4MGZR

Selective activation of epac1 and epac2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
molecule keywords Rap guanine nucleotide exchange factor 4
total genus 41
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgzR00
3GLHB 2A7QA 4B2IA 4X8LA 3BH0A 1QG4A 4JLKA 1AGRA 3V4RA 2DR3A 3I3SR 4TMTA 4NDZA 3UG6A 2CBZA 2QI9C 2DWOA 4TL9A 2AKYA 2H7VA 2NPIA 3GEIA 2ZE8A 4I1OA 1Z6TA 2A5JA 2ZUCA 5C18A 1KKLA 1WXQA 4OYHA 3MMPA 3RC8A 3QPWA 3ZVRA 4YLGA 2F1RA 2HEIA 3LWNA 3PVSA 3CNNA 1GKYA 4O0MA 1ODFA 1TTTA 2BDTA 4KFTA 2ZYVX 2BOVA 4OQLA 2VRWA 2FN4A 4DKXA 1FX0B 2PZGA 4RD6A 5CITA 2O8EB 4JYCA 3IEUA 2DFNA 4MKFA 3JVVA 1QHNA 4OJKA 4C4PA 5B57C 2EYUA 1Z0JA 1A4RA 2AXPA 1KYIA 5BWMA 4QNRA 3TSZA 3NC0C 1CS4C 3ZIAD 3MUFA 1E0KA 4HZUA 3BB1A 5EXTA 4KLZA 2ZRLA 4FD2A 2ATXA 4IJMA 1DO2A 4AKGA 4LJ4A 4I4LA 3CNOA 4KJZA 1KGDA 1W4AA 3CPEA 5E3HA 2YOGA 3TVTA 4QJ3A 1XEXB 3NEYA 1D2MA 4GL2A 3RWMB 4HAVA 3QF4A 2GEVA 1UF9A 4JKYA 1PLJA 4Q1AA 4UNNA 4CEHA 4V0MA 4Q4AA 4WZAE 5AJVB 4Y0VA 4XVRA 1Z83A 4US0R 1YZKA 5CM8B 1ZM7A 2WWGA 3PR1A 3U6BA 4LV6A 1CR4A 5KSYA 1R0YA 1UDXA 4LHVA 2P6UA 4HB3A 4M1OA 4EJSC 2CK3A 4OL0A 3SN6A 1E79D 2X19A 2NO7A 4LV8B 5F9HA 2OBNA 1JECA 5TVKA 4LUCA 4RY2A 2J41A 4MH0R 4NH0A 5JJLA 1SQ5A 3H4MA 4HLDA 1BO6A 2OZEA 4DIDA 2P67A 2IYXA 2QTVB 5FR1A 4UJ3A 3OIWA 4ARZB 2K5UA 3SR0A 3BOSA 4Q48A 2R9VA 2ZR9A 1RW4A 1Q3HA 3KXIA 4NYJQ 4PSAA 2PCJA 4FWIB 4HI0E 5EE1A 1LW7A 4PQYA 3KB1A 4CEJB 3L2OB 2ZJYA 4B44A 1ZCAA 3LY5A 3QXXA 4RCYA 5HTKA 2WWIA 4IDPA 2QORA 4K46A 4LJ7A 1G8YA 4JMPA 2P0EA 3RS2A 5DHFA 3TVDA 3WNDA 3O8BA 1JR6A 2OCBA 1XXHE 3K8YA 3VR2A 2ZYWX 2MSCB 3GJ4A 4F4JA 1NN0A 1MV5A 3SQXA 1P9RA 3UPUA 1G16A 3GP8A 5F2EA 4ESVA 2FFQA 1NBMD 3EA0A 3M1IA 4HAZA 4IOKA 5GVSA 2V7QD 1M8PA 4Q03A 4RZUA 1KI3A 1CR2A 4AC9A 4C9BA 3WBKA 1HTWA 1Z0KA 2P6NA 3QXCA 4JLOA 1G3MA 4OI0A 3I61A 3L8YA 4OHXA 4YONB 1P72A 4NCKA 3ZYCA 1KNXA 4LPKA 3B9PA 1B23P 1S96A 1E0AA 4AY2A 1Y63A 4TYQA 2WWWA 5CK4A 5EXPA 3VR1A 3HU1A 1QHHA 1SVWA 4JT4A 1P60A 4F38A 4EJSB 3A37A 3ASYA 2ZUBA 1RJ9A 2ZS7A 1W0KD 5FH9A 2HCJB 4MKIA 5LB4A 1G3QA 4G5SA 4E09A 1K5DA 2ZSAA 4A2PA 2DFKB 3BS4A 3VTKA 1Q1EA 2C9OA 5BXQC 5J4LA 4TZ0A 1SHZA 3MRSA 1M74A 1TF5A 2IUUA 2F7SA 3QF7A 2Z83A 2UZIR 4ZPXA 5J4VA 1OYYA 2EW1A 2I1VB 2PMDA 1E0JA 1GTVA 3NC1C 2CXXA 3R8FA 2BWJA 3AUXA 4UNSA 2IWRA 5JSZB 3C41J 1R0XA 2RGEA 2UVQA 3K53A 2QZ4A 4IOJA 3SJCA 4CVNA 5B64A 5FOXA 3VNVA 2ZJZA 4UJ5A 1FZQA 2X1VA 4P4SB 1TU3A 2ZVQX 3THYA 4D0LB 4YMUA 4DVGA 3NG1A 1IHUA 1NMYA 2VSOA 4HB2A 2W6ID 2GZDA 2WVJA 4ABYA 5DI3A 2GK7A 4MUAA 5J4YA 2WPDD 1HY3A 3KDSE 4RD4A 2GBLC 3KL4A 2XGJA 1ELOA 3D3QA 2P6RA 1QHGA 4ZIRA 1ZP6A 4NCHA 3K0FA 3B2EA 3IQXA 2HUPA 3SFZA 1N6RA 2QRNA 2KB0A 1FQKA 1KK3A 4RD1A 2VHTA 1Q44A 2B7CA 2WKPA 4A92A 4OK6A 1X3SA 3B5JA 3Q85A 3CM0A 4W5JA 1DOAA 1LF5A 1N5LA 2ZITA 1KSJA 4Q9IA 1JXOA 3Q72A 1LF0A 1I4DD 1AK2A 4WAUA 3BRWD 4UNPA 1E69A 2NO1A 1JJVA 4ZCMA 2DY1A 4D0GA 4JLVA 1GL6A 1QDEA 1MRSA 5AR1A 1P61B 2BBSA 2O5VA 4JIMA 3WY9A 1MOZA 3VKHA 1Q1ZA 3C16C 1IXZA 2FPMA 2QMHA 3QXJA 4GRAA 4M4SA 3PUZA 3OE7D 1HE1C 4D80A 4LPSA 1GILA 2CE2X 2O8CA 4IEEA 1KZ7B 3UKDA 4DIEA 4CEIB 2XTNA 3TAUA 1ZNYA 3AVVA 5CB6A 1ANKA 4M9SA 4XSGA 3AH8A 1XJCA 1CJTC 1OFTA 3W3ZB 4ERNA 5JFGA 4U00A 3W9YA 5HKKA 3CRRA 2Q9AA 4GOKA 5JJKA 4OI1A 2IYRA 4D81A 4ZV4A 1N6OA 5DIFA 4D6PA 1N25A 1Z47A 4M1MA 5JI2E 1DARA 3AVWA 1NY5A 5L3SB 3C14C 1IN4A 2Z5FA 4ZCIA 2VHCA 2WJYA 2EQBA 2Q6TA 1RYFA 1WP9A 2ZREA 4DCVA 2JIZD 1WE2A 1XMSA 2RGGA 3ZZ0A 1TQDA 2N46A 3I8XA 1XEWX 2QTFA 3SU8A 2P5SA 5EQTA 3TQFA 5KO2A 2IEYA 2XNSA 3BK7A 4TQAA 4TYPA 2RGBA 1XCMA 1H8ED 4QBIA 1P73A 2XZLA 3TR0A 4XWKA 2GEDA 5LBIA 1NVUQ 2OT3B 4TMWA 4DCNA 2WWYA 3U4QB 1HE8B 5AUQA 3A8TA 3VHLB 1N0UA 3TE6A 4M53A 4IFBA 4MRRA 2EFGA 4NPHA 4HSEA 5AK0A 2XX3A 4S35A 1E1RD 2MMGA 4PPQA 3FVQA 4GP6A 1UBGA 3PXGA 5TMPA 5JZVA 4WW0A 4DLZA 4DXAA 5G3ZA 1COWA 2JLZA 1JXMA 2FGJA 3BAFA 2BV3A 1F6BA 4DJTA 3M0EA 1PZNA 3MAAC 2CNWD 2I1QA 1FNNA 3FHCB 2R2AA 3CPHA 1T3HA 4BPBA 4FMCB 3NBFA 4KO8A 4LY6A 3T1QA 8OHMA 4HAUA 4EUNA 4KBGA 4DDUA 1KTVA 2QA5A 5DGXA 3RS7A 2JGNA 3SYLA 2FF7A 1CIPA 2XSZD 1V43A 4UNRA 1YVDA 2CCGA 1KDPA 4YMTA 4KU4A 2LKCA 3AVTA 2FSHA 2QAGB 2R62A 5EXSA 1F2UA 1UM8A 1IXSB 4A4DA 1EFUA 1P9WA 3P32A 4LCBA 1H65A 5E95A 3P26A 2YHSA 2HV8A 1VHLA 5JMTA 4QHYA 2AWOA 3U7FB 2ZAOA 5K8TA 2WV9A 4Q9HA 2QP3A 1TF7A 2CHVA 2GZHA 3TLXA 3PEUA 1KO1A 2OO7A 4JLMA 2IL1A 2N42A 3MWJA 5KDOA 1XD2B 1AM4D 3R8CA 2ZEJA 2J7PD 3LQQA 2GZAA 2VL7A 1CEEA 1E94E 4Y0AA 2IYLD 1P2VA 3VU9A 2O8DA 4YXWD 4LYHA 3UMRA 1FL9A 1VG8A 1W4BA 1X86B 3FFAA 4KHZA 1P6XA 1G6HA 1Z2AA 5EP3A 4Q1EA 4LJ8A 1F2TB 2XNDD 3PG5A 1OF1A 2X8AA 3ZS9A 1G5RA 4E5UA 1KI7A 1CLUA 3FYHA 5BN4A 3VR5A 4EIWA 2VEDA 1LFDB 1ZD9A 2EYQA 2BBTA 2VTKA 1J2JA 1G4UR 5CK5A 4PXAA 4MYHA 4EQ6B 3OEHD 3OF5A 4NYIQ 1AS0A 1JBKA 1NVXQ 2FEOA 3ND9A 1QF9A 5CLLA 2GDJA 3EIQA 3GLIB 3U3RA 3THWA 2OLKA 1XB2A 2GXUA 1T0JB 4US2R 3G5UA 3NDPA 5G41A 3RS3A 1L2TA 4IXNA 2D7CA 2WHXA 2H18A 4EPWA 3F0TA 2AN9A 4NE2A 4F91B 4PHTA 4NONA 5SZIA 3DPUA 1Z5ZA 4JL8A 5JWOA 1G21E 1FX0A 2O8EA 1XZQA 2WICA 4O2RA 3T12A 4TLCA 3SJAA 1HV8A 2V4ZA 