3ET5A

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase complexed with tungstate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
244
structure length
244
Chain Sequence
QANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHKGKVFYVTNRKDSSEKAGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Outer membrane protein P4, NADP phosphatase
publication title Structure of Recombinant Haemophilus Influenzae E (P4) Acid Phosphatase Reveals a New Member of the Haloacid Dehalogenase Superfamily.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 97
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3et5A00
2B82A 1XVIA 4J2TA 5ALIA 4CF3A 3F9RA 5AW7A 3NIWA 3N28A 3OTQA 4Y2PA 2CFSA 1NNLA 3WGUA 5IT0A 1T9ZA 1MH9A 4Y2SA 4CNQA 5AW4A 2WF6A 3KOOA 3I1YA 2ZG6A 3BWVA 3AR5A 2G09A 1TA0A 3S6JA 2NO5A 4UMEA 2JAWA 1JUDA 3KDPA 3L8EA 2C8KA 3MC1A 3EF0A 3E8MA 5ALMA 1X42A 5AW0A 5AKYA 4Y2TA 3K1ZA 2AUTA 3W5DA 3QU9A 4UARA 3NANA 4FYPA 3OPXA 1ZJJA 4KN8A 2GMWA 2P11A 2IOHA 3I28A 3N8GA 1RLMA 2FPSA 1Z5UA 4BKMA 1YNSA 3ZVMA 4L6AA 4JDPA 3AR3A 4KX3A 1ZD3A 1L7PA 1Z4LA 2HF7A 2P9JA 4XPZA 2YBDA 4YCNA 3QUCA 3QYPA 4YGYA 5ALWA 2GHQA 3WGVA 4CF5A 1Z4IA 5AW2A 3UMGA 3FGOA 3DNPA 3SKXA 2AMYA 2R8YA 4UMFA 2HHLA 4FFDA 5AK6A 4YIKA 3QGMA 4AS2A 1T5TA 2JARA 4CF4A 2HEGA 1L8LA 3WKAA 3ONNA 3B9BA 2G1AA 2YJ3A 4AS3A 3GYGA 2MU1A 1Z4MA 3SMVA 5AVXA 3U7GA 1PW5A 3RFUA 4E88A 2GFHA 4HYTA 3U26A 5ALNA 5E0OA 3QXGA 3WK4A 2YJ5A 2I6XA 5A3QA 5AW6A 1WZCA 1QQ7A 2YJ4A 4OD0A 5AI5A 5ALGA 3L8GA 3OCUA 1YMQA 3U19A 2HX1A 4O8CA 3ZTWA 3FM9A 5AVVA 1QYIA 3NALA 4C4RA 1WR8A 2I55A 3QX7A 2C9MA 3MMZA 1ZOLA 2Q4RA 5ALQA 3WKDA 3IJ5A 4NV0A 2EATA 1TJ5A 1RKQA 4Y2RA 1ZRMA 4GIBA 4DW8A 3L0CA 1Z4OA 2YY6A 4UMVA 3R9KA 3WK6A 4UAVA 2ODAA 5AI6A 2YN4A 1ZD2P 2B1RA 5ALYA 5AICA 3KBBA 1ZD5A 2JAOA 4EENA 1Z4PX 5AKKA 3WK8A 5AKGA 2HF2A 2I33A 2W4MA 3DAOA 1O03A 2FEAA 4UM7A 5AVTA 3FPSA 3WK9A 1RDFA 3A3YA 3MN1A 2WFAA 4CE6A 5AM1A 3TLMA 5AW8A 3ED5A 5AK4A 1VFPA 4J03A 1ZRNA 3L1UA 4EELA 5A3SA 3U7EB 3WKCA 3U7FB 1XPJA 3WKEA 3E81A 3AR2A 1O08A 3ET5A 2RBKA 1QQ5A 2PQ0A 4I9FA 2WF5A 2B8JA 2P27A 1Z4QA 1TJ4A 4OFZA 5AKLA 3ZVNA 1RLTA 4G63A 3WKBA 3DV9A 3EPRA 3ESQA 4AP9A 3UMBA 2RARA 4EZEA 2FPUA 2EARA 3MPOA 2RAVA 4DFDA 5AKEA 2FI1A 3A1CA 3RF6A 5JJBA 3IB6A 2R8XA 4OCZA 5ALFA 1L6RA 1U7OA 2RB5A 2BDUA 5AIAA 1Z4NA 4MWOA 4HGNA 1F5SA 4G9BA 3AR6A 2JGAA 2ZBFA 2ZBDA 5AVYA 4Y2XA 3QUTA 4HGRA 5AKIA 3NRJA 5AI0A 4C4SA 1WVIA 2IA5A 2CFTA 1YS9A 1L7OA 4BX2A 1CQZA 3ZI4A 1N9KA 3N5KA 3W5AA 3HYCA 2QLTA 3AR9A 4PNHA 5ALTA 5AHXA 5ALDA 5AM5A 3DDHA 2W11A 4EX6A 4I9GA 3HLTA 4YH1A 3L1VA 2OM6A 3QU7A 2Q4TA 5AI9A 2HO4A 4UATA 1SU4A 3PGVA 3L5KA 3E58A 3EF1A 2G06A 4BYGA 2YMMA 5AVRA 3FPBA 1RKVA 1Z5GA 2G80A 1J97A 2PR7A 2Q5EA 4KNWA 4KX5A 4UASA 2WM8A 2CN1A 2OYCA 2R8ZA 1RMYA 2P69A 3L7YA 5AK5A 1SWVA 1LTQA 2YMPA 2HCFA 4FE3A 3QU4A 3QU5A 5AVUA 4Y2VA 2YMQA 1RKUA 2FPXA 2OA0A 4ZEWA 5IT4A 2WF8A 4EX7A 2B30A 3QLEA 2PKEA 2NYVA 5AK3A 3QU2A 3WK7A 2FPRA 1ZS9A 4DWOA 3UMCA 2G0AA 3ZUPA 1Z4KA 2IOFK 4NABA 5AW5A 4HGPA 4UU1A 3W5BA 3ZX5A 4Y2YA 5AW1A 5AM4A 1U02A 3D6JA 5AVWA 3PDWA 5AM3A 5ALUA 2IOFA 1L7NA 2WF7A 3OCVA 1RQNA 2I34A 2HSZA 2R8EA 1Q92A 4C4TA 4Y2QA 4RETA 2GO7A 3QUQA 4JB3A 5AKJA 2FPWA 1EK2A 4L6CA 2AH5A 1NF2A 4F71A 2B8EA 1RMTA 5AKHA 3SF0A 1LVHA 5FP0A 1S2OA 3PCTA 4BX3A 2IYEA 3U13A 4XQ0A 3VAYA 3R09A 1RC8A 4XOUA 4QJBA 2FUCA 1N8NA 1XP5A 3N07A 4KYTA 2DQSA 1IWOA 1KYTA 4Y3UA 3ZWKA 2FUEA 3NASA 4NFLA 5ALSA 3BA6A 4BBJA 4IG4A 4QQFA 5ALKA 1WPGA 3OCYA 3ZW7A 2D2VA 2B0CA 3I6BA 5AKZA 3N1UA 3SLRA 1RPZA 1Q91A 5AKXA 5ALJA 2I54A 2X4DA 5ALHA 2ZBGA 3WK5A 4YCMA 1L7MA 3W5CA 2GHTA 5AIBA 3QUBA 2MSNA 1Z4JA 5ALEA 3SD7A 5AW9A 3OCWA 4BX0A 3L8FA 3M9LA 4HGQA 3E84A 3KD3A 3I76A 1U2TA 2C8LA 3KZXA 1QH9A 2W43A 3FVVA 1U7PA 4IFTA 5ALZA 4UMDA 4OHFA 2JAUA 4BNDB 1ZD4A 5AVSA 4HGOA 3NUQA 1AQ6A 2ZXEA 3R4CA 4UM5A 4XE5A 5ALXA 3L0YA 3PGLA 2BY4A 2B1QA 1Y8AA 1T5SA 4BEVA 3FZQA 3ZTYA 3QNMA 3OCZA 4BEWA 4L57A 4RESA 3B8EA 2WF9A 3P96A 3CNHA 3KC2A 3AR8A 5ALOA 3A1DA 5AI8A 4EEKA 1RQLA 2C4NA 2CFRA 1SWWA 1U2SA 1YJ5A 5AM0A 2BDEA 2I7DA 1RRCA 2EAUA 2ZOSA 3B9RA 4KNVA 5AVQA 5ALVA 1CR6A 1YV9A 3U7HB 1L8OA 2AGVA 4Y2UA 4YCLA 4B6JA 5AM2A 5ALRA 2VKQA 2YFYA 2HDOA 2OBBA 3SKYA 5AW3A 5T41A 2FDRA 3NAMA 3EWIA 2QYHA 1QQ6A 2HI0A 4F72A 3J7TA 1TE2A 4GXTA 1NRWA 1EK1A 4NAVA 4UU0A 2O2XA 2C88A 4ZEVA 2WHEA 3ZX4A 3UM9A 3OCXA 1VJRA 3ZU6A 1RMQA 1RLOA 2HOQA 3ET4A 2G07A 5ALPA 4DCCA 5ALLA 2G08A 1VJ5A 3L0BA 3AR4A 1YDFA 5A3RA 2YJ6A 3A1EA 2YMLA 5AVZA 3M1YA 1K1EA 4UW9A 4Y2JA 4BNDA 3CZ4A 4MUMA 4ZEXA 2ZBEA 4UAUA 5AESA 4YIHA 4NWIA 1TJ3A 2O9JA 1Z88A 3AR7A 3L8HA 4HAIA 3ZWDA 4H1WA 2NO4A 1S8OA 5IS2A 3ESRA 3IRUA 3SHQA 3ZVLA 1FEZA 5AI4A 1J8DA
chains in the Genus database with same CATH superfamily
