5FUQA

Crystal structure of the h80r variant of nqo1 bound to dicoumarol
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGRLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Novel Structural Hot-Spots for the Correction of Functional and Stability Defects in a Cancer-Associated Polymorphic Nadph:Quinone Oxidoreductase 1 from Sequence-Alignment Statistics.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
total genus 93
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2016-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fuqA00
1TLLA 2OHIA 1CZHA 2XOEA 2QX8A 4QODA 3NHYA 5NLLA 4U7FA 2QX6A 5F51A 5B3LA 2FLVA 4DY4A 1AG9A 1XI2A 3NFRA 4OXXA 3NHKA 1C7EA 2OHJA 3NHJA 4N82A 4DIKA 3OVMA 1OFVA 2BF4A 3K1YA 3N39C 1J9ZA 3L9XA 1ZWKA 2ZKIA 3GAMA 3NHLA 2FZ5A 5LLDA 3N3BC 2MWMA 1FLVA 4U7GA 1FVXA 3KAPA 3P0RA 4C0XA 1J9GA 1X77A 1XYYA 2FVXA 3ESYA 5FUQA 5JROA 4GI5A 3U7IA 3RPEA 4QOFA 5LBTA 2V9CA 2Z98A 4LAFA 4N65A 1YKGA 1AKUA 3ESZA 3UXEA 1CZNA 1BU5A 1XT6A 3OWXA 4FGJA 4PTZA 3OJWA 1H66A 2GSWA 3QFRA 4FX2A 1AKTA 4LA4A 2RG1A 2Z9CA 1DXQA 1YCFA 1YOBA 5A4KA 1FTGA 3B6IA 5LMCA 1I1OA 3HLYA 5LBUA 1OBOA 1RLIA 3FX2A 4ZVKA 3D7NA 3OX2A 2ARKA 3QE2A 4U7HA 2FOXA 3F90A 4D02A 1QR2A 4NULA 3NLLA 4F8YA 5F12A 1V4BA 2Z9BA 1CZKA 1AZLA 5ULLA 3NHPA 1D04A 3U7RA 2X2OA 3ZHOA 2FDXA 3TZBA 1QBGA 1DX9A 3SVLA 4C76A 2QX4A 1FLDA 1FLNA 3ESXA 3HA2A 2Z9DA 2FX2A 1ZX1A 5F4BA 4ZVLA 4ZVNA 2BPOA 2QMYA 4GQIA 1YCGA 1D03A 2R96A 4CETA 2V5UA 3OJXA 3OWHA 2X2PA 3N3AC 3LCMA 3OX3A 4DILA 3KLBA 4PU0A 1CZOA 2HNAA 3FNIA 3JSXA 3KEGA 4YAFA 3TEMA 4YAOA 4HS4A 4Y9RA 5FX2A 4YQEA 2N1MA 1B1CA 1FUEA 1QHEA 3NHUA 1H69A 5NULA 4QOGA 3UXHA 4QOEA 1KBOA 3B6JA 3LT5A 4FGKA 2QMZA 2QR2A 1RCFA 4LTDA 5EAIA 2BN4A 2KQUA 3F2VA 1WSBA 3NHFA 2R97A 1AKRA 3F6SA 4LTMA 5LVAA 1CZUA 1ZWLA 3O2NA 1J9EA 1CZRA 2FAXA 3O73A 2HPVA 2BMVA 1RLJA 3KAQA 3W79A 3W78A 4YAUA 3K20A 1DXOA 1RTTA 3FVWA 1AKWA 4QOJA 2F1OA 2HNBA 3ES9A 1CZLA 2D5IA 2QWXA 2OYSA 4H6PA 1OBVA 2AMJA 1D4AA 3NHSA 4Y7CA 1E5DA 4C0WA 6NULA 5LJLA 1BVYF 1FX1A 3HR4A 1SQSA 1T0IA 3EDOA 2BZSA 2FZVA 3OX1A 4GR9A 1AMOA 2OHHA 3NHRA 2Q9UA 4PTYA 4YALA 3R6WA 2M6SA 2Q62A 4XDGA 5FA6A 4FGLA 2A5LA 1JA0A 2B3DA 1YDGA 4HEQA 4NLLA 2QX9A 3W77A 1GG5A 4BMOB 1KBQA 2KLBA 3F6RA 1SG0A 3GFRA 2MTBA 3GFSA 3S2YA 5LJIA 1J8QA 1TIKA 5TGZA 1T5BA 4QOHA 3W7AA 3B6KA 1AKQA 3B6MA 3L9WA 4XDHA 1XYVA 1YRHA 4LTNA 1NNI1 1AKVA 4C14A 2MOKA 2V5VA 2W5UA 2WC1A 3G5MA 1F4PA 4ICIA 4S24A 4ESEA 4CF6A 4N9QA 1YCHA 4H2DA 1JA1A 2XODA 2FCRA 3TE7A 2M6RA 4R81A 1AHNA 3NHWA 5EA2A 1VMEA 3QFCA 1FLAA 3FW1A 4M0CA 4YAWA 3FJOA 4J8PA 4QOIA 1WSWA 4ZVMA 5B3KA 5BUCA 5EMNA 1C7FA 1QRDA 4BMPB 3GFQA 4Y9UA 3EYWA 2MT9A
chains in the Genus database with same CATH superfamily
1JIUA 4KLZA 4RORA 5IABA 3PEUA 1LNQA 4MKXA 3GVIA 1E99A 4GG1A 4U0KA 3WJAA 2IJGX 3GJQA 3LWZA 3LXRA 1K6JA 4TGLA 1UIRA 1RP1A 3L5OA 1Z0SA 1SBHA 3I2YX 4MS4A 3O74A 3KKPA 5FTMA 2V9PA 2Y93A 1LBSA 2I55A 2VP5A 2ZBUA 4FYIA 1VFNA 4N7RA 3UHFA 4EFDA 3D4OA 3T5MA 1QV7A 3S7TA 1MAWA 2RGXA 2BKUA 4Q34A 5LNK6 4PO1A 4CM7A 3FR8A 3VKWA 2Q5CA 2I54A 1MX1A 2NTJA 1Q21A 3A14A 1UOOA 2AK2A 1DXQA 2WIAA 521PA 3RKRA 1P61B 4ZCTA 3I4LA 5ECWA 3WWCA 1BOFA 2VJKA 3B5JA 5L95A 4HLDA 5FJJA 1KEEA 3MWDB 4TSRA 1NBHA 3DQQA 3HJTA 1JFVA 1NVKA 1BWQA 3O0DA 4D02A 1RM3A 2DC1A 2BMAA 1IHPA 1JSZA 3SEZA 3FY4A 4A82A 4CKBB 2NU8A 3AVOA 2V6GA 4HB3A 5HUQA 3HU2A 1PJ8A 1L5OA 3M89A 2B8TA 1DO0A 1T36B 1UBKS 4DQLA 3N8KA 3GRRA 2A5YB 1NPTO 3QVVA 4IIVA 1GYRA 3TSWA 3MTEA 3R41A 1ZSYA 5ALZA 4KN9S 2I1VB 3R3HA 1JTVA 4HLQB 1KMMA 4OHYA 2PFKA 2XGSA 3LY9A 4YT5A 5IVIA 4DGSA 2RKWA 3AVTA 1WSDA 1ZIDA 2X8WA 4OL0A 3O75A 4YAFA 3TLMA 4YMWA 1UT8A 4KQHA 2ZQYA 1Z6ZA 3ZS9A 4S2UA 3ZHBA 5JRDS 3T5PA 1D8TA 3CLUC 1NN1A 1H0RA 3A7DA 1ORDA 2NT3A 4B4UA 4G4IA 3GFPA 4V3CA 1RRGA 4HX2A 4LPKA 5AVZA 4HK4A 4F2HA 1CYDA 3R9XB 4R41A 1R6XA 1CRZA 2HWYA 2IYUA 3COWA 4XIYA 1XEXA 3K1AA 5IARA 3HCRA 3OD5A 1QVZA 2GEDA 2GVNA 2Q50A 3CF4G 4G4SO 4V39A 1UADA 4G36A 4KXUA 3BMCA 1UAAA 1RACA 1NXVA 1XA0A 2YNMC 4LZNA 5DX8A 4LC0A 5DM2A 1LPAB 5H70A 4O5AA 1HE8B 4DUZB 5HBGA 3BL8A 4KMRA 2C5GA 1CUIA 4MUHA 3I9NA 2J3EA 1X7DA 3UK6A 1G291 3SKVA 3U1VA 2EX4A 1ORTA 4OQFA 3KRTA 3STHA 4JXZA 4QEKA 4L9SA 1KTVA 4R1MA 2AJLI 5AKJA 3LZDA 3MT7A 4FN5A 5CGZA 1W25A 1J00A 1ZSNA 3HSKA 2Q4DA 4EJSA 1GGMA 2R00A 1P2BA 4Y2SA 2PFGA 3L02A 4BKOA 3W04A 4RZHA 3WICA 3EA0A 1N2JA 3L8EA 3RTGA 2XE8A 1SKAA 3C8UA 3RWBA 5EPEA 4UMVA 3VTZA 3E3AA 2JFBA 1AKVA 2P2GA 3QMPA 1P6XA 4D42A 5LZ2A 2X9NA 2EFCB 3GV0A 4H2DA 1VYVA 1UPCA 3KAJA 3ZDRA 5HJEA 2V8BA 5CBPA 4L72A 4O4IA 3WL6A 3UOAB 3WK4A 1JAZA 3QE0A 3R6DA 4BJ3A 3TNDA 4C6HA 1ID8A 1E5LA 1KMHB 2NUAA 1T91A 3KJNA 1F7VA 3PP8A 4RVCA 1T4MA 1QORA 1QZZA 1IUOA 1UBRS 3PGLA 4HHEA 3BWEA 3ZY3A 2C5BA 3R3ZA 5HZHA 4CTJA 1K8YB 3STVA 3CUSA 1TLFA 4D8YA 2OENG 4Q3EA 2P3OA 4N82A 5E1BA 2Q8QA 1MPTA 4YP0A 2Q07A 3NKVA 3N86A 2QROA 3R5KA 3A10A 4IV8A 4HQOA 4CJXA 3JQ9A 1FNNA 2VZLA 4UAJA 3T7EA 2PFSA 3E53A 3RQSA 2RGBA 9LDBA 3RH0A 3TW8A 1TA4A 5FBHA 4OATA 4QTUB 4EG0A 1EQAA 2J0QA 1ISSA 3ONNA 3ZE6A 4XM0A 3IPYA 1JUDA 2I2CA 4P54A 3A70A 1HQCA 4AAYA 4XSGA 1AKTA 4EG3A 