3ET5A

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase complexed with tungstate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
244
structure length
244
Chain Sequence
QANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHKGKVFYVTNRKDSSEKAGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein P4, NADP phosphatase
publication title Structure of Recombinant Haemophilus Influenzae E (P4) Acid Phosphatase Reveals a New Member of the Haloacid Dehalogenase Superfamily.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 97
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3et5A00
2FEAA 3N1UA 3WKCA 2JAUA 1TJ3A 4UARA 4UMFA 3R9KA 3QU9A 3R09A 4L6AA 1QYIA 2B0CA 2YMLA 1SWWA 2NYVA 5AKLA 5AKKA 3I28A 4BX0A 3E8MA 3ZVNA 2I54A 3ONNA 3I6BA 1ZS9A 2MU1A 4H1WA 2D2VA 4O8CA 1RRCA 4BYGA 1CR6A 2B1QA 3PGVA 3N8GA 3FVVA 3FZQA 4QJBA 5AI8A 4Y2SA 3IRUA 1RQNA 1Z5UA 3DNPA 5AW9A 3NUQA 5AK4A 3NRJA 1SWVA 2G07A 2B1RA 4Y2JA 4AS2A 3AR4A 3FPBA 3QNMA 2C8KA 3WGUA 2I33A 2RAVA 2IA5A 4RETA 5AVWA 4YCNA 3AR9A 3SF0A 2YN4A 3F9RA 3ZW7A 2C88A 3EPRA 3QU5A 5A3RA 1RLMA 1RPZA 1Z4OA 3U7EB 5AW5A 3A1EA 3OCZA 5FP0A 3WKDA 3OCUA 1RKVA 4Y2QA 4OD0A 1Z4KA 1ZD3A 5AK3A 3BA6A 2B30A 1S8OA 2WM8A 5AKHA 3QU2A 4Y2VA 3AR5A 1N9KA 1XPJA 3N28A 3QUTA 2VKQA 2AGVA 5T41A 5AKGA 3U26A 4Y2UA 5AI5A 3QX7A 2B8JA 4YH1A 4XE5A 2WF5A 1TA0A 2B82A 1YMQA 1ZOLA 4DFDA 2OBBA 1RC8A 2EATA 2FUEA 4QQFA 2R8YA 2C4NA 5ALOA 3KZXA 1YJ5A 1ZRNA 2JAWA 5E0OA 3U7HB 2X4DA 2FPRA 3B9RA 4OFZA 3EF0A 3OCXA 4DW8A 1Z88A 1Z5GA 1L7NA 3W5DA 3L8HA 4OCZA 3WKBA 3U19A 3SMVA 2OA0A 3K1ZA 4KNVA 4BKMA 5ALRA 2YY6A 1QH9A 4G9BA 1T5SA 4ZEXA 5AVZA 3VAYA 2P11A 3D6JA 3A3YA 3L0BA 3A1CA 3UM9A 2HI0A 3FM9A 2W4MA 3OCWA 2AH5A 2RB5A 2HDOA 2C9MA 1N8NA 4YGYA 5ALZA 5AI6A 1L8OA 5AW1A 3SKYA 2DQSA 5AIBA 1VFPA 3MC1A 5ALKA 3UMCA 5AESA 4NFLA 1FEZA 1L6RA 1Z4MA 2IYEA 5AKIA 1ZJJA 2HX1A 4AP9A 2YJ6A 5ALGA 3IJ5A 2RBKA 3KC2A 2FPSA 4BX3A 3W5AA 4KX5A 3OCYA 2ZBFA 1ZRMA 5AIAA 5ALIA 1L7PA 1QQ5A 3W5CA 5AVVA 3EWIA 2FPUA 3J7TA 5ALXA 5ALTA 2HCFA 1L7MA 1Z4QA 3M9LA 4UU1A 4E88A 2CFTA 5AKEA 2R8EA 3SHQA 3ESRA 1EK1A 3AR2A 4RESA 2YMQA 4BBJA 2ZBEA 4HGOA 2ZBDA 4HGQA 2WFAA 4C4TA 4EEKA 4HGRA 3ED5A 1ZD4A 3L7YA 5IT0A 1WZCA 1S2OA 4FFDA 5AKYA 1RQLA 2CN1A 4BNDA 1U7OA 3HLTA 2PQ0A 1YDFA 3R4CA 1AQ6A 5A3QA 3U7GA 5AW8A 1VJRA 3QGMA 2OYCA 4IFTA 3QXGA 3UMGA 1Z4PX 4HGPA 4J2TA 1U2TA 2R8XA 4F72A 1RMQA 3ZWDA 4EZEA 2OM6A 3QU4A 3QYPA 4UU0A 3DV9A 4G63A 4NWIA 5ALHA 3ZX5A 3SKXA 4MWOA 4BNDB 3KOOA 4EENA 1PW5A 2HSZA 5AVRA 1WVIA 2JAOA 2FPXA 1QQ7A 3W5BA 3RF6A 3E58A 5AKXA 2G1AA 4UAUA 4UATA 3MMZA 2P27A 3WKEA 1O08A 2FUCA 4UMEA 3TLMA 1L8LA 1EK2A 1T9ZA 3WK8A 2EARA 2PKEA 2FPWA 4DWOA 5AVQA 1YV9A 2HEGA 1VJ5A 2GO7A 3MN1A 3WK4A 3A1DA 2GMWA 3AR6A 3AR8A 1IWOA 4KYTA 3PCTA 5AI0A 5ALEA 4Y2YA 2G80A 3NIWA 3L1UA 4CF4A 5AW7A 5AHXA 3QLEA 3QUCA 3CNHA 2HO4A 4NABA 2HHLA 2YFYA 2EAUA 1WPGA 5ALNA 5AM2A 1RLOA 4NV0A 5AM3A 2YMPA 3PDWA 3WK7A 4UM5A 3I1YA 2GHQA 1RDFA 4KN8A 2FDRA 2RARA 4HAIA 1ZD2P 4UW9A 1X42A 3EF1A 5AVSA 4C4RA 5IT4A 2YJ5A 5AICA 2GFHA 3QU7A 2G08A 3WK6A 2I55A 5AKJA 3PGLA 3FGOA 1NNLA 3AR3A 5ALWA 1J97A 4BEVA 2AUTA 5AM4A 4AS3A 3ZWKA 3FPSA 2I34A 3KBBA 1CQZA 2YJ4A 4BX2A 2PR7A 2HF7A 1U2SA 1XP5A 5AK6A 2I7DA 1Z4JA 5ALPA 1Z4NA 5AKZA 2IOHA 4CF3A 4JB3A 1SU4A 2WF9A 4ZEVA 1LVHA 4HGNA 1U7PA 5AW0A 4Y2XA 5A3SA 3M1YA 4UMVA 2IOFK 1TJ5A 1Q92A 5AI9A 3S6JA 2R8ZA 2AMYA 5AM1A 4KX3A 4DCCA 4BEWA 5AM0A 4Y3UA 3DDHA 5ALDA 3ZVLA 3HYCA 2O2XA 3U7FB 3GYGA 4Y2PA 2ODAA 3WGVA 3QUBA 5JJBA 4L6CA 3WK9A 5AVUA 2HOQA 5ALLA 4XPZA 1Q91A 4YCLA 2I6XA 1QQ6A 4EX6A 4Y2TA 5ALYA 4UAVA 4XQ0A 1YS9A 4EELA 2W11A 2QYHA 3I76A 1XVIA 3L1VA 5ALSA 1TE2A 4I9FA 3L5KA 3NASA 3OTQA 4XOUA 2G06A 5AVYA 1Z4IA 5AM5A 3ZU6A 5AW4A 5AW3A 4YIKA 4B6JA 2YJ3A 4L57A 4GXTA 3OPXA 2NO4A 1RMYA 2CFSA 1NF2A 4I9GA 1Z4LA 3ET5A 3NALA 2IOFA 4IG4A 3L8FA 1YNSA 1NRWA 3ZX4A 1JUDA 2BDEA 2G0AA 3OCVA 4JDPA 1RMTA 2WF7A 2ZBGA 4J03A 2YBDA 3CZ4A 3KD3A 4GIBA 3ZI4A 5AVTA 1J8DA 3ZVMA 4YCMA 2Q5EA 3P96A 4NAVA 2FI1A 3ZUPA 3SD7A 2C8LA 3AR7A 2P69A 1U02A 4MUMA 5IS2A 2B8EA 4C4SA 3L0CA 4CF5A 4PNHA 2P9JA 5ALJA 3IB6A 4CE6A 5AW6A 3SLRA 4OHFA 1LTQA 1MH9A 3MPOA 2G09A 4FE3A 2WF6A 3NANA 3QUQA 3BWVA 2WHEA 3L0YA 5AI4A 4KNWA 1KYTA 1Y8AA 2JARA 1RKUA 2ZG6A 1L7OA 2YMMA 5ALMA 2MSNA 3U13A 1RKQA 3N5KA 5AW2A 3ZTYA 3B9BA 3L8EA 3WK5A 5AVXA 4HYTA 3WKAA 5ALFA 2CFRA 2ZXEA 4EX7A 4FYPA 3E84A 3RFUA 3B8EA 3DAOA 4UASA 2HF2A 2GHTA 3L8GA 3ESQA 2W43A 2BDUA 2ZOSA 4CNQA 1T5TA 3NAMA 3E81A 3UMBA 1O03A 5ALUA 4F71A 4UMDA 3ZTWA 4Y2RA 4ZEWA 2QLTA 3ET4A 1TJ4A 1K1EA 1RLTA 2BY4A 5AK5A 4UM7A 2WF8A 1WR8A 1ZD5A 3N07A 5ALQA 2NO5A 2Q4TA 4YIHA 2Q4RA 1F5SA 2JGAA 3KDPA 2O9JA 5ALVA
chains in the Genus database with same CATH superfamily
