDA 4PHTA 1KJWA 2WMNB 1JJ7A 3AGQA 3BFKA 4C2UA 3GFPA 4HZUA 1XMVA 4JSTA 2RHMA 5IK2A 1XD8A 4KBGA 3PVSA 4PAOA 3ICEA 4JLVA 2O8EB 2GA8A 3ZZUA 1G3UA 1NMZA 4NDZA 4XTRA 4OK5A 3VNVA 1XDBA 3LLUA 2D2FA 4I1OA 5E3HA 2FPLA 3T34A 1BO6A 4BFVA 2ZITA 1WDTA 4ITRC 4LY6A 4AKEA 4A0GA 1UDXA 1N6HA 2B8WA 4TL7A 4IW3B 4JL5A 4ZKEA 4F4IA 2NO9A 4NYMR 1HE1C 2WOOA 4NL4H 4N0EA 1QHHB 4BPBA 2O8CB 2OXCA 1HYQA 2IUUA 3B1WA 4TLAA 4ZCIA 4KFSA 3GFOA 3VKGA 1E32A 2ZQ5A 2ZU6A 5EZ5A 3GJ0A 1GOTA 2ZAOA 3L8ZA 3SHWA 3WYGA 2QP3A 1GKUB 5LD2C 1Y3AA 5C2JB 221PA 3RNLA 3UXMA 4B3CA 1ZU5A 5CK4A 4B44A 2OG2A 4WZBE 2VP2A 1IXZA 4II7A 2WPDA 1ONBA 1QHHA 1XBTA 4DXAA 4QHTA 4RVCA 2PLRA 5E7MA 4YMVA 5B64A 3R9WA 3OIVA 2A5YB 1TNDA 4XSHA 1GTVA 1Z0DA 5J47A 4AYTA 3PV0A 2P3SA 3HJNA 1UKZA 4UJ5A 4HAWA 4DLXA 2OM2A 4Q4JA 2X2EA 1C9KA 4MKHA 3B85A 1OXUA 4BGDA 3GEEA 1GSIA 1VIAA 3DVLA 2GBLA 4QC2A 2AWOA 3E5HA 3FHOA 5SZIA 2AK2A 1JBKA 2NOAA 1GRRA 4FIDA 2FGJA 1FTNA 4MH0R 5FOUA 2WJHA 4QRHA 2ATXA 3U3JA 3FHCB 3SZRA 5BN3A 1OB5A 3H0KA 4OI1A 5EJEA 4WAUA 3RLFA 1HURA 2J0UA 1U9IA 1N6NA 1SKYE 1J90A 2ZYTX 1T6NA 3GJ8A 1SXJD 3B82A 2FV8A 3A4LA 3DM9B 1EFUA 2C2HA 3B13B 1EX6A 1AGPA 1UEIA 3ASYA 3MJHA 3VX4A 3AVWA 1NSFA 2IYWA 4Q4AA 2P2LA 3GLIB 1D6JA 4D2IA 2UVQA 4BWYA 3AM1A 1XZPA 4B2IA 2ZYWX 3R7WB 3THXA 3EWAA 1BMFA 1Q22A 1E4YA 2GVDC 1QZXA 4LUCA 2J7PA 1ELOA 1RYFA 3OEHA 1TU4A 4JKIA 4LPKA 3ZH9B 4BQSA 2HV8A 4BLOA 1FZQA 4RD1A 4ZI2A 2DFNA 1U0HC 4RZUA 1NN0A 1MO5A 1MT0A 2JLSA 4OQFA 4UNPA 2V1UA 3PEYA 5EP2A 1P5ZB 3X1XA 3CRQA 1U8AA 1WF3A 1PV4A 1TF5A 4IRUB 4JL8A 4QHSA 1VMAA 3R7WA 1R8SA 4D80A 1G8HA 3FWYA 1OW3B 1ZVQA 1E79D 1XJQA 4LJ4A 4E07A 2VL7A 2ZI3A 1S96A 5TDHA 3D3QA 1Z8FA 2ZS8A 4MYUA 3NHAA 1Q1ZA 3U7EB 1CIPA 4LJ7A 3WYAA 3TKLA 1JR3D 2QU8A 2RHDA 2HCJB 3AQ4A 1G8YA 2GAOA 4QBFA 1ZMXA 4D6PA 4KBFA 2WBLC 5HZHA 2UZ3A 3SYNA 1ZM9A 3DOFA 2ZR9A 4L9WA 1ZYUA 4UXHA 2BVNA 3QKRB 2V6IA 1KNQA 3BD9A 4CEIA 2V7QD 1VCIA 3QXXA 5JS8A 4YXWD 4EJSC 1RVDA 2GCOB 4M21A 1E1QD 4NPHA 3X2SA 5TVKA 1VG0B 3PG5A 4GNKA 2DFKB 1XTIA 5DH9A 3TVTA 4D4MA 4Z1MD 1NLFA 3M6AA 4BZXA 3A8TA 3QVVA 4EJSA 2LKDA 5BW8A 2YINC 3QKRA 4MRPA 3I5XA 1ZIOA 3FDIA 4FMCF 3UG7A 2AWNA 1SKQA 2F3RA 4JSYA 4DWJA 2GEDA 1JALA 5B30A 4LJAA 4OBEA 3PUYA 4DLZA 3AVXA 1FP7A 4V02A 2ATVA 1Z0FA 5KNDA 1XCMA 1XTSA 3G5UA 2BWJA 4DEXA 4UNRA 3ZVRA 4RZXA 3H1TA 3AGPA 4DJTA 1FNMA 4KSCA 1F2TB 1T8UA 2JASA 4Q9HA 1X86B 5E7IA 2NMVA 3EASA 1DO0A 3B78A 4QBIA 1C4OA 4MITA 2ZJ2A 2LCFA 1IN4A 1EFRD 1R0XA 3W6NA 3TSZA 1GRNA 2G3YA 1BOFA 4LC0A 1OHHA 2KSQA 1E9SA 3QXSA 4CEJB 1MR3F 2Y8EA 4LYJA 1GL9B 1VKJA 4RD6A 2OZEA 4KAXA 1QHNA 2OESA 4IDPA 4F4JA 4IDNA 2R8RA 1XCPA 1EG7A 1XEWY 2G1JA 3NKVA 4NZYA 4PFSA 3EIHA 1FL9A 1ZD1A 4R2HA 3CNNA 1E2FA 2ZJ5A 3SHFA 3K53A 4M53A 4NBSA 1G16A 1AZSC 1HV8A 2BBTA 3EA5A 4B2PA 1OH5A 3CRVA 3HPQA 3GLFB 3H86A 2NTYC 2OCBA 1KI7A 4LCBA 1HA3A 3P20A 1LF5A 4A4DA 5A5GA 3TVDA 1UJ2A 1W36B 3LX5A 2ANBA 1X6VA 3CF6R 1YJ5A 4I4LA 4ZDKA 1RW4A 3PUVA 1I2MA 5DYGA 3SYKA 2O52A 3BC1A 3AVOA 4Q47A 1MKYA 2XXAB 2JDIA 2V54A 1J8YF 4KYIB 3BORA 2PLFA 1ESMA 3U3OA 4GRAA 5G53C 1DE0A 4OQMA 1QG4A 3GLFA 4Q9IA 4OHXA 3GD7A 3PFIA 2QP4A 4XWOA 1RRFA 2YWEA 2H92A 1G6OA 2FPKA 1DTSA 4JLKA 1GKIA 4V0ME 4WOPA 3RABA 1E2QA 4MDFA 2CLCX 4Q9KA 5GJCA 1JXOA 4NCKA 4TYQA 2DFLA 2OBMA 821PA 4DKXA 2QAJA 5FPYA 3SE0A 2BKEA 4A36A 3DM5A 2VF8A 4GI7A 3CR7A 4N0DA 3CNOA 2PX0A 2XOKD 2ZRBA 2BMDA 3GJ7A 4LBWA 2OE2A 1YU9A 1RJ9B 4GBMA 1NG9A 1ZD9A 4F92B 5EXSA 3OEEA 5KSYA 3QG1A 3I5YA 4TL6A 4EPVA 3RC3A 3B1XA 5DNYB 1JI0A 3WP1B 3NEYA 3BE4A 1Z08A 4UQOA 4DLYA 3MCAA 5D3QA 1WE2A 1QVAA 5FPHA 4TL8A 4WBSA 1BS1A 2GETA 3SFZA 1IN5A 1TQ6A 2WWGA 3A1WA 3B7GA 3TSOA 4AK9A 2BMEA 1CF4A 2XJ9A 