4GEKA 5DLQC 4DSUA 1H2WA 3JQDA 2JFHA 5EWJB 3ZDZB 2PUJA 1XZPA 3FUXA 3SDBA 4HEA1 4DUPA 5HP4A 1M83A 3PPXA 1KA9H 5T4EA 3SZ3A 2O19A 3E3AA 4G1EB 1U28A 3F73A 1SVKA 2ZRKA 1NNLA 1VBMA 3GK3A 4NLLA 4PZLA 3RS5A 3LQ4A 1S0UA 5A0FA 5JYCA 1S9DA 4KH0A 3L7NA 4LGMA 2NTEA 2Z09A 1NMYA 4XR9A 3HJCA 3WLRA 2WT4A 3DV2A 4OQEA 1O94C 1AU9A 1USGA 1OX5A 2GK6A 4Q1DA 4LJSA 4EOGA 4YUXA 3T7SA 1XJ5A 1KK0A 1N92A 2JH8A 4FEEA 5EE1A 5TARA 5A5GA 4X71A 4Y6PA 2BONA 3EDCA 5CNJA 3AM1A 1ZNXA 2X3UA 2X8JA 2CLCX 1L0BA 1OT5A 3MD0A 2OKCA 1N5RA 2V1XA 2FR0A 3NH9A 4WFJA 1S2GA 1Z9BA 3O94A 3QU9A 5CFNA 1V4NA 2QPLA 1N2CE 4P7BA 1C3OA 2IU4A 2QRHA 1IAVA 3IYLW 3GLVA 5G1OA 1HUQA 1WW2A 3QV1A 3VDMA 5HSGA 1ACLA 5JT1A 2P11A 4EGQA 2O2CA 2MSDB 1MGOA 4IHJF 3FNRA 1W73A 1V6CA 1AK2A 3PXDA 4NZZA 2RJOA 5EERA 4ND8A 1PWHA 4HFJA 3WVNA 1A27A 1NXQA 1G20E 1SRQA 3OQIB 1N5LA 1GEEA 2SECE 4RA9B 4MUFA 1KNXA 2ETXA 3JW8A 2Y6VA 3OFKA 1CUJA 3PI6A 1SQFA 2PJDA 2PKQO 1Z2DA 1SOUA 2ZR0A 3PKZA 4QDXA 4UZSA 1OLOA 5AW2A 1NTRA 4YPVA 2C5EA 2B99A 3HJRA 5IJXA 3WZ2A 4TKLA 1PR1A 4Y7DA 3PEVA 4EUKA 3R6LA 4A6EA 2PJUA 2YDXA 3PG5A 4YUYA 2MWMA 2FGKA 1C9KA 3LT1A 4IX9A 2GFIA 1Z2NX 2VSNA 3UB4A 5LBIA 2HEGA 3ZC3A 4UXIA 2AFHA 5DNUA 4NCAA 3QK7A 1PFKA 2DUUA 3OLCX 2G1AA 3UQYS 4TV9B 3KEFA 2NUPB 3FTPA 1ONNA 2D5LA 4NONA 4O33A 4DDVA 2VG8A 3I4LA 5DI9A 2RK3A 4D96A 4JASB 2AMLA 1GZ6A 2JJMA 4W1RA 2HGZA 3OSUA 3KKQA 3KUDA 1EP3B 1T5IA 1OWPA 4JLAA 4JCCA 3S2UA 4KXWA 1HSOA 1H6AA 1VJ1A 1P7VA 3MVEA 3R6TA 4HYTA 1AY0A 4IH4A 1NBIA 3ST7A 5EE3A 4PHHA 1ZR2A 2D06A 1P7PA 2O0KA 3CCBA 2JFOA 2O1SA 1YASA 1VHJA 1UBGA 2CXUA 3ETJA 4NE2A 3MRSA 2Q5FA 2WU1A 5DHAA 2O50A 4PNEA 4LF5B 2GM3A 4MKIA 4ZYYA 4ARIA 1DXOA 1U3GA 2VAWA 2Y1KA 4N8DA 4R2IA 5KJEA 4BB0A 4PG8A 5ADHA 5JFGA 1JFVA 1I5RA 2X3FA 5FL3A 2XT9A 1CQIB 3K0FA 2NVWA 2YICA 3STYA 3UKOA 4C4RA 4ENUA 4WKOA 3X2FA 2V03A 3EDYA 3MMZA 5ECWA 5EJEA 3H5IA 4OQPA 5DNAA 3PR1A 3ZU5A 3WKDA 2W6MA 3O92A 5K1ZA 4MGHA 4WUVA 3IAAA 1QS0B 1BHSA 2WHPA 2YASA 3PC6A 4EI7A 1XYYA 1ZRMA 4N5LA 4MQEA 1EXMA 2DG2A 4YVFA 5EHGA 4OQLA 3GZNA 3ZV6A 4V0LA 4UPVA 3WK6A 3HFSA 5CR9A 1GZUA 4JI1B 5AI6A 3ROKA 2RBGA 4CGYA 1C14A 2Y2VA 5EKTA 4OYHA 1JWBB 1ZJYA 2ACKA 3FNQA 4WXMA 1EI9A 5E7QA 5ADVA 2BFEB 1A5ZA 2BGJA 3U6BA 2GBGA 2JJ8A 2PT5A 1N2CB 2IHVA 3NT4A 3PGJA 4HAVA 2BGNA 4RENA 3VR5A 3N3AC 3UHFA 1Y6RA 3W4IA 2NO1A 4WNIA 4G01B 3GJYA 3AVXA 5CLFA 2GBLC 1X1AA 2HJHA 4R81A 5IKOA 4EENA 1TEHA 3GELA 5GAJA 221PA 1T8TA 1GUFA 2NZJA 1E32A 5BV2P 1A96A 2HF2A 3QE3A 2L69A 1MG0A 1XAJA 1XX6A 3E1SA 4EB8A 3AMVA 1G20B 1U2ZA 3PUYA 1NF9A 2P65A 1WTAA 4HH1A 3BB4A 6Q21A 3C48A 5IK2D 4HNVA 1FSPA 1XEAA 2G9QA 1EVZA 4Q3NA 5J2TF 1Y4UA 2A9RA 2GTIA 4JOSA 4P7FA 4YRLA 4ZREA 2R97A 4CM5A 1XV5A 2VATA 4WOPA 4JI0B 3GCZA 2WQZA 2PUEA 2ODPA 1ZAYA 4M8IA 5K3SA 5I9SA 1UBRS 3AKDA 4H77A 3T7RA 3LX6A 1YU6A 5JUWA 1U7HA 1PR6A 1A9OA 2AJLI 1DUIA 1E2DA 1JFLA 1Q7RA 1MV5A 1S02A 2OBFA 1U4OA 3HLYA 4N3NA 5BSKA 5KNCD 5TLSA 4EPRA 4R71A 1C3EA 3VBEA 4F91B 1QQ5A 4PN3A 2O4CA 2FOXA 5KO2A 4HZGA 1QRUA 3SR3A 2C5GA 3G2JA 5JHHB 3SEAA 3T1QA 2XADA 3LU1A 2PX5A 1I4DD 2NO0A 4MWEA 4XCVA 3RNLA 3GRUA 4ZV7A 2HHAA 3HVUA 3IE0A 3KOXA 3PUZA 1C4OA 5DM2A 3VPGA 1XIVA 4DL9A 1VCHA 3KAJA 3WB2A 2CNWA 2H5LA 2V7WA 3WX0A 5CD1A 1KRHA 2ASVA 1JAHA 2ZCUA 3DOFA 2CCGA 4RPKA 4ERNA 3V6LA 2OP0A 2H4YA 1U1CA 4YRPA 2FI1A 4TMXA 2CNOA 4AG6A 1P9WA 4BO9A 4Z1MD 3OQNA 1GKIA 1WDKA 3PYLA 3VZCA 3I37X 3A1CA 4Q7LA 5GM2A 4XFDA 1BRTA 1RXUA 3Q3HA 4X1KB 4RJLA 3VYSB 4BIIA 2R8XA 3I12A 3PB3A 4CKCB 3U62A 4MJ3A 3RKUA 2W8ZA 4A8JC 2QMOA 2PL3A 2PXHA 1L6RA 4U2EA 3W8DA 4O8ZA 4F11A 4MR9A 3PUVA 1AGPA 3OJFA 4HN9A 1RQRA 4L95C 1J0XO 4FGJA 4O5OA 2EZ8A 2Z6QA 1QYDA 2X1HA 2HA4A 4P3PA 1P4GA 4Z0HO 3CW9A 5LIRA 2AWNA 2IS1A 2YCLA 4TWJA 1U7XA 2R6DA 5BW4A 2CJWB 3P2IA 5AH0A 5KI6A 4L8FA 4MI6A 3ZBPA 1VBFA 3ACBA 4QYTA 4REQA 1WDLA 2JGMA 4PNHA 4YCSA 5T6BA 3RQSA 4YALA 4YREA 2JFXA 3UG7A 2PH7A 2DFPA 2EKQA 2XZDA 3FMOB 3K2QA 4N7MA 3AOEA 4PGHA 1N2HA 5CD9A 2A94A 3HU2A 4MA0A 3K70B 4LJ5A 4QYIB 4DC0A 4Q9HA 3X0DA 4B6PA 1ADBA 5MFPA 3OEYA 3L1KA 3MOSA 1B74A 4DBLE 1Y5IA 3EIFA 1G6HA 1BDJA 4GYYA 4E5YA 5JEEA 4OQ4A 5F52A 3UAXA 4J0QA 1J97A 3WO0A 4KV9A 1KY3A 1FYVA 3KLPX 2WM8A 4KNWA 4M1QA 4UASA 5I9BA 3V48A 2QY6A 3HB5X 4WADA 1LF5A 3HEBA 3DD1A 2AFIA 5A7FA 3LQFA 2GKSA 3C5HA 4R2XA 4D9BA 4ISBA 4X20B 5HZMA 1O6BA 2FZGA 1XZKA 2Q46A 4NOLA 2PTGA 1EZ1A 3NTUA 3OWOA 1PFQA 3TOVA 3TPFA 3TW4A 3A6LA 3EGVA 3QLEA 4G4SP 3QU2A 1E3TA 2X14A 3QLJA 4QDOA 1H2XA 4FOOA 1J7KA 2XQFA 1QGDA 3B1YA 4DCMA 4DLLA 4CEHB 2ACWA 3LS2A 3O3CA 1TQHA 2HHCA 1PJAA 2JBAB 1G3QA 2B37A 4ZYWA 5K01A 2GXUA 3G2HA 1RBZA 1KSGA 4JU8A 4DBVO 1B8PA 5H9WA 1P2VA 2R751 2WKSA 2PMWB 4R51A 4ER7A 4F3NA 3D4IA 2P90A 5AVWA 2FB9A 1ZUWA 4XLZA 3CR8A 4PYOA 4NL4H 3SHVA 1EM8A 1WNFA 4EIWA 2FW0A 1NY6A 1V71A 3EXHB 3WS7A 5F2NA 5E9QA 2ZPAA 2PPVA 3VXKA 3JQEA 4WEOA 2Q3LA 4NPAA 4EY6A 4EAAA 5HM6A 2H2GA 5B3AA 1Z82A 2NVUB 1ZK4A 2OQ2A 3FFTA 1EK2A 1PVVA 3I6YA 1WD5A 3T6KA 2J3DA 3MRXA 5DFAA 3KR9A 4A0GA 1J1IA 2IODA 2FQXA 3Q3VA 3SJBA 1NQWA 1GGMA 3CRRA 3VC7A 3LVFO 4KO2S 5GP1A 4WECA 2JCGA 1XKQA 4IJ5A 4RF5A 3OQMA 1H5NA 3VRHA 4QJBA 3FNIA 2PUTA 3E35A 3L82B 1ISFA 5FI3A 3LUBA 3C6MA 1EX1A 2UVPA 2DQSA 3NUGA 5E2BA 2A9JA 3A6JA 1Z2OX 3OO1A 2FUEA 4BNIA 5I4CA 1DIOB 4BQSA 2F4VB 2IOQA 4I1YA 4XKJA 3CISA 2CDBA 2J08A 1DX6A 5AJWA 5A6SA 3OTIA 3L05A 5A9SA 3F4BA 4RLQA 5TPZD 2HNKA 2K4MA 1XVVA 1N7GA 3TZBA 1X7XA 2P9FA 1OTYA 5FL7A 2TYSB 2ZKIA 4RA6A 3SYTA 5EQFA 3UTCA 1DC4A 3K1TA 3PUIA 1BJKA 4R9SA 5GWXA 4NZ9A 2E4WA 4GC9A 1I1OA 1K8QA 