3GLHA 2BEJA 4TYNA 5AJWA 3RHFA 1IJFA 1TQ6A 1GDDA 3T1OA 3B1VA 2C03A 4EPVA 1U9IC 3DZDA 3X1WA 1WDTA 1N6IA 4US1R 1TF2A 4OKSA 3K0AA 5FBLB 2BKUA 1YU9A 3MWLA 3OIVA 2ZS9A 2V9PA 2HF8A 5TDHA 1KK2A 1A7JA 3EZ2A 4DZZA 2C8VA 1XMIA 1ZC4A 4LK2A 2QTHA 3KUDA 1WBDA 1EFRD 2VP5A 2Z6VA 1W46A 3UANA 3UIEA 621PA 4M22A 1VG1A 3CPJB 2BKEA 2MMCA 1S1CA 3X1XA 3O8CA 4HDCA 1KHTA 2HJGA 4LI0A 4DBLC 4EKDA 4H1VA 2JJ2A 4TYYA 2W6JD 1P2TA 3K09C 2VP4A 2WKQA 4LHWA 4IRUB 3IIJA 2QRZA 3BB3A 3DKPA 4Q1BA 3ADCA 4DUGA 2UZ3A 4FINA 3AF4A 1N5IA 5EXXA 3Q8XB 2ZRCA 1SVOA 2WMNB 2ZRDA 3A1VA 4PC2A 3W90A 4LJ9A 1ZM4A 3RS4A 2F1IA 2BEKA 4JVNA 1RRFA 3K9HA 1DG1G 1E79A 2QL6A 4XH9B 1XXHA 1SXJE 1SVLA 2ZYUX 5KDLA 1EXMA 1II9A 4M1YA 3VR4A 4QOSA 4MUBA 2BIFA 3ADKA 3AP2A 3RRZA 1CR1A 2PL3A 3GLGE 1T8UA 1JAHA 3PENA 4B2PA 1AA9A 3DDCA 3SJBA 4DCSA 3CRW1 1TNDA 1E2GA 2J46A 5CYOA 1OH5A 4JBXA 2GHIA 3AF1A 4KAXA 5J5CA 4IVPA 2QGZA 2MSDB 2PLRA 5JECA 2IF0A 4FCTA 5UKDA 3WYFA 3VNUA 4B6EA 1N5JA 2QENA 2W0SA 2QY9A 4R7ZA 1NIPA 1VYVA 2DCUA 4MGYR 1GRRA 2BC9A 3A1WA 1A2BA 1J70A 4P4UA 3KFVA 1WCV1 1RIFA 2J45A 4GNKA 5FUXA 1PUJA 3VHXA 1X8KA 2O8CB 2EFDB 2WOOA 1DO0A 1IBRA 5ELXA 2D4HA 3ZZTA 3LBHA 2WPDA 4UNQA 5L8VA 3HDTA 5H8WA 4GP7A 2AXNA 4B73A 2CJWA 2HLDA 2IUTA 2W6JA 1ZAKA 3QKSA 2QPTA 2NGRA 1OH6A 1F3OA 2HDNB 1CP2A 3SI7A 1TMKA 3T5DA 6Q21A 3WRYC 4KYIB 1E3MA 2PJRA 1YZLA 3CONA 4IHQA 2WKRA 1F2TA 1XD8A 2QN6A 1QHIA 3CX8A 5TY0A 3A4LA 2IEZA 2IYVA 2BBOA 2AFIE 4LJ5A 1GRQA 2OILA 4P0TA 3TKLA 2XAUA 1J8MF 2QT0A 5EUQB 2P65A 3H86A 2B92A 4URUR 4BLTA 4QHSA 3A58B 1GL9B 4W9MC 1XDBA 1VKJA 3I5XA 2VF7A 1E9RA 3I73A 4KLNA 1OFIA 2GAAA 5J40A 5DI3B 1ZUIA 1QBKC 4TL8A 3U7EB 1IN5A 4B2LA 1SVMA 4QM6A 1EGAA 4M1SA 3TR5A 3EARA 2FZLA 1M1YE 1PLKA 4F4IA 2WWHA 1XNJA 4NMMA 4EFNA 3O8DA 1UKEA 4F93B 1RRCA 5KPDA 2A3RA 3ZVNA 5DN6D 2IC5A 1OH7A 4JSYA 4XIGS 2ZE5A 1OSNA 3AM1A 3G82C 2YC2C 3VFDA 4PHGA 2WOJA 4YMSA 4JLNA 4AYWA 1NNEA 2R44A 1CJVC 2BCJQ 4DLWA 3ZS8A 1CJMA 2ORWA 3D31A 3LVQE 4URXR 4KXFB 4XOIA 3U61B 2O8FA 3KX2A 1XCGB 3ECCA 1MO6A 4DT1A 4FMDF 2H5EA 5JSZA 2Z4RA 1VTKA 3DM5A 5H68A 2WJIA 3SNHA 1AZTA 3ICEA 5EP1A 4DSNA 2RKOA 4V0LA 2ZI7A 3DVLA 3AKCA 2ZU6A 3DHWC 2XZPA 4V0ME 3RAPR 1CRQA 2GVDC 2VBCA 1BYUA 2JJ1D 2VHQA 4I1UA 4TN1A 3EZFA 3L0PA 3RS5A 3LDAA 4A36A 1DS6A 4MRSA 3IHLA 3CLVA 4QRHA 1R0WA 2OCYC 4PANA 4JVSB 4ACBA 1Z0DA 1U0HC 2ANBA 5FUVA 2RCNA 4TL7A 4A1FA 3WYAA 4A6XA 3OFND 4FXPA 5J4HA 5EUMA 5AWFC 1E1QD 2GAOA 2PLFA 2VP9A 3WHKA 3U6KA 1UDWA 1DADA 2IHBA 3AUYA 3ADDA 3FE2A 3MG9A 2ZR0A 4A0FA 5GJBA 2V54A 5LDDC 1FP7A 1YZUA 4WXPA 3D6TB 1E9SA 4FWTA 3PQCA 4IOMA 1CULC 2D2FA 2OXCA 3C15C 5EP4A 2QP4A 3KKQA 2EFHB 4Q9JA 2FH5B 2XXAB 2CE7A 3U3JA 2HYIC 821PA 4BFWA 1IY1A 2OCAA 3E5HA 3QKRB 2XTMA 4PZYA 3TW8B 4BRWA 4RFSB 1QVRA 3RABA 2OESA 4ARZA 4ZKEA 2IYQA 3UATA 1C1YA 4WIAA 221PA 3QJYA 2IWHA 1G6OA 2EWVA 2RGNA 1T0HB 3W5IA 3QKRA 2IYWA 1TU4A 1XEWY 3EG5A 4EQ6A 2P3SA 3JZAA 4DWJA 3LBIA 4DHEA 1VCIA 4A0GA 2DWQA 1KMHB 3BORA 1N6LA 5SZJA 4AG5A 4I81A 1GOTA 2ORIA 3PEYA 3FB4A 1VIAA 3B8HA 1ESNA 4BRUA 3U3MA 2KWIA 3W6NA 5CIQA 3ZH9B 3LW7A 1WQ1R 1GL7A 4ESHA 3E1SA 1WF3A 2REBA 4DCTA 1FUUA 3HR7A 2WBLC 1KO4A 2CLSA 1G64A 4A2WA 3ONWA 1SHKA 3AKYA 3KQLA 1EWQA 1QRAA 4NHOA 2FU5C 3LXXA 3RANA 2ZM5A 3HJNA 4V03A 2VO1A 1JQLB 1N2CE 2ODWA 2W2TA 1AS2A 1UKYA 3NH6A 4L8GA 2JDIA 1GNRA 4IDNA 3R7WA 1HH4A 3K70D 3K9NA 2GEUA 4URVR 1VIYA 2OM2A 5JLJA 1HQYE 1M7HA 4LHYA 4EPRA 4ZIRB 2XNDA 5J4KA 2NG1A 3H1TA 3EZ6A 4CT4B 3EZ9A 1T3SA 1T5LA 3B1XA 3NBYC 1KDTA 2OAQ1 3F8TA 4WBSA 3RLFA 3UXMA 2FSIA 4DDWA 3QG5A 3QVUA 3KKMA 3C4JA 1ZU5A 1U0JA 4G3XA 4PAOA 2XITA 1W49A 3D8BA 1ZCBA 2ASEA 1AKYA 2BMDA 3AGQA 4NBSA 4BFSA 3C5HA 1NLFA 1YRBA 1LNZA 3PITA 3W6OA 5FTLA 4B32A 2ZI4A 2VA8A 4TSFD 4AYXA 5JCZA 1YKSA 4LJ6A 3AVUA 3T35A 3TUJC 1JAIA 2ZRKA 4GMXA 3RWOA 4IEIA 3UWOA 5JEEA 1SZPA 3TK1A 3GCGA 2NZJA 4XVQA 2R6CA 2OUKA 3IQWA 1UKVY 1JR3D 4IVQA 1UADA 1UBCA 2ZS8A 2GXSA 4UXIA 2VP6A 5BW8A 3A6PC 4KI0A 1ZUHA 3QPUA 1DAKA 1VG9B 3SOPA 3X1ZA 3RDPA 2FPKA 4MRVA 1X1RA 1ZINA 3DOFA 1RYHA 2IYSA 2J7PA 1VCMA 2BM0A 2XB4A 2QM8A 2Q3FA 4TMZA 1KK1A 3BFVA 2IHYA 3BWDD 3AVXA 1KY2A 1KAOA 4D26A 4HLQB 2AKAB 4F7WA 1ETUA 1SVSA 1EESA 1E2QA 2C78A 4Q7MB 1KDRA 1Z2CA 2ZI5A 5CIWA 3KUCA 2WJHA 2XOKD 5JHHB 1EK0A 1P75A 1TADA 1ZC3A 2RHDA 3QEJA 4JBWA 2QBYB 1RKBA 721PA 4BEJA 1FTSA 4IXMA 1QVAA 1D9ZA 2OXRA 5E7MA 3AP3A 3V00A 4EPYA 2CHQA 4B3GA 3HPQA 2R6DA 2CDNA 3K9GA 4PHHA 3IKJA 4CGZA 1XTKA 3AEZA 1NN3A 4FCWA 1P4SA 1GKUB 2J7KA 1DBSA 1E2DA 5AUPB 1B0UA 1MR3F 2J5XA 1EFHA 3QI2A 4M9ZA 4Q4AB 4DLRA 1XRJA 3CO5A 2OFXA 5KNDA 2VPPA 4IDOA 4ZO4A 2E87A 4PO8A 4CIDA 4L15A 4KFSA 3TSWA 4B74A 4R2IA 5IK2A 4C0AC 4BZXA 5AUNB 2F1JA 1DVRA 2VYFA 3EWAA 1UBEA 4HATA 1U8ZA 5K8UA 1MT0A 3P20A 1RPZA 5IF9A 1R2QA 2HF9A 4NYMR 1R5NA 3EPKA 4TWZA 2WWXA 4G01B 4ZCLA 4M1WA 4BLRA 3PV0A 1NSTA 4Q9LA 4RSGA 5H1YA 4A2QA 4NZYA 3UG7A 1W0KA 2QAGC 3MCAA 4M1KA 2R65A 1NBME 2ZJAA 3GQBA 2FFBA 5BN5A 1JPNA 1QZXA 5CM9C 3KTAA 2VHJA 1TQ4A 2XZOA 1ZVQA 1MABA 3I32A 2OG2A 4N1AA 4X8MA 5GJCA 4A0RA 4A8JA 3EZ7A 2JJ8A 1TQ2A 3ICQB 4Z1MA 3ZVMA 3VU9B 1DAIA 2IS6A 1CXZA 2H57A 2SHKA 