3JQBC

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-5-(2-phenylethyl)-3,7-dihydro-4h-pyrrolo[2,3-d]pyrimidin-4-one (dx6)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
247
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
total genus 89
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqbC00
2D5CA 3C7AA 2NVWA 3TN7A 2Q45A 1K0UA 2PD6A 4PG4A 3FSRA 5TGDA 1PTJA 3OECA 1UZNA 3PZBA 2VWQA 5C3MA 5A03A 3PIIA 3DO5A 1G0NA 3TNLA 1LSSA 3ITDA 1U2DA 3FCOA 2DAPA 3LK7A 3JQCA 1FXSA 1BVUA 4AJOA 4YAIA 2IDZA 3WIEA 4F46A 1PGQA 4II3A 1H6CA 1EUCA 4KUEA 3C3XA 4MP8A 1UP6A 5T5QA 3OIGA 5IAAA 4D42A 2HSDA 3WR5A 1Z75A 4XB1A 2Y0DA 4NU6A 1XIVA 4I9UA 4JBIA 4CMIB 2VCYA 1WDLA 1PS0A 3BIOA 1YQXA 4GWGA 1I10A 1UXJA 4ND5A 3WQSB 1ZW1A 2BFPA 3ZGYA 4ESOA 2DTXA 3FNGA 3KM0A 4QFCA 3QRWA 3FRJA 3QA9A 4XQGA 2HMSA 3VH3A 3DMTA 4EI2A 3PJGA 4CR7A 1K89A 4A0SA 4ID9A 2G76A 1GPDG 1YKFA 3ROPA 4J1TA 5IZCA 2VUUA 1B8PA 3AI3A 1E3LA 5DBIA 1Y5RA 3A06A 5G0TA 2IZ1A 4YWJA 3N7UA 1LLCA 2B69A 1F12A 4Q3CA 4P4NA 4CLEA 4XQ9A 4YAEA 1VC2A 1WVGA 4YYZA 3GN1A 1LLDA 2YV3A 1Q0HA 4MIYA 1W8DA 1RM3A 4WLFA 2P4QA 1HE3A 3P2OA 2UYYA 2YHIB 3U0BA 3DXFA 4AICA 3UH1A 4IXTA 1VI2A 2BFAA 4W7HA 4EJ0A 2GO1A 5H81A 1TI7A 4U0JA 1GPJA 2O3JA 5ILOA 2GNAA 4B4VA 1FDUA 4WNIA 1QR6A 3CZMA 4R01A 3GPDG 4PG6A 2VZ8A 3KUXA 4D3SA 1MB4A 3WDSA 1JAYA 1HSZA 2IE0A 3ZV4A 5L53A 3QLJA 4HY3A 4AJEA 4CM6A 1T2AA 4DYVA 2OL4A 1SOWA 5JY1A 2AQHA 4DUPA 4TWRA 4JNKA 4E5YA 1LSUA 4YJHA 2I65A 4Z6KA 5CDUA 1I3MA 2SCUA 3GEMA 3ABIA 3EMKA 4ZGWA 2LDXA 3Q9UA 4M86A 5I9LA 1GYPA 2PTGA 5DT9A 1L1FA 4TVBA 5J23A 3K9QO 5JDIA 1GFSA 1P45A 2VRCD 1K6XA 3GA0A 5AYVA 3E6AA 1U3VA 2VHXA 3ZU5A 4TQGA 2GF2A 5JCJD 2Z1NA 1OOEA 1IULA 1E7SA 1Q2XA 3JD4A 1IZ0A 4PLVA 3R3JA 4CMJA 2AQ8A 2C7VA 3G1TA 4CV0A 3D64A 4GQAA 1X1EA 5JXWA 4MVJF 4GX0A 3ZNNA 3JQ8A 2I6TA 2IXBA 5JO0A 2CD9A 2RH4A 4YT4A 2IYOA 4UVIA 5L7TA 3E8XA 3F1LA 3RASA 1HLPA 5CDYA 2NNLD 2EJVA 4W9NA 2NM0A 1GZ6A 1S6YA 1PQPA 2YHIA 4BOYA 2BLLA 3HZZA 2G0TA 5TQVA 2HMUA 4AVYA 4BNNA 5GY7A 5DF1A 3DTTA 3EZLA 4BMNA 5COQA 3PWSA 3ICPA 3VPXA 1Z45A 3ASUA 1C1XA 4G65A 5LCXA 5JE8A 4CLOA 2DUWA 3RSHA 2VOJA 3D3WA 4B8ZA 3BMCA 1C1DB 4IIUA 4BNGA 2C59A 1PL7A 4W6ZA 5GZ6A 5HA5A 1X0XA 4XYLA 3VAZA 2ZJ1A 1CF2O 7MDHA 1V8BA 3AFMA 4BHTA 2J3JA 1PGNA 2Q1UA 1NPTO 4R69A 4IS3A 1XQ6A 2DVMA 2FPPA 1ZSNA 4DC0A 1N9GA 3A9WA 1ZK0A 2QRKA 3KSDO 1VL6A 3BTOA 3VC7A 3H9EO 3DZHA 1QP8A 1UR5A 5TSDA 4E2YA 1V35A 4JP2A 4OXYA 5T6BA 3KSUA 4B8WA 1FMCA 2H6EA 3CMCO 3W6UA 3I9KA 5K6AC 2PGJA 5TX7A 4FS3A 4I08A 4DYDA 1K6IA 3GN2A 4FJ0A 1NXQA 1V6AA 1E7QA 2O4UX 3WMXA 2OP1A 2B4TO 3CIFA 4CMEC 4EITA 5A02A 1QLHA 4RVHA 3RBZA 1PSDA 2XXJA 3GEDA 2HMVA 3JD3A 1MGOA 4MVJA 1NPYA 4OKNA 4AJNA 4KDFA 3ZNOA 3UN1A 3K31A 3O4RA 1EUDA 4W4TA 2Y99A 1WW8A 1C0KA 1P31A 1X1TA 3G79A 3E5MA 4NI5A 3ON5A 2J5QA 3P7MA 4YDRA 1LJ8A 1LSJA 1R4NA 4YVFA 4AFNA 4KUGA 1DB3A 3B1FA 4KQWA 3H2ZA 4PGFA 2YY7A 4E31A 1Y1PA 1YL5A 3ZI0A 3AUTA 4Y67A 2ZCVA 5TNXA 2FZWA 2HO5A 7ADHA 5BSEA 4RV9A 4FW8A 2W2KA 2X58A 3TFQA 4F3YA 3S1LA 4M87A 1MC5A 1JVBA 5IDYA 3JQAB 2JL1A 2DTDA 1B3RA 5C7IO 1U7TA 2Y1GA 1ZO8A 2CVQA 3T4XA 5IXSA 5L40A 1H6DA 5EL0A 4RF4A 1B0AA 2VHWA 3N74A 3AUUA 1P1HA 1W0CA 1XEAA 2ZB3A 4B3IA 1XU7A 3DOOA 3QVWA 4ZVVA 1E1KA 3M1AA 2GN4A 2YDYA 3QWBA 1X7GA 2RAFA 5MGBA 1HEUA 4TZTA 4PZDA 1QG6A 2AQKA 1FF9A 4YQYA 2WDZA 2B83A 3VPSA 4LK3A 4PLYA 4R9RA 3JQFC 1YVEI 2O2YA 5F5NA 3H9QA 1U7HA 3QIVA 2VWPA 4Q3DA 2OO5A 3H65A 3LT0A 3V2HA 1Y81A 1GU7A 3W8EA 4ZQEA 5BSHA 3W1VA 4YEDA 2I3GA 1R6DA 4LSMA 1EE9A 4LN1A 3I1JA 4K6FA 3PGXA 3TDKA 2Q50A 3Q9NA 3AOEA 1HDRA 4OKIA 2H5LA 3BMCB 4UEKA 5G4KB 5KWEA 1BW9B 5IXYA 2HRBA 4TVOA 4F6CA 3K6JA 2CFCA 4A73A 4YT8A 1DOHA 4II2A 3F1KA 1TLTA 2NQTA 1GV1A 4LGVA 4AJJA 1DFGA 4BO0A 1J49A 1PS8A 1LDGA 1CETA 1YGYA 3WGTA 5BNTA 4I8XA 4L74A 4BO3A 2GGSA 3MWEB 4CQMB 4N18A 4EJMA 3IL2A 3OM9A 2G1UA 1KY4A 4TMFA 5T64A 2FP4A 2AQIA 4CMAA 5B12A 5ITVA 2Y68A 2EWMA 5G4LA 1YRLA 2X22A 1EK6A 2RH8A 1LLUA 4INAA 4L73A 1A7AA 4MPDA 2Q2WA 4JCOA 5JMWA 3JQEA 1DFIA 1ZK4A 2QIOA 3ZW9A 4BB6A 1LDYA 4RCVA 4XR4A 5A9SB 3PYLA 2ZYAA 1DO8A 1VKNA 4C7KA 2ZYDA 4R68A 3TOXA 4P4LA 3H5AA 4J0EA 2B0JA 3WGQA 1ZFNA 4M49A 5BT9A 1SB8A 4CMIA 2GD1O 5CEFA 1MUUA 4Y9DA 3CKYA 1SOVA 3B6ZA 3MJEA 3M1LA 3ZWNA 4IDAA 2R2GA 4OOEA 3I9LA 4RO0A 2VNAA 4U5QA 4IQ0A 4YB8A 1J6UA 4XRRA 1C0IA 2JFGA 2JJYA 3DHEA 4BNFA 3RUEA 3DHYA 1EVZA 3L9XA 5I9MA 1KEUA 3ENNA 3KYCA 3LT1A 3WQRA 2X23A 3WJAA 1XKQA 2JFHA 1LX6A 4B4UA 1KVRA 2JAPA 3RU7A 1MX3A 1YB4A 4P4GA 4TZKA 3WB9A 4ALJA 1NVTA 2GZ1A 4G81A 1IL0A 4IDBA 3GZNA 2GN8A 4J1SA 3PZRA 3JQ9C 1QRRA 3OQ1A 4RVFA 4DTIA 1R4NB 3IP3A 3QHAA 2ET6A 3AWDA 4L4SA 1U5AA 5KVCA 1DIBA 4CMGA 2VOEA 3DBLA 2JCXA 5JMPA 2AHRA 2PGDA 2WTBA 1HRDA 1H2HA 3WIDA 5T67A 2IXAA 4G2NA 1LEHA 3K5PA 3AK4A 1P3DA 2OXIA 1ARZA 4E2XA 4U6SA 3E5RA 1H9AA 1I30A 4IMPA 1C0LA 1KETA 3QW2A 3HDYA 4PG7A 1PJ2A 2E37A 5U9CA 1WDMA 2YV1A 3PXXA 3O8QA 3UFXA 4RQTA 1U3UA 2GSDA 4FD3A 3AOGA 2P9GA 2YUTA 3ZHZA 2YHUA 3JYOA 1ZJZA 2DUUA 4R16A 1PIWA 3NT5A 1IB6A 4YAJA 4CV3A 3K73O 4LVUA 4OHUA 1R4MB 3F5QA 2XF8A 1I3NA 3ZW8A 3MTJA 4GL4A 4BNUA 