1YUBA 4P32A 4XDHA 2OPHA 1U2PA 1C50A 2QL6A 5KTTA 3UUFA 3O9MA 2BGMA 3OPVA 1G7CA 3EVBA 1U2QA 3MUEA 3JX9A 5BNIA 2IPAB 1VYVA 1UC8A 3SD7A 5HX7A 5KSPA 4QXRA 6AT1A 3EXIB 4KFUA 1W85B 3E9RA 5JADA 2FZCA 2ZJ1A 5BN5A 3A1WA 2G4VA 3OIVA 3ZLUA 3EUFA 1KP9A 4PZPA 4B3BA 2B9EA 2JJ1D 3OTGA 4XRGA 1Z8DA 4KLZA 2FWPA 2NSHA 3M0EA 1NYLA 1GA1A 3HNRA 1RVDA 1QH9A 2UZIR 4BAUA 3KVVA 4YHBA 4DMLA 3KJGA 1YRAA 3QUAA 3SLKA 3L2OB 2WSSA 3ANLA 5C8YF 4CQMD 4QO8A 2XF8A 1T34A 4D4HA 3ZDBA 4KLAA 3GP8A 2ZSBA 2RAUA 3VNUA 3ZD9A 2JD0A 1FVFA 3AXTA 2AFHE 1E2FA 3X44A 4Z7QB 2C9DA 3U4CA 1HYBA 1HT1E 4YJFB 1Y8CA 1ZP6A 1BGWA 2ACVA 2HU2A 3QELA 2GARA 1NC3A 4L74A 1E1QA 3F7NA 1Y8AA 1YVRA 1IY2A 2WRZA 3JATA 3NG1A 4XUDA 4D26A 1FJGB 2QR5A 1OV4A 1CP2A 1KBZA 1W75A 1Y5MA 2FMKA 3DBVO 3H4IA 3WNVA 3KSRA 4Y6RA 5IDQA 1O9GA 4RY9A 2JIDA 2BRUC 3GAAA 1DLJA 3TRHA 1KJZA 1PS0A 3LRPA 2BUCA 1YR3A 4D81A 2QN7A 4REOA 1IOVA 4NXMB 3GEPA 5CRIA 3MWKA 2VUTA 5AI8A 1ST2A 1H66A 4EBFA 1GGVA 2NAPA 1WCV1 3QRWA 4INJA 4K9LA 2Q1TA 3BK1A 3W6OA 2YXEA 5FOQA 4EFDA 2ZKLA 4ZV9A 2C31A 4RK1A 4FOPA 1AN9A 4TV9F 2HK9A 3GZ4A 3WJ7A 3SZRA 4EHNA 2EGGA 2Q3DA 2RGGA 5DGIA 1AS3A 1UQTA 2AN5A 4Z7JA 5CCXA 1L5YA 1W59A 2HJ9A 1ZCZA 3BGWA 3DNMA 3PL5A 1RHMA 2R87A 4PX5A 4DV3B 4MB2A 3MNFA 3IUPA 2ZIXB 2FX2A 2X8JB 4ZYXA 1KEPA 1QQ6A 2C29D 3BWCA 4PRYA 2X8AA 3GLHA 4I5DA 1QFMA 4B5KA 4PIPA 2EGUA 3DCNA 5C4GB 4XGRA 1C3OB 3ICQB 2PXAA 3C14C 2QN9A 3PNOA 2PL9A 4UU0A 2E4YA 2HV8A 5CGQB 5IFLA 4CCAA 2YVAA 3UC5A 4JWTA 5JNLA 3EW7A 1N78A 4V0OA 1ZGBA 1TTPB 5FLYA 3VH1A 2PUDA 1RRGA 4LF4B 3KYJB 4XQEA 2Q5JA 4FSXA 1WUYA 4ND8B 3TQIA 3LF2A 5BPFA 4KDFA 4CIAA 3S0JA 1SKMA 2OOKA 3H9GA 3H9BA 4G5HA 3LV8A 4REMA 3UTDA 2ZIZA 4RZQA 3Q5DA 5TGDA 1F17A 4ZK2A 1GQOA 1GSHA 3WADA 2JC3A 2J31A 3A31A 3DLHA 3IQFA 1G3UA 1QPZA 2WAAA 4GD3Q 2VJMB 2VWQA 3HU3A 4JJIA 4MVJM 3ONFA 3ILYA 5F9FA 4QVIA 3CZ4A 5JIBA 3G8AA 4UAUA 4YI5A 3KQSA 1A97A 2R00C 2N3ZA 4YT8A 2QZ9A 1X7WA 4MV1A 4UXHA 3JTEA 4A23A 2NXJA 1K5PA 5E1MA 1J42A 2AFHB 3BH6A 4DMGA 2XD9A 4DARA 1P8JA 1U99A 1UBOS 4HAIA 4ZKDA 2CXOA 2NOAA 1B6SA 2G36A 2WY2D 2WJ6A 4CM1A 5BY2A 1S8OA 2QQ5A 3HP1A 3UOGA 4HV4A 1Z6ZA 4J7UA 4BWYA 2VHQA 1AUQA 3IRUA 3H9JA 1RYDA 3G7NA 3QJYA 2IX9A 1AMOA 1J8DA 2VPXA 4R0MA 5M29A 2YFQA 3C3BA 3I72A 5J1TB 4BNJA 4N9WA 4MW7A 1P72A 1R6XA 5EJFA 1RYBA 1Z6PA 3H1PA 1DLIA 4MDHA 5AW7A 2QG4A 3SHOA 1RRKA 2AFVA 4YCJA 3HJFA 3LNTA 1KRWA 2L2QA 4IS3A 1IRXA 1RXYA 2RK4A 4UFNA 4Z49A 3ICVA 5JS8A 4N0DA 1B15A 3AB7A 3B2EA 3O21A 3N7UA 1MOQA 4NQRA 4A2WA 2NIPA 3I1YA 2FWNA 3K0FB 4WASA 3RFFA 4DDHA 3ZHRA 4G0UA 2VP6A 3G2KA 3ZWAA 2EZTA 1SA0A 5J4HA 2CKMA 1D2HA 2JBHA 2NU6A 1H0RA 2O2HA 1Q12A 3FZYA 3ND5A 4GLLA 5K8LA 2VPPA 3MC1A 3UJAA 4KSYA 4BC0A 4M9UA 3VDXA 3VJRA 4DCJA 1VE1A 4MUBA 5ALMA 3LA6A 5GJWC 3NVKI 4IWXA 3C3DA 3A9UA 3WLOA 3GZNB 1CQWA 4XX1A 3RGGA 3LOPA 3RTEA 1VB5A 4B4VA 1M5UA 4JDUA 2WSMA 4X00A 5DB4A 1PE0A 3N0WA 1I7SB 2I3GA 3FUVA 4ZGWA 5D5HA 4BNZA 1KKUA 2EDAA 5IDYA 1YT5A 5CM8B 5G4KA 4D79A 5IZCA 1ATZA 4Q1VA 1B43A 3Q41A 4HB0A 2YYYA 3FMIA 1FYXA 3G9UA 4AMVA 4Y9RA 1DBIA 2QJTA 5HF6A 1M1NA 3C6QA 5BURA 1B3RA 5FOXA 1M8PA 2EZUA 1M33A 1M6NA 1FX1A 4XPZA 4KSCA 3OWXA 4ZRDA 1C7EA 3IMEA 4R3WA 4UBKA 5GMOA 4ZZ2A 4LBWA 2GN1A 5DCYA 4BNWA 5B1EA 2Z4SA 1MENA 3X2SA 1MABA 4CIXA 1A71A 1M2GA 4D99A 4X64B 2XJ9A 3K7EA 3CMMA 2C97A 5JYDA 3DYBA 4RQAA 3CS3A 1DPGA 3CWZA 3MAJA 4M8SA 1MAWA 1F6DA 2H07A 2YQ5A 2R8YA 3AEXA 3FH0A 2XB9A 3MPUA 4HDRA 1XZAA 4ENQA 3GEMA 4TKVB 3LY8A 1C3JA 3TN7A 2AW5A 4Z5XA 4LJ7A 4DDUA 5HZHA 1B8OA 2PS3A 3GFPA 2GF0A 5K05A 3T5TA 4DMMA 1IY0A 3F96A 1MJGA 5I7AA 3UATA 3RUFA 2E5FA 5A5VA 4RHCA 2QTTA 5DP2A 3W8RA 3FYUA 4XIIA 1VIDA 3NO4A 3IEKA 3N0XA 1T2CA 2DBYA 3IKTA 1FP6A 1YFJA 3G88A 3K05A 5LPNA 3NFRA 3U7GA 3NPAA 1UFKA 2PRIA 7REQA 4HLNA 1NRIA 4NC9A 1JFSA 4X8LA 4ACAA 3DL0A 3FMVA 3FMFA 3HSSA 2V0CA 4HUJA 4JN6B 1XCPA 3LFUA 2EQBA 2C99A 2PZKA 3FKSD 1KJNA 5EUMA 1RXIA 5E6UA 1IHDA 2WD7B 3FUTA 4KE6A 2YJ4A 1OZAA 4TWBA 2ZSJA 3M4JA 4UPDA 5B58T 4F4JA 2CXHA 4FYWA 5ALGA 1MORA 1R64A 3LL4A 1ZJ6A 2OCKA 4L9RA 4MTCA 3RU9A 4DEVA 3RRFA 1PDWA 5F3RA 1XN4A 2J1LA 3QX7A 2DHRA 5LQSA 1OCEA 3TVYA 4R2JA 1LK7A 3UEOA 5HR5A 2QMHA 5JVDB 10MHA 1NW8A 3DE4X 3BQ9A 3G0DA 4MV5A 1S2MA 2VUHB 4G8JA 4A0FA 4BTEA 3THYB 1VBKA 3ZE7A 1G7RA 3JYPA 4MR9B 5EPUA 1BHO1 1EWVA 3DE5X 3LX5A 1W5EA 2SBTA 4KMSA 1KIAA 3P9RA 4MKGA 3KQWA 4UAVA 3TCKA 3U0BA 4D97A 4CODB 2YOHA 3FLBA 3A32A 2BMAA 1USVA 4IFBA 1RRPA 3E9CA 5BSMA 3WYAA 4FLMA 3IPRA 4IDHA 4JNCA 2GASA 1V1RA 1UMCA 3HCWA 3VR6H 3FBWA 1YTLA 1W4RA 1WMSA 3ZZ1A 4U63A 4REQB 2JAOA 2BFPA 2IBSA 1TZBA 2FNAA 2MHCA 4JLOA 5WRFA 3REGA 5E8RA 4I3HA 2VH1A 4KXFB 1JJAA 3HRIA 3O2SB 4C1NA 2GM5A 2GEJA 3HFGA 2A4MA 2XB2A 4MVJE 4ZEMA 3HR7A 1O4VA 3H0CA 2WP0A 1JEEA 1UH5A 2WR8A 4UM7A 4N65A 4ZO9A 5DRTA 4MQUA 2VNKA 5FBWB 1UEIA 1H2BA 4JUAA 5DO9A 4BX9A 4DAEA 2PKWA 4M21A 5DXAA 3DXZA 1CYEA 1YOVA 2EVWX 3QTTA 4I4IA 4WNAA 1MRZA 2J0SA 3OFSA 1S5PA 1P4SA 1R6UA 4M1SA 2WM3A 1A82A 2X7XA 3NGXA 1B0UA 3OZRA 1BU8A 1RCTE 5HGJA 4BRWA 1DKRA 2AFIB 3WKEA 2P3OA 4FNAA 5K03A 3CG0A 3CUWA 1DAHA 1WMBA 3UK2A 1PX2A 1W5TA 2QTZA 3BFJA 1R66A 3SXUA 4HRAA 4F06A 2ZB8A 1L2TA 2BE9A 3EAFA 1TJ4A 