2WHRA 4O2BA 3ZE1B 4A0RA 3F1KA 3IJ5A 1LLCA 4LHEA 2GPSA 2JIMA 3HV2A 1BX3A 3KVNA 3WX0A 3TNLA 1C8VB 2O8FB 4NK5A 2H1IA 4CTKA 5DN6A 4YUYA 3VJRA 3EMBA 1RU3A 2B1QA 3EXHA 1R9NA 3EHDA 4X84A 3RHZA 4G63A 2XMZA 3PHLA 3PZRA 4TPKA 5HF9A 1JEYB 1HTBA 4QLOA 2BAGA 4HB4A 4O2BF 1JXAA 3U7HB 4MVCA 4EGSA 2ORWA 5JYCA 1NW4A 2BH9A 2C2YA 2NPOA 2ZRGA 3GLHA 2PZEA 3MTBA 2CBZA 4BQPA 1DAIA 4DADA 1QDUA 2AN9A 2VF8A 3OCVA 3I6IA 2F4NA 2QAGC 5EWLB 1HNZB 3B8HA 3DFMA 1PZFA 4MO9A 5CA1F 1D5WA 2ZIXB 3AIIA 1DJPA 2ZJ0A 4A1FA 4D1YA 3HHPA 4QTYA 3D6VA 2K6GA 3DCYA 2RK4A 3K7EA 1B6SA 4JKIA 4RL4A 4BMDA 1G16A 3EH1A 3MERA 3W4IA 3CUYA 1ZZEA 3O83A 3GRVA 4BIMA 1Y1QA 4FMDB 4N18A 1GQRA 1GVNB 4P08A 1KFKB 2Z08A 5BYBA 4AMVA 2YWGA 3QPAA 2NT4A 3EIFA 4YRGA 1MD9A 4AU1A 1Y0BA 1YB1A 1T1JA 4JMPA 4YP6A 3RS2A 2DPXA 2QSJA 3OKCA 3AOEC 1W4CA 1H8EA 1NJ2A 3I1FA 1EDEA 4GYWA 4MW0A 5JYDA 1OB5A 2D59A 4EH1A 2BMFA 1N0WA 5JW6A 3GIDA 4ERXA 1KI9A 1V41E 4NNJA 5ARBA 1S89A 3N9IA 1THZA 3BZBA 4DLRA 4RTNA 1QH0A 1VL8A 5EMHA 1Y63A 2X86A 2YZGA 1GNTA 2Q99A 1L3BA 4PTLA 3MOSA 1I2ZA 4DIBA 4E5DA 1DJQA 5DI9A 3W77A 5K4HA 1KBQA 2HCBA 4OUKX 1W1IA 3I28A 1L5HA 3JTEA 4WY2A 3TD6A 1JEAA 3X1XA 1QWSA 3FPBA 4MK4A 4Q4AA 4JITA 4LQLA 5HA5A 1L1QA 3WMFA 3II6X 2ZXEA 5U4XA 1ABFA 3JAKA 5JNRA 2ZI7A 1XR3A 1WW8A 2JHPA 5JPIA 4Q9LA 2X76A 3IQFA 3UJ3X 2F8TA 5CLLA 3W1VA 4B74A 3FPKA 1AHPA 1DKMA 1LDNA 1Q7EA 1GG9A 3VKVA 3I9FA 5DM1A 4ZYUA 3Q2OA 4EKGA 3F7TA 5HIAA 1CFZA 1T0PA 3AEYA 4R1NA 2GEFA 5KNDH 1BDMA 4HLNA 3MGCA 4ZOEA 3ZBTA 1PFGA 2WJZB 1XVTA 3HY4A 3R24A 1DG3A 1X70A 4JUAA 3ZCPA 1KP2A 2Q5LA 5JG7A 3IPCA 2QD4A 2PH5A 2IW1A 4W82A 3C48A 4ASUA 5BSEA 1N5MA 1KGSA 2DVMA 2QD1A 4NMMA 1VHQA 1O4WA 5T4BA 4X71A 2P6RA 1NIJA 3ESYA 1MJHA 5GADl 5DYTA 4GI5A 3VVMA 3I62A 3LDAA 1YQUA 3UBMA 1K1EA 1K08A 1ULHA 3HSYA 1XQVA 2IZOA 3V4RA 1IZ9A 2V7GA 1J56A 2I2XB 4DE5A 1SCIA 4CMHA 1JKXA 1SPBS 2G9QA 3CFYA 2NQ8A 2L0XA 1ESZA 3EXEA 4O1MA 4URZR 4BB9A 4WKCA 2HRBA 2VPXA 4WLEA 3QMVA 1NATA 2OHOA 3TOXA 3RUDA 1S1CA 4CIBA 5IT9A 2GZDA 2W8BA 4WQMA 5BW4A 5ITWA 3NBYC 4IFEA 2IYWA 4X64B 4YQYA 1AY0A 3IMFA 1J33A 4NCKA 5F1KA 2GR9A 4LF6B 2IPNA 4RF3A 3NTVA 2XRZA 4X1YA 4PBRA 1XYGA 3I04A 2DULA 4I9NA 1FZTA 1H6DA 1QHGA 1A72A 4FI3C 1LVUA 4NMHA 1J7JA 3M5PA 2VWPA 4ZCQA 5KOHA 2WQ7A 2MSDB 3H75A 4O4HB 3ISTA 4ZK2A 3NT2A 3VNSA 4HLCA 4P8RA 4CETA 5KHLB 1Y4AE 5ALHA 2J07A 1IK6A 3LXUX 4MRAA 3WRYC 3PF9A 2NXJA 5KVVA 3GLGE 2I7XA 3W9SA 2A1TR 2POQX 1RXYA 2I34A 4JD5A 3DR5A 4MQFB 1SXHA 3AI1A 5FPYA 2FG7C 2Q3BA 3OMWA 1A4XA 4NYMR 3FSJX 2XYRA 2FW0A 4WE3A 1NPYA 3BTUA 3MAGA 1ZK4A 3KL4A 3K6KA 1HETA 1U2PA 4X6UA 2O8FA 2HSZA 4ZCSA 3DUFB 1NJ8A 2OEPA 4JYZA 3BN3A 4RF2A 3RSHA 2IPOA 5DOZA 1ESCA 5TPWA 3ABOB 1IN6A 4J9VA 3QKSB 1IRXA 3F6SA 5TEWA 2VCYA 1AH2A 5DX1A 3KR1A 3U4MA 4QUHA 1HQKA 3O8NA 5CYGA 3OQPA 3RANA 4LWOA 3W9YA 4OQXA 4LNUB 2H5LA 3WYCA 2HY7A 1E1MA 4HDNA 3A27A 1BD4A 1FA9A 1OSNA 2WWXA 1DFHA 1YMVA 5K6TA 3ST7A 1XHEA 5JC8A 3BXHA 4PPNA 3N2KA 1MB0A 2BUCA 1WUKS 2YDXA 4XOIA 4A5OA 1Y8ZA 3IXMA 2ES4A 1U7PA 4GXTA 2EJUA 2CNLA 1JA0A 1OF1A 3FH0A 1BE6A 4BLQA 2XLBA 4WLNA 1HT3A 2W6QA 2AFHA 3O7WA 4W9NC 3IQZA 3TOSA 3DEIA 3JV7A 1FW6A 1RHKA 3DEHA 5FQOA 3TGWA 2FE1A 3VVLA 4Z9FA 1M2WA 1P60A 2C2GA 3HUUA 3PYMA 2A3RA 2QDXA 1M2NA 3HKEA 1DTWB 3A6DA 3ANLA 3QXGA 1VJ1A 1UQRA 2Q29A 1Z29A 1VFPA 4KOEC 1GZUA 3AVUA 1EPUA 1QYWA 2UZ3A 4MJ3A 4MUYA 2QL9A 3PDHA 2GN9A 1V7PC 3I2HA 4JBXA 2ISSD 2C57A 4UPDA 4H1UA 2WMOB 2CGEA 4U8HA 1TZ2A 5AXAA 4QODA 3R0QA 1WHSA 3TTWA 1V8ZA 3LBIA 3R8XA 4E5VA 3Q6IA 4QSMA 4B3IA 4ZAFA 1EE1A 1DV2A 4GMXA 4RD2A 5F23A 1XMOB 1Z7BA 2RGEA 3FWPA 4ROTA 5FYQA 1JQLB 1JVBA 3OCWA 1SCKA 4OFWA 1N32B 1XUOA 4YBRA 3IYLW 3CZMA 2R48A 1KC1A 4AJHA 4BU0A 1GAXA 4UBMA 4C22A 5LBTA 4XPIB 4Q93A 1EX9A 3V33A 4A15A 2X4IA 2IQ5A 1OAAA 1W4RA 3ZVLA 1DIOB 2A5GA 1QG2A 2BBWA 1KO4A 2PKQP 4KK3A 4Q1EA 1A0OA 4TQAA 2HBQA 1LX6A 2WJGA 1GG8A 1UDRA 3D3NA 1T5IA 2GAJA 1N2IA 2GN0A 3I58A 4YBZA 1X1EA 1NT4A 1N3IA 1A7KA 3ZHCA 2B99A 2VDPB 5AVJA 4AZ0A 2YQ5A 3LWBA 3QVSA 4Q3CA 5DBIA 5AK0A 5H7XA 4KOAA 4WX2B 3AUYA 2A59A 4YRPA 4ZDIA 1V11A 4N5LA 5FA8A 2ZDGA 3ZGVA 3UH0A 3M4ZA 3NETA 3IAS1 1MNQA 1OI4A 2EFHB 2PZ8A 2WUWE 2O4UX 1G42A 4WMLA 3LAWA 3WTCA 2QE7A 3AEQB 4AG3A 3PDCA 4HXEB 3KJXA 2BDUA 1PNOA 1RADA 3GGOA 2CHFA 4HQ6A 3B7WA 4L5JA 2FPGB 1X7YB 1CJSA 2H92A 5B12A 1XSEA 2X9VA 1WPQA 2BJWA 3PVCA 1FX0A 2PUBA 1NLZA 3CPJB 2ID7A 3EZYA 3E22A 4YONB 1N6PA 4PO9A 4RMHA 3QY0A 1C3JA 1K27A 3TOCA 2J1LA 2JJ1D 1V8DA 4OMCA 4R69A 2V4ZA 1QGOA 2VDRB 1YKFA 4FGUA 4I5EA 1XJ5A 3OIFA 4P32A 3SJ7A 5HJ7A 1N1DA 1RQPA 1TA9A 4NENA 2IGBA 1MB9A 5ALOA 4M8SA 5CLGA 1NP6A 3IPXA 2YASA 2NQ2C 1D6SA 4PLWA 4AICA 1GGNA 1E0SA 3G8BA 3PD7A 5DWQA 3HCPA 2Q2OA 1SKMA 4TXJA 1KRHA 1P31A 2Q1SA 4F2DA 3LHKA 1P1RA 1Z33A 1T5HX 1VJCA 3CRW1 2J67A 2IS6A 4M0KA 2R6ZA 3ENKA 1Y9AA 2WFMA 2JFHA 3L77A 3HEMA 1U7OA 1ZK0A 2YC2C 4X24A 4JLNA 3WWOA 3BIJA 3FKSA 1TJPB 1OXUA 4IO0A 2C95A 3VZDA 4R05A 1JDUA 3BE8A 2ONKA 1GPAA 1MPXA 4ITVA 3UW1A 4RH0A 5K3DA 1LF5A 1V1MA 3KQWA 3MVEA 5L40A 1G8YA 4B2IA 4C7OB 2PZAA 1TCVA 4PXAA 2BGMA 2ST1A 4ZVUA 4YJDA 1QVRA 2F9FA 4TQ9A 5BN5B 4AMZA 4RKWA 4U63A 4W6QA 5KVCA 2Z6AA 1ZDMA 