4OQNA 1X80B 5L4NA 5JXWA 3T7IA 4ZEOA 4G5HA 3PXUA 2VZ8A 1N8SA 3M6XA 3H2ZA 3H2KA 1AKVA 4CMEA 1GCOA 2GCPA 2AX3A 1J8QA 1OZHA 1PYDA 2G76A 3TH5A 1Z2DA 1VYHA 5AKKA 4R51A 4AO8A 3E8MA 1T10A 2RBEA 2I54A 2JHCA 3DMNA 5K8VA 3PKJA 5CDHA 1T5BA 2F3QA 3GF4A 4ZGBA 4EB0A 3T9CA 4G37A 2R96A 3QPWA 5EY5B 2WYOA 1GA4A 2GXAA 5GVRA 3TECE 4NBNA 4X95A 3EISA 2AMJA 4Q18A 4A73A 4C0SA 3N6XA 3VC3A 2FPPB 4HQKA 1DP4A 4IEIA 3T9AA 1XTSA 5C53B 5EHQA 1GG8A 4C5AA 1XRNA 4MVJP 1A9PA 3ORYA 2XX3A 2IT1A 3R3JA 3FUTA 3CF4A 3NRJA 4YDQA 2G07A 3EZXA 5E7JA 3D9QX 2Q1TA 4BNTA 4J2OA 3AR4A 4XVHA 1GL9B 2CT8A 3MTIA 4KSBA 5DTJA 3ZLVA 3EZ7A 3UAYA 1QTIA 1ZMTA 3ZTTA 4BATA 1YRLA 4ENPA 1MN6A 1N6NA 2P41A 1RVDA 1UXOA 4HLDA 4XM0A 3SC2B 4J7XA 2ROQA 1S9DA 1DDGA 1K63A 3HDJA 4P5DA 2WJYA 4U0KA 3GRCA 5F5NA 1PV1A 1LNZA 3HJNA 2GZHA 4EYOA 1U8UA 3ZE2B 3A1EA 4QXOA 3RRBA 3VGJA 2IXTA 1MHTA 4EKGA 1E2HA 3IMFA 4EI7A 3X2SA 2B5WA 1PJZA 3O6VA 5M29A 1EVYA 4RK5A 2H5JA 1D8AA 1U8EA 3KS9A 3E5RA 1PFWA 3FKJA 3HI4A 4NEQA 3TRFA 5EE1A 2AWNA 3HXTA 4AY3A 3EODA 4D42A 1R0LA 2XXJA 5EVCA 2AQIA 3QV1A 4WA8A 1DX9A 3EGOA 3GCWA 4MVJH 5EWMA 2NUAB 2DTEA 4QJ4A 3IMKA 4WLNA 3RREA 3L6RA 5FUQA 1UDAA 2PZBA 1W4AA 1X0XA 1G20B 3AJRA 4HX9A 5IU6A 3U26A 1YS1X 2Z1DA 5AI5A 1SUPA 3B8HA 3CUYA 3MCWA 3OURA 2ZI6A 3PDIB 1VA5A 2VDKB 3Q4GA 4ONEA 2O7NA 4Q4AA 4AJIA 4NYIR 3BMNB 1N78A 2O8EA 1DJMA 4G36A 1ODKA 2DBQA 2ZGVA 2PJZA 3W2IA 2XDWA 1XF9A 2W2VA 1ZOLA 2B9VA 2Q6IA 4HVAA 4MINA 2W98A 3PICA 4ZOLA 5GONF 4ENSA 2H65A 2Z4SA 4I14A 4FT4A 5DGCA 1Z33A 2GT1A 1M33A 1U4SA 3WAJA 5K6AA 4M54A 1JHQA 1EBBA 3IIJA 3THYB 4WZAE 1FOEB 2VWGA 3CEMA 4EB3A 3G9ZA 4JJEA 2WZBA 2VZLA 1YJ5A 2Q3FA 3QKTA 4X1IB 4AF8A 4B4VA 4TKUA 5LC1A 2JAWA 4DNQA 3ZV3A 1M6HA 2X7XA 3MCZA 1MJHA 3RANA 3CZCA 4U2DA 1E59A 3W8DA 4OJQA 4IUDS 3T8YA 4MWGA 5A62A 3GGSA 4ERNA 1C8LA 1P2GA 1L4EA 3DMHA 4JT2A 5J5AA 3JQ8B 2P7HA 2PZ8A 3QEMA 4HQLA 3WRWA 2I6GA 1RTTA 4S1PA 3DAFA 4OOEA 2M6KA 5IYZA 1XHEA 1ULUA 2XQVA 2V0GA 4JNKA 4IXWA 2ONZA 2PYZA 5BXQC 3UENA 2C97A 1YSCA 3PKIA 3BHIA 3N7TA 1N7IA 3DOUA 3VR4H 3LHDA 1IXYA 1FTWA 3RSGA 1ZU4A 2W4MA 3I2FA 4QQNA 4JU8A 3VSEA 4L4ZA 4ZGGA 3CEPB 4DIMA 1YVUA 4NFHA 1CUWA 3EIFA 4XSGA 2PQ6A 1NX9A 2HIHA 4IUBS 4LMPA 3IDOA 3GX1A 1VFPA 5CEEA 4XM1A 1UM8A 1CLEA 4CMKA 1GN9A 1UPBA 3FR8A 5C7YA 1RVV1 1P4JA 1ST2A 2IUEA 2VI5A 3B52X 4MQMA 4QTZA 4RJIA 2FK8A 2R2GA 2D2IA 2IYEA 3C70A 3GNSA 2WMDA 1H5NA 4XPIB 3JQBA 2FB9A 4DV3B 1GPLA 5HCIA 1KJZA 4CDNA 2CEAA 2EP8A 2WUDA 2I03A 2ZXFA 4I5EA 1M2NA 4BLRA 3DLPX 1W44A 4D02A 5HSGA 5DYGA 1FK8A 2RHWA 2CKMA 3UAGA 3DPSA 2P6MA 3DW3X 4NMMA 2C78A 2FPSA 1S2GA 2QE7A 4JLKA 5DYIA 1JLRA 4G84A 1KKLA 3D7RA 5KSOA 3GG9A 3JD4A 3BD6A 4HS9A 4P0TA 1GHTA 3TFOA 3G5TA 3HXOA 2UYHA 2OK7A 4C0KA 2DGDA 4JK3A 2ARKA 1GNQA 1U28A 2WV9A 3KJZA 1S2LA 3FNBA 1VHQA 3D8RA 3K0KA 3FPKA 1G2IA 1T3ZA 4JT8A 4BBJA 1E94E 1QUEA 1Y1TA 1HQDA 3GLSA 3MK31 5LQKA 1ZHOA 1U65A 4GWKA 1YBAA 4H0NA 4MQUA 3AEQA 3C7CB 2VYQA 3PGJA 4HOYA 4LI3X 4TL7A 5CK5A 4FMDF 3ZW8A 5IT0A 1H3FA 2FSPA 2ZDHA 4HZUB 4N3CA 1CW2B 4UU7A 3IODA 4J29A 2VWHA 5JCOC 3BTVA 1ZVVA 3PWSA 1MB9A 1JSCA 1MQ8B 1I7QB 4M1WA 2ZYGA 2GPWA 3R4CA 3CUSA 2F2TA 1V8ZA 7ADHA 4G89A 3HCRA 3IFSA 2R4QA 2ZJ3A 4AX4A 4IG9A 3TW4A 2O2EA 1ZD9A 2UZAA 4N6OA 1TZKA 4RK0A 4TPKA 4N49A 1XN4A 1NFRA 4LRQA 2QV0A 3QVXA 3ZX5A 5HF8A 3DE6X 2XE6A 1M8KA 4ZDJA 1GQFA 3BULA 3FFAA 3PTAA 1N1DA 4GI7A 1YONA 3GLVA 4UOEA 4LMBA 3KRTA 1GD1O 5ICGA 1KZHA 1M2VB 1IK4A 4C78A 1U0BB 1KVQA 1SVIA 4M9SA 4J6EA 1NVAA 4RHYA 1ZWLA 3UTDA 4O8ZA 5C52B 2YQ5A 4KLRA 1LGYA 2R79A 4HI0E 3QX9A 2Z1MA 1BE1A 1UKCA 5IM5A 4UATA 3B82A 4L8LA 1SG6A 1Z2EA 2CFOA 1BHSA 3NRCA 2OV1A 4KBYA 1RLUA 4B2YA 1M74A 2N1BA 1RHUA 1GUBA 3DYBA 3A6EA 3LIIA 3JRXA 1U0OC 1V35A 5ICCA 1RPNA 1TD9A 3P4UA 1CP2A 1L2TA 5I45A 4MB6A 4RKWA 2I2AA 2V6BA 3FMPB 2ZUEA 3EARA 4O0MA 1C7ZA 3ZJ5A 1PFUA 2CFIA 4FX2A 3TQRA 1NXSA 2CCGA 1OSNA 4PG7A 4KMMA 1ZW1A 1ZM2A 2YZKA 5AH0A 3ZCXA 4C0AC 4WFQA 2H51A 4O1IA 5CR9A 1SHLA 2YASA 5BMVF 2FSGA 3DE7X 3SOZA 4DLXA 3T9DA 3DHYA 4PYQA 4RJTA 3O4FA 2VTBB 2GMWA 2Q1WA 1DELA 4ZI5A 5LM3A 2GQ0A 3GAMA 2V1XA 2WABA 4LNUA 4HQ6A 5AQEA 5JY1A 2AE2A 1F2UA 3AB8A 3JQAD 3A1TA 1XAJA 5KPJA 3E9YA 3SE7A 5ICEA 3PIDA 3T7AA 3FTNA 3AU9A 3HCFA 3UQZA 1FP1D 3W5VA 1F14A 1JPUA 5AHXA 1UBEA 1KYWA 1T9GS 1NLYA 4IMPA 1XQ1A 1YAJA 4QG3A 5FOQA 4LY9A 3RKUA 3KWMA 3CKLA 4TRRA 2W6JD 1DG1G 1G291 4ROSA 3WK7A 3B12A 1E2NA 3N05A 4ZZ2A 3TNDA 4F46A 3IDQA 2PUEA 1TAUA 1Y8QA 4X20B 2ECPA 1W34A 4Q4JA 3Q5DA 4BHTA 3V4ZA 1XTKA 4EVSA 2NAFA 1SBQA 4YRBA 4TT3D 1TK3A 2QQEA 4JLAA 3TRKA 1YCFA 1C4KA 3HUDA 1F7UA 1Q77A 3LM8A 4OXXA 3GJ6A 1EGMB 2I55A 2O8NA 2VXOA 3PGLA 4EG5A 4WBNA 2O19A 1Q83A 5FOVA 1QYVA 3R1IA 1E9SA 4EG7A 1T26A 3GIDA 1T8SA 1T25A 5C4IA 4C2TA 4OHPA 3JD3A 5FNZA 1J56A 2XGSA 3PHCA 1CPYA 4QOFA 4B2LA 1Z37A 2PT5A 1GUDA 3BD9A 2A5LA 4ZIRA 5GTDA 1O95C 4RH3A 2H1CA 2XQIA 3LH5A 3CT4A 1N0WA 2XJ4A 4IZOA 3IUQA 1ZNQO 3Q7SA 4UE6A 2GILA 4Z1MD 2EJCA 4NYMR 4NU6A 1H0KA 1HWYA 3RFCA 3KKKA 4CF3A 5LIRA 2I3BA 3I4LA 3KK0A 5HXAA 1JJ7A 3BE5A 1FUIA 2AZ4A 3TQFA 2HZBA 4BOYA 1C0EA 1X8XA 1DEXA 1F6WA 3D8UA 4TT8A 4TV8B 3RI3A 1NY5A 2P35A 2HA3A 3D0OA 3JWEA 4CG3A 2UU9B 2F00A 3ESYA 3C85A 4WN9A 2ZBVA 3R77A 2FE4A 3U7RA 3VO9A 3MJHA 2O3SA 1WTAA 2V4UA 1YMVA 1CJVC 4MHTA 1KMCA 1RC0A 4YUVA 2WIDA 3ELUA 1W85A 5EWLB 3M83A 1JTVA 3PR2B 2OECA 1NNEA 1T5LA 1X2BA 2COKA 1DG9A 2XNCA 2R85A 2Z6VA 4IDCA 4QWWA 4UQPA 1Q3HA 4P4SA 5DRTA 3TG8A 4RTOA 3CVYA 3DDHA 1CSEE 4ZAYA 1E1CB 2VJDA 3BUSA 4URZR 1K7FB 5C80A 4WBSA 3ZLJA 3IBGA 5TNXA 2BCJQ 3JQ6A 4G0OA 3TQIA 1ZVQA 