4GLLA 3NTRA 4TRJA 1DHTA 3KYDB 1YO6A 2BH9A 3S55A 1B2LA 4GLOA 4IQGA 5C7OO 3QQPA 3D4OA 1ENZA 1NVGA 1P33A 3ETDA 5U4QA 5HTOA 2YDXA 1E1MA 3TL3A 4I9NA 2YFQA 1GDHA 2CNBA 4B7UA 5U1PA 2ZQYA 2PLAA 4FGWA 3G1UA 3KV3O 3V1YA 1N9GB 3F9IA 4DPLA 2X6TA 2Y1EA 5I7FA 5DNAA 3TRIA 2I67A 2W8ZA 3ETGA 1AGNA 1YJ8A 2J3KA 1X0VA 3GFGA 3LSYA 3RKUA 5FWNA 2A94A 5JDCA 5A9SA 1EDOA 3DZFA 4J43A 3DAFA 1NYTA 5LC1A 2UDPA 2B36A 3GNTA 4GVLA 4XEHA 4CMCA 4UAGA 4WGGA 3C1TA 3B1KA 1B15A 3INRA 1H93A 1N8KA 3L6OO 5F1KA 2WSBA 3JQDA 3PHIA 5JDCC 5AXDA 5ICSA 3LYLA 3WX0A 2NACA 1D1TA 3HDQA 1CQIA 3D4PA 4KQXA 2BI7A 4NH4A 3RUCA 3EK2A 3A28A 3ANNA 3D3EA 4ND4A 5TJHA 3GG9A 5L9AA 2OHXA 4FOOA 1Y8RB 2C07A 1E7YA 2TMGA 2WE8A 1GQ2A 3WQQA 1M2WA 5I8ZA 3RD5A 2EGHA 2OBYA 1A27A 3E48A 3JQGB 3JQ8B 3TWOA 4GWKA 3W4IA 4AJ1A 1R0LA 4XKJA 3PI7A 1YL7A 3CE6A 1ZIDA 3HQ4O 4E21A 2IEDA 1CERA 4XDYA 4N54A 2OGUA 1BXGA 3VZSA 1H2BA 1PZGA 2A92A 4AJHA 4EEXA 2PH3A 1T1SA 3RC9A 4BIIA 9LDTA 4IM7A 3JYLA 2O3SA 5TC4A 2JCYA 3WYCA 4YPOA 5I7VA 4LRTB 3WMWA 4EJ6A 1LQUA 1PEDA 2POQX 2OORA 4JROA 3H8VA 4M8SA 4WK6A 4FQ8A 3CTMA 1K6JA 1EQ2A 4DXHA 4J9UE 5KVQA 1O8CA 2ZQZA 2EG9A 1R66A 2Y66A 4XIJA 4ZA2A 3FI9A 3SLKA 3TZQA 4A5OA 4DIOA 3NAQA 3P2YA 4C7JA 1VLLA 3M2PA 5JC1A 1ZSVA 3ADPA 4YQZA 3BMQA 1D3AA 4DBZA 4NDNE 2I99A 1GQYA 4L9RA 3N58A 1WAMA 2CZCA 4BQRA 4FFMA 3VH4A 5B4UA 1YBVA 4O59O 4L75A 5CFZA 5IDWA 3GQVA 5L4LA 1E3SA 2VNSA 2V6GA 4KTTE 4AJIA 1ULUA 4QSMA 3WOHA 2EV9A 3D5QA 3ITKA 2Q49A 4I5DA 4OQYA 5DULA 4O0LA 4XA8A 5A04A 2AE2A 5IFLA 4PVDA 2O3QA 3KYDA 1UUFA 4GAEA 4CQLB 2P68A 2D0IA 3ZZNA 4TKLA 4GSLA 3UAGA 3MZ0A 4JN6B 1QYWA 5DBGA 3E9NA 3T7EA 3FPCA 4HFRA 1A72A 3CINA 4N5MA 4KMSA 3KXDA 3ONFA 4QFDA 3Q11A 1SC6A 3H4VA 1J5PA 3GHHA 1DIHA 3ANLA 3JQ6A 3DEYX 4BGUA 4J2HA 5C5IA 4I9HA 5IN4A 5L3ZA 4IY1A 1WZIA 2O48X 3VVCA 4UEOA 1EVIA 4JIGA 3EW7A 1RKXA 2RIRA 4MJLA 3CPSA 2QW8A 2GN9A 3I4CA 1F17A 2Z5LA 3HUDA 5KVVA 3LC1O 1DLJA 3DAPA 1GUFA 1ZK3A 3GG2A 3GVHA 3IP1A 4QECA 5ITWA 4JLWA 3H9UA 4BS9A 3IAHA 2LDBA 4FFRA 4GX5A 5ER6A 2C82A 1MG5A 3SBOA 2NVUA 1LUAA 3PVZA 1B14A 1OAAA 4MVJG 3OEYA 5JCXA 2Q1WA 4R5MA 4Z9FA 3GY0A 3UCXA 4I5FA 3V8BA 2PNFA 4FN4A 1I32A 1N1GA 5KNLA 1IPFA 1ONOA 1PR9A 1VKOA 3KETA 4BV9A 1NX6A 3NJ8A 4DPKA 3OIDA 4RQUA 1E7RA 4LISA 5ICMA 1BDBA 1A5ZA 1NR7A 1NVMB 3BMOB 1SZJG 4BNYA 1BHSA 1PZFA 1B7GO 4ONEA 5LDGA 3IKTA 4PG8A 2FSSA 5IF3A 3SXPA 4J7XA 2IZ0A 1ZK2A 2NQ8A 3GLQA 4BL5A 4RJTA 2VQ3A 1PGPA 2BFOA 1GEEA 3VOSA 3PGJA 3JYQA 1UXGA 3JQBA 2PWZA 2V6BA 3QWFA 4BNXA 1BW9A 5TS3A 4MVJD 1PZEA 3O26A 2W2LA 8ADHA 2I66A 2FMUA 4E2WA 2CVZA 4EUHA 3DZBA 1DC6A 1WPQA 2X9VA 5F3RA 1N1EA 1ZEMA 1YB1A 3K96A 3OQBA 1U3WA 2EXXA 1D1SA 2ZTVA 2HJRA 5KIAA 2OMEA 4ZICA 1PJQA 4ZRNA 5L4NA 5K9ZA 5C37A 1A9YA 3IDSA 4JK3A 1NFFA 4AJ2A 3RC1A 2AEMA 3TJRA 5COAA 1PWXA 4LSWA 2VTEA 3FHLA 3I83A 5JAZA 4IJWA 2CDAA 3RUAA 4PLCA 3IIEA 3RQSA 1Y9EA 5KVSA 1LRLA 3IQDB 4CQLA 1ISGA 1IUKA 3MJSA 3K92A 2PGLA 3DOCA 4BGVA 1DDOA 2BGKA 4IJVA 3WNVA 5KTKA 2CF6A 4E5KA 5I7EA 5HM8A 1FJHA 5KKCA 1DRWA 2E6UX 1D4FA 4BKUA 1B8UA 2X0NA 4WCDA 3BMOA 3NKLA 4RDIA 3FR8A 1QYXA 2HDHA 1XG5A 1T2EA 1LDEA 1M75A 4E4YA 1GYQA 2BELA 4BUCA 4MDHA 3FTNA 4E32A 1JKJA 3GT0A 3JYPA 4RPJA 4ZJUA 4Q3AA 3ZWBA 1GEGA 4S3MA 3GOHA 5EQDA 4R41A 2WYWA 3H2SA 3WG9A 4C4OA 3FWNA 3PFWO 3FNHA 5KJFA 4YRDA 3QVTA 3AM5A 3DQPA 4R1UA 4YRAA 3WFIA 4WLNA 5JO9A 4IJKA 1ISJA 2A4KA 5A9TA 1P1FA 3OJ0A 3ROKA 4PLWA 2WJPA 4DL9A 1MP0A 5JPIA 1O6ZA 4GPD1 2ZCUA 2PK3A 4J3FA 1YXMA 1W73A 2HMWA 4CM9A 1Z7EA 2VRBA 4BO9A 1LDNA 4OMUA 3GZ4A 1A4IA 4MO2A 3A4VA 4GBJA 2QX7A 4KZPA 3WLEA 2AMFA 2NU6A 3C7DB 2Q4EA 4NFYA 4YRBA 2AA3A 1ONNA 2TMDA 4GGOA 3BTSA 3RKRA 3K2EA 3W8DA 4OXKA 2PFGA 5CEEA 3U9LA 4WEQA 4PLPA 3FTPA 2VWHA 3NTQA 3UKOA 3H5RA 5L45A 4EW6A 5I7SA 1HETA 4CM3A 4N7RA 1J4AA 1HE4A 4BO1A 2QQ5A 1GY8A 2QRJA 3UW3A 3TQHA 4PFJA 1JU9A 3A14A 3PHGA 3L9WA 4HV4A 4YAKA 4NJMA 3EDMA 4BNKA 2QYTA 2D2IA 1NHWA 1GYRA 3D7LA 2AG5A 1ZKMA 1AHIA 2X7HA 2ZATA 1JQBA 4XX0A 3ADOA 3LT4A 4BQPA 3AM4A 2J3IA 4RLHA 4GMGA 3B1JA 2PZLA 3KEQA 3UGKA 2GRAA 2HUNA 4F45A 1CWUA 3CXRA 4XD2A 5EPOA 2YZ7A 4NBTA 3HDHA 5B37A 4J91A 1IHXA 3E18A 4WOJA 4EZBA 1QLJA 1BG6A 4BNIA 4RVGA 3ZWXA 3RC2A 1PJ4A 1I2BA 4R1SA 1E7MA 1ZEJA 2P4HX 3GHYA 1C1DA 2DKNA 1HZZA 2DBZA 4RPHA 1T24A 1CIVA 1QYCA 1BVRA 1PJBA 4J49A 1JDJA 3HADA 5ENDA 3WSVA 3KEOA 5ER9A 2FN7A 4ALKA 3PFFA 1PS9A 4DQUA 1OC2A 1ADCA 3LF1A 4URFA 2PZJA 1N92A 1MFPA 4K1LA 3F46A 2ZJ0A 2Q2QA 1BXKA 1VJ0A 3ASVA 4IDGA 4YBZA 4IDDA 3L6DA 4HKTA 4YAGA 5A06A 3HFSA 4YCAA 2C29D 4BO7A 4BNHA 3VHRA 2R00A 4XYGA 4D0RA 5GZ1A 2HK8A 4FOSA 1E3WB 4LCEA 3ZNQA 4MKXA 3L4SO 3FNFA 3M2TA 5A5EA 5CG2A 3GAFA 1V3TA 2X0JA 2JHGA 2OBNA 4FFNA 4CM7A 3FPLA 2AW5A 4CUZA 5TJ9A 3IKVA 5L4SA 1O89A 4GVXA 1YBMA 4MP3A 4XIYA 1JW9B 4RPKA 1QKIA 2NU7A 3U09A 3Q0EA 4BGEA 4E30A 3ZV3A 3W8FA 1RYDA 4CJXA 4DWVA 5A5FA 3TZKA 1A9ZA 4PLTA 4OSPA 4Z3KA 4CM1A 5JY6A 2J5KA 2HCTA 4WLEA 3SX2A 4M54A 3BMNB 5JYDA 2HK9A 2D1YA 4E3ZA 4XRGA 3IJPA 1RPNA 4BO2A 3G17A 3EAGA 2WM3A 3JQ9A 3ZV6A 3CMMA 1KC3A 3RUHA 4TSKA 4NU5A 2C2XA 1KVTA 5KJEA 2X5KO 3RJ5A 1GCOA 1Z73A 3WLFA 4FB5A 4S1VA 4MVJI 2FPGA 