3FHLA 3AL2A 2J87A 3IAXA 3UJDA 1TUBA 1XWIA 3EJWA 3WYFA 3GCZA 1XWFA 2BGKA 3EUFA 3ODPA 4INAA 4GRAA 4UBLA 1J5EB 4OSPA 1GZ4A 2ECOA 3OMLA 4NTZA 5MDHA 4ZYZA 4HNQA 2Z6QA 3BWVA 4BMPB 3IIIA 2VEOA 2VPIA 1SA0B 2PKQO 4JLVA 5DB4A 1ECGA 1TLLA 2CUNA 2Q3CA 2WZBA 3FKSD 3KJQA 1NI4A 1WABA 1TZJA 1ZYUA 1KAMA 2F43A 1VSBA 3DMGA 3Q7EA 2GD6A 3CR8A 4P36A 4ZQEA 4C0LA 1EUDB 2CJWA 2H2HA 4QDXA 4ZEXA 3KVYA 4LJ6A 3GEGA 3IQGX 2X4DA 3QKRB 3A1UA 4KO1S 1T34A 1GRVA 1KQPA 4YUWA 1NBME 1P2VA 1ZIXA 3O4IA 5TB5A 1KDVA 3OOWA 3WGYA 3HC7A 2OO5A 4JU9A 2ZYTX 5EHGA 4Q12A 2BGIA 2OBLA 4UNPA 3S7ZA 1UXGA 3TBKA 3PRKE 2Q5EA 2VWHA 3AJRA 3KPUA 1AV7A 2X8LA 3WLSA 3G9TA 3AKYA 5ALPA 3B6IA 4HBZA 1C8KA 1FU7A 3K0SA 5BT9A 1QQ5A 3A31A 1C1XA 2CKDA 3UGJA 2LIPA 3E15A 4R3NA 2RGCA 5J47A 2FOXA 1U8CB 4BMXA 1Q7GA 4YC7A 4EABA 5AFSA 4BO6A 1KFJB 1DRVA 1CIPA 3BBPA 4RV4A 3VSBA 4CG1A 2YWCA 5JHGB 1YKSA 2YMMA 1GEEA 4HDMB 2QQEA 1PFKA 5DPMA 3K71B 4OQEA 2IOFA 1BVRA 4BS9A 4KDEA 3ORYA 1HLGA 5DI3A 3GGJA 1QVAA 2BFNA 2KJQA 4I1UA 4R2JA 2EC5A 1JI3A 2XTJA 1N2XA 4FHDA 3T0GA 1D0SA 3D54D 3GUZA 3MT8A 3OWHA 4Z9AA 1RVV1 4OCZA 2OPHA 3MHTA 5JJLA 2Q6VA 2X0NA 2CWWA 3L18A 1PJCA 4LFCB 3FNIA 3WFIA 1UWLA 2VP4A 2D3WA 1NLMA 5C3UA 4E6EA 3FOFC 2VH1A 3USCS 1VSVA 3U13A 2O1XA 2IYVA 4J4HA 1MQSA 4ZRMA 2W90A 4GI7A 3N2KB 4QOEA 3EXAA 4G5SA 2BE9A 2ZE6A 2QR2A 1XDDA 4D4MA 4EJSC 1B76A 1SURA 2IHBA 2QZZA 3WMXA 2QQ0A 3L0PA 4EGQA 3BM5A 4HMOA 2VXBA 3LX5A 5EMKA 2PMEA 5IUNC 4DIFA 4PZDA 3U4HA 3I83A 4X6XA 3REOA 1V2GA 3HR4A 3OOYA 4YJ3A 3UBTA 4HUTA 2FPIB 3CMMA 1TO1E 1GIAA 2GJ9A 2ZDQA 2WB2A 2IH5A 4KNYA 1AK2A 2WG0A 2ZIFA 3PPXA 2NXWA 3R74A 1GUYA 4XH9B 5IC6A 2VT2A 1DBPA 1PBTA 2JAOA 2YJZA 3MBOA 4DG8A 3TEFA 1AKNA 2BGRA 1PT9A 4ZO9A 4E33A 1E2DA 3IVCA 4PPFA 4NENB 4K6FA 5A4AA 1N5DA 4AIRA 5KNLA 3FOAA 3O8DA 3GP8A 2H07A 2ZYUX 3MJVA 4AZSA 5B4UA 5JWRA 1TKRA 5CUQA 4E3WA 4I19A 3WRXC 4D97A 5BR8B 5EG5A 5I47A 3G88A 2V59A 1IEVA 5T8KA 3W0LB 5HS4A 1F3LA 3QW4B 3QXCA 1IY0A 3O9ZA 3RSFA 3VI3B 1PZGA 3HRIA 2W8BB 4RK0A 3KQSA 4KLCA 4TMFA 5FP0A 5I5GA 2Y1KA 3PT5A 3SVTA 1QO9A 1UAGA 2G6TA 5KS2A 3TJRA 1M6NA 2CKMA 2XMDA 3MUFA 4ZTUB 2H17A 2Z09A 3HYCA 4L08A 2ZU6A 2J31A 4QGFA 3HM2A 3WDLA 1ANKA 3PD1A 4CM4A 4J4BA 3U17A 3HXTA 4AJEA 6LDHA 1QE3A 2FZ4A 3QLTA 4OQMA 3RRYA 3L49A 4O25A 4R5HA 5JZOA 1KR2A 1QAOA 2P78A 2W6CX 3KVOA 3VYRB 1WS6A 3ZV6A 2EF1A 3TBHA 5AR1A 5K9ZA 3WAGA 2FSVA 3CEAA 2NO1A 2O3RA 2YJNA 3QF4B 4P4SA 5AM1A 3FFTA 3R7NA 1RXWA 1DC5A 2Q4BA 2JGNA 4Q6BA 4Z51A 2LE0A 1X7YA 4C2BA 4MJXA 5JXWA 1R4AA 4GYJA 5ALIA 1OBOA 1NG1A 3HZHA 3KSAC 5JY6A 6Q21A 2P9ZA 4V0LA 2ZBVA 2NO5A 3A1VA 3LUKA 3WLRA 2NTVA 4BRSA 2Q27A 1WDWB 1RIIA 2FW8A 3SHWA 4LE2A 2FUEA 5ENDA 4EMBA 3LTNC 4OOFA 1THGA 2I6TA 2XQJA 4TXNA 2JI4A 3KJEA 3KLMX 1QFZA 2AF4C 2AOTA 4DBVO 10MHA 2EWMA 3NWBA 4GLLA 3NGMA 2PWAA 1PK9A 2QX4A 4Q0MA 1U2DC 3E2MA 1AQ6A 1GAQA 4H7FA 4RF5A 4BN0A 2I87A 4FFMA 3ZHRA 3U7FB 3Q41A 3ANXA 5AKEA 4I50F 4RFVA 2XGGA 4I9HA 4M9QA 1VJ5A 3HO6A 1C2TA 3LCMA 5KQLA 2B1RA 1YZKA 5AMXA 3TQFA 5DNCA 4KE8A 5LQMA 2BEWA 1E79A 4I1VA 4KGZA 3RTDA 1CJTC 3KD3A 3ZE9A 4PR3A 4AMGA 1JZTA 4EG7A 2YJ6A 4RVUA 3G5AA 4IHQA 3UMYA 4I4TF 3SX0A 1WXQA 5A7GA 2UYOA 1DKOA 3QP9A 5JTUA 2P9CA 2HXYA 5F9HA 2XRFA 2JRLA 4M1OA 4K2HA 2VDLB 3PXDA 3EUWA 4I6GA 4LQ4A 2ZSDA 4R51A 1ZCFA 3ACDA 5TR9A 1Q0TA 5DWDA 1YR6A 3TLAA 3DP9A 3T54A 4A8JA 4IMRA 3DAGA 4WERA 3WKBA 2VRBA 3AF3A 1SXJB 2RGNC 3GT3A 3E8XA 3GXOA 3L1JA 5BSGA 1AKWA 1OH6A 5LYJA 3I9MA 2QN3A 4D0SA 1PL0A 3H11B 1WEKA 2P8SA 5EKXA 2UXCB 4KRXA 1U8AA 3M6AA 3HEBA 3A1FA 2DHRA 2BYTA 2Q3EA 2XNHA 4KR6A 2WI8A 3PEWA 1M5TA 3ZWQA 2C7PA 1EGMB 5ILQA 1QTQA 2QD5A 2ZR7A 3F6RA 2WILA 4XIFA 4P2BA 4D92A 1IL0A 4EI9A 5TE9A 1KWKA 2C2KA 2CB0A 3HXKA 1NW6A 1DKPA 4YEDA 5IDQA 1SEPA 1XTPA 1G6KA 1NNUA 3FYUC 3TIGA 1Y9DA 4ALMA 3GY0A 1HNNA 1CDDA 1ZD1A 3C4QA 1KS9A 4TV9A 4CLXA 4DMCA 3H4MA 1MENA 2VSQA 5FLEX 1EP9A 1TUEA 3EIEA 1NSFA 2HA3A 2I1WA 3K5IA 1SCQA 1WG8A 3PYLA 2H5EA 3MC1A 3MTQA 5JI3E 3C6KA 1E1DA 2HRCA 3PFWO 5KNBH 3QVWA 1ISMA 1UP4A 4QAJA 4KCGA 4JLPA 4WXPA 4Q3OA 2JNWA 3VMFA 1PK8A 4PC1A 2V6IA 5DMXA 4PAOA 2JJ2A 5CX4A 2G6BA 1A27A 3WMEA 2W9XA 1HRDA 1M0SA 2O8NA 4ED9A 1RZRA 3M49A 1DARA 1P5RA 4PM4A 3VO1A 2PKCA 4BWGA 2FSUA 3HE3A 2F2TA 3N2EA 3VSEA 5JXHA 1TW3A 2FKAA 4KDCA 1Z63A 3MGBA 3IAM1 4PAQA 3HLTA 1GZDA 1M34B 3BEOA 1R0XA 2O8EA 1WXDA 4MV0A 2GHQA 3QBTA 1WTAA 4W8GA 1E6MA 1XV5A 2JK1A 1R64A 3OQ1A 1K9SA 3T95A 4AK9A 5IK2D 4YAEA 2F00A 1CZNA 1D5CA 3EA4A 5BNFA 3O2SB 3QFRA 3KYCA 2GO1A 1CYEA 4GMHA 3EXEB 3H2IA 4NNPA 2C5SA 3C4VA 4PQRA 1PVDA 2IK8A 2HLPA 4I4NA 5CVJA 1YR7A 3QFHA 4HNTA 1L5QA 1HSOA 3U3RA 4IBOA 1GARA 1DDGA 5DP1A 1GA1A 3PLNA 2X0EA 4FXOA 3KT8A 3M0EA 4ID3A 4YRIA 1COWA 2LW7A 4DW8A 3KDAA 1CEYA 2GCIA 3M6VA 4UTXA 3FMFA 2OQVA 4C06A 2BRUC 3LQQA 4E0BA 2Q8PA 3G3EA 5F1YA 2IWRA 4ZVNA 4W7IA 2XOKA 1LDBA 4W5JA 3RUHA 1BS2A 2Z2JA 3O3NB 2P5SA 2YFYA 3HI6A 3P2YA 3T34A 2D00A 5IN4A 3ADKA 5FHQA 3ERCA 5JCOC 1FK8A 3C7DB 4DSAA 4XTRA 3NI2A 1HXHA 1T8WA 4B32A 3B53X 4IZ6A 2ZIUB 3PC3A 4EZEA 5JVDF 4TZKA 2ZT8A 4BLTA 3FMPB 4WOBA 1VG9B 4OO3A 5ECDA 2HU8A 2KLHA 1PNQA 4NCIA 3K2IA 5FOUA 3VO2A 3K8ZA 5G2OA 4LKRA 4UNNA 1SG9A 