4U00A 3RS7A 1CF4A 3GNLA 1H65A 1ZJWA 2NU7A 1IATA 4LPSA 2PD6A 1S8FA 2C95A 4JB2A 4KACA 2RJNA 1OBHA 2XVAA 3A1WA 3B3AA 1CS0A 3B6MA 2CLFB 3HV0A 5JSUA 4XIFA 2R87A 1LUAA 3AUXA 4WI1A 1PS8A 4PPGA 3AWIA 5B30A 1P5JA 4YTEA 5THKA 4N0EA 1QDLB 1QMPA 2W00A 1IAQA 1Z3CA 4E13A 2DFVA 3GAAA 4ZHQF 1NJGA 1WMDA 1O96B 2GAAA 3LWDA 3V4LA 5K7SA 5GPBA 1EQAA 4Q4LA 1D3AA 4F2DA 1EUCB 2OVBA 3VJRA 4HN2A 2BT4A 4H1TA 4KH0A 3UICA 2RHMA 3V4PB 5K0EA 1B15A 2G0NA 4DCJA 3TSCA 3NHMA 4ADSG 4AY6A 1RRFA 3OZCA 3OTQA 5JS6A 1T0PA 1CJCA 2J59A 1IY9A 3WZLA 2JGEA 4EAAA 1AO0A 3GLFE 1RKBA 3NT4A 2KB0A 2XYQA 1TQ2A 1X38A 2EFHB 1X7ZB 3ORRA 3PPXA 4ZT6A 4ZDWA 4L57A 5AD1A 3X0DA 1DWUA 3ROKA 2BI8A 2O8CA 2I2BA 1K5DA 1LLFA 5KBYA 4UM8B 3ANTA 5CU7A 3JZFA 1NVDA 3PCRB 1AZSC 3VH1A 2OBLA 2QSUA 3EWNA 1E1RD 4G1FA 3C3CA 3S5UA 1CX9B 3PP8A 2HBRA 3ODGA 4KNYA 1JDUA 1GGHA 3UCFA 1D1QA 5IKMA 3CRVA 3DGFC 3G0CA 1A5TA 1ZLXA 2ZIXA 1E61A 1DHRA 3B70A 3SS8A 3O75A 4DDUA 1T15A 4GR9A 1EHCA 1T91A 1IJFA 1PR2A 5YASA 4J4TA 1GLGA 2YWCA 2X8JB 5AO9A 5HG0A 5IS2A 4IIUA 2CV0A 4C4SA 3GGGA 2LIVA 2JCXA 4B4DA 4DR1B 1Y6GA 1W46A 3EZGA 1H8ED 1U31A 2P9JA 2XNDD 4YRTA 3KEGA 2JJYA 1N2CE 4BCBA 1FQKA 4GL4A 3LUJA 1CUUA 1Z22A 3EH1A 2WKRA 1USUA 3P0RA 4KQFA 2OUKA 3L0YA 4HKTA 3E2MA 3SSAA 4BP8A 1TXGA 1YCGA 3HXKA 3KHSA 4CJXA 4FIZA 2JIOA 5ERXA 1YC5A 4R9VA 4GM1A 5HMMA 1PZEA 1HA3A 4Z99A 3P26A 3IUEA 3SLGA 4DQVA 4MPPA 1W36B 3ZCRA 2FEPA 3CUVA 4C0BA 4IHQA 1PNRA 3L0DA 1DOAA 1IN4A 3JQ9A 4HNAA 1LNSA 3QKSA 4JI8B 4L27A 2CHUA 5JCZA 5JMTA 2X1VA 4FHFA 1F06A 1DKLA 3IOMA 2EGGA 4RL6A 4PICA 1IBMB 3IT0A 4TS9A 3C6KA 3F49S 3LUGA 4FYPA 3E84A 2GVDC 4LWQA 2AYZA 1BOFA 3EXAA 1CQIB 5BSTA 2B1JA 4NDNE 5K51A 1OZFA 2CF6A 2D7JA 2Q2QA 2OCLA 2W43A 5I4BA 2ZS7A 5JVDB 3DMFA 1JYFA 1HDYA 4I3GA 3GA5A 1QH0A 1T5TA 2IU3A 5IBQA 1OBCA 5A0VA 2AN9A 4ER0A 5JAHA 3PUZA 3E18A 4UMDA 4CRWB 1DX6A 4OREX 1NYLA 2GF0A 2ET6A 4MVJE 2EZ8A 4TS3A 4TZKA 3WLHA 1QP0A 3OPYI 4XB1A 4NU8X 2WU4A 1XTQA 4O63O 1VLHA 3I9V1 4B4OA 2Y0DA 2HNBA 2ZUBA 1U0FA 2W5UA 1OGJA 2TECE 4J43A 1XP8A 4AU1A 4D9EA 5A9SB 5LNK1 3TLJA 4R8VA 5HE9A 1HK7A 1OH7A 3H83A 1VCIA 3AOEA 1WETA 5SY4A 4LHSA 5EA2A 1DV2A 4TTRA 5JJLA 4UARA 1FP7A 2I5PO 1DCKA 5FBKA 3FI0A 4H60A 4GXQA 2P65A 2YYYA 1QP4A 3I04M 4GLLA 3MWJA 3PITA 3KB1A 4IS2A 1EAMA 1J00A 5JQGA 4DMCA 1QGYA 1WUYA 2DLNA 5I7HA 4NJEB 2H2WA 2HY7A 1ZRHA 3FHLA 3IAS6 3MCTA 2J9FB 1IFXA 5AI8A 4K87A 4JEIA 3FZNA 1Y5NA 3Q7IA 4JLSA 3G0HA 1DKQA 4JIGA 4R2KA 2XDQB 1X7YA 2EIXA 1EWYA 2FX3A 2F6RA 2YWXA 3BMQA 1Z63A 1ZM3A 9LDBA 1NJ1A 2GSDA 2HWWA 5EIAA 3DW1X 3HFSA 1WUIS 4IIJB 5D1NA 5BVGB 5C7OO 2CV1A 4BN0A 2GCIA 4E6EA 3D2BA 2ZZKA 5K6TA 3H11A 4X63A 1UMKA 2ODEA 3K8ZA 5L53A 5GINE 2ZWVA 4GI1A 1QV9A 3MCVA 2YN2A 1QF7A 2OCKA 2RI0A 1AUOA 3IV6A 4P7JA 5LA6F 5T4HA 3TD6A 4D41A 2FRDC 1XTVA 3L18A 1XMSA 4ZN6A 5LMNB 2ZU0C 1VIMA 4GRAA 1N2EA 3SZLA 5EIEA 4ZKEA 1YCDA 3KE8A 1N2OA 2QX8A 3GRKA 2EKZA 1IQRA 2G9ZA 3RC7A 4B1FA 3DC7A 1OXBB 2M2IA 2YUTA 2O0KA 5D3KA 3OCUA 4R8LA 1SBCA 3OPVA 3I01A 4R4JA 3D7KA 2C2KA 4FNMA 4QUGA 2GN6A 3FWHA 1IQUA 3A10A 5GAJA 3WWDA 2G5TA 1EJBA 5JSYA 1EFRD 1QLWA 5C5EA 1O7JA 4GOXA 4MARA 3H5WA 3JATB 2X0NA 1AVTA 3QUTA 4OXKA 4J8PA 1JBEA 2RCNA 4D3XA 3FPJA 5I9TA 2DBVO 2POCA 4PZYA 4NJOA 5LWHA 4DRYA 4F3KA 3OQHA 2HCRA 2AQHA 3KQLA 2PJRA 1QM5A 1E2GA 3CPSA 1C0IA 4EOGA 1Q7BA 1JQEA 3I2KA 4JJ7A 1FU4A 2XD9A 4KUEA 3TVYA 3HZOA 4BQIA 2QAGC 4DG8A 1Z39A 1WB6A 4R5MA 4XD7D 4HFJA 3WIVA 3RJZA 4NP6A 2HIGA 1N6KA 2BGIA 1HFWA 2VDLB 3KYBA 4GZ3A 4IMIB 4IOLA 1X7WA 3WLOA 4I9GA 3ZU5A 1WB9A 1C4OA 1BCSB 5T6BA 5LXTA 1JIQA 4E11A 1R16A 2UZ1A 4XWKA 4AJHA 1CRZA 4CKXA 2ATEA 2WJWA 3H99A 3B7PA 2A0YA 5LP6F 4Z3OA 1P2UA 2E55A 3GN1A 5D7BA 4PR3A 1WXWA 3NBKA 2NVUB 1GTJ1 2O3QA 3KQTA 4GM4A 4Y8VA 1X1EA 4YAEA 6Q21A 1XRPA 1FFYA 1UK9A 5ECWA 3G2PA 4UBIA 1MEOA 3NIBA 1HLFA 4I4TA 2R44A 3MUFA 5EE5B 4B5LA 4YMUA 1YRAA 1KR2A 2QZ9A 3HO6A 1XVUA 3EDQA 3ZQJA 1E92A 3TRDA 3L8HA 1IE3A 2BGLA 4BWFB 4BTLA 1CUEA 8ABPA 3FYCA 3NT5A 1EVEA 3IR7A 4I08A 1DARA 2I4RA 4OGLA 2HK6A 3A1CA 4RDXA 2ACEA 4EGFA 3Q2IA 1Y80A 3A2KA 3EZLA 4GI2A 4HSGA 2HBYA 3ZR4B 1ADCA 4UM9B 1CY8A 2HDOA 5IN5A 3Q6NA 2Y1GA 1XZFA 5BQFA 4EGSA 1OH5A 1GAXA 3PYXA 3DONA 1F3LA 2RG7A 5AI6A 5DOVA 4DSZA 5KVVA 3ZHUA 3PPWA 2DMRA 5BVHB 1PJTA 3IT1A 1SIOA 3O2JA 2D4HA 1NWCA 3X2EA 3QKRB 3I6IA 3ZU6A 3I53A 1FEZA 1WUKS 4UTVA 4YMIA 1GR1A 1W8IA 2C94A 2GTHA 3I62A 2JFGA 2ZTLA 5IKEA 1JWBB 4JBLA 4I55B 4RK7A 4X1OA 1HDOA 1WDTA 2DQYA 2OCYC 1LCIA 3I6ZA 3W5SA 2GPNA 4WXYB 5A4MS 4QZVA 1RS0A 1D2CA 2BFWA 3MTDA 3QXCA 4MCJA 3PBKA 1V26A 1KKMA 2IXDA 1NVMB 3RTDA 3VX3A 2WRZA 4N0PA 2C2HA 3X43A 2ZSBA 5EIOA 4WAUA 4WBNF 2IW3A 1K6EA 3Q7QA 1U2DA 2OBNA 5B4UA 2JHFA 4QPZA 1I13A 1L7PA 2J0SA 5FF9A 5FX2A 4BLTA 2V7PA 1KARA 4CF7A 4GLBA 4IGEA 3SZMA 1JIKA 1Z26A 3BGSA 3NDRA 4M9RA 4FVTA 3RSZA 3HK2A 1G21E 4BVBA 3UMJA 3OX1A 3AVXA 2C0CA 1L7RA 3SHQA 2CEKA 4YRRA 3EEBA 1Y9ZA 2RHBA 3K2EA 3FE2A 1CIPA 1FNMA 1VJCA 2PUWA 1M2KA 1S8AA 5BNFA 1F1BA 4HH4A 1WZCA 1T9HA 2XVYA 3A8TA 1NMSA 1ZY2A 2HD4A 1NBMD 2PQMA 3BA1A 5DU2A 5T8KA 4TVBA 4F4IA 4KE7A 3U5TA 4F8EA 2FPIB 2OFPA 1ZSNA 3HA3A 2PBFA 1C7QA 2A1IA 2H1VA 2F1JA 5CA1B 3EVCA 3QMWA 