3ET5A

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase complexed with tungstate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
244
structure length
244
Chain Sequence
QANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHKGKVFYVTNRKDSSEKAGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Recombinant Haemophilus Influenzae E (P4) Acid Phosphatase Reveals a New Member of the Haloacid Dehalogenase Superfamily.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Outer membrane protein P4, NADP phosphatase
total genus 97
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3et5A00
1O03A 3OPXA 3L8HA 5AICA 4BBJA 1NF2A 2R8ZA 3E81A 2FPXA 1L8LA 3AR9A 2NO5A 3U7GA 3HYCA 2GHQA 2YMPA 4NWIA 3SKXA 2CFTA 4G63A 4UARA 2WF5A 3ZVNA 4YCLA 4UU1A 5AW5A 4EZEA 3L0BA 5ALIA 5AESA 1WR8A 3N28A 4OHFA 1RRCA 4EEKA 2I7DA 1TJ3A 2YBDA 4RESA 1PW5A 1SWVA 1RLTA 4Y2RA 5AVXA 3M1YA 2IA5A 2MU1A 2G0AA 2HDOA 4Y2UA 1JUDA 5AW6A 1ZD4A 1L7OA 3QNMA 3L0YA 2NYVA 4KX5A 2W4MA 3K1ZA 3PCTA 3WK7A 3SF0A 4FE3A 2R8EA 2B8EA 3BWVA 1ZRNA 3I6BA 5ALJA 1EK1A 1RC8A 4Y2YA 4JB3A 5ALVA 4CF4A 3W5AA 2YJ4A 1XVIA 5AKYA 2HI0A 5AI5A 1ZJJA 5ALYA 3ZVMA 2GHTA 1Z4IA 4KNWA 1Z4NA 3ONNA 2CFSA 4UATA 1WPGA 4OFZA 4B6JA 3N5KA 2P9JA 3KC2A 5T41A 4KYTA 3ZI4A 2JAUA 5FP0A 1RPZA 2OA0A 4BEVA 4HGPA 5AVQA 3QUBA 4OD0A 4ZEVA 1T5TA 2HOQA 3U19A 1RKVA 1F5SA 1U2TA 4Y2VA 3ET4A 3SD7A 5AKXA 2FI1A 3ZW7A 3AR4A 4PNHA 4DW8A 3A3YA 5ALRA 1TJ4A 3DDHA 4XQ0A 4FFDA 3I1YA 3ET5A 5AVVA 3KZXA 3ZWKA 2GMWA 3F9RA 3QU9A 3L8EA 2EATA 3R4CA 4DFDA 5AI4A 3QU4A 3U7FB 2AMYA 5AIAA 3SLRA 2QYHA 2FUCA 2B1QA 1IWOA 1WZCA 3E8MA 5AM0A 5ALMA 3WGVA 1CQZA 4RETA 4Y2TA 3ZVLA 3BA6A 3ZWDA 2ODAA 4NFLA 4J2TA 2JAOA 1RMYA 1ZD3A 2HEGA 2IYEA 3EPRA 1QQ7A 5A3QA 3HLTA 5ALWA 2QLTA 5AVTA 2YMMA 2C8LA 5ALSA 2DQSA 4C4SA 1LTQA 3W5CA 2AH5A 3AR8A 1TE2A 2C4NA 3L5KA 2PR7A 2P27A 2ZBFA 3WK8A 4HGNA 3SMVA 5AM3A 1RQNA 3AR3A 1L7PA 1Z5GA 1Z88A 4AP9A 4OCZA 4MUMA 3WKBA 3L7YA 3QU2A 1Q92A 4CNQA 5AKGA 3DV9A 3A1CA 1U02A 3UMCA 3IB6A 5AM5A 2HX1A 3NAMA 2G07A 3ZX4A 5ALPA 3N8GA 3NUQA 4DCCA 3WKAA 4XPZA 5AW9A 5ALTA 3UMGA 3D6JA 3WK9A 2WF8A 2BY4A 1K1EA 4NABA 2CFRA 2B0CA 1VFPA 5JJBA 2I33A 5AW3A 1N9KA 2C88A 3QUQA 3RF6A 5ALKA 4HGQA 4BNDA 4H1WA 4YIKA 3B9BA 3NRJA 3ZU6A 1RLMA 1RDFA 3R09A 2G1AA 2YFYA 3QUCA 2EAUA 4ZEWA 5ALQA 2PQ0A 1SU4A 5AI9A 2OBBA 2Q4RA 5AW8A 4BEWA 1QQ5A 3A1DA 2X4DA 1L7NA 3MPOA 5AW1A 3EF1A 3E58A 3ZTWA 4KNVA 2AGVA 3U7EB 3PGLA 1Z4MA 3N1UA 5E0OA 3WK6A 5IS2A 3SKYA 2RARA 5AK4A 2O2XA 3L8FA 1T5SA 3L1VA 5AVRA 2GFHA 3AR7A 1L6RA 3FVVA 3QX7A 3DAOA 2YJ6A 4AS2A 3B8EA 5AIBA 1ZOLA 5AW4A 1MH9A 3MN1A 3OTQA 3W5DA 3NASA 2EARA 1FEZA 4J03A 4CF5A 5AW2A 3SHQA 3OCUA 1O08A 2B82A 5AVZA 5AKKA 1WVIA 2FPUA 5AVYA 2D2VA 3CNHA 4IFTA 3KDPA 1CR6A 2FPSA 3MMZA 3U26A 4BYGA 4UAUA 2B30A 1Z4OA 2P11A 5ALUA 1Y8AA 2YN4A 4I9FA 3EWIA 4GIBA 4UM7A 5AI8A 2B1RA 3MC1A 2G06A 3ZX5A 3QU7A 2JGAA 5AW7A 5ALFA 5AW0A 1AQ6A 3FM9A 1TJ5A 2ZG6A 1YV9A 1Z4KA 1ZD2P 5AHXA 2OYCA 3L8GA 2WFAA 3AR6A 4EX6A 2ZXEA 1J97A 5ALHA 2WHEA 1ZRMA 2W43A 2C8KA 4UMEA 5AKLA 3OCWA 3QLEA 3B9RA 2YY6A 4XOUA 3KD3A 1XP5A 2HHLA 3WK4A 4EX7A 1QYIA 2Q5EA 3AR5A 5AM2A 3UM9A 2FUEA 2NO4A 1RMQA 4UMVA 3L1UA 4MWOA 4UASA 5AI6A 4YH1A 1X42A 3GYGA 4O8CA 1T9ZA 2G80A 5ALDA 4UMDA 4BX0A 4BX3A 1Z4LA 1VJRA 2JARA 3KOOA 3A1EA 3QU5A 4Y2JA 5ALGA 5IT4A 2I54A 4EELA 3U13A 1L8OA 4C4TA 1U7PA 5AI0A 4BKMA 4FYPA 2FPWA 1S8OA 2WF6A 5AKJA 1RLOA 3S6JA 5AVUA 2IOHA 2YJ5A 2I55A 4QQFA 3QUTA 1U7OA 2HSZA 3WK5A 2OM6A 2FDRA 2Q4TA 4YCMA 5ALZA 5AKHA 4UM5A 4CF3A 5IT0A 3M9LA 1RKUA 3NALA 3IRUA 3ZUPA 3NANA 4L6AA 4HGRA 4HYTA 1NNLA 2YJ3A 3WKEA 2WF9A 2ZBEA 3FPSA 2MSNA 1YS9A 1KYTA 5ALXA 2O9JA 2R8XA 3WKCA 3UMBA 5ALOA 4UAVA 1YDFA 1S2OA 2RAVA 3DNPA 5AM1A 5AKZA 4IG4A 1NRWA 1TA0A 2ZBGA 4AS3A 2FEAA 4HGOA 4F71A 3FGOA 3ZTYA 2BDEA 2HF2A 5A3RA 4YIHA 3PDWA 3WKDA 2HF7A 1Z4QA 3OCYA 1RMTA 2C9MA 5ALLA 1YNSA 2WF7A 4UW9A 3NIWA 4G9BA 3EF0A 4L57A 3P96A 2W11A 3FPBA 2BDUA 2HO4A 4L6CA 4Y2PA 5AK6A 4C4RA 5AKEA 2CN1A 1ZS9A 1QH9A 2I34A 2WM8A 1VJ5A 1Z4PX 2YMQA 2I6XA 2ZBDA 3FZQA 4UU0A 1RQLA 4Y2QA 3ESQA 3OCXA 3ESRA 4CE6A 3N07A 5AVWA 3W5BA 1RKQA 1N8NA 4JDPA 2FPRA 4DWOA 2JAWA 3L0CA 2YMLA 2G09A 1Z5UA 2AUTA 2B8JA 4YGYA 4HAIA 4QJBA 3ED5A 4F72A 3OCZA 3VAYA 5AM4A 4Y2SA 3RFUA 3E84A 3OCVA 4Y2XA 1L7MA 1YMQA 2RB5A 3J7TA 3QGMA 4YCNA 4I9GA 2IOFK 3AR2A 3I76A 1U2SA 3TLMA 4UMFA 1SWWA 5A3SA 2ZOSA 1J8DA 3R9KA 4NV0A 1YJ5A 5AK3A 3CZ4A 1ZD5A 5ALEA 1XPJA 4EENA 3U7HB 4KN8A 4Y3UA 5AKIA 3QYPA 3WGUA 3PGVA 2PKEA 1EK2A 1LVHA 3IJ5A 1Z4JA 4NAVA 4ZEXA 1QQ6A 5AK5A 2P69A 2HCFA 2RBKA 2G08A 4E88A 3I28A 1Q91A 4KX3A 4BX2A 2R8YA 5ALNA 4BNDB 3QXGA 2GO7A 4GXTA 3KBBA 2IOFA 4XE5A 5AVSA 2VKQA
chains in the Genus database with same CATH superfamily