3UG6A 3OZIA 5K01A 1QQAA 1EWTA 1X1QA 5F78A 3NXKA 3OI7A 4OI2A 2Y92A 4FEEA 4U2EA 1QH8A 4W1QA 2ZUEA 2R79A 1YR1A 4NZ9A 3W79A 4LYEA 1P0FA 2B92A 3MGGA 1E9FA 2HSWA 2OYSA 4HFJA 3SIWA 1D4AA 4V0RA 2ZBEA 3T9EA 4P3XA 3ZK9A 1GZ3A 2PWYA 2QXTA 2H1FA 4WSOA 4Y98A 5DTEA 4F6CA 2F6RA 3GP5A 3M1IA 4RADA 2YBEA 2J9FB 3FR7A 5E6RA 4JT9A 5J59A 5CDGA 3BXEA 1G5PA 4PYNA 4RH1A 2OHGA 1OLXA 5AKXA 3QEKA 4HXYA 4DLXA 4HNRA 4XUDA 5KYWB 4BNXA 5B1DA 2IUEA 2D2VA 1K8ZB 2FWRA 2WNHA 3LK6A 3PIRA 3QOFA 1C4KA 4UKDA 2PSJA 4IV5A 3ZDCA 1UK9A 1EZ4A 3DDZX 3K6RA 4HATA 4S0XA 4G8DA 4QYSA 2R66A 4AF6A 2SICE 3M5CA 1H0SA 3NS7A 1CNEA 3OAAA 1NGSA 1L7NA 3PNMA 2ATVA 4MV7A 5JS8A 1OLUB 2BEJA 1VSTA 2HL6A 3L06A 4G0NA 1X0VA 4GZLA 5CYPA 1ZY2A 4EY6A 5JSYA 3USZA 1L4FA 4GEKA 4OMUA 1ZL2A 2FR1A 2X5KO 2IYFA 1TM7E 1F06A 2OFWA 3TW6A 1ZM2A 4BPBA 3UV3A 3VBCA 4GGOA 4PRZA 2O2IA 3BSWA 4ZAWA 2FSIA 1CZHA 5JH7B 1RQ7A 1WM1A 5EJIA 3PVSA 1QMPA 4R2KA 5J2TA 4DARA 4LOKA 1JNYA 4BE4A 2FWJA 1DNPA 3IR5A 1EP2B 3R3JA 1JJVA 3X1JA 2CF5A 1L4LA 4IGKA 3MWKA 4XSHA 5L3QA 4CW7A 3W90A 3QQ5A 3GHHA 3IP8A 4JP2A 1QH1B 3B60A 3TOVA 2HF7A 3FKQA 3NANA 3E7PA 1OV4A 4H1HA 4YP7A 1BU5A 3LO5A 2DMRA 1QIIA 1ML3A 4FXPA 4FGJA 1ZBQA 1JILA 1ZM7A 5JJBA 2FEOA 2FFBA 2X8AA 2DKFA 1G3QA 4Z49A 3MTAA 5HUJA 4DLKA 4YNBA 4B79A 4S35A 4B33A 3OU6A 3RT7A 3QVGB 1U8EA 4H6WA 1RRKA 2C61A 4IDBA 4JVLA 4YJ3F 4XJXA 5DJ5A 2PX5A 4J49A 4JASB 4MV8A 1IJKA 3PKIA 4X3OA 3BFXA 5GVRA 2G17A 3LDHA 5LZ5A 3SICE 1BGWA 4AQ7A 3IH5A 5AVTA 3GPLA 4MMXB 1P0QA 2VHZA 4OB8A 4A8JC 4DANA 5BWLA 2JAPA 1H9BA 4EMSA 4HMPA 2ZJ5A 1DCTA 1K89A 1WVGA 1OJ7A 3OT1A 3O8OB 4FR5A 1O95A 2ERYA 2PRKA 2QDKA 1BGXT 1WVIA 2UVPA 3C1UA 2COKA 3L7LA 2G0NA 3I32A 2RB5A 1P9NA 1RM5A 1UKEA 3AHFA 3HACA 4DLYA 1OGJA 3EB9A 1MX5A 4AL4A 1SB8A 2PY6A 4GP9A 1M0EA 1N6HA 1CR0A 1N34B 1CY0A 3RSGA 1PNTA 1EVJA 3MK31 2WJ3A 1EWYA 3WRVA 2VBCA 1O77A 3ZTTA 5F9FA 1U3CA 1QFYA 3RU2A 4MUXA 1PDWA 1T10A 2Z2ZA 3UPTA 2GHIA 3DZJA 4UU7A 5HHTA 3U5TA 5E2IA 3AFOA 2R2AA 4H7KA 3VGJA 1UQTA 3FJYA 2EATA 2XIJA 1GYQA 2JGIA 5DNVA 2WT8A 4RK1A 4D0NA 1U99A 4PC3A 3CSSA 3BGIA 5J1TB 4UQPA 1M8FA 2HPVA 4UDYX 5EJ9A 1OWNA 5LFAA 3D1JA 4LSWA 1QC5A 1UWVA 3B2QA 1WXEA 1V8FA 1MRSA 1JR4A 4FK8A 5DSZA 3G2JA 5IT0A 1LJLA 2D1QA 2JLAA 3OESA 3K1ZA 2P5YA 4FJ0A 4MTLA 1BVYF 3ZVNA 4TOIA 4ZANA 3K6JA 1CW2B 2IUFA 3N8DA 1SQSA 1GCOA 1P29A 2CMGA 2FHPA 4II7A 1Q2XA 1SZJG 1OASA 3P0IA 1JEOA 2E3JA 1T1SA 5JSHA 2IPLA 2NP7A 4OQLA 2QYOA 4IJQA 1GHTA 1UXIA 3VV2A 4DOMA 4BTLA 2E18A 1G60A 1ZOIA 5AHKA 4BCCA 2JFPA 1KZGB 1S2LA 2B6NA 2A7QA 2DWUA 3KKEA 1KJZA 1OFTA 3EVFA 4CN9A 1KYQA 5ARCA 3KALA 4C3VA 3VPSA 4QG3A 4L5YA 3B52X 2XVZA 3KB8A 1Z6AA 2MSNA 3S1LA 1M5RA 1TMGE 4CEIA 1U0OC 2IF2A 5HJ5A 1XK6A 2JASA 1OXVA 3BWDD 4MW1A 2Q0HA 2DRIA 4YCLA 4MA5A 3PQDA 3VDRA 5AWFC 3QXJA 1USIA 4MYCA 1JDSA 4EF5A 3D8BA 3H5NA 1E2IA 1R5JA 4PV7A 3REQA 2CEAA 3O2QB 3RU7A 1TF2A 2H59A 3CEMA 4FE7A 4TZ6A 2BOVA 4JV5B 5CH3A 3I01A 3LCJA 4ARAA 5IKPA 5JECA 1H65A 3E35A 3MXOA 4MR9B 4Z2YA 4OHFA 3RJZA 4B0PA 2PX4A 5JH7F 1VPDA 2J4DA 4LKOA 1CWUA 3GQBA 2HMTA 4C0XA 4QNNA 1S8FA 3CCFA 4V1CB 4CEIB 1V45E 5K99A 2C9ZA 2FPPB 4EHNA 1Z6XA 3VI4B 4FS8A 2VKQA 4NAVA 2BCGY 1BD3A 5GOTA 1OXMA 3VR6D 4NXMB 4OX9Y 1H42A 4LOJA 1W0JD 4Z4QA 1ZVMA 4OB6A 6YASA 2AYZA 3ILYA 3WIUA 3WA6A 1JS1X 1YGYA 2JAHA 2RHLA 3IBFA 2GDJA 3TZHA 1RKUA 2OCPA 4CHGA 1XDBA 2AFHE 4YCDA 4LXXA 1R6VA 1GUZA 2AXQA 3PNSA 3LA8A 4RACA 4EFMA 2AF3C 4CL8A 1Y6GA 4NCXA 1CZKA 4Q1DA 1K75A 2RH4A 5A0VA 4MKGA 1FQOA 5DP2A 3RVOA 2RD2A 3USES 2BELA 3KWJA 3S4YA 3JYOA 2FA9A 4G5RA 4QJIA 3SVLA 3PFKA 4LFBB 4X41A 5DXJA 4KKXB 3K73O 4RTQA 4EDFA 2IGTA 4YMIA 5C7YA 3CX8A 3ZDFA 4PYIA 5E9AA 1V9SA 2O7VA 4J3NA 1VA4A 4UCFA 1ODCA 1N25A 2I4TA 3IHTA 2QGFA 2FV8A 4AY4A 2WIDA 4GR4A 3QJYA 4ANFA 3KB6A 1Q91A 3IR7A 1KZHA 1JHMA 1N2EA 4EP1A 3L05A 5NULA 2J3HA 3D02A 1XFDA 3NTRA 4LZPA 3DCJA 1M2KA 2VJNA 4GI3A 4WFQA 4XFKA 5FUYA 1Z37A 2IPMA 4IIFA 1ZPDA 1KOFA 2M1XA 3U0BA 1N6KA 2RHCA 1ORIA 2OD7A 2R6AA 2WWRA 3ENWA 1GCGA 4JXKA 2YV3A 4HAZA 5IASA 4K9NA 2ZBGA 4TYMA 3T7JA 2HBRA 3SZUA 3C3JA 1EFTA 3E48A 2WWVD 2XV1A 2A5FA 3TVTA 1A1SA 1IZ0A 1DC6A 4MPPA 4EBFA 3IOEA 1TGVA 1XDSA 2C7RA 3EIOA 1DRUA 5F2KA 5J2TF 3JQ7A 1O97D 2P0EA 2Q21A 2XB9A 1EZZA 3AONB 4N9WA 4OQZA 1BDIA 1Z2PX 5IDYA 3RC3A 5ICEA 1XTBA 2FP4A 1AXGA 2HI0A 4JA2A 3RU9A 3GN1A 5AI5A 1O0CA 2V96A 3GMDA 1YQGA 1DADA 3FSEA 3OP4A 4R8VA 3LT4A 3Q4GA 1OTHA 2QM0A 1GFZA 1FP1D 1P39A 4K87A 2V7PA 1QGYA 4ICIA 4BQSA 5JANA 2WF9A 5ALMA 2FGKA 1NVEA 3RROA 3RFXA 1B14A 1D3AA 1NZDA 1OPRA 2FSPA 3Q6MA 3HUFA 4M76B 4ZPJA 3TE7A 4FE4A 5BN3B 3OZVA 1TAGA 5AVVA 4EF6A 1JRLA 2EKLA 4H31A 3K0FA 4GLFA 3C97A 2LPMA 3LHIA 1QIGA 1PR3A 5K0LA 1T8RA 4D8TA 3H42B 2YXLA 5KPDA 1DKQA 2Z30A 4E31A 5EJ6A 3TRFA 3KHKA 4CQMB 3PNQA 5JXJA 1N78A 3AF1A 3NHKA 3R6TA 4I46A 3ZWMA 1DUIA 4GXRA 3PTZA 4PAGA 3ZDEA 3G0DA 3FNQA 3IP3A 1DEXA 4EYSA 1QP8A 1NNEA 4K1LA 4F5EA 3GI1A 2VO1A 2PZBA 1UODA 1FVXA 3IB6A 3P9SA 4KN5A 1SKYB 1CKEA 2GKSA 1R1DA 3WY9A 2Y77A 4TN5A 3EWNA 1Y6RA 1Q0RA 5KDOA 2BF7A 3CBGA 3TPCA 3EG5A 4HWKA 1DG9A 1O95D 4BJ1A 2W2OA 3BGSA 4I3GA 3ICCA 4KFTA 1SQ6A 1MG5A 3LL7A 2WWYA 3MB5A 3H9JA 1U2DA 4UM9D 