1YR7A 2F9MA 5G40A 5J47A 3GMTA 3QF4B 2RGNC 1DAMA 5FOWA 1II8A 3WNBA 3ZQ6A 4DDVA 3KXKA 2EFCB 2W2XA 2QP9X 3QVVA 1BMFA 2DWPA 2GCPA 2GRJA 2FX3A 4NCNA 2VF8A 3KJEA 3VR6A 2G88A 2YWEA 4GFDA 1LS6A 1VECA 4B43A 4BFZA 4B75A 3A1UA 5DHAA 4TYWA 3BBPA 3FMOB 2WM9B 3MGCA 4OQXA 4NL4H 1PV4A 3NXSA 3W5JA 2KI5A 3WXMA 4XTRA 1YE8A 1NJGA 4DEXA 3RNLA 2KE5A 3DKVA 2A30A 5GADl 1Z22A 3J81k 3FHTA 2C9CA 2QE7A 4JVMA 2FDCA 2OFWA 4Q19A 1D9XA 4TMKA 1M7GA 3CF6R 4Q1CA 4NCJA 3LO5A 1S3SA 4V02A 2ZIAA 4OHWA 4LRWA 2CL7X 1II8B 3DZ8A 5FPTA 3KJIA 2HXYA 4FMCF 4NP6A 5DE3A 2ZJBA 3LD9A 3T61A 3QQ5A 3ZIAA 1XTIA 3MJHA 2O0HA 1NG9A 4Q4HA 4KFRA 5F98A 5A4JA 1RRPA 3ZGXA 3SHFA 1IN7A 2BMEA 3OIYA 2NTYC 3T5GA 1KJWA 4V0KA 3IGFA 3ZDQA 4LHXA 2NQ2C 2ZRPA 4GI7A 1G291 1S4QA 3KQNA 1CF4A 1WRBA 1BOFA 4HLCA 4QBGB 2C95A 2NMVA 4Q1DA 1R5BA 1JPJA 2QU8A 4QJ4A 5AJYA 3PUYA 4NCIA 2GBLA 2IXFA 1P9NA 3QENA 2QM7A 3WHLA 4GSYA 3CUEF 2YJTD 5FPKA 5HZHA 5KHOC 2QUZA 4BLSA 1N6PA 2JJ1A 2CLCX 2WJGA 4OJQA 3K0CA 1U99A 3U7GA 2AHOA 5M04A 1Z0FA 1EX6A 3CKLA 2JLWA 3LX5A 4A8JB 5JHGB 4S2EA 3MWYW 2CLDX 2ZVPX 1Q3TA 2ZTSA 1VPLA 3MSXA 2F1HA 3VKWA 4PPGA 2FNAA 4E07A 3PFIA 1KMHA 1XTQA 2JIZA 4TL6A 1LB1B 5CDFE 2ZRFA 1T9HA 1JQJC 1VHTA 3FPAA 1M7BA 4MKHA 2KJQA 1H8HA 2WIBA 4FN5A 2ZR7A 5TXGA 2WZQA 3PJRA 2XB2A 1XMVA 1W48A 2O0KA 4DC9A 3U5ZB 3WYGA 2ZANA 1TL7C 3PIRA 1KI8A 2ORVA 5K8IA 3GLHE 1E2KA 1E1RA 1D2NA 1NG1A 2GJSA 2J1LA 4PO1A 4AD8A 3KQUA 2YYZA 1U90A 2QMEA 3WP0A 4HUTA 5IDVA 3B60A 4L5BA 2DB3A 3CZQA 2E9SA 1ZM3A 2ECKA 5BN3A 4YC7A 1YZNA 2Q9CA 4N0EA 5AJZA 2GF9A 2NOAA 1JNYA 2OBLA 3U3KA 5B30A 2PZEA 2RH5A 1Z6GA 2YWFA 4NYIR 1R10A 1SGWA 1J7KA 4M8NE 5GJVC 3FMIA 4MRNA 2QPOA 3GJ3A 3NHAA 4OHZA 2IK8A 1W0JA 4ZDWA 2FJUA 4R71A 1OB2A 4L9WA 1U81A 3U44A 1RFLA 4PQRA 5F9FA 1MH1A 2YVUA 2IUSA 1G7SA 1OFUX 1UKZA 5HE8A 3PEWA 1US8B 3VR3A 2PX0A 2IS4A 1F5NA 4OI2A 3N2EA 2BVNA 1IN6A 4QL3A 1DE0A 421PA 3K0SA 3L0SA 3LQRA 3ZD6A 4HLUA 1DAFA 1Z6AA 4OBEA 4WOPA 1US8A 4AURA 3NH9A 1G20E 3OFNA 3NHBA 1FOEB 1G5TA 1N6NA 2O52A 3C8UA 3OE7A 1SULA 3QXSA 3V9PA 2A2ZA 4JLBA 4JLJA 4C2TA 2FG5A 2ZQ5A 5FOVA 3W34A 4G5OA 4JKIA 3KFXA 3NWJA 4YXWA 5KUTA 2JLRA 2W83A 2FMXA 5DNYB 5KYKA 1UBFA 3JVUA 4TQ9A 3VKGA 1J90A 4Z54A 2D3WA 4F4CA 2BJVA 1NN5A 1SXJB 4RVCA 2V3CC 2VQSA 4Z51A 2JLVA 2NO0A 3NBXX 1R5OA 3OHMA 1E99A 3EC2A 2QGNA 3CNLA 2FGKA 4MGZR 4AYTA 3K09A 1U8AA 2ZU0C 3CBQA 4F92B 3AVQA 2J0VA 2NO9A 4JS0A 5JS7A 3TGPA 5L3QB 5EE0A 5FI0B 4C0HA 4AKHA 5TV2A 3B1ZA 5TARA 1WBBA 2ZRAA 4PPNA 4URWR 2CK3D 1XTRA 5BQ5A 4LOAA 5FPYA 2FSFA 2QE7D 4KYUA 1RC8A 3GFTA 2AX4A 1EFTA 1YRAA 1G8HA 2NPFA 3GFOA 4O3MA 4BECA 2A5DA 1G7RA 2XJ4A 1OJLA 1JEEA 1Z6XA 1AIPA 4D4JA 1CR0A 1W36C 3EASA 1KKMA 4D2IA 1IN8A 2PMKA 2WIAA 2W00A 1OXTA 3DEFA 1XCPA 4G5GA 1NRJB 5FBVB 4DB4A 1FW6A 4XD7A 3RSLA 1E9BA 4I99A 4NTZA 4C3ZA 1KI9A 3QKSB 2FSGA 2Y8EA 4QNMA 4CW7A 2YINC 3TQCA 1DPFA 1NVWQ 1XF9A 4HUQA 4RD2A 4XWAA 4ZI3A 4DCUA 1IAQA 3IHWA 1EFRA 5JRJA 2H1LA 3GEHA 2C2HA 2GCOA 2JCSA 2JA1A 3OEED 1D6JA 3DMNA 3EA5A 3NBZC 1RE0A 2JJ2D 3FWYA 2GXAA 2V1XA 4JSTA 3ND8A 3RC3A 1KZGB 3F3YA 5JJIA 4C0SA 5P21A 3ZVLA 2GK6A 4L4UA 2ZRJA 1N6HA 4G0NA 5L3VA 4TTQA 1N5KA 4KCGA 5JS8A 4KBFA 2ANCA 1KSGA 2GWHA 1YJ5A 3MFYA 3C5CA 3B9QA 4FW9A 2JLUA 2IA5A 2J87A 1ZD1A 3IEVA 4DLTA 4TT3D 1S9DA 4HAYA 3WMGA 1GUAA 2B7BA 1YR8A 3NIBA 4DEYA 1KDOA 4DT1B 3SQWA 4TLAA 1MKYA 1G18A 1TUIA 5LB2A 2O0JA 4C30A 2ZI9A 121PA 3VAAA 3CIOA 1XD9A 5IK2D 1GIAA 2CL0X 2IYUA 1A82A 4BLQA 3IBGA 3O8RA 3LVRE 4RD0A 3OIUA 1OT3A 4QKQA 4YDHB 4W7SA 1U98A 1ZM2A 1T6NA 2ODBA 2ZI6A 1AGPA 5FUYA 3N70A 3HWSA 4CEHB 1W2GA 2I4IA 1QHHB 1NKTA 4ZDIA 1ZU4A 2P2LA 2RMKA 2VSXA 3S1AA 3EX7C 1SKQA 2UKDA 1UJ2A 2ZYTX 4RFVA 1FMJA 3VMFA 5JRZA 3LFUA 4JZKA 4QFMA 3TBKA 2AK2A 3EC1A 3B85A 2GJ8A 3BFXA 3KJGA 2EVWX 3W3AA 2OHFA 2CEAA 2ZROA 3V4FA 5FPSA 4II7A 3GLFA 1MO5A 3FKSD 4HYYA 1NMZA 4MQBA 3D7MA 1Q12A 1GG2A 3MWKA 4EFMA 2G77B 2G3YA 3IBYA 4PX9A 3TMKA 3R20A 3K0AB 2G6BA 4URZR 1TAGA 2C9YA 1HURA 2QMOA 4TLBA 4ASUA 1XMJA 1NN1A 3EXAA 4Q1FA 4BFTA 2VHUA 1PJRA 3K0CC 4FIDA 3W6PA 3ADBA 4MRPA 2AD5A 2OAP1 5KSPA 5TB5A 5B58C 1S3GA 3OZXA 4CRWB 3CW2A 3QKUA 1QHSA 1BH2A 1KJYA 4QJ5A 3W8NA 3THXA 5FTMA 4BZPA 3CZPA 2ZSEA 2VP2A 3SBEA 1AQYA 2Q0HA 1HA3A 1MABB 3GJ5A 3IIKA 3U7HB 2YKGA 3SZRA 1KSHA 2OV2A 3ETLA 3O47A 3QIAA 4EDHA 4ZDKA 2REXB 3ZD7A 1XU4A 4HDOB 1OW3B 2OSBA 5KSOA 2ZJ5A 5EE5B 3GLGA 3PCRB 1ZYUA 4EFLA 1KMQA 4GT1A 3L43A 1ZMXA 4Q66C 5C4GB 1SXJC 5FOTA 4RFSA 4TMXA 3CF0A 1O87A 4L9SA 1K6MA 2VIIA 4Z8YA 2O8DB 5G53C 1GKIA 3FGNA 4DSTA 1G19A 1E9CA 3LAWA 1ZNWA 4TZ6A 1EX7A 1UAAA 3HU2A 4AG6A 1S0UA 2WSSD 4HUQB 4M9XA 3SFVA 4E03A 1A5TA 3P27A 2XJ9A 2AL7A 4JBYA 3B1YA 2GF0A 1E9FA 3ZQJA 1OE0A 1ZD8A 4D4MA 2C77A 1Q22A 3CX6A 3T15A 3PUXA 4LJYA 1Z29A 3KKNA 5FR2A 3TRFA 1KSFX 3I4LA 5CJPA 4Q4LA 2A5YB 3K70C 3GJXC 2BJWA 3HYRA 4IW3B 4G1UC 1XZPA 5HE9A 1JALA 1XBTA 1VG0B 1E98A 5DN6A 2PT7A 1Z6YA 3SJZA 3BERA 3U60B 1PVOA 3GJ6A 1IY2A 1MO3A 1W1WA 1M2OB 3LXRA 4GOXA 4B34A 3BXZA 1NL3A 1XEXA 2C99A 2QMUA 1IONA 1BMFD 5KOYA 4AKEA 2FWRA 1QHYA 2VP0A 1G41A 5EP2A 4HAXA 4MDFA 4PZLA 4TSFA 1E2EA 3GEEA 1KNQA 1D8TA 3DL0A 