3PG5A 4KDRA 3WGHA 4YQFA 2H6EA 4LJ9A 4MI1A 4TXHA 621PA 3EFHA 3OICA 4IL5A 1KK1A 1I7NA 3UJPA 4C20A 2C99A 3UG7A 4BZPA 4F3TA 1DZIA 3DBLA 2ATEA 3TRHA 3UXMA 1H4QA 2P2NA 2FN4A 1V8DA 2PGJA 1YBHA 4G4SO 3U4HA 1TZMA 2BHRA 2O2DA 4BNGA 2R1VA 1VRWA 1CJVC 3G3EA 5ESXA 5C5DA 2ZI9A 4KMOA 4O29A 1DAFA 1GKKA 4CL0A 1VG0B 5B3KA 4RK0A 1B43A 2O3TA 3F47A 3BULA 4UUAA 3A70A 4Q05A 1PAUA 2HY7A 4HZUA 4OATA 4D9FA 4IDPA 1AO3A 1LW6E 1N2IA 1DEOA 1T2UA 3FFWA 3KQVA 3LVQE 2FH5B 3MAGA 3PB3A 4L8LA 1GO2A 4LY6A 5FIUA 3UANA 4LECA 1I3MA 4OHPA 2YOHA 1M6WA 5EKDA 5KJFA 3SFZA 5CFMA 3K6JA 1XLVA 4EA8A 1V9CA 3BK7A 3H2JA 1FTSA 2BUBA 3NIFB 5CR9A 1DEAA 1N0VC 3TG8A 1X19A 4IH4A 2FF7A 2X2EA 2Z3ZA 2XR1A 3K0CA 4ZOQI 1IZ0A 3PCTA 5JTUA 2H3EA 3ILSA 4Q4DA 3MGGA 1D9ZA 1VP3A 3P0HA 1V25A 3RVOA 4A23A 1JWBB 2IUFA 4MB0A 5J23A 1PL8A 4EHNA 2X4IA 3CKMA 3I6BA 4BLOA 4I81A 4BZXA 1KO8A 5EG5A 4CVNA 3QVOA 5FUVA 4AF8A 3ZCRA 1AM4D 4AP5A 1A5TA 2GNAA 2QRLA 1N0HA 1IZZA 4AZWA 1VLVA 2GGSA 2H5JA 1JAIA 3BD6A 2HI0A 4YJFB 3RSHA 1MJNA 1LBEA 1ENYA 2DBZA 4UM9D 3I5XA 3COPA 1VI6A 1JJFA 4TX1A 2A30A 1MX3A 3PU6A 1DC7A 4OMUA 4AKGA 1Z4IA 4DV6B 4RY0A 2FMUA 1LLUA 4L0DA 5EY5B 2IUYA 5F3DA 5JWRA 2DQKA 2JHCA 4HR7A 3ZZNA 1RLJA 3D6NB 3PHBE 4Z4QA 3DBHB 4KO1S 2X5NA 4BO9A 2BFAA 2G6TA 2V6IA 1FBTA 3KS9A 4C6TA 2BFMA 2DYKA 3ZI4A 4B80A 3VYSB 3DUFB 4MDHA 5G41A 3SIPA 4CIVA 4DAOA 2OA0A 5FOQA 1U7XA 3WRXC 1TO2E 5LUBA 4WNAA 5CRIA 3TKYA 2QSYA 4LOIA 1L5LA 2VA9A 1JZTA 2YIDA 4D26A 2QZSA 3HDVA 4Y2VA 4X8HA 3VYVA 5ENVA 2QMEA 5BWNA 4R01A 3HWSA 2C03A 1RXUA 3MJHA 5DNAA 1LKZA 5T4BA 5EJGA 5JQWA 3TL2A 2FFJA 3KWLA 1QPBA 3HBJA 1TD9A 3HY4A 3QKRA 2OXEA 1KJZA 2C9CA 2H52A 1JXOA 2AMFA 4WCFB 3KVRA 1K98A 4H0NA 5KYVA 4DRYA 1E2GA 1HF3A 1OAOC 2RE8A 3B1YA 4DILA 4HDCA 1ZD1A 4MV7A 4G97A 3PUHA 4AXXA 1EINA 3GJSA 5FNVF 1Y6RA 1UFVA 4LA4A 4XM2A 3VM6A 1VIVA 3CVWA 3H6HA 5AOVA 3GMSA 2G1JA 4PXAA 3NHWA 2BJHA 4URZR 4C03A 1A9OA 2V7TA 3EPLA 4PGMA 1OBCA 5L3VA 2CGEA 4CKXA 1WCV1 2WTXA 3E03A 4FFNA 1T24A 2BEWA 3IH5A 3Q9UA 4JT8A 1V9LA 1QLHA 5LA6B 3R7DA 3G7NA 3RVMA 2OQVA 3U0BA 2H7CA 3LSYA 2D1YA 3JAWA 3ZZUA 4QDZA 5BUCA 1KBZA 1KMIY 3L9WA 2Q6LA 1PRYA 2WFLA 4FDLA 4DBLE 1Q7GA 1YU6A 2DPMA 1YR7A 4HDKB 3OWOA 5CURA 3TLYA 3SXUB 1BQ4A 2NT3A 4Q16A 2A88A 4KQ6A 2UZ4A 2ZJZA 3ADBA 4EP1A 1YAHA 4QDXA 3WIOA 3I2YX 2RGXA 3BMNB 1AHIA 1J22A 3CZMA 4FHCA 4MYHA 3SCZA 2GK4A 4E4TA 3R9WA 1RRFA 3KR1A 2Q6TA 3NBKA 3UA3A 3UT6A 5CXUA 4QVIA 5D1NA 2GBFA 2R85A 2A94A 2XWPA 3RUPA 1C3LA 3CZ9A 3OT1B 1DDOA 3QHAA 1Z68A 4Q7EA 1ZQ9A 3UO8B 5EESA 1U0FA 4I5GA 1Q92A 4D79A 3EZGA 4QFBA 1G6HA 4ED9A 3R5KA 5HZGA 1OI4A 1TYAE 1V8PA 4P31A 4TZKA 3AIIA 3GVHA 5K51A 1THGA 2G36A 4M1SA 5LPNA 3FPHA 4FUQA 2PXCA 3OEWA 3IOCA 4P3KA 2PMEA 3EB9A 3NVKI 2GM3A 3N8GA 1T6XA 2GN9A 3HFJA 4PGAA 4V24A 3O75A 4I6JA 1U9IA 3NV7A 3DOUA 3PLRA 1N8TA 3WOVA 1D2CA 2A86A 3IO3A 2OXFA 1HPLA 1X1RA 1RRMA 4QSMA 5CVEA 1FMJA 4FT4A 4YFYA 3VYRB 1Q1BA 2L42A 1LPAB 5FV4A 5HW0A 2HJRA 1V5GA 2B0CA 4ZVQA 1X1CA 3LQKA 4RV5A 4HLCA 2ZPUA 5T5QA 4JJ6A 4OK5A 5IJWA 1RM0A 2O7VA 1TF7A 3F8TA 1F6DA 1VMKA 1XTZA 1XZGA 3EXEB 3HDHA 1V2GA 3ETNA 3KG2A 1KERA 4N5LA 1O7JA 4XEHA 3WYGA 4B6SA 4G26A 3WXMA 1XMOB 1N1EA 2VPWA 4HDRA 2NP7A 1U98A 3LCUA 4AG5A 2E4UA 1LGYA 3MHPA 4AWBA 1FPQA 4DWVA 2AS0A 3I5YA 1IJKA 4WBNF 6ADHA 3HKBA 2PNJA 5BWMA 2GASA 3ID6C 3DEYX 3HDGA 4WEOA 4ZVSA 3PE6A 2QW0X 4I5FA 1QQ5A 4DQ0A 2X4DA 3EOBI 4NBKA 2G4VA 3AZOA 4OL0A 2WUWE 3IJPA 4QUHA 3AUUA 2CCKA 2I1QA 4GRAA 4EYQA 3NWPA 4CEJB 1LBTA 4TMFA 3M1LA 1EE2A 5G4KA 2Y1OA 1LJ8A 3A6DA 4Q6WA 2B2NA 3W5JA 4CL8A 3S2EA 1KARA 4WY2A 5FI1B 4H7EA 3C3WA 3PFKA 1FP4A 2PZLA 3TQFA 5I8PA 4H77A 3T3NA 3L1VA 1VG8A 4MUNA 3T1VA 1N1DA 1HWYA 3NWBA 5HR5A 2VJDA 1MJFA 1IONA 3AYZB 3RRBA 3ZDBA 1DCFA 3VU0A 3ZE1B 2AK3A 4E2ZA 1W4LA 1YA4A 2PG3A 3BF7A 5FBVB 3OZTA 1RBMA 2N1BA 1HNZB 3V6MA 2O23A 4D6YA 3MQ2A 4QXAA 3RASA 3KZNA 1R0BA 2XUOA 4A0HA 4HX9A 4CKCB 3H1GA 5LNK1 3EFOA 1Z6TA 4FFLA 4HNTA 3GUZA 4FXPA 3TIFA 4DR6B 1BVYF 3U9SA 1BIFA 1J99A 1T4CB 4RE5A 2J0SA 4FILA 3O93A 3WYNA 4OU4A 3N59A 1KMCA 1JLLB 1XT6A 4IOMA 4IBOA 2PD6A 3DE0X 2YIJA 3IESA 3KJEA 1ADGA 1J0AA 1NNI1 4X44A 4YBZA 4C4YA 4MAMA 3SEAA 5LMZA 3QPAA 3BCRA 5C4IA 2V54A 4PZLA 2O5EA 1PK7A 1Z8NA 1CZKA 1JHUA 1GLVA 2WPDA 3BJIC 3ONFA 1T8UA 3B78A 2FJUA 2X0IA 4H3SA 4QIHA 2R4QA 1JQJC 2V9PA 3LPMA 2WSBA 4MQUA 5AQEA 4IJ5A 1CQJA 4LBWA 4OF4A 2JH8A 1ZC4A 1AQ6A 3CM0A 4G8CA 1P0QA 2DBVO 3BX1A 4OQLA 4M37A 5CLQA 5KTRA 4FBLA 3DB1A 1CJTC 1SCUB 4O2BB 3G0OA 4M0CA 1G7RA 2PCJA 3C74A 2VYQA 1JEJA 4CV1A 1W85A 1WD5A 1NJ8A 2WT8A 1QHSA 1WBDA 1NPYA 4XKJA 5LOVF 5BR8B 3PHLA 4H2DA 4GKKB 1XZDA 1KY5A 1O8CA 2P9FA 3U7JA 1FRFS 2A9RA 3NHRA 4D8VA 4EAQA 2HL6A 3OO0A 3QEMB 3T99A 4JSTA 1H22A 1Y3CE 4EQZA 2X3FA 4EQ6A 1JA1A 1NDHA 3HA7A 5CTJA 1BYUA 1NQ5A 1EUDB 1EDOA 3L1UA 4UASA 2WSYB 2ZU6A 3GN1A 2BDTA 1I01A 1M1YA 3LWDA 1I4LD 4HMQA 4URYR 4ZYYA 3GEHA 1ZGBA 2I8LA 3P20A 1Z33A 2Z9DA 3GU3A 1VHDA 4G07A 3B1XA 4B5KA 2JLYA 1R9NA 1QQAA 3RC3A 1XEXA 2GRJA 1WHSB 1WUTA 1AKRA 2YOFA 2FE1A 3DD5A 1CR4A 2QM8A 4ZT6A 3QXCA 4WLOA 3WC4A 5F3RA 4GSKA 2FSUA 4M8SA 4TSKA 4PEVA 1YXMA 3NM5A 3T7CA 2QU7A 4ZRNA 3W4IA 4JSRA 2QPTA 3ABZA 3WE7A 4Q4AB 1T5BA 2C7GA 4FYPA 4HMOA 1U0BB 2QTVA 3FOAA 1FU8A 4B87A 2GPYA 2HXGA 4PF1A 2A5DA 2BBTA 2EP8A 1CE8B 2DPLA 1UM9B 3ANYB 3LO8A 4A92A 2WVJA 4CMIA 2D4AA 3PWKA 4HDNA 5H1YA 3IKLA 3ANSA 3I5UA 5E8JA 1EK5A 4Z7NB 4IGAA 5F3WB 1JTVA 3LVFO 3LT1A 4WACA 5F5XA 1SUBA 1W36D 1GV1A 3IPRA 3JARA 5IVPA 4HEJA 2A9QA 4G56A 5HRUA 5EYPA 3KOWA 4LSWA 3VUFA 3G2MA 4RK6A 3RWMB 4YQEA 4HYTA 3AB8A 2YJ3A 