2GEBA 4LYFA 3UH1A 3RK1A 3DE3X 1RNLA 1RLTA 2GTHA 1C3XA 1Z56C 3GUYA 4KIFA 2VPTA 4YRBA 1Q7BA 1B0ZA 5EE5B 3AI1A 5ERGB 3G8YA 1T24A 3IDZA 4OHXA 1KOFA 4LGYA 2QXTA 4DB4A 5IM4A 3TGWA 5TMPA 2I7VA 1BX1A 1I6KA 2J7KA 1JLLB 1QE0A 4B4WA 4JOQA 5L3SB 2BZ1A 4BBAA 3TW6A 2B4QA 3H3XA 1V8ZA 1C3VA 3QIAA 3PC8A 2PSSA 4IDNA 1ISPA 1UZNA 1WCYA 1FP2A 1IBCA 3EQ9A 3MA0A 4EMTA 1EM8B 4D0NA 5KWEA 5JRDS 5KX5F 9MHTA 2W6NA 4D2IA 1C7RA 2PUVA 3PQ7A 2YZGA 1E9FA 3N7TA 1W47A 2ZP1A 3N2GA 3QQ5A 4KP7A 5CG2A 1H2HA 1KH1A 2H7CA 2A3NA 1X1QA 1KQPA 1AZTA 4MWOA 1NZJA 1EUZA 1LDMA 1Z5OA 3QIVA 5E4JA 2JGAA 3GPDG 4BV2A 4DJDC 1Q95A 5C7OO 4IIJA 3FWHA 3SXPA 2VTDA 1Z6QA 4G24A 1YS9A 2DQ4A 4ZCQA 4WK6A 5HILA 3JPYA 1JHZA 5JLAA 3BUSA 1C4KA 4DNPA 4HWPA 2I6QA 2FR8A 4LX8A 2NAFA 2ATCA 2XNDD 4INZA 2ZRHA 2UVPB 4N0MA 1O5OA 2F3SA 4IHAA 5IBQA 4BFZA 4YDHB 3RB8A 3JAWA 5ALDA 4FYXA 4RVNA 5EN4A 1NMZA 4PYLA 4UDOA 2YZ7A 4GNKA 2F1RA 5ECDA 3O93A 5A6SB 2LVBA 3B51X 3UWMA 1U11A 4AWXA 4AXXA 5A9SB 3QLUC 1A9YA 3BN3A 4UBNA 4PS0A 1X7XB 5CDFA 4I99A 1HFKA 1YVUA 3K09C 4HQRA 4LVUA 4UATA 1PW7A 4RA6B 5C3UA 2QM7A 3AI3A 3F0TA 3C87A 3GLHE 3UT5B 2X0IA 2ZTHA 4PZ0A 3AF3A 1JZTA 1D2CA 2WLTA 3IAM1 5TJ9A 4EJ6A 4RVOA 4ZALA 5TRTA 1B6RA 1R0SA 1SBZA 4ITUA 1P9RA 4MKFA 2NVOA 4CR7A 4O6VA 1LNQA 3G2MA 1VCMA 2G80A 4WJZA 5TQ2A 3RJTA 3DWGA 3G1UA 2OXTA 2R8ZA 3K9QO 2PNFA 2C5BA 3JQFA 4G5YA 1SWVA 5K2OA 1E1CA 3CLTD 4WERA 2Z6UA 5BN5B 3CLSC 4EHFA 3PC2A 3I32A 4GR5A 4Q9KA 4Z4EA 3JU3A 1EXDA 4J7AA 4N7JA 3EPLA 2P78A 3GQBA 4C6HA 3GA5A 5H70A 2H11A 1E9AA 3K9CA 4H08A 4BWFB 3FN4A 2VCEA 4B17A 3T3NA 3HR4A 3EOAI 1SOMA 4MR8A 4OLFA 2Z4TA 4DYDA 4URHA 1H94A 2E3JA 5J5CA 2QW8A 4CMEA 4YAKA 4JQZA 5HKLA 5AW5A 3ZJTA 1IM5A 1JEAA 5C37A 4LYEA 1FTQA 4LJ6A 3H7AA 4MHOA 4KKXB 4PHTA 1KE1A 3LPLA 3KYDA 4Y2YA 3QG1A 2QVZX 5I7RA 5IFKA 3WYEA 3KB8A 4N6OA 3D6JA 2PA0A 5DVZA 1QTRA 3B70A 3CE9A 1XEXA 5DASA 3RC1A 2C2OA 4JEHA 3QELB 3KUCA 3T94A 4R9RA 2NM0A 2HSZA 3JATB 1NG1A 3CRMA 4QTUB 2QSYA 5F76A 4PICA 2F1KA 1BMTA 2QN8A 1BTOA 1NQ5A 2G9VA 2JCSA 1QK5A 1NW3A 3L7KA 5CNIA 4XSGA 4YAJA 3WFZA 1NATA 4RF2A 4WLUA 4IIHA 3GJTA 4KMOA 4DJTA 5JXHA 4GBMA 5B12A 3EIXA 3HXPA 3PEFA 1RC8A 5TQJA 3PNMA 2FHSA 3NETA 1PFUA 3GX1A 4ITVA 2XGOA 4JHLA 3VI3B 3I9LA 1D0SA 2AEEA 4Y3UA 3V8EA 2RGEA 1C4XA 4QUJA 4F60A 4HTFB 4E21A 3H1GA 1FNSA 2O52A 4QQFA 2NTNA 5B2ZA 4WDQA 4ZVUA 1RWVA 2ZGVA 5CLHA 4Z6KA 5KC9A 1MX3A 3KRTA 1VPTA 2O3SA 1QJ4A 1WQ1R 4KIGA 1ZICA 2PGJA 1XGKA 1T10A 2XWQA 3QPCA 3GLHB 4G36A 2PL5A 5CM9C 2WDZA 3WZLA 2QRGA 1NXWA 4ZHSA 1MRSA 1NHGA 3DR5A 4OGLA 4ZRMA 4IGIA 1XMQB 3ZWVA 2ILTA 3AUXA 4C06A 3NTQA 1EXVA 3V5NA 3AFIA 5DGDA 1TMKA 1JU9A 4TKUA 3N8DA 4HGQA 3H5NA 1QNLA 2JIBA 4EW1A 4AIRA 1YI8A 1MOZA 4IOLA 5ES3A 3V00A 1YDMA 1J22A 1CHDA 1YZNA 1VSVA 2IEAA 2PXXA 3IULA 1HQYE 2GNPA 1E94E 1DRUA 5IKMA 1QPGA 1HT0A 2WJYA 3DTVA 1GQFA 1ZN9A 1RXCA 4KPUA 2V6FA 4LWPA 4CTJA 2Q5LA 1FYDA 4FR0A 3TX2A 4QGHA 1X7WB 1JSLA 1M67A 1ARZA 4DQVA 4Z4HA 3HJBA 3L9WA 1G6Q1 2PUWA 1LJUA 4H6XA 4RV9A 5IN5A 4DIKA 3N0RA 4P0QB 3QMWA 4D92A 3ZD6A 3PA8A 1J0EA 1YRYE 2DKFA 3BKWA 3D7MA 2EQ5A 3ZHOA 2I9KA 3DMHA 1W8DA 4C29A 1QOZA 4V0MA 4JA2A 5H68A 2VHCA 1N9ZA 1RWNA 4MQ5A 3FZQA 3KT3A 2IKSA 3EVGA 4R1SA 3IA2A 3MGGA 1O87A 2V7GA 2Z08A 4UBLA 1GIAA 2JS7A 2RH5A 3AHGA 5DNEA 4JV5B 2C58A 4F3YA 1E8NA 3P96A 3KC2A 4RTMA 3EF3A 3FWYA 2AVDA 5DISB 3AW9A 2GF9A 4GLFA 1CY0A 2XY4A 1Z5WA 1JDNA 2AZXA 4V2UA 4RPCA 1MOSA 3L7CA 4P0PB 1JQ5A 3LRXA 4MQFB 2LBPA 3CX3A 4MO9A 4F96A 4Z1OA 5FQNA 1DV2A 3AEZA 2L17A 1PJZA 4QQNA 5KYKA 1CR6A 5B1HA 3QPBA 1TPYA 5IU6A 1LLDA 2X2FA 1OYOA 1SA0B 1VP9A 2C2WA 4D3SA 4GPD1 5AM2A 3KJIA 2C78A 6YASA 2YFYA 1H23A 2HDOA 4BX8A 4DR4B 3SFZA 4MR7A 5KYXA 3ITNA 3ZPXA 4LFCB 5SY4A 3LSYA 3WLMA 2CL0X 1HG1A 2XE8A 4KQJA 2XHEA 3CNBA 4K1LA 1G9SA 2KW5A 1QP4A 2FLWA 2VDNB 4R8RA 3R7LA 5MDHA 5EJ9A 1PVOA 1LPSA 2GJAA 5G4KB 1WQ4A 1O95A 5LYYA 3R0ZA 1E92A 1GU1A 1RMQA 3BQMB 4ND6A 4CMHA 1UBNA 5E3HA 3H9QA 1HURA 2OKGA 1I3NA 5LQKA 1PUXA 4U6SA 1M1NB 4MLCA 2WWVD 2R4UA 2BKEA 2JCYA 1FDRA 1WY7A 3HB1A 4QBTA 1WLYA 3M83A 1KZ4A 3DDNA 3L0BA 2WK1A 2V5AA 4FMPA 3UKJA 1MABB 3AVPA 3GRYA 3OBBA 1TM7E 2NPIA 3LPAA 1HTTA 2VDVE 5JSFA 3Q98A 1Y5RA 4UDNA 5JWRA 4Q66C 1GSOA 1V3UA 3ZWNA 4BNDA 1ZUIA 2GHRA 1E61A 3A11A 2PGNA 3GHHA 3ZIDA 2W42A 2GAIA 1KF0A 3VKHA 4Z7OB 4GKVA 3P9XA 5C8VA 1GTSA 1ST3A 1H4TA 2F17A 3ES9A 1UOQA 3PICA 5HDBB 3GMTA 3I2KA 2D2EA 2DM6A 1JL3A 1EH5A 4UEWA 3S70A 3FYUB 1YJBA 2BP7B 2EX1A 1SJ9A 4N49A 3S7ZA 1DAGA 3Q0TA 4B75A 3DQQA 1UOPA 3LKZA 1GG8A 5AUOB 2GCNA 2QOEA 2AG6A 5KU1A 1XMOB 3LCRA 3V4SA 7REQB 3SQWA 1KDTA 1LU9A 4FYHA 1CUAA 4EUFA 2ZETA 1OZFA 4ZK6A 4ENVA 1XTQA 1LRJA 1ZK1A 3A1TA 4GXQA 5IM5A 3R75A 3PJFA 4RFLA 3NIBA 1I6WA 3VKVA 4NTZA 4EKEA 1Y6ZA 1YZQA 3O0DA 4WXEA 5E6UB 3WRXC 1WV0A 5JY6A 4HH0A 4ZHQF 2RGAA 2BSQA 5GJCA 2GI4A 4AY5A 3WGUA 4MI1A 1S3SA 4FQ5A 3UPTA 1DQZA 4CG2A 4CNQA 2R7MA 1ESCA 2H7XA 3A36A 3OWHA 3ZHUA 4G9EA 1L4MA 2X6QA 1V16A 4QECA 2YWDA 4Z7NB 3B52X 3QNUA 4JSTA 4DWWA 4EVRA 1VLJA 2GYVA 4MCIA 4KFRA 4D25A 1ZMTA 2F9FA 5JQGA 3M5DA 4ES6A 1XDWA 3C3KA 5BYBA 3B8HA 4MGEA 1QQAA 1CUVA 3TQTA 4ZYZA 1TQ4A 2B36A 3CA8A 4HJRA 3TI7A 3WL6A 1KBOA 4XW2A 1PSWA 4LRTB 