3JQBC

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-5-(2-phenylethyl)-3,7-dihydro-4h-pyrrolo[2,3-d]pyrimidin-4-one (dx6)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 89
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqbC00
3W8FA 2P4HX 3ANNA 1B26A 3U09A 2OFPA 4DGSA 2E6UX 1JVSA 2PGLA 2W2KB 3INGA 3WGIA 2QHXA 1T26A 2VRCA 3NDJA 4XA8A 5T67A 3JYOA 4O5OA 3LK7A 1GCUA 2AE1A 2EKPA 4JNKA 3U5TA 3ULKA 5L3ZA 3ZWVA 1AN9A 5L4SA 3S2GA 3RAJA 3I3OA 3DAGA 4RV9A 4CV0A 4CLRA 2D3TA 2ZKLA 4R3NA 1V0JA 1B0AA 3L77A 4E0BA 4G5HA 4URFA 4XGKA 4I5EA 4BV9A 5F3RA 3ETGA 5TNXA 4ZRNA 4DBZA 2O3JA 2WSBA 4IXTA 1WW8A 4AFNA 4KQXA 5G0TA 5FYDA 3X2EA 2NNLD 3ZZNA 3RUCA 2D2IA 2J5QA 1P1HA 4Y9DA 5K6AA 1CQIA 3AU8A 2IRWA 1SCUA 1SEPA 3VKVA 2AA3A 1SOWA 2BGMA 2QRJA 3M2TA 3EDMA 2VRCD 5A06A 3JSAA 4K6FA 3JQ8A 2CDBA 3OJOA 1B8UA 3U62A 4CUKA 1NXQA 2RH8A 4CODB 2D0IA 5JFOA 1Q0HA 4J9VA 5L7WA 2I76A 3H5NA 5F5LA 4NK4A 3F47A 5F21A 1WMAA 4WE3A 1IPFA 4RQTA 4WNIA 2CUKA 5CDSA 3BMQB 4JIGA 3N74A 4D3FA 1T4DA 4C4OA 4D42A 2VWQA 3PLNA 2IZ1A 3C1AA 2AW5A 1KBZA 3CSDA 5JYDA 3ZV6A 4BKOA 1K3TA 2D59A 1HXHA 3QWFA 3DXFA 2CF6A 4E5KA 4BHTA 4CLOB 1E5QA 4DC1A 4CQLA 2C54A 3RC7A 2UVDA 4RDIA 2Y1FA 3DZHA 4GMGA 1ZZEA 4BS9A 4YRAA 5CPBA 5JCJA 5BSFA 2AQKA 3N58A 5ICMA 1LDEA 4PRKA 4ZVVA 3PYMA 1MFZA 4X54A 5JAMA 1PX0A 1FF9A 1QV7A 3FPCA 4MP3A 3R1IA 3VAZA 4E30A 4WOKA 2FPIA 2W2KA 4YQYA 4RPHA 2G17A 5MDHA 2CF5A 3ZU2A 4R41A 4FBGA 2GN8A 3SJ7A 3JQGB 1UXIA 5DP2A 1RPNA 2WYUA 4FGWA 1ISJA 2OGUA 3H9JA 1ISMA 1I5RA 4UULA 5TJHA 3K31A 4CM4B 3PDJA 3FR7A 4K26A 2E48A 5G0SA 4LCEA 4O6VA 4RL6A 4ZHSA 4O59O 3CXRA 4FJ2A 4NU6A 1ZH8A 3S55A 5B1YA 1KVUA 4PG4A 5HRUA 1N9GB 3HDYA 1NVGA 3DZKA 4NIMA 2Y0CA 2NM0A 1PZGA 3WTCA 3E82A 5L40A 2PA3A 3GY0A 