4Z7OB 3U4HA 3A37A 2BV3A 3U7GA 4WKBA 1A77A 3HR7A 3MWDA 1NZDA 1X8LA 2QRZA 4LGMA 4WLEA 1PJ8A 1HE2A 1P4HA 2FPKA 3KR1A 3VVCA 4YUWA 3HG7A 4PYKA 5JMPA 1RMQA 4EHFA 4GEGA 3EW7A 1UBUS 3LUCA 4GE0A 2RIRA 4IQFA 4UU0A 1S8NA 2A67A 3IHLA 5IAEA 4NEHB 1ISHA 5IWCA 3VPFA 2HPHA 2JZCA 5JPDA 2OKGA 2D1SA 2VLBA 3VO2A 4PCLA 4BNDB 5KYUA 2CMDA 1SBIA 2V9ZA 2J0UB 2XE4A 3A25A 3FYUB 3GUHA 3Q41A 4LV6A 4MHSA 1A9TA 3IVMA 2E6UX 3OPYA 1JI0A 1XQ9A 3HDYA 1SOWA 4BFZA 4D82A 4EITA 5L3VA 2QRUA 3DZKA 1E7MA 4JSTA 3G3EA 2RC6A 3CJRA 1GLVA 2VPIA 3DH0A 4JVMA 4LJ6A 4OAPA 1TFRA 1I1OA 2E1RA 4MVJM 5LBUA 4FXOA 4FEGA 2BRUC 1XA0A 2UV8A 2HDWA 1L7EA 5EI5A 2BGJA 4PRLA 2R1ZA 4QGBA 5AJWA 2OHVA 3KPWA 2VDQB 1Q0QA 4L0CA 5G4LA 1TCVA 1ZN8A 1R10A 2C20A 3FLEA 3FWYA 5LBTA 2EFCB 1X1QA 3LUFA 1I3OA 4OUDB 3U4QB 4BO8A 1A8SA 1AQYA 3L7CA 4JYZA 5HM8A 4HEA6 1O3YA 3PQ7A 5ARDA 4DGSA 4UDYX 1YMUA 5G02A 2J6BA 1BHQ1 1I4EB 1OXTA 5EKXA 3RYFB 3ICEA 1THZA 4JJZA 2QN2A 4Y67A 3UW1A 1M67A 1T2VA 1W88B 3CCBA 1G7TA 1FQJA 3BWXA 1HEYA 3F6EX 3M49A 4IPTA 5BORA 1KI6B 1H2ZA 1G0OA 3N87A 2UAGA 3P71T 3TCNA 3HFGA 4KN9S 1O5TA 2YZNA 3KKEA 4HAOA 5HYVA 1N7HA 4R7ZA 2HHHB 3HHEA 4BKOA 4NBTA 1BSVA 4D5EA 4IINA 3B85A 4B46A 1SD1A 4M22A 3VC7A 1G8JA 2GLXA 2ZK7A 3QH4A 4RDHA 1J0BA 3RS0A 1I1QB 1U80A 1UMCA 2IYYA 4DA7A 1AKMA 1HQCA 2C3OA 5EFOA 5IJAA 4TWAA 1IBRA 3BOSA 4L15A 1XZGA 3W8NA 1LLDA 4I50B 5F2EA 1E2BA 3K16A 4XTCS 3QXJA 3EN0A 5C4GB 1TJPB 2IF0A 1W7AA 2D59A 4PANA 4A2WA 3ILSA 1YB5A 4P3YA 2WJZB 3LZCA 3NWPA 2FOXA 1X42A 1IN5A 2VYCA 5CX4A 4C01A 1CP3A 1E99A 3M8KA 1GFIA 3FWPA 3DB1A 1EM6A 2G08A 4QOJA 1OJ7A 3DXZA 4ABTA 4DEVA 3D81A 1GPH1 4JI7B 1NU6A 5CB6A 1FY2A 1Z35A 2XUDA 3DTVA 4AS3A 1JAHA 4PC6A 3RBZA 4RBNA 1IVYA 2IGBA 3KBBA 3K0EA 3C8HA 4R8RA 2PLNA 1GRRA 1U1EA 1E79D 1UR5A 4KPUB 4NHOA 3PNQA 3JZAA 4XSHA 4E5MA 3N2GB 1FSFA 1XD8A 2X2EA 4NLLA 5B3LA 1NNI1 1PSZA 2ZSDA 4PRYA 2FQ1A 4ID3A 3ROZA 4CKYA 3LCVB 3ADKA 5ALPA 5K0GA 4IDEA 3MZ0A 4IJQA 4XVRA 3BEDA 2AHOA 2WF9A 5DISB 2XT9A 2DXIA 5K0BA 3FUUA 1Y3HA 4UAJA 1P7PA 3ZV4A 3PCXA 4JBWA 1CEEA 2WT9A 1J39A 4DTIA 3LY5A 1CD5A 1XZ8A 3C74A 3CJTA 3L6BA 4MWCA 4F9FA 1SVSA 2DKOA 5KYTA 4WNCA 3BQ9A 4OFWA 3SEZA 1EZ4A 1TJ5A 4O4LB 4WLOA 5A1JA 2EYQA 3EQ8A 3EVEA 1HRKA 3OFND 3OTWA 3G0OA 2AA3A 5C46F 1ZKDA 3IUSA 2YWJA 3CUEF 3DBHB 5DFAA 1Z7YA 5DPMA 2HSDA 3O4GA 1B6GA 4DCCA 3VSBA 2SCUB 3OIGA 1BH2A 1WQ3A 3R0XA 4I9HA 3EEFA 3VJKA 2G82A 1TNDA 2GN9A 2O2XA 3RG8A 3DWEX 3AJAA 4BRWA 4CDGA 3WGVA 1EFCA 2CL0X 2DFLA 2X9NA 2NSHA 5JCJA 1MT0A 2D54A 1M7GA 3P9KA 4CQNA 1GCGA 1MJ5A 3KSZO 4OMFG 1GQSA 1K8QA 4HFMA 4TMZA 4JOCA 4XPZA 2YW9A 4EF6A 2XTAA 3MW8A 1PDOA 5M2QA 4DUGA 2PWPA 1CE8A 1KQPA 3KQQA 2HK8A 3I9LA 2XVMA 5A05A 4XQ0A 1YS9A 4EYKA 4MO9A 1RQ2A 5GV8A 4L4RA 3KWLA 5BV7A 3LQ1A 4N54A 1L1EA 1V0JA 1VECA 1R5BA 2CE7A 2YJGA 1SXJC 3AIIA 3LY8A 5EESA 4LF8B 1H6CA 3WL7A 3G2MA 1JR2A 3HVIA 5K8TA 3CA8A 4ISBA 4GKKB 4BUCA 3L5OA 2QMOA 3PA6A 3NOXA 3I9FA 5FWXA 3KQMA 5HFJA 2J4CA 3LQRA 3EEIA 1GTG1 3PC8A 2A2ZA 3AHJA 4ILKA 2R1VB 4Q9JA 2RGRA 1DMRA 4GUAA 2JGNA 5EJMA 4L7QA 4HMOA 1JIXA 3THWB 3AHEA 3A9WA 1Z29A 4JA0A 4RA9A 1HL7A 3U09A 3OSUA 3PT5A 3K5WA 1M54A 2Z6UA 1YFZA 2UZ0A 2LRHA 3HBMA 1G20E 5ENDA 4MVJG 1U8YA 1NT4A 5JJ5A 3EIWA 4BN4A 4B81A 4KV9A 4EG1A 4MJXA 3ZX4A 3O73A 2GEUA 1WCYA 1AZWA 2I0FA 3GHYA 4FUTA 5DE3A 4J03A 1QIEA 3QA9A 2ZSIA 2Z4TA 3BBLA 3HXPA 4MV8A 3UK6A 3RVRA 1IN1A 3WLMA 4YQYA 1W4ZA 4X8MA 2Q9CA 1E9RA 1C0PA 2QL6A 2WJ6A 4PPQA 4EGQA 1GTMA 2BLLA 3DAYA 2VHXA 2ENWA 3GJ5A 2EG5A 3O26A 3RHFA 1KNQA 2WIBA 4AJEA 3NETA 4KXLA 4N4AA 3O8BA 5EMJA 1GGMA 2VJNA 3MELA 2CVPA 5JALA 2FVXA 1NQVA 1XV5A 1Z25A 2JBWA 4B3RB 2C31A 5JARA 2YYZA 3GIWA 5BO5A 3ZUGA 4OP1A 2ZITA 3LT0A 3GLIA 3R7SA 1YTUA 1EESA 1JHXA 4PLCA 1HE3A 3B9PA 2R7KA 2WDZA 3PRYA 1WZNA 4XB2A 4BNNA 1UJMA 1XDUA 2WHEA 1QORA 2Q3LA 1XK7A 4D81A 5K0CA 4LJSA 3GEHA 4DDTA 4M0UA 1IU9A 3RFVA 3KWJA 2VJYA 3ZIAA 3GPLA 3FIJA 4PTYA 3PQ8A 5F3DA 3V7UA 1WCIB 3U13A 4JOBA 4K6KA 4D0LB 3F3KA 3L7NA 4EEZA 4OIFA 4W5TA 3W77A 1EDEA 1VSBA 4O4JB 5LXTF 3DMDA 4PAMA 1JP7A 2ETVA 2OHGA 4F1KA 4TTTS 4E32A 5FTNA 1LK0A 1QKIA 4PLFA 2QN7A 1J5PA 1FDIA 3FRHA 1CUZA 1MAVA 2C9ZA 2VA8A 4G2TA 2YCBA 4OQDA 1YU9A 4R05A 5KREA 1IONA 2BFEB 2NQ2C 3LXUX 4BTEA 4INOA 3DD5A 3NBQA 4FFWA 4NBUA 3BRQA 2IV7A 3E9CA 4BUJA 2X1HA 2C1XA 1FL9A 2YHIA 3NJ4A 4LJ8A 3N76A 2YWFA 2ZP1A 5EIBD 4Y98A 1P8AA 3NAMA 5SZHB 3D2CA 3B38A 4QGGA 4CLXA 5JJKA 4C3UA 1QF9A 3E15A 4HV4A 2P78A 4Y6RA 1YZHA 2FZ4A 3DFUA 3SHTA 3SYMA 3TLGA 3DD1A 1XELA 3BIXA 4JX9A 4R68A 1G98A 3EXFA 3UUFA 1FMCA 4BWGA 1J2YA 1AS0A 1GTZA 4QA9A 5HTKA 1XJ5A 4AULA 4FHEA 1ORTA 1Z8NA 4DT1B 1NLZA 3WLIA 4IIHA 2VF4X 4JEMA 1D2HA 3RUAA 2R47A 3UMSA 1HZZA 1F5SA 1L3IA 2BBWA 2Q3HA 4JQCA 4R8KA 2GDJA 5L3SA 2ACWA 1DEHA 1G5PA 2MSWA 4XJXA 3OY7A 2WKWA 3JQ7B 3WGYA 5MFZA 2P2YA 3R9KA 4ILEA 4LYEA 4CU2A 5I7RA 2IH2A 3H8VA 3C5EA 1I5OA 1Z28A 3OFSA 5BN1A 1H8HA 1OU0A 3MXTA 4GP6A 5GJVC 3VHRA 5B2EA 2OD9A 3BDIA 1SUEA 3ZIDA 2XZLA 7MHTA 1SCIA 2AE1A 3II6X 3LFHA 2NSYA 1BXGA 3UPUA 4KR7A 4GLJA 3AJ8A 3KZVA 1GTVA 1Z07A 1DIBA 5K09A 4RGBA 5ENZA 3KTAA 1UP4A 4NCAA 2XNJA 2XVXA 5CTAA 1QHHB 1HI9A 1JXQA 1VSUA 1V6CA 5IK2A 1XMOB 3GUCA 