4CLXA 1GCUA 1GV0A 4PLFA 4M55A 5A3VA 3D5TA 3MCVA 3DDNA 1HDZA 4B7CA 1IZ9A 5CPBA 4B4OA 2J5RA 1VE9A 4BV8A 3AW9A 1N7HA 3W6ZA 1XCBA 4PRKA 5EERA 2NTJA 4QEDA 4MP6A 4WECA 4CLOB 1G1AA 2DBRA 3BHJA 5EJ2A 3TL2A 3R6DA 5BSGA 4UUPA 1Q1NA 2VN8A 2H1SA 4NFSA 1F14A 2GASA 3NYWA 1NQOA 3LZ6A 3RUDA 3SC4A 3ZNPA 3ZU4A 4MIOA 5AVOA 3RU9A 1UP7A 2NLOA 1ZVMA 2DM6A 3OFSA 4CLHA 4O1MA 1U8XX 2JAHA 4PZEA 1TXGA 1YDEA 4UUMA 4PLZA 2Y0CA 4OQZA 2EEZA 1B26A 1CYDA 1YJQA 3VDQA 3F4LA 1N7GA 3LU1A 4BMVA 2DTEA 3H6KA 4QTZA 4B4WA 3RAJA 3QVSA 3IS3A 2W2KB 9LDBA 4E5NA 3DZIA 5T8KC 3MJ4A 4LW8A 1HXHA 1XQ1A 4UUNA 4W9NC 2FZEA 1PQUA 3U49A 4CR8A 4B7XA 1BTOA 1F8GA 2XOXA 2PH5A 3OA2A 3PYXA 1GD1O 1ADFA 4Y6SA 2P2SA 4FFOA 2VHYA 3KOUA 4XYMA 2DPHA 4RORA 5BNFA 4YT5A 2WWRA 1O5IA 2O7QA 4IBOA 3AOEC 2NV6A 5JAIA 3BZUA 3QJ5A 2NSDA 1ZMTA 2P5YA 3DZJA 3E82A 3D3WB 3PDJA 4ND3A 3TPCA 2PKQP 2ILTA 3EY4A 4J1NA 4NBRA 1GAEO 1E3JA 1NWCA 2J3HA 5CHEA 1GL3A 1OBFO 2EHDA 2I9PA 2JD0A 2BHLA 3AY3A 3PHJA 1BMDA 4WCFC 4CMHA 3HFGA 1E3WA 3GEGA 1AXGA 1JLLA 3JQFA 4R3WA 2CF5A 1U3TA 1A4UA 4U7WA 3GDFA 5G0VA 1KC1A 2FR0A 3GVCA 3NUGA 1JWBB 1Q0LA 1X13A 4H7PA 3S2GA 3E03A 1IPEA 2J6IA 3V2GA 4PN3A 4UVHA 4J90A 3OEWA 4WNCA 4IZHA 4BO6A 3BXXA 3C8MA 2B35A 1QV7A 2VT3A 4DLLA 3DONA 1S7CA 5JAQA 3COSA 1R15A 4JJFA 1EDZA 4QQRA 4D3DA 1EFLA 4BO4A 3ONDA 2OZPA 1HYHA 1XYGA 1T25A 3RFXA 3O9ZA 2PD4A 4EBFA 2NVUB 5BNIA 3QWAA 3JQ7B 4MVJP 2WE7A 3HNPA 4FFPA 4KOAA 1HT0A 3F3SA 1XHLA 2YJZA 1VRWA 5T57A 3LT2A 1KEWA 1AXEA 4BNVA 4I5EA 5DCWA 5CPFA 4N5LA 3EVTA 4L76A 4FFLA 4OJNA 4GSKA 3RFVA 3KYCB 4I1IA 1SO8A 3V5NA 2IRWA 2AEJA 3AI2A 3O38A 5IDXA 2E49A 3PQFA 3OICA 1X15A 1TB4A 3BYZA 4Q9NA 2CMDA 1SB9A 2NADA 5EESA 1K2WA 2BD0A 5A1TA 1E5LA 5DCYA 2DC1A 1VL0A 3U4IA 2C2YA 2HLPA 1UDCA 3DFUA 1OC4A 2V6FA 1B8VA 2G17A 1C1XB 2XXBA 4J4HA 1X7HA 3JD2A 3SLGA 4UVGA 1NAIA 5K6AA 4GGPA 1E6WA 1R16A 4AJPA 2QZZA 1RWBA 3R3SA 2C5AA 3GRKA 4MOWA 3ZHXA 3OMLA 4XR9A 3MOGA 3ZH2A 3WYEA 2EF1A 2G82A 1Q7GA 3KB6A 2JD2A 4UEJA 2DPGA 2WD7A 3ZV5A 4D43A 1NQTA 2I76A 3QY9A 1UXKA 2EP5A 3O8QB 2FRDA 4P8RA 2QYSA 4Z9XA 1BXGB 4EGFA 4CM8B 1T4BA 3FBGA 1DSSG 1ZSYA 4BNTA 3AUSA 1XR3A 1H0KA 1LQTA 2WD8A 5CDSA 3WGOA 4AJ4A 1E92A 2GLXA 1UJMA 1D7OA 1GUYA 4PZCA 3R0IA 3I9NA 4R1TA 2JFFA 3ZWVA 6LDHA 4FSHA 2HMTA 3KLMX 3UOGA 2CDBA 2YQ4A 1SAYA 2D4AA 3PWZA 3A1NA 4XCVA 2VYNA 4LMRA 3DBHB 3G0OA 3MJVA 1I3LA 5G0SA 1HDOA 4W82A 4R3NA 2P9EA 2EGGA 2AE1A 5TRTA 4Y6PA 1Q7BA 4H3VA 4R4JA 1N5DA 2VHVA 5A05A 4ZU3A 1DEHA 4YR9A 3AJRA 1GQQA 2VRCA 2AXQA 3AY7A 5KOIA 3GFBA 2HK7A 1WDKA 4OYRA 1L7EA 3PQEA 2XAAA 4HFJA 3DB2A 2WYUA 2FOIA 3JSAA 1W4ZA 1NFQA 1Y8QA 3L07A 4GKBA 1Y7TA 3WGZA 3PQDA 1QV6A 4CUJA 4O63O 2GUGA 5HBRA 5CDGA 1NWHA 2HRZA 1EBFA 3TZ6A 5CAEA 3P5SA 3W4JA 1KS9A 2I3AA 1T1RA 4K26A 4QX6A 1RM5A 1TT5A 1Q0QA 1MA0A 2R6JA 3FR7A 3WWYA 3GGOA 3ORFA 1IHYA 1K3TA 4ND2A 3GZNB 1NM5A 2V65A 4NZ9A 4J2OA 1UAYA 4NR0A 4F6LA 5DDIP 4IQ8A 3WGIA 3H7AA 4OXNA 4OAQA 1MLDA 4H15A 4QT0A 3JQBC 5GMOA 4IDCA 1QYDA 1FDTA 1WLYA 2W98A 3SJ7A 2Q99A 4LRSB 2GZ2A 1WZEA 3WTBA 5CG1A 3LVFO 3CEAA 4H16A 1PX0A 3E9MA 2IEBA 2Q1TA 3K2BA 5B4VA 3CZRA 3TZCA 4NBUA 4RZHA 1VJTA 5EN4A 1EFKA 1E0DA 3UCEA 3VZRA 3DBHA 1EQUA 3GVXA 1U5CA 3BTUA 2UV8A 3MTGA 4A26A 3FWZA 4OM8A 1I01A 1PZHA 1UAGA 3OQ6A 5JNLA 2B37A 3DTYA 4IPTA 2RHCA 3WWZA 4CL8A 1DPGA 1XELA 2PA3A 4ITUA 1AHHA 2C7GA 1NQAO 2ZYGA 1NR1A 1LC0A 4JGBA 4J4TA 4RLSA 3DMTC 2B5WA 2YQ5A 3QWHA 1YBAA 5EMHA 1NHGA 1P77A 2Y1DA 3BTVA 4WKGA 2A35A 4RF2A 1ISFA 2GDZA 5TT0A 1R0KA 2BMAA 4OOFA 4DIFA 4FJ1A 3O03A 3D1LA 4WE3A 1YOVB 4CM4B 5A9RA 2EW2A 1GR0A 1MG0A 1VJ1A 3IC5A 1OZAA 5HRUA 4BO8A 1ISIA 3FF4A 4KUHA 3VH2A 2PR2A 3UF0A 2J8ZA 5FFFA 1ENOA 1N2SA 4KWIA 3KVOA 3DZKA 1E77A 4CV2A 4DLAA 1P9LA 1DC5A 4NMHA 4LMPA 1ZNQO 2P5UA 1E6EA 3QWIA 3UHAA 4WEOA 5AQ1A 1F8FA 1HF3A 4UVDA 2X5JO 3I4FA 3JD1A 3NJ4A 4TROA 2NVBA 3CUKA 3KLPX 4KP7A 4CMBA 3BMQB 4Q3EA 3BHMA 1Y8RA 2EKQA 3U4DA 3PHHA 4BNWA 1HKUA 4NQZA 2QZ9A 1XU9A 2JD1A 5K0ZA 3X2FA 4IMRA 2QG4A 2PD3A 3LQFA 3U3XA 1P1IA 3WICA 3ZN2A 5KKAA 4XJTA 4Y8VA 3IOYA 3LLVA 2OUIA 3UXYA 4NJOA 3UICA 5L95A 1RM0A 3QP9A 3GUCA 3AI1A 4NBVA 2BRUA 4OL9A 1NAHA 1SMKA 3IUSA 3L4BC 3VTZA 3GVPA 2HAEA 1A71A 1SEVA 2GPTA 3PYMA 1BDMA 4PG5A 1LRKA 1I24A 4JBHA 4CL3A 3DL2A 1U2GA 3U4HA 2DQ4A 4UVEA 1EZ4A 3PHLA 4CMKA 4E2ZA 2ZKLA 3BMNA 3MJCA 1NPDA 1P1RA 1HDCA 3KBOA 1DHRA 2GN6A 4E6PA 4E33A 3PWKA 5JW6A 1X7DA 1HZJA 1FDVA 4ZHSA 4FC7A 1HDGO 3RC7A 1YOVA 4CM4A 1NNUA 1V0JA 1V3UA 3R1IA 2PKQO 4Z0PA 1I0ZA 1NTOA 4IXWA 4P38A 3JTMA 4OIMA 3VPFA 5FF9A 2CY0A 3ROQA 4ZRMA 1NFRA 3WYBA 4EUEA 1E3IA 4PLGA 4QUKA 3OSUA 5THKA 4NK5A 3HG7A 3MJTA 2X5OA 4L4XA 1LDBA 1DJQA 4BB5A 3KHUA 3KYBA 4WLOA 4NG5A 1YQGA 1EMDA 1I5RA 1MXHA 2F1KA 2X1HA 4Z3DA 4ALIA 3Q6IA 1B16A 1H9BA 5HS4A 2VUSA 4YJGB 3UCFA 5THQA 1H6AA 3JQAD 2FR8A 4YA6A 4CLRA 4FJ2A 4NK4A 3C24A 5EIOA 1GTMA 2CDCA 3DAGA 2WD7B 3VDRA 4DMMA 4XYBA 1QXSA 3ZWCA 1MV8A 1ONPA 1YL6A 3EYWA 3VPHA 3GR6A 3OIFA 4IDFA 4CM8A 1Y8QB 2VT2A 3WFJA 3C85A 3PJDA 5G0UA 4XGKA 5KJCA 1BXZA 3WS7A 4XWYA 3VZQA 4IGEA 1M6WA 3OJLA 4ZQFA 1OFGA 2V6MA 4PCVA 1CJCA 2V7PA 2O50A 5JLAA 1C0PA 1PJ3A 2UUOA 