4HFNA 1JEAA 4RACA 3WKEA 1OX6A 3K1JA 1SURA 4ZYUA 1ZAYA 1N1GA 2Y3IA 4M9SA 2OQ2A 2ZJOA 4X95A 1DG3A 3GHHA 2VJCA 4PE5B 2G9QA 1E2EA 4KDCA 3V3TA 3V4VB 4B45A 4MKXA 3QEOA 4Q02A 4KXXA 3UW1A 3COYA 3OJCA 3FKQA 1DXQA 3V1KA 3GUCA 2AX4A 4GQIA 3ETLA 1KJWA 2I4OA 3KHUA 3A26A 4HWSA 4HNVA 4EGSA 1WDKA 1GTL1 1QIIA 4I19A 3E3OA 2ZIFA 4N9QA 1LRJA 4Y2HA 2CL0X 4C14A 1KL7A 2HJGA 5JS8A 4N3CA 5EZQA 2ZETA 2ZFUA 1ORIA 4J2HA 4RPIA 5AHOA 3GLFB 5B6JA 3CEPB 1V4BA 1BKSB 3LWNA 5T3YA 2HF2A 2W6ZA 5A4IS 3IIIA 1W52X 2W6JA 3V6LA 4BNUA 2X0JA 1W34A 4O4IB 5HRAA 1QNLA 1SXGA 1SIOA 1T5OA 3DDSA 1VLQA 2XQFA 5D85A 2O20A 3EXFA 1UJ4A 2EQ5A 5FADA 1MW9X 5H4GA 3MTIA 4OQEA 2XNSA 2M1XA 2GVNA 1XU9A 2WSSD 2PS9A 2FG7C 1OVMA 3HB7A 2RJ3A 2XLCA 3PUIA 3IHTA 3KKMA 4NZYA 2BOVA 2OCKA 4H7DA 1ZOSA 4JYCA 3W79A 5JTTA 4KGXA 5DSTA 3RD5A 3R77A 3JS5A 1IY2A 1XTKA 2CD7A 3ZN2A 5KJ1A 3SZRA 1L4UA 4G5XA 4INAA 3O3MB 2A0XA 1GPJA 4ERXA 3WHLA 5FEMA 1NBMD 3JQRA 1E0DA 1H23A 1I3OA 1UFKA 4R1TA 3OTIA 1K7FB 1JR3D 3MIIA 1GPLA 2R8OA 4U2GA 1GGKA 1VM6A 2B8JA 2P4HX 3EBLA 1FL9A 1OCEA 4ZT5A 1X3LA 5LXTF 3STWA 3ZXIA 4EG8A 3RSCA 5LQDA 3ED5A 4DPMA 1SIBE 4EW2A 4E31A 2FSVA 2PYZA 2Y0BA 3RFUA 3TW8A 3QJ5A 3B1KA 1MABB 5IH3A 2JGJA 4RJJA 1HDCA 1KXZA 1NV9A 5IEBA 5JYEA 3FLEA 3B2QA 1V71A 3CH4B 3F6PA 3GJ6A 2QN3A 4OX9B 1REQA 4BNZA 1CY2A 5BRAA 1H66A 3C6BA 1QXSA 4EZBA 1CP2A 5HZMA 5F76A 3BDIA 3PC4A 4C0WA 3KQQA 4Q12A 4O1IA 1VPDA 5TPZA 1BWRA 1DJOA 1D2GA 4WOJA 3T4PA 2R6DA 2WKQA 1NI3A 3HMQA 3GGCA 2PBFA 1EWVA 1Z39A 2QUZA 1CY7A 1JKFA 1LNZA 2FPIA 2G9VA 2PRSA 5I8WA 1ECBA 5DZSA 4ZO7A 5GV8A 1Y6ZA 3HO8A 3H5IA 3ROQA 1SNYA 2SNIE 3PC3A 3L9XA 1IQ0A 1Y6GA 5HF9A 1RJFA 3PJGA 3PE4A 2JL1A 4LHSA 3UB3A 4DNPA 4BFYA 4GX2A 4WBXC 5ALNA 3SXJA 3K5HA 1CYDA 1L7XA 1NQVA 3M6UA 1E6WA 4N54A 3QYFA 3K70C 3KBBA 4Q9KA 2P2SA 3HKEB 1L4KA 2CVPA 3N8KA 3I1JA 4OM8A 4DCVA 2ZWPA 1SEPA 5ECWA 2O8DA 4YPOA 4DC9A 4FM9A 1WCIB 4ZHSA 1QB8A 1UBOS 4LPSA 4OQQA 1CQWA 3TW6A 2VHXA 3GNSA 4HSGA 5GMOA 5P21A 4AN1A 1YS1X 3OO1A 5FPHA 3ZCSA 2CBXA 3CX8A 4Y0AA 1WCIA 2BMVA 4WJKB 2VBIA 4G89A 3KX2A 4YAEA 3K9QO 5CDFE 5FFNA 2HHAA 3AOGA 1N36B 4LSGA 4HUJA 1KBQA 1ZONA 1SIUA 2YMPA 4M1WA 4NWIA 5DWDA 3TOXA 5K1ZA 2CFTA 2FUNB 1Q16A 4K9NA 2V9ZA 4IWYA 4NPCA 5I7UA 3B48A 3D1LA 1Z36A 4TLCA 4Q3KA 3RC1A 1GOTA 3G2HA 4M55A 5AO9A 3C3EA 4YALA 4EZEA 2P3LA 4ZV9A 2H1FA 2RAUA 2OBYA 4NBVA 4FKMA 3DFKA 1NN0A 4G0XA 1K66A 4YA6A 3VVCA 1T8SA 2YBDA 4OHZA 3N05A 1FX1A 1P6QA 3D8TA 3OFVA 2OT3B 1C0EA 1NLUA 3H2KA 4KQWA 3UGKA 4ABYA 3IFSA 2IDZA 3TD6A 4LY3A 4V0LA 2Z2JA 3D2AA 1E9SA 1KDVA 2I4MA 3IB3A 3JAKA 4Q7LA 1TL7C 2VCHA 2NZ8A 1IM2A 4YYZA 2G1UA 4NJEB 2FE4A 3QEBZ 3P9CA 4XX0A 3B9QA 3OQ6A 1X92A 1BDMA 3S68A 1EP1B 2XYQA 1UOOA 4IGIA 2C2HA 1SBHA 3IR5A 4DLPA 2PEZA 4NU0A 3EY9A 4I46A 1I8TA 5ALJA 4FYXA 3JV7A 4NOKA 1J00A 1C3EA 4C06A 1XCJA 3JZDA 3E70C 2VJLA 1X7WA 2QLNA 4PM4A 1XD2A 1WXEA 1ESNA 1M1YE 3JRNA 3L0IB 1I3KA 4IIJF 3W5AA 3LLVA 4FTWA 2I62A 1P31A 3BZWA 4DDUA 1I7DA 4OFBA 1PZXA 1MEEA 3ZD9A 1KWKA 2H0AA 1YF3A 5H3CA 2DCUA 1MIOB 2A9JA 1A50B 3EVTA 1UJ2A 3TZBA 2K87A 2AD5A 2ZDGA 5EERA 5HDBB 4BO3A 1NVVR 2R6ZA 4QUEA 4DUPA 3B3AA 4KNWA 1T36A 4UATA 1PQUA 3EZFA 2BI8A 4Z86A 4FPXA 2DHDA 4HFRA 4R0NA 4U7HA 4YMSA 2VDWA 5EIFA 3SM9A 4LYGA 5T41A 2XF8A 2OXTA 2WUVA 4DR1B 1KJQA 2W0SA 3OZWA 4L22A 4REQA 3ZC3A 5TLSA 1XWFA 1UK6A 2XCUA 3HQ4O 5EPUA 4G6ZA 5KIAA 1L7QA 1EB8A 3MUOA 1B26A 3I6IA 4HUTA 3EEOA 1A88A 5THXA 2X77A 4QYXA 1U6IA 3A4IA 4OHVA 2YRWA 4RTSA 4UFPA 1N8SA 1PUJA 4EUEA 3P4XA 4YXWD 4HDRB 3RKUA 1L1RA 3LY8A 2QRGA 4MJ3A 4XLLA 1VI5A 4R2KA 3F3SA 3NR2A 5U4XA 2ZP1A 4ZHQA 3I1YA 3HN2A 4Y6SA 2R0QC 1JR3E 1PI3A 1TLLA 1YIAA 3F98A 4JC4A 5JNSA 2CLFB 1XU7A 2PD4A 1KSFX 2Y1XA 3Q72A 4Q19A 4BFTA 1OLUA 2Q7XA 1JECA 4S0ZA 1EJ6A 2OG1A 3C3MA 5HKKA 3SC4A 2CLOB 2UUPA 2FN3A 1D1PA 1BKDR 3MIZA 4GDMA 2GA8A 3ZH9B 1QUFA 3JASB 4QGGA 3RPEA 3R4VA 1NSFA 3DZJA 3IP9A 1TK9A 1TTQB 1ZCFA 5JLJA 3O1IC 3CF4G 1ZMTA 4MR9B 1ZZGA 1ENZA 5FJIA 5JSHA 1R18A 2HMVA 3WQRA 2CFCA 4JROA 5JY1A 1W0CA 5TPZD 2CUTA 3F2VA 4UJ3A 4YMVA 4TTTS 2C8LA 2EKPA 1KQNA 3K6SA 1AQUA 4J0DA 3P2YA 3U4MA 3OOJA 2EFGA 2DQSA 2C96A 2HLNA 1U3VA 4HZUB 3KK0A 3H2BA 4MX8A 5J4HA 2PR7A 2C9OA 3L4JA 1YACA 3O4IA 4H3KB 3L40A 3ST7A 3QBVA 2UXDB 5J59A 2VJAA 1TMYA 1FMFA 4RQBA 4HGNA 2E5WA 2F64A 3CX6A 5DW3A 4ZQEA 4DA7A 1WWKA 4JI7B 4J0KA 1G9XA 2G5CA 2P4QA 2BEJA 4U3JA 4AZTA 4M54A 4I9HA 2F8MA 1DB3A 4TS4A 1J2JA 2CC2A 4LIPD 2G0TA 3WAGA 4QYIB 3L1JA 3VR6A 4ARZA 3HCAA 1MAVA 1N5DA 3VC1A 5LP6B 3LVBA 1P80A 3GDGA 2YW2A 5LQAA 4HVLA 3L04A 4LS3A 4NZOA 2V7GA 3RYFA 3IT2A 3ND8A 3OF5A 2H4HA 3IUNA 4Q82A 2CVZA 3Q11A 4X41A 3M3DA 3TFQA 5C7YA 1Y6FA 4FFVA 1MFPA 2JHAA 3OOSA 4NAUA 4QOHA 2XDQA 4WY5A 3T3EA 4DLWA 4D4GA 2JBWA 5ALTA 4JMLA 1FDSA 2XGOA 3BD8A 1UH5A 1VIAA 2BY4A 3VUEA 1NP7A 1IXSB 1XK6A 2RHWA 3KZCA 1U4SA 4G5SA 3Q7TA 4P7KA 1G5RA 1NURA 3P2EA 2JFGA 2R3SA 3O8LA 4ND3A 5IWCA 5BYBA 3X1DA 1YC2A 2I33A 3OJEA 4JL8A 3WGJA 2DUUA 2C5LA 1Z28A 4LNUB 3WDLA 5DI3B 3WJ2A 1KEPA 4O08A 1P5JA 1LVGA 1XROA 3AP1A 4K0RA 3S7TA 2RC5A 4Q4JB 3W9YA 1Y34E 1L3BA 3EQZA 3K9CA 2PTGA 1FSGA 4RH1A 3QE9Y 2W6JD 4OLHA 3M3PA 4L4SA 2E4WA 4TMYA 3ACDA 3RVPA 1B0AA 1ZJ4A 