1ZVVA 1VJTA 3RD5A 4PZEA 4IP0A 3BD7A 2PCJA 3VX3A 4JXJA 1KIFA 5ECYA 5LMNB 1MJFA 5E2IA 1N6IA 4G1UC 4DF3A 1SIBE 3ZWQA 4WZ6A 3CWQA 2D1QA 2WKPA 4Y9UA 1BVHA 3QVOA 1JA9A 1V1RB 1GLGA 1KZGB 4FC7A 3MXOA 1UWVA 2BFFB 3IUBA 4DTIA 1YNSA 3IP9A 3G5MA 4YC7A 5DSTA 2CV2A 1XQVA 1QOPB 3AEQA 5ADUS 1UDBA 1KI8A 4KX3A 3LYHA 2XLCA 3U3XA 3WMXA 4DSZA 5JC8A 1RTKA 2ABWA 1HEYA 2FEPA 5HK8A 1X7YA 2GETA 4LSWA 1KDVA 1G8FA 2ZYUX 1M2WA 3CX8A 3U4IA 4NATA 3LSTA 5D86A 5LJLA 1PEAA 1NJ5A 4O4JA 3AIIA 1LPNA 2F64A 3LQQA 3SAJA 4KDEA 4YR9A 5JLJA 5T3YA 1YOVB 5EJGA 3P4UA 3ETCA 5B6JA 2HHLA 2VK4A 4J0IA 3SHTA 2I4RA 4RH0A 1B23P 3S1AA 1WIWA 4LZNA 3GROA 3Q0IA 3AHCA 4GPZA 2MR5A 2HM7A 2QZZA 2PMBA 1WHTA 2BOVA 1H2RS 4ZU1X 3K0EA 1UBLS 4M88A 1YUNA 4AECA 4OA5A 4WOCA 1JKIA 2O1EA 3DUFA 3SXUB 2EXXA 2BAGA 1UP4A 2JPDA 3IP7A 3MTQA 3CV3A 2VDRB 3KSMA 2WYOA 4PBTA 2EJBA 2E82A 5DMXA 4AUKA 1XK6A 2CXNA 2PZAA 2QTWB 4LA4A 2VBIA 1GA4A 1WVMA 1K3TA 2JFWA 4RHEA 2RHTA 4UVIA 5EG5A 4ETNA 2GFHA 1RU3A 2OLJA 5B7NA 4EQ6A 1XMJA 4W9NA 2A14A 1T5HX 3NBUA 4MQLA 4NZOA 2ZIGA 5ALNA 5E0OA 3T1NA 1QHIA 2QLBA 5HIAA 2ZEJA 3IJRA 2X3YA 3HNOA 1H2YA 1J8YF 1V25A 3L7DA 3UUWA 1Y33E 4O2LA 4DCGA 2FW8A 1HQKA 4Q3DA 3A9WA 3EG5A 4LDNA 1ZN8A 4Z0PA 4HYYA 2MSKA 2VAPA 2ZQ5A 5AVVA 3NVAA 3JQQA 4U9UA 1Y1PA 2HA6A 1JILA 3Q7TA 2I3ZA 1HFEL 2GN8A 4L7QA 1RJGA 3MINA 4JP1A 4QOEA 3AFHA 3GF4A 3FLEA 3KLNA 2O8DA 4NP6A 2FR1A 4K3VA 4Y2RA 5DTQA 2V4MA 5DWVA 3QPUA 2V98A 4NMHA 1ZSYA 4RC9A 1I0ZA 2Q4OA 4ALNA 1EESA 3CVUA 2XVAA 3NMUF 1U2GA 1NI4A 3DDZX 1R37A 4RYDA 3ZDQA 1KZ6A 1CUEA 2DBVO 3HBMA 3JAKB 4IIJB 1HYQA 2HK8A 2NP6A 4RDCA 1HMPA 5ELMA 3TIGA 2BFNA 1H3NA 1DPFA 1OF1A 1XZFA 2CXQA 3Q12A 3BMOB 3E7FA 3QW4B 5JRJA 4MVJI 4HBZA 2DX7A 1IUKA 4R0NA 4YCCA 5ALYA 3EASA 4KXQA 1XZJA 4PYRA 5AICA 3KOWA 5DHTA 3KBBA 4ZVNA 1Q0ZA 1ZM3A 2IYAA 3RC2A 3O3OB 3ZNPA 4ADSG 3IA7A 5HZKA 4QNNA 2PRZA 3AP2A 1CIVA 3JAWB 1DQRA 3EGEA 1NDHA 3T5MA 1M2JA 3OSZA 4HVAA 4Q3OA 3JVDA 2I33A 1P7CA 2ZYTX 2C4KA 4K9PA 3PFHA 4Q9NA 1GPNA 1CUGA 4MS3A 4QYXA 1DINA 5EYPA 2IDZA 4KMRA 1HEUA 5JI2E 2HZ7A 3CZQA 5JSZA 5FBQB 4K9OA 1I80A 2FHPA 2ONYA 2ZK7A 3MN1A 3PVCA 5JISA 4RF3A 5FLEX 4PYQA 4L8VA 5DN9A 3UV7A 4URZR 5TQ2B 4QOHA 3VO1A 3IIIA 5AK4A 3TM5A 4N0PA 1LKZA 2PGAA 1GYQA 1T5BA 1WSWA 1ZISA 2PQ2A 3H65A 1R6VA 1Y9EA 4J6EA 2ZIVB 4A4DA 4CQJA 2ODEA 4EELA 1K2VN 2BW0A 4CIDA 4NBSA 5HJ7A 1E1CB 2FUNB 1JDJA 3VOSA 1K6EA 1DAMA 2BKAA 3V4VB 2DOKA 3QVUA 4I9FA 4M2LA 3VR4D 2P27A 1Y3CE 2OHOA 1T3SA 3I83A 4IQ4A 1GZDA 3D3EA 3GQBB 3OOWA 5EL0A 3SN6A 5L4NA 1A9XA 4A10A 2XCUA 4RPHA 2B7BA 1T8UA 2I71A 3WKBA 5LN1A 1WBBA 4OBEA 2E37A 2EJCA 1PJBA 2H51A 2ZT6A 4WY5A 1U2EA 4MR8B 2P5SA 4QXMA 5FKJA 4DHEA 2IZ6A 4XUEA 2D0PB 2VQ6A 4B2YA 2O4UX 1LDYA 4MW6A 3GR6A 3UMBA 5KOIA 1QMGA 1A5TA 5AD1A 1U80A 3CSUA 4AKGA 1FXSA 2HT1A 5COBA 4QXQA 1WCWA 3KYDB 2WU3A 1T9KA 3EEFA 4J90A 4L27A 4TRNA 2IW3A 1PWXA 3RQIA 4KAJA 4RVDA 3HYLA 1XEXB 5C5EA 1W19A 3NTRA 1U9YA 1Z6YA 4HUQA 4V0ME 4EYSA 5IXSA 4IXWA 3SQLA 1QRTA 3UB3A 4MWCA 3MGAA 4KGDA 3I8SA 2M6LA 3T9CA 1TJPB 1NLFA 2GPJA 3PDUA 2IDKA 5JXWA 2CZGA 1GDTA 2GUGA 1V4BA 4WV3A 3CF0A 1BCRA 2D1TA 2HY7A 2IKQA 4JIMA 4D5EA 2CVFA 1VHDA 1X14A 4E09A 4GXRA 3GCDA 4JC4A 5AI0A 1WVIA 3IUEA 4G0MA 5FTWA 3LUJA 2Q6KA 4MVJG 1C0LA 3MCVA 2J0EA 2XOKD 1FP1D 5REQA 3UXHA 4D8YA 3LW8A 4EPWA 3KOMA 5A71A 2VJNA 1MJHA 2FRDA 1BH2A 3VVCA 5T67A 4POOA 3IALA 4QATA 1FYFA 1KK1A 4YK7A 4WY2A 4UVEA 2PEZA 2VHJA 1N6HA 1LD3A 2E4UA 2PX2A 2W11A 2WNIA 3PHLA 5KNBD 4HYQA 3QBVA 1QTNA 4MEAA 3LL7A 1CVIA 3A27A 4K26A 3KR1A 3NUZA 3OZSA 3FPFA 4I9HA 3UYLA 1CB7A 3BWDD 4ZVMA 3TB6A 3DHVA 3Q9LA 4TMFA 1BC5A 1LPBB 4AYXA 5HYVA 4WA8A 4B3IA 1YBAA 1RACA 1RJEA 3ASVA 4M9XA 1C7JA 1U5CA 3N2KA 4X6XA 5JDIA 2JFFA 3G2OA 1B1AA 4GFDA 2OYCA 3T7EA 1RFGE 1VE5A 2Q28A 4A1FA 1XYGA 2ADOA 1XOIA 2IUUA 1LTQA 3TFWA 4TKUB 3Q6NA 2PQMA 4A1OA 1FLVA 1PZMA 1JN0A 1UK9A 2X76A 2WC1A 3ONEA 1C9MA 3OU2A 1FQJA 3WV4A 1NMSA 4NBKA 1B2LA 1Y4DE 1OZ0A 1GTJ1 3MTJA 1UBHS 2VNSA 4EX7A 2VAVA 2Q2VA 1YR2A 2I2XB 2JG3A 4HX9A 5DM4A 2J5QA 4BMPB 2X2OA 4MB6A 2OQVA 1G8AA 1KFKB 3MYRA 3ZUPA 3ZJ5A 1WU7A 1WX1A 1JALA 2IOFK 2Q2WA 2WTXA 2WYVA 3OKCA 1PI3A 1U1FA 3DTVB 3PSHA 4KPUB 2OO7A 4C3OB 1THMA 2V7XA 3DMTA 3EUWA 2JAQA 4AZTA 3VUFA 4AZSA 5L4LA 3DC2A 1ZI8A 3R5FA 2CHQA 3SSAA 3ZU3A 2V7VA 4EZIA 1N9GA 3PDWA 2YKGA 4WINA 2X0DA 4ZARA 1L7NA 3PF8A 3RVJA 2H31A 3ML1A 1YFKA 2QRPA 5GZ6A 2H0RA 4GPAA 2P1ZA 3BMCA 4IJUA 3U1VA 2X9NA 1JDSA 5M5BA 3VV3A 4D3YA 5FTLA 5LZ9A 5AKJA 4M60A 1H42A 1YZGA 3SZGA 3TXAA 4I81A 2RAPA 4ISCA 1V5WA 3KXKA 4ROSA 1KR2A 1LVHA 2W2OA 3BMXA 4MINA 4ZAZA 2ZUDA 1E8MA 5CW1A 2IYEA 5JHGB 2XGJA 4CN8A 3VAYA 2VPQA 4PLWA 1C8BA 3ETDA 1XJQA 3AF2A 4IQGA 4MV7A 3STVA 3OA2A 3TM4A 1W46A 4LYYA 3IOEA 4EJSA 5CCEA 4OX9B 3R9XA 2V7EA 2XECA 5CNKA 2TECE 1O58A 5I01A 2O3QA 4YAUA 1RSZA 1ORHA 2CW5A 4H60A 2WWGA 4WGFA 2AKEA 1NKSA 4XD2A 4BIMA 4RTSA 2HO5A 3LT0A 3GVCA 4X60A 4F2GA 1G5HA 5KYXB 1G8YA 3A0RB 3W4JA 3ZE9A 4RTOA 1NAIA 3HZOA 3F3SA 4B6EA 7YASA 1C0KA 4BNVA 1WBDA 3N8IA 1Y34E 3D6NB 2ICAA 3F49S 5KQRA 2V7TA 3KVRA 2P5UA 4PZAA 1AIPA 3O8LA 4RS4A 3T54A 1K98A 3PYXA 2W48A 5JAPA 1XDDA 1WUIS 1Z73A 2Y71A 3R7AA 1BMFD 1TD1A 1PT9A 