3KRTA 1EBUA 1UP4A 1LSOA 3VKUA 4U8GA 1PGOA 3L0DA 1ZZEA 1QSGA 3UVEA 2VZ9A 4R51A 4BVAA 1IE3A 4CPDA 1ZK1A 1SPXA 3DWFA 4OO3A 2E48A 2BFMA 1E1LA 3EVNA 1ENPA 4Q3BA 4N5NA 5HS6A 3ETEA 1R37A 2O3TA 2X0RA 4BKPA 3NGXA 1Q7CA 3B70A 4GKVA 3NT2A 3PJEA 4CM5A 2FY8A 2HU2A 1KVQA 4O5OA 5JC8A 3HSKA 3OP4A 1YS4A 1P1KA 1U4OA 3ZWAA 4IZIA 4Y98A 4NJMB 3ZWMA 2F00A 2PY6A 2FPIA 2O4CA 4ND1A 2YW9A 1VSVA 3LC7O 2E4AA 2RHRA 4B3HA 4YJGA 5AXCA 5A3JA 4WLUA 3PRJA 1C14A 1SCUA 4DIBA 2GERA 1RJWA 3ZWWA 3T7CA 2DFDA 3RJ9A 2EERA 3HN7A 1JKFA 5IZCC 3OHSX 3ANMA 3OETA 4OH1A 1HL3A 1WNTA 3SC6A 1HE5A 1HLDA 4WJZA 1M6HA 3DMYA 4CMEA 1DRVA 5KCZA 1PL8A 3MEQA 1GZ3A 4EEZA 3VH1A 4UULA 4GI2A 3NDIA 4ZQHA 1WMAA 2BGMA 3VVBA 2NWQA 4TRNA 1RYEA 4DQVA 1XSEA 3PP8A 4FCCA 1U9JA 1BWSA 3OF2A 1PGJA 1JN0A 3FN4A 4AJKA 3PTZA 1YWGO 4CQMD 1HYEA 3WXBA 1KYQA 3S2IA 4PLHA 3DBLB 3H3FA 2C20A 2VYVA 3LDHA 3ZDFA 5A4DA 2CVOA 2JCVA 1TT5B 3PDUA 3NEPX 1V3VA 4RPLA 5JSFA 2IZZA 5JYEA 1ZXLA 5EINA 3OJEA 1H5QA 3DR3A 3F47A 4QO7A 3KO8A 5KJ6A 2CSUA 5IZ4A 4XJSA 3SJUA 4BNJA 1KERA 1DC4A 1DAPA 2ZTLA 3EHEA 3I9MA 1UDBA 1PR3A 2H9IA 3IJRA 1JVSA 4RVUA 1DFHA 1YDWA 1X14A 1UDAA 1PQWA 2Z1MA 3V2UA 1SEPA 4FDAA 1AN9A 2Y67A 2BI8A 3NT4A 4IIVA 3JQAA 1PWZA 2BGLA 2AG8A 3QVXA 5BSFA 4J16A 2NU9A 4RPGA 3FD8A 3KTDA 3I6QA 3DFZA 1E3EA 4E12A 1IOLA 3HN2A 1YQDA 4WUVA 3GNSA 3Q3CA 2EJWA 1DIRA 1QYVA 2DBQA 2HKIA 4ZN6A 4D0SA 3K30A 1LBEA 1O94A 2DLDA 2W4QA 1W6UA 4D44A 1VL8A 4FGSA 4J1QA 4JBGA 3I23A 1D8AA 1XDWA 4FC6A 3AM3A 3EC7A 1YH3A 2Y1OA 3LC2O 5FEUA 3OJFA 5FYDA 5L7WA 4RVDA 4NIMA 1KEVA 4J6FA 2NU8A 3W4KA 3DBRA 3WGGA 1I3KA 2D3TA 1DRUA 5JAMA 1T2DA 4YJFA 4Z0HO 3ZHYA 4EYEA 3I52A 5TLSA 3HWRA 1E5QA 1WXDA 2FSVA 2ZK7A 1M76A 3E9QA 4OGWA 1FDSA 3OJOA 1MXFA 2ZB4A 4HBGA 1DIAA 2OOSA 3GK3A 2D5AA 4PVCA 4J4BA 3PLNA 4MVJH 3ULKA 3HJAA 1EK5A 1TA4A 3HE3A 1LDMA 3H5NA 3NTOA 1EVYA 1G6KA 3ONEA 4MVJM 2Y93A 6ADHA 2DBVO 2VYVD 4FR5A 3DBVO 4WASA 3PJFA 5G0WA 2ZTUA 2BKAA 3AU9A 4DQXA 1TEHA 3HDJA 2Y05A 2X9GA 2Y1CA 4XQEA 1R0SA 2NTNA 3UUWA 1T4DA 5FI3A 3RBVA 2EP7A 3U62A 5CEJA 1ADGA 3OBBA 3B20A 2IYPA 2VYND 3V1UA 1QMGA 1EEHA 2OFPA 5DOVA 1CEQA 3IUPA 3AFNA 2VTDA 1I8TA 3WJ7A 1QORA 4O6VA 5I9NA 1R4MA 3I3OA 4PRLA 3S2EA 5AOVA 2FR1A 3M6IA 3F4BA 1O9BA 2EIHA 4TRRA 3GUYA 4DA9A 2Q46A 5HWSA 4K28A 4BNLA 2UAGA 3GDGA 1AUPA 1MC4A 4HNHA 4CV1A 3AUAA 3BHIA 3G49A 1JKIA 4HP8A 4WLVA 3F6YA 4CQMA 2H63A 3BAZA 3I9OA 4GH5A 4LCJA 5IG2A 2ZTMA 3NX4A 4EUFA 4CLRB 3ZU3A 4FPXA 2HJSA 1ZXBA 1WWKA 2X0IA 3D0OA 5BR7A 4A2CA 4DPMA 4GX2A 4MVJE 1VPDA 5JDIC 2RCYA 4OSOA 3EGOA 1UXHA 1DBVO 4NFHA 1MFZA 1NBOA 3S8MA 2UVDA 3DHNA 3STHA 3TF5A 4ALMA 2E82A 1CDOA 1XWFA 4CR6A 4EDFA 2VWGA 1KVUA 2PV7A 1UZMA 1EE2A 3WGYA 4RGBA 3IMFA 4A10A 2C54A 4DGSA 5GZ3A 4MKRA 3Q2IA 3INTA 3ST7A 4IINA 1Z82A 1WP4A 4JXKA 3EUWA 4NPCA 1P1JA 1BGVA 4G5HA 3AY6A 2X4GA 3INGA 5F5LA 3GF4A 2PZKA 1F0YA 1L7DA 1OI7A 2P9CA 4I5GA 4RVSA 3ZHBA 4FIZA 4NHEA 2W2LD 3PEFA 5DZSA 3GC6A 3GMDA 1ZMOA 4MIEA 1ZH8A 3C7CB 4XGNA 3GVIA 2O3UA 3H3JA 2ZIZA 5EQFA 4E5MA 3QVOA 4D41A 3K8ZA 1JWAB 1ZCJA 3VZPA 3I6IA 8LDHA 4DREA 2FWMX 5FI5A 4P22A 5B4TA 1H94A 1O95A 4XDZA 1OMOA 3QSGA 3C1AA 4R54A 4HFMA 1JAXA 1FDWA 3RUFA 1P0CA 1U28A 3PK0A 2Q1SA 4D45A 3PPIA 4R5HA 2B4RO 2O2SA 4DRYA 5I8WA 2I5PO 4XGIA 5L7YA 2YV2A 1HSOA 4WOKA 4B79A 1AE1A 3MOIA 4YACA 1VSUA 3SEFA 4DMLA 1I33A 1NQ5A 4BO5A 4HWKA 4IDEA 2XPCA 4E5PA 5JBIA 1XLTA 2X86A 4Q39A 1Y9AA 5CDTA 1ORRA 2W90A 3GPIA 5ILGA 5G2OA 1PJSA 5C7LO 2B5VA 4XQCA 4TRMA 2NUAA 2WYVA 1GZ4A 3Q1LA 3BA1A 1H6BA 5F21A 4XYEA 4WPGA 1LU9A 3Q2KA 4Z9YA 1ISHA 4B3JA 4XZ3A 2X8LA 4ZQGA 2QRLA 4Y6RA 4A27A 1E1NA 4IJUA 5ADHA 4DC1A 5BQFA 1DJNA 2JHFA 3VTFA 3WNQA 4IGFA 5IJZA 2Q3EA 4RF3A 1LRJA 1LI4A 3GGPA 4NBWA 1ISMA 1ML3A 3VPGA 4CM9D 4D3FA 3HB5X 4BNMA 3RCBA 3LLSA 4RZIA 1C3VA 5JFOA 3QV1A 5LDHA 4NNJA 2AEFA 2P91A 3RVDA 3WTCA 1LA2A 5AXAA 5CP8A 4LVCA 4CODB 4L0QA 4JP3A 1NASA 5TF4A 5H83A 3ZWPA 4DVJA 1HYGA 1HWYA 2ZB8A 3GRPA 4KTVE 4R9SA 2GYYA 3EZYA 3LF2A 5JCJA 1I2ZA 1DIGA 5TT1A 3RWBA 4D7AA 3I9JA 3QE3A 3JCZA 3JV7A 2O7SA 3OA0A 1KEPA 5DN9A 1PJCA 5L51A 3H9GA 1SNYA 2DT5A 1P74A 1RM4A 3NDRA 2GR9A 4L8VA 3L4BA 1FK8A 1KY5A 1PJLA 3ZWOA 1DLIA 3ZU2A 3HHPA 3JD0A 2NTVA 4ILKA 2PZMA 4QXMA 4RL6A 3ROMA 4D79A 1XGKA 1LLQA 3GH3A 1YB5A 1E7WA 1HTBA 4YJFB 3D4NA 2R00C 4ZD6A 1V9LA 1M66A 1KBZA 2ZB7A 4HX5A 1GUZA 1ZUD1 3C1OA 4A7PA 2HQ1A 1LXCA 3KSZO 3ZWYA 3CSDA 1UH5A 3WBFA 4AG3A 1U8FO 3E1KA 2WMDA 3NV9A 3X2EA 1BRMA 3PIDA 1U4SA 4J9VA 1ADBA 2Y0EA 4PIVA 4HFNA 3GDOA 3MWDB 4W7IA 4J0FA 4WCFA 2EKPA 4FBGA 2Y1FA 3RI3A 4BKRA 3SVTA 1PJTA 1BSVA 1UXIA 3RUIA 4M1QA 4Q3NA 4YT2A 4MKZA 5DCUA 3CH6A 4ALLA 4GX1A 3RROA 1K5HA 1LC3A 2O3RA 1JTVA 4J7UA 3RBXA 4JJIA 2D8AA 1HDYA 3NRCA 4JX8A 4Z0TA 3RIHA 2G5CA 4IUYA 3F5SA 4AJLA 3DBRB 2DU8A 2Q2VA 1NP3A 1CRWG 4E0BA 1T2CA 2B4QA 1KIFA 2BF7A 3TOZA 3U4CA 4UREA 1I36A 1YONA 4W99A 3TSCA 1Y5MA 3AU8A 3T4EA 1VM6A 4M89A 1HDXA 4YTEA 1KOLA 1UZLA 4BKOA 2Z95A 1ULSA 3DZGA 3ICCA 1PL6A 3PLRA 4RF5A 3NDJA 1B3BA 1DC3A 4U0KA 3DOJA 2PKRA 4BMSA 2C5EA 3L77A 1P44A 4ALNA 1E6UA 2YYYA 2VHZA 4HNGA 1R12A 4BNZA 2Q4BA 1YE3A 1Z6ZA 4KWHA 3G3EA 2VZ0A 3WSWA 