3SBDA 4OQNA 1R5BA 3WNCA 2EYQA 2QPAA 1A4RA 1OKKA 2ZYVX 4DCTA 4OHYA 1ZM4A 4L5BA 4B47A 5A4JA 4EPXA 1LS1A 2W00A 3QF4B 2PH1A 3Q85A 1OIVA 3W3AA 2ERXA 1WBDA 1FQKA 1I2DA 4TTQA 2WIAA 4E03A 1MABB 1KZ7B 4LPSA 2XZLA 4TL9A 2ZRFA 2IS2A 2DHRA 3EIEA 1T3SA 3MMPA 5FOXA 3CX7A 5JECA 1M74A 1IOZA 1CR1A 1FX0A 4KYUA 2F9LA 2O8DA 1JQJC 4ARZA 2KE5A 3N2IA 3GJ3A 1Q57A 3O8CA 5KPDA 2FWRA 3SDZA 3W8NA 4UXIA 1KDRA 1XU4A 2PZEA 4BE7B 3K8YA 2BKUA 3DKVA 4ERNA 4TQUS 2JJ1D 1MABA 5FTJA 1VCNA 2HF9A 3K70D 3TUZC 4QM6A 2IL1A 2ZR7A 5FPKA 1YVDA 1YR9A 3TK1A 1W48A 4TZ6A 2FEMA 3VAAA 1M7GA 4LZZA 1TQ2A 3C41J 4M9XA 4GOXA 4ZI3A 2C8VA 4C2TA 5DSZA 2AFHE 1N6RA 2R6DA 4EPTA 4LHWA 3QXJA 2ZJYA 3I3SR 2VHCA 3CW2A 1ZU4A 2G6BA 1S2MA 5IRCD 1E9EA 3U44B 3VKHA 3GLIE 2WWFA 1CLUA 4KLZA 4AKGA 2GXQA 1W46A 1HH4A 4DT1B 2ZUBA 5J4KA 1KOFA 2D4HA 4OK3A 1JPJA 2ZRNA 4QNMA 4RD0A 4W5HA 2W2XA 2AFIE 3TSWA 1G6HA 1QHGA 2A5GA 2WJIA 3GEHA 3OE7A 4KSBA 4PZLA 4C0LA 4ASUA 2ZI7A 1CRQA 3L8YA 3OIYA 1XXHB 4AY2A 1VIYA 1II9A 5DN6D 2RAPA 1G7CA 3QNUA 5F9HA 5EXTA 2RGNC 1LNZA 2FU5C 1OIWA 3RSLA 4TLDA 3R8CA 2JLXA 3W34A 2UZIR 4B6FA 1CXZA 5FOWA 2R44A 4Q1EA 5HE8A 3WNBA 2FX3A 1T8TA 4IXNA 1Z22A 2VSFA 4XWAA 5DHAA 3BS4A 1R0ZA 4JT4A 1R5NA 2RGNA 2ZRAA 1G291 3IQWA 5AUQA 1D5CA 1Z2CA 1CR0A 4FI3C 4OI2A 4CT4B 3K0AB 5HKKA 1GNPA 1K6MA 4BLRA 4OQXA 5JSZB 3PQCA 4PPGA 1OYYA 1CULC 1OH8A 3QPWA 1G5RA 2CEAA 1H8EA 4PAMA 3RWMB 4CRWB 3KXIA 4MRRA 4TMKA 1MRNA 4A15A 1Z0AA 4WZ6A 4DEYA 2XTNA 1SXJE 2PL3A 3B1ZA 4TZ0A 5KDDA 5KHOC 5GJVC 1Z6XA 2JJ2D 3KKPA 1DAMA 1KI4A 1C1YA 4LHXA 3FTQA 2FOLA 4ACAA 1SQ5A 3HR8A 5CLQA 1W0KA 1XEXB 5F3WB 5AJVB 2CCJA 5A0FA 1VECA 2IWHA 2QAGB 5KOYA 2FF7A 1YHNA 2ZJZA 5IHPA 3T1TA 1NG1A 3NC1C 2X8AA 4XTCS 2CK3A 5LBIA 2ZETA 5EUQB 3TQCA 4MA4A 1A82A 3FFBA 5FR2A 4TLBA 2GEVA 1G19A 1Q1BA 2OO7A 2XITA 2OBLA 4R7ZA 4EUNA 2J0QA 1G3QA 2QMHA 4LV8B 5SZKB 1KI8A 3DMNA 2QAGA 3ND9A 3QIAA 1Z29A 1ZNYA 2A7QA 2Z4RA 1GZSA 2ZI6A 3R20A 3A4MA 1W0JA 3O8BA 3JZAA 1ZAKA 1MV5A 4QJ3A 2ZRDA 4BFSA 1JR3E 1CR2A 5L3QA 3M1IA 5JWHA 4GSYA 2NPIA 3FVQA 4H1UA 3MSXA 4Y0VA 4MGYR 2Q3HA 3RS5A 3UATA 3L0OA 3UPUA 1G18A 4BRUA 1DAFA 1P3JA 2QMUA 1VDZA 3FYHA 2O8BB 1YZTA 2ZXUA 5FL3A 5L3SB 2JLYA 1IJEA 1KY3A 2CHGA 2JEOA 2ZE6A 4PPFA 3EARA 2G83A 4GPTA 5HCIA 4A2QA 3AB3A 2PZFA 2IBMA 2IUTA 2V9PA 2W6JA 5FR1A 1D9XA 4KVAA 3DHWC 1P72A 2ZJ8A 3RANA 4B3XA 1E94E 5HCNA 1S3GA 3IEUA 4DSNA 4ZKDA 3AV0B 2O8FA 3CB4A 3CR8A 4EQ6B 3BERA 2XZOA 1P62B 1IQPA 2H18A 1DADA 4C0BA 5CK5A 4RKFA 5KSOA 2KI5A 1KJZA 4IJMA 1NVUQ 4V03A 4RFSA 2O8BA 1E1RA 1GP2A 2XB4A 4PXAA 2GILA 4A1FA 2F7SA 3OFND 2RB4A 5ELXA 3B8HA 1AQUA 2B7BA 2ZE8A 1YZUA 1KGDA 4HZIA 5TMPA 1US8B 3WXMA 1L4UA 4LJ9A 4A0RA 1F2UB 3LVQE 5AR1A 3C8UA 2QZ4A 1P9WA 1S9DA 3CONA 4RKEA 2QA5A 2VO1A 4URUR 4HB4A 3EPLA 2JLQA 1Z6AA 3LAWA 4A9AA 4QXAA 4DLRA 5BXQC 4FCWA 3KXKA 4NKRA 4FWIB 1KI2A 4D0GA 3AP1A 4LHVA 5B2ZA 4QGAA 4HAUA 1DO2A 2EWVA 3TW4A 2ANCA 1KSJA 3CPJB 2ORVA 5FTKA 5KTYA 2OAQ1 2ZE5A 1J2JA 4BRWA 5KSZA 1CJTC 1DG3A 2OFXA 1XD2A 4C30A 1NY6A 3T61A 1XPRA 3VKWA 4LBZA 3WRYC 4E5UA 1OH7A 2ZANA 1LFDB 4B3DA 2VLIA 1KNXA 2QQEA 2G77B 3DEFA 1YR6A 4GT1A 1RRCA 4HB3A 2KBFA 4XH9B 1TF2A 5AK0A 5CLLA 5IF9A 3I8SA 3AP2A 3KKMA 3EA0A 3SFVA 5J4HA 2O0HA 2BM0A 2FSGA 4X8HA 2OCPA 4ESHA 2XSZA 1ZM3A 1G4UR 1X1SA 3BIFA 2F55A 1J70A 2V8OA 5IK2D 4LDJA 4NU0A 3DL0A 2ZS9A 3ZJYA 1G7TA 1N0VC 2DYKA 3CIOA 4NP6A 1GDDA 4A2PA 5LPNA 3KQKA 2DPXA 1VCOA 5KDLA 1R0WA 4KODA 1G7SA 3QE0A 2CE2X 1M1YE 1X1RA 5M04A 2AHOA 5FPSA 1KK0A 4DLSA 3BH6A 3BFXA 3T5GA 1EESA 4C0SA 3RS0A 5TB5A 4MRVA 1TTTA 1Z5ZA 3IO5A 1VYUA 3HU2A 2FFHA 1G5PA 5C1BA 2R9VA 2BOVA 4URYR 2BC9A 3N2EA 4M1SA 4D0LB 3PEWA 1A2BA 2K5UA 4PR0A 2A30A 