5C1BA 5FFMA 3Q7QA 1SXJD 1HEIA 3EPLA 1CBUA 1Z3IX 4YMWA 1P3JA 2AFHE 4JYBA 4LYJA 5L3QA 2Z0MA 5IT5A 3R9XA 5E7JA 3K0FB 3Q3JB 5EJEA 3S1AB 4BASA 2ZI3A 4QM7A 2QG6A 3SEAA 2C98A 4PTLA 4B3DA 1FQJA 3Q9LA 4LX0A 5G3YA 2BBWA 5C4MA 1OLOA 2WMOB 2IYYA 4WZ6A 3LW8A 3UK6A 3IPYA 5FOSA 4BQSA 2QT1A 3LV8A 3THYB 2QAGA 3KXLA 5FBWB 3AVOA 3OAAA 1GRNA 2GKSA 4ON9A 1NBMA 2W0MA 4LHZA 2WJVA 3HPRA 1Q57A 2E1RA 4MGKR 4DLVA 3EIHA 2PZFA 4LBVA 4LDJA 3SE0A 2HLDD 3UWKA 1GFIA 2NO6A 2FOLA 4PAMA 1KI6A 1O3YA 5HCIA 4D4KA 2DPXA 2XSZA 2VLIA 4A0HA 4BGDA 2HT6A 5JCPA 2RB4A 3A4NA 2CCKA 3AF2A 5DYIA 3R9WA 4RKEA 1E2FA 2CVFA 2A9KA 3GPLA 3T34A 2PCLA 1W5SA 2FZ4A 4C0QC 1TPZA 1G17A 4C7OA 1UEJA 4QC2A 4GPTA 4U5XA 4QBFA 4B3BA 4MDEA 2ODNA 3JZMA 4OQFA 4LC1A 3I8SA 2F9LA 1UEIA 2GESA 1XJQA 1T8TA 1Q1BA 3L82B 2JAQA 3Q5DA 2GNOA 1VYUA 2WAYA 1G4AE 3TSOA 2YC4C 4JT2A 3WRXC 1S9HA 1NVVQ 1GM5A 2XTZA 3ASZA 1JR3A 4BEBA 4I1SA 2D06A 3EWSA 4UKDA 1E6CA 1LTQA 1SVIA 4HLUC 1TX4B 4LBWA 4P33A 5A0FA 3ZZUA 1W36D 4AI6A 4Q7JB 1OIXA 2CMKA 4IDHA 1YHNA 1OH8A 2YZ2A 4ASUD 4A82A 4RZ3A 5ANRB 4J0QA 3KQHA 1KAGA 2F43A 3VX4A 4G5RA 4JL5A 4JLDA 4YMVA 5D3QA 2IW3A 2J0UB 4B35A 2DHRA 2B8TA 1E4VA 2IYZA 3SYKA 4JL6A 4AIIA 1ONBA 2QSZA 3B13B 4LZZA 2PH1A 3BC1A 2CJWB 2V7QA 2YNMA 2NIPA 2QPAA 4UQOA 4AK9A 5HZKA 1P7CA 4EPTA 3KZ1E 2F55A 1Z06A 4M2LA 1CJUC 2H92A 4CF7A 4CEIA 2GJ9A 1LVGA 2C04A 4U02A 1L7VC 1OXXK 3L0IB 5E4FA 1H8EA 4NU0A 1IM2A 1CJKC 1EFCA 1R6BX 3L0OA 3KQKA 5EZ6B 3T06B 3NKVA 2AK3A 3MLEA 2RGDA 2IS2A 1P5ZB 1F48A 1FFHA 3RRMA 4CYMA 3I62A 3FDIA 4PC6A 4TLDA 3K9LA 1OFHA 2WAXA 4BE7B 1R0ZA 5FBQB 3P4XA 3IO5A 2AD1A 2ZRBA 3AVPA 2DFLA 3LX8A 3GJ0A 1GITA 1CTQA 4UXJA 1COWD 2JASA 2JDID 3QBVA 3QPVA 2V6JA 3FKQA 1TEXA 4LBZA 4DB2A 4HB4A 3RRYA 1E2MA 1VDZA 4GDFA 1E32A 2LKDA 2J3EA 4H9GA 1KI1A 3EIEA 3CR8A 1KI2A 1RZ3A 3PUVA 4M0LA 1W47A 3LH5A 2RGCA 1G8PA 4OQNA 2GA8A 5AUOB 2V55B 4W5HA 2BMFA 2Z4SA 3C7KA 4JLPA 4KITB 2WSSA 1NSFA 4KVGA 4AKIA 1ZIPA 4M9QA 3TUIC 1XPUA 2PEYA 4LBYA 3CRMA 1Z0AA 4P4TA 2J59A 3IUYA 1D5CA 1OV4A 2V6IA 1XPOA 1RJ9B 2L0XA 2IXEA 3GD7A 1G8GA 3TW4A 2G9NA 4TMVA 2P5TB 1U8YA 2V8OA 3CH5A 5FTKA 4A6PA 2ERXA 3TUZC 4GZMA 2D62A 2LCFA 1E2LA 4DLXA 3QKTA 2YWHA 5FOUA 1I4LD 2GJKA 2BM1A 3AKEA 4EPXA 1C9KA 1G7CA 2QAJA 3QOFA 1S1MA 3GJ8A 4HAWA 4IOLA 1TUEA 3SHWA 4DUGD 3K70B 4E22A 2DBYA 1Z28A 1FNMA 4H1UA 2OLJA 1G3RA 1FUKA 2DYKA 4Q5IA 5DYGA 1AKEA 3RS0A 2D2EA 5HR5A 1N0WA 1NJFA 1ZW6A 2OEPA 1BS1A 3NTUA 1SKYE 3QY0A 4Q4JB 2KSQA 5KTYA 4DLSA 4PR0A 2ZRGA 4KV9A 1ZUNB 2O8FB 2F3RA 1NMXA 1XWIA 4PPFA 5DI9A 4MYTA 4XVUA 3GFPA 4PC3A 4CEJA 3BH6A 3IILA 1HYQA 3L8ZA 4OI4A 4JLAA 3ZLJA 3BB4A 4GZLA 4BLOA 2X2EA 1OHHD 1ZM9A 4GMDA 4KFUA 4O2LA 2B8WA 1Z0IA 4BZQA 4R9UC 1DTSA 2XOKA 2ZJ2A 2QROA 4I1VA 4OK5A 1E1QA 5A5GA 4C2UA 3F5FA 1W4CA 3R7WB 3TH5A 5FL3A 2HXSA 2BCGY 2ODEA 3LA6A 3HU3A 3QEOA 4BWYA 4YDSA 2AWNA 1R7RA 3UMSA 2DFTA 1XP8A 1II0A 2OBMA 1BKDR 4ZKDA 1E9EA 1TEVA 2LWIA 2R6AA 2X2FA 1W7AA 2ZSFA 1KO7A 1U94A 2GCNA 4O25A 1KOFA 3N5CA 3QG1A 4A15A 4PC7A 2CL6X 2F3TA 3Q7PA 3LBNA 4NYMQ 3B78A 4PZZA 1VYTA 1T4GA 1KO8A 3OAAD 4M21A 3DMDA 4MYCA 1OKKA 4Q02A 4QBHA 3SC3A 1T5IA 2CNWA 2F6RA 1L4YA 2D7DA 1E9DA 1UPTA 2EWWA 2G0TA 2ZSBA 1N0VC 2VH5R 3B1WA 4Q7KA 1U2RA 1E96A 3CRQA 1OPXA 3X1YA 3HP1A 3WMFA 2VSFA 4LSGA 4Z8XA 1GWNA 3FMFA 1XX6A 1Q20A 1E9AA 3FMPB 2BHRA 1AS3A 2G1JA 2ZETA 3AB3A 4Q4HB 1ZRHA 1G5PA 5CJ2A 2JEOA 1P2SA 4R2HA 1L4UA 3HYTA 3Q5EA 5KNBA 3ZJYA 1QG2A 1Q0UA 2X77A 4P3YA 4PC1A 5JEDA 4RZXA 3AVYA 5HCNA 4DDTA 4B3FX 1JR3E 3BH7A 4UXHA 1FMLA 3GLIE 2I3BA 1U9IA 1Q21A 3VX3A 4C7OB 2FV8A 4B33A 1DG3A 1OXUA 2ZE6A 4C0BA 2A78A 4P32A 4RCZA 2Q21A 4TTRA 3REFA 4R98A 1E0SA 1IXRC 5EE3A 1SXJA 4BFVA 2R6FA 4PFSA 2BMJA 1XTJA 1P62B 2RAPA 3FHOA 4MKGA 3SYNA 2G0NA 1LV7A 4PAQA 2ZAMA 5H70A 3U2QA 4Z1MD 4ZDJA 4MYUA 1F60A 4IDQA 1S2MA 1XTSA 2YWGA 4DSUA 5LD2B 1GSIA 4KODA 4TLEA 1G8FA 2REOA 4X8HA 4V0OA 1VCOA 4NKRA 1EG7A 2H8KA 1XEFA 4HZIA 1G1MA 3QSYA 1E2PA 1PUIA 3OEHA 2FFHA 1G3UA 1U0LA 3IDQA 4KSBA 4PQFA 4CT5A 5SZHB 2PJZA 4GBMA 4XWOA 3KKPA 4IVRA 1W36B 3QUSA 2QQ0A 4PSKA 1CKEA 2CHGA 2NZ8A 2A5GA 4RJLA 1NVVR 3TJZA 2G83A 3GLFB 1E2HA 5IRCD 1G7TA 3A4MA 1YQTA 1JB1A 2IYTA 3K1JA 2PT5A 4W5WA 4BFXA 4QGFA 4WA7A 1OYWA 4IKEA 4LC0A 3X1DA 3LLUA 3T1VA 1CRPA 1VMAA 3A36A 2YV5A 3GLIA 1I2MA 3KTAB 1KY3A 3BJIC 4KSCA 1JJ7A 1WA5A 2RGAA 4YQFA 5K8LA 4D25A 3MD0A 1IY0A 3SDZA 2TMKA 4WZBE 2PBRA 3LNCA 2G1KA 3PEVA 3K0EA 4U7DA 5L3SA 4EJSA 2JLXA 1IJEA 4D82A 3QE0A 3RVBA 4B3CA 1X8LA 4TQUS 2ZJOA 5BYKA 1LY1A 4NYJR 2OFOA 2GXQA 2ZRNA 2FA9A 4G5QA 1XJ0A 3A1TA 1S8FA 5HPYB 5DSZA 3MJRA 1CU1A 1NLYA 3THWB 1ZNXA 1FTNA 3M6AA 1N6KA 2F43B 3EW9A 4V0NA 1GNQA 2ONJA 3GLFE 5EZ5A 1RVDA 4XJXA 1W44A 2J0UA 2W6IA 4BFUA 2IF2A 1W2HA 3QNUA 4EAQA 3AQ4A 1AQUA 2GILA 1YR6A 1XFAA 3WP1B 2ZSDA 2ZUDA 3IPXA 4ILEA 5EE9A 5B2ZA 4X8OA 2EFEB 4OHYA 3UMFA 1DAEA 2W58A 4ACAA 3BD9A 3B7GA 3QXHA 4PHFA 1SVKA 5FI1B 4OK3A 2CVHA 4Q18A 4CDGA 2FPLA 2ZXUA 4QGAA 4DRZA 3AKDA 1A2KC 1W4RA 3W8RA 4K81B 5C2JB 1XD2A 3TNFA 4XSHA 5CDFA 1ZNZA 4Q00A 3REGA 2CCJA 2V1UA 3DO6A 5KPJA 1Z08A 4ITRC 4LWZA 4LJAA 1GNPA 1I4TD 3E70C 5KDDA 4P31A 