5IDQA 4TKMA 5H82A 1IY8A 4KDEA 1DXYA 1T26A 3NGLA 1EUZA 2OP0A 2FHSA 1ENYA 2C0CA 5KJ1A 3JQGA 1JA9A 2EKLA 5G4KA 5T8KA 2GCGA 2CUKA 3ENKA 1Z7BA 2IODA 2O23A 4YJHB 5COBA 3FBTA 4XB2A 1LTHR 4GMFA 3L6EA 3OH8A 3TZHA 4ROSA 5F1OA 4CLDA 4DBVO 3TFOA 4UUOA 4JJGA 3KZVA 4WCFB 3VKVA 1A7KA 5DBFA 1ZJYA 4AL4A 1TT7A 3JYNA 3ZCXA 4IS2A 1ID1A 5B1YA 5IN5A 1M67A 2UUPA 4L4RA 2EW8A 4A03A 4CUKA 1P0FA 4R1NA 1Y6JA 2JKVA 2RBEA 5DOZA 4BGIA 4X54A 3WBBA 4U6QA 1F06A 3WGHA 2QHXA 4YXFA 2WEKA 4E13A 5TIIA 5MDHA 1U1IA 2X9NA 3RFTA 1ZBQA 3JQ7A 2DFVA 5JS6A 1IYZA 3V1TC 4HUJA 1T2FA 3FNEA 3GNQA 4HXYA 4ZQBA 1I2CA 3H9JA 4QO8A 2A9FA 3GMSA 5F1PA 1XA0A 1WMBA 2D59A 4MINA 1G0OA 5ENVA 1GADO 1KVSA 4RDHA 4DLBA 3HB4X 3U5TA 5AXBA 3GGGA 1LNQA 4BKQA 2VUTA 3DC2A 3GAZA 1PU2A 4K6CA 4YJDA 1J0XO 4JQCA 1O0SA 5DP1A 4D46A 1HE2A 2YFHA 5DP2A 1TVEA 2GZ3A 1Z74A 3P19A 4HADA 1SBYA 4J7CA 3S2FA 1DAOA 1EVJA 1CQJA 4K9DA 5ES3A 3I5MA
chains in the Genus database with same CATH superfamily
1D6MA 3V1MA 1JV2B 1K3FA 1O6GA 3M4XA 4QBHA 2Q45A 3UXMA 2ZIXB 2PRIA 1KO5A 3LECA 4KAAA 2PD6A 2P7IA 4MUXA 4PG4A 4ZI7F 1EM8A 3O74A 4DVGA 3I2IA 1MQ9A 4P7GA 2FLKA 2FB9A 1QF9A 3CUWA 1BDHA 1BCSA 3QVGA 2BEUA 3KFVA 1GPUA 5LLSA 3U31A 1NRXA 3V8PA 3DO5A 1YUNA 1G0NA 2LBPA 3WLTA 3TNLA 4D26A 3ITDA 1M0WA 1VG9B 2DAPA 3JQCA 3H3XA 1FXSA 3F8WA 4P1ZA 3LBAA 2E18A 3MWLA 5D84A 4YAIA 1K6MA 2XRMA 2FDRA 3I6YA 1H6CA 1EUCA 4S35A 4V0OA 2XCIA 1GP2A 2JDIA 4L7VA 1UP6A 4N49A 5T5QA 4EVSA 3LP8A 4D42A 1LH0A 1QG0A 2PR7A 1X77A 1KSHA 1IEXA 1U65A 3NIBA 4NU6A 1L1QA 1XIVA 3NVAA 3RRNA 4E15A 1T6BY 1PR2A 1IATA 4GWGA 4CMIB 5CTAA 4XAQA 1I10A 4ZAVA 2D3WA 2C5GA 3UIEA 3WQSB 1ZW1A 1TL7C 2BFPA 4CG2A 3M4YA 2CLOB 1UZAA 2Y4NA 3I12A 3MINA 4C7VA 2OB2A 2QQFA 3KM0A 5FORA 4KMRA 4BPBA 3V7WA 2I91A 3QRWA 5E2BA 1U0HC 2ZULA 3TMKA 4CBVA 4P0QB 1UM9A 3ECSA 4AZ0A 2FEWB 2R1TA 4ERNA 5CH8A 4I2NA 2EYUA 1QP0A 4M8LA 4RD0A 3Q7QA 4J1TA 1J0EA 1YDGA 4PZUA 2VUIB 1U8TA 5ALFA 1N1MA 4LRUA 5DBIA 2OCGA 1P6QA 2FGJA 5FOXA 5G0TA 5JARA 3P9QA 3K4QA 4Y2JA 1V11B 1GOTA 3AKEA 3PNYA 2C1XA 4JNCA 3FOAA 2WJAA 4BX9A 5TVGA 1JKJB 2W2VA 5L3SA 2AHOA 3DMHA 4WLFA 5AJWA 1TNDA 4NE2A 4P31A 5HCNA 5DN6A 5LSAA 3JALB 2UYYA 5CM8B 3UT6A 3VXKA 1AMUA 4AQYB 3DXFA 3FF1A 4AICA 2HV8A 1W7AA 5D3ZA 2QP4A 2IYYA 4NCHA 4F5ZA 2WWWA 1Z6TA 1Z68A 2GO1A 1U5BB 2RHTA 1TI7A 4GMXA 1UFVA 4GNKA 3GT3A 4C0WA 2QQEA 3JZFA 1GPJA 2O3JA 4K9KA 1YDFA 4B4VA 4QJBA 5KC9A 1B93A 5ILOA 1GRQA 1IBCA 1QR6A 3CZMA 4YWHA 1JU3A 1KP3A 2XEDA 3IAM6 3K9FC 1GNLA 1AKRA 2VZ8A 3UANA 2XUPA 3DOIA 5J9FA 2CBGA 1GJRA 1PG5A 1W5SA 2QENA 3GGSA 3VBCA 2GAAA 1RYMA 4CR8A 1XCGB 3LX8A 4JWKA 5JISA 2JFYA 3ESQA 3UUFA 4ZCSA 2MT9A 5B36A 1SOWA 2OAEA 1D9ZA 4QELA 5ALLA 3HFRA 4JNKA 4EUSA 4YMHA 4OJMX 1R6TA 2GAOA 2I65A 4OBXA 3ZGVA 3NHYA 2QP9X 3EMKA 1NBMA 3IEMA 4YMTA 5EIWA 3EZXA 3AI7A 2PKEA 2ROQA 5B7GA 5DT9A 3R8CA 5HK9A 4OX9Y 1N2XA 5TY0A 2I33A 3EWNA 4B3BA 4H1WA 3SKYA 5J23A 2Y1XA 2ZPAA 1XAGA 2RGCA 3WKAA 3O0TA 1P45A 4ZMRA 3TCXB 1JA0A 2HLDA 3AG6A 3GA0A 5AYVA 4D96A 4QYIA 4EKIA 4QLBA 3P97A 3IEPA 1QOZA 1E63A 3LUFA 1IULA 3N6VA 4DZRA 2BCGY 4GSYA 3T5TA 1FFGA 3ZCTA 2ZWOA 3QXJA 3R3JA 1T8RA 4UCQA 2H5JA 3G1TA 1ZN7A 3HSSA 3PQ6A 1X1EA 2Z09A 3PGVA 4MV1A 4MHSA 5E4TA 1YRQA 5L8VA 1KQFA 4G5RA 4K40A 2HXYA 3JQ8A 2CLIB 3IDZA 4HWRA 4MYRA 2YXNA 2P77A 3COYA 5FH9A 1KNQA 3TR5A 4MEJA 5L7TA 5KYKA 2FETA 4D9GA 2C4NA 3FLEA 4OGKA 1RFLA 5EP1A 3RASA 4NCBA 2NNLD 1SIBE 2HJVA 2A7QA 5M3BA 4BCCA 5BWNA 3UFXB 3ADCA 4LI3X 5GJVC 1XQWA 4WOCA 3R5SA 4NULA 3TUZC 1NW8A 1AZTA 5KYNA 4HX9A 3OPYB 2WVHA 4RKEA 4GO1A 1MO6A 5E1OA 3C3BA 3M34A 3EZLA 4JMPA 5COQA 4LAFA 3SEZA 3EXAA 3VPXA 1C1XA 2HZBA 4G4SP 2DUWA 2XZOA 3ZPXA 1JFVA 3D3WA 5KTOA 1IUNA 1EI9A 1XNGA 5BW4A 3BGIA 1PL7A 5GZ6A 1C7FA 3OZEA 2GPJA 4XYLA 4JJ4A 3ZS9A 4G07A 5DRTA 4Q66C 5H0IA 3VAZA 1EK0A 2H9AA 1CF2O 2B1RA 3L0ZA 4PQFA 5TQ2A 2FGKA 5AIAA 7MDHA 1FNNA 2J3JA 2BYTA 2VHUA 2A5JA 3ZTTA 1PGNA 2OGZA 5I7UA 1OIXA 3F90A 1Z29A 3GUHA 1NPTO 5ALUA 1E5VA 3GJTA 3R41A 2CUNA 2ZBRA 3P0FA 4IS3A 4OTZA 3F9CA 4K8OA 1FS5A 4IIFA 1E0KA 1S89A 1ZSNA 2JI9A 5F51A 1EP9A 4DR1B 3KSDO 1EFVB 3DZHA 4R40A 3T9DA 1TVCA 4FYXA 2L0XA 4OXYA 1UDWA 3KSUA 3Q3HA 5T6BA 4QPJC 4P84A 3SZUA 4B8WA 5AW4A 1BKYA 5DGTA 3W6UA 5DYNA 5TX7A 1L4GA 1FFXB 1HT1E 4LNUB 4M8KA 5B2ZA 3KZKA 3OMWA 4IIYA 3WWEA 1GPLA 1TLFA 4HMQA 4EITA 4ITRC 1K66A 3GJQA 1ZISA 5EP2A 5A02A 1IH8A 4UDNA 1QLHA 1L7AA 3EGWA 1WBDA 4C0XA 4MB2A 4EYQA 3N0TA 5AUOB 1MGOA 3U7EB 1NPYA 2VH2A 4OKNA 4AJNA 5EOVA 3ZNOA 2QY6A 1UT5A 3H1AA 2Q9UA 3O95A 3U7JA 4ROTA 4DIKA 1RYFA 4IHJB 5GIPE 1P2VA 3B6EA 1XTJA 3K94A 1EUDA 4TSFD 4FYHA 4W4TA 4U9UA 1DAMA 2Y99A 3N87A 4NMWA 1P31A 3G79A 1F4PA 1NA5A 3QELB 3NORA 5REQA 3W9SA 2Q5OA 5EE5B 2J5QA 2CCKA 3A2KA 1RMQA 1LJ8A 4E07A 2IVZA 2VJKA 3KQUA 4YVFA 3HWSA 4HVTA 4M1SA 5EZ6B 3T7IA 2GWRA 3M0EA 3H2ZA 4WFIA 4D8VA 1YL5A 3ZI0A 1J25A 3AUTA 5TGZA 1J9GA 5EIBC 1J20A 1D07A 2IYAA 5A4FS 4TQAA 3AP1A 4NJEB 4DQ0A 2X58A 3TLBA 2JZNA 3S1LA 1UAAA 1GTG1 1CUCA 2VNHA 2V0NA 1M1UA 2W6JD 4KH0A 2PVCA 4PNEA 2YJ5A 3FH0A 3IUJA 2JL1A 2DTDA 4MWZA 2ZROA 3TZEA 3SVLA 4GFDA 1EXVA 1H6DA 3OOHA 2QRUA 5IKEA 2CLCX 