4XD7A 2AD5A 2HXYA 2ZS7A 2YOFA 3RS7A 2ZTSA 4GMXA 1N6LA 1J7KA 2EVWX 1VG9B 1AN0A 1RZ3A 1GNRA 4Q03A 1OFTA 2CJWB 3LA6A 1HT2E 4PX9A 2REXB 5KDOA 3BH0A 3I72A 3AEZA 2IT1A 1B0UA 2OLKA 3QBVA 4RD4A 1TAGA 5CB8A 3Q5DA 4KFTA 4XVQA 2BV3A 4PPQA 1KAOA 4TMTA 4KFRA 3GJ5A 2QPTA 2YWFA 2PJZA 3ND8A 2OFWA 2CL6X 4Q66C 3KB1A 4NYJR 4BFZA 3A1VA 3PXGA 4CT5A 1P2UA 3GFTA 2CJWA 3W3ZB 2IS4A 1OXSC 4K8OA 4D4JA 1JXMA 4XVUA 1XJCA 3QKTA 4M1YA 2UKDA 2YOGA 4Q1CA 2D06A 2WKPA 2ZUCA 1A5TA 1E3MA 1T5IA 5EUMA 2P0EA 4US2R 1XXHE 3LX8A 4Z54A 2P6RA 3NWJA 3PITA 3RHFA 1UDWA 5DO9A 3EC2A 5JJLA 2WWHA 3FKSA 1KK2A 2ERYA 4V0MA 2HF8A 4BLQA 3KQNA 5K8LA 2NO1A 2QE7D 2O8EA 1PZNA 2FH5B 2X1VA 2ZEJA 3Q72A 3THOA 2VHTA 2GJSA 1E69A 1SULA 5H70A 1U94A 3ZD6A 1KKMA 3CRW1 3EZ9A 4G1UC 1XP8A 5CB6A 5DLQC 3SYLA 5GJBA 5J4YA 4LI0A 4D82A 1YQTA 3LH5A 1XMSA 1Q44A 1ZNWA 3MWKA 4WW0A 3WMGA 5JCPA 3KQUA 3AVYA 1JR6A 1E2DA 3SOPA 2A78A 1Z6GA 2BHRA 2ZI5A 4JZKA 1VYTA 1JECA 2O8CA 3X1WA 1HT1E 2P65A 1BMFD 4G5QA 3IQXA 2ZM5A 1IHUA 2Q3MA 1WRBA 2QUZA 1KYIA 2J7PD 3KB2A 3OEHD 4MKGA 2NZJA 4PO9A 5GJWC 4A8JB 1V5WA 1RRPA 2AD1A 3GCGA 4Z8YA 4JLDA 3KQHA 2FJUA 4EIWA 2ECKA 4PC7A 1SZPA 4AKIA 2GRJA 3NBXX 1SVMA 2GBLC 1NF3A 2KBEA 1OE0A 4B6EA 4ON9A 3EPKA 2OCYC 3HWSA 1KTVA 2ZVQX 4Q9LA 2PZGA 5EE3A 2O0JA 4MGZR 5GVRA 1E98A 3R9IA 2QPOA 4TN1A 1IY0A 1FPMA 2QN6A 3QY0A 2PEZA 2ZSAA 4A0HA 4RSGA 1U9IC 4L4UA 3V4FA 2H57A 1P75A 5ANRB 3X1ZA 3Q3JB 2R6FA 1FNNA 1KO1A 1CJVC 3Q5EA 4M22A 2LWIA 4NTZA 3CPEA 2QBYB 5AJZA 4B32A 2ZROA 4JL6A 4LC1A 3AVPA 1SHZA 4Q19A 1YZKA 1L8QA 2CLDX 3CX6A 1Z06A 2PEYA 2W83A 3U3MA 3BWDD 5EE1A 4TMVA 1NIJA 1WMSA 3WP0A 1KO8A 3HPRA 2GXUA 4FMDB 3BK7A 4CEHB 1HUQA 5FBQB 5AUNB 4XWKA 5JLJA 2B21A 4DSUA 3LXXA 2ODWA 2D62A 3AVQA 4TYPA 3NBFA 2ORWA 3BB4A 4DZZA 1R0YA 4B2LA 1A7JA 4TLCA 2YHSA 4EPRA 4IHQA 3PJRA 2CNWA 5CJ2A 2YJTD 4DSOA 3F8TA 2IXFA 3P32A 2J0SA 4ZDJA 2OUKA 5KU1A 3H4MA 1GFIA 4ZDWA 4BZPA 1NIPA 2C5LA 4DC9A 5BN4A 2CHVA 3K9LA 4PC1A 5JCZA 2WOJA 4B76A 3P4XA 2F1HA 3GLIA 3I62A 4LYFA 1OV4A 3NEJA 5SZHB 3ZD7A 4AKHA 1ZCAA 1RIFA 4DSTA 1TQDA 2EYUA 2ZRIA 4TYYA 3IIJA 4P33A 3BRWD 5JHGB 5E95A 3LVRE 2C04A 3ZGXA 5BYJA 4JYCA 1G5TA 3BH7A 2ZRMA 3A6PC 3C5HA 3EXAA 1QVRA 1E2KA 3MWJA 2GKSA 1AZTA 1VG8A 3ZQ6A 1XZQA 4AD8A 3ZDQA 3C16C 2JLVA 1U99A 3ZZ0A 1XPUA 1SXJB 1IM2A 4M1MA 4V0LA 2IA5A 5FBVB 3BJIC 4NCNA 1ZUIA 4OQLA 3TLXA 4J0QA 2GNOA 2X2FA 1T3LA 2G0NA 3JVVA 4YC7A 3U60B 4Q7JB 3AKYA 3SU8A 1OPXA 2H1LA 2AKAB 3B2EA 4B71A 2ODEA 5H8WA 2HT1A 1WB9A 5LDDC 3AVUA 3HU3A 1M34E 2JDID 5IT5A 3LXRA 3LV8A 1GNQA 1F6BA 1QHSA 1HQCA 2BCJQ 1SXJA 1II8B 4Q21A 2GCOA 5BQ5A 4URVR 1E9DA 1GITA 4JJKA 1XEWX 1PJRA 3I73A 2YC4C 4OK6A 3K1JA 3T06B 2YYZA 2EFEB 1JNYA 5FPTA 4RD2A 2Z4SA 4D26A 3PEVA 2HEIA 4RY2A 8OHMA 3B1VA 5FI0B 1YZNA 1EGAA 4I1UA 4IOKA 1XMJA 2IUSA 5DI3B 5EE5B 1G8FA 1FOEB 4URXR 3QF7A 3REGA 1OT3A 1EXMA 3VR5A 1ZIPA 1VG1A 2A2ZA 2IS1A 3FB4A 3C14C 2QM8A 2RGDA 2EFCB 4PQRA 1U81A 3Q7PA 2ORIA 1F2TA 1ESNA 3CNLA 1E0KA 1G9XA 2GZAA 4ZIRB 3KTAB 4WVFA 3FHTA 2P5SA 3L0IB 3MUFA 4U00A 2QTHA 2NO0A 3C4JA 4DCVA 2CL0X 4YMTA 1DELA 4LYAA 4Q02A 2XB2A 5DI3A 2HT6A 1VTKA 4BASA 5DISB 3DOEA 1QHIA 4L16A 4CEJA 2H5EA 4YLGA 3U2QA 1G21E 3TR5A 1JR3A 1XTRA 1Z47A 4PPNA 3WBJA 4PQFA 4ABYA 1MO6A 4BFTA 3UK6A 2V4ZA 4QBGB 2ZRGA 1HY3A 2OSBA 2WVJA 4PO8A 1M6NA 1G8PA 3SC3A 1D2NA 3VTKA 4FWTA 1W36C 2B92A 3VU9B 2ZIAA 1R10A 1OSNA 4M2LA 5P21A 1ETUA 2QGNA 2V7QA 4YXWA 1AS0A 4Q4LA 1XFAA 2ONJA 1E4VA 2GWHA 3LW7A 1M7HA 3CRMA 3TIFA 1UEJA 1D8TA 4JIMA 5CIWA 3AF4A 3KUDA 1GM5A 3QVUA 1Z6YA 3KFVA 3KJHA 2XXAA 4Q4HB 1ZJ6A 4AYWA 4RZ2A 5HTKA 2VEDA 5FL7D 4BUJA 3NXSA 2A9KA 2R6AA 4JVNA 3PUZA 2WAYA 2IYZA 3ADBA 4HUTA 1EFTA 1U98A 2W6ID 3IEVA 2OV2A 3P1JA 1RKBA 1E2PA 1NJGA 1WA5A 2F6RA 4C0QC 3GEIA 1P2TA 4O0MA 4CGZA 3VR6A 3GMTA 1NN3A 5FOSA 1W4BA 2V1XA 4Q4HA 3SJZA 2Q0HA 1FUKA 2J7KA 2XTZA 1EFRA 4YMWA 4IVPA 4PC2A 3SI7A 2HLDD 5JWRA 4K46A 3VQTA 3I61A 1ZUHA 3P4YA 2C96A 1CEEA 4A92A 1AIPA 1RJ9A 2IYVA 2P6UA 5FTLA 2OT3B 1DAKA