5CYPA 2A5FA 1DELA 1Z07A 4HB0A 3KKOA 1SKYB 3IIMA 3CR7A 1QHXA 4ZI2A 1YR9A 3LLMA 1Y3AA 4OHVA 3AP1A 2ERYA 3AF3A 3CB4A 2HT1A 4Q9KA 1IQPA 3FOZA 4B76A 1NIJA 5E7IA 3X2SA 3QBTA 1FP6A 1H8HD 3BFKA 5IHPA 1NLZA 1V5WA 4M1TA 1K8RA 3BIFA 1OIWA 1OIVA 2FFAA 3I72A 2XXAA 1IOZA 3N2IA 4D0NA 4QG7A 4Q01A 4XTCS 5GJWC 3WMEA 1T3LA 4Q47A 2Q3HA 4B71A 2KBFA 1BYIA 3P1JA 1G3IA 4HZUB 3EPJA 1NKSA 2J9RA 4MITA 1LS1A 3BGWA 3GJ7A 5SZKB 1MO4A 5CB8A 2ZJ8A 2J0SA 1ZJ6A 3CX7A 1W5TA 4B47A 1DEKA 1D2EA 4Q4JA 2IBMA 3NVAA 1GZSA 1R4AA 4HDQB 1YZTA 4HEJA 5FL7D 2R8RA 2Q3MA 1KK0A 1DAGA 4JVLA 2C5LA 5BYJA 2WSMA 1M34E 2H17A 2O8BA 4OQMA 3KJHA 4BLPA 1M6NA 2FE4A 4A9AA 1XPRA 2J0QA 3CWQA 4MGIR 5JWHA 1N3BA 1KIMA 1GP2A 1X8JA 1HT1E 4JJZA 1AN0A 2B21A 1KI6B 1NY6A 2Z43A 2WWFA 1OHHA 4N3NA 1X6VA 5FTNA 1WB9A 3G0HA 2HYDA 1Z63A 3T1TA 4WVFA 3I5YA 1KI4A 4C0JA 5JI3E 1JEDA 1I2DA 1E2JA 2O8BB 1E2NA 4TTPA 1UFQA 1A1VA 3TAHA 4D4LA 1R8SA 1GAJA 2QSYA 1OXSC 2Q9BA 5D3MA 1E4YA 2D74A 3U4QA 5DISB 4K8OA 1G9XA 3B82A 1T91A 2W2VA 2GCOB 2RGXA 4RZ2A 3CH4B 2IXGA 1HUQA 3B6EA 1R8QA 1Z8FA 1HQCA 4XD7D 3U3OA 1YZQA 3CF2A 4FI3C 1J99A 3AV0B 2ATVA 3DM9B 4RD3A 2B6HA 3RSOA 3THOA 1NF3A 2H16A 5DH9A 1OKKD 3M4YA 5DO9A 5C46F 3DOEA 1KJZA 1NP6A 1P2UA 4AWXA 4C0LA 1PLLA 3KB2A 4PSVA 4B48A 3TIFA 3PUWA 3WNCA 4DSOA 5F3WB 4IFEA 3HR8A 5LD2C 5DLQC 4FCVA 2C96A 5KU1A 3H0KA 2FEMA 1E2IA 3NDBB 2HCBA 3H2YA 4WXRA 1GVNB 3E2IA 1ZBDA 3R9IA 2XEXA 1OXVA 4N0DA 3RRNA 3A1SA 1ZIOA 2HJVA 521PA 3FTQA 1W0JD 2ZE7A 1ESMA 1KO5A 5FL7A 4BUJA 3IO3A 4GOJA 2YOFA 5AJXA 3FFBA 5L3RA 4LYFA 2GETA 1J8YF 4PO9A 2IS1A 2PX3A 1YZGA 2ONKA 2ZRMA 1L8QA 2QEQA 2PEZA 1K5GA 3VQTA 3P4YA 3GLGB 4QGGA 2IT1A 3EAQA 1JI0A 5JWRA 2WTUA 3RYTC 1NI3A 3AGPA 4FMBB 5JBQA 1WMSA 4POAA 4B3XA 2OCPA 5CLQA 3BE4A 2ZRHA 3FKSA 3I1FA 2QNRA 3SBDA 4BFYA 4LGMA 2GJAA 3EPHA 4LYAA 1VCNA 5FPHA 3CRVA 5D3MB 1XXHB 1FPMA 2GVZC 1HT2E 1MRNA 2N1BA 3I92A 4CZ2A 1AJEA 1DAHA 4QHTA 2R6GA 4FMDB 3NEJA 3H84A 2RHMA 3OESA 4QXAA 4JJKA 1AZSC 1Q1QA 1RRGA 2AR7A 2YOHA 2QQEA 5KSZA 4LV5B 5FTJA 4TT3A 4C0KA 4KVAA 5FBRB 2OE2A 4MA4A 2JLSA 4DLUA 5GVRA 3LRPA 3AF0A 1C4OA 2KBEA 1EWRA 2WJJA 4L16A 4Q21A 4RKFA 3THXB 2GTPA 3OEEA 4P4SA 5FUWA 4Q7LA 2MSEB 4DLYA 2EU8A 3WBJA 2JLQA 5LPNA 2IX3A 4B6FA 2JLYA 4URYR 1BIFA 1F2UB 3CWZA 5HKKD 3U44B 1OB5A 2ZRIA 4A8JC 5KNCA 3SS8A 2QBYA 4QGHA 2JATA 2ZPTX 1X1SA
chains in the Genus database with same CATH superfamily
2W6QA 5LIRA 2XBLA 4X8LA 3LWDA 4FFDA 1T2NA 3FFWA 5JAIA 2FHPA 2PA3A 4JB0A 3I0MA 3K5IA 3LUPA 5G0VA 3UG6A 1MXFA 1RAFA 4H4CA 2CBZA 4YQEA 3ZV6A 5G1NA 4BQPA 1L7AA 1NW3A 1O1YA 2GT1A 4FDVA 2DH5A 2VHVA 4TL9A 3RWBA 3UWPA 2Z2YA 4FSXA 4LY3A 3WKAA 1EX9A 2C4TA 1UIRA 3FPFA 4QUJA 4D9KA 3ENVA 3CBGA 1QP0A 3RC8A 4Y8VA 4YLGA 2HEIA 4NMXB 4B3RB 5BR8B 1HXHA 3CXRA 4O0MA 1H4TA 1ODFA 1NV8A 4YP5A 1E1DA 3GB9A 4BWVA 2ZYVX 2PZJA 4B8ZA 5CBPA 3EMVA 3WLHA 3BIOA 4MWCA 3SX2A 4OO3A 1ULSA 1I9GA 1RXCA 4DKXA 2PZGA 2O8EB 4TRRA 3E8SA 2V8BA 4JYCA 4WCDA 2DFNA 4RETA 3JVVA 1QHNA 5H4GA 3EWNA 5B57C 1JIXA 3C3XA 4RAOA 2AXPA 2WTMA 5BOVA 3IMCA 1D1TA 3MC1A 4CF3A 3TSZA 1OFUA 1CS4C 3NC0C 1X1AA 3ICCA 2BGKA 2XMGA 4HZUA 4KXXA 3BB1A 2ZSUA 5AKXA 3MAGA 3A04A 3EGIA 2AB0A 5H9VA 2B5WA 4I50A 3WL7A 4IIJA 4YRGA 2WHQA 3CPEA 4TTIA 4MEAA 4M60A 5E3HA 4LVUA 4WNAB 3TVTA 4QJ3A 2OG1A 5BSHA 4QJIA 1QPGA 4QDOA 1D2MA 1SKBA 2P4EA 2AOUB 2GEVA 4QARA 4RIGA 4E12A 4B46A 3PT9A 2MINA 4Q1AA 3RODA 3DR5A 3JQ6A 1B16A 2EL9A 4KO3S 1SEPA 3OPMA 2DX7A 1V4NA 4IDCA 2WWGA 4TXJA 4Z7NB 1ZCFA 1QONA 3HA2A 3E1GA 4EJSC 6REQA 1GYQA 1QFSA 4I4IA 2JGDA 5KHAA 2QOEA 4ZVLA 4E70A 4EP1A 2GKOA 2GPYA 1P2BA 4AQDA 5F9HA 3GRYA 4YP6A 1U0EA 1H85A 1XZGA 3DONA 4LUCA 4NH0A 3B9RA 4KVZA 5JJLA 3IMGA 1EG2A 2E82A 2VQ3A 4G0UA 3SHOA 1BO6A 2XODA 2OZEA 1U1EA 3RBXA 3P52A 4CG2A 4ZYXA 4ARZB 5JARA 2FPIB 2K5UA 2WUFA 5MHTA 4I4NA 3SR0A 3HQ4O 1QK4A 2DPHA 4MCJA 5E6RA 2OCDA 4R2LA 3RF6A 1G42A 1PVDA 1GTMA 2R9VA 2WFLB 4NULA 1Q3HA 3KXIA 4FWIB 3L7MA 3RT1A 3RF7A 1YB2A 2VRBA 1CERA 2JEYA 3OJWA 4NZMA 4PQYA 1EM6A 3D2CA 3KB1A 4UHFA 1I6LA 3SZGA 4R83A 3TSAA 3DC2A 3L2OB 4AWBA 4GVLA 4XFKA 4CMIA 2W71A 4EF6A 2O59A 3V8QA 1L5GB 5HTKA 1MB9A 2WWIA 3ZCUA 4LOJA 2L2QA 4XRRA 4IDPA 4K46A 1Y1QA 3B5IA 3FRIA 3GVCA 5C34B 4D8VA 1C3XA 3RS2A 5DHFA 3SSOA 3O8BA 1S6YA 3DCJA 3FN4A 2MSCB 3GJ4A 1NN0A 2B30A 3PSHA 4X93A 4CU2A 1G16A 3GP8A 3UPUA 2UXDB 4YRZA 2FFQA 4HAZA 5GVSA 2BGGA 2OQ2A 4PFQA 2A1UB 3O8NA 4JITA 2W9XA 3SBOA 2V7QD 4OA8A 3GRVA 4PAWA 4EAAA 4EJ6A 5D1HA 4O1HA 1KI3A 5G4KA 4ZVUA 2M6RA 3OT5A 4GDMA 1KQGA 3AKZA 2HQRA 2R7NA 4UCXA 4CG3A 3WYNA 4ECAA 1XDUA 3BMOB 4L76A 4OHXA 3ZYCA 3E84A 1Y7TA 3A6LA 2FMTA 1RYZA 2AJDA 3B9PA 3NHYA 3OM0A 1B23P 3N3BC 4HDKB 1UQRA 3N58A 3TLGB 4NS1A 4AY2A 2CNDA 2CN1A 1NZJA 2GEJA 1Z26A 2JHAA 4P7KA 4PRZA 1DEOA 5EXPA 5C51B 3ZKWA 3MS7A 3ETDA 3PP8A 5LOVB 1LLQA 4L5YA 1QHHA 4UHJA 5JUWA 4EJSB 3A37A 4EY8A 1ZJYA 4X62B 1G0OA 1T2DA 2UUCB 5FH9A 2EFJA 3C39A 5JPCA 3JATA 2HPAA 1OR8A 3B20A 4F3CA 1K5DA 1QH9A 2ZSAA 4XWYA 3VTKA 1Q1EA 1M6HA 4JB8A 4ZK2A 5BXQC 1RACA 1Y1SA 1SHZA 3MRSA 1GXSB 3KLOA 1M74A 2IUUA 1LLUA 2F7SA 3DEJA 1UR5A 3AU8A 4NY1A 4O2AA 4ZPXA 4RFLA 