3QEKA 4D9NA 4EA9A 3F1LA 3FCOA 2RBGA 3WB9A 4DCGA 4N0MA 3O7WA 1DJLA 4RKFA 1DRWA 2P30A 3CW8X 4KQKA 1EDZA 2WPDD 3AO0B 3TVTA 4JIMA 1T4BA 3K31A 3I1JA 3ZHCA 2OHIA 2IYLD 2NVBA 3BKWA 2IA5A 1QPGA 4UDXX 5DBOA 4QNNA 3LL7A 2PV7A 3ZW7A 1Z12A 1D8TA 1JECA 1KJNA 2ZWOA 1TW3A 1QIFA 1NVEA 1A95A 2DSTA 2XBLA 5REQB 3IL2A 1ML4A 3F6BX 4UUQA 1Z4OA 1X7GA 1ZVJA 4HDMB 5EPUA 3T6KA 4FGZA 3WMRA 4CETA 5FLXA 2PM8A 3N53A 3EZ2A 1U3WA 1KOGA 2PMWB 2NW6A 2B35A 1JG1A 2YRFA 3JWJA 2E5FA 3KV3O 3OX4A 4WNYA 5FP0A 3SG0A 4A26A 3AY7A 4NAUA 4A2PA 2IS6A 2XSZD 4OI1A 3HUEA 4FD2A 1V16B 1VG8A 4YAJA 4MLZA 1DFIA 2W0MA 3UUEA 3NORA 3EEOA 2IH4A 1PE0A 1PR9A 1YS4A 2OG1A 3HJAA 3O4RA 4YDSA 3UA3A 5CXQA 3N2EA 1T9BA 3QU2A 2NTVA 4U02A 4Y9SA 4RWZA 1WL8A 3N28A 4JVSB 5LYYA 5JNWA 1FU8A 2GGSA 3TRJA 5KQSA 2QU8A 3H5IA 3QMMA 2DWUA 5LYJF 4CUZA 4TUYA 1Q0ZA 1U7UA 1U9IC 4PLVA 3QSGA 3CX4A 4MA5A 4KPFC 2Z5VA 3MUEA 3AI1A 3DBLA 4P38A 3RT1A 3S1AB 3GWZA 4XE5A 4JB0A 1JV2B 2KSQA 2WWGA 3SQMA 4MVWA 3DVRX 3LBFA 2PKYX 1PL6A 3GNQA 3R4VA 4B3BA 5KCZA 5DNYB 1FS5A 2P5SA 4I5GA 5L40A 3E27A 4IOJA 1WW3A 1TAHA 3RBAA 3TRHA 2Q6KA 2IS4A 4RTLA 2BAGA 3E3AA 4HSEA 4YALA 1PNQA 1JGTA 3WDMA 2ACKA 3PFNA 3UFBA 2C4NA 1I1HA 1MV8A 1U0NA 2QW1A 3LG2A 4OEHA 5ALOA 4AMGA 1HE1C 4RLQA 1ZH8A 2VHYA 1NUQA 1YZQA 1PK7A 2FPRA 1VMIA 1XKLA 1A98A 2AEJA 3GFSA 1TVCA 1IBKB 4LN1A 3A9TA 3OQIA 4BCCA 4IR7A 4DW8A 1DC7A 2I2FA 1V9CA 3LKZA 2B99A 5KNCD 1RWOA 2LCIA 4MMXB 3O83A 4XWAA 4LOIA 3H2BA 3QPVA 4OSPA 3S55A 3QQPA 3RSHA 4BKMA 5CA0B 1P0QA 2ILVA 3Q9UA 3QBTA 4LE1A 3LI2A 4B6RA 3QTLA 5HUHA 4GKAA 1M34A 3FOBA 2ZYIA 1P5RA 4L8YA 2XQGA 3DJYA 3DMRA 4H4DA 3UMFA 2C9MA 3SOPA 4B3FX 1QWOA 3RVSA 4R0VA 1SMKA 2ZB7A 3FTDA 3O4IA 4O59O 4PE5B 4UD6A 2CFCA 1XNGA 2QM7A 4YGYA 1M6VA 5EXEA 4ALLA 3NV9A 1B0UA 2I6SA 4C7XA 2YWGA 5F7XA 2IY7A 1R0XA 2QSJA 4NULA 4DJEC 1VHTA 3G82C 4UBOA 1RC1A 4F6RA 2D1RA 2WVGA 1KZ9A 1UPUA 3AFGA 2GEVA 4UUPA 7GPBA 3KDSE 1ANKA 4F8YA 3P9IA 2BUBA 2OR3A 3CQ9A 1J23A 1MU0A 5LB2A 3Q12A 3I72A 4B33A 4G4JA 3EHEA 3C6XA 3W5AA 2GXSA 4MDEA 1UMDB 4ARSA 4C87A 1DQPA 1SUFA 4HB4A 1ND5A 3GDGA 1B4DA 2YOGA 5JYEA 5KO2A 3KV1A 1QQ5A 3L01A 1CS4C 3ZKWA 3LUKA 2B2CA 1MF7A 2GKGA 2FRDA 1P9OA 4G1VA 1GUFA 4YRIA 2HCFA 4QD3A 3RYHB 2YBEA 3AGQA 1ISRA 3MFQA 2H59A 1ZO8A 3DT6A 4MWZA 4MW6A 3HABA 2CLDX 1P2DA 1U99A 3AIOA 3GFBA 3P19A 1FX0A 1HRDA 3Q1LA 4FYVA 1X9GA 4YB8A 2VBFA 5EPOA 5JLJA 2WJJA 4GD3Q 5F64A 1YR9A 1ZH0A 2B20A 2G5PA 1W6UA 4Q1FA 5B3JC 2J7KA 3U7QB 4X44A 1CYDA 3ZWAA 4MRMA 4N5NA 1QJ4A 2FX2A 5JRJA 1XWIA 4ZVOA 1FJXA 4M86A 3WNVA 3TXXA 3LQ2A 3EUFA 5FOSA 4YAOA 1JILA 1Z82A 1SBTA 5DBIA 5EQFA 3X2FA 2GEBA 4RK4A 1OX5A 4WN3A 2VQSA 4FE7A 2C9OA 2XUHA 4JL6A 3HA2A 3RPEA 3U3OA 2CJFA 3LVBA 2OCGA 4I4NA 4G0WA 2B7BA 2QX4A 3R3VA 4NXNB 1A50B 4IGFA 5LNK6 1MRZA 1OA0A 3GXOA 4GNKA 4MUXA 4QDJA 1JX6A 1CZUA 1QHXA 1XG5A 2OM6A 3QYPA 4MCAA 1QQAA 4BXOB 1E4OA 4GS5A 1KY2A 2P5UA 3EOAI 2MYNA 5HCUA 3AV0B 2JLZA 4WLVA 1A82A 1KS2A 1U7HA 3KOOA 3FTEA 3RVPA 1LI7A 1TEVA 4XDYA 1QFZA 1XHFA 3G8YA 3A1NA 1KAEA 3Q7PA 1RXYA 2VDVE 2W2QA 3G49A 1RPAA 3O1JC 1WBBA 3QVLA 3K20A 1U8CB 1XYVA 4HNSA 1F3OA 1I24A 1ZGCA 4P32A 4R81A 3IHTA 2VYNA 2IUTA 2YJNA 4K2AA 1UEXC 1IEWA 1NUHA 3R5SA 4HX5A 4OH7A 5LQRA 3TEJA 1G3QA 1L8LA 1VP9A 3T7KA 5BN4A 5CDTA 2ZSEA 1DCFA 1VIVA 2ZBRA 4NZYA 4XIIA 4D9CA 3T7JA 1UMBA 1R27A 2A0UA 5F5XA 2JGDB 3C98A 3QNWA 2EKQA 4J4HA 3W7AA 1KU0A 2WA1A 1WHTA 4COOA 1E32A 1EXDA 4HQNA 2XRFA 2Q4DA 1W1IA 3BEOA 5FPHA 1OV6A 1IBCA 4PWYA 2VYVA 4FKZA 4MV3A 1SFRA 5I9IA 5I9MA 2W2MA 4OLFA 1K08A 4S1NA 1GNRA 2IV3A 1KEWA 2F55A 3ZZ0A 3Q0EA 2G3YA 2GYVA 3PSAA 3E82A 2FLKA 3O1IC 4TXLA 3GJSA 1ZICA 1F7VA 3KXLA 4CMJA 4IRMA 3KLPX 4OQEA 3ZHRA 4OI2A 5EAIA 5ITZA 2FWRA 5IX8A 2CLSA 2Q2NA 1LFDB 3LW7A 4E2WA 1X7XB 2Z04A 5JSKA 5A0FA 2ERXA 4J90A 1AGNA 1GZHB 1WPGA 1DXQA 1MKYA 1JDVA 2C5EA 2JLYA 1UJBA 2CXXA 2X3FA 1T2DA 1GZVA 4TVSA 2W4QA 4CG2A 2JCYA 1HDXA 4TXJA 4ZAWA 3GMTA 1ZONA 2L42A 1Z83A 1ZXBA 1SQ0A 3EF1A 5IW8A 1ZGAA 2PVPA 4J3FA 4J0FA 5L3QA 3EUWA 1TJYA 3UJ6A 2PFKA 5ELXA 1WCXA 4HDCA 2VP9A 4G5FA 2JL1A 2PK3A 4AM8A 1GZDA 5B1EA 5JASA 1NNLA 2B1IA 1RHJA 3EC1A 4AW9A 1P3JA 1KZ4A 4GRIA 3QLVA 4QWMA 2MSLA 4B8WA 4ZPXA 5DNUA 2PQ2A 1PKEA 2QD5A 1WPQA 1QIKA 3R6LA 4QL3A 3SWWA 2JGFA 1AKNA 1L7VC 3RC2A 4C0WA 4KCGA 3N58A 2HT1A 5M3BA 4G1UC 2PR7A 1BTOA 1N9ZA 2MWMA 3HCDA 2QRVA 3BJIC 3A6DA 4R2JA 1I10A 3HO1A 1PTJC 4XQGA 1ZYUA 4BLQA 4PYLA 4EYGA 1HL3A 3C48A 4L4SA 4QDXA 2XGOA 5GJCA 2YIJA 2IX9A 3AF1A 2EEZA 2C1ZA 3P27A 4HGNA 1Q16A 1CCWA 3RUCA 4LOHA 2N46A 1UKVY 2FZGA 5JR3A 4ENUA 1QPZA 2AQKA 4LGVA 4PQEA 1IBLB 4KFCA 3ZEAA 1JZQA 2DJ5A 4LGYA 2REQA 4JP1A 1UDCA 4ZALA 1RM4A 2GBPA 3D31A 3Q10A 5DLPA 1HTBA 1RP1A 2X9VA 3KL4A 1RZRA 1T4DA 1Z6GA 2HC9A 3FJYA 3INYA 4O4IF 5A4DA 5I7WA 2WM9B 3PE3A 2E4YA 1IUOA 1G9XA 1K89A 1SY7A 4ARAA 4DG9A 3RIGA 3OM9A 3HYCA 2FCRA 3HDHA 5DP1A 2F59A 4OB8A 3HXQA 1KFBB 4DBLE 4MKGA 2XMPA 3V33A 2PWZA 1VBNA 3NUGA 1FRVA 2P79A 4AURA 1PAUA 4FQ8A 4I9UA 4MAFA 3RIYA 5B1HA 1B41A 3C7KA 4GMXA 2BRUA 3LC1O 4TMKA 3S0JA 5KHLB 2NGRA 3S29A 4IDDA 5TX7A 1I2MA 4DADA 3PLAE 3A6ZA 4NV3A 2Q99A 5FO1A 3B6KA 3DVAA 4PIVA 1U3UA 3KCNA 4PHHA 5CNKA 4B47A 4F86A 1JR6A 