chains in the Genus database with same CATH superfamily
1SCBA 4DDVA 1FQJA 1IPHA 1SNYA 4QGSA 3W06A 4CETA 3UJ6A 1WEHA 2OXFA 4GPAA 1OWMA 3DXZA 5AXBA 3DULA 4YX9A 4OX9B 1RJFA 4S1TA 5DBFA 1S2IA 1P4JA 4WWHA 2IHUA 1NXPA 1W49A 2AE2A 4JBIA 5D51S 2YKGA 1UDAA 1CRPA 2X0KA 1AH2A 1W44A 2RGEA 2VWGA 1YQXA 1EZ1A 2B30A 5EESA 3S2GA 4E33A 1P6XA 2AN5A 1YDHA 4RXMA 4LQLA 2JFQA 2YNMC 2WTUA 2OAEA 3OJLA 2FI1A 4X7PA 2VQDA 2J6HA 3O82A 1DAIA 3CPHA 4BO6A 2ZYSA 4BDSA 2YH2A 2QQGA 1PKXA 1YGYA 4JA0A 3T5TA 2XAAA 1UBGA 2DTEA 2ONKA 1GFWA 3ZJUA 2RI1A 4IHJA 3M7IA 5HF8A 2HW8A 4QU8A 3L8GA 3U3KA 3CRZA 3ETCA 1Z56C 3N86A 5AD1A 1OJ7A 2P2NA 3CZQA 4TS9A 4R8MA 4MVYA 4IYRA 4L5CA 3U4IA 5JADA 5HKKD 4R81A 2DWQA 2EKQA 3JZDA 3MMZA 2Q0SA 1X8KA 4NCXA 2ZVPX 3ENVA 2Y68A 1PR6A 1PT7A 2A9JA 1CUGA 4O4HF 1PS8A 4RVHA 1EQUA 2HCRA 3K72B 3RIMA 2FMXA 5CM9C 4J4TA 5JAIA 4UDYX 1EK5A 1MO3A 5DIFA 5AVKA 3OJWA 4GPD1 4OXXA 4QPDA 2FXIA 1KC1A 2CE7A 3GEBA 1TA0A 2VNIA 4QXQA 2PGLA 3I52A 3DBLA 4QA9A 5EXEA 4JDPA 2NQ2C 2GZMA 4RMHA 1G8MA 3AFHA 3GARA 4KWIA 2C31A 5CNKA 2IP4A 1KEZA 1W8DA 3PUHA 3ND6A 5DNUA 3VUFA 3A58B 1KSHA 3M9WA 1E64A 2NSYA 1SN7A 1T9CA 4FIZA 5EXXA 3DZ8A 4EHDA 2HF7A 2AMFA 2I1WA 1XPOA 1T6XA 2EG5A 3ROGA 1E6CA 1BCSB 2O7QA 2E21A 4Z8XA 1NI4A 1XVIA 1YR1A 2ODNA 1R7RA 2GAFA 4ZPJA 5EY5B 2QRZA 1LBIA 2RONA 4EGJA 1QFYA 2DCMA 2P4EA 3PQEA 4G1VA 4XIIA 2UVDA 5AUOB 3VMFA 4LQCA 1XRJA 2VPYA 4RHEA 3V4LA 5CA1B 1KY5A 3IHWA 2QMEA 3E0XA 3NRCA 1JJAA 3E9ZA 3VPGA 2CDAA 4L0DA 3U1TA 3WMRA 4B48A 1UUFA 4OI0A 1J5PA 1U6KA 4O6VA 1U5BB 3SMQA 4KKXB 1XZEA 1GQSA 1XCLA 3RBVA 2AXQA 4RKWA 1Z3IX 3K0CA 2J9RA 1S4MA 3CLKA 1SFRA 2O07A 5CYPA 3ZYCA 1XDDA 3QVWA 2PL1A 4PLZA 1DTWA 1E6KA 2GZ3A 4CM9D 2ZLBA 4CIBA 3WYDA 5DGHA 3Q7QA 4ROSA 1XT6A 2BW0A 1G3IA 5AJYA 1WG8A 1XCJA 3C3XA 1H8HA 2YC2C 1T1JA 2BY4A 2FOXA 3PFNA 3REQB 1LBEA 2ZBPA 5JG7A 1PJCA 4ND1A 1B7GO 4BX9A 4J0HA 5KVVA 2PQMA 4HAVA 1W2GA 1V39A 3AF0A 3GAAA 3R5SA 3UW1A 4HYEA 5AFSA 1M8FA 4CG3A 2QQ0A 1E2EA 4HH3C 2A5JA 1Q83A 1QRAA 2YV5A 1K6IA 4XVCA 1GG8A 1X8JA 3SQXA 4DNOA 4ZO7A 3LUHA 1MV8A 4EY3A 2QAGC 4ZV9A 1P61B 3KCQA 1YK0A 4ZOLA 4LRYA 1OH6A 4M0DA 2FJ0A 5LMNB 4LVOA 2OOSA 1L5OA 3MBKA 3QPUA 4JB2A 2B7CA 2WNHA 4P4SB 3GOHA 3N39C 4FFOA 5H9VA 3VYSB 1X80B 3SZGA 3KNZA 3SK0A 4B9EA 3CMMA 3JYPA 4PO1A 2W0MA 1YS9A 4CDGA 3LZCA 3T3GA 2VK2A 3LY5A 3ZW9A 3W5VA 1ZH0A 1ZXBA 1I3NA 1GAJA 1SEPA 2XADA 2HRZA 3BE6A 2K2QB 3QEOA 3LOPA 3M34A 1PZFA 3KYDB 4D4KA 4IIBA 3FIUA 1F0PA 2NVUA 4QARA 1MJHA 1U8ZA 3OLVA 4RL4A 4DA7A 4ETMA 1G41A 2GCEA 3BHIA 3LG2A 3SQNA 1I2ZA 1CQWA 5CX1B 3LCMA 1UFRA 1F4LA 2W8BB 5KYUB 2QN3A 4I81A 1IK4A 4JUAA 3TX2A 3LXUX 4C6TA 4DA9A 1G20B 1I3MA 1PGJA 3WLFA 1XFDA 4D57A 5M7EA 3C6YA 3R4VA 2ZXFA 1ODFA 2PGJA 4WUTA 5JS6A 1JHRA 5JEDA 4QU0A 4OJYA 1XZBA 4ZAVA 1G38A 3GJ6A 5NLLA 3GI1A 5L6LB 2D1YA 4QLBA 2I66A 1ZGZA 2FA9A 3EGWA 3FPGA 3PFGA 2GFQA 3KLMX 1MRSA 4XYEA 2NM0A 1OF1A 2O2EA 4F3YA 4P0QB 3ZVKA 3UMBA 4QVIA 1SU6A 2JIZA 1T8SA 1Z35A 3ZVNA 2IVZA 3KB8A 5L3SA 2C7VA 4HHEA 3DQZA 3RIYA 2IX3A 1DGQA 3FNFA 1ULUA 2QLFA 4XIGS 3ZN2A 3DG9A 3IUNA 1XJ0A 2XV1A 2Q9CA 4BNDA 3ISTA 4YROA 4AIIA 2VHJA 2Q6IA 2GSDA 5J5CA 4J3NA 3NATA 1JLSA 1RLOA 2V3VA 1NP6A 4EQ6A 3IEKA 1N32B 1MH9A 3OEWA 2FZLA 4R2MA 1M2OB 1PT9A 2PX8A 3WGTA 4N0MA 1WZUA 3E7PA 4CMHA 4WEQA 1DEKA 3IUJA 3R6GA 4TLMB 4A16A 1HNWB 1A97A 2JD0A 4MIOA 4Q9DA 3I2HA 4KMSA 