2XRYA 3OT5A 3LXUX 2HMWA 1N0IA 3FCUB 2QF7A 5K6AA 1JFFA 2OHGA 1J0BA 3C3AA 1VYUA 1NYQA 5LU9A 3KSBC 3TMAA 4RTPA 1JZQA 2OZVA 3CTMA 1IBRA 4FS3A 4HVTA 1XEWY 4A6PA 5MN4A 4KXMA 3JXEA 1E77A 2A9FA 2YWBA 3KZXA 2O0LA 4IOKA 4F7WA 4Q3CA 1IPEA 1U7PA 3F5MA 4UQLA 4XM2A 2VWHA 1EFVA 2P6UA 4NV1A 4NJEA 5A3VA 3K2IA 4DVJA 4DR3B 1PSDA 3IRVA 3I0ZA 4BNDB 2B8TA 1MRNA 3DH0A 4NNPA 2H48A 1ZI9A 5MN6A 3A6GA 4TXNA 4P7KA 2DXIA 1O7JA 4Q21A 5FCDA 1GN9A 2W58A 3H4VA 4AO8A 4AAYA 2P75A 3RC8A 3UA4A 4PU0A 1A7UA 4R3NA 3V32A 5BSFA 3UAZA 5IAOA 4QUIA 2APJA 3SX0A 2W93A 4ZMBA 1QC5A 5DNWA 5DW3A 1C9DB 2OE2A 1QU3A 2WUDA 1Z68A 2OPBA 2SKCA 3UICA 1TUIA 1IYZA 1Z17A 1MC8A 3HCCA 4R31A 3CZPA 2WZBA 4NRDA 1XTRA 4ZVOA 4YMSA 3DLIA 1DFHA 2BL4A 4O4HB 4PINA 3X3HA 4IDQA 3WYBA 2VDJA 3A1DA 2FP3A 3QX3A 1TTQB 3H1TA 4OM7A 1SWWA 2G63A 3OJ0A 1ISSA 3AM4A 1G2QA 1OFVA 1XNHA 1SVNA 2QAGA 1NXTA 1XO1A 1V16B 2YRXA 2Z9DA 1L4HA 3MMPA 4LSZA 4JELA 1NXPA 1T4BA 1DBVO 2Y68A 2GBPA 4WKGA 3URMA 1MHTA 1GARA 4K9SA 2XI4A 4E07A 5B30A 4YQEA 2ZAMA 3ELDA 2A0YA 5F5LA 3ABOB 3M3DA 1KFCB 4QKQA 5JQGB 1EIZA 3NRBA 3SKYA 4B33A 3KEQA 3MSXA 5T41A 1K0UA 2ASEA 3L04A 2R62A 5ITZA 1ND5A 2G1KA 2WWYA 3WLAA 4BKUA 3JWJA 3FVTA 4EF5A 3UK6A 4P58A 2ZDGA 4F8JA 2EBUA 3TZCA 1F6BA 1UK8A 3AHIA 5EIFA 4RULA 1U2DC 5BUSA 1B26A 2AQKA 2BMDA 4DN6A 1Q20A 4X7MA 2NV6A 4LJYA 1PD0A 1GKLA 4F5YA 4HWOA 3WLTA 1EZZA 121PA 1CJBA 3ZU6A 3ANSA 1FFDA 5I6DA 1T36A 1MA0A 1SCIA 1I2MA 1WPRA 4YQFA 1NNI1 3AEQB 3UUEA 4ZCIA 5A03A 4RKWA 3M70A 2PM8A 4Y18A 4RNDB 2BR4A 1QYXA 1X7YB 5KWIA 1IBLB 3DD5A 1R8SA 1MW8X 1Z3IX 5EJ4A 4IUYA 3GFGA 4M46A 1DIAA 1KVUA 5FA8A 4BN5A 4O4JB 4U02A 2VF5X 3KTDA 3EWSA 5EUQB 1PJ2A 3BXXA 5K8VA 2WI8A 3D0QA 2EG5A 2VO1A 2H2FA 2O2ZA 4C0XA 5BSEA 3S1AB 3VC3A 2Q9CA 4Y0AA 1ZH0A 1KEVA 4P2GA 1JVNA 4RSGA 2ZZNA 3FWNA 2CYBA 3RCBA 2IZ0A 4AJ2A 2QRZA 4GL2A 1SVUA 5JCPA 1WHTB 4DGQA 2OK8A 3VPSA 3W06A 2RE8A 1R0RE 1JPVA 3DUFB 1YZLA 4JOCA 4H1WA 3AIKA 3EMBA 4IICA 3C7AA 4EKIA 1R6TA 3QF4A 4RXMA 2MINA 4LOIA 5K0EA 2HSDA 4X84A 4XCQA 1TW3A 4XVRA 3WLPA 4BEBA 1XZLA 3AO0B 1T6NA 3QUSA 4U7DA 2GEKA 3UHPA 5EWMA 4EQ6B 3WLNA 2VTEA 2XYRA 2OSBA 3ETHA 3QPDA 2XUZA 4OQMA 2QK4A 2O2EA 4FFRA 5BUQA 3C70A 5DJ5A 4IGKA 1CUFA 1TCCA 2Q27A 3ADPA 3LPCA 3MCUA 5D6NA 1DG3A 1TGVA 2CK3D 2QLFA 1EBBA 1EUDB 1QLHA 3DC7A 1T9ZA 3EG9A 1M7GA 3PWSA 3QKRA 5IT0A 3WIEA 1LSUA 4KQHA 1E7QA 3I9NA 2FEOA 1BHJA 5EJ8A 2BFCB 2NUAA 2VYNA 3OUTA 2DCMA 4FX5A 2QKYA 2JAWA 2ZSEA 3ZIUA 3MINB 5CEJA 3DEAA 2O8DB 1Q1BA 4QICA 5IK2A 1Y5NA 4AT1A 2XTMA 2IELA 3EODA 1FS5A 2E4AA 5BSWA 5J23A 1AV7A 3AF1A 1NI4B 3SJZA 3ICCA 2GJ9A 1GUDA 3JYOA 4C2BA 1JR4A 4B6SA 4GICA 4TMVA 3ZHYA 3UGQA 2O5CA 1DBPA 1MCZA 1JBQA 4PXAA 5I7SA 3BE8A 4XIYA 1C9EA 5C46F 3O73A 5G3ZA 1KY4A 1I7PA 5KNCA 3AL3A 3N8GA 5I8ZA 1K4KA 3A4TA 4Q1AA 3LLVA 1J4AA 5AMXA 2BJHA 4G86A 1K27A 1O5IA 5DTJA 5TT1A 3HH8A 2VR1A 3UWKA 3L8CA 1NQTA 5IWAB 2IX3A 2R7AA 4PC2A 4D3ZA 3S2FA 1CDDA 1EFTA 4TMZA 1FUIA 4ERXA 2A92A 2LD4A 2JCBA 1TKRA 1M2OB 3QUCA 3OLVA 2ZUWA 1L4YA 4MS3B 5EYPB 4CL2A 3UNXA 5C7LO 1ABEA 3M4XA 2CLHB 4R9NA 4DLAA 5J4YA 2XCTB 4JI7B 1P4HA 1FDUA 4JBGA 3UMGA 3DNPA 4Q16A 4Z1MA 3MJCA 4FFDA 5ISMA 4Y1GA 3DHEA 3L6UA 3ZWMA 3ROQA 1R8XA 3LO8A 4UREA 2RFLA 5IEJA 1YRLA 5COAA 1YVPA 3R76A 4L4XA 1OFUX 2CVZA 5ES4B 1DXYA 4MMYB 4FE7A 4QE3A 4RD3A 5KTMA 3M1IA 1A9XB 4LAFA 1UXOA 1Z4MA 3RSOA 3PHGA 1DG1G 2JH3A 5IZ4A 4PSCA 1U7DA 4WFIA 5CIWA 4CNBA 3NDPA 1G5QA 3EGXA 4ME6A 4MPRA 3OM8A 4P3NA 4U2DA 1RYNA 4E5VA 3W6NA 3EXHC 2V58A 1O94D 2DR3A 5DX8A 1PFGA 5K9ZA 2PSHA 1YMUA 4YAWA 2YV5A 3X1KA 2OGSA 2OY0A 1DEXA 2DYKA 5IJZA 2A9KA 3N58A 1NR7A 1ZI6A 5BW6B 1ONPA 3FM9A 4CMAA 5INTA 1TLTA 1MX1A 4DCOA 3DMDA 1ZGZA 2O3JA 3QE0A 1DOZA 4HUQB 2ZW9A 3FZGA 3Q3JB 4Q4DA 4C0HA 821PA 4S24A 2QP4A 2EATA 1GLNA 2MTBA 2LP4Y 4PWZA 4YP6A 4B47A 1GKUB 5LQRA 4FUQA 2BFBA 3SU8A 4YPFA 1X13A 2JLSA 3IXQA 3M34A 4DUGD 1BCRB 1D4ZA 3AGQA 2PG3A 2DUWA 3QJGA 4KXUA 3BG5A 3P9CA 2ODAA 3R3VA 1NNSA 2NTJA 3EGDA 1DIHA 1GUAA 1X6VA 2CE7A 1N7HA 5YASA 5LYJF 1WKBA 5FLKA 1AM4D 3HY6A 1H1LA 1Y6GA 4NCBA 2ZYHA 4P38A 1D1TA 5REQB 3FYHA 4MAAA 4ARSA 4XLTA 3O03A 3QVLA 4AU1A 3PPIA 4HB2A 3EW9A 4PFQA 1IVYA 2EX4A 2FSVA 5FYDA 1IG3A 5D3KA 1ZOOA 1IEXA 2IIBA 3S8EA 4EKYA 4S3MA 1E69A 4NS1A 4ZJPA 1DP4A 1HOXA 1L4EA 2XIJA 3GU3A 3PGA1 4X9XA 3RC9A 5A5FA 1NN1A 3DW1X 3NORA 4R6WA 4DC1A 4DSTA 3I30X 1GL9B 2QTFA 3DS8A 5HIJA 2O14A 1P1FA 1MB4A 1ZH2A 3KDAA 3RG8A 1RI2A 2AR9A 2FFRA 2F8LA 5T57A 4UBOA 4IRUB 1ZKMA 1JJBA 3ZKAA 4A8PA 2AA3A 3TLMA 2ZCVA 4Q3KA 3VTAA 2W2NA 5J43A 1ML3A 1ODSA 2JLVA 1NVWQ 2J59A 2XA9A 2ZBQA 4S04A 1P6QA 4E5SA 5BUZA 2QU8A 4DR6B 2PZEA 1HTWA 2XCIA 1V45E 3P7MA 4FXPA 4MVWA 1Z0KA 3E81A 3HGQA 4KFCA 5CBKA 2Y1OA 4PYIA 3KR2A 2IV2X 3COYA 2WAOA 5JSHA 4QOSA 2B6NA 5E4FA 4AYWA 4B09A 1ISIA 1U3FA 2ZJ0A 4ENTA 5KJCA 1P0FA 1FNDA 4CIVA 3V8BA 3HV2A 2EEZA 4FWIB 2BKVA 1AZSC 5L8VA 3NTOA 3N2EA 1PKXA 4WRRA 3UYKA 4MI9A 4NCIA 2I76A 4MP8A 4Z8XA 2G71A 4B4UA 5KTOA 3DCJA 1P75A 4HZIA 5BVGA 1OD6A 4PY2A 1OB2A 3MPOA 4BNTA 5DV9A 1S3FA 3ZBTA 4HH3C 3V4LA 3AWDA 2CBGA 1DAPA 1ZC4A 4DS3A 5L6MB 3T5DA 3K8ZA 2VP5A 2I4TA 1ZVJA 1I2BA 1G5PA 1XRNA 2ANBA 2WG0A 4FGWA 3ZU4A 5GOZA 5JJBA 