1PRYA 4RAQA 4U9UA 1WXXA 1KIMA 5CJJA 1V7CA 4MWTA 1X1RA 3F1LA 3GU3A 4PYLA 4R84A 2F43B 1T1EA 3I8OA 2IIPA 1FFEA 1LW6E 4KMMA 1OFGA 2I7TA 5TMEA 3K8YA 4YXWD 3Q15C 1HF3A 1PX2A 2Z5FA 3UC5A 5KQRA 4RGQA 4BFLA 1CIJA 3TIVA 4MGKR 1L1FA 4Y2UA 1QDLB 2ETXA 1U04A 3DPSA 3GMTA 1U9CA 4GR5A 4TMVA 4P93A 1UK7A 1L5GB 4FWTA 1J0EA 3OJCA 4EHBA 1ZHFA 3IMGA 2CJXA 4L0QA 1ZONA 2R751 2PS9A 1WLSA 1RC1A 5FBQB 1UZUA 1MV8A 1XN4A 5AJXA 1A7AA 1CZOA 1CY8A 4A3SA 3I0NA 1F48A 2GUGA 1M1ZA 1J09A 5TV2A 5EP4A 3LGXA 3KOYA 3NASA 1E4EB 4IOJA 4BOYA 3BXZA 3P19A 2SKCA 1SO8A 1SVSA 4L07A 3GUCA 4URFA 2ROQA 2R8YA 5HUHA 3Q7IA 1ENPA 2ZT7A 1TMKA 1JZQA 3B7GA 4L15A 4C5AA 4DYDA 4CT5A 1V9LA 5BQFA 5I5EA 3ND9A 1W5SA 2Q4OA 1A76A 1AKRA 1W46A 2J85A 1B6RA 2XTMA 3B1XA 3DEAA 3K0AB 3VHQA 2ABWA 3ENQA 4E13A 4XM1A 1FDTA 5KNCD 1MIHA 2VF2A 5TRTA 1JDNA 2HBYA 2BI8A 2X7XA 1C1HA 3ES9A 2D5IA 5I9LA 3MJDA 4LMPA 1EG7A 4I55B 4F9EA 1AXRA 4ZT3A 3A2KA 4S1OA 4PCAA 1NVMB 1P5HA 1RHUA 5IC4A 1PVOA 1EAYA 1OZHA 4J16C 3KEFA 1SPXA 4YDQA 3UB4A 4ARIA 4PAMA 1R37A 3EGXB 3V4SA 3E23A 2COEA 3KLNA 4ARCA 1KSFX 4C6RA 1DELA 1UJCA 1WY7A 2R6DA 5JQGA 2XYHA 3DE7X 2IBTA 2VXCA 3UMBA 2NVUA 1JPJA 2J7KA 2V9ZA 4IF4A 2R84A 1E98A 4UBNA 3TL2A 5KYXB 1DINA 1L2TA 1PR6A 1XTQA 3BHMA 3KPWA 4AYTA 1ZISA 2XXJA 3E1KA 3SC2A 2QJTA 3ZD9A 1NVVR 3X44A 2WWWA 4F9TA 1UFOA 3GFOA 5B6PA 1U2QA 3RRNA 4BUJA 2I76A 2IIVA 5JNSA 3U9LA 1QLWA 3OZTA 4LXUA 1PV2A 2W2MA 4TT8A 1M8KA 1ZG3A 3C70A 4CM3A 4UC0A 1P4SA 2UZAA 1GUFA 3NC1C 3K0HA 4M98A 4Q47A 4FHZA 3SM9A 2IUSA 4CHTA 3LSTA 1V8OA 2RI0A 3O94A 4Q4JB 3JWGA 2GHRA 5AYVA 2P6UA 1J24A 1NDQA 2EFJA 3R0XA 4JLMA 4D2IA 1JQKA 2XMGA 2BI4A 1MVLA 5CVEA 2WHQA 4YI5A 4YP9A 2RBEA 2UVPB 4ENPA 3CEJA 4KZPA 5JIBA 3IJPA 4L57A 1LLUA 3F49S 4EGJA 2ZPUA 2AFRA 2VHEA 3R9WA 3AUUA 2HLNA 4G26A 1U8XX 1ONBA 2XUDA 5ALVA 5ITSA 4NU0A 1NUQA 1SQ5A 3DXZA 4TLEA 2WM2A 3H1AA 2P4EA 2QRVB 3QH4A 5IF9A 1MEEA 4DHWA 4HJRA 2OZVA 2I0FA 5DK6A 3UJ6A 5JLAA 2V74B 1TEXA 4R3UC 5EJ5A 2Z5VA 4FFRA 3HGMA 3NRJA 4AQDA 3I8SA 2L82A 4CLOA 3ZX5A 3ZCVA 4TRRA 2ZWMA 4YCNA 4KRGA 3LF2A 4I81A 2ZJFA 1JQJC 3O7MA 2O1SA 1G4AE 5LLTA 4KSBA 4X66B 1YUNA 4Y2GA 1XC7A 3FMOB 2E5WA 3UV6A 2YCBA 3MTDA 2XD9A 4FR2A 2IZ6A 4K9LA 3KS9A 4PQEA 4ZDWA 5JR3A 1ID1A 1KERA 4KAAA 2M1ZA 4IX1A 4DWWA 5BV2P 1HRKA 4IHJB 4GBGA 2V3CC 3QX3A 2HREA 4PPYA 2E4XA 4B2LA 3L7BA 2FW1A 1DQNA 1ORVA 2CW5A 1VPEA 5E1DA 5LLSA 2H5JA 1DIGA 2N1MA 3E84A 4O2LA 4ER5A 4DB4A 1OB2A 1QHEA 2VUHB 4DLUA 3ENNA 4RCVA 2BSAA 1Y1SA 5AKHA 2GN2A 2RGWA 1SCDA 1SKBA 3PUZA 4JLWA 3C6ZA 1EUCB 5DZSA 4M1MA 4MCJA 5EJ8A 3QMMA 2FR0A 4PVDA 2QMUA 3TJMA 2VPQA 2IV7A 2Q5QA 1ABBA 3G0BA 1H4SA 4JLBA 3CKMA 5LOVB 1I36A 4XTCS 3ZIDA 1IPEA 5K3EA 2JL1A 3OLYA 3UAXA 5LBIA 4Y18A 3E70C 2O5VA 2YHUA 4LHWA 2Q6KA 1NULA 2QRMA 4DR4B 1S4MA 1JKJB 4PSCA 3S8MA 2ZB7A 4L5AA 5LKRA 1PT5A 2IVFA 4E07A 5I7SA 1QV9A 1OLXB 4Y9DA 1PJBA 5BRNA 4JOQA 3ROEA 1KI6B 1SCUA 3WTBA 2ECFA 2TSYB 2CXNA 3HO8A 1FJGB 3FTEA 1PD1A 1JGTA 4F4HA 2CLDX 2BFEB 3FTCA 3WJ1A 2W2VA 4GKKB 3ZWWA 3KT0A 2I2WA 4PSDA 3IAFA 4CM8A 1FQWA 1KARA 1Y4UA 4RKYA 4R0VA 3NEYA 2Q46A 4MMYB 4GICA 2DBQA 3WL5A 3FGPA 4M1ZA 1SG6A 1A71A 2ZJBA 4RHEA 1NONA 2Y68A 2QUHA 5IHXA 2RH9B 2AC2A 2DH5A 3KKOA 4HDRB 4EA9A 1GDDA 1QPZA 1X6VA 4L3OA 1O94A 5DHFA 4ZHSA 4P9NA 2QVZX 1OBFO 1J8YF 4OK6A 5BOVA 1GZ5A 3JW8A 2RARA 1ZCZA 3W7VA 4O4JF 4R01A 3Q7RA 2WD8A 4FDMA 3JALA 4ILKA 2DQSA 2M6LA 5HR5A 4LXGA 1JLMA 1W96A 2IHVA 1QRUA 5CFQA 3TFOA 5FCDA 5CRIA 3L4SO 1JAIA 2R25B 4MPJA 4AZ3B 2G40A 4M8KA 2OR3A 4NJEA 1A69A 5LLDA 2ZJ2A 4GP7A 4JR1A 1O57A 4RM3A 3PPIA 1WXWA 2R7AA 3ITEA 2XNJA 1K86A 4MS3B 3E2PA 5H5JA 1SAYA 5EZQA 4RHYA 3QUTA 3COYA 4EVRA 1W52X 4I8XA 4ENWA 2B35A 3DOCA 3JD4A 2OGZA 3RYFA 3HCWA 4XA8A 2O8DB 1C8BA 4UE3S 1N5JA 2G06A 2YIJA 3WZMA 5H4GA 3V3KA 1PR9A 3KV1A 1JPUA 3AVWA 4C30A 3LHDA 4ZZ1A 2EWVA 5F4ZA 1SZPA 4YROA 1F51E 2NV0A 3F90A 3LUAA 4ER6A 4YMUA 4MARA 4O8ZA 5C8VA 2O0HA 3BOSA 1FUUA 5C4MA 4MQ6A 4EQ6B 3H16A 2OQIA 2R1ZA 1PL8A 3OF3A 1ZCAA 4MROA 3D6UA 3N74A 1WZ2A 3V7NA 3SS8A 4NS1A 2AG8A 4EJ2A 2Q1XA 3TEJA 2JARA 4AY3A 1XRMA 3AILA 3E3NA 5FPSA 1I6WA 3E9DA 2I8AA 3WGLA 4DCPA 5TLSA 2Q45A 5C53B 4ENSA 3L4BC 1SN7A 2PKWA 5THXA 1L5VA 2ID9A 3B1ZA 4QPNA 1BYIA 1W4LA 2B61A 1REQA 4ACAA 3UKDA 4RTKA 1R88A 1I14A 1G5HA 4IOLA 2I6QA 1DIAA 5DN9A 4BV9A 5JNWA 5LZ4A 1K6EA 3AFHA 4FKZA 1SXPA 5AI6A 1KI4A 3QWAA 5AOVA 3QWBA 4PYKA 4MGHA 1DJNA 4Q4CA 2C29D 2ZYRA 2ZRJA 3QPBA 4OYHA 2C4KA 5EINA 1SIBE 4LXQA 3CZ5A 3KQUA 5K0GA 4NJMB 4YHBA 1H05A 5BV1A 1EYZA 4FMCF 4NARA 3BGDA 3BE4A 4NU8X 5FTNA 1JDBB 3Q3CA 5DTIA 1D6NA 4KACA 1KA9H 1SZCA 2J4CA 4BECA 4LUCA 3WLIA 3MCVA 3C85A 2EQ5A 5FPKA 1EDBA 1CG6A 4C7VA 2GZAA 1DWOA 4JH0A 3TX6A 5DHPA 2B4RO 1G21E 1ADJA 3QLVA 4G1EB 1FYDA 2H06A 3INNA 4Q3KA 3V9AA 4FFLA 4L74A 1E5TA 5CG1A 5I4CA 1LV8A 3NAMA 1HNXB 5ESWA 1P18A 5AW2A 3CONA 4XZ3A 1UZMA 4HI0E 2ORVA 3SAJA 2P62A 3EPPA 1EHYA 1U2SA 2NUBA 3UKOA 4M8IA 4BVLA 3KXDA 4GKJB 1USGA 1LD3A 5DHRA 3AJDA 2FF7A 1ZH8A 5FOQA 3R2JA 1ZEJA 4TMKA 4B6JA 4CMCA 3W7BA 1WLYA 3COPA 3I1IA 3DNFA 3ZTYA 3H18A 3NUGA 5CT6A 4O0LA 5FBRB 4EO4A 3T6KA 2QT9A 3P4XA 5J4YA 3P9RA 1NBMD 4G37A 3HR7A 4FB4A 3IP9A 1LSSA 