4YRKA 1GPWB 1NI4A 2FU5C 2ZRLA 5A9TA 3LA8A 1YB7A 1BO6A 2R7AA 3FUVA 1SOVA 4XLZA 1JHDA 4Z49A 2AZXA 1M8GA 1RWPA 3ZLTA 2PRZA 1NC1A 3OFVA 1VYTA 4P7GA 5EHXA 4C21A 4FM9A 1KJYA 1DQSA 1T6YA 4ITVA 4BVFA 5AVYA 3QWFA 3IKJA 3GUZA 1D4ZA 4WUVA 4QXQA 2CVHA 4Y9RA 5HFNA 4QFCA 2GUGA 2YJ3A 1KSHA 2R6JA 4KQ1A 4LYHA 1E8DA 2VZ0A 1JSLA 2R00A 3F6CA 3EY9A 2YXBA 2VHQA 3QX8A 4FZVA 1UZMA 1NN1A 1Z4LA 5CNIA 4KAFA 3EZ6A 1YA4A 5JLAA 2G77B 3DKPA 4HWPA 1NRWA 1CK4A 4KO8A 4RAQA 5B57C 1VJDA 4DSAA 2VF7A 1FRZA 1RI4A 4AQDA 1KORA 2C59A 2XYVA 4ZVPA 1N5KA 4I4CA 4Y2HA 3PG5A 2HPVA 5IEJA 2X6QA 3BXHA 3IOCA 4WZAA 1JEOA 5CD1A 5EFZA 2VRCD 4D44A 4QYSA 1SJ9A 3BFKA 5ED4A 2F3UA 4BQQA 4PXAA 1R9GA 4BGDA 3F5FA 3OWHA 3QPUA 2FEWB 3TYXA 3ND9A 2HGZA 1GZ4A 1POXA 1GQOA 2V45A 1Z9BA 3SNHA 1MPXA 1V3VA 2WD7A 2O8BA 1TO1E 5HJEA 1ULAA 1LTQA 2WIAA 1W5EA 4ICIA 1A27A 4ECAA 2VH1A 2X1MA 3I5AA 4KKXB 4B75A 3PNBA 1WZ2A 1N1MA 4QAJA 2P90A 2UKDA 4QJ5A 5IUKC 1WOMA 1JR4A 3EGXA 2XA1A 3LC2O 1XTPA 1ATIA 5FUBA 2PLWA 3L6OO 1RHQA 3BMOB 4JVNA 1UT8A 4JFAA 3OQNA 3IJPA 1UPTA 1GOTA 3JQCA 3WZMA 3K6SA 3CPHA 5ALMA 2MSNA 5CHYA 5HKOA 2J4FA 3TMKA 4TWBA 1BE8A 2PXXA 1ZW6A 5AW2A 1UWCA 1PEKE 4CM4B 2OSBA 1XDBA 1OBFO 1HC7A 4KAAA 2Q5LA 3BE8A 3AHIA 3WGMA 1ACMA 2CDNA 2Q5HA 2QPTA 2R86A 3DQQA 3LCMA 5EE3A 3RS2A 1YI0A 3ZKAA 2DX7A 2GJ9A 4O4HB 2IUYA 3ZG6A 1VLMA 2GPSA 3TQCA 3DAOA 4JBNA 5EZ6B 2QN1A 3NHPA 3RVBA 2X8BA 4PTZA 4CMCA 1AURA 2HMVA 3HBJA 1T5OA 2RI1A 4WERA 2BDUA 5EZSA 1BA2A 4US2R 5LOVA 4W5NA 1E9DA 1RJ9A 2RCYA 2IUSA 5KYKA 1QO0A 2ZT8A 1R12A 5BOSB 1EA5A 1PSWA 3PUHA 1DKNA 4JJ8A 1UOQA 4LOKA 3S99A 5KUTA 3T1YB 3DFZA 3MBKA 3VX4A 1Q0UA 1YOVA 3IKMB 5DMHA 3DVLA 1QH1A 1LDNA 2IEAA 2PT6A 4UQLA 4J7UA 4P1ZA 2PTHA 5IF9A 3NC4A 1R0BA 4Y2RA 5BN3A 3N9IA 1HYEA 2CHVA 2ZUUA 3AEXA 2QM3A 1N6LA 4R6XA 3TB4A 3JVUA 1UAAA 2CSXA 5KNDD 1DEOA 3L07A 3TL2A 3TIXB 2J45A 2ZRBA 4ZANA 4M89A 3TLKA 1BDMA 2VT3A 4YXFA 2UXCB 5E38A 4ZI7B 3HKBB 3D6MA 3L6UA 3VFDA 3ZZUA 2B36A 1MFPA 5AVKA 5K3BA 3F47A 1ZD8A 1KDZA 1Y37A 1IY8A 2GNPA 3L4BA 2B7LA 5E8RA 4DA9A 2OZEA 4RU1A 1EZ1A 1CZHA 1W0KA 2B0CA 1X14A 1JLMA 1M8PA 4O5AA 3KG2A 3AI3A 1VCMA 4O1MA 5TB5A 3WHKA 2QRQA 2OGTA 2DWOA 3ONNA 4XZ3A 3MAAC 3TPCA 4JWKA 4DGQA 1R6TA 3FUXA 3GPBA 3MQ4A 5DBEX 4H1WA 3HCAA 4FOOA 1RRCA 3K05A 3W4IA 5LR6A 3HUUA 2CBGA 1SA0A 3FRJA 1KWGA 2BSQA 2OB2A 2VTBA 3A6LA 3DTVD 2VWQA 5JNLA 3AUJB 2PGDA 3VZBA 3S2IA 4JL8A 1T1IA 2QNIA 1U3CA 1KK3A 2IXFA 3GR6A 4FMCB 4RSHA 5LZ9A 4XCQA 2FXIA 4AS2A 3V3KA 1Q1EA 1FP2A 4AWXA 1BMTA 1M72A 3KU4A 2D00A 1OFVA 4EI8A 2C8KA 3TBFA 1DCTA 4ME6A 4JP5A 3WWYA 5AVWA 1G2OA 3AR9A 4JXZA 2YN4A 2PT9A 3F9RA 4LXQA 3WLKX 4HQRA 4QQRA 1UWKA 1YK1A 4NBKA 4OBWA 4R8MA 3UK7A 4LRSB 3WGUA 8OHMA 1OXXK 1I7NA 2OBMA 2V0NA 1ZIOA 3HN2A 4RK1A 3VBCA 1E9FA 3PE6A 1V48A 3CE6A 3FWKA 3AM4A 1NJFA 3OCZA 2O5VA 4PX2A 2AFIB 1L5MA 1H2EA 3UK0A 3DEYX 1MH1A 3W8FA 1A2BA 1C9NA 1WX1A 3MT0A 4Y2QA 1Q11A 5CT9A 1JZTA 2WVHA 3ZHBA 1GNSA 3H0KA 2WM8A 1YQGA 4MVJI 4JJIA 1K0UA 4GZMA 3FLBA 4PCAA 4OQLA 3AR5A 4ZCRA 4CIBA 1XPJA 2WTAA 3QYAA 1CRLA 3AL3A 5JCJD 1SHTX 1ONBA 3OJEA 2WWTA 3QPDA 4TSKA 3A4TA 4AYXA 3K9QO 2PANA 1Y4SA 3I04A 4YAUA 3AYXB 4DB2A 4DUGD 2FHSA 3TQSA 4YH1A 2PFSA 3ZZMA 2E89A 3VAZA 4LIPD 4M8NE 3AVTA 1L4GA 3V55A 5E6UA 4MZDA 3GRYA 3TGPA 2CL5A 1YBHA 3IEMA 3IAXA 2JS7A 4QE3A 4DCTA 1GCAA 4AJNA 1KPGA 2AYXA 3MLBA 1A76A 1Q20A 1Z0DA 4NR0A 2Q3MA 3JW8A 4YPFA 3QWBA 4RFSA 2VKTA 2KX7A 4L5AA 3TIVA 1E69A 5BVGA 3NDPA 1A8PA 3CGWA 5E0OA 2K2QB 1USKA 2H2AA 1YVEI 2CHQA 2I7CA 2C4MA 4GI3A 2CVQA 3OCXA 2BKXA 3P9SA 4C6SA 2A9VA 1Z2PX 2CB9A 3DNFA 5CH3A 2A0WA 4ESHA 4MQEB 3AFIA 4TV9B 4MYDA 5MN4A 1L4FA 1YH3A 1XZLA 1T0JB 2HBQA 2OA0A 4B6GA 1B74A 1XTTA 2PRIA 3MA0A 4FB4A 5C5DA 3UJ8A 1GKLA 1ENYA 4XWYA 4ZEXA 2WG1A 1IPHA 2H92A 3OIFA 1SCJA 4ND1A 2A8YA 2PKRA 3SFZA 4B6FA 3UJ3X 3HCCA 4YPOA 2JFQA 4G24A 4NG5A 4BO6A 2C84A 1RJDA 2FETA 4TQGA 5GM2A 1ZJYA 2AH5A 5C9ZA 1JHZA 4M0PA 4WJZA 4MV9A 1J9GA 4OHCA 1E3DA 2WTEA 1I33A 4LC0A 3P4XA 4Z86A 4PO8A 3B3FA 1IHOA 2DFNA 4A8TA 1H1DA 4FQ5A 2JFUA 4GXRA 1P1KA 2O5RA 2RC5A 4RHUA 1YHYA 5BR7A 4PLWA 2FN7A 3EXHA 4G65A 1T1SA 3MTBA 1QNFA 2V74B 4IHKA 1F8YA 421PA 3PDJA 4J1TA 1XPRA 4JI0B 1OWNA 3O84A 2XA2A 2N47A 3QXSA 4HB3A 2P67A 1NR1A 1CUHA 5KQGA 1VHJA 2QM0A 5E1DA 4KU4A 4ZZ0A 3N0WA 1DTEA 3HCEA 4XYGA 1T9GR 1CRWG 2QL5A 2QP3A 2YNMC 3BJZA 3IJ5A 4CL8A 2FW1A 5EUMA 3BZBA 1CIVA 3O31A 4DV6B 4DLYA 5C1DA 4PAGA 1UANA 2IWRA 4YN3A 1MVOA 2EFGA 1ZVMA 2GWHA 5DNEA 4B8YA 3O1LA 4HLUC 4OF4A 2KI5A 3CYFA 4KK3A 3RS8A 4BMCA 4YO8A 1CVIA 3R5JA 3DZCA 4KE6A 3ZIAD 2JKYA 4BLSA 1OYOA 5EJ2A 1GYPA 1UBKS 4E09A 4AZWA 1Z4QA 5TMEA 3NOQA 1ZGHA 5G0VA 2NO6A 2CFTA 3O21A 4E08A 4EY4A 4D56A 2CXQA 1F17A 3T4XA 1SNYA 3G9TA 3WYGA 1KFCB 4X3PA 1J5EB 1TTTA 2EDCA 4A0SA 4CTKA 2ZIVB 4LXGA 4DILA 1R64A 5KS2A 1WJGA 1H6DA 1T6XA 1TEHA 3ETHA 3QMVA 5JNSA 1S2OA 2PSFA 4GMKA 4QC2A 1OTHA 4UHDA 4LJLA 3MOSA 1N2HA 3D0QA 1X1DA 1U5BB 2VH2A 4MO2A 4R1PA 2F8TA 4ALKA 3STVA 1T4CA 1OASA 3OM1A 1AKTA 4GZ5A 4UHEA 2IDJA 4IDGA 4M53A 2J08A 3R44A 5BV0A 4LF7B 3G59A 1YZNA 3SI7A 3ZDRA 1YCHA 4BAGA 4CTMA 2AD5A 4UTRA 5B64A 2GYYA 3AVPA 3L0OA 1IK6A 3TR0A 1YR8A 3OH8A 3NDJA 4DS3A 1U2TA 