5TPZA 1A77A 3ADCA 3BJRA 3KUUA 4KIJA 3TUZC 1XMSA 4JXKA 1QK3A 3BMCB 3HKBB 1BNCA 5EE0A 4C7KA 3QHAA 1C80A 1U28C 4QAQA 4AWAA 3SOZA 4J8PA 2H0AA 3ESYA 3REQA 1GZHB 4XB2A 1I7LA 3RHTA 2CLEB 2ZBDA 4Q12A 1BIFA 3BRSA 3TAHA 5TF4A 2QTAA 4FZ3A 3V46A 2FMIA 4QU0A 3RO7A 2BHSA 3EVCA 3R8FA 4X44A 1OYVA 1BXRB 5MF6A 2R6HA 2AYXA 4C0QC 5C53B 4PIVA 1ITZA 1SHJA 3HYCA 1CDOA 1RI1A 4GVXA 3WBJA 3R9XB 2BELA 1TM4E 2JJ1A 2KHZA 5DLEA 2Q29A 5KTKA 1T25A 2Y9PB 4JOBA 2O54A 5AM5A 1SVLA 4BJ5A 3DDHA 5GV7A 2B25A 2FWMX 2BN4A 4P22A 1W7AA 3WQQA 3TLCA 5C1IA 2IYOA 1YDWA 4IF6A 3KALA 4RLSA 1TUBA 4WPGA 4EITA 2W2TA 4CQMA 4OA8A 1F20A 1YBFA 1CETA 2RKOA 1CRZA 2IZZA 3L5KA 5LQJA 5I3ZA 4PZ9A 3KBOA 4V39A 2GLTA 2BBTA 3OD1A 3Q3IA 1EXWA 1FCJA 3JD3A 2NZYA 3DZCA 3SXJA 3Q1KA 1NDQA 3CLKA 2V8OA 3CX7A 3GDHA 1FDVA 1QIHA 3RPEA 4MMXB 4DCTA 1GV1A 1OXTA 3ZJ4A 2ZSIA 2JIQA 2H57A 1X1DA 2W2QA 1JFFB 4WGGA 4PAWA 1YZVA 2NZ2A 2C83A 1OBVA 1CQPA 5C7YA 5JECA 1JLKA 4RYLA 5HWSA 4BNLA 4JGBA 5JY1A 2WFMA 5IW8A 2BV3A 3HU1A 1LFDB 3KL2A 1N2IA 4C21A 2CD9A 1PJ4A 1R4AA 2PKEA 3HE3A 3SC6A 4ROTA 1WULS 5TQVA 1M1YE 1Z5ZA 1EFVB 2G0AA 1NUHA 2OHJA 2CFIA 4LX0A 3RT7A 3WGZA 3CZMA 3UJBA 5IANA 2IS4A 3ZWOA 3G5LA 3D8NA 1GFIA 4KQGA 5IH3A 5B1SA 3M3PA 1C1DA 3G2QA 1YRHA 1VZ2A 1O6ZA 4J0KA 4WZAA 3HJTA 4PLFA 4YT2A 3FHTA 4OLAA 3ND6A 5FOSA 3K35A 3DT6A 1LBQA 2XB4A 5TPWA 3HZHA 2BEJA 4EARA 1ULZA 1YB5A 2IPNA 2GCOA 3JVUA 3KHKA 3OCVA 4M3NA 2QBYA 1RFLA 4I4LA 1W96A 2I1QA 4XFKA 2YOGA 4I1UA 1HMYA 2JHPA 1TLLA 3IQEA 3K4HA 3QUQA 4LOKA 3WK7A 1U3CA 3K73O 2RGWA 3DMFA 1KXJA 4L5IA 4M76B 4FFBA 3VHXA 5DN6A 1FFGA 3GFTA 1KZ9A 4YAOA 3F6PA 5KSYA 2RKBA 1GPUA 3H6GA 4JJEA 4K6OA 2PRKA 4KK4A 4I3GA 5FWDA 1P2GA 2LCQA 2AOUA 2WKQA 1IN7A 2YL2A 2AC4A 4OXYA 4ZCTA 2ODNA 2UDPA 4F5EA 4ZI7F 4WBNF 2HHHB 2R1VA 1EQ2A 4ZDIA 2FX5A 2HNAA 2VAMA 5ITWA 1E5VA 4NG5A 2WZDA 1A76A 1WCIA 3RJMA 3E82A 4M0EA 3ZVRA 3B6IA 1E2NA 4J16A 3MOGA 1E66A 3N39C 2PKYX 4GAEA 1U7WA 1HL7A 1E6CA 1SUBA 4RX1A 5AKZA 4ZAWA 5ITZB 3AI7A 5CLGA 2FWAA 3ROFA 3ZE2B 3FXAA 4JX9A 2SKEA 5F64A 5DNCA 1GP2A 2UZ3A 3AUUA 3LXXA 1IEWA 3STWA 3WXBA 4OI0A 2C9BA 2KPOA 1JSCA 1JAZA 3IESA 3IHWA 3R20A 3TRFA 4KPEC 1RZUA 4G4IA 4HC4A 1SVWA 2OD7A 4QPJC 2MSNA 1JYEA 1PGNA 2RI6A 2F90A 3M1AA 4L7VA 1J2JA 3FI9A 5EWLB 2C7VA 4EI9A 3IQHX 4NBTA 2XJ4A 3V1LA 1WXQA 1T36B 2FZEA 2QJFA 4XQ9A 4HNQA 1Y3HA 3DAPA 2VNHA 3HZZA 5FNZA 1K8XB 3ER8A 3C5VA 4FVTA 2RGBA 3L8DA 1A7JA 2ADFA 3EC7A 1OIVA 1Q0SA 4I08A 2P9CA 4G25A 1M1YB 5JASA 3QWHA 4ZYVA 4J07A 1E4EB 4AJPA 1T8WA 4IHKA 2FN8A 4FI3C 2M6KA 3ROZA 4BLPA 2PUFA 2IBMA 3NBZC 4YDSA 1Q0HA 3MUOA 3RU7A 5B1YA 2Q1UA 3GP3A 4QQRA 3BH7A 3LGAA 4RKEA 1NI5A 1PVDA 4Z53A 1KKMA 1FTNA 3I8OA 3OHSX 3UG6A 5CGZA 3WGHA 4E2FA 2NQTA 1GNRA 3DB2A 3DJYA 3LPNA 4ONEA 4Y6GB 2RHBA 4W1QA 1T2AA 1UJ2A 1CWUA 5G53C 4P83A 4RTQA 1NQAO 1ZK3A 3RSFA 1JYSA 2I2CA 3U4QA 3QF4B 2DBZA 4Q7EA 2MINB 1OI2A 3PHBE 7GPBA 1T29A 3BZWA 3GZTB 1KO8A 4J3FA 5CVEA 1O57A 1XD9A 4U2CA 1TVKA 2V4UA 1ENYA 3KK0A 5EWMB 3MCAA 3CRZA 3E9YA 2WHRA 3WI7A 2C5FA 3GAMA 3SC3A 4DUZB 1CJMA 5EVJA 3WG9A 4M9ZA 4MUIA 4KOAA 2GJ8A 2LIVA 1R00A 4TQ9A 3AP1A 4OHMA 2DR0A 4BAGA 2QPTA 3EG9B 3HBLA 5TR9A 5JU6A 1ZNQO 1OXKB 3V4RA 1IY8A 1BKSB 1MNAA 4JAVC 3L01A 3LXMA 1N5JA 2P30A 2NUAB 2Q99A 2AZMA 3V1NA 2CD7A 2Y4OA 5ALVA 5CH8A 2JL1A 1URPA 1K6IA 3JQ9A 3MS2A 3ZZMA 4DGSA 5KQMA 2OXRA 1FS6A 1IBKB 3PQCA 4OO3A 4HQKA 2RHWA 3BIXA 3E61A 4PVCA 3W5SA 4II3A 1Y98A 3MB5A 4YY3B 1T4MA 1LRLA 1UPCA 3B20A 5CTJA 1EJ6A 3FOCA 2PRJA 1EE2A 1QZTA 1YDGA 2YXPX 5LOVA 3O8OB 1Q11A 4KQ6A 1X74A 2HRZA 2C03A 3OQPA 4K6CA 3AOEC 1Z18A 2CFOA 4MPJA 2XXAA 2WOJA 2HT6A 3ZXXA 1J0AA 3L7OA 3IMKA 1N2JA 2QIOA 4HK4A 4U8HA 1ZG3A 1BXZA 1NX6A 2QNIA 1K68A 3FNEA 4EG6A 1XTUA 4NICA 2V6BA 3L77A 4A8TA 4IO1A 2XA1A 1XRJA 4QPDA 4RCZA 4RIHA 4IL5A 2GCIA 3FKSA 2CLDX 3R5SA 4GM1A 4XEHA 1QH0A 3THSA 4F9TA 5JROA 1FDOA 4DJ5X 2DPHA 3CVJA 3M1YA 4XDYA 3FUUA 1S3GA 1ZX1A 4Y2JA 3IP3A 2QVYX 3BTSA 1J20A 3F8WA 5K0NA 2M6RA 3KWMA 2X4GA 2XYPA 3EWNA 4H16A 5B6IA 5C8XA 4KR3A 1AXEA 1F4PA 1HV8A 5CA0A 4CKXA 4YYZA 5KHLB 3QP9A 2JIPA 1Z6AA 2BJWA 3ME5A 3K9FC 1UJCA 4E08A 4AQYB 3T5PA 1N0VC 1FMFA 1FFSA 2XITA 2X1LA 2R8PA 2V8BA 3AVWA 5EFZA 4WWHA 4GGPA 4OYLA 3O74A 1YC2A 1E1YA 1YCGA 1PQUA 4JJZA 3V9AA 3VVLA 4X1YA 4D9MA 3J80A 4R7ZA 3PGKA 5AI4A 2HRBA 3Q2IA 3UJ9A 1HR0B 4IX1A 5CT8A 3FRJA 5C0OE 4U9HS 2YY5A 1E64A 4HDCA 2CNNA 3R7NA 1ISHA 3EGXB 3U48A 4M1KA 5I51A 1ENPA 3TZKA 1WPQA 5JAZA 3OTQA 1NJFA 1EEXB 2OL4A 3DFFA 1T0JB 1ZM9A 2NYUA 3KXPA 3X1ZA 1O6GA 2QMQA 5EJ7A 5KB3A 4JLSA 3FRHA 2Y1WA 4I4NA 1SQSA 1U98A 4NJMB 4TVKA 1N1EA 3JCZA 1VCIA 4U7GA 3TBHA 3UWPA 3S7TA 1R6BX 2W6IA 4CTNA 2A7XA 1MEJA 3DVRX 1EFDN 2J07A 3QKWA 3EAGA 2HWYA 2VYQA 2WKRA 3BB3A 3V1YA 5FRDA 1Q7GA 2ST1A 3D1VA 1ZMRA 3EF0A 2BFBB 3FAZA 4MCJA 5FBHA 3L6RA 1RHQA 4PANA 4B3CA 2FWJA 2OSVA 2W7TA 4G6ZA 4D6YA 4YI3A 3AM5A 2FRVA 2HB6A 2J46A 3EGDB 3GLRA 2QMYA 4I8DA 1N25A 4DQLA 2FF5A 2ZT7A 4QUAA 5LNK1 3OPXA 5KWJA 1AKVA 2ZI9A 1H1LB 4TRJA 4G1VA 4FSHA 3PQ8A 4MQBA 5HZGA 5LR6A 2BR5A 5DU2A 4NULA 3QG5A 2ZI6A 2IIPA 3MIIA 4ZOLA 3O82A 3FETA 4L2IA 3F98A 5C31A 1O0BA 3IQZA 3KCQA 2EERA 2Z8YM 3ZWWA 3DT8A 2P9JA 1IDOA 3ITEA 1I4TD 