4C9BA 1Z5PA 1N9ZA 5HCUA 2B0CA 5A0FA 3FCEA 1XRRA 4XIIA 1YZQA 3V1MA 4DY4A 5AW5A 4JBHA 1NJFA 3IP1A 1UJ2A 4KBGA 4C1BA 1FYXA 1EDOA 1J9ZA 2VA8A 3DOJA 3GGDA 1EJ0A 3P9XA 3FPJA 5EWJA 4KBFA 5FL7D 1G21A 3O93A 5EJ7A 1Y5NA 2XUFA 4N6GA 1W2WB 2HCFA 4PLTA 1DJLA 3E1GA 5FADA 4Y1FA 2I5PO 2FEWB 1PJQA 1ZBDA 2C8KA 1RRCA 1UBEA 1V2HE 2VAWA 3QXSA 4HF7A 2WA1A 3D0RA 4JQZA 4OQPA 4Q9HA 4Y9SA 3T3PB 2G08A 3FAKA 4CBVA 4LGMA 4QZVA 5J2TB 3ADCA 2VXYA 3BREA 4G65A 3VOBA 4AW9A 2A9OA 1W93A 3NLLA 3NBFA 4JLAA 2CVFA 3G9QA 5CNJA 4YRSA 1TJYA 1EVLA 2C58A 2OZEA 2VHQA 2X22A 5B57C 3AEZA 5D7BA 4N3AA 4ODIA 4QA9A 3K9WA 5K3FA 4ZOLB 1SIUA 1ZZGA 1II8A 1C4OA 3IEIA 4JJ7A 2E6KA 4QVGA 4XB2A 3SQNA 2BRUA 3HVRA 1I3KA 5JQGF 2WU0A 1MHPA 3FPGA 1LKZA 3AETA 3GQBB 4H17A 4NZYA 1JMKC 4OBEA 3OX3A 5SY9A 5TQVA 2B4YA 3D7KA 3KWFA 3T7RA 1NXPA 1G8AA 4QGHA 4GUDA 1QAMA 5IJ0A 1EFCA 5EPUA 1T2EA 4HRXA 4JBNA 4ZVTA 5BP7A 4RTPA 2WPDD 1ZXXA 1UM9A 2I4RA 2RJNA 3GD7A 3SG0A 3UPDA 3WFZA 1W2GA 3GK3A 5CPBA 3VVBA 3FA2A 5LD2B 1HOTA 1O96B 2CUKA 2M98A 1IU9A 3FWYA 4IIJF 3TSAA 4B3RB 4EB0A 3NRBA 4UBOA 5EXEA 2O2XA 2WM8A 5CM2Z 5IP5A 5A5EA 2CV2A 3DFKA 5AW7A 1RCUA 3E9QA 3KKQA 2OC9A 3ZW9A 4QTXA 2YXBA 3EXG1 2PD6A 2BFDB 1SUSA 4N1AA 5WRFA 3TNJA 5ADUS 4UCQA 3CVOA 3UB3A 1N2CA 4F06A 2FSVC 4MDYA 1E4OA 1M2OA 2BMDA 3I9OA 3JQFC 1VTKA 4G0OA 4RZUA 4NICA 5LU9A 1T9GS 2FSFA 2HU7A 1G59A 3RC9A 1PV4A 3NPAA 4PE5B 5EEGA 4FX5A 3VBEA 4OU4A 2H8GA 2E48A 2GXAA 4DCMA 3VZBA 1F8YA 3IR6A 3WRWA 5AXDA 2HBZA 2II6A 4OHXA 4B6QA 5HKKD 1G7CA 2A88A 4Q5IA 1LK0A 3OQHA 1Z4MA 5DEIA 4NIMA 3A1SA 1T1RA 3DCIA 4N0QA 1C3VA 1YRHA 2A30A 1SQ0A 2G04A 2Q5HA 5J4HA 2FMIA 1XTJA 5AQEA 1NDHA 3OP1A 1VI2A 1Y48E 1VJRA 4CUZA 4R1SA 5LP1A 1XCGB 2EZTA 1EAMA 1ENYA 1TVKB 1UBUS 4TS4A 3A3KA 2O0LA 2O0MA 1PQ4A 4G9GA 3FPAA 4TTPA 5EZYA 4TKUA 1L8AA 3A9SA 3PRHA 2QVLA 1JIXA 4BO1A 5KB3A 1NBMA 1QHNA 1WKCA 3D5TA 3RHSA 3TPZA 3GRFA 4Y6SA 2XAUA 4BJHB 1X8XA 5JY1A 4UD6A 1NF3A 1KDPA 4GUAA 2OGWA 5GJCA 3S2EA 2WF8A 1XZNA 3MJRA 3JQ8A 3MFQA 4UEWA 3R7AA 2O2JA 5KMGB 3K1YA 2HWKA 2GPAA 3QVMA 3CSDA 3KZVA 1O3YA 3JD0A 1VKJA 1FFWA 2ZCVA 1E2FA 1FLVA 3G2NA 2H2FA 2JFZA 3E9ZA 1AB5A 1UJMA 1YXMA 3FE2A 4L3WA 1C30A 1GKLA 3G68A 3PWZA 3QKWA 3Q2KA 1KY5A 4I4LA 1PR2A 4BMZA 4LDQA 1V47A 5ILOA 4BNHA 1UMDA 1J39A 2EW1A 2WLSA 3CH7A 4DJTA 1TUBB 3QRWA 4P0TA 3L40A 4MDHA 4QTZA 2AG5A 3G9ZA 1TFUA 1INLA 5KEIA 4QFBA 1DWPA 2YW9A 4NFHA 4PZCA 3RRBA 4BNIA 2HQOA 1YASA 2W2KB 1NI3A 2Z8ZA 3ZDQA 4AWBA 2ATXA 3ZHQA 1NVVQ 2X58A 4CKXA 2SECE 4UTOA 3R7SA 4WN9A 5K4GA 5U9CA 3F5QA 1FMLA 3SCZA 1DEKA 1EFRD 2ZIAA 1R00A 1UFKA 2ZBRA 4JNCA 5U1PA 2XT9A 2IU4A 2XBUA 1JIVA 2O5EA 3X0DA 2VF7A 3U7RA 2MSWA 2GTHA 2AOTB 3I53A 3WV5A 4A4DA 3GPBA 3AHGA 3C74A 4LV6A 1DX9A 4HH1A 2WJPA 3ZJYA 5IBRA 3PHIA 3WK6A 2Y71A 2A8YA 4U6NA 3NPMA 3WRYA 3FTPA 1TQDA 1X42A 2O3QA 4RESA 1VGRA 2CNNA 3VR5A 2PANA 4JI1B 4PWYA 3VNAA 4MV4A 2W7TA 5G3YA 4IIDA 5M7EA 3GT0A 1WB5A 2MYNA 3LRXA 3TAHA 2C07A 3ASUA 3UGKA 4B34A 4BKRA 3NDPA 3AR5A 1Z0KA 4H7DA 5JH7A 1OI7A 4R6WA 4ZO8A 2VOEA 3EOZA 4R68A 4RTRA 5AK6A 1FFBA 4LGYA 4EG8A 4GEGA 5CH5A 5FB3A 1J8FA 3IUYA 3T38A 2X7JA 5A4DA 1GSIA 5HNKA 2OM2A 5C18A 4LJSA 1KI2A 1QZUA 4L27A 4LDPA 3OM9A 4LF4B 4OX9B 1FX0B 1H22A 1NRXA 2WD9A 2JLWA 1E9DA 4HGZA 1IHXA 5EHIA 5B53A 4DA0A 3C5EA 4W1SA 4XUCA 5KYGA 4G0XA 4DV6B 5HGXA 1MO6A 2A0XA 2K2QB 5DTQA 2WOOA 3JYNA 2XMRA 1KJNA 3F78A 3FDIA 1Q14A 3EXFB 3IUNA 4M7RA 3RYIB 2G1JA 5C34B 1JQEA 3E27A 4HQLA 4P98A 1Z2NX 3EF3A 3QE3A 1PG5A 1CJUC 5B1SA 2YXEA 4IDCA 3FG9A 1G20A 2CHVA 3JX9A 1YWGO 2DBVO 3UMGA 1LC3A 3SGLA 3L1KA 1ISRA 1QTRA 2GZSA 2W4QA 3H8VA 1L5WA 4B85A 4B9AA 4JJEA 2ONZA 1DO8A 2QAIA 4RD6A 4LSGA 1PUJA 1K7YA 2CLEB 5KOJB 3WYAA 1W36B 2YFQA 3GLIA 3AK4A 5CDUA 1CERA 3BERA 1VDMA 3C6YA 5CA1B 1U94A 5FPTA 2GK7A 2VQEB 2WYUA 2PXHA 3QVKA 3HADA 1MKYA 1RI5A 1XJCA 1LSUA 4QUGA 5AW9A 3VM6A 2PDAA 2COUA 4IOKA 4GDMA 1Y8RA 3QTLA 3EQ6A 1EM8B 1OCEA 3D3WB 4RVFA 3SE7A 3B38A 1EFUA 1WOYA 1WTCA 3OM8A 3GJRA 4DMKA 3SBXA 3GJ5A 4DLAA 2NQTA 3TMYA 2YWRA 1CEXA 4IQ0A 2OHJA 4JSTA 4IIUA 2BV3A 1XTRA 1M6VB 4R8KA 2O48X 4GX0A 2VT3A 1VJTA 3P45A 4XYGA 1Z47A 3ET5A 1PWXA 4IMPA 4NYJR 3SLGA 2JAUA 5L3SA 2TMGA 4QOFA 3WO0A 3Q7PA 2OV8A 4KWTA 2WKSA 2W2LA 4XDZA 4H7IA 2DR2A 1K4YA 2V6MA 1H66A 1V1JA 1L7BA 3VPCA 2HMWA 3EWAA 4FCWA 1VECA 2QS9A 3N58A 3N8HA 2OWEA 2MSCB 1KDOA 1E66A 3H1TA 3DBLA 4C5BA 3KYIB 5JALA 1EGVB 5JATA 2DB3A 1R9GA 1T2UA 3DVLA 2ODBA 3IV7A 4C05A 4MVJP 1KDZA 1CEEA 2FKNA 2YY7A 3STTA 3CC8A 4G81A 1PLLA 1TPYA 2LKCA 2J9RA 1OZFA 1ZH2A 2NXNA 1YDHA 3F8SA 2Q3MA 4HB2A 3G8CA 3JQGB 3G6KA 1AD2A 4PNHA 3WWEA 3ZHOA 4L4SA 3EUEA 2I9PA 3EFBA 4C76A 1QF7A 3L07A 2O59A 1FLDA 4OHBA 4LVUA 2OESA 1X1DA 3QVUA 3MTIA 4HNSA 4E30A 4OFBA 4I5FA 4PG5A 5KTOA 1NUAA 2Q2VA 3F5MA 4WDQA 3AUKA 1MXFA 3EDMA 3NATA 1CB7A 3L0DA 1TKAA 3EQ9A 3CKYA 1CV2A 4NG5A 3TRJA 2WSBA 3ELDA 1H23A 3Q1LA 4MGYR 4MW4A 4C4PA 4ADSG 3JY6A 4ECEA 1NW7A 1KAHA 2MMCA 5H0IA 3IOCA 2R1VA 5C8DA 4FYKA 2PVSA 4QL3A 1WQ1R 3DEYX 2JI9A 3KZXA 1EX1A 3SF0A 2C7OA 3ABQB 2QJRA 1W5TA 1Y6QA 1N0HA 5DYWA 1F2UA 3EXHB 1E3SA 4KU4A 5ECGC 1DIBA 4GXQA 1KHHA 3O2NA 2QLLA 1FFYA 8AT1A 4PLPA 3UWPA 1JZSA 3RUIA 1T2AA 