3PQCA 9LDBA 2VQ3A 1CE8A 2D5LA 2Z4RA 3C8HA 3KXDA 2QT1A 5GVSA 4A8JB 2V1UA 2QHXA 2QTVB 1UXOA 4IDBA 2PZKA 4ND1A 2ABWA 3IJEB 4DQLA 3CZCA 2KB0A 3MGAA 4R40A 3GAFA 3I9JA 4HS9A 2P1DA 3AFOA 3FTPA 5FTNA 5B5SA 2BSAA 1FW6A 1Z6QA 3FAKA 3V8VA 2P40A 3BAFA 3ZWCA 4G1FA 3IDQA 3FCEA 2J9RA 2D06A 5SY9A 1KJ9A 1AXEA 2I91A 1EWYA 1U0RA 1T5SA 2GYWA 1ZCZA 3N75A 4H3HB 4LK3A 5DBIA 5FOTA 4XVUA 2Q21A 2V5UA 1CLEA 4X0EA 2X0RA 5JFTA 4F3KA 3TVTA 3EYAA 4NMLA 4W1PA 1SKQA 4YT8A 5GZ3A 3FUUA 1Z8FA 3L92A 3MRSA 2RG1A 1PR6A 4CODB 1V37A 4HB4A 1D2RA 1LF0A 4UNNA 3MJSA 3WLSA 5JXGA 4NXNB 2XGGA 4CF5A 1PV1A 3WLMA 3OE7A 1YR6A 5E6UB 4YRDA 5E0KB 3L7BA 2ZI5A 3DKRA 421PA 2FKAA 1L1EA 3FXAA 3VKFA 3VR4H 3O4FA 5AKKA 4BDSA 4C5CA 2FUKA 2N47A 4ZO8A 1EFVB 2RK4A 3Q3HA 1ZI9A 3DM5A 2NU7B 4MUIA 4NL4H 3T3OA 2IFTA 3ITNA 1L4MA 7GPBA 3WYAA 4FGWA 5IBCA 1E2DA 3AUSA 3C8MA 4H7IA 1AHHA 5DLPA 5CT4A 2NU7A 3VHXA 5FRDA 5C5CA 1OYVA 3A6FA 4LNHA 1USIA 1SRQA 4ZI7A 2PMDA 4ONEA 3UK2A 3R6TA 5DKFA 4WW0A 2QA5A 3FPFA 4PIMA 1EFPA 3HXLA 1NJGA 4MPRA 5BQPA 2H5EA 1TM7E 1ZH0A 1TU4A 3TQOA 3OEED 1FDIA 3QP9A 4KB5A 4ZOLB 3U7IA 2R25B 4A9AA 3R7NA 3QA3E 3MK31 3VX3A 3ZVRA 3SIWA 3WNDA 4NS4A 5M04A 1WHSA 2OESA 2XD4A 4XYBA 4BCDA 1PJTA 1EJ0A 5B58C 4OFXA 1BU8A 4DBVO 1MO4A 2C3PA 4ND8B 1VSUA 4OJQA 3SSNA 3V1MA 2HF9A 5TQ2A 1XYGA 1SA0A 4C7BA 2JPDA 1UP7A 3B9RA 2PKQO 4BFUA 3KQOA 3WGTA 2DLCX 3ZW9A 5IP5A 1PR2A 1YE5A 3D4IA 3O1JC 4G24A 4GS5A 4NQRA 3T54A 4D8YA 2IWHA 3ICEA 3JCZA 1YE8A 2CHFA 3HCFA 3VRHA 2NO4A 3GBPA 5T6MA 2FQQA 3L7JA 1IG0A 1FNDA 1NFRA 4X93A 5LZ7A 1GUDA 1X1TA 2QN7A 2V6BA 5COBA 4G4SP 3RKRA 3ZCVA 5KWEA 4ITUA 1X42A 2ZSEA 2AJ8A 4EHDA 2PL5A 5JMTA 3AKZA 3O2NA 1DKOA 4WKNA 1HDXA 2X9LA 3M70A 2LWIA 4JJGA 4YV1A 1ONPA 3EUEA 3QFSA 5J2TB 4NTZA 5JXJA 1Z4LA 4K6FA 4QGBA 4A16A 1WOYA 4OL9A 2XUFA 5KBYA 2VSYA 4C7OB 1LQ2A 1G4UR 5TC4A 4BWVA 4K9OA 4NZMA 1Q7EA 4PAWA 3X2FA 3VZBA 4UUNA 2IWRA 5C9ZA 1SG0A 2B6HA 4PY2A 3ZBPA 1RJEA 3LZDA 5CW1A 2OV2A 3QLUC 4HJXA 1E8NA 3TGPA 2JBAB 3HL4A 1ODTC 1PVVA 2QU8A 4BL5A 4MICA 3UH1A 5HIJA 1EM8A 1CVLA 2JANA 2B25A 1UDWA 2QTNA 5H82A 3BERA 2GB4A 3EGOA 2B4KA 5CP8A 4U02A 5BSTA 4FBGA 4IDNA 4PCLA 3V4SA 3EGDA 1ZUD1 2DR3A 3QXHA 3L6DA 1JFRA 2WZBA 2ZR7A 1QFZA 2V97A 1C29B 1SU7A 2OHIA 3OCCA 1DTWB 2GJKA 2XZPA 4AUNA 3PVSA 1JLKA 5U1PA 5KWVA 5LKAA 2C7OA 1FUEA 3NC0C 4XRRA 4DTIA 4RJIA 4YECA 1GQSA 5ILQA 1EG7A 3FCXA 4G84A 4NCIA 1MC8A 1SD2A 1X7HA 4LTMA 5JNTA 3FDIA 2G1KA 4FD3A 1Y8RB 3G5TA 3Q3EA 5ALOA 4ZK6A 4B3DA 1BN6A 2JGIA 3PS9A 2J0QA 2WE7A 4O2BF 1EXDA 4DY4A 4YHBA 2FW0A 1CHNA 1N2CA 4YV7A 1QGED 4QHTA 1QX3A 4QTTB 4Q93A 3AJAA 3LMKA 3LNTA 2B0JA 3A1FA 1L8XA 1DQZA 2ZCVA 3HE3A 3VTFA 2FFBA 3DD1A 1E59A 1B7GO 2VP6A 4AQYB 2LGJA 1S3IA 3TJZA 2H48A 4I9UA 2HWWA 2CDAA 4TWZA 1DO8A 2DHCA 2J30A 2HUPA 1Z6GA 3N5CA 3RADC 3W2TA 2O8EA 4KXUA 3SXPA 3CG0A 4IKOA 3LT4A 2YASA 1L7RA 1FX0A 1SVWA 2ONKA 4AJ4A 3KAQA 4YROA 3T94A 3VNAA 5FO1A 3WWZA 1I94B 3LT5A 1GDTA 3SN6A 1QGYA 4NZ9A 5CBPB 1AZWA 4YPFA 1PCXA 3D8UA 1KFCB 4MQEB 1K6MA 4PCAA 4B2IA 4AC9A 4EJ6A 5M29A 1Y1QA 3L7DA 3A58B 3UTCA 4YREA 2Z1NA 2VLIA 4O63O 1AK9A 4B9AA 1QF7A 1SK9A 2I2BA 2A5LA 4F84A 1Y4AE 4CMKA 2WHPB 2QN6A 4F93B 4MB6A 1RKQA 1K92A 2YXDA 1QHEA 2OPHA 4WESA 4A6EA 5F52A 3L6UA 5L9AA 3L0CA 4QEDA 2O2YA 1RZVA 2C0QA 3DCJA 4GMFA 1FFHA 3M6MD 2C3OA 4N39A 5LQRA 2NTNA 4H27A 4FNAA 1JHVA 3KB8A 1T8WA 2XCTB 1Y4UA 3PIDA 1U5BA 3K9FC 1HFKA 5B2ZA 4PFSA 1SR8A 3CBQA 3D8BA 4H1TA 4J0QA 3BBPA 5DV9A 3AR2A 2F8TA 2B9EA 2AMJA 1N4DA 2DFLA 1VIDA 4A0QA 2LXNA 2CLCX 2WKRA 3KL2A 3LHFA 2GTHA 5CHYA 5IYZA 1ORDA 2GUGA 4NV0A 4XM0A 1F0KA 2PZEA 5CFZA 2ZIVB 5GTDA 3UAWA 1FMLA 3CZ4A 3HCOA 1ZD5A 2KWIA 4NBTA 1LI4A 4QQRA 1P2BA 1IXYA 3K31A 1ADJA 4GLBA 2AI2A 2D5CA 3EQ7A 4KN8A 4JBNA 3RFXA 1M5TA 2F2TA 2WYWA 2YOGA 1V0JA 4D7AA 1C9MA 1M7HA 1RFGE 1SELA 1E79D 2F1KA 1DPFA 4RKFA 3PWTA 1PWEA 4X1YA 3ZE9A 4C29A 4G0NA 1RHKA 2QLMA 4DYHA 3WA7A 3SSMA 2V4ZA 3TECE 5AK5A 5K3FA 5CYPA 1LB1B 1Z0ZA 3AHCA 4RNCA 3FYSA 3F5SA 2HDNB 3MG9A 1DRJA 4GKVA 4CF7A 1SUEA 5I51A 1XRPA 2WNSA 3H2ZA 2GAIA 4N7BA 1DFHA 3EC1A 1ITZA 3UAVA 3OHPA 1EVJA 4M9UA 4Z3OA 2QJOA 3GLVA 1XZMA 4OSPA 1C9DB 2BEWB 3AV0B 2R48A 1WPRA 1YQEA 2IIVA 3BTUA 2Z6UA 4C7XA 1KRXA 2IHUA 4KPUB 4J94A 6AT1A 2VKQA 2WWTA 3R0JA 4TL7A 5CNKA 4ZZ1A 1GTVA 2JJ8A 1LSUA 3MAJA 4Z4IA 2PGIA 5EMLA 1GU7A 2WD8A 1NSYA 5ITVA 2EF1A 1II8A 4LOKA 2B4QA 5AP9A 4LQ4A 4B2YA 2QRNA 4H0FA 1EEXB 5FUWA 3AR9A 2GD2A 5A0TA 3VISA 5FF9A 5F1YA 4M1TA 1UBUS 2BTOA 1P9RA 4MR9A 4P33A 5TVKA 4CKCA 2VZ8A 3TDMA 4CUZA 2OILA 4YK7A 2NUAB 1YO6A 2HSJA 121PA 2XMBA 4LXQA 3AFHA 2RHDA 3E7XA 3H04A 3R2JA 3DOOA 3STXA 3DWIA 4P5DA 1E7SA 2OOSA 1CUCA 3A27A 3HJUA 4BQNA 7MHTA 1UKZA 2FXVA 3AHHA 3I05A 1XQXA 4ITVA 4QDTA 2NADA 2PK3A 4FCTA 4L9SA 4UAGA 4B85A 4LF4B 1QF6A 3MUFA 2JLZA 3QX3A 1JFVA 3OE1A 2C5HA 3PC8A 4ETNA 2EKBA 4W1RA 3AX6A 4PAMA 1Y81A 4IMPA 4RZHA 3HYLA 5C80A 1KDOA 3N0TA 5ERYA 3FJOA 2IV7A 2YW9A 5GGXA 1Y8QB 2YZMA 4E07A 3VNUA 3DH0A 1YB4A 5EJFA 3WDKA 2OCYC 1S6YA 3JWEA 5E6RB 3URMA 2PL3A 3W5SA 4L72A 4CF6A 5I01A 5LP6A 4JLUA 2JGLA 4TZTA 1G7TA 3TL6A 1FJ2A 3OF2A 3H1FA 2ACKA 4OJTA 4P93A 3PI7A 1UMDA 3QE0A 4PZ0A 4Y1RB 3WGQA 4Z54A 