4ZC8A 3S44A 4EGAA 3DDCA 1J06A 3OWXA 4G63A 3LH5A 2ZB3A 5EPEA 3DOOA 2WPDA 2ZI6A 2BFEA 3L04A 3IT1A 3MQ4A 2OBLA 2QRVA 3QWBA 5C5CA 4MROA 2ACWA 1NJ5A 2FMHA 2YWFA 3AH8A 2XVYA 5A7GA 1ZC3A 1HEUA 3IDOA 4I7EA 3EXG1 2IU6A 1SCQA 4TZTA 5BN5B 1FF9A 4YQYA 2Z9DA 1T2UA 2AI3A 5KTMA 2Q6TA 3UH0A 4QGSA 1KZ1A 4LK3A 1XEWX 5CURA 2A1UA 3JQFC 1YVEI 5F5NA 1XMPA 2OQ2A 3H9QA 1MZPA 5KQLA 2TMKA 3MAGA 3EB9A 3E7PA 3LT0A 3DKRA 1SXQA 1GU7A 3MCTA 1VJRA 4B84A 4N9WA 5NLLA 1IUPA 4M2LA 1N78A 1PI3A 2OKCA 4LN1A 3I1JA 4K6FA 4Y1RA 5FTKA 3VBEA 1N6IA 2O2CA 1W4BA 4M9ZA 2O7VA 2BGIA 1EXNA 3SNHA 3TX2A 3IAS6 4R0VA 2H5LA 3NM6B 4UEKA 4Q4HA 3AWIA 1ADYA 1E1RD 3WYAA 3K6JA 4YT8A 1QU3A 1EBBA 3DEJA 4II2A 3QLUA 4OAOA 1ZD1A 3F5DA 2C2KA 2JIMA 5CCXA 1J49A 1PS8A 3SN6A 3COJA 2V9PA 4JR2A 4V03A 5ECYA 3L18A 3WGTA 3I01M 5FWAA 2QJTA 4TTJA 5BNTA 4LECA 4YV1A 3NKVA 4CQMB 2QL9A 3JYHA 1KXZA 3O3NB 2G1UA 4NYMQ 2Q9AA 2AQIA 4N3AA 4CMAA 4YUXA 5B12A 2Y68A 2RK3A 4JLUA 2RMKA 3WKDA 2QUKA 2YXPX 4AP5A 4OUKX 1UL1X 2VRNA 2Y1WA 3VX3A 1BKSB 4RKFA 1LLUA 1NXVA 3HO8A 4L73A 2GYWA 2WUGA 1TAHA 1W44A 2FR8C 4NOKA 4TUYB 4AM8A 1A7AA 2GF0A 2ORED 4N12A 5J4YA 1ID8A 3HCNA 4DLVA 1DFIA 1SZDA 3FCYA 3TCKA 1X94A 1P4JA 3QX9A 1BJRE 1OR8A 5E8RA 1QFJA 1TC1A 4ZHQF 5A9SB 2FN8A 4C7KA 4TL8A 4ER0A 2E21A 3LYAA 1EWVA 1ZWKA 3ENQA 2Y6VA 3ABSB 4R68A 4XUEA 1EWRA 4IRXA 5CT5A 3HRHA 2LVBA 1TF5A 3QBJA 5DLDA 3WGQA 1VHDA 5BT9A 4MYSA 4Y1EA 2JLYA 3KLBA 1FUIA 1X8JA 2R6GA 3SHVA 4NCAA 1SOVA 3B6ZA 1KNXA 4HTAA 4QIHA 1G3UA 1UKYA 4R05A 4GGMX 2XBUA 2HHLA 4OFWA 1Q6YA 1VLMA 4IIJB 4R1PA 1MO2A 2FJ0A 3EPJA 2ZBGA 4ER5A 2R1TB 2NU6B 1C0IA 4C3UA 1UEIA 1SIWA 1H4TA 4DLTA 1V96A 5BVHB 4US2R 3E2IA 3H87A 5ALZA 3FHTA 1VG0B 4DMFA 4KQFA 1NXTA 4NECA 2OCIA 3K1ZA 2A7XA 4W8HA 3ZCUA 4UM9B 3C74A 1KEUA 2PPVA 1KH1A 3KYCA 4EW6A 1SQGA 2X23A 3WJAA 4A0RA 3KFXA 2QRHA 1XKQA 2X4LA 3FDZB 2F7SA 4FDUA 4TZ6A 4MPRA 1BE1A 2GNPA 4JBXA 4MCAA 4Y2UA 5DI3A 5E95A 3ROZA 1IXRC 3NPAA 4ZI2A 4ZCLA 4EHBA 5KMGA 1IJFA 1VLQA 3O9VA 1YQUA 1NRWA 1RAFA 3FMGA 3I2GA 3PXAA 3WB9A 3JZMA 4ALJA 1I6KA 5KWIA 1NVTA 2PS9A 4LXQA 4IIGA 3GZNA 1W96A 4HK4A 3PZRA 5ANRB 1VECA 4L15A 1CFZA 1R4NB 3IP3A 4LKOA 1APBA 3ORRA 4Q82A 2ZJYA 3QEJA 2GD6A 5CDFE 5KVCA 3UJ7A 3O9MA 1TRKA 2PGDA 2BHSA 1W85A 4PC1A 4Y2YA 3Q88A 5T67A 3QF4A 4DUGA 4GLBA 3JRNA 1LEHA 1UBGA 4FQ7A 3PTLA 4MQMA 3HU2A 5DVZA 1P3DA 1QMPA 1ARZA 1QE0A 5UKDA 1RCTE 1I30A 2ZUUA 1J90A 2VBGA 3JQRA 1TO6A 2IWRA 3A9VA 2W6IA 4IMPA 1C0LA 3QW2A 4PG7A 3HDYA 1PJ2A 1QPBA 1WDMA 4P08A 4JLJA 4IL5A 3L4JA 1QZ3A 2JFVA 4RQTA 1RR6A 1SQFA 2ETVA 1OYVA 3G88A 3HJUA 5CLLA 4A92A 2P9GA 2PGNA 1NI3A 5EP4A 2YHUA 3JYOA 1TAGA 4OK5A 1ZJZA 3EASA 4F93B 3M4ZA 2EIXA 1IB6A 3PCTA 2CXUA 2OV2A 1AM4D 3AV3A 1RQXA 3Q0TA 4XWAA 3CRZA 3R3YA 4B3SB 3TFWA 1JKXA 5F2OA 3RPEA 2QJOA 4OMFG 3H0KA 3ZW8A 5EIXA 1DADA 1RSZA 4PXYA 1MORA 1P9NA 1YO6A 2RHDA 2BH9A 5D3MB 4C2AA 3IBSA 3QE4A 1ENZA 3NBUA 4PAWA 5CHYA 2PPLA 1XJ5A 5EJ6A 1XLUA 1UBHS 3TQQA 4F6RB 3ZH9B 1E1MA 4KB5A 5TDHA 3O93A 1I7QB 4BFSA 2GN1A 4BVKA 3DLAA 2VATA 4HPXB 1CRZA 2PMKA 1N9GB 2C8VA 2X6TA 3HWWA 4G01B 5IW8A 2Z4SA 3YASA 4GOMD 4EQ6A 3I0NA 2W8ZA 4JVNA 5EIAA 4KU4A 4DLWA 5FWNA 2ZXUA 1RZRD 3RKUA 3DW3X 3R3ZA 3M4JA 4S24A 2UDPA 4IIEA 2B36A 4EIWA 1GAWA 1R7RA 3C1TA 2ZSAA 3MRSA 3O8NA 4GI1A 4RD3A 5H02A 5AK3A 4I14A 3I34X 1Y3HA 3LRPA 2Q4DA 2X1MA 2Y2VA 1M72A 4NC9A 1GFIA 5E6SB 1NE2A 3AUFA 5JDCC 1Q1GA 3LYLA 2NACA 3BWMA 3EMBA 2R1VA 3HMQA 2IL1A 3JWPA 2BI7A 2SECE 4KQXA 4WDQA 4IV5A 5AI4A 4AK9A 3MMXA 4B6RA 1NVKA 3GELA 3GG9A 1U8UA 1G42A 1G6HA 2YXDA 3FCXA 3IAFA 4FOOA 1NOJA 5ERXA 3ZDEA 1E7YA 1XF1A 3MOSA 2MSDB 1KYXA 1P4GA 4N8EA 3QENA 2LCIA 4QPZA 4TN1A 1IUOA 3ZY4A 1FY2A 1M2WA 3OKAA 3LLMA 2AIRA 4ZIRB 4Z53A 4FTWA 2EGHA 1DC7A 1QM5A 2AV6A 3ETLA 3JQGB 1S3IA 2F8SA 2IZ5A 1VCNA 4MR8B 1NI4B 4OQEA 3AL2A 1EXMA 2HWYA 1W4LA 2PSDA 4IKOA 2EVWX 1U2PA 1PNVA 3PI7A 3R6TA 3HQ4O 1QB8A 2NOAA 5GTDA 3A7DA 1JQ3A 3ILXA 5ALOA 2A92A 1FP4B 2AD5A 2PH3A 3ONNA 1H4SA 3DD1A 3PE3A 2X3UA 4IVRA 4ZZ3A 1TE2A 2XW6A 1GCIA 9LDTA 1GVNB 4MS3B 3WB2A 5KOYA 2FMIA 1JE0A 1A2BA 3IPLA 4IM7A 3OJWA 1J1IA 2O3SA 1VL1A 3WYCA 2P35A 1E64A 4YPOA 5SY9A 4QGGA 4LRTB 5ALMA 5BSTA 2AI1A 3VMMA 5JNRA 4EJ6A 2EAUA 3THSA 1LQUA 4IX1A 2HI0A 3HKEB 4D6YA 4A0FA 2DMRA 1QPZA 1XD2A 2OORA 1Z4KA 2JI4A 4OY3A 4J94A 3K6RA 4KN6A 3U37A 2BT4A 2ZQZA 1YZ3A 1R66A 4ZA2A 4KXNA 3LK6A 3UPDA 5BSKA 1KEEB 1YU9A 1X39A 1JPNA 3M2PA 2AMYA 3MJFA 3MLEA 4ZT5A 3ADPA 3VPAA 4DBZA 3VNAA 2AYZA 4CKBA 1JEEA 1L5YA 2GOYA 5BNWA 5JRJA 3RGWS 2JLXA 3UPUA 1ULBA 1FXWA 2CZCA 3A9TA 4Z99A 2UZ1B 2LZ0A 3WRVA 5B4UA 3C98A 2AYYA 1XB2A 3G85A 3EGVA 4L75A 3KAKA 2I4OA 4WESB 1IBMB 1Q0UA 1OYOA 1UJBA 4W1SA 4KTTE 5FQOA 1RI2A 4PR3A 5EE0A 1M34A 4ZOLF 4HGNA 2RBKA 2FEMA 1E2JA 5LXTF 5IEBA 1O97C 3C70A 4XA8A 5A04A 1WR8A 4DCVA 2GXUA 4US1R 1ZNXA 3KYDA 4N5HX 4Z1OA 1UKBA 1Z2PX 1JLRA 5IAEA 4B4KA 2D0IA 3E61A 4R9NA 3UAGA 3W5BA 3T7EA 3FPCA 4HFRA 4C6TB 1AF7A 4R81A 4TLLB 1V5FA 1W85B 1XNHA 3EOZA 3CINA 2IHTA 4Y9SA 5EUBA 3D6UA 1F5SA 1YDHA 3DCIA 3EGIA 1NN1A 3KXDA 3ONFA 3QLUC 4QFDA 3VJLA 3Q11A 3VR6D 4F3NA 5GP1A 2H4YA 1X74A 4RFVA 5FJJA 1I5EA 3AFGA 