2VQDA 1CUCA 2V6FA 1M2EA 1ZIXA 2ZXFA 4XGQA 3N7TA 4RU1A 5DPMA 5H7XA 2ZR8A 3NGLA 1DC8A 4BZZA 3JD1A 4P3NA 2AUNA 3ED5A 3WSWA 5LJLA 4Y9UA 1R0XA 5DM0A 1CYEA 4MYRA 4R68A 1IVYA 3DG9A 4GOLD 4KQIA 4DFDA 2QZ4A 4YEDA 4IOJA 4REOA 4RIFA 4C0XA 4DV6B 2JFUA 3SJCA 4NJEB 4YUYA 1O57A 5B64A 3PYLA 4PE5B 5LQNA 4PN7A 2XR1A 3VNVA 1RLJA 2X86A 5ENZA 3DZKA 1TU3A 3THYA 2A86A 2CFSA 2YVQA 4JEUA 4C6TB 4EECA 4BKRA 2V7XA 3NG1A 5AJTA 1L4KA 1ZZEA 1HI9A 4M0EA 3UMJA 3ZZ1A 1ULTA 4HB2A 2GZDA 4X1KA 3VAZA 4ABYA 3MQFA 2GK7A 3KQQA 3LL4A 2C7PA 2NV2B 2BLLA 2JPDA 1RADA 3PX7A 1NC1A 2ECPA 2MOKA 1YSCA 4YCDA 5AW5A 4S0XA 2YFHA 4Y7CA 1QHGA 1ZP6A 1RKUA 4NCHA 2KS6A 4DE5A 3W8EA 1XKXA 3ITDA 2V9ZA 3K1YA 3AW8A 1YE3A 2E0IA 4M0UA 1TFUA 1XWFA 4Y9RA 4BNXA 1PZXA 4MUIA 4GBJA 2Y05A 1VIMA 4CV1A 1FQKA 1KK3A 3EGWA 5DNDA 1ZMBA 3FSGD 2AEJA 2W6ZA 1FXSA 3EQ9A 2PUFA 3ZOKA 4GIBA 3OM1A 4HWKA 4I7EA 4A92A 1ZCZA 4GI2A 1K06A 1P77A 5DF1A 1QP4A 5A3RA 5LP6B 1CQJB 3ROMA 5JJBA 1GGNA 4IGEA 1Z4IA 1FQOA 2QG4A 2ZITA 4EVRA 2FSPA 3E3LA 1HTTA 3PC7A 4Q9IA 1AK2A 1U7TA 5K3FA 5JPDA 1Z13A 1M83A 3ZNPA 3IEKA 3TCNA 1QHFA 1QDEA 2BONA 3COSA 3A3NA 3D02A 4MYSA 1J0DA 4UEWA 1YUBA 2O5VA 2V7EA 4OFXA 5CDYA 3VKHA 1F0PA 1Q1ZA 4WERA 3HN7A 3OU2A 1ZJZA 4CNQA 3ACBA 3R8XA 2CE2X 4IEEA 1H6DA 3HL0A 4DNPA 2CSXA 2F3SA 3R6WA 4RAQA 2Y1CA 4Y1GA 4EYQA 2X42A 4CEIB 1I14A 2IHTA 5CH3A 3CVXA 3D5EA 3TAUA 4MVJF 4CM7A 1ZNYA 1BDBA 4OCZA 3IXQA 3AVVA 1ANKA 4X64B 2Y1KA 1I5EA 3FTPA 3AH8A 1R8YA 1XJCA 2IP2A 4I4TF 4U00A 1U80A 6ABPA 1DKQA 2EJUA 3HYLA 2QQFA 3EXHC 4EY4A 4Q3BA 5HF8A 1IZ9A 5JJKA 2XV1A 4EF5A 3U4IA 1YQXA 4OMCA 3NASA 5CT5A 4IIUA 1O97C 2HI0A 1N25A 1L7PA 1YIOA 4M1MA 3KAQA 1YBAA 2Z4TA 4BX2A 5IKPA 3HY6A 3ZNQA 5BV8A 3KE9A 1WO8A 1B0AA 5E1DA 2EQBA 4YWJA 1WP9A 1YZYA 4BEWA 5LWHA 3HBMA 3EVTA 3SSAA 1XMSA 3UA3A 3ZZ0A 3ZWOA 2N46A 3L4SO 5EERA 4BCBA 2RGBA 1XCMA 1QQ6A 2HSDA 3L6EA 3KFLA 4P7GA 1P73A 4PYLA 2GEDA 1DTWB 2XQKA 1PSWA 4C6TA 4TUYB 1HL7A 4ZEVA 2EW8A 1XL1A 2JAPA 5AUQA 3WGLA 2A3NA 1E6KA 2WG0A 4IFBA 1D07A 1BE1A 2XT6A 1JHZA 4BVKA 2M98A 3AEKA 4HSEA 3NFRA 4WZBA 5DFAA 2XX3A 3MB5A 1EWTA 2E4VA 3IUMA 4PPQA 5B6JA 1UBGA 5J5VA 3GT0A 5JZVA 1ISPA 2ZBRA 5EZYF 4JXXA 4EARA 3IOCA 3RD5A 2X5NA 3O4RA 3R0ZA 2FGJA 1WV1A 1N8NA 3NAQA 4MW7A 5IXSA 3IUSA 1TZMA 1IOLA 1L5HB 2I1QA 3AMVA 4XVHA 4RPCA 2R2AA 4RJLA 4RY9A 2ROQA 4YX9A 2H0RA 1CWUA 3GA5A 3MM4A 3C3AA 1EXNA 1NVKA 3I1YA 1ZOOA 2XRZA 3SM3A 3JQEA 4CM8B 4Z49A 4BNVA 1PYOA 4J0KA 4EUNA 4DDUA 1PKXA 4MKXA 3V46A 3EEIA 3SYLA 2BKXA 4BV8A 2FF7A 1Y34E 4CV2A 2O3SA 4MIOA 4AQ7A 1Y5IA 2JFGA 2OBXA 1KU0A 3OFSA 4UDYX 1FVHA 3A70A 4YMTA 3BQ9A 5BWLA 4CLHA 3AVTA 4WXHA 2QAGB 1WCYA 2BEVA 2FZKA 1RRMA 2ZIFA 3KR1A 4JJAA 4KH1A 1D7AA 2HMSA 1L9KA 4GI1A 1EFUA 3P32A 4TLMB 5IEBA 4A4DA 3WSVA 4EVQA 1SK9A 4LCBA 2EEZA 1NE7A 1H65A 1OYVA 3BKWA 3PHBE 4G81A 4KEAA 4UD2A 4Y1RB 2YHSA 1JLLA 1URPA 5HF5A 3HRKA 3T1NA 5JMTA 5LQUA 5JJ5A 4UM7A 2WD8A 3DD5A 3TX2A 5K8TA 1T13A 2C5HA 2GPJA 1YR1A 2ZYSA 2CHVA 3E9RA 3IKMB 4JD5A 2NUAB 3TLXA 4AJHA 3PEUA 3RS8A 3NP7A 1OY1A 3H1EA 3HFSA 2B1GA 4O0LA 4RTOA 4PHCA 5KDOA 4PINA 1EUDB 2X0RA 3JQBC 3IR6A 4X1YB 2ZB3A 3RQSA 3JALA 3BK1A 2GZAA 4IQGA 1WDKA 3KV1A 2VL7A 4PIPA 5CFOA 1BN7A 1EVQA 2Q2NA 4PAGA 2IYLD 4TT8A 1Z6ZA 1WIWA 5ALHA 3NBMA 4MSUA 4MPRA 1SCDA 2NNLD 4LDZA 4AAYA 4NAVA 3BTVA 1W4BA 1P4HA 2Q3EA 2B36A 3LG2A 4LN1A 1Z2AA 4W7HA 3SF8B 1DIGA 4C0LA 1NOIA 1MJGA 3FUWA 4LJ8A 1F2TB 4M0MA 2IX9A 4MULA 1N8SA 2VAVA 2C7VA 3QGMA 2BKAA 4RMIA 1G5RA 1P6QA 1CB7A 2II6A 1KI7A 2V0CA 3PNMA 2JGDB 3IC5A 4E5UA 2QL5A 5BN4A 1FP4B 1K92A 3O8QA 1OTHA 2VEDA 2UVPA 4X66B 1EM8B 2OB2A 1G4UR 3DEYX 2YXDA 3DKKA 3IJ5A 3MCWA 4OQPA 1PQPA 3Q0IA 5CK5A 4C1NA 1U31A 4V24A 4D92A 1YL7A 5I01A 1AS0A 1NVXQ 1DI0A 1QHEA 3ND9A 4RZHA 4D41A 1QGUB 1TQ8A 3CT6A 7AT1A 2LE0A 1YB1A 2JANA 3KXPA 3A32A 1PE0A 3DT6A 2WA2A 2VF2A 4GZ3A 4WY5A 3QXGA 4D0SA 4I8DA 1XR3A 1YDEA 4EMSA 4US2R 5F78A 1KIAA 1RBMA 1UUFA 2I7DA 2NQTA 4IGIA 3RS3A 5CBKA 2D7CA 2WHXA 5EQJB 4DNOA 3EAGA 5B3LA 1QZZA 5AXBA 3F0TA 1GAWA 4NE2A 5AKYA 2JFPA 9LDTA 2WNSA 4ZCPA 5CYFA 1Z5NA 4PHTA 2E85A 5BV1A 3JRNA 5SZIA 1WABA 3DPUA 3JAKA 3LDHA 2DBQA 2PS3A 2GX6A 2AFVA 5FBKA 2O8EA 4BTLA 2WICA 4ZOLB 5ALGA 3T12A 2VBIA 1PJBA 4I8XA 3GLHA 4TYNA 2FMKA 4JC5A 3GVIA 4OAPA 3WI7A 1CJSA 1GDDA 1E6MA 4I5EA 1Q7GA 2GPTA 1A98A 2AE2A 2C03A 1YJBA 2P11A 3ORFA 3PWKA 5F52A 4EPVA 3PHCA 3B6JA 4NBNA 4ZI7F 3E8MA 4US1R 3K8QA 3N8HA 1U0TA 1TF2A 3BX1A 3ONVA 4X7PA 1CQXA 3G2HA 5FBLB 2ILVA 2BKUA 4MW1A 3A3PA 3MWLA 2P3LA 4UZSA 4PR3A 2WU4A 1M2VA 2ZS9A 2UUBB 4LG1A 1WEKA 3EDRA 3SKXA 4B6PA 1YFKA 1L7MA 5D5QA 3VVMA 2ILTA 3ZGOA 4FS3A 1J22A 1DKMA 1EFRD 3A9UA 4B6OA 4M22A 1VG1A 3CPJB 4NBWA 4ZQIA 3UMBA 1TAUA 1VB3A 1UZMA 3LUGA 4HDCA 4EKDA 2TMYA 1PYGA 1NONA 4QLAA 5HYVA 4TYYA 2W6JD 3K09C 3WWCA 2VP4A 1WP4A 1RQLA 3L8DA 4CKEB 5L6MB 1Y4ZA 3TPFA 2QLTA 5LWQA 3DKPA 3BK2A 3OQNA 2BELA 2UZ3A 3AF4A 2W43A 4FINA 5EXXA 4YCBA 1SVOA 5IUKC 3EVAA 3W90A 3J81A 4LJ9A 1V47A 1FLAA 1LSSA 3OFJA 4BO3A 3J80A 3UT6A 4EW1A 4OEHA 2AOVA 4BCDA 5B2EA 3M6VA 1DG1G 5BSFA 1WHSB 5F7JA 1K3TA 3C3KA 3IAM1 1X1EA 1II9A 3PI7A 1GGEA 2R96A 4PYKA 