1A1SA 1IBSA 3E9MA 2C20A 1JHYA 2ACWA 2VWQA 2WIJA 4PSAA 4UZSA 1OU4A 2P6NA 4RK5A 3TTTA 2RARA 1WOMA 1ZKMA 2WWWA 4X1YB 5AKGA 1D6MA 3KJQA 3U4DA 1H3EA 1E3WA 1E9FA 1BDIA 4H6VA 4RWEA 1IBMB 3M89A 5JANA 3BDVA 4ARUA 2NGRA 1OROA 2KHZA 2DECA 4NAHA 4ZA2A 4Q39A 4LQDA 4FB4A 2ECOA 5GZ6A 1EE1A 3QI7A 3O4FA 2Z5FA 2Q9BA 2ZBUA 1CB0A 4JC4A 4JBXA 5FIUA 3AF3A 1JLKA 4H4CA 3KDSE 3TD9A 2PKYX 2WSSA 3ANSA 4PRLA 1EHYA 3TNJA 1QGOA 3MGAA 1KTIA 3OQNA 4OL0A 1J9GA 2ZSFA 3HYLA 4UE2A 1N4AA 4EJ2A 1RPZA 2IYLD 2D54A 4NS4A 2FFBA 4PG5A 1WQ3A 2DULA 1TM3E 4GR9A 3UFXA 2JH3A 3MRSA 2SCUA 4JLOA 1H9BA 3VKVA 1JQLB 3CX8A 3G0IA 1D7OA 2GEBA 4TT8A 2DC1A 2B4AA 2GUWA 3EAQA 2DUNA 2V3CC 3B3JA 4YAUA 2X6TA 2A0KA 1LK0A 2YXNA 3OQJA 3ZI0A 1UOPA 3AKDA 1HXHA 2PRJA 3OIUA 4EK9A 2AR0A 2GEUA 2IIVA 4IHJF 3PNSA 5BR8B 3PL1A 4O29A 2WQ7A 1SRRA 3T7AA 3NVKI 4TRRA 5BVHA 4CM3A 1ZICA 2A1UB 4L4ZA 4XUDA 3EG5A 1RHRA 2ZUWA 5F78A 4EW6A 5CLJA 4CLRB 1H6CA 1IQ0A 1U0NA 4ZJUA 1EDDA 3IMEA 1OXVA 3NPAA 1AK9A 1SHLA 3RJZA 4BV2A 3CXUA 2ZI9A 3BHMA 4HSEA 4I4IA 4KQJA 2JJMA 4ZMBA 2NV2B 3TUIC 1M1NA 3L1JA 1OAKA 3FPKA 2JHPA 3DUFB 3EZYA 4TT3A 1TUBA 2GF9A 3CUWA 3WC4A 2JLUA 2IBSA 1GL6A 2XAUA 3M0EA 3AEUA 1JWAB 1MXHA 3BQMB 3OC0A 4GLOA 5CW1A 3VOTA 2P77A 3K96A 4EW1A 3BM5A 3ZE0B 5LA6B 4B09A 4PQYA 3LO8A 5B58T 2MYNA 4KTTE 3IBFA 1Y3BE 1GPUA 3ME5A 4CLOB 3HXLA 4OA8A 1FU8A 3P2KA 1PP4A 3UT6A 2QI9C 2ZGVA 4RK4A 1JEEA 3WLOA 2CKDA 1Y34E 3KKZA 3E3LA 3EUEA 3X3HA 3B3FA 4J1NA 2D5CA 3GJRA 3K2IA 4IQFA 5BSVA 4BBAA 3SG0A 4LDRA 3HCFA 4IDHA 1TT5B 3N6VA 4NFYA 3M4YA 4R98A 5HNKA 5CHEA 4ITVA 4RX1A 4H7FA 4OGGA 2F1KA 2CBXA 4OYHA 4YUZA 4CN8A 2E37A 2OXEA 4JJAA 3ZGYA 2WKSA 3WWDA 3AFOA 2PRKA 3GGPA 4TV9B 3C4QA 3DTVD 3NH9A 4GUDA 1G17A 4B8ZA 1G21A 6LDHA 2WE8A 2WFMA 1E0SA 1ZP6A 3DBOB 4DQXA 3HN7A 4C3UA 3C24A 3W0LB 2AA3A 2ETVA 4UZFA 4YPVA 2OXRA 4LXUA 5KNLA 1GAQA 4TZKA 2ZCJA 3T9CA 4DE5A 5ITZB 5IJ9A 2EBFX 3H2HA 3ZX5A 3AFIA 3PJFA 3VTAA 1Z82A 2IY9A 3MRVA 1U1EA 2BI7A 4S0ZA 1FU4A 3NGMA 1MAUA 1FTSA 1H1TA 4MV8A 1Q2UA 1L7OA 2O3RA 1WQ1R 1UZMA 3LHSA 3X1YA 4M76B 4QBHA 3KQOA 1MQAA 4MS1B 5GONB 1K4YA 4E2YA 2REBA 4DQKA 3OPNA 4J94A 4E4YA 1TEZA 3AF1A 4Y6PA 1GZ4A 3DYIA 3UIEA 4R2IA 3G2PA 3R5TA 3KQQA 4OQ4A 3RRYA 5LMCA 2ZSEA 5I4BA 1T4BA 1PKEA 1Y1RA 1YOBA 2W2LD 3DXFA 4LOHA 4REQA 2CB9A 2ZWOA 1ODIA 2JVKA 3LDFA 3FZGA 1BEUB 2OENG 2C8JA 2VQEB 2UZ1B 3B9QA 2XRZA 5M2QA 5BYKA 3EW9A 3G68A 2YL2A 3HB9A 3F2VA 4WZAE 5K1ZA 4O4JA 2RH5A 5LUBA 5KU7A 1SIWA 2JAQA 2ZIVB 3OCYA 3FI9A 4REMA 1MHPA 3E7DA 1FMFA 4UARA 1SU7A 5DYWA 6AT1A 1GN8A 1A7KA 1DCFA 2HYIC 1FFYA 2IYAA 1DJNA 2I6SA 1U7TA 1AQYA 1UAYA 4ZOLF 1YD7A 1JQAA 4AICA 4NMLA 5JYBA 1JHAA 3DD1A 1V9LA 2ATEA 2PG3A 2E4VA 2Q46A 3OFJA 3TTVA 4YLYA 3FZYA 4X84A 2NU9B 3OPVA 1JMVA 1N2BA 1RE0A 1C9MA 1V95A 4UMEA 1B23P 1MUUA 4K6KA 4FYVA 1D03A 4ILKA 3BMNB 3CZ4A 3GIDA 3N3AC 1QYIA 4K6MA 1B76A 5CXSA 4A8JC 1NI5A 5HGXA 3QE2A 2WUEA 4ICIA 4YP5A 1N2XA 3B6ZA 3RFCA 2AG5A 3BTVA 3V9AA 3GQVA 5B1SA 1REQB 1C7ZA 4CM8B 1MT3A 1DOHA 1Z15A 1Z5PA 1YT5A 4BCCA 4Q4JB 2HPVA 1T2AA 2QE6A 3VSBA 4U2KA 4QTZA 1P2FA 3E23A 2ZFUA 1I5OA 2JJQA 4MI9A 4OAPA 3R7SA 2XCRB 1DWOA 4M89A 1LC3A 2RHJA 3DVRX 4G4SO 1FFCA 3QENA 3F6EX 3Q2OA 16PKA 1T5OA 2N9UA 5E7QA 5A9TA 1L5HA 4TROA 1NMSA 3IOMA 4MAMA 4D42A 5C7OO 1TD1A 3VOAA 2HN9A 2G9NA 4EHJA 1QO0D 2FLVA 4Q3KA 5CDFA 3EIUA 3MRTA 4ZWNA 5IAJA 3ZHTA 4GYJA 1GQ2A 2PYIA 3FLEA 5AM2A 4IJUA 3SF0A 3VU3A 3GGJA 3RBXA 3QUBA 2I9KA 2ZRQA 1L4YA 3QQ5A 1II0A 1RLMA 2GCIA 3FPEA 3VO1A 3LFTA 3OPMA 3JWHA 3WLMA 5JZVA 4B3JA 2QBYA 3T3PB 3NEPX 4MYSA 4EQZA 2H1WA 1ZMRA 3I9OA 4BFYA 4QJBA 3GJTA 5LOVA 1LRLA 2HIHA 2Z43A 1UP7A 3RU7A 2QY6A 2IELA 4RK7A 4QU5A 3A25A 2ZM6B 1MB2A 1PGPA 