2Q50A 3P9RA 4S35A 1Z7EA 4F72A 4CL3A 1II9A 2O7QA 1K8YB 1QVZA 3E53A 4QTUB 3UANA 1VRCA 2ILTA 1AK1A 5TE9A 2Z3ZA 4ZXFA 1YQ9A 5BRJA 1CB0A 3UVEA 2ZFUA 3VSAA 4E30A 3RE1A 1IHDA 4MWOA 4EI9A 1W93A 5AVRA 3O3OB 3DFKA 3EQ6A 5FPSA 1JLLA 1LFAA 3BCHA 5JI3E 1XYYA 1MV5A 3PHGA 1A5ZA 1A88A 4O02B 2EOAA 5EQTA 5K0LA 3RBVA 1ENOA 2X2PA 3LZDA 1DKRA 2IJGX 5CDFE 4E1BA 5H3HA 3GB9A 1ZNZA 3WNDA 2W6ZA 3E1KA 2HWKA 1O94C 3Q7TA 2VTEA 1AMNA 2FP3A 1O08A 1SZCA 2Y1OA 3DLAA 4WCDA 1PGQA 4UMEA 2QMUA 4K9DA 4RVFA 2I2XB 1NMXA 1ZNYA 1A2OA 2PL1A 2W0SA 4KFRA 4HR7A 4ND5A 4RXUA 1SCUA 4MKFA 2VRWA 1FTSA 3H2SA 4IUYA 1EK2A 1N2CA 2NN3C 4NBWA 5KX5A 7ABPA 5KINB 1NLFA 3KVNA 4FQ7A 4YJGA 4DSTA 4KXNA 4YDRA 1M83A 2FAXA 2FPWA 1U81A 1DBSA 4YRDA 3M6IA 2LIPA 4MP8A 4HNUA 2L2QA 2ONKA 2P5YA 3ZDYB 4S05A 4MAAA 1FMFA 1FF9A 1PFKA 4WESA 1NRJB 2ZJ7A 4IZIA 5E2IA 2QI9C 2B4RO 2ORVA 4IWXA 3AR6A 3KYDB 1E1MA 5FOXA 4ARZB 4F5EA 4GWLA 5A1TA 5I7VA 2B5OA 2J9XB 2MINA 3BJRA 3ETNA 3K0CC 5FPQA 1UM9A 1JVNA 5A5FA 5K5EA 3OTOB 4J16A 3RTCA 4N8EA 2Z9DA 3OFJA 3CR3C 5BW6B 4QXRA 3WDSA 3G2QA 4F4HA 1XL1A 1NF3A 1ZAYA 3OAAA 3P9CA 3DF9A 1VMKA 3UXYA 1TRKA 2MYPA 2Z5FA 3E6AA 3LX6A 5NLLA 4BFUA 4ZA2A 4ZZIA 4G5RA 1XZHA 1TZBA 2Z9CA 3GCZA 5H7XA 3SXPA 1RLOA 4L6IA 1QHSA 4BKQA 5AM3A 5JNVA 3M6WA 3PDWA 1ZCBA 3KWFA 5DNAA 2VP4A 1HG1A 1RM5A 2QZZA 5I6DA 1TFUA 4MPDA 5F52A 1KHTA 2G71A 3GRAA 1UFKA 3WS7A 4KAJA 4M1SA 4UW9A 2WJVA 3OJWA 2Y93A 3R9IA 2ODTX 4G09A 1H1LA 5TVGA 3O7MA 4YP6A 5ECDA 4E31A 2WFLA 2ZRCA 4UXIA 1CC1S 1U6IA 2X9QA 2JLRA 1J8FA 1EP3B 1E9EA 1JHYA 2XADA 3FGOA 2BMEA 5TQVA 1Y4UA 3E2IA 1U63A 1H0SA 4MVJA 3THRA 3BC1A 1OLSB 4X84A 4AYTA 5KNLA 3OLCX 1Z0UA 3U62A 3ZK9A 2QN8A 1QO9A 3S44A 3WYAA 3VC2A 3ZS9A 3M1LA 2YJ4A 1FVOA 1N2XA 1V7ZA 4I1OA 4BX2A 4OQFA 1BJTA 5IMBA 4A2QA 3INTA 2AWOA 4BAZA 4KK4A 2WAMA 4BFCA 2JIPA 1TKCA 2I6TA 2WP8J 1J0CA 1BU5A 1XU7A 3DR3A 2JIMA 4EJFA 4ETWA 2IOHA 2AG6A 2Q3BA 4KRYA 4X1YB 4BGIA 4OJMX 4EVQA 3LV8A 1EMDA 1Z7BA 4XFJA 3G88A 1BHO1 1S02A 4UKDA 3NKLA 4JEUA 5GOZA 1GU1A 2KLBA 1L5WA 3OG9A 2WE8A 2KW5A 4RD2A 1JVSA 1GADO 1N57A 3OOEA 3PI6A 4MA4A 4TYPA 5FPYA 1UK6A 4B34A 3Q72A 2XZOA 4AKGA 4PVCA 2BKVA 3QQ5A 3AZOA 3NONA 2XB6A 3C6QA 3L4JA 4N7BA 1Z0IA 4U7HA 4GKVA 5AM0A 3VTKA 4Z7QB 4K1XA 4LYDA 2NSJA 2ZE8A 3UF0A 2F3PA 4PZPA 4YCAA 4RMJA 4G1EB 3RM3A 3VZQA 4IEEA 2V6IA 2WU1A 5HRUA 1ID8A 3BK1A 4UTOA 4EQ6B 1MMFB 1HNXB 4ZPJA 2D0PB 3I39X 3DCJA 2F1KA 1KY5A 3N2KB 4MMZB 5GZ6A 4WGFA 3T1NA 3VR4A 5CUQA 5JH7A 2J3KA 1GVNB 3AH8A 4BMXA 1D0VA 2W2KB 2OCAA 3CZPA 3KQWA 1R4NB 2WHPB 4QYXA 1WVMA 4OLAA 2N42A 4K9LA 8ADHA 3NKVA 6ADHA 1R8QA 2V97A 4REOA 1VI5A 3KJNA 4EW3A 1DQZA 4GGMX 5JZSA 2O0JA 3LGXA 2WU0A 4NYJQ 5CA1F 2H7CA 5JWOA 4RPGA 1VSVA 4MW2A 3TLXA 2O8DB 3CHYA 1XX6A 3CZMA 2CXTA 1HEUA 1YZLA 5FR1A 3NASA 3AETA 3PE4A 3SICE 4N8SA 1AHIA 2VNSA 2XCUA 3SK0A 4PN7A 5IANA 1JH8A 4PBSA 4DQDA 4Q93A 1QZXA 4LXIA 3ZPXA 5A2QA 3WNQA 3HSSA 4BIMA 2BFCA 1SR8A 1KE2A 2P6PA 4A16A 3S81A 4D96A 2QE6A 4YMLA 3VAAA 5CIYA 5CFRA 1OFUA 1OH6A 3A06A 1ZK0A 4UHCA 1E63A 4A10A 1GKYA 2UYGA 2VZEA 5JZ9A 1E4EA 2OXEA 2C5LA 1ZBDA 4D25A 3UOGA 1SAYA 1WHSB 2RGEA 4NNOA 1GGKA 3CO0S 5FKJA 3BZUA 3FPEA 4A6DA 3DMTC 3LCCA 5DGIA 1OYWA 4Q9AA 1HSZA 4FIDA 1GDHA 2CCJA 4XA8A 2WILA 5KMGA 2IXBA 1B8NA 4I8XA 4NKRA 1UP7A 4F60A 4KJXA 3WL3A 3KTOA 4BB0A 4N8DA 3GQVA 3R3WA 5EKTA 4BJHB 1DMSA 4PQYA 3AZPA 3JU3A 3FHOA 4IHJB 3ZV7A 5BQPA 1ITZA 3HZRA 5HZMA 3IB6A 1NBEA 1O5IA 2ECFA 1HOXA 2I76A 2IQ5A 1P33A 3KOMA 2P8JA 2ZUDA 2ZIGA 3N2YA 4BL5A 2EP5A 1YKGA 4LZAA 1KYYA 5FQOA 5KQRA 3RTAA 2HZ7A 2A30A 4C6RA 4J6FA 4DWWA 4TMYA 4ZYYA 4AJOA 4EJSA 2HA4A 1I1NA 1FX1A 5AJYA 3SR0A 4CM1A 1Y8AA 2L17A 1DFHA 4YONB 4AN1A 4AP5A 4AUKA 2V6JA 1WEKA 2ZG6A 1ZUNB 5DX0A 1HMPA 1HT2E 5L95A 4UVEA 4J0KA 4TZ6A 1QLHA 1JKMA 3SNKA 1PW7A 3KT6A 2D6FA 4NE2A 3ZWCA 2JK1A 1T13A 3B9BA 5I4CA 4XX0A 3DZDA 4D92A 4DR7B 3MEQA 1ZCAA 3D7MA 2JIZD 1ZPDA 3AW8A 4N5DA 5J4HA 2GESA 3TPZA 3ANMA 3K0FB 4UPEA 4MIOA 1ICEA 1OZ0A 3RFUA 1XDWA 2FWJA 4S3MA 1JALA 4UTPA 1L7DA 1J24A 1EB8A 2Y0CA 4MUGA 4QBGB 5KHAA 1QLJA 1II0A 3L8GA 3R7WB 1V3UA 2I4NA 2GJKA 1K66A 4NYJR 4TLMB 1N9GB 3FY4A 2CNBA 4BNYA 2IOYA 2C92A 4KXUA 2EIHA 4F3YA 2DY0A 4AZ0A 5MGNA 3QIAA 4GPEA 3PNKA 1GDDA 5CDSA 3U9SA 3GEIA 2VYVD 1G66A 3D3WB 1L7AA 5E4YA 3F97A 2VP6A 1EFPB 1I5RA 2ZYTX 4DAEA 4ZEMA 5KWIA 2PZLA 3REQA 2BN4A 3AKCA 3AVOA 4CN9A 4MQFA 1GKIA 3GT4A 1B73A 3C15C 1JS1X 5K2MA 1YIOA 3T7EA 3ZTWA 5L45A 4FB5A 3I83A 1G21A 1Q0HA 4GPD1 1JHOA 4O2AA 2VDOB 3WAKA 5JAZA 1NBME 4RACA 1A3CA 1COWA 1SG9A 4P80A 4TL6A 1QVVA 4OGFA 2OAQ1 2RI6A 2GBFA 2P6NA 4IIFA 3TX6A 5C1BA 5TT0A 4ZJZA 2QRHA 3IQXA 3NS7A 3K1AA 1LC3A 5HGXA 4GOJA 4IV0A 3LTNC 3FOFC 5KTRA 3ZZNA 4QM6A 3DR5A 1KE1A 1KMMA 1OBOA 2ZR0A 4XR4A 3TW6A 4B35A 2C8VA 2ZETA 3QE4A 1V5FA 2PSEA 4WNAA 2WY2D 3S2SA 3VDXA 4D0GA 3AVVA 1SBZA 5D00A 5F1OA 3SIWA 4MV0A 3NKFA 4YJ3B 1RI2A 3FDZA 2NP6A 3CLRD 1V8BA 2C5AA 2H7YA 4Q1VA 3O95A 1JTFA 1Y8ZA 2C07A 1TT5A 1I32A 2H29A 4BNFA 1OZAA 1SCDA 2EERA 2GZAA 2NUPB 3SQDA 4MLDA 4TVKA 1YU6A 3VA7A 3NHYA 1G38A 2A58A 3AEUA 4QODA 1XPOA 3AERB 3CVWA 4YJ2B 1RBMA 2CWDA 2EW2A 5KDOA 3LZ6A 1Q3KA 2EHJA 5I51A 3FOZA 4YYZA 4D0RA 6PFKA 3ECCA 