3Q3VA 4ZMRA 1ZN2A 2HNBA 1O5IA 4D57A 1VIDA 2OUKA 3ZU6A 1ZMTA 1DP4A 3RTBA 4XUGB 3IAS6 2HU2A 2IUTA 2GAIA 4WKPA 1A82A 1ULBA 1AGRA 4FZJA 1SMKA 2AEMA 2P1DA 5C7IO 1XTIA 1SBCA 1X3SA 1U0JA 3CNEA 3FSGA 4MR7B 5HQJA 1BKSB 4KIUA 4MJLA 1BYUA 3CZ4A 4HDQB 5KTKA 2YZ2A 3G9UA 3PNBA 4KP7A 4JLUA 4DLWA 1T9GR 2FJUA 1PS0A 3VUFA 3W8FA 5KCMA 1Y3IA 5F7JA 1GAWA 4HDMA 2HQSA 1VE3A 1RKBA 5BQOA 2AR7A 2AD1A 3NIFB 3KFVA 4FNOA 4QU8A 2EFEB 3VDXA 1B23P 3H2SA 2FMFA 2HSDA 4MAFA 4AYXA 4D0LB 3GT4A 2VYVD 1NMYA 3HA5A 2P1RA 5IXYA 4J0DA 4J43A 4Y0NA 4GWGA 5E8RA 4CL3A 3I9LA 3B13B 1VRVA 3KM0A 5JAHA 1FL9A 2GWHA 3FOCA 1JP7A 1BXZA 3HU1A 4CV1A 4MQUA 4AULA 3FI9A 2QD2A 1P7WA 3LBNA 4BO7A 3PJFA 4U7JA 5FI3A 3TX2A 4PTYA 1YS4A 2JIOA 3K15A 1CU1A 4FHCA 4OLJA 4IJ6A 2PUAA 1C3XA 5L3QB 2D0DA 4TS9A 3CKLA 4URVR 5T57A 4DXHA 1PZHA 4IWNA 1K5DA 3OPYA 2E82A 4LI0A 2QUJA 2VNJA 4U5QA 5EC8A 3ZYCA 4X85A 1E1LA 1YDFA 2PLRA 5A4FS 2ECPA 2MIIA 4U3JB 2CYBA 1OXTA 2SNIE 2O2CA 2QN2A 4PTZA 2ZSHA 4NWIA 2BFOA 4UDOA 4ZAYA 5IJAA 3ZCSA 1EUZA 3WOHA 1G1MA 2FPRA 1FBTA 4WJZA 4Z4CA 5EJMA 3KBBA 1ZS9A 3HP4A 4QXQA 1UFVA 4MWEA 5FOVA 4E7OA 5AM3A 3TS1A 2VTBA 1UBCA 1SHLA 2B82A 4H1TA 2CV1A 2IBSA 2BKVA 2OMEA 4N4AA 3ZC3A 3HWWA 3IP5A 1T0HB 1SK8A 5DLYA 3W6NA 2VQDA 3SZOA 2D5CA 2VZ0A 2YHIB 2IPAB 2GMWA 4H1VA 4D81A 3U19A 1NSYA 5KVSA 5JCJD 1B26A 3ESXA 1FLNA 3HS3A 5L3ZA 1XKXA 3V2GA 5I4KA 5C51B 2V5UA 5BN4B 3OQMA 3WLNA 1AQUA 3AUXA 3GRAA 3HH8A 3ZHXA 4F3YA 1YI8A 3BJIC 4WZAB 1FU8A 4BB6A 3DYVA 3NHMA 4EPVA 3EUAA 4PRYA 1DI0A 1O9BA 3IQXA 3KYCB 2WSIA 5KU7A 2ZR0A 4W7SA 1JL3A 2EKDA 3HKCA 3NOOA 1TEHA 5FBVB 2UUOA 2QRUA 3DQZA 1NMZA 5AKKA 2REOA 3GEBA 3U1BA 4EELA 3SE0A 2PXXA 6REQB 3H9CA 1CZUA 1UDWA 1G2OA 3D4LA 4WVFA 3ZGOA 1IBKB 2HW8A 3GDGA 1Z0IA 2XR1A 3D81A 4HWOA 3OLWA 4HAWA 3KZNA 4IKOA 5BSKA 1CBUA 4E2YA 1L0BA 3EFHA 2O8CA 3SQOA 4YRNA 1TDJA 2YJGA 4EWLA 1N6OA 4AZWA 1US8B 3OLXA 4AURA 3U60B 3QELA 5E6UA 4RF4A 3THYB 3RJ9A 3BE5A 3NTOA 1MV5A 1GG5A 1K92A 3SQDA 3TKYA 5CCEA 2X3FA 4HLUA 2ZYIA 1SR8A 2G70A 1SBQA 3JXEA 2P75A 3PT9A 3QWFA 4XJVA 1N8SA 2CSUA 4I4TA 2C5AA 3AUSA 3R40A 4M36A 2HHAA 5HZGA 1Q44A 2HIAA 3THSA 2Z8XA 1XL1A 1Q17A 2V5VA 2XDQA 1UBFA 2ERXA 1LNZA 2EBFX 2YRFA 3TF5A 2HK6A 3ADDA 3W1WA 5E1MA 3GCDA 3MUNA 4IQ4A 1DEAA 1BG6A 5CVDA 5K0BA 7MHTA 2A1UB 3HN2A 1AHNA 1N9KA 1T8YA 5JMOA 1GILA 2WQZA 3K70C 2ZB4A 1LLFA 1XXHB 1BOOA 3T1NA 3MYRA 4MR8A 5SYAA 2YWBA 3PX2A 2UYCA 2PBZA 4HGRA 1C3EA 4D4IA 1EEHA 4MV1A 2W83A 4RHFA 4RZIA 2GI4A 4JMLA 1IEWA 4H0NA 4CKEA 4REMA 5DX0A 3BCRA 2BJHA 2XB8A 3I6MA 3WO1A 1JFFB 3W8EA 5D3MA 4MDFA 2HUPA 2ZKIA 5AJYA 1PCXA 2QXUA 1T4BA 5EE9A 1QTIA 1QB8A 1J22A 1VE7A 5EXPA 1X13A 4L5BA 3T9AA 5JD3A 1JLHA 5AI9A 3ZIAD 2YRXA 4FTWA 2D0OB 3U7IA 1EIWA 2ZUDA 4IJ5A 4A6PA 1UBLS 1UBSB 3C0KA 4I5IA 5F2OA 1M76A 2DUNA 1QO0D 1SC6A 3KKKA 2H7XA 2DG2A 4YMSA 2CCKA 1YONA 1J2TA 3F74A 4QUAA 4ND2A 1RM0A 1YRQA 2A5DA 3HB1A 4M1KA 3SQLA 3F97A 3TFWA 1DT3A 4GWLA 4Y8VA 1I1OA 1QC5B 3M33A 2ZWOA 1XCBA 5THKA 3VR2A 4BLOA 4E32A 1MB3A 1A9XA 2EJCA 2CLLB 4QBIA 4KXVA 3EF0A 5KAMA 1H6CA 1QZTA 5C8XA 2VDVE 1QIKA 4FHFA 1CUVA 3HSSA 3THRA 4JJIA 1JA9A 1R0LA 3CR3C 5JZBA 4Z1MA 1G9XA 3QBVA 5BNZA 5F5XA 4YPOA 1GTZA 4ZK6A 1JQ3A 1N2GA 1ZK2A 2R11A 2XPCA 4HN9A 1JWLA 3P9YA 3IAUA 2YJ4A 1N2CE 3I9JA 3QKIA 4XWTA 4CFYA 4DR5B 3DWIA 3JQEA 2YOFA 2YDYA 1C9EA 2ZRHA 3UK1A 3VKUA 4MUJA 3DKPA 4TZ0A 1Z06A 1SIOA 3QPCA 1D2MA 1E79D 1PUXA 2IXAA 2X6TA 5B1IA 3EBOA 2AX3A 3OQJA 4N0DA 1A9PA 1KQOA 5BYJA 2NU7A 5A9TA 3UMRA 3W06A 2XKAA 4IGEA 1NM5C 1T35A 2UUAB 1XEWX 1RXCA 4Z7NB 3HJAA 4FDLA 1PJLA 1ZD2P 3L0IB 5DM70 1F60A 1H2ZA 3R7DA 4JUIA 4MMZB 3EOAI 1RLJA 2P27A 3OPQA 4HH3C 1B73A 4E2ZA 4ZCIA 5JARA 3GLFE 4CEJB 5HJ2A 1T5OA 3T06B 3NWEA 3OEYA 4RCYA 4U6SA 1UM8A 5K6RA 2FFRA 5DT9A 3AW8A 5AM0A 2PX2A 1XVIA 2C5LA 4UOEA 1UP6A 1ZH4A 2F7SA 3LECA 4BBPA 4HZUB 3C41J 3ONVA 4YRAA 1CHNA 2XQVA 4XD7D 2QV7A 1IAQA 3L0OA 4B87A 4UAVA 3PC8A 4YRDA 4KAXA 3F6EX 2VJCA 2CDCA 3T0FA 5IJZA 3GRUA 1H1LB 3BQ9A 1CFJA 5EQDA 3ORFA 5JDCA 3WZ2A 4UHKA 2N3ZA 1AS3A 1LU9A 1NAIA 3SLRA 3KQVA 2QN6A 2V55B 4AJKA 3ZQJA 4ECAA 5I9NA 4B7XA 3DSRA 4ZI7A 4FOPA 5EOVA 1ZM3A 3FF1A 5B7QA 1E7MA 4IRXA 3P9CA 1SXQA 1JAXA 3KZ1E 1MA3A 4ALKA 1W47A 2YTZA 1M6HA 5E95A 2FPLA 1ZVKA 2GCNA 3H3FA 4MVJM 1L5YA 1EMDA 3DTVA 4X5OA 1V1MB 3Q98A 2VDJA 4C7OA 3HYSA 3G7UA 3S8EA 3T1TA 4F72A 1DKUA 3OQVA 3TVYA 5ICSA 3VKGA 2ZLBA 1GN9A 3D43A 4KXFB 3HCBA 5KQSA 2FZKA 4C6TB 1Z25A 3A1EA 2IOHA 3L79A 1CUFA 1JDVA 1H3FA 1DWUA 1QIFA 3AOEA 1SU7A 3IOYA 1U2EA 3KBOA 1HNWB 3JQ6A 2C3UA 4QPJC 1HYGA 5IVHA 1EZ1A 4PFKA 3RVBA 4AY6A 2C97A 4PBSA 1VOTA 3Q3HA 1ZOOA 3HLKA 4UUAA 1PL6A 4X20A 4J76A 2VNAA 3PBKA 4L9AA 4EKIA 4KX3A 4ESOA 3CNOA 4PYJA 1E4VA 3I37X 5DHSA 5C1BA 5CFOA 5KYVA 3OQOA 1YE8A 1FFAA 1SXGA 4D7AA 1GTMA 1I0LA 3CVUA 3ZGLA 2RSLA 3JPYA 3LFHA 4BHTA 3ZD7A 4BX8A 3UFXB 3QWIA 4G1CA 5CXUA 1QQ6A 1UBTS 2Z1DA 3AG5A 3V4LA 1V4BA 3OH8A 4DNXA 3DPIA 1YBHA 2X9LA 2CVQA 2ZE7A 5DIZA 1Q7CA 4BFWA 2D5AA 4MS1B 1W44A 4ISCA 4JI3B 2DLDA 13PKA 2OB1A 2OL4A 3ABSB 3WFJA 3FYUA 1I2DA 2MSEB 3ABZA 3WLTA 4AY2A 3PC7A 3G02A 2AQ8A 4WZBE 4Q1FA 5LUAA 3O1HB 5DDIP 5CAEA 1AHHA 1A9OA 2FPSA 4V03A 1U8YA 