3EGXB 5BVHB 1SK8A 1T5HX 1EUQA 4S04A 4JXJA 3OZAA 1VHQA 3SPXA 1DBVO 5DT9A 1ZCAA 4DMGA 1F9AA 1WABA 4X66B 2OVFA 1FK8A 3RAJA 1QQTA 1EK1A 2H1LA 1IE3A 1NVKA 3GFOA 4F4IA 4HG2A 3FMOB 4G0UA 4IF6A 2VDOB 1NI5A 5LD2B 4K03A 3AVTA 3GNLA 1BXRB 4UDXX 1ZR2A 3VH1A 1LY1A 4DY6A 3AVXA 4GC9A 1GCAA 1PV4A 3FCOA 3R3ZA 4E46A 4LJLA 4ZAZA 2WW8A 1W0JA 2NNLD 3DOEA 2NU8A 4XIGS 3OAAA 2IU3A 3HJGA 4QC2A 5D01A 4F4HA 2R00C 1M54A 1OD6A 5J63A 3ONNA 2WM9B 2W8BA 2Q1SA 3N5KA 1WEKA 3IUBA 4U6SA 5FLYA 4R1UA 2PH5A 1U99A 3SQWA 2ZJ6A 2V59A 3BWEA 3ZU3A 3U5ZB 2D0IA 5SYNA 3OH8A 5IM4F 3BXGA 3V33A 3K0BA 3WRWA 4UUOA 4FX2A 5DN6D 4W5WA 3FOFC 4YP1A 1PSDA 4ZI2A 5L3QB 3C87A 1XRRA 4R9UC 5G3YA 2JFNA 2H59A 2Q3JA 3A32A 2FQ1A 2R6AA 3AIKA 4IS2A 4IZOA 4JJ7A 5T6BA 2FSVC 3ZW7A 3CT6A 4A8PA 2L0XA 3OTHA 4LQDA 2I3BA 1JPNA 3NTQA 3ZQJA 4FN5A 3DF9A 2HLDD 5TVGA 1WZUA 3W3AA 3EUAA 2HBZA 1CFJA 2BEUA 1XDDA 1XDUA 2GMWA 3BTOA 3FROA 3UTDA 2YYZA 5TRTA 2PLAA 1QOPB 3T3DA 1NW7A 1NASA 3PUWA 5CDYA 4LMPA 4IV8A 4Z4GA 3FOBA 1FP7A 5ADUS 3K16A 5CX4A 3FFTA 4F9TA 3E9CA 5HCIA 2GZ3A 4QTZA 4RM3A 3A0RB 4JBGA 4LXTA 3RSZA 3ZVLA 1HEUA 2EKQA 3JSXA 2Z08A 4IX9A 1GKYA 3QLVA 2AHOA 4YMHA 3DZIA 3BJMA 4ZCRA 3RS8A 5LQJA 1XG5A 1ZD3A 3G6KA 4TVBA 2XITA 3G2OA 3SR0A 2LCFA 1AVTA 3H3FA 5KU1A 3EPRA 1NR5A 1WW2A 2VBFA 4UDNA 5EYPB 5DF1A 2GM4A 2A3RA 2R1ZA 4RVNA 4ZMSA 2H3HA 4FWIB 3PKJA 1PJSA 1TC1A 3LTNC 1VA4A 1BD4A 4Q3OA 1L5VA 4RLQA 1VG9B 3HBAA 3SE7A 2QN8A 1UK8A 1XCMA 2W2MA 2HR1A 4C4SA 3UQYS 1HFJA 1NBMA 3PRYA 2PJDA 3OFND 4EBBA 1OYOA 3WGMA 2WAYA 3U1VA 3UPDA 3U4DA 5B4TA 3PJFA 3WWEA 4JEMA 4HRAA 4XVHA 3VSAA 4IILA 4O4LB 2Y76A 1L7PA 3THSA 5JSZA 3CY6A 3EOAI 2Q62A 3I6MA 4CGZA 5JBQA 3W7BA 2C9ZA 2FOLA 3HFRA 3QMVA 1DFIA 4MCJA 3PGKA 4FJ2A 2Q3FA 1Z0FA 1IIBA 3TVYA 5HFAA 1NM5C 4AZ0A 1SOVA 2IX9A 5EJ7A 1WJGA 4A0RA 1Q20A 4UM8B 1ZN9A 1SA0B 3WB0A 1M2VB 4B3HA 5BQFA 2IHVA 2ZI3A 2I6GA 3CEHA 4NF2A 4XAQA 3RVNA 1NKSA 2UYCA 3MF4A 1GPUA 4CN8A 2FEOA 4ZDKA 2XXBA 3ROFA 3PQ4A 4XCXA 1OV4A 4HNSA 3KJQA 1NUPA 4TUYF 1UMCA 4ZALA 2RHMA 4EMBA 2AKYA 4ARIA 4R9VA 4AMYA 2IS1A 2FP3A 3H5TA 4NATA 1TAQA 1E3WB 1H8ED 1M1XB 2W37A 5DLDA 1EXVA 1WBBA 2GZMA 2P7IA 5C34B 3T9EA 5BV7A 3FYCA 3N0WA 3VNVA 3LKVA 1XCGB 4C0SA 5I7OA 1Z56C 4EWLA 4N0PA 1FPMA 3ZIUA 4IGFA 3CXRA 1TK2A 2VWQA 3B52X 4YNBA 3RSLA 3R09A 3P9XA 2GA9A 1P0FA 3KRTA 1QV9A 4XZ3A 3ZHTA 4UU8A 3LYHA 3U9TA 2R4TA 2ZRPA 3RT1A 1CR1A 1XR3A 3MPOA 4R0MA 1F9EA 4D3ZA 3X2EA 1HG0A 2PNFA 4GWKA 1E7QA 3ICQB 5KYWA 2GILA 1FLAA 5IVDA 4FYIA 4TZ0A 2Q46A 2NV6A 4OFWA 3M2PA 4YRZA 4DDVA 2XZTA 1A95A 4UKDA 2CY0A 3D8HA 4OKNA 3VPSA 3DLPX 4BE4A 4ZAWA 3RRZA 1P9LA 1M6EX 4BFSA 5BSEA 1F6WA 1YFJA 1SPXA 4OHMA 4R98A 2ZRHA 4J6FA 5HHTA 1QYVA 1EFDN 1P7WA 4KKXB 4P54A 1QCYA 1YULA 2R5WA 2W2VA 2G70A 2FPMA 3JRWA 3PQFA 3WI7A 3KIPA 1NPTO 3CN9A 4MHOA 1ZOLA 1RAFA 1AKNA 3PUXA 1W75A 4CM1A 1D6NA 2JK1A 1JNYA 4DEYA 3NASA 2EARA 2PUFA 4J03A 1M34A 3MILA 1RAIA 1Z5PA 2VDJA 4H4CA 6NULA 4TXLA 1FTWA 2XE7A 4KE7A 5AVZA 4OJYA 4IQGA 2Q5FA 4HN4B 1OX4B 4XPIA 3CLUD 3DFIA 1K2WA 1P9OA 1TM2A 3CNHA 4YI3A 5A06A 3BMQA 5FDFA 1QYRA 3HO6A 1PEYA 2IS6A 1CRPA 3UYLA 4D0GA 4CKEA 4N9WA 3IUJA 3R3XA 4G8BA 2PRKA 3ER8A 1MO5A 2Z2ZA 2MOKA 1WXQA 3AEUB 3FNBA 5FUBA 1TZBA 1XFAA 3ICPA 3ETJA 1ADBA 2WQZA 3G2PA 3GCGA 3CUKA 2QLJA 1NV8A 3P4UA 4GYWA 1Z6PA 1IY1A 2A1UA 1LJUA 4FMCB 3B6EA 4KN5A 3QU7A 4W7IA 3WRYC 3AEUA 4D99A 4O25A 1BHSA 4CMHA 3FRHA 4C5BA 4KIUA 3GLGB 1D0IA 1ZD2P 3AC0A 1VPVA 3C14C 4JVNA 4AYXA 2JH3A 4NZPA 2QZ4A 2XODA 3CKYA 5L3ZA 3TLAA 1R4AA 1QRTA 3AR6A 3E1GA 2GXAA 2G82A 1EJBA 1JRLA 3V9AA 5A1TA 4CM7A 2AJDA 2NO1A 3QW2A 4PRZA 1XZAA 1TK3A 3CZQA 2VP9A 5K8UA 2AR0A 4N6OA 2JZOA 4M9CA 4BQPA 2AIRA 3OPYI 4B76A 4JZYA 1YZHA 2PKRA 4MS4B 3MMXA 5BV1A 1SKAA 4IHJF 5EMNA 4DPLA 4NEHB 3J7AC 3L6CA 3VU3A 1JE0A 3ZV3A 3S8EA 4CXMA 3P19A 3G88A 2ODTX 4MA4A 3WMEA 2D2IA 2VNHA 2YVUA 2G80A 2ZTVA 4MGKR 4PC7A 5F33A 3I3OA 2E37A 2FZLA 2WKSA 5L8VA 1JAZA 4YDRA 5K3AA 1DOAA 4DM7A 5CXSA 4EYGA 4LYHA 4PTYA 1GKUB 3DM9B 4M0EA 1I3CA 4DJFC 2XZDA 4ITRC 1HT3A 3H9QA 2I65A 2J4CA 5JJKA 1CQXA 3NGLA 2DWUA 1I1NA 2OK8A 5JG7A 3RJ9A 4JXZA 2WM2A 2FX2A 5K0FA 4MPPA 4Z9YA 2H5LA 2VZ0A 1Y8RA 2IYRA 5DBGA 1DDGA 3OLQA 3LF1A 3RK4A 3VPFA 3Q0EA 3W90A 1CD5A 4PBTA 3H2GA 4V2IA 1TC2A 3U4CA 1O96B 2VYVA 1XRMA 4U9HS 5G1NA 1X1QA 1IRXA 1N2CB 5E7MA 2D1TA 4ZOBA 1RZ3A 5CPFA 5FBQB 3TLKA 5GINE 2PDAA 1OXMA 4KIGA 2GKOA 1RKUA 2XDYA 1KAHA 1MCZA 2XTMA 2NZUG 3BHNA 4OXYA 4P34A 4BCBA 1NNLA 5I7WA 2WMNB 2YS7A 1K5GA 2DFTA 3JYOA 4J7XA 1J23A 5B3LA 4QPZA 4NDZA 1YZKA 5LQMA 2EBUA 4NH4A 3RKSA 2V0NA 1ZM4A 3IYLW 3PD1A 1YFKA 1V2HE 2IYPA 3EIXA 3RFVA 2YFHA 1OZ0A 3WQHA 1GUYA 4MI3A 3JZFA 1ZN8A 4DABA 1U2GC 2FR1A 1CQIB 2IXGA 1AOXA 2BKXA 1LX6A 4L75A 5F73A 1W6RA 3NVDA 3L4KA 3RC7A 1G8GA 1E9EA 2IHNA 1MQ9A 4FFOA 1UQUA 2WOJA 4FYMA 1ESZA 2BFDA 4HFMA 3SGLA 3FI0A 1D6MA 4EKIA 4F6CA 1RXWA 3GNTA 4II7A 4KLZA 1BQEA 1FVXA 1SQ5A 2AVDA 2J32A 3SC2A 4JELA 3LY7A 4ZO4A 4F71A 2RHJA 4ZODA 3IP6A 4EUNA 3FHJA 3O47A 2VDNB 3M6IA 5KVQA 4KR9A 1XEWX 2B4AA 3PDWA 3CRZA 4HYEA 1NOJA 2GZ2A 2QGFA 1MG0A 1V3TA 2H4JA 4NI5A 5EA2A 4R69A 3BIXA 4OJKA 1A2QA 3C3BA 3PQDA 2WF7A 5FWXA 3G0IA 1J2YA 2VRCD 3M2TA 