1JBKA 1M1XB 2VDQB 2ZWMA 1CUYA 5HIKA 4JEMA 5DPMA 1CY7A 1UQRA 3WGVA 1F9EA 3A4YA 3ABZA 4TXMA 5K0ZA 2DH6A 4GMKA 4ASUD 1AHNA 1UOOA 3KQPA 1H3EA 3DLCA 1TT5A 2AMYA 3BIJA 1U65A 4RMJA 3UN1A 4HS9A 4L76A 2B83A 2EFDB 3NIDB 4MH0R 5CFMA 1CVLA 3HK2A 3CF6R 1W34A 1G4UR 2IXDA 4YIKA 1Y42X 5JD4A 3CINA 2QD4A 4Y8VA 1HQCA 1MX5A 4CDMA 4FGKA 4CF4A 5F12A 4F3CA 2EJVA 5DDIP 9LDBA 3LC2O 4PTZA 1BWQA 5IMBA 4A0QA 2E6KA 3IBCA 3OLQA 4I3FA 1SXHA 5AVOA 1ZGAA 3R1IA 2GN6A 2QXUA 1XJWA 1SKAA 5ICCA 5LQDA 3LM8A 1N7IA 3II6X 3SMVA 5AVXA 3UJ3X 2GZHA 1UPUA 1XMPA 5K8IA 2O7NA 2HCRA 4MVCA 1CJVC 3U26A 1VMAA 5EIOA 3THRA 3LFHA 1E0DA 2PH1A 4WZAE 2X13A 2GVZC 3IP8A 4ZMSA 1UKBA 5BVGB 5CLJA 5I4IA 4DUGA 1SUAA 2XNDA 5IJ9A 2HLHA 3TSOA 2GDZA 3L8GA 2RHJA 2YRFA 2HA0A 2C7GA 1G41A 4DRXA 2WE8A 1EVIA 2Q3BA 1PR9A 3KPUA 3HDJA 3WAJA 2BSAA 5CA1F 2C9MA 3EFBA 4Z86A 1OHHD 3D5EA 2F6RA 3ZWXA 1BFUA 1U8FO 3CKMA 1ZOSA 1RYFA 1WHSA 2OV1A 2G28A 3G9TA 4PO3X 1BS1A 3REQB 4C7VA 3ZZUA 2YY6A 3QOWA 4EF6A 2QPAA 1XQWA 1JW9B 2TS1A 3L4EA 4RV5A 1JDUA 2D7DA 3LUKA 1G8HA 1VLZA 4NCJA 5LCXA 2YWGA 2DWUA 4R01A 4B5LA 5FULA 4LKRA 1ZN2A 4QRHA 2EKLA 1ADCA 4TZKA 3VOBA 5HEKA 4TLDA 5KBYA 3VFDA 1M6EX 3FMGA 5H8WA 1HOTA 3I5YA 1U3WA 3RSSA 4OI1A 1JHYA 1VJGA 2I2DA 4YJ3F 4X3PA 1JQ3A 5HKAA 2FLVA 3IHTA 2OO5A 5AKGA 3GGGA 1L4FA 3JR7A 1Q57A 4DRYA 2YHIA 5LQNA 2CMGA 3EEOA 4WZBE 4COOA 2PHZA 2GZMA 1GCIA 1N6NA 4KVAA 1TUBB 3GLFA 4CQMB 4LI0A 5AVTA 4D9EA 1WB9A 1ZM2A 1PBTA 3A2NA 3KG2A 1CUZA 1GAJA 1H5UA 4GWKA 1F12A 3LO5A 3TBFA 5DTMA 3HUTA 1QF7A 2ZJBA 1J70A 3B60A 4Y1EA 1RW4A 2X5NA 4RMHA 1VG1A 1CB0A 1SCBA 4PG4A 1GQQA 3S8YA 3L6CA 1DO8A 2PIAA 1K6MA 5G4LA 4EVIA 1Q74A 3SZLA 2B8JA 3H2ZA 2HSWA 1YHNA 5DHQA 3V55A 3L93A 5HMLA 5JOQA 2JGEA 1EG7A 2CVHA 1XDSA 4X41A 5KCMA 4D9JA 3FJ1A 5KTNA 3GIDA 1GGEA 2C8JA 5LZ2A 2Z0MA 4ZI3A 5A06A 1Y7LA 4F04A 1GTZA 2X5KO 3CNEA 4RCYA 1B00A 2AVNA 2WWHA 4FEYA 5FNVF 1R5OA 3QX9A 3U61B 2OV3A 2XEDA 1FVOA 2C2MA 3AERA 3GFOA 3LK7A 1C1DB 1MZVA 4Q02A 1T6XA 3WXMA 4WZAB 4DFDA 5EZYB 5IJ0B 1NV9A 1X1SA 5SY6A 1EP2B 3M5PA 5EEGA 1B76A 2C1XA 1QCDA 2RDMA 3M9WA 1PAUA 2AQIA 4JI2B 1VC2A 1Z7GA 3V2HA 3W90A 2VDOB 4JH0A 2GCOB 2EHJA 2H5EA 2J09A 5K8UA 3IB6A 2QBYB 1P1BA 4F1KA 1Q21A 2X0RA 1CUSA 1M0TA 4JVLA 4JLVA 4JT4A 5NULA 1LS6A 2DWCA 1CY2A 1Q1ZA 1QIJA 3CKKA 3UMSA 4KNYA 2A1UA 3K31A 1PJQA 5E3IA 3ULKA 2GPNA 4RIEA 4A26A 3DEYX 2OTCA 4OGWA 3VHXB 4N5DA 1ZLXA 4LS3A 4UHBA 2IYNA 3GEIA 2B61A 2D8AA 3VO9A 1JLMA 1FTWA 1GV0A 1UPAA 1CF2O 4L15A 3RFCA 1K6XA 2G1PA 2AOUB 1N9KA 1YZHA 2EIHA 1A2OA 4RQUA 1BS9A 2AEJA 3U17A 4PV7A 521PA 4IZHA 2ATVA 1Q3KA 3E5RA 1PG0A 4U9IS 1R8JA 5FHQA 5A9RA 5HK9A 2AJTA 2JLZA 3AV3A 3FDZA 2XGMA 5ENDA 5DW0A 4C22A 2EFGA 3UMMA 3WB1A 4POAA 1MVNA 4NU5A 2B94A 2E21A 3C43A 5IZCC 5KTRA 2Y1GA 2JCXA 1WMDA 3IUMA 3PE6A 3R0QA 1WNTA 5C3MA 2AB0A 2XYHA 3TW8A 1U6KA 3WRWA 2O07A 1R9NA 3OIYA 2INGX 3N8KA 3OKAA 4AP5A 1PDVA 3GXBA 1QKIA 4JVMA 1EFHA 4QUDA 1ORTA 2H1RA 4OXRA 3Q1LA 1TMOA 2OZKA 4P4SA 2ZRQA 3TGPA 4ZFNA 4M7WA 1I4LD 4EVQA 2YMPA 3FNGA 2EGHA 4N9QA 5B3JA 2QD1A 4Y30A 1JKJA 4E2WA 2PFSA 5AWFC 5A4FS 2GA9A 2QVLA 4PPQA 2QG9A 1WW8A 1RKUA 2ECKA 2J9RA 1NTOA 1ZNZA 2ZS8A 3N9IA 3QNWA 1PEDA 2J9YB 1LI4A 1RAEA 3FD8A 4IYRA 1PF7E 2A78A 1SRRA 2C9ZA 2IZ5A 3HB7A 1MG5A 1OXBB 3B1VA 3I39X 2E0IA 3IIJA 4G5OA 4GOOD 5ICMA 2DFLA 3HHEA 1YZUA 4G0XA 2XDQA 8ABPA 4D9IA 1SKUA 4HGPA 4UU1A 1J56A 1L9XA 1WKCA 3K5WA 5T7BA 1V5IA 3FYUC 3U56A 1MPXA 3JQ8B 2J3LA 3ZKWA 2G1JA 4KREA 1YKFA 3IVAA 3PNBA 3R5HA 4YJHB 3HUFA 2BFMA 3U3JA 3ZEIA 4K05A 3WDKA 1V8DA 1O9HA 2QRJA 1ZXBA 2EW2A 3OO0A 4R9UC 5IYZA 1AJEA 1RHUA 3HI4A 4B3RB 4QUEA 1L5HA 4C4TA 4GDFA 1JJIA 1NWCA 4PZDA 4RGBA 1VJCA 5AOAA 4MV8A 4RETA 5KS2A 3X43A 2FPWA 2ZYAA 4PGFA 2YZKA 4D9FA 2GKGA 3EZGA 1TVKB 1VHQA 2QD5A 2R79A 2H18A 3K20A 4MVJD 4CTOA 1FW6A 3HVRA 4GI7A 4K7JA 3DDOA 1X7ZA 4BQRA 1T9HA 5KYWA 3PCTA 3AUKA 1Z2CA 2VYFA 5CYOA 3SM9A 4XQ0A 4GMFA 4YNBA 5FBRB 2PGIA 2FA9A 2JLAA 3IAM6 4XIFA 3ZDAA 4C5CA 1C7QA 1N1DA 3LJKA 3M6WA 1YL7A 3A04A 3MUNA 5EGSA 4EA9A 8OHMA 1G8JA 1MB9A 1ETUA 2IPMA 1KXZA 1MDFA 2HAEA 3M6FA 3HKEA 3L41A 3V7WA 2VK8A 1JMVA 3CEAA 3KYCA 5A4MS 2Q07A 3DTNA 2ID4A 1NBWB 3PC4A 3R2JA 3ZG6A 4CMIA 1O54A 1XCBA 1XAHA 2XR1A 4X0EA 5FUBA 5JO0A 5EKXA 3D6MA 4FD3A 3BGVA 4DV5B 2X5JO 4NYJQ 2IIQA 2WILA 4HDSA 3SLRA 1KE2A 3B85A 3EC2A 1YDEA 4PG7A 3CLRC 1QZ3A 1BE0A 2P3QA 3IAFA 2FVYA 3K0SA 5ALHA 3PE4A 1F1JA 2P0EA 1OLUA 5EFOA 5LOVB 4LI3X 4X6YA 2UYGA 2P41A 4TZ0A 1IZYA 1P31A 2OG1A 2GK7A 1EX9A 4EY5A 4R4JA 2XXAB 4B3FX 5FA6A 1MIOB 2ARKA 1M54A 1SZJG 3FSEA 5DYWA 3P4YA 3LHSA 4PLGA 1XKXA 5H02A 1EUCA 5HIMA 2HJWA 5JWHA 5CDTA 4DSNA 3JQGA 2Y1EA 1WMEA 2BEUA 4KZKA 2Q1SA 3LYUA 3PDJA 2AQHA 1QU2A 4OV6B 3FVVA 1DKNA 2Q5QA 1LTHR 4UCFA 1CUBA 1WZNA 1Q7TA 1DFIA 4XJSA 1IZ9A 1JVBA 3LA8A 4I1VA 1KNQA 4IVPA 1M2KA 4F5DA 4ZJZA 1MO2A 1ZD4A 1QG0A 2VT2A 2Z5LA 1IM2A 3A25A 3KQTA 3LUPA 3FB4A 1VL0A 2NXWA 3IT0A 3P4XA 2NPFA 1VRWA 1IHOA 4NR0A 4ZDWA 4BMYA 5CA0B 3LY5A 3H83A 3R4CA 3DFMA 3H99A 4L16A 2JFYA 2H8GA 3TOXA 2DRIA 2YIJA 1HO3A 3HABA 1N2ZA 4XLLA 3C98A 4KQEA 3M4YA 1UC5B 4KBYA 1XRQA 3MLBA 3HCDA 4AMYA 1EWQA 4GLJA 4F8YA 4X1YB 4LY6A 4HATA 2QL7A 5BQ3A 2I6TA