5JROA 2G08A 2MYUA 1E32A 2J3QA 2WILA 1WXQA 2GARA 3SK0A 1HOXA 1PF7E 2NV0A 2R7MA 4J2HA 4I9HA 4RIHA 5EG5A 1EGAA 4IY1A 3ZQKA 5BP7A 3VVCA 1IK6A 4DWOA 1IQUA 3T1HB 3NBFA 2RIRA 4MJLA 5HK8A 4G5GA 1G8AA 4WXMA 4XPIA 4D8WA 1ZRNA 4A8JB 4OI1A 1UBNA 3DJFA 4WXYB 3N8KA 4IHJF 4KBYA 4YP5A 1RMTA 2OGWA 3DAPA 4QECA 4G5OA 1S01A 4JLWA 4RY0A 1FUYB 4B3DA 4R6WA 2CXTA 2GPBA 4UKDA 4ZI3A 4DB2A 1W46A 2NVUA 3KJQA 1DX6A 5E6UB 1CD5A 1YR3A 1BS1A 1TKCA 2PS1A 2Z0MA 3ICWA 4WZAE 1QKJA 4DW8A 4Z4HA 3KT8A 1AT1A 4Z9FA 2R8EA 3JASB 1OIVA 3PA8A 2R6CA 3SE7A 4FN4A 5LQSA 1N1GA 4WA7A 3H2YA 1R4ZA 4JJKA 3W9BA 1KE1A 1HFWA 2KM1A 4CFYA 1NOIA 3KETA 4NNOA 1F2TA 4J0IA 4FOPA 1HMPA 3K9HA 1E7RA 2HBRA 2P9FA 1E2QA 2GXAA 1NVMB 1NR7A 1T9KA 5KBYA 1NSFA 2D00A 1KSFX 5E8JA 3IESA 5EJAA 4AUMA 1GXSB 2ZWVA 2I29A 4BNYA 1OZHA 4X00A 2SKDA 1B7GO 3AEQB 4MS4A 1CDEA 2NYUA 2FSSA 2ZR9A 2BKUA 3SXPA 1AZLA 5KVAA 3F67A 4LF7B 4URUR 4FKBA 3B3AA 4RJTA 3N2YA 3NYQA 1DEOA 1NW5A 4KQ6A 4RK6A 4U3JB 5EZYB 3SG0A 2RB4A 1UBTS 3AX6A 3PGJA 3ITEA 5ERYA 1TQ8A 3HXLA 3UUEA 3TBHA 2H4WA 2RONA 2WSSD 3AP3A 4TL7A 4J8PA 4XTCS 1KSJA 2I66A 4UATA 4S0ZA 2CMHA 2C2ZA 5FDFA 3EA0A 2QU8A 5MN5A 3QVLA 1DC6A 2X9VA 4EO4A 1N1EA 4QAQA 1Z5NA 4EZIA 4EVIA 5IUJC 1OWMA 1A82A 1U3WA 1L4FA 3RS7A 1EE1A 3CUYA 1D1SA 2R8XA 1FYFA 4BE7B 2HJRA 2NTEA 2OMEA 3KR1A 1PJQA 1Q21A 3A3KA 4JUFA 1MBZA 1WIWA 5K9ZA 3M49A 4JT8A 1X87A 3PQ8A 1NLZA 1NLMA 2B8WA 1PFKA 1PYGA 2GZAA 2WTEA 4RUKA 2GZHA 3JTEA 4ASUD 4AJ2A 2Y92A 2VTEA 1YZQA 2A5FA 5JAZA 3E0XA 2HTEA 3HUFA 5D5HA 5H9WA 2CDAA 1VIYA 5EWJA 4EHAA 3L5KA 4KACA 2PUGA 2P75A 1FRQA 3ZJVA 1XTBA 3DV2A 1KDVA 4JQYA 3WHLA 2JGDB 1WW2A 3DE7X 1L6IA 5D5PA 3K92A 3ZZTA 4ZHQA 1EU1A 2WHYA 4MV0A 3FPFA 2R97A 1TUIA 3OCVA 4G24A 3U0VA 4BZPA 2Z5GA 4NG4A 3E5NA 2PT7A 4NZPA 2NXCA 4BRUA 4DV7B 2SHKA 1RZRA 1KR5A 3IA7A 3VPDA 4D9CA 3WNVA 1XCLA 1LPMA 2C78A 1DV2A 1U9ZA 1D4FA 1B8UA 4BATA 4WCDA 5IBRA 1M1ZA 4D3XA 3K70D 2QQ0A 3NKLA 4B45A 3FR8A 3KL2A 3CNBA 4O3FA 5IVKA 4MS1B 2UUCB 1PFWA 2GD0A 2H3HA 1XG5A 4JVLA 4ZOAA 2H29A 1AK9A 5IRCD 2X0DA 4E4YA 3KJHA 2BELA 4BUCA 2FH5B 1Q3HA 1XMJA 2FPUA 1AGPA 1QFXA 2XNSA 3HCPA 4GXTA 4HSGA 3GT0A 3JYPA 4RPJA 3UT5A 2P9BA 3LUBA 2OBXA 2AYXA 4HLQB 1PFGA 2EG5A 5EZQA 4EA7A 3ROGA 4PFQA 3H2SA 4QUIA 4DRXA 3FCCA 4JC0A 4WZAB 3FNHA 3IKLA 4YRDA 5KX5A 1HV8A 3QVTA 4A15A 2HADA 3AM5A 4J0JA 4R1UA 5TMDA 1T9DA 2MMGA 3AF1A 4JHLA 5AKKA 2B8TA 3WFIA 4DWJA 3ELDA 3L82B 4YPFA 1KK3A 1FTQA 2C1EA 4REMA 2CLKB 3TKYA 4IJKA 3P71T 2JI8A 4AMYA 4E5VA 4TTRA 2RFLA 2WTXA 2X3FA 3EPKA 4FHFA 1MP0A 4L3VA 3LP5A 2EOAA 1KI4A 4KK3A 1ZC4A 4JJ7A 1G7TA 3P94A 3OKCA 1Z7EA 2VRBA 4BO9A 2IBSA 3KC2A 4MO2A 2ID7A 2OOKA 4RELA 2DUMA 4GS5A 2R84A 1FRFS 1L2TA 2CZQA 2OPBA 4K88A 4IIHA 4PANA 4W1QA 5HGJA 4RZQA 3WGLA 3FIUA 1STOA 5KNCH 2YOHA 3C7DB 3U7QB 3TEJA 1GZHB 2H57A 1Z2DA 4NFYA 3WZMA 2VI5A 4MVCA 4DJEC 3UFBA 2BKEA 2GYVA 5CA1F 2AA3A 1ONNA 7YASA 2HCJB 4N3BA 1ACJA 4GGOA 3BTSA 1XA3A 4I3GA 2EBUA 3DNMA 2A0XA 2RI6A 3RKRA 2YVKA 4B9EA 3KSAC 2JAOA 3OD5A 2BJWA 4RX1A 3U9LA 3K6SB 1R8JA 1U31A 3G5AA 5ITZB 2X0FA 3LWNA 4IDOA 2DUNA 1XPUA 4Y2PA 2KLBA 4GNRA 1B0PA 1J4AA 1HE4A 2IHBA 4ZQCB 2VJCA 2B1IA 5BUZA 3PC7A 4PFJA 4UE6A 5LZ8A 1FLAA 1QR2A 2VDWB 3FOFC 4HV4A 5DNYB 1CQJB 4BNKA 4TN5A 1I4WA 3S40A 3HLTA 3OZGA 4V2IA 4C3VA 3DLBA 4RMHA 1OWLA 3TGLA 1W36B 1J2YA 3D7LA 3WK5A 2ADMA 3FRHA 3HU1A 3S99A 2O8FB 1WF6A 1SUPA 3B9PA 3QKUA 4AAYA 4DSAA 4MGKR 4JASB 3ADOA 3CKKA 3U81A 1XYYA 2ONCA 3LT4A 4BQPA 2J0UB 4DUZB 1DUSA 3H7IA 3B12A 4RLHA 4X63A 1ZLYA 2JCGA 2JLBA 1I1NA 2PZLA 1FFXA 1N0WA 1QZTA 1VBKA 2AFVA 1AKTA 3KEQA 4LNUA 4RZ2A 1MZVA 4TQUS 2YZ7A 4LF4B 1P0PA 3IEUA 1EK2A 5CXXA 3E18A 3N59A 5ICFA 1GAQA 1WD7A 1EFTA 4BNIA 3ER6A 3KOWA 4RVGA 5IJXA 3RC2A 3QFSA 1XD9A 1IBSA 4R1SA 3TXXA 4GI5A 1JHXA 1AO3A 1E7MA 3SIRA 4C08A 4CODB 1C1DA 4RPHA 2DBZA 4QG3A 3JVDA 2GPNA 3DOHA 1EG7A 3JARB 2ZBFA 3HADA 2MSNA 5ENDA 4I0WB 3AC0A 2QTMA 3KEOA 2FN7A 2VAXA 5FNVB 5IC4A 4LHZA 4A1FA 4DQUA 3EIEA 3BL5A 3G68A 5AHWA 1ADCA 1PLLA 2C4WA 1S96A 1K8QA 4C7OA 3A6DA 3QNWA 1FFHA 4K1LA 2ID9A 3F46A 4MWCA 2Q2QA 4DIUA 1OTYA 4KRXA 2R87A 4YAGA 3DJYA 2YKGA 1QCYA 1EFHA 3ZDBA 1YR8A 1RYNA 2GWHA 2XNKA 2KB0A 1KJQA 3NYRA 3RU2A 4XYGA 2HK8A 4FOSA 4BUZA 1I4OA 4OJYA 4Q4LA 4GDMA 5E3JA 3DWEX 1QUFA 1HQCA 2QJWA 3BQMB 3CEJA 9MHTA 3B82A 3DE5X 3GMTA 2VHEA 3JS5A 3K8QA 1GPKA 4Q4JB 1DG1G 3L79A 3DL7A 3KQSA 4YJ2B 3CZ9A 3PCXA 5KUTA 3K6SA 1WUJS 2X0JA 3T4PA 4FFNA 3TUIC 1URPA 3K53A 1FC0A 1KGDA 2KWIA 1RKQA 2IY7A 4ARSA 3PFGA 4XM1A 2X7XA 2OQVA 4Y2VA 4B3GA 1LBSA 1ZD3A 2Q7XA 4I9FA 4RPKA 3RRYA 2VQDA 2HQBA 5JS8A 5MFZA 3SXUB 4UCWA 3U09A 1OX5A 2W83A 3Q0EA 3TMYA 3OFJA 2YHSA 4E30A 2ON6A 4DWVA 4RMNA 3QBDA 5DSTA 4Z3KA 1D4ZA 1GPAA 1ZG3A 3ZY5A 4R2WA 1RQGA 2QQGA 3KWFA 5KNDH 4ABTA 3KD2A 3NM5A 3SX2A 4TV8A 5JYDA 4WERA 2I78A 4MMXB 2QT9A 4XRGA 3IJPA 1Q44A 3A70A 4BO2A 3CUSA 1ZNZA 3G5UA 1UOQA 1JDBC 2YC4C 3BWVA 1XQ9A 1ZOPA 3DPIA 4JU9A 1W5BA 2C2XA 2I4MA 1W36D 2QKYA 3AIKA 2JGEA 3UMRA 3E9YA 3HBJA 4FB5A 3T35A 1Q7RA 1THGA 3O8DA 4PGAA 3EF0A 4PGMA 4CLXA 1W88B 2Y9PB 4RS4A 2QF7A 1NYQA 4RCZA 1ZNWA 4MRVA 3OOEA 2Q3BA 4B4OA 1VE1A 3L7LA 3OLYA 