5C8VA 1WQ1R 2YY7A 1WUIS 4JSYA 4OU5A 3X1KA 1VPLA 1XMVA 1T34A 3L1IA 1U7UA 3AP3A 4BMSA 1TM4E 2RHBA 3ESYA 2YMQA 3FZQA 5JZVA 4RTMA 1NP3A 3OD1A 3ESQA 5E1MA 5BN4A 1MPTA 1THTA 4PYRA 2ZYVX 3GGOA 3MRVA 2O0JA 3GLFE 4X62B 4WA8A 1JI0A 1WZ2A 3BFPA 2UYQA 2OC9A 4HNRA 5JPCA 4PCUA 3HN7A 4EB8A 5KOIA 4LRQA 1Q1AA 3ENWA 4CEIA 4AYWA 1YQGA 2JDID 1O5IA 1AZLA 3M9WA 2Q3MA 2I22A 3O0TA 4IWXA 1G5QA 4ZKDA 2G71A 4GZ5A 2J6HA 1V6CA 4TWRA 4YP0A 3H2HA 5BURA 3ASVA 4DUYB 2QUJA 4BAUA 3M6XA 3E9RA 1UJMA 2E6UX 3GFBA 5CAEA 5EEHA 5LMUB 4Y2XA 3I52A 1L7MA 3J7TA 3RRNA 2BISA 1R5JA 2OKGA 2OBXA 3THRA 4DIUA 1GQFA 1X39A 2DMRA 2QUAA 5TR9A 1GXSB 1B16A 1A8SA 1E3QA 4IUBS 4WBSA 4B81A 5HIAA 1PLJA 1X70A 4I6GA 2XDAA 3BAZA 1BZYA 3LXMA 4MLDA 5BORA 3I64A 2GT1A 2Y4OA 3IKVA 1WDTA 2GFQA 2YHUA 3T7AA 4PBSA 5CCBA 2CV0A 5DSZA 3LECA 2R1UA 1EWTA 2Q0QA 5LUAA 3H5VA 3GQBB 2GHIA 2POQX 4Z7OB 4MP6A 3PHCA 5IAAA 5EIWA 5HKBA 4BQFA 2FSHA 3P9ZA 3U1BA 4RW0A 2RGNA 5JXHA 1UPXA 4P35A 3WYEA 2HHHB 1Z4JA 3EISA 1R6BX 3GX1A 5HKOA 5LU8A 4W9RA 1H93A 1S8AA 5LYJB 1TFUA 3RIHA 2F55A 1OT3A 1M8KA 1PTJC 3K0AB 1C1XA 2HCFA 2XAAA 3C98A 3IBYA 1VKZA 5C0OE 3WGIA 5HCUA 1HI9A 1E6CA 3ODGA 1WUHS 5LOVB 1RJWA 2O06A 2G4LA 2O57A 3LCMA 2BL4A 3H9BA 3W6PA 1QIKA 1NNUA 4KE9A 4PZPA 5K0GA 3D3WB 4UHKA 4WT7A 3I73A 3WIVA 1DTWA 4DE5A 1EU1A 3D9QX 3I2JA 1H0KA 2HQ1A 4QUJA 2EWVA 3U56A 2EIHA 3AL2A 4OIFA 3VO9A 1I30A 1RWKA 1GZ7A 4CI9A 4MMZB 5GIOE 4O1MA 3VI3B 1G21E 3IERA 3IC5A 2F6RA 1JG1A 1ADFA 1Z7BA 2ZREA 1AE1A 1H85A 3UC9A 2BH9A 2QG9A 1LQUA 3W2HA 2FSFA 4FHGA 3DMTA 1OGIA 4D98A 4KPGA 2HQRA 5I4CA 1PYGA 4JLWA 4FFPA 2AQ8A 4WGGA 1CEQA 3KYCB 1XZBA 1UOEA 3B3JA 1AKVA 1BVRA 3A1SA 4WIAA 2DX7A 3HI6A 4RD1A 1NXXA 1IY9A 4H4EA 3MCAA 4MTCA 1WCWA 3IQDB 4MVCA 3SEQA 5ALIA 2A6PA 1DMSA 1C2YA 2VPPA 1N2JA 2Y0EA 4NOMA 2F4NA 3SDBA 1UANA 2J3EA 2M2IA 2O1XA 3A9VA 3EZYA 4IYRA 1PW5A 1FFXB 5JSQA 1PR1A 3JQBC 3M1YA 3I34X 4TQAA 2Z8ZA 3UOAB 2QORA 4WN3A 3OPNA 2FPOA 4O4HF 4P3NA 2WKWA 4HWRA 1V16B 1Y1SA 4JHXA 3TYXA 5HXAA 1QE5A 4LRYA 4U0KA 2EU8A 1DG9A 4IXMA 1V5FA 1ZH8A 3FIJA 3WJAA 2BTEA 2O8BB 3RRYA 3DXYA 1K3UB 3V2GA 2A67A 3WRYA 4F9EA 5JO0A 3VO8A 2PGLA 1YTUA 5IDYA 1ZJ6A 1SBQA 4I8DA 3SEFA 3VZRA 1U0NA 1GITA 3RO7A 3QJGA 4X20A 3BFXA 4KLRA 1EDZA 1EFPB 3N2KB 4J76A 5E9AA 4JAVC 3UXYA 2IY9A 3VHRA 5EJMA 3WYDA 2VXBA 2WAXA 2RGEA 1UP4A 4BXOB 2HU2A 5ESWA 1QDEA 3TCKA 5JDCA 1OYWA 3E18A 4EO4A 5A5VA 3JWJA 1QLJA 2WJWA 3FBGA 4IXTA 2WP0A 3TLCA 4LBZA 4FIDA 3DTVA 3A9CA 1MQAA 3U3ZA 1M67A 1W2WB 3BE8A 5PGMA 1JLSA 3GY0A 5B7GA 1EHCA 3WWCA 1Z38A 3HVJA 3P52A 2H1CA 3MQFA 2AG5A 3QFTA 1AGPA 3W8DA 4LJRA 1DAEA 2PUEA 3NFRA 5IJZA 2P3QA 4IQ8A 3KFLA 2B1GA 2VK4A 4Q4LA 5DXFA 2YJZA 1QSGA 2QAGB 2ZVQX 2YL2A 4PZAA 3WLTA 1EFKA 4LW8A 3IE1A 4PLZA 2JFUA 2YV2A 1ODSA 4ZEVA 1JEDA 1UXJA 1A9PA 3NIDB 2V4MA 1RI3A 1ISPA 1CDZA 2C4UA 3LX6A 5FPPA 1P7PA 1F2UA 1UFOA 3OVMA 3WWPA 4GH5A 2CHVA 2GAAA 4CNBA 4P3XA 3E5NA 1VSVA 4XR4A 3BH0A 3DVAA 2BKVA 1JSCA 4JOQA 2CNBA 2HMYB 4JL5A 4KACA 4XGRA 2F9FA 1SZDA 2H92A 2NG1A 2QLFA 1M72A 3CKKA 3DEHA 5D8DA 3UMFA 4EF4A 2OFXA 1CRLA 5JADA 2Z2IA 4RY9A 1Z2OX 4NYIQ 5AIAA 3SLRA 2CE2X 5ADWA 3PDIB 1H6CA 1NR1A 2WSLA 4CLXA 4NENB 4WNAB 3C1UA 4H31A 4F7DA 4YRIA 5JYCA 3W8EA 4DR2B 1SXPA 2TS1A 3PUVA 2KPOA 3TCXB 1H3NA 2Z0MA 4HDAA 3Q3VA 1I6WA 4MV3A 2ZYGA 1LZLA 2B78A 1TCAA 1GUZA 3DCYA 1ZA1A 2JI7A 3A28A 4QHYA 1SUFA 5CDGA 3AB3A 4BZZA 1K8YB 1T2FA 2XUAA 2ZYWX 2FZ4A 4WHMA 1PZNA 1UJCA 1Y82A 3WZLA 1IWPB 4M7WA 3LOQA 3LXRA 3ZHSA 3BRQA 2Z4TA 3L5OA 2AL7A 2GN2A 4I5EA 4WMLA 1FNCA 1R12A 3G7UA 3PCRB 1QNFA 1DPGA 1XCPA 5B1HA 1P77A 2MMCA 3E9ZA 4MRVA 4GOLD 5KTPA 3K6KA 1XTBA 1NIPA 2WZCA 3BFVA 2C5FA 4DN6A 4ANFA 1JAXA 3UKOA 3W05A 3W5CA 4BP9A 1E2BA 4KWTA 3EJ6A 1KYVA 4PG5A 1NLFA 4B79A 3REQA 1U3TA 5J40A 1J1UA 4KJXA 4L9AA 4DKXA 4ZZ3A 1G1MA 4YRQA 4C0AC 1LSSA 1N7JA 2ET6A 1KE1A 3WIUA 3AUKA 3I2GA 4L7VA 1QKKA 2GYVA 5E7JA 1E5LA 4NXMB 1GNTA 3CZAA 4BQEA 5IVIA 4LRWA 4WKPA 4CTJA 2X9VA 2ZI7A 4L27A 4YUZA 3A05A 3TAXA 1KKMA 1PR5A 2RONA 1NU6A 1AUOA 1ODJA 3F7OA 2XCQA 4P7BA 3SNKA 3AEYA 1US8B 5IJAA 1OZAA 2DPGA 4CLRB 4J07A 3OIWA 3WMWA 4ZO6A 2VUHB 2Y2UA 5JD4A 1NN5A 5ES3A 2AFIE 3V2HA 2Z6AA 3UT5A 1Y3IA 3BOSA 5HQ3B 1JR6A 4Q1VA 3FCSB 3QF4B 2ZPAA 4E5VA 5KWJA 2HH9A 2ZT7A 1BX1A 3BMCB 4D8WA 5F9FA 3O8DA 2CB0A 1X7ZB 4QATA 4ZCLA 3UMGA 2H1SA 3NUGA 1RE0A 1OZFA 4MUHA 3GFGA 3AEKB 4IOKA 1NZDA 4XWTA 3CC8A 4M9XA 5IZ4A 2ZBUA 3ZGOA 5K45A 1QIEA 5C8YF 5KYGA 4KMRA 3C8UA 1JB9A 1U3CA 3W06A 1N34B 1XEXB 2YR0A 4Q4HB 2GK7A 4HGQA 1Z06A 1OKKD 1PWXA 4QRDA 2O2EA 4XGNA 1UWLA 4O2RA 1ZH2A 5DHFA 1IBKB 1LLFA 3GAMA 3ZU6A 2OMEA 4OX9Y 2EERA 3ZCTA 3QUCA 2PPVA 1QIDA 4MVXA 4HLQB 3LUJA 1GLNA 2R2GA 2A58A 3NAGA 4R5HA 5KQSA 4X1OA 1UJBA 4KRXA 1H0SA 3D43A 3KJXA 1OWLA 1V8ZA 2YZ2A 1C7EA 2HJWA 2OZLB 8ABPA 2RK3A 2AXEA 3UCFA 3VNQA 4CM3A 2BM9A 5H8WA 2H2IA 1A5AB 2JFHA 1SQFA 2OEPA 2FW7A 3B38A 2HPHA 1LDEA 4L5IA 4M7RA 4E51A 1FZQA 1S96A 3IAM1 2OZLA 4NFSA 3C41J 4QT4A 2HMSA 2J6CA 2JFFA 1DI0A 3BKXA 4QOEA 3IAS6 5BWCA 2R47A 3NKVA 3ACBA 3SKYA 4FQ7A 3PX3A 1JJVA 4EJ0A 2BJVA 2FTKE 5FULA 3RV3A 3SHVA 8MHTA 2J48A 3BZUA 1L6RA 1NYRA 2ESRA 3FVVA 1DSSG 1F6BA 3CRMA 1GU0A 4G25A 1GQRA 