4MUBA 3VR4A 3BAZA 2P3QA 3QMMA 4HS4A 2EFYA 3AP2A 3DTTA 4DWVA 3GWZA 3RFUA 5IAAA 1CR1A 2FE1A 2JCYA 4QU9A 1T8UA 4EB6B 1YL6A 4NG4A 5CR9A 4PX5A 4DQKA 3SJBA 2YWJA 1W75A 1TNDA 5CYOA 1OI3A 2IQIA 3G49A 3TI9A 4F8EA 2MSDB 1XDZA 2PLRA 2Z58A 1SKUA 3KT0A 2IF0A 4RS4A 5ALIA 5DSTA 5IARA 5A9SA 4LFBB 4IIHA 4B6EA 3VNUA 2YZ7A 1CNMA 3FVVA 4PGHA 1N5JA 4D79A 4DM4A 3AW9A 1EDDA 1K6XA 2W0SA 1IZ0A 1KAMA 2A8YA 4R7ZA 1VYVA 4G09A 1CQIB 2DCUA 1WOYA 1X7XA 5TGZA 4F1KA 2BC9A 3H97A 1O9HA 2HWKA 2EXXA 2DFPA 3OHPA 4K6CA 2VHXA 2IV3A 5HF6A 3N87A 3VHXA 4TGLA 4AJ1A 1X8KA 3E61A 1ORWA 4X00A 1IBRA 5E4JA 3RAGA 2ZTUA 3DE4X 4OMUA 4RPJA 4OHRA 5ELXA 1M6EX 3LUCA 3LBHA 1UCFA 1EZ4A 5L8VA 3A6HA 1NU8A 4B79A 2CDRA 1LLDA 4W99A 2AXNA 2N0SA 3UK0A 1HORA 2JKYA 4XKJA 2HLDA 4RA9B 5DYYA 1GDHA 3B3AA 4AM8A 1C3EA 3LF1A 1K4YA 1H4VB 1C1DA 1YA4A 3K2QA 5C8YF 4F12A 3W2GA 3FZYA 4FUQA 3U9TA 4A6DA 6Q21A 2CLLB 2Y92A 3OE1A 4E4TA 1YZLA 2QZZA 1L6RA 4CMEC 4CCSA 1ZWKA 2XA9A 2QN6A 1WNTA 4QO7A 2YJ3A 3NGXA 2X0EA 2IEZA 2NV0A 5DBOA 3TKLA 2ENWA 4MB6A 1J8MF 3S29A 3ZUGA 5MGNA 5U4QA 1GQRA 2B92A 3H86A 2Z95A 2M2IA 3H9GA 3OPQA 3SEZA 3T5BA 2PSHA 2P7IA 2PKRA 4Y6OA 3A58B 3CW9A 4HXEB 4FQ5A 4L4YA 3GQVA 1YA6A 4QEZA 3BDAA 5KOJA 3QE2A 5AW6A 2R79A 1F1JA 1OFIA 1NAIA 1Z33A 3N0RA 5DI3B 5J40A 3C85A 5HOEA 3NBAA 4QDXA 3AJAA 3ZCXA 1RAIA 3CLHA 4HH3C 2CZQA 3FRHA 1GFZA 3W5UA 4IZ6A 4QM6A 3EARA 4E4RA 2FZLA 3S7TA 4I1PA 1K8QA 1YK1A 3O82A 5AJUA 1DC7A 1CUGA 3GDFA 2MR5A 5ECGC 3H16A 4WMLA 2XOXA 1XNJA 4HH4A 2WHEA 4PQEA 1AH2A 1P0MA 3EEBA 4K6GA 4ZQEA 5B30A 2YR0A 3NDRA 1N2IA 2SICE 3JD0A 4EFNA 3O8DA 3R09A 2JJQA 5JH7F 2HADA 5KPDA 3TBHA 1QP8A 1X7WB 4IX1A 2YY7A 3GZ4A 1QIKA 4M6WB 4EDFA 2A3RA 2Q1UA 2Y0CA 2D8AA 4RLFA 5EJIA 2JFHA 3QHPA 2VDVE 3HZOA 3D2LA 4RNDB 5L53A 2CFRA 1BQ4A 2YC2C 3JAKB 1EK5A 2O54A 4NJOA 4BQNA 5A02A 1NNEA 3OQJA 2R44A 2BCJQ 5I8PA 1GPUA 3C5WP 2OA0A 5EMHA 1CJMA 2J3QA 5FNVF 2E5WA 1P81A 2NW6A 4N54A 4F8JA 4EYGA 3IDZA 5CYGA 5JQGA 3U61B 3EEQA 2HU2A 1G9TA 2B4RO 5JSZA 4O3FA 2Z4RA 4Z3OA 3MTIA 4PO3X 4IKPA 2QYSA 3U4MA 1P1KA 1Q0PA 3MWDB 5D6OA 5DWQA 2B3TA 5ILQA 1P91A 2DAPA 1HDIA 3ECSA 2HW8A 5LMZA 3R44A 3T38A 2FZGA 4YRPA 3MAJA 5F2OA 1RYYA 2VHQA 1PT5A 4PRKA 5BN1A 2XCTB 3LDAA 4OAQA 4PNHA 1CVIA 1DS6A 3F4LA 4A36A 3E5NA 3IHLA 4QRHA 4CDRA 2H3HA 1NR7A 4DREA 2AW3A 4JVSB 3TQFA 2FSVC 2O3RA 3GMSA 2QXUA 3EVFA 4MYDA 2WLSA 3PFCA 4N40A 5DLEA 4NE9A 3OM8A 1JWAB 5FUVA 3G5TA 3NIDB 3WYAA 1HDOA 4FXPA 2CKDA 1QFJA 3KZXA 4I9UA 4YQYA 5EUMA 1BE6A 4EELA 4R1LA 2YIJA 4OMDA 4P4LA 3EIWA 5GJBA 4L7QA 5DJ5A 3RREA 3LUBA 1FP7A 3DHNA 1FTYA 4YVFA 1RXWA 1H3EA 1JLKA 2D2FA 1IHDA 2A0YA 2OXCA 5EP4A 5SY4A 5G0TA 2IPXA 3INTA 1J0BA 5TPWB 1Q0LA 3KKQA 2RDMA 3RSSA 3R7NA 1ONNA 4WCFB 2HQSA 2NUTA 2GCGA 3KPWA 3NTOA 3PF8A 4WK0B 3E5HA 1Y8AA 1RM3A 3M4XA 2H1WA 3QKRB 5E8RA 2FP4A 4PZYA 4B6GA 4L5CA 4DV2B 3TW8B 1K0UA 4BFCA 1Q0QA 4BRWA 5KIAA 1NMEA 4K0RA 1JPUA 4AVYA 3ZI7A 3Q2OA 5KMGA 5HG0A 2VDNB 1J2EA 1C1YA 3AF6A 1KARA 1V37A 1M2OA 1V71A 2BHNA 2I7CA 2RGNA 4LMRA 5U4XA 2R4QA 3FETA 1CG6A 3RGGA 3SEFA 1KQOA 3JQ9C 4A03A 5KZMB 4DA6A 2WTXA 3EG5A 3UB2A 4B0PA 1VCIA 2PFKA 3H0CA 5GM2A 3WR5A 2XDWA 1KMHB 2XVYA 2HEGA 1JL3A 3D7NA 5AM5A 3CC8A 1JU9A 1KRWA 1VIAA 2JIRA 3QY9A 4AZ0B 2EERA 2C5FA 1YQGA 1ZUNA 4Y98A 3W6NA 5LU9A 4KQHA 2NZUG 2DWCA 5CIQA 2XUOA 3ZH9B 3LW7A 4RLHA 1W4ZA 4GZ5A 4OY3A 4U6QA 2AJCA 1Q0RA 3VV2A 3RIHA 1KO4A 3Q9UA 1G64A 4AJ4A 1R8JA 2ZBDA 3LDFA 2NUTB 1SHKA 4GR4A 4IS3A 3AKYA 5CIYA 1EWQA 3QH4A 1QRAA 2KPOA 1K7SN 2FU5C 1QTRA 3HJNA 1N2CE 2Z5VA 1V9CA 4K3VA 1SJ9A 1L8LA 3DAHA 2CXQA 1UJNA 3ENWA 3NH6A 4I5GA 5AP9A 1V6CA 5IKOA 2OV8A 2JH9A 4CPDA 3R5SA 4URVR 2OM2A 4G89A 1AB6A 1JN0A 2RJNA 4EPRA 3FLAA 2WD7B 1AO3A 1DBRA 2EJWA 1VLMA 3F3KA 3PZBA 3J7TA 2NG1A 7ADHA 4H1WA 2PIDA 4Z9XA 3OOJA 5DM2A 1T3SA 1T5LA 2AFRA 1Z74A 5K0GA 2OAQ1 5IT9A 2FRVA 2YQZA 5TPZD 1GG9A 3UXMA 4DDWA 2XKKA 3QG5A 4UHEA 5CLJA 1Y9DA 4U2KA 2W7TA 3C4JA 5BYBA 3L6BA 4G3XA 1AO0A 1D6SA 4RVFA 4CCAA 3TINA 1WUTA 3D8BA 4FFWA 5ELMA 1KEKA 1JLMA 1GGJA 6NULA 1LDEA 3AGQA 2N47A 3WB1A 3CA8A 3ZYZA 1NLFA 1YRBA 3GPBA 3V4LA 5F7XA 2C2BA 3KPJA 3D59A 4O4LA 3LECA 1NQXA 3Q7TA 2XE7A 5FTLA 5MGBA 4MWGA 4ETIA 3UMCA 4BNMA 4GPZA 2P7HA 2C8LA 4EMUA 1Z75A 3SC2A 5ABPA 5CAEA 5JCZA 1YKSA 1JXAA 3EGCA 1G6KA 3DBVO 5ESWA 2B4KA 4GMXA 3RWOA 5HBRA 2AJ8A 4LYGA 1AOXA 3R3ZA 3UWOA 5EJ5A 1SZPA 3TK1A 3GCGA 1KH3A 3F96A 4X6UA 1PKEA 4F9EA 2QVZX 2R6CA 4C89A 1Z7WA 4RZIA 4MO2A 5KVSA 4F21A 3QUCA 5BW8A 1PW5A 1OU0A 1TUBA 2ZS8A 4EW2A 2VP6A 5C8XA 1V16B 1AF4A 1XRQA 4ZU6X 4KXQA 2GYWA 3HLYA 3KVYA 1GN9A 1SBNE 2WHPA 1AQLA 4J2TA 4MRVA 3RHTA 1X1RA 1ZINA 1ZVMA 2ZWIA 4NCAA 1ODTC 1RYHA 4W1QA 3BILA 4BO4A 2Q1WA 4HTFB 2QM8A 3LDUA 1KK1A 2BGTA 3VXKA 2ZWPA 1VJTA 4I5FA 1TLTA 3K1AB 1ETUA 2SNIE 3GRUA 3Q4GA 4Q7MB 2YBDA 3EODA 4GR9A 5TIIA 3KUCA 3R3YA 3LGSA 3FR8A 1MW9X 2HLHA 2QB5A 1TT5A 2G76A 2FFRA 4QA9A 1I8TA 1YS4A 4RHFA 2HMWA 4BEJA 2H3EA 1ZHOA 4FGZA 4Q9JA 5BURA 5E7MA 9ATCA 1YMQA 2QUBA 4PSUA 3AP3A 3P9QA 4ARUA 3KJFA 2CHQA 5FF9A 4QE3A 4EH1A 8GPBA 2R6DA 2AR9A 3DAFA 3G2KA 4X3PA 3SD7A 4B7UA 1QH1B 4JXJA 4QDUA 1XTKA 1PP4A 5KKAA 5I45A 5K8JB 