3DDUA 5FBWB 3QW2A 5I7WA 3TQQA 4X65B 4CTNA 3DMHA 1J0BA 3A7EA 4IIXA 2C78A 3DV0B 4HXFB 5E7JA 5TPZA 2HA0A 4BFLA 4EDHA 2BL4A 4QAJA 4CEHA 1KPHA 3GLQA 4X54A 1YE5A 3KVNA 3ZGOA 2GASA 2W43A 2PUEA 3C6QA 1U0BB 1RAHA 2A5FA 1SQ0A 1OTHA 1KYVA 4Q3BA 1SXHA 3KSDO 2J46A 2SICE 3K5WA 2P35A 4YUYA 4AJ4A 3I5MA 4KK3A 1OMOA 1EP3B 1UADA 1JV2B 2OILA 1AJEA 4RPIA 2QRHA 4RY8A 5AVTA 1OHHD 4I5GA 1GILA 2C3PA 3DF7A 3QJYA 2P3QA 1TE2A 2CDCA 3JARA 2JHCA 3IUSA 4HDOB 2W6OA 4GAEA 5JE8A 2QN9A 4FYKA 4MMYB 1S6YA 1MX9A 1NLMA 1RXUA 4IGKA 1N6KA 1OREA 2PUJA 2QIPA 1JBEA 1ZC4A 1YAJA 2OSVA 3S27A 1DDGA 1PG2A 5C81A 1F51E 4ZO4A 2XT6A 1EX7A 1LEHA 3D31A 5FI3A 3KQLA 2H52A 5K0LA 1E1YA 4ZXFA 4M7RA 2ZRLA 1IIRA 5AVVA 1U3GA 3I32A 4CEIB 2VK1A 5J9FA 1UXKA 2C0PA 5KHLB 4MWBA 5IZCA 1CNMA 1SCNE 4LXIA 3UUFA 5DGTA 3NQ41 7REQB 1YJAA 1S0UA 2ID9A 4C6TB 4OM8A 3O5AA 3BWEA 3NT5A 1RAIA 4JBWA 4V0SA 5LZ8A 1HDIA 4B3FX 4B83A 3Q9NA 3MJCA 4MQFB 5EP1A 4PANA 1TUIA 1PAUA 4A3SA 1DSSG 4KGVA 2J9ZB 1JKJB 2PCJA 2GF2A 3CXRA 4YDSA 1KMMA 4ZEWA 5REQA 3KKKA 3QMMA 4DHEA 5JHHB 4P0PB 3LKBA 1NN1A 1PQPA 1IAQA 2BBOA 3G79A 3KYJB 2DH5A 1U7PA 4WXMA 1IPFA 1EP9A 3EZFA 4Q5IA 5K0CA 2XGJA 4IVRA 5T6MA 3ROFA 3L6RA 1U7DA 1P1RA 4D3YA 4G3XA 1OFIA 1IBRA 4ND7A 1PJ4A 2AJDA 5JT1A 1C8VB 3WMEA 2F1IA 1A77A 1IEXA 1XTBA 4FEGA 4DCUA 4DG5A 2JKZA 2WTAA 1EK6A 4HEJA 4XQGA 3DW1X 2XE7A 1LS6A 3V33A 1TL7C 2W2TA 2Y77A 3PL5A 1WZEA 2C7RA 2RFLA 3FFWA 3MG9A 4MCIA 4D6XA 2G09A 2GFIA 3KJEA 2Z58A 4RFLA 2WHXA 2QT1A 3T3IA 2M2IA 2V58A 3DAOA 3TWOA 3I9V1 1PGNA 4U2EA 1X70A 4I5FA 1FDWA 3GFBA 5D5HA 3SF8A 4YEDA 5IU6A 3CU5A 1F4PA 1MPXA 1TYZA 3EB9A 2B35A 3T3HA 4MDYA 4DQLA 2E4WA 2J3QA 3B5JA 3PDIA 4Y3UA 3SLRA 4LF8B 2PV7A 4NJMB 5FBZA 4DM7A 1JB1A 1F48A 1IEWA 1F9AA 1S7GA 1X92A 5ALWA 1E3QA 3KT6A 1MPTA 4XVHA 4Y1EA 4RK6A 4BNYA 3USES 2A86A 1CQIB 3KTAA 4OV6B 4R2LA 3RG2A 1BROA 2ZPTX 3PXDA 2ONCA 1ZH4A 1Q7GA 3R09A 3WE7A 3W5BA 2QYTA 3AH8A 3BGWA 1DQRA 3T9AA 4EL5A 5B57C 5L8VA 5L4SA 2QW1A 1OKKD 1JA0A 1KEVA 4HI0E 4QHYA 4FSXA 1CUCA 1ADYA 1GSOA 3LPMA 3A1TA 1R12A 3ADKA 1YGPA 4CODB 5LKAA 2PV0A 1E1QA 2PZKA 4WK4B 4M8IA 5DM4A 2MYTA 3FYDA 4YDQA 3QEKA 3WHLA 1NRIA 4F3TA 3I6ZA 3EDCA 4U02A 2IYXA 1GZ3A 2MCFA 4LOAA 4EO9A 3GJXC 3OCZA 3B9RA 4MYHA 3TIIA 1COWD 2KJQA 4KN6A 3BTUA 3VU9A 3VVLA 4D4LA 5CFMA 3ABQB 3OZDA 5F2OA 4DY6A 3VNUA 3Q0EA 1JFSA 3IBSA 3A06A 3SSOA 2HU8A 4Y9DA 1JZTA 1WTAA 4XGRA 3I0NA 1VRVA 4DF3A 3IQIX 1SBYA 4O4JF 3FLBA 5GGXA 5AJTA 3D0RA 4UHBA 5AJWA 5I3CA 5IVIA 3U9TA 4ALLA 5LU8A 1HZJA 3IFSA 4MULA 5A62A 1TLFA 1RC1A 4DPKA 1K8ZB 4KIUA 4M9ZA 4Z2YA 1QS0B 3JVDA 3PUWA 2VBGA 5I9BA 1CJBA 5F1PA 1T2CA 1E62A 1DO8A 1OFUA 1UPBA 5F76A 1K9VF 4O5OA 3JRNA 5LQKA 4AG6A 3FFAA 3BB3A 5H4HA 2DR0A 5F51A 1LJUA 3AKZA 2OQ2A 1P4RA 4JITA 4N4AA 1XNJA 2G63A 2YRXA 3H84A 4BLVA 3N2GB 2PUHA 2WIFA 2VAXA 4HAYA 3E27A 3AG5A 4CCYB 1A8IA 4W99A 1O89A 3F7NA 4KX5A 2H7YA 4W9MC 4PFJA 1N6IA 4HXEB 4J6FA 5EZQA 3L43A 1PJSA 4YRLA 3RHTA 1MD9A 1KO5A 4E09A 5L3VA 2IHYA 3AEXA 3NTUA 4NMXB 4G0NA 1TTPB 2AZTA 4TSRA 4U3JA 1YBFA 4PCVA 2FRVA 1UZAA 4UMVA 3WB2A 3WRWA 3ESZA 2LCQA 1UMCA 3UHFA 5BN1A 1D9ZA 3I6IA 1N0HA 3GA0A 2ACKA 3OE7D 3V1UA 3JTMA 1C7EA 4F0JA 1F5NA 3RAGA 3WK4A 1P0CA 3I0ZA 1N25A 3PC7A 4YJGA 1DC8A 5K3BA 1SCUB 2GO7A 1E7RA 2VPXA 2HJVA 3ZK7A 1PHPA 2ZWVA 3K32A 2BEWA 1G1MA 1CJMA 1YRHA 1PYOA 3UANA 1I3KA 2NN3C 2RMKA 4X7MA 1E0JA 2H2WA 2YS6A 1Z4LA 1QDEA 3CBGA 3CNQS 3OG9A 3PVZA 1UT8A 2CVOA 2FPWA 2A59A 2V0NA 3GQBA 4LF5B 2XXBA 2RGWA 3FWNA 3AM4A 3N8DA 3ZDEA 3L4EA 3UHOA 3FUUA 5AI4A 3CGWA 1MTOA 4NBLA 3UK2A 5LIRA 3G0CA 3IPLA 1FS4A 3DR3A 1VMIA 3C2QA 3TSYA 5LOVF 5I4CA 3JQPA 2OKGA 3RRMA 2ZIXB 3K9HA 3LY8A 2Z57A 1M6HA 1IZ7A 4TV8B 