2OYSA 2NWQA 1MOSA 3IDAA 1KFJB 3RRFA 1C4KA 4RXUA 4CHGA 5BMOA 5IXYA 4DR7B 2Q99A 3M8KA 4R2IA 4LCBA 2XGJA 3ELUA 4Y18A 4IMIB 3K5PA 3AF0A 2XW6A 1E2PA 4GWLA 5A71A 2MIIA 3H1BA 4BUCA 2W70A 1J09A 1GUBA 2NPOA 4XVCA 2ASEA 1QHIA 5G0SA 4UTPA 2A9FA 4ZMRA 7ABPA 2CL6X 3QHPA 2FPSA 3TQHA 1KI3A 2ZRIA 4KPFC 5JEDA 3C85A 4EY6A 3DYIA 1XN1A 3BWBA 4RJKA 2G40A 3VSCA 4F97A 5KNLA 4RDCA 1AN9A 1V4VA 3OG9A 4HC4A 4BRUA 5JALA 1WETA 3O95A 4FX5A 4JBYA 3EVNA 5HUJA 5F12A 1EX1A 5IDQA 4FFBA 2IUTA 1J1IA 4N8SA 4XD7A 2Y92A 1E2FA 1Z13A 3NPAA 4RC9A 4EJSB 2RGUA 3B1VA 4KP7A 4KO2S 3I9NA 1PGJA 3N6VA 1BXZA 2WSMA 4PYOA 4UEOA 1G5HA 2BR3A 2YDXA 3QM1A 4NKRA 3GK3A 2Q8QA 3NHJA 1N3BA 4QSHA 1U1FA 5DM1A 1GPWB 4IMRA 1HKHA 5T8KC 1T1GA 3Q41A 5BNFA 2DERA 1WKBA 2FK8A 1C81A 3HWWA 2IP4A 2D2FA 2Q28A 2QX4A 4NYJQ 3IV9A 2O0LA 5DRYA 1VCMA 2A35A 1ZRMA 1GPH1 3DZKA 4JA2A 4RIFA 3SYLA 1XMJA 1KPGA 2H9AA 2QN9A 3HR4A 1BSVA 3ER9A 2NU6A 2PCLA 1SXQA 3FPGA 1GCGA 2C5EA 4AZ0B 1Q1QA 2A5JA 1H3EA 2PT7A 4YAKA 4OXXA 2DY1A 2E89A 2I6TA 4R8RA 5KMGB 1J0EA 5FI3A 3DDZX 5IZCC 4I14A 5KTNA 4CEIB 2X7HA 3RUFA 2EFCB 3VTZA 1A1VA 1L4FA 3P4YA 4MWOA 1G98A 2HHJA 4YRRA 5LQUA 3SQXA 3C43A 3QF7A 4O4JA 4ON9A 2YYAA 1Z2CA 2O6HA 3C6MA 3L93A 2NTEA 3P9NA 2JLUA 3KQSA 1D4FA 3EXEA 1OVGA 3BGWA 1W1IA 3P9PA 2QENA 1HZJA 3WDSA 3UEOA 2IPAB 4JBWA 4C2TA 4V1CB 1XWIA 4Y2JA 4YC7A 4MUGA 4LV6A 5JASA 4QGFA 1WXXA 1M5RA 4I1YA 4HWPA 3RIYA 1W1UA 4PC2A 3WAJA 2B6NA 4YR9A 4BKUA 4CG0A 1IATA 5FBRB 1J24A 2Q49A 1P91A 5FL7D 2VPYA 1L5YA 5T57A 3OZDA 4DGQA 1XRJA 3ONEA 2X0EA 2RGGA 3VYTB 5C1OA 4DCNA 3H5RA 1DXOA 4LWQA 4OLFA 2B3TA 4CTNA 1NY5A 3FX2A 4QQFA 3Q0TA 1FVOA 5MN5A 2X41A 4RPGA 4R1NA 3TAHA 2WYVA 1HTBA 1GRCA 3SJUA 3VV2A 3DBLB 2GYUA 3VDRA 4G0ZA 4U4AA 1J2RA 3Q1LA 4E4RA 3HV2A 3FPLA 3HJAA 4C3ZA 3KE9A 4PXSA 1JDPA 4RZXA 3KELA 3SJCA 1PS8A 4KQ1A 1CEYA 4QDUA 2JIBA 3O8QA 4V3BA 5TE9A 1BOOA 1J2TA 1NI4B 4W7SA 4YP6A 1FRNA 1PBTA 3ZWNA 2A8YA 3HLKA 5IN5A 4QO7A 4QBHA 5I5GA 3QKSB 1VLLA 5JDIA 4KQKA 2E0IA 1YDFA 3SR4A 3TSYA 5J4KA 1HNNA 1IEXA 2ZYHA 3HNRA 3MM4A 5E2IA 5FA8A 3LP8A 5AM1A 3GRFA 2J9YB 3MTEA 5JAHA 4RPCA 2C2GA 2FGKA 4UBOA 3RROA 3H4VA 1RQPA 3A1TA 5L4NA 4M1EA 4NV1A 2ZUUA 1PJQA 2DP4E 1CUYA 2WK1A 2X9QA 2ZBGA 1L7BA 4IVRA 1BDIA 1LC3A 2QMZA 4K6KA 2E4YA 3PC6A 1ZM2A 1Y8QA 1BDJA 2C5GA 1M0WA 2KQUA 4PCVA 1FC0A 3HYTA 3L2OB 2B7CA 5KHAA 3VR4A 5A3RA 2Y0CA 2CCJA 3CQ9A 3QTLA 2J0EA 3ZU5A 4DUGD 5I9NA 1H9CA 1NE2A 3ABQB 3G0DA 4KJZA 3CUUA 3HACA 2C1XA 5JZSA 2B5WA 2Y67A 2QP4A 3DWGA 1MFZA 2Y05A 3H99A 1B8OA 1CRQA 4XTRA 5LLSA 3HSKA 3RAEC 1DKRA 1MB0A 2ORVA 3GROA 2R7LA 4A6PA 1UBEA 1W36B 5KZMB 4K8RB 5IT5A 1XF1A 4TRRA 3WNVA 4G0YA 4C4AA 4CMAA 1GPNA 3PFCA 4QU0A 2X8WA 1KR5A 1G17A 4RHTA 2D7DA 1XD9A 5EN4A 1OBHA 1V7QA 3AKDA 5LXTB 4JNCA 5G2OA 3WLPA 1IULA 1XELA 2ZQZA 2OV8A 2VF7A 1YFLA 4NCKA 2CBZA 1G9TA 2AOVA 5AHKA 4QL3A 4OBBA 1L3IA 1PG5A 1NHGA 3AINA 4OG2A 2ACWA 3P0EA 3VBEA 3AEQA 4ZQFA 1MW8X 3O7MA 4UDYX 2ZATA 1T9GS 4N8EA 2Y99A 4MVJH 4QUIA 4TLMB 4U1RA 2QRVA 1WDWB 3I8XA 5JY6A 4KLCA 1BFDA 5EHNA 1Z0IA 2I03A 1N2SA 1VKOA 2WEKA 3OCZA 4AJ9A 3WB2A 5LIRA 1PEKE 1T2CA 3BJRA 3QOYA 2YNMD 3QLTA 4L4RA 3CUWA 2NVWA 4U00A 1UM9A 4E5YA 4QQKA 3THYA 1SKUA 3TDKA 1YJCA 3M7IA 2JD2A 3LU1A 4E6EA 3P8ZA 4YEDA 5JI2E 2GD0A 4AZSA 1XMXA 3A4TA 3PD0A 2FZVA 5IKXA 1KSHA 3CUEF 2HREA 3F2IA 3IQWA 2JIZA 4FZVA 4J16A 1JEOA 4L8WB 5IAKA 1UPFA 1JDZA 1P4AA 2LUOA 5B58T 4MRMA 3BS4A 4EENA 3U0VA 5K03A 4G2NA 1VE5A 2O07A 3MWDA 2BEUB 4L85A 1EE1A 1GL7A 4BTLA 3FFBA 4WX2B 2YIMA 2MYNA 3K8ZA 1QZZA 3QBDA 2XSZD 3CWCA 4FB5A 5JJCA 1EK2A 2Y27A 4AICA 3G6WA 3OQJA 2HIGA 1ZYUA 1U90A 2OGZA 3DJYA 3R7SA 3ZE2B 4BJ5A 4BWFB 2BSQA 3ZHQA 4FYJA 4J0GA 1I4OA 3G9QA 4A27A 1SBYA 3WLOA 1TTPB 3TFWA 5CFQA 4IRXA 2R6JA 4G81A 2PLRA 2VEDA 2AEEA 3NDIA 4CM5A 2ONJA 4EI8A 3R0VA 1ECFA 2FY8A 4ZKEA 4E7OA 1CNMA 3BN3A 4OQFA 2QV7A 4ZI7B 3V7NA 3TIGA 3DG9A 5AVSA 4PWZA 2XB8A 1DO2A 2Z8YA 4WZBA 4GXQA 1FFXA 3B3FA 3BD7A 3FNEA 2DTDA 2P90A 3PDIA 4YT5A 2JNWA 2VDMB 3E0XA 4DSNA 5F98A 3HYNA 2XCIA 2IPLA 2VLBA 3UJ9A 3EFBA 4B3MB 4O59O 1QHNA 3DOHA 3I61A 2O2IA 3OTOB 1HE5A 2EP5A 3GBVA 3MA0A 1W36C 5B1EA 4Z9FA 1HZZA 5AJVB 3OJXA 2BCGY 4YJKA 2GHQA 4H16A 4Q00A 1BE8A 4P8RA 2Q6IA 1FTNA 1TMGE 3QV1A 5HF8A 2HMAA 5EQDA 1C9JA 4HS4A 3GJRA 1Z0UA 4UU1A 3UYKA 2O19A 1U2DC 3DE2X 2BH2A 4X3PA 1Z12A 1XC7A 4M9ZA 3H5LA 1IVSA 3CTPA 2J3MA 3GUYA 2OWDA 2WD9A 3FSGD 4PG6A 1SBNE 4JUFA 4D9IA 2WWYA 1B6RA 4TKVA 5JIBA 3V42A 2EZ4A 4INOA 4N3NA 3HJBA 3AUYA 2AXNA 1FNBA 1R6TA 2J0UB 3VU9A 2C3YA 5IANA 3TMKA 3AKYA 1U0TA 1EHIA 2OCIA 4MDYA 1KJNA 1T5IA 2XHZA 2P9HA 4GGMX 3SHOA 3V1NA 4UNRA 3UWMA 1P4SA 3JALB 2FUG6 3QQ5A 4EG1A 2QTTA 4CLRA 1TKAA 1L7DA 4FE3A 2QTGA 5JYBA 4KMMA 3ZHCA 2GDZA 1EFHA 4TOIA 2X5XA 1CUHA 1ZNXA 3W5UA 4GHWA 5KNDA 4PSCA 4Y9RA 3DOCA 2WJVA 2W4QA 2ZCUA 1NPDA 1Y4DE 4A8TA 4DJJA 4C2UA 2X86A 4DQKA 3A4LA 1SCNE 1ILWA 1THZA 4K9SA 3RVRA 3PXCX 3TG2A 4BVBA 4F1KA 4GZ6A 1IM8A 4J9UE 2VHTA 4Z4CA 3EMKA 1SUWA 5C37A 3R20A 1KVTA 3T7JA 1N6PA 1DE0A 4JEIA 4XUCA 4DDHA 1YL5A 3AHEA 3QWHA 1XA0A 3LQRA 4OA8A 2NIPA 5AWFC 4AF7A 4DS3A 4NJEA 2BP7B 4LBVA 1DBPA 1W5FA 3IP3A 3WLFA 1DWQA 2RMKA 1QAMA 2IXEA 4YCCA 4ZVOA 3EBPA 