3B1JA 4G65A 4FIZA 4J2HA 2OP1A 3I6QA 3WSWA 5JCJD 5TLSA 1ISGA 1KS9A 3DOCA 3PP8A 3VOSA 4PLWA 1NFFA 1SBYA 4OXNA 1YONA 3F9IA 1VLLA 4M89A 3RFXA 4BO2A 4CMCA 3H3FA 5AQ1A 2G5CA 1PQUA 4FJ0A 4YJFB 4BNLA 3DZGA 3DZBA 2ZJ1A 3NTQA 2UYYA 1OAAA 3AUAA 5L95A 1PJQA 3HFGA 2AE2A 1X15A 1OZAA 1XG5A 3GUCA 3K9QO 3TPCA 1HLDA 2OL4A 3ZDFA 2DU8A 5DCWA 5DN9A 4MDHA 5C7LO 1OBFO 2EERA 4JP3A 3GVHA 4B4UA 1FJHA 3VC7A 3H65A 5DDIP 4MO2A 1BDBA 2FZEA 3V2UA 4XYGA 3NUGA 2NTNA 1A7AA 3RUDA 4OHUA 3FRJA 1JAYA 1GUZA 4WLOA 4A73A 3ADOA 4OGWA 5I9NA 3HB5X 3FR8A 1GTMA 4LVCA 2B69A 2P91A 1OMOA 3VDRA 5TX7A 4J7XA 4B4VA 4EYEA 1ISFA 2QX7A 5IDWA 2DT5A 3WB9A 5C7OO 3DBHA 1LC3A 3GR6A 3D5TA 1I33A 3I1JA 4CMIA 4JK3A 3LQFA 1BVUA 4BO4A 1F12A 2HMWA 1GDHA 1YJ8A 1C3VA 3SJUA 3PJDA 4YAKA 3GC6A 3GAZA 1EUCA 3HUDA 5CEJA 1F8GA 2FPGA 3OIGA 2WTBA 2QIOA 1QV6A 4NQZA 1JQBA 1BXGA 1V6AA 3A28A 4CMBA 4YPOA 3O8QA 2BMAA 2ZQZA 1GYQA 2JAPA 2Y1DA 3BTSA 3G0OA 3PQFA 1J5PA 4XDZA 1K6JA 2FZWA 3I9KA 4XB2A 3QVOA 4GGOA 4NNJA 4E32A 4J1QA 4J7UA 3QJ5A 1JKJA 2QYTA 3F1KA 3WGQA 3JQGA 3PZBA 3PJGA 1JWAB 4HUJA 2OHXA 2XPCA 4EUEA 4CM4A 4BNWA 1MXFA 1UXGA 1EBFA 4NPCA 4LK3A 1ADCA 4S1VA 3G1TA 4Q9NA 2JFHA 3PPIA 3VTFA 4FC7A 1HWYA 4E31A 1U7HA 2PZKA 2UAGA 5ER6A 3GNSA 2X5OA 1BRMA 4DYVA 4JP2A 4W6ZA 2PWZA 1WNTA 2YV3A 1B7GO 2HK7A 3PHGA 4MP6A 3JYLA 3GLQA 5DT9A 4Z0HO 2ZCVA 1SAYA 5G0WA 1ZK1A 4J1TA 2A4KA 2ZTVA 2POQX 4JXKA 2X1HA 3OA0A 1H2BA 4GWKA 5DOZA 4IGEA 3RC1A 3D64A 1QYDA 1MP0A 2PH3A 1E7SA 4MKZA 4P4GA 1LLQA 1QMGA 3L6DA 3OEYA 3ZU4A 4D41A 1DC4A 5IG2A 3BMCA 3VZQA 4DQUA 3WXBA 3CH6A 1R0LA 1YE3A 3I9MA 2GLXA 3AI2A 3AY6A 1ZSVA 5L7YA 4OXYA 4HFJA 1P1FA 3OMLA 1P45A 2QZ9A 3PVZA 3NDRA 1P1IA 4YYZA 1UXKA 3OM9A 1M67A 3IMFA 2BFMA 1A9ZA 1KY5A 1NWCA 2W2LA 3Q9NA 4OSOA 5A5FA 