3T7IA 4EG5A 4EW2A 3I5UA 1M2GA 1NVWQ 2CDRA 3I1FA 3JQ6A 5KCZA 1LPOA 3DJYA 3C3WA 2XOKA 2N46A 4HPJB 3MMNA 1JQEA 2VUHB 4LKOA 1CBUA 4IKEA 4JVMA 2LTAA 4Q4AA 2W6IA 2X23A 3IEIA 1N78A 3P45A 3M6LA 3ELWA 3DH0A 2QY9A 4HUQB 3GCXA 1M6WA 2W5UA 4E3WA 4TWJA 2QX9A 3DFKA 1G55A 1QG2A 4ALMA 1U9ZA 5DNDA 1E2JA 4G5FA 2ATCA 2FW1A 4DMCA 5CLFA 2X15A 4RADA 2WMOB 4G63A 1YULA 1GXSA 2P8SA 2DERA 2YJ4A 5FAXA 2QTLA 2CCKA 2FPIB 3CJTA 1DEOA 5HIJA 4C7OA 4ZCPA 1XCBA 2OXTA 3DOOA 1GO2A 1KZ6A 1U2ZA 1JBQA 3DGFC 2VSNA 3V8QA 2GPWA 9GPBA 4RE6A 3JAWA 1NBIA 2EOAA 3ZIAD 1XMOB 4YHBA 2JZCA 4ENRA 1X9IA 1P44A 1CS4C 4RVSA 4RHTA 2FPMA 2HBYA 2G9VA 1MQ9A 1MNAA 1AD2A 4NPCA 1QZUA 1DZ3A 3I4FA 1OZ0A 4JNKA 2EJCA 1OCEA 4WXRA 2IP2A 1MX5A 1O3YA 2AXEA 3IKMB 1TJNA 5EAIA 5IDVA 3G9UA 3DZKA 4LE2A 3HA7A 4NHEA 5IM5A 4N12A 4D25A 1J1ZA 1S1MA 2DGDA 4QNNA 2GI4A 1FY2A 2V5UA 3EH2A 1YZGA 2DH6A 1P9NA 1T1IA 2WHYA 3CN9A 4GWGA 5HP4A 1HE2A 1Y63A 3U56A 4HNHA 3NHBA 3E1SA 4KV9A 4LRTB 5F52A 3TCXB 1A2OA 2XDQB 3EXFA 4MKRA 1FUIA 3U0BA 3HYSA 3JR7A 3R7FA 1PJAA 1XLTC 4Z9AA 1XZ8A 1UC9A 2QRNA 4RY0A 5IAGA 5C7LO 2V96A 1E6LA 3GEGA 4YCSA 1UM9B 1BE1A 3EQ8A 2Q3EA 3OQ1A 2FCRA 1O94C 4CNBA 2IKQA 1EPUA 3F90A 5ADHA 3RK4A 3A3OA 3HO6A 3V2IA 3W5HA 4ZHQF 3U16A 1L7VC 2XQIA 3UGTA 1TQHA 2CVHA 4JT2A 3NFRA 1M66A 1Q1EA 2PNFA 2P3LA 5JRJA 1R88A 4M1ZA 1CUFA 3MOIA 5H0IA 2OFFA 2EXXA 1HNXB 2J9FB 4ALIA 3ZDBA 2HDNB 4AY3A 5CT6A 1XOIA 1MX3A 4EA8A 4LTDA 3AZQA 1J1IA 5T3YA 3R0JA 5FB3A 4FZVA 5F9FA 2XY4A 1EWQA 3HGQA 2V5VA 3R5JA 1PNVA 1PZMA 2WQZA 3FYUA 1C30B 4J76A 1ISHA 4MI6A 3RGGA 4BU1A 3N28A 1M2WA 1QIMA 2VJAA 3D6FA 1UMKA 4TKUB 4CUKA 3SM9A 4HLUC 3JQGB 4BATA 1KPGA 1TB4A 1OB2A 1E4OA 1XQVA 2G0AA 1EUQA 1QHXA 4P54A 3KZ1E 2RGXA 5TPWA 1EQ2A 2BJVA 5KNBA 2MSCB 1RWWA 3ESBA 1K4KA 3DV9A 1ORIA 1TU0A 1U3CA 1K89A 3S1AA 5JR3A 3RWOA 1H2ZA 2CNLA 1V48A 1WUJS 4U7PB 2C2XA 2BBWA 2MHCA 2YJ5A 4I1SA 2PFKA 1E4EB 5IDWA 4KSYA 2EJTA 5J4VA 2VPQA 1EFDN 2FF5A 3G5MA 3OJCA 5I4IA 2CMKA 2FPPA 4CU5A 3TW8B 1V4NA 1DAGA 1KOLA 5G3YA 3H83A 2Y0PA 5CVDA 5GVSA 2B78A 4M54A 1SKYB 2XX3A 1ZX1A 3RRXA 3U4QA 1MIOA 1K88A 3AL0C 5JY6A 1MAWA 4GW3A 4P53A 2CWDA 1GEEA 3P9QA 2R1ZA 4IXMA 2Z2JA 4DDKA 5PGMA 5F73A 3JQFC 4ZEXA 2RSLA 3LOUA 5FBRB 4P81A 3PLAE 2QXYA 3UPDA 3AEQB 3HYRA 3MJRA 4LYHA 2A67A 1K8YB 4FOLA 5KTNA 1PUIA 1RLIA 2I8AA 1LDGA 1V43A 3F5FA 1V16A 1D1PA 1ZBDA 2FW6A 3LBHA 3QIVA 5TIIA 2JJ2A 4MEJA 4NCJA 4C4OA 4YR7A 3VI3B 4UOZA 1GTMA 1KO4A 1SXIA 4MDHA 1OXKB 1RRGA 5AVZA 3VV2A 2Z98A 3CLHA 4XPIA 1QIIA 3L92A 5BQOA 2WG0A 4QUGA 3RIGA 4KAJA 1N1MA 5EEHA 3DHVA 3RODA 4M1KA 2ZWIA 3H16A 1WP9A 1CS0B 5EZYF 1LJ8A 3EF0A 3SVTA 2FFAA 5IDQA 3OCXA 2XQFA 1YTLA 2XNKA 4KH0A 5K6AA 3GLGA 4FR2A 3HKBA 5BT8A 2G71A 2EQBA 2BRUC 2EKDA 3MHTA 2HY7A 2I0FA 3CBQA 3MINB 3DBHA 1W6UA 1NI3A 1NXQA 2RI0A 2ICAA 3I2GA 3GLVA 1FFDA 1XD2B 3T1OA 5J59A 1O2DA 3OHMA 3B1KA 1DJMA 2VHZA 4LJ5A 3CCCA 1ZRSA 4D8WA 4EB6A 1C9YA 1ADGA 2HJWA 4E70A 2VYFA 2CN1A 1E9BA 2JRCA 2E1RA 2QAIA 1UBEA 1YDFA 4S05A 1IUNA 3EBLA 1XTPA 3MK31 2QM7A 4KFUA 5E8JA 1X8XA 3GEMA 4BMYA 3VFDA 5EHZA 4JB8A 1FCJA 1EVEA 3BREA 4RCYA 3TH5A 4IZOA 5F33A 4S1WA 1O0SA 1PZGA 3OECA 4G65A 4YMUA 3HP4A 3GPIA 1N2CE 3MUEA 2Q1TA 1FNBA 5FD8A 3DEJA 3GHYA 1R9NA 3HSYA 3TUJC 2ZB3A 1DUSA 1N0UA 2G67A 2Y1FA 1W7AA 4M4SA 2AC4A 3CLUD 3MOSA 3FWHA 5K8IA 3KEFA 2PJRA 4I7EA 1M9NA 1BVYF 1E77A 1NW4A 3IQEA 3EOBI 3H18A 3UJAA 2IRWA 5HR5A 4NBKA 1T2DA 1ZH6A 2QSZA 3HA2A 2DTDA 3I4LA 4UVGA 3ROPA 1XN4A 3W5CA 1C0PA 2GPSA 4PXSA 1GZHB 3EJ6A 2G9UA 1Y6FA 1RZRA 3GUVA 1XDGA 3G59A 2DSNA 4X20B 5L7WA 2DX7A 2IF0A 4WK6A 5AVWA 3HVKA 2XUPA 1WXIA 2H51A 2QL5A 1K5DA 3GRKA 1YCHA 2W98A 4JI6B 3DD5A 3AI7A 5FQNA 1KMQA 3S2YA 