1FDOA 2J7KA 1AF7A 3GFVA 2GMWA 2KYRA 4MVJD 5IJ0B 1ABBA 4RTNA 1RLOA 4EFLA 3GUZA 2XF8A 4G9EA 1B8OA 3FOBA 3PIDA 1D2RA 4CQMD 1E4EB 2LV8A 4EHAA 5ISMA 3CO5A 5KNDA 1WXDA 2OFXA 1QV9A 4J0JA 4V39A 1P2FA 3YASA 3FBGA 1PR6A 4L15A 4X92A 1JHXA 3TSWA 2B0CA 4M0DA 4B74A 5IK2A 2WM2A 1GT6A 3RVKA 4C0AC 1P3Y1 2F1JA 3L6RA 1AG9A 3ENKA 5AUNB 3GEGA 5AIBA 3ANMA 2AKEA 4RO0A 1LW6E 3CF4A 3VH2A 1WVIA 2I54A 1B43A 4EK9A 1QORA 2WAAA 3TW6A 3BIXA 1IQRA 1K3UB 1XZBA 5IF9A 4NYMR 3EPKA 1MDFA 2WWXA 4ZCLA 1YDGA 5JDCA 3G0DA 3K6KA 1JWLA 5LJIA 3PV0A 2XNKA 4WEQA 4EG4A 1BA3A 3I6YA 4RSGA 4Y2TA 4BC0A 4NZYA 4XGKA 3UG7A 1TDJA 2R65A 1RVV1 4YRKA 2ZJAA 2C31A 5LM3A 1I2BA 3F5SA 4EFKA 1JPNA 1QZXA 5BN5A 3M34A 5LQJA 2GHTA 4M87A 3RYCB 2PUGA 2HBZA 2OKGA 2HWXA 2JK1A 5D86A 1E7RA 4DMFA 3MOSA 3NOXA 2OG2A 1IEVA 4KO1S 2H48A 3E81A 4TTSA 4WK2B 1NRIA 1X2EA 5L7TA 3KHTA 1GCAA 4HGZA 2Z1DA 3AJDA 1E61A 1LWOA 4JN6B 4PS0A 5KI6A 3TTXA 4CUKA 1DAIA 4AG3A 1CXZA 3A6KA 3PFWO 3F73A 1W88A 1NVAA 3QIVA 2QLLA 3GVHA 3GEBA 4NQZA 1LRLA 3F8SA 2WU8A 1BXGA 1BWQA 4ROSA 4JH0A 2P62A 4QULA 4EYOA 1C5KA 1Q7TA 4QQNA 3QF4B 1DAMA 3OZIA 1W85B 2HK9A 3ZQ6A 1ECCA 3PNQA 4F9GA 2W2XA 1V2GA 5DXAA 2QP9X 3GJYA 4B3HA 1Q77A 2DULA 1KEEA 1WAMA 2FK7A 2MSKA 1FW6A 2GRJA 3ZE2B 3KCQA 5TMDA 4WJZA 4C7JA 3KJEA 5FLYA 4KP7A 3SQNA 1RXVA 2GM4A 4HWOA 1VECA 3H2ZA 1YWGO 4KWEA 4Q9NA 3HBAA 5P8WA 4RHCA 1ZMRA 3LLSA 5EA2A 4FTWA 5DHUA 3O3CA 3T3IA 3MUOA 3R2JA 4LY0A 1IUOA 1ONSA 4FOPA 4YJKA 2QU7A 4OQXA 3VR4D 2PO7A 3IELA 3HYCA 4UBOA 3NXSA 1PV4A 4UUMA 4DQVA 1PFKA 3G1WA 3ESDA 3OLXA 2E7ZA 4JCCA 4KWHA 3GH1A 1D6MA 1I33A 3A1CA 4XTRA 3UTCA 1Y42X 3UENA 3RNLA 2RARA 1WDMA 3IL2A 1MIHA 2A30A 5GADl 4DV4B 3KBBA 5FBHA 3SK0A 1DJPA 3LGAA 3N8DA 4ILKA 3L1HA 5I5GA 4HDMA 1NDQA 3KZVA 3NCHA 4E11A 1K86A 1IWOA 3MGGA 1S3SA 3T0FA 3RFFA 1QPZA 1AUQA 4LRWA 2JLAA 2B4TO 2AFIB 3I6BA 2JRCA 5BR4A 3KJIA 2WTNA 4D97A 1UT5A 4NP6A 3ANSA 1JFTA 5FT9A 3M6MD 3T61A 3QQ5A 5EIHA 2OHIA 2ZW9A 1DQPA 1Y37A 2C54A 2GN1A 3EQZA 4GUDA 3SHQA 5KJ6A 1I7QB 1WHTA 4Q4HA 3UUWA 4KFRA 2NT3A 4S2UA 4Y2GA 3FPBA 3MLAA 1JG3A 5GY7A 2QY6A 2SCUB 3OY7A 5AOCA 2QVYX 2GN2A 3IGFA 4M8LA 4LHXA 2HCFA 2Y0BA 1P33A 4OQZA 4UPDA 3ZDQA 3ELBA 4DV0B 3RIGA 7MHTA 3B1FA 1S2IA 4N7MA 4QSHA 1BOFA 3N0XA 4QBGB 3O90A 4DARA 2C95A 3KPVA 1EQ2A 2NMVA 3ZWXA 1R5BA 3VBEA 3G1TA 4DAEA 1FQWA 3NYQA 2BFBB 4Z3KA 3PKJA 1P9NA 2HWYA 1PT6A 2UAGA 2VCHA 5FPKA 1GTRA 2PQ2A 1F0NA 2PRKA 2XD9A 4FXOA 5KREA 4R2MA 3UJ6A 3TG8A 1V7CA 1QO0D 5CTJA 1A8HA 2UUAB 2JLWA 3WRVA 1U6IA 4O02B 3RJTA 2I6SA 5JHGB 1GU1A 1SCUB 3MWYW 3C1OA 1U3WA 3DZFA 4S2EA 4YT5A 4F3TA 3MSXA 4LKOA 3U48A 2FNAA 5BW6B 1CRZA 5MN6A 1LB1B 2O2CA 4Y18A 1FP4A 4YJHB 4F5DA 1ZITA 2ZCJA 2J3JA 2ODAA 3QEBZ 1M2KA 2X14A 2VTBA 2IU6A 3H5OA 2NX2A 3NGMA 2QMQA 3T7DA 2JGMA 3OLZA 4FN5A 3NJ4A 4BZWA 3H5AA 1ENOA 3GW8A 4U4AA 5TXGA 2WZQA 5AW7A 4PIVA 2FJ0A 1QP7A 1M1YB 3ABQB 1KVUA 2JA2A 2O0KA 3SM9A 3OBIA 4DC9A 3WMXA 3WYGA 1QCCA 1SHJA 1ZGBA 4HUJA 1ECGA 1NW6A 3WLOA 4BNGA 5TPZA 2LBPA 2QHXA 1KI8A 4KR9A 3Q5GA 3UWDA 1E3WB 3GLHE 1EJ2A 2R00C 3E23A 1D2NA 2IIPA 5ETJA 3LPAA 1D2CA 4AD8A 3KQUA 2YYZA 2BDEA 3TIIA 1FYFA 1KJ8A 3H42B 3PDIB 1BSVA 3W6UA 1BDIA 2F8TA 1PAUA 2VK2A 3HYSA 2WVHA 1PWHA 3B60A 2YXPX 1XZCA 5ALUA 4W9NA 4UFPA 1ZM3A 1JIVA 1GRVA 1JSRA 2E3JA 2XMZA 1OYOA 3KJNA 2P6MA 3QOWA 5C5DA 1QPBA 1XU9A 3NHJA 3P9KA 5JVDB 2PUTA 1JNYA 5ALOA 1BQ3A 4N7JA 3GK3A 1X15A 2OBLA 4YP7A 2FMUA 1T1EA 4HEQA 2RH5A 4Y1RA 2OYRA 1RTKA 2P9GA 3I6MA 3I01M 1KYZA 1R10A 1J7KA 1SGWA 2H1HA 2O1EA 3T54A 5MN5A 2EHJA 3DTYA 4COOA 3EDOA 3H9CA 4R3NA 5C52B 2O5EA 1OB2A 2J08A 3LSYA 1R4MB 3V4ZA 4JI0B 4PQRA 1G0NA 1TM1E 2RBEA 1U1DA 2OAGA 2OCIA 1DJNA 3OOSA 1SQ6A 3ZHBA 2I3GA 3G3EA 1UBHS 2WP0A 3ASVA 1IPHA 1EI9A 3SQLA 1SK8A 2BVNA 3MD9A 1U0SY 2UZ0A 3DEZA 2VPQA 4AS2A 1R74A 3WGOA 4QQKA 4KI7A 421PA 1R15A 3WQHA 4B85A 1LBSA 1VE9A 4O4HF 5H16A 1DAFA 3ABOB 3DC7A 3CUTA 4YASA 1US8A 3F49S 5J2TB 3EGXA 2IZ1A 2QM0A 1O89A 4PG6A 1MPTA 3AIMA 3ZV3A 3ZCSA 4EGFA 3CVWA 3IP1A 1XMXA 4EUHA 2C92A 3QE4A 1DU4A 4HP8A 5ICMA 5HMLA 4ARSA 4JFRA 4EMBA 2QUHA 2O14A 3E4DA 1IYZA 2ZQ5A 5KYVA 1FCJA 1TM5E 1FRFS 4JKIA 3ZGLA 4DLLA 4IP0A 2W83A 1PEYA 3ZWPA 5DNYB 3VKGA 1VKOA 5JCJA 4E7OA 2BJVA 1A5ZA 1NN5A 1H1DA 1S8OA 1DWQA 4GOOD 3O95A 1X80B 4OJNA 4Z51A 1XVUA 1FF9A 2CXUA 3EXEB 3WGJA 4Z4CA 4BIIA 1A4XA 4BYMA 1E99A 4FYJA 5JNWA 4P2GA 3CNLA 2FGKA 3N5KA 4KE8A 4MGZR 4I4CA 4YJ2A 2XBUA 2HSGA 4OL9A 1O5OA 2Z2IA 3JQ8B 1JEQA 5EE0A 4ZN6A 1QGDA 1QF6A 4C0HA 2E5FA 1C7ZA 2HWUA 3C8ZA 4AKHA 4FEEA 4CCYB 5TARA 4ZVTA 3P96A 1BTOA 4U8GA 4URWR 2G1AA 3OE5A 3ZJUA 1FTQA 1PS8A 2BEWB 2QE7D 1YACA 1RC8A 4RVOA 2AX4A 1P0CA 2I03A 1EFTA 1YRAA 3JD4A 3WKEA 5FDFA 1NBIA 3DNPA 3DFFA 4W9RA 3W9BA 1B8VA 4PPYA 3L7BA 3GFOA 2I2WA 1ECLA 2OMKA 3IXLA 3DZHA 2GEKA 1B00A 4C4TA 1AIPA 4X71A 4D2IA 2WIAA 4G5GA 5GV7A 2O1WA 3GCXA 1NRJB 4IJKA 2WSIA 4J75A 3EQ6A 2P0YA 1E9BA 1QIIA 3RYIA 5TPWA 3AC0A 2JL1A 3WIDA 1XE3A 1P7ZA 3OBBA 2Y8EA 1HRDA 4HGNA 1G2OA 3STUA 5JMPA 1XF9A 3FOCA 4HUQA 1WZEA 4G85A 4XWAA 3V7YA 4DCUA 2VVTA 1AHHA 3J7AC 1ATZA 1MN6A 2WYUA 2E4ZA 4IIGA 4OKNA 3WLJA 2XUQA 4KDRA 1XMOB 3P97A