5A9RA 4XWYA 2YW9A 3FTPA 1Q7BA 4BKUA 4HADA 5CHEA 3ZH2A 1XGKA 3ZV5A 3JCZA 3DOOA 5A04A 3F46A 2D8AA 5DNAA 2ZYAA 1WDLA 1GV0A 2HMTA 3ZWCA 4YR9A 2GERA 4LSWA 5J23A 5F1OA 3MJVA 4KOAA 2EV9A 2X22A 5IDXA 4FQ8A 3DOJA 4BNMA 3AUUA 1V3VA 3JTMA 4ALMA 4R01A 5THQA 3BZUA 3DQPA 3GDOA 3O26A 3GEMA 4OM8A 3U3XA 4MIEA 2PZJA 1OOEA 5CDGA 3VKUA 2LDBA 2HU2A 2X7HA 4ZQFA 3ANLA 5AVOA 4CUZA 2FSVA 4YAJA 3IAHA 1SNYA 1V35A 1H2HA 5DBFA 3TOXA 1T24A 3UCXA 1J6UA 2H5LA 3RVDA 4YDRA 3I9NA 2Q2QA 2RAFA 3U4HA 1ADGA 2W2LD 5I7EA 1V9LA 3WYEA 3KBOA 1JKFA 1O6ZA 5H81A 3E9MA 1DFIA 3TZ6A 1ONOA 2FRDA 3UCFA 5B12A 5T6BA 4R9RA 5CFZA 5TRTA 3TDKA 1P1RA 3I5MA 5EMHA 4ZJUA 3ON5A 4H15A 4EGFA 5KKCA 4FN4A 2A94A 4LGVA 1H6AA 1V3UA 3GG2A 3IUPA 2YDXA 1PJ4A 4B79A 3OEWA 4IMRA 2AQ8A 4OAQA 3DZJA 1B16A 2XF8A 4JLWA 4FFPA 4D44A 1JN0A 3CMCO 3BMOB 3GUYA 4N5LA 3TZHA 3WLEA 2C0CA 4BO5A 4XYLA 4LSMA 1QORA 3BTUA 4JCOA 5JAZA 4B3JA 2O3SA 1HRDA 4NFHA 3SBOA 2IEDA 1UP4A 1ZK4A 3L9WA 4CLEA 4BQPA 4TRMA 4NU5A 5L9AA 3JQFA 1Y8RB 2B4TO 1K0UA 2J6IA 3ZWYA 1X13A 2ZTLA 1YRLA 2C7GA 4J4HA 2DM6A 3W4KA 1E1NA 1VC2A 4E2XA 1X1EA 2Y0EA 1WDKA 4LCJA 3R6DA 4R51A 4YBZA 1PIWA 4RF4A 3O38A 3D3WA 4DL9A 2BFOA 4PLGA 2BI7A 1UR5A 4K1LA 4TRJA 1EEHA 3C24A 1E7RA 3D4OA 3H5RA 4Q3DA 4PIVA 4MVJP 3WICA 1PSDA 2H6EA 5H83A 1NPDA 1U8FO 4OQYA 2D5AA 4WCFB 1YGYA 4HNGA 3W8EA 4AJJA 2J3KA 5JPIA 2O3TA 2IYPA 1P44A 4HY3A 5GMOA 3DZIA 1H0KA 4A5OA 2P68A 3E03A 2DBVO 1XWFA 1NQAO 5JMPA 3BYZA 4CQMB 1NYTA 4QQRA 3VH1A 2CD9A 2GO1A 5U1PA 5IXYA 3RFVA 4L73A 1DRUA 2JFGA 2BF7A 1N92A 3NRCA 2X5KO 3DBLA 1HF3A 3RKRA 2WM3A 3S1LA 3PK0A 3HSKA 1M6WA 3RUHA 4BNNA 4WK6A 1E3JA 4CPDA 2E49A 1EDZA 3NX4A 4AJKA 1LRLA 3WQQA 1Z7BA 2VWPA 4NFYA 1YL7A 1SOVA 3UXYA 4BUCA 4UVHA 3JYPA 1NPYA 1OI7A 3MJTA 3RUFA 4ILKA 