1SWVA 4WCFA 4W4TA 3V1NA 3R3XA 5KTYA 1OI3A 1N5JA 3FPBA 3VHXA 4AWAA 1AV6A 2IPOA 3FNIA 3PF8A 4QYIA 1OAOC 2VUUA 1JHMA 1QU2A 4PZZA 4ZOEA 5IM4F 2NXCA 3CZAA 1OWLA 3IGFA 5H3CA 4EMUA 3DDCA 2A92A 2IHUA 3NVMB 1AKEA 2R6R1 4K9SA 4L2IA 4WE3A 4GNRA 3CEAA 3G5MA 5CXSA 3Q3HA 1SPXA 3WFJA 1CF2O 2JCVA 1M1NB 1T6NA 5EMKA 1NFFA 1M66A 1O6ZA 3SJBA 2XW6A 2BTQA 2PVCA 2FG7C 2H16A 5C1OA 2ZIFA 4AL4A 7MDHA 5HQ3B 1TVEA 4QQKA 3PL1A 4BVGA 1CR4A 4A82A 3UH1A 2JEZA 4PC2A 1NC3A 2CLCX 2EWVA 1SEPA 4K81B 4DB4A 4EHAA 1B6SA 5E3HA 5JT1A 1R4ZA 4RH0A 2YWRA 3IQIX 5F7JA 2AOVA 3ADCA 1KJIA 3Q3EA 1NBAA 1SBYA 1L6IA 3FZEA 4XEUA 2PS9A 1YK0A 1AN0A 3E22A 3JPYA 3OUTA 4NCHA 4C7JA 4R0MA 3VKHA 3DBVO 5A4FS 2RH5A 3E3NA 2MR6A 3JD1A 3SEFA 4BU1A 3CH7A 2GVZC 2P2DA 3P5SA 1N2JA 4Q7KA 3EQ7A 3PVSA 1MAUA 4BMSA 1L5YA 2Z3WA 5E0KB 3VKVA 2FXVA 3OJCA 4JJ6A 4WRRA 1RWXA 1XLTA 2WW8A 3E9EA 2VJAA 3IIIA 4E2FA 4E2YA 1ETUA 4NC9A 4UPVA 5EP1A 3MTGA 3PEFA 4I1VA 3UWPA 4G0YA 1UT6A 4RLFA 4Y6OA 1UBGA 3SDZA 4ZI2A 3P0EA 2ADFA 4H7KA 3LL4A 3THSA 2VS1A 1NXXA 4B9AA 4CCYB 6GPBA 2IZ7A 2QGZA 3KZXA 5CPFA 3UA4A 1YL6A 2XMRA 4GQBA 3E03A 2BBOA 4QJIA 2GM9A 3T9FA 2NPIA 3NYRA 4FN5A 1GAWA 2J85A 1CUXA 1I5EA 4I1YA 2PA3A 4XYLA 4ZGWA 3MTEA 4CDRA 2NQ8A 4RD4A 2C42A 3C1AA 1NVGA 5HZGA 3T4UA 4NXMB 3EXEA 2RH4A 1Q7GA 1BCRB 2G67A 1P18A 2PKWA 1G5RA 2ZVQX 4HC4A 1KERA 4HWTA 4K9NA 2PGOA 5JO9A 4QM7A 2BJWA 5G0SA 3VAYA 2W2TA 3GXBA 3G23A 1QVRA 4OGGA 1QQTA 3A3YA 3L0BA 4HB0A 4N5HX 4DIKA 5CLHA 4A5SA 2O4CA 1T1GA 3OZSA 4K5QA 4FI3C 3AT1A 4S04A 1RNLA 2W7TA 4IRXA 3I0MA 5I8PA 1CWUA 3G8CA 3I30X 1TYCA 3EBLA 4W6ZA 2J0EA 2O2CA 5I9SA 5C5IA 2G9VA 3F67A 2J7PA 3PXBA 3U3MA 4AMYA 5D6OA 4R6WA 3SFTA 5CXUA 1XXHB 2DQSA 2FZLA 2NZ8A 3H04A 3QA3E 4U3JB 2HA2A 3UMCA 3K32A 2EJBA 5FBZA 5J43A 2E5LB 4EYSA 3MGBA 1XQ6A 1D4FA 1L0BA 3EXG2 5FUWA 4ITRC 3ZV6A 4C30A 3I9KA 3ZW9A 2PUTA 5JXHA 3DDSA 3Q8WA 1GRQA 4LHEA 3PWKA 2GPAA 2ALJA 1ZGZA 4BV8A 2VA9A 4C7BA 3DDZX 1RQPA 1ZRMA 2QTVA 3ASUA 1N3LA 1DIOB 1PFGA 1QOPB 4RTQA 4EF5A 4MVJF 3VPSA 4WVFA 1XSEA 5CBPB 3S28A 5JWRA 3V34A 3R0VA 1LTHR 5EIFA 2QQGA 3I5YA 1HT3A 1NVBA 3NX4A 3CX3A 3U3KA 4DL9A 3L8YA 2FWAA 2CXOA 1PBTA 1EWRA 3R5TA 2QUHA 4TZTA 1CR0A 1X0VA 2QYSA 1I94B 2H0AA 4YJHB 5FLEX 1DDIA 3GFGA 1D9ZA 2GFIA 4RESA 3SC2A 1TM2A 2V5VA 3CLUD 3SYTA 4F2WA 3LAWA 3H5LA 5IJZA 1E2LA 2Y9PB 3AESA 4EP1A 1QK3A 5JADA 1ZD4A 3L7YA 5E4JA 3JAMA 2ORYA 3EA5A 1VMAA 3GEGA 2CLKB 2CN1A 2NQTA 1NMQA 3CUWA 3WGZA 4TWIA 4CG1A 2TMYA 3MERA 3Q9NA 2AZDA 2X8WA 3SIPA 4ZCMA 3DCIA 1J7JA 1TQ4A 3NQ41 3ITDA 4ERXA 2R48A 3NTLA 4DV7B 1Z4PX 5LP1A 4HLQB 4JNCA 1LZLA 2HMUA 1YBMA 3FUWA 4KMSA 4KOAA 1Z2OX 2VC2B 4M0DA 2HRBA 3ML1A 2G8NA 2AZMA 2W6MA 3T5TA 1G20A 4Y9UA 4B3TB 4DJTA 3PT9A 1ECFA 2JHPA 3HB9A 4NWIA 3PDIA 2GEDA 5J1TB 3WP0A 3ZDDA 4GSKA 3BMNA 4BNXA 1ZVKA 2C2OA 2H63A 1NIPA 2LTAA 2A57A 1NPDA 2HXSA 2OOSA 2Y1EA 5JIBA 1KGSA 5BUZA 5JH7F 4WKPA 2FPXA 2XCQA 3RAJA 4E5PA 1GQQA 4GP7A 4TKVA 1PSDA 1XVTA 1IQ0A 2BBSA 1YHNA 3FFWA 1JU3A 1U8ZA 4MXDA 1WG8A 4P4GA 2CLMB 3V4OA 4BRZA 1W2WB 5CFNA 3DWFA 2PUCA 3OC0A 1W48A 1OTXA 3WKEA 2CXSA 2GZSA 4LOJA 2XXAB 3U7JA 2XXBA 2EFJA 4R9SA 5E7MA 4E5VA 4PFJA 1UBTS 3H7AA 3G6KA 4MS4B 3LQKA 3TNFA 1JFTA 2XECA 3KHTA 1T9ZA 4K05A 2LUOA 1E0SA 1I3LA 4J0EA 3D4PA 2NXWA 1F51E 1TUGA 3JQ8A 4X6XA 3LP6A 3SYNA 1QMGA 4CMAA 1EFHA 4DWOA 2O14A 5D3MA 1YE8A 4N6NA 2CY0A 4R1TA 2HREA 2NV6A 3E70C 4W63A 4HWRA 4JI5B 3AX6A 2VHZA 5EQJB 3K9NA 5GONB 1NOJA 1ZSVA 4MROA 2ZDGA 3DL2A 2C82A 1F4LA 3PCTA 4CQLB 4F3TA 2HRDA 1FNDA 1B8OA 4MNTA 5MGBA 5B58C 1X39A 4GYYA 5CCXA 1R0SA 3OJOA 1FW6A 2V4MA 1UKEA 2VXYA 3IQZA 4LNHA 5BSRA 2J3MA 2YZ7A 3QLEA 3CNHA 3QXXA 4B4KA 1L5QA 3TX2A 2IPNA 3KXIA 3LPCA 3W0LB 2VWPA 3JAWA 4U8HA 4WASA 2WUGA 2OKCA 2CMKA 3CVOA 1UFVA 2AFRA 4XPIA 4Q21A 5ESXA 5LZ2A 5K01A 2I4LA 2AIRA 1W0JD 2OILA 2CL7X 3ABQB 3GLUA 4QATA 1MG0A 2AX4A 4IF6A 2WU8A 3COJA 2M6LA 3I6MA 5CMLA 2YV5A 3ZI0A 4KN8A 4JWTA 1GQYA 1QHYA 3AY0A 5CJPA 1P4RA 2CD9A 3KHUA 4K9KA 4FCWA 3M1IA 4IDNA 3SSOA 2J09A 1REQB 1HE4A 2I1QA 1IIRA 3MSCA 4JLVA 2G8LA 1QVAA 5AKJA 4ZO4A 2R6FA 3F7NA 3PUYA 5DM1A 3NEPX 2FR8C 1TTQB 4H6PA 1L8QA 1ZN9A 3MJCA 4HFNA 3IQHX 4YMVA 4LYAA 1GCUA 2Q5CA 2O2IA 2X2OA 4DN6A 1PGJA 4CLRA 4CEHB 3PR1A 5FJIA 2BGUA 4J1QA 1VXRA 5DDIP 2PCJA 4H1HA 1CF9A 2JB9A 3WRXC 4HH0A 1C81A 1B76A 2WLSA 1JIIA 1DC8A 5E6RB 1C50A 2HMAA 1ZKMA 5JD6A 2X4GA 3UHPA 4HZUA 4Y1GA 1XI2A 4BQPA 1DC4A 3WHPA 3UJCA 3MBOA 2XJ9A 2H1FA 3W34A 4KWHA 3A28A 4ZKDA 2W6PA 3LNTA 4YLGA 4N0QA 2YW2A 3QJGA 3B13B 4MGZR 4YCSA 1EUDA 4IH4A 1LLQA 1PR6A 2HMTA 4IIYA 1NFQA 2OO5A 4MUYA 2WIFA 3IUJA 1Z6XA 1RAFA 4GX5A 4B2PA 1N92A 3H5NA 4KR9A 3WRYA 4Z0NA 2OCPA 1CUJA 1KEZA 1G9TA 1RWBA 4E0BA 1OKKD 3IHWA 4FFPA 4YDHB 3SEAA 1ZFNA 2DWPA 4IV5A 1H69A 4JXJA 4EA6A 4Y3UA 2VAMA 3KZNA 1TRHA 4IDPA 4KL8S 4G0MA 2LPMA 5JBNA 3FGZA 4FMDB 4Q6BA 2PZEA 4H35A 1QYCA 2VPXA 3H2JA 4C89A 3IP6A 1O94A 4IIXA 4YT5A 4LMAA 2HOQA 1SU6A 1PR5A 3JWGA 3L0IB 3QE2A 1M2GA 3V42A 4ASUA 5IFKA 2I6XA 3SZRA 1N5DA 2ASVA 4YRJA 3TJZA 2ISCA 4LUCA 5FT9A 3ANYB 1PZNA 2ATIA 1MVNA 1C30B 1VE6A 3H1EA 4Y7CA 2FCAA 3E23A 1ISFA 1Q7RA 2QZ4A 4QRIA 4LYFA 1JKXA 2CV2A 1HNWB 1Y8CA 1SUSA 4KV7A 4EELA 4KQIA