1U2QA 2VK8A 1PEKE 3U3XA 4IR7A 3ZGLA 1F4VA 1UEXC 2ADMA 2X4LA 1SKMA 2IHTA 1XQYA 1XWWA 1VA5A 2J87A 2DMRA 2OV8A 3CF0A 2A35A 2Q5CA 4AMGA 2QQ5A 5JBQA 3PGLA 2JCSA 3WK5A 1Q1GA 4ID9A 2HK6A 1XALA 3H1EA 4KXUA 4YONB 1XRRA 2BGJA 3AF5A 4BDTA 1NX9A 1P31A 4QM7A 4N9QA 4PR3A 1QVWA 3A9RA 1TJPB 2J09A 2G4CA 3AO0B 4X8LA 4I3HA 4JLBA 3GRFA 3KX2A 5K05A 2SNIE 3A6FA 3C7KA 2MIIA 4MQLA 4JENA 4UU8A 3ADDA 3B6EA 1N5KA 4Y2UA 4F5ZA 2BMFA 4BAUA 4BY9E 2O0KA 4CF6A 4TXNA 4LBYA 5LLTA 2AMJA 2JEYA 4XX0B 5FADA 2PAAA 3I5AA 3V9PA 5ALDA 4QEKA 4XWWA 1YNOA 1YQDA 4A0FA 3K0SA 2C4VA 2VBCA 5D8DA 2RGAA 1AZWA 2CZQA 5J4LA 1N9ZA 1YZQA 4R2KA 2XDWA 2YRWA 2YV1A 3LYUA 4WERA 3L7KA 3TB6A 3M9XA 2GD0A 3UYKA 2GPYA 1JEDA 5JYCA 3DJFA 4E3ZA 5F2EA 5U4XA 1RCUA 4XD2A 3HC7A 2IF2A 3QPVA 4EPWA 4B3DA 3AIKA 1E66A 3KXDA 2AOVA 2VIIA 4G5YA 4I6GA 2Y1CA 4HDSA 2X1MA 2VUTA 2IE8A 4MTLA 5ECGC 5FEMA 3L1UA 3RJ9A 3GC6A 2GLUA 3MT8A 5KI6A 4TVBA 3BFKA 4YAJA 1D8AA 3PRJA 3PNPA 4P2BA 1ULAA 2HZ7A 3G8AA 4QECA 5AK4A 5IG2A 2O7NA 4JSTA 4ZV7A 4C6SA 5IK2A 3H9BA 1HDGO 4KBGA 3R76A 1PJZA 5GV8A 3LQ4A 4JQSA 2GA8A 1QFZA 4C4TA 1RS0A 1NHGA 1KJIA 2WZCA 4NDZA 4C4XA 1NPDA 2R4QA 4XTRA 3P0JA 4OK5A 3VNVA 4QQNA 1L7EA 2OCLA 4V1CA 1JMYA 2FPLA 3T34A 3GDWA 3P52A 2IUYA 4OHKA 5EUBA 3ZTTA 1V5GA 2ZITA 4ITRC 5AHWA 2B1JA 2VJNA 3N9IA 4KE6A 1JX6A 3MGBA 4WBNA 3GLUA 1N6HA 1IIBA 1K8XB 4JL5A 4L85A 1G5HA 2Z8XA 4KQMA 4AQDA 1HE1C 1VPEA 1ZN9A 2WOOA 2I6TA 4PLGA 3GG2A 4UEOA 2ZSIA 4ZQHA 1WLSA 4EFKA 4ZFNA 2GN4A 2O8CB 2XR1A 3ZWYA 4DAEA 2NV6A 5HJEA 4JROA 3HDQA 1RBYA 2I2XB 3A6ZA 1T3ZA 3C6KA 1E32A 1WHSB 5EZ5A 1BMDA 1ZW1A 2ZDGA 3GJ0A 3L8ZA 3Q6IA 4HGYA 2HMSA 2IZ5A 3KU1A 4XJVA 3BBLA 2I2FA 1GKUB 2CZCA 4HCJA 1Z37A 2P5YA 5EVCA 2P2SA 3S70A 5KYUA 1MB0A 5BMVA 2XUKA 1CIVA 4B44A 2OG2A 4WZBE 2VP2A 1IXZA 4UATA 3BMCB 1UPFA 3I30X 3R77A 4JYPA 4NK4A 4ZGBA 4DXAA 5I6DA 4QHTA 3DTVA 4ZU3A 4WEOA 3VH1A 3H8WA 4UMFA 3JWEA 4NEQA 3LHFA 1XKLA 2UXBB 4XB6B 3EGEA 1Z9BA 3LT4A 4RPHA 1ZHOA 3S44A 5L45A 3LWZA 4BNHA 1W19A 2I3ZA 3VNSA 2M6SA 1Z0DA 4PLTA 5SYAA 4YT2A 4AYTA 2XDYA 1EQAA 2I33A 4NABA 3ZWMA 1O0BA 1SCQA 3ZCUA 1JEYB 1VL5A 1IAVA 3RVSA 3T99A 4Q3OA 1JIVA 5EWLB 5HIIA 2DSTA 2X2EA 1C9KA 2NSDA 3PFKA 3MC1A 3DBIA 4YJFB 3L1IA 5C1IA 4BGDA 5JU6A 3PDJA 3PWKA 3DVLA 3HNRA 2E6KA 1E3IA 2GBLA 3IYLW 4ZVNA 3LOQA 5A0TA 3E5HA 3ZWXA 3RVRA 5SZIA 2H4HA 2Z1DA 1YXMA 1KAQA 1EWYA 2D0IA 1FTNA 4MH0R 2YY6A 4PBTA 4OOEA 1DFIA 1YMQA 4CJXA 1A9TA 2VDVE 2Z04A 3SZRA 4TXMA 3U3JA 3H0KA 1OZAA 1QONA 4PWZA 1E1KA 1SBIA 2J3HA 3RLFA 1U9IA 1YQGA 4RO0A 5IF3A 3RTCA 1J5EB 1MU0A 3JAMA 1Y5MA 1JI3A 2PKQO 2ZYTX 3GK3A 4XB2A 4IIVA 3WGMA 5HQ3B 4H2DA 4AZVA 2ZR8A 3D3WB 3QH4A 1BRMA 4K9MA 3VX4A 1UEIA 1UZUA 3ASYA 2KLHA 4A27A 1NVBA 1NSFA 5EPUA 4YCAA 4U9IS 3OZFA 2JANA 1D6JA 2FK7A 2UVQA 1HLFA 4BWYA 3WKEA 3AM1A 4AZSA 3NBKA 4N8EA 4B2IA 1Q16A 1RQ7A 1BMFA 1Q22A 2VKQA 4RCVA 1NFFA 3OX1A 4BJ3A 5BURA 4LUCA 2ATIA 1Z88A 1BXGB 1BXZA 1ELOA 1RYFA 1SB8A 1TU4A 3FPCA 3H8JA 3N0VA 3OEHA 4LPKA 1QRDA 2BUCA 4QO8A 4W8OA 3V8MA 4J4BA 3RRBA 3VNAA 4BLOA 1YRWA 1I6MA 2OV6A 3R3JA 2DFNA 1U0HC 2HA4A 2NU7B 1JIIA 2AFIB 2JLSA 3ULKA 4AX4A 3GJYA 4A1OA 4P83A 1U0TA 3I9MA 1QYXA 4QD3A 3WGNA 4M7PA 1U8AA 1WF3A 5BRJA 1TYBE 4Q16A 4FYWA 2FR8A 1CEXA 2OPHA 3TEJA 4JL8A 1ND5A 1A5AB 2Z95A 4MRMB 5EIBC 1G8HA 1TC1A 1OW3B 3FWYA 1E79D 2VDNB 2DTXA 3O7MA 1IVYA 2ZVDA 3NHAA 2I78A 4WVLA 3C8MA 4YCJA 4ZANA 3TKLA 3D7LA 2O5CA 2QU8A 3TFQA 3B48A 1C50A 2HCJB 2GAOA 1QF6A 1J09A 2NUBA 3IJ5A 3OM8A 4LYGA 4DIOA 1N8NA 1YDEA 3OOHA 4UBOA 5HZHA 2UZ3A 1F7VA 3SYNA 3U62A 3LY7A 4AMVA 3NWOA 1RKQA 5DXFA 3TLGA 4UXHA 4HX2A 2QJWA 9LDBA 1NXSA 2GBGA 3QKRB 4EI2A 2W2OA 1QO0A 5IBRA 3BD9A 3EBOA 4UW9A 4DRXA