1Y5IA 4OQDA 4Q7MB 4GVPA 4QJ4A 4C4TA 1AJEA 3QA3E 1LTKA 5GONF 4Q9IA 1XCBA 3H17A 3ESCA 2NTJA 1O5TA 4QEDA 4WECA 3SYTA 1XQYA 3ZE9A 4X62B 5ELLA 2B4YA 1G1AA 1O87A 2DBRA 5FLEX 4YO8A 1Q1NA 3JZDA 2N42A 3SC4A 3RUDA 1XRNA 4MIOA 4UE3S 3L1HA 3EIUA 2H1RA 1B74A 3ZE7A 1W0JD 3NCHA 1MW8X 2Q6OA 1C8KA 1XI2A 2EEZA 2Y0CA 4G8JA 4OQZA 5IABA 2WHXA 5BRNA 1YJQA 4R2KA 3PRKE 1N7GA 3LU1A 1OD6A 4OUDA 2M6LA 4G5XA 4BMVA 2FW9A 5HKLA 1JP7A 3RAJA 3EG5A 4GZMA 5I4IA 3AGPA 5CFMA 3DZIA 1VKJA 2EATA 4MKHA 3N8NA 3U49A 4KLCA 4CKEB 1CUFA 2CW5A 1KI1A 1RWXA 2HN9A 1PT7A 4U9HS 4YXWA 3RHFA 5G40A 4B7XA 4EL0A 3OJXA 1AO0A 2G5TA 1SZPA 3OA2A 1WETA 3A3OA 3STVA 1P5FA 2GRUA 1OLUA 1UKCA 2P2SA 3QQ5A 3TD2A 4FFOA 1G21E 4HDKA 4AZWA 4NYIQ 4XYMA 4DV0B 5IAOA 2HT1A 4BZXA 4YO7A 1UC8A 3AOEC 2G71A 3PPXA 3G2JA 3K9BA 2JEOA 3TW8B 3W8RA 2VG8A 2PKQP 3K5HA 4PTYA 3HGTA 3IVAA 3H86A 2I7CA 4J1NA 4N0QA 5EMJA 3LX4A 1E3JA 2G0NA 2JKZA 3ZHOA 1GL3A 1T4CB 5JCOC 3QMWA 4JJZA 3ZEAA 2JD0A 4ZJPA 1KAQA 3AY3A 1NE7A 3NC4A 3OU7A 3PHJA 4WCFC 5FULA 3TL6A 2O1EA 1E3WA 4WKBA 1AXGA 4R3WA 3AY0A 1XN4A 3S29A 1A4UA 3Q8LA 2WWYA 1O97D 2FFRA 4C06A 2GI4A 3I2FA 1TU4A 5JMTA 5CGQB 2IYSA 1X13A 1RHUA 3JVUA 2HFJA 2QPTA 2YJ4A 3A6HA 5BV0A 2EZUA 1IPEA 1TW3A 3DV9A 3L8MA 3EGXA 3QLTA 4PBTA 4WUTA 3RKSA 1W6RA 3QKSA 4RTNA 3QYPA 3OEWA 4J90A 4IZHA 2FAXA 4N7JA 2XZTA 4N48A 3NG1A 4MQEB 5IC6A 1NUUA 2F17A 1TGVA 1Q15A 2EWVA 2R79A 2H2AA 1S7CA 3RNOA 5JAQA 3CLSC 1Y9ZA 4DLLA 1EDZA 4M36A 4D3DA 2XB8A 4HEQA 5KQMA 3DQQA 3NZEA 5LJIA 2I4TA 1VKZA 5B3LA 2GAFA 3FFBA 1HYHA 1AS3A 4MVXA 1LTQA 521PA 3WRWA 1MIHA 1FYEA 2PD4A 2AOWA 2RGNA 3HNPA 4RJLA 4JB3A 1HT0A 3GLGA 5DYYA 4LWZA 5LZ2A 3R5HA 3R7NA 4P0PB 2CT8A 1W4AA 5I3ZA 1ORHA 4YJKA 1MH1A 1KEWA 1EAYA 4B47A 5JBQA 5KCMA 5TR9A 3QFTA 4XX1A 3LY8A 3G0CA 4L76A 5BSUA 3T52A 1KQ3A 4NNPA 3N1UA 2QE6A 3MIZA 3A31A 1Y6FA 3HVHA 1D6JA 4ZOCA 1X8LA 2OAP1 3OICA 2REQA 1EFUA 4KPYA 2CMDA 1MAWA 1V41E 2CB9A 2REOA 3T7JA 4AI6A 1ABBA 3HZHA 1GAJA 5EESA 1XTIA 4MPJA 4C4XA 2BH2A 5K3SA 1PX2A 5ALYA 1UDCA 1JEDA 1GQFA 3DOEA 3CCBA 3KNZA 2G17A 1X9GA 2PKYX 4EG8A 4XWWA 1X7HA 1NQWA 1Y0BA 2XMCA 4UVGA 2I2XB 1WUIS 3B36A 2BZ0A 3JVIA 2AXNA 3RJTA 1CEEA 2Q3FA 2A88A 3IKMB 2V7GA 1X6VA 3C5HA 5LYJA 2C83A 4MOWA 4ZANA 1TUEA 3SZRA 5FR1A 3ZHXA 3OMLA 1PSWA 1KPHA 2DFPA 1Q57A 2ZBPA 1KZ6A 3E2PA 3R74A 3UV7A 4DN6A 5KTNA 4XR9A 4UCFA 4ZFNA 3G13A 4DJDC 3QEMA 2VAPA 1JPVA 4WACA 2EF1A 5FPQA 1E2BA 2ADOA 4D8XA 2XNHA 1MJ5A 3KQOA 4IO1A 3KB6A 5A2GA 3CVUA 1UK9A 1QHYA 1CUWA 2LD4A 4HAVA 4UEJA 1UMDA 5KOJA 2XZDA 2I76A 2XJ4A 2IHKA 3CT6A 3GRAA 3NPMA 4G1EB 2EP5A 3O8QB 1J0BA 4HLUC 4YRQA 4E5DA 3BD8A 4CM8B 1C9EA 1DSSG 1ZSYA 2GN0A 3AUSA 1XR3A 4BNTA 4PYLA 1H0KA 4RTJA 1KKMA 5EKDA 2WD8A 2ZSKA 3AINA 1WEKA 3ZTYA 1YS2X 2CNDA 3CLSD 2QPLA 4LJKA 3G5MA 4NV0A 1GUYA 3MTDA 2PMFA 3QHQA 1QG4A 5ALKA 2ESRA 3R0IA 4ASUA 4R1TA 5FAKA 4Q1DA 2I9KA 2C92A 1JEJA 1R6BX 1HLGA 2A8YA 1LD3A 4LMBA 1RKVA 1NLUA 1MTOA 2CDBA 4KCGA 1XJCA 1IOVA 2ANCA 2VYNA 1CNMA 3HYCA 3UAZA 3SDBA 3MJVA 4ND6A 1LLFA 1HDOA 1OFUX 1WSDA 1RLTA 1K8YB 1UJ5A 4MV8A 3SHTA 2XDQA 5KI6A 2EGGA 5TRTA 4YUZA 2JARA 4C3ZA 4R4JA 2MSLA 1GSHA 3CX7A 4KI7A 5DYWA 5DW0A 3WB1A 3LP6A 5FP0A 3MWKA 4HQOA 1Z83A 1KO7A 3AY7A 2Z98A 4P92A 4TX1A 1IHPA 1QH8A 1SKYE 2BONA 4OLFA 3ADKA 3H4MA 5AW6A 2DLNA 5HOEA 5LIPA 4NWIA 3CLRC 1WDKA 5CIQA 2IOHA 3CX3A 4OYRA 1RAIA 3KXLA 3QEKA 1YSCA 2G40A 2XAAA 3R23A 2JRLA 2CYCA 4CKCB 1WXIA 4Q48A 2FOIA 3L07A 3MLAA 4OK3A 1FQWA 3P0HA 3VR4D 3PQDA 3EGDB 3WGZA 5JQWA 1D2GA 2JFNA 3DLPX 5HBRA 4HR7A 5CDGA 5M7EA 3A1UA 1FYDA 1M0TA 2H17A 2Y3IA 1WU8A 3P5SA 3OWOA 5BWCA 3I5UA 2I3AA 4HEA1 3SYRA 1H2EA 3IB6A 4D9JA 1RM5A 5ALWA 4KR3A 2XGMA 2R6JA 1Z0DA 1WHSB 1AKMA 3WWYA 1K3TA 1UT8A 3GZNB 4TV8F 8AT1A 5GJWC 3A1EA 1CP3A 4L5AA 2ZUVA 1UAYA 1JHOA 3P45A 3U4MA 2E5LB 1WPRA 2FA9A 3A10A 4MV9A 3M6MD 4NBNA 1MLDA 1UWKA 4H1TA 1RAAA 2P90A 4B3MB 2XUOA 1NC3A 4QT0A 2I6QA 2VXYA 3JQBC 4TLCA 1F51E 1LVUA 5AW3A 2W98A 3KQPA 1GRNA 4LRSB 5ALVA 4JT2A 5CG1A 1P6XA 3ZDAA 2AI2A 4I1SA 5DTEA 3UK1A 5EXPA 4FYIA 3A1CA 3MCZA 3MT0A 1X92A 2BAGA 1Y1TA 2WAAA 5HFJA 5KHAA 1I4LD 3QX8A 4RZHA 4PRZA 2GK6A 4LYGA 4UW9A 1L1RA 3Q85A 3IH5A 3HCDA 4KNWA 1U0RA 2XODA 2GM5A 1OJ7A 2XRZA 4PO3X 3UCEA 4HNRA 2YZMA 4M7OA 2Z9CA 2DHCA 1II0A 2TMYA 2Y2UA 1V37A 3L7JA 2UV8A 1CY6A 1ETHA 1N2CA 2QLTA 3THWB 5IT9A 3K0EA 2R1VB 3UAWA 5JNLA 1AH2A 4PZ9A 5ECGC 1V16B 2B37A 3ZKAA 2JANA 5BMVA 4KHPB 3GROA 4IPTA 2CYAA 1T1EA 2XKBA 3C6KA 2RB5A 3OEHA 4CL8A 1XELA 1RFGE 2XE7A 2B7BA 3FYHA 2ACKA 4C2UA 5JPCA 3NBQA 4J4TA 4K6GA 1ZPDA 3HS3A 3CLTD 1OBCA 2YQ5A 1G63A 1Z4PX 2F3UA 4IHQA 1ZRMA 5AK4A 3VC1A 4DCGA 1NHGA 5CDFA 3KK0A 4WKGA 1J9ZA 1XKTA 5J4KA 1ISFA 2OFWA 2G88A 4OHXA 1R0KA 3NNNA 4RMGA 2BMAA 2JGLA 4FW9A 2ZP1A 3D1LA 3L7AA 4L2IB 4WE3A 5KQSA 2QAGB 3PKJA 4E94A 3F49S 2BEJA 1OBVA 3ZIAA 1VJ1A 4E7PA 3MGKA 2HWXA 3L92A 5HF8A 3UY4A 5HRUA 4M8NE 4XPZA 5E2IA 3TX6A 2HQOA 1Y3DE 2JGNA 1NBHA 2GQ0A 2Q6KA 2ZYTX 3HEBA 3I5AA 1RAGA 3PUJA 4JVSB 4NP6A 4PY2A 4DLYA 2QUAA 3KJGA 3W6PA 4LGMA 2WUWE 4PCUA 3T5BA 4LJ5A 1RBQA 3UMYA 3MTIA 4G4IA 5KHOC 4DB4A 1P72A 3E8MA 1E77A 3A1VA 4YQFA 5MN4A 4TYNA