5E1DA 4F91B 2X1VA 3I5MA 4AQDA 2HW8A 3PXAA 1ORTA 1XD8A 3B20A 4Y6RA 5KJ6A 1JWAB 4GOJA 2CXPA 2JAUA 3U3XA 4DDKA 3VKWA 1KC1A 3IAAA 3NOVA 4U5QA 5LFAA 1R2QA 1T3GA 1N3YA 5LZ2A 3M33A 3GCZA 5IUJC 2IYUA 1GSOA 2PV0A 2GKGA 3U19A 1M76A 3W0LB 2JCYA 1GKLA 4L15A 5TGZA 2HB6A 1M1NB 2XUKA 2X2OA 4ZCTA 5JZMA 2I7VA 3CH7A 2UV8A 3GFFA 4UVHA 1OASA 3HUEA 3PYXA 3Q2IA 3MOIA 3Q6NA 2XEDA 4M8IA 4HCJA 4P0TA 3F6RA 1WB4A 4UE3S 4R81A 3B1JA 3F8SA 3JQ9C 5AVVA 3KHKA 2DVMA 4C0XA 4MV8A 2ON6A 1UJ6A 3G8CA 2V7QA 5JOQA 1VGQA 5JQGA 1ZIXA 2DQ4A 1F7UA 1U3WA 2PMBA 1GDDA 2AR9A 3GP3A 2ODNA 3I2IA 4IXNA 1ZGAA 3TRFA 4AKSA 1K5DA 2Q27A 3ME5A 1XA4A 3G7SA 5JSKA 4RQTA 5CBPA 1ULUA 4IJ6A 2F67A 2FMXA 3O2QB 3VBCA 2ODAA 1L4HA 5KTSA 2FMHA 2W2XA 4J2TA 3S1LA 2Z57A 3MJVA 5EIAA 3UXEA 2P79A 3MYRA 4DDWA 1NBEA 1T2NA 3K8QA 1E2UA 1DUSA 5JECA 4EEXA 2NV0A 3QH4A 4TWJA 5HWSA 1V26A 3KTOA 4GWGA 1AUXA 2IYOA 3FI9A 5AVTA 1KVRA 4LJ5A 4UQOA 1F2TB 5ALSA 3ZQKA 3JQCA 1Q0SA 4N5IX 4FFWA 3JQ6A 3ESBA 3B2EA 1JHOA 3PUZA 1SOUA 2VN8A 1UL1X 1V8BA 5JAPA 1Q1ZA 2SKEA 3OUTA 3MJFA 1DOHA 4YJDA 3ZBTA 4JXXA 5CCDA 2IYNA 4NG4A 4GKJB 3H5AA 1E2LA 4S1WA 1Z6AA 2FMFA 3QU2A 4B44A 2IYQA 3WA6A 1WKVA 1E5QA 2QR2A 4E3WA 3TSWA 1M1YB 2GEUA 3A3PA 3H0CA 1XEFA 3ICCA 3BE6A 1NBME 2C8VA 4FFBB 3WTCA 4A6DA 2WJIA 3RLIA 4BQOA 1A9RA 4ROTA 1D4ZA 1HQDA 1NVVQ 4CKWB 2C4HA 3UMCA 3U4IA 3VOSA 3DHWC 1ZIYA 5KS2A 2FFAA 3DOFA 5K7SA 3P2MA 1C7FA 5IRCD 1IN4A 2WA2A 1SBZA 3NUQA 2H16A 3AG6A 3OE4A 4JP2A 4C4PA 3HXTA 3KTAB 1H2BA 4MQ4A 4DCCA 5MGBA 3RJTA 2ZBQA 1Z63A 3LHKA 4ZQBA 5C1IA 2EL9A 2ECFA 5D87A 1QS0B 2YWEA 3PPIA 2CFRA 3I5AA 2VSQA 1KEKA 3CO0S 2HWUA 4DSTA 3OA2A 1P29A 4YWJA 2JGDA 3EGXA 4D2IA 1H8HD 2O1SA 1ZUNA 1QH8A 1OBVA 3AHJA 4KO8A 1M8GA 3LPDA 5ILGA 4KGDA 4OTZA 1X7YA 4ZD6A 1GPYA 3M82A 3CNLA 2DH6A 4HQNA 3INNA 1FOEB 4DM4A 1FVHA 1O95A 4LMRA 2JFQA 3HB9A 1HYBA 3PSHA 3VYWA 2Q4BA 2QYOA 3ANMA 4R8VA 2YFYA 5J2UA 2BFWA 2EAUA 2RKBA 3HBMA 2IY8A 1L2TA 3UMVA 1VQ1A 2O0HA 5KHLB 1S2GA 1U2GA 4EHJA 3PL1A 3ZTWA 3C48A 1BS2A 1LLQA 1I4WA 4TMXA 2A4MA 4TSRA 4WD3A 2JFOA 1I4DD 1Q95A 1G0NA 2OFOA 2QUHA 5FNZA 3WY9A 2RHRA 2WUEA 1VIYA 4TKZA 4RMIA 4YRFA 4ERNA 4CV3A 4KNYA 1E1KA 2J45A 2HBQA 2W2PA 3ON5A 4LOAA 3NC4A 4N1AA 3ZLBA 2QG6A 3ZZ0A 1O77A 1JYFA 3A2MA 3LBFA 4NLLA 1GTJ1 5F77A 1GZUA 4Q5IA 5KQMA 1RS0A 4WNIA 1OC4A 3I8SA 2YV5A 5CFPA 2PZGA 3CLTC 2ZE7A 2BKUA 1A3CA 5ERXA 1T10A 3KNZA 4XDYA 4F6RA 1FU4A 1TT7A 3KDAA 3GFVA 3S0JA 2W9XA 4WY8A 3VH4A 3VZDA 4PQEA 4EVRA 5ANRB 1RLIA 4PO1A 2DE0X 4PGHA 4GRIA 3IQEA 4V0MA 5AW2A 5K0JA 1VL1A 2ARKA 1QP8A 2NO7A 1O08A 2PX5A 5C3MA 2EEZA 5K0ZA 3UUFA 4XVQA 2D2VA 5A02A 1XAGA 4BMYA 5ICEA 5HF6A 3AOEC 3CGWA 3BORA 3QMWA 4ZQGA 1M73E 1GVNB 3N86A 3PXDA 4G85A 3RDPA 1RXCA 3FSEA 5IZCA 2VF5X 4CFZA 1IY0A 1CUSA 1IZ8A 3E48A 1E3EA 2Z2KA 4MINA 4UAUA 1Q7RA 5LB4A 3U40A 4CM4A 2XXAA 4FQ8A 4LV5B 4E5SA 5IHXA 2QM0A 2O8DB 4JJKA 5DWVA 1KMNA 5EAIA 3WGKA 2RHTA 4OUDA 4ENTA 4BO8A 2AFVA 1USUA 3KLMX 3GQVA 3OMWA 5EVCA 4C4ZA 2Q6VA 1LC0A 3LK7A 2AJLI 3BL8A 5DYYA 1QZTA 4OSOA 1QIFA 5UKDA 1JDJA 1KA9H 2WJPA 2EFEB 3WZ2A 1Q57A 1Y1PA 3VXKA 4BMOB 1DKQA 1D2MA 2ZXEA 1J97A 1QO0D 2N46A 2P6MA 4R4JA 3SQOA 5BNTA 5BR4A 2PUBA 3GA7A 3KXIA 4KQFA 5GOZA 2BV3A 3EEBA 4Q9NA 1XPUA 4AKIA 3T5GA 5GJWC 3QE3A 2P0YA 3M4JA 4JIMA 1P9WA 3WLHA 3A4VA 1ZU4A 3EVCA 3HB4X 5GVRA 2Q5EA 16PKA 1PJLA 5KYXB 2D59A 4XSHA 3PPXA 4N5HX 3ZY2A 3H4MA 1G2QA 4MR8A 1W19A 5KX5F 1B0ZA 4KOAA 1H4SA 1NZFA 4NU5A 3TE6A 3CJTA 4XR9A 2VI5A 5PNTA 4EGJA 3GYGA 1GY8A 1UKEA 2FWAA 1I6MA 1ST2A 1WZNA 2QRUA 4P80A 4ZRDA 3SOPA 10MHA 4J6EA 3R6LA 4FDTA 5IM5A 2LIVA 3C5WP 4EVSA 3GGGA 3L6RA 1H65A 4PNZA 3CF2A 3P9YA 1JQEA 1PJ4A 2CYBA 5EWMB 3X1WA 4PYLA 1M6VA 1C1YA 3KEFA 4OIMA 3A1EA 4Z3DA 2JFPA 3DW3X 4GSLA 4YMIA 1JHZA 2PSEA 5ALGA 2E55A 3K0FB 2XTZA 3NP7A 4MRMB 4XSVA 1NWCA 1IHOA 3GI1A 4PVDA 1LNSA 1S01A 3UJ6A 4ARZB 1N33B 4CQMA 2WZQA 4H7JA 2CJFA 3E1SA 2QR3A 1NMSA 1Q14A 2W98A 2KLHA 2DH5A 4JWKA 5HK8A 1NNSA 4DQDA 3G68A 3UGJA 3EC7A 1IL0A 1PWHA 3T34A 2F8LA 2GX6A 1SC1A 5DN9A 2ZWIA 5LYYA 3RTDA 1JT2A 3H2YA 3TEMA 1E58A 1EAYA 3O03A 2Q3HA 3MINB 3M1AA 2WHYA 2XBUA 2DT5A 4HDSA 4KH1A 4R3NA 2Q5QA 3G2JA 4GE3A 4RABA 2V1XA 2RI1A 1U2RA 4QJ4A 3PPYA 2NPFA 1BA3A 1GARA 1YH3A 5DWQA 2NP6A 3CJQA 3VTAA 1SVNA 3ZUPA 5J2TA 1U2ZA 5J9FA 3SHFA 2Q1UA 3C7AA 4YTEA 4DIBA 4TLAA 4X91A 4P32A 3B6IA 3KPUA 3BSWA 1YA6A 4I55F 3UY4A 4AWAA 1AZSC 2BMWA 2E48A 2HGSA 3SQLA 1NVFA 5JMOA 2HMWA 2QX7A 4NECA 1A5ZA 1QG0A 3AFMA 5A2GA 4B6PA 4D4MA 1E2NA 3LDAA 1KYXA 2B61A 3GEMA 4QXMA 5D84A 2Z5GA 3D1VA 4N7MA 2XYPA 4MWEA 4URWR 2GF2A 3TLGB 4XWOA 1QBKC 1R66A 3RI3A 1E9DA 3G9ZA 3OURA 4QBFA 4BNYA 6REQA 1L4YA 2CLIB 1NRWA 2CXQA 2QVYX 2HZ7A 1EFRA 5LCXA 3BXOA 1OWMA 1E2JA 1ILEA 3LA8A 3ETEA 2HSGA 4N49A 1IUNA 5TS3A 3THWA 4GECA 2MINB 3FWZA 3JXEA 2E4ZA 2BVNA 2NTYC 4XLZA 3ZJ5A 3PFHA 1DVRA 2B5OA 2FX3A 2MTBA 4AW9A 3ANLA 1U94A 3GPCA 4RD0A 4LMBA 5LDHA 5KCMA 3S81A 3HFSA 3THWB 1TEZA 2C9MA 4K6CA 3FNRA 2BTQB 1UF9A 4CGYA 3I62A 1E1RA 1PX2A 5HIIA 4C0HA 4A4DA 1NQOA 5EIBD 4FDUA 5BW6B 4CHTA 1YK1A 2O54A 1QOQB 5F2NA 3R41A 4PRKA 4RD3A 5AKEA 3VSBA 1VGVA 1PR3A 1ZS9A 3OI7A 1GDHA 2JA1A 1XD2B 4PNEA 5IHPA 2L82A 2XH8A 2DB3A