4WCFB 1NNSA 4YO7A 1WF3A 4IV0A 2PKYX 2A0WA 1KK2A 3AP1A 3ND5A 4HGOA 4EHFA 2YX1A 3PWTA 1ZGGA 2GN1A 2XUQA 1ZFNA 3OEED 4L4UA 5DSTA 2P90A 1RAFA 4AG6A 1JHYA 2GETA 2NU9B 1UC8A 2PKEA 3IILA 4RK6A 4JN6B 4ZAGA 5LDDC 1WX1A 1UC9A 3D8NA 1GPNA 2AZXA 5KQMA 3BMQB 1V43A 3C2QA 3KSBC 3U6BA 4Z7QB 3A1TA 2INGX 3L1VA 1M2HA 3KAQA 3U3ZA 4BPRA 3MA0A 5F7XA 2HHJA 1X1SA 2ZJ7A 2QJOA 4NK4A 5TSDA 2D5BA 3ISJA 1CY2A 2GD2A 2HEIA 4ZU6X 3G85A 1KI7A 5CDFE 1BMQA 1W4ZA 3FFWA 4V0MA 3OZBA 3GWZA 3OOSA 2Y0EA 3CPHA 4DCGA 4LY0A 1WCIB 5JCXA 1YQEA 1T43A 2O50A 2DQZA 3K09A 4X63A 2H18A 3EVAA 3GLRA 1BZYA 3D6MA 1G7SA 4FFDA 4A8PA 3RU3A 3OCXA 4FR0A 5EN4A 3IESA 5GPBA 1C7ZA 1OXKB 4GZ6A 4R31A 3JRWA 5DISB 5I9SA 3ESBA 1KEKA 1GZSA 1Y5LA 1AHIA 3A32A 3BGWA 5M04A 3PEVA 1FB5A 3N53A 1T5TA 1NU6A 3K32A 3V42A 2Q41A 5CXQA 3L1HA 1SBTA 4D79A 2JZOA 1ZM9A 1FMTA 4RK5A 3IQWA 1DL5A 1Z18A 2J0EA 3BD7A 2TMKA 1BVHA 2VG8A 3QVOA 5DBFA 2HCRA 2QF7A 1P5JA 1M2VA 1XAHA 2CFOA 3VPXA 4DR7B 2V0CA 4RE5A 1NA5A 3QLVC 1ZLYA 2I7VA 2FUKA 3N8NA 5B7NA 4J0JA 3T35A 1MEJA 4M89A 5E6SB 4EBBA 4MOWA 3V1UA 3B2NA 3BMNA 2FP4B 3HNOA 1E0AA 5K0FA 3WYDA 4F4UA 2O7QA 5DV9A 1B2RA 4DR6B 4XUEA 4G24A 1DPFA 2RGNA 1Y4SA 2Q3LA 3ICOA 5E2BA 1K97A 1OYVA 1I5RA 4K86A 4X7MA 4QSHA 3DMYA 3T3HA 1OLSA 3HDTA 3ZXYA 3OM1A 1U02A 3MGKA 1PDVA 4JA0A 5ED0A 5JAIA 1IH8A 3CLHA 3AL3A 3H2JA 3INYA 5CNMA 3EY9A 3AERB 3RSOA 4EY4A 2C0CA 2NO4A 3ZZNA 5K3AA 4PSVA 1I2CA 2FWBA 3R5SA 1L5KA 4GI1A 1VRWA 1KAQA 2P5UA 1MC1A 5AVQA 2I1LA 1KAGA 5EJ2A 4XARA 1SOMA 1NFFA 5JZVA 3DV9A 4FFBA 4JB3A 4LDNA 4CM4B 5AHWA 4KW7A 3WG9A 3W9UA 2C4WA 2AT1A 3B48A 1Y8AA 1UEJA 4NEQA 5COQA 3CKKA 3T7CA 1DCKA 2BFWA 5F4BA 1YRBA 4HOYA 3QY9A 3ZHSA 1UBGA 3F7OA 2ZM6B 3B6EA 1XPUA 3FZNA 4DCNA 2E89A 3ASYA 2Q1UA 1F3OA 4W5HA 3CLTD 3WWZA 4OHOA 3MMNA 1IY9A 3BRWA 1NASA 1Z6QA 1RC0A 1EESA 4XFJA 4F56A 3JQQA 1U98A 2CXPA 2NNWB 2ZROA 4EENA 4BO0A 1NE7A 2JFFA 5J23A 3ROQA 4P7JA 2Z1MA 2QRNA 2XNDA 5HE8A 1PV1A 3EHEA 3LKVA 1ZRNA 2MYUA 3IA7A 3KSZO 3AY7A 3G2PA 2PHZA 4MVJA 5C5CA 1NJ5A 4LX0A 1PX0A 3NCHA 1YBMA 3D6JA 3T99A 2HEGA 4JBYA 2ZRKA 4KQ1A 1VBMA 4L28A 4P58A 1XF1A 2OV4A 2X5NA 3GNQA 4V2UA 3DDHA 3HDYA 2IXTA 1FDVA 4YRLA 2EBWA 1EIZA 3GLQA 3LYLA 1ZD3A 2C78A 2JCGA 3W8DA 4R9RA 4MIKA 5JQWA 1JKJA 2IYEA 1JR2A 5TARA 2G82A 4OAQA 1C3OB 2W0SA 4Z7OB 5HG0A 4YV2A 3E5MA 2L69A 5C8ZA 1VLQA 1GDHA 4D26A 1V5IA 2CVZA 4HH4A 3UKJA 3NUQA 5KTTA 1YJ5A 1N3YA 4BLWA 3C24A 3FVRA 3KTAB 3REGA 3GJ7A 3AR7A 3FNHA 2REQA 4L78A 3ZW7A 1V4VA 2FMUA 2PR2A 2IP2A 2OP1A 2F1KA 3IOMA 3W8RA 2XBMA 5DASA 3NQ41 3QOXA 2B9VA 1N7GA 1WXGA 3Q9NA 5G0SA 2I3DA 4UXHA 1P91A 4Y1EA 3MZ0A 4K1XA 3BH6A 1FMJA 1W94A 1EM8A 1XL0A 4OIFA 2AG1A 4B4DA 4BNLA 4S05A 1XQ6A 1YA6A 3CHYA 2ZUSA 4FLMA 1FLAA 3FJ1A 1WJGA 1W8DA 1X0XA 1F8GA 4L8VA 2CHUA 5FPPA 4UNRA 4YV7A 1NQWA 4F7WA 2NYUA 1E20A 3RE1A 2WIBA 3ADBA 4ZJYA 2D1TA 3EISA 3BA6A 1RYBA 1HTWA 3A4LA 2YYSA 3L8HA 1PEAA 5TXGA 1Q1ZA 1USKA 1P1HA 2QRKA 1V16B 1C4WA 2Y05A 2XTAA 3R3XA 4MUIA 4EYEA 4CM1A 5ITVA 4D3ZA 3QUSA 4L6AA 4QT4A 3U4AA 4BYGA 2G3YA 1MFZA 5GONA 4JT4A 5C5DA 3OWOA 3ZKWA 2QUIA 5HCIA 3EA5A 4HEA1 2IYTA 2QIPA 2VVTA 1EP3B 1F7UA 2V54A 3UT6A 4C4ZA 3K2EA 4ZZ3A 2YWHA 5DVZA 3BB1A 1ISPA 3AHEA 5CVVA 4RVDA 1T4CB 4FMBB 3ZOZA 4UUQA 4IQ8A 3F5FA 1P9RA 2OCLA 3ETCA 3GARA 4JVOA 4KFRA 1CUYA 2AC7A 4JWTA 2RI1A 3A6GA 3DR3A 3FX2A 3MN1A 4NNOA 4XKJA 3GDOA 4J7CA 4ZQFA 1OIWA 2YWFA 1ULAA 2JLRA 2PGLA 5ALSA 4EPYA 1UOEA 2AHOA 3NIWA 1FSPA 5E7IA 2O7NA 2C9OA 1OMOA 3SMQA 2UZ1B 2BT4A 3NIBA 3LGAA 2JGEA 4EPTA 1X8KA 1ZGJA 4GECA 3A4NA 5FBWB 1GJRA 1E7SA 1Y7LA 2JGMA 2O07A 2JKZA 1M72A 1JBEA 4RA6A 4FBGA 4ZU1X 3RYTC 4F2WA 3ROGA 3T5AA 3FI0A 1CUBA 3ORSA 1N3BA 1D03A 4QBTA 3O4FA 1TCAA 4JDUA 2P77A 1U9YA 4DJAA 3B1KA 4M6WA 2J0VA 2ZUVA 2QTVA 2Q1TA 4QHYA 5EMJA 2C98A 3LV8A 4WJKB 3AVQA 3K53A 5HF6A 5EIBD 4OK5A 1AOXA 4NDZA 4PC7A 4B75A 2Y0DA 1WE2A 5BVHA 5IZCA 3DKVA 2D0PB 1IWPB 3IUMA 4WTOA 1NVDA 1BA3A 4JLJA 3VNQA 3MJTA 1HV8A 1E32A 3IV6A 2J6HA 2BH2A 1W0JA 1Q3TA 3ELYA 4DQXA 2XH8A 2OXCA 3C6MA 1MIOA 1Q6ZA 3LBHA 4PHCA 3PHHA 4M55A 4XVRA 5AM2A 1AA6A 3QE9Y 3RVLA 4JHLA 2GJ4A 3UHOA 2FTKE 3DMDA 4D44A 3J80A 4LRWA 3O4JA 3VQTA 2CFIA 1KZ1A 4XWYA 2REXB 4OL9A 4DWOA 3R20A 1ZMXA 1RZ3A 1LC0A 4YJGB 2GFIA 1C3LA 4JEIA 1Y1TA 2VI5A 3K9LA 4KXWA 3S2SA 4GPBA 4JJ8A 1NZJA 3T3EA 1EFAA 2GLUA 2J5RA 3GBPA 3TCNA 3RTCA 3UA4A 3WNQA 1RXUA 3WKDA 3L7AA 3SHTA 1CX9B 2HV8A 2KE5A 5K8TA 3C3PA 1XCPA 4Y67A 3AXTA 1P9OA 3PGJA 4LBYA 4QXOA 4K40A 4S1NA 5EFZA 4C14A 1UZNA 2J09A 3IAAA 1G2IA 4O0MA 4PGFA 4IWYA 4UXJA 2WFZA 5G02A 3ZG6A 4I6EA 3DMTA 2PT9A 1JG1A 4JGBA 2QLTA 4FEYA 2JGDA 4H16A 3TUZC 1VMAA 1PWEA 2A1UA 2FI1A 4UATA 3SDZA 4B43A 5IHPA 3FPLA 2CBXA 2VHXA 1W0KA 3ED1A 2YVLA 3H2BA 4XRGA 1CS4C 4ABTA 3F6YA 1RXIA 4XVHA 3NIDB 5CHYA 1V1RB 2NYAA 2QLFA 4PNEA 3BGVA 3CO0S 3WNCA 1Q15A 4EL5A 5LIPA 1E18A 1WPGA 3ACCA 1E4EA 5FORA 2BI7A 2C7BA 1DAHA 2JLVA 2JHCA 3EK2A 3ZXSA 1CB0A 5A3RA 2J3JA 4NCBA 2PE5A 2FY8A 3K9HA 2GM9A 4POOA 1UP7A 3GGPA 1QONA 5KSZA 3OURA 4I3HA 2G9VA 5L3VA 7ADHA 4DDVA 1X7HA 4DV5B 5EUBA 3EFEA 3E5HA 3G7SA 4BFUA 1QXSA 3DDUA 4IG4A 1JVSA 5EWMB 4AZ0B 1EQUA 4NPCA 3K9FC 2WB4A 1I8TA 5FNZA 1T6NA