5KJFA 1ZKMA 2O7SA 4A10A 4GX2A 4P4LA 2E4AA 3GMSA 1DLJA 4EBFA 2HLPA 3OH8A 3RASA 1C1DB 4OOFA 1VRWA 1BW9B 5K6AC 1Q0QA 2HAEA 4RPKA 3ZV4A 4R16A 5JYEA 1DO8A 4CM9D 3RQSA 4E13A 3TZKA 1CIVA 2HJRA 5CPFA 1YOVA 3B6ZA 3ZW8A 1HT0A 3BMOA 5BSEA 1LBEA 1Y6JA 1F17A 5A9TA 5A9SA 3WBFA 5KVCA 4PZEA 2HO5A 4IJKA 4E33A 1U8XX 4JGBA 2FPPA 4GKBA 1NNUA 4CR7A 1VSUA 4IQ8A 1PJBA 1Y8RA 2PD6A 4G81A 4YT8A 2O2SA 2GZ2A 1FDTA 4OIMA 1PGPA 1EZ4A 3S2EA 4FCCA 4MP8A 4GQAA 4UAGA 3KYDB 1SZJG 1B14A 4IPTA 3JQ7B 4OKIA 1EE2A 3EHEA 3UAGA 2OMEA 3HN7A 3VZRA 3UGKA 3MCVA 3ZWXA 4UUOA 3UHAA 4GVLA 4R5MA 1LTHR 4FR5A 4BNXA 5HS4A 1E5LA 1LEHA 4W9NC 1EK6A 2OUIA 5DZSA 2X6TA 4DUPA 1MFPA 3UVEA 4CLXA 4DWVA 1U3VA 1DFGA 4JBHA 4EEXA 5KJ6A 4WCFA 4WUVA 4KDFA 4M49A 3GGOA 1R12A 3L07A 1E6WA 3K5PA 1IHXA 2GGSA 3QWHA 3AUSA 4CV3A 1AHIA 1NQ5A 5JAIA 3L9XA 4JJGA 5TF4A 3AOEA 3P2OA 3OICA 3PIDA 1V3TA 2YJZA 3ANMA 3BHIA 4BNTA 2X23A 3PLRA 4CQMA 4OH1A 4GL4A 4NZ9A 3HNPA 5JLAA 3EC7A 2Z1NA 2EXXA 2VYNA 4RF5A 3FNEA 1ONPA 4HX5A 3H3JA 2V6FA 4XDYA 1ZK2A 4PVCA 1Y5RA 4GX1A 1GL3A 2O3RA 3IQDB 2WYWA 1UP6A 1PJSA 3V5NA 1I2ZA 4JX8A 3PDUA 3TF5A 1I36A 2HUNA 1HDOA 4R54A 3GN2A 2BH9A 4BNJA 5C5IA 2X8LA 3H8VA 1ENYA 2DTEA 4PG6A 3GEDA 3LLSA 3AOGA 1R16A 3VH4A 1LSUA 3WGYA 2ZYDA 4BNHA 1N5DA 4FGSA 2QW8A 1X0XA 4MJLA 1I32A 3SLKA 3INRA 1P74A 2RIRA 2HDHA 1I3LA 2ILTA 1BW9A 5KVQA 1P3DA 3U4DA 2HQ1A 3OIDA 3I6IA 3QW2A 5EQDA 4CQMD 3GZNA 2HKIA 4KTTE 4YJGB 4ND4A 3NT4A 1NR1A 3FSRA 4YXFA 4BB6A 1K2WA 2VRBA 3L0DA 5COAA 2GN6A 3NDIA 3HHPA 3ASVA 3LC1O 5IF3A 1WDMA 5JY1A 2JCYA 3DEYX 1ZEJA 1MB4A 2NVUA 2P2SA 2QRKA 2Q2VA 2O23A 5CDYA 1PJLA 4ZA2A 4GX5A 3MOIA 5BSHA 4HXYA 1S7CA 3GDFA 9LDBA 1TI7A 4BMNA 2SCUA 3GPDG 4IJUA 4K6CA 3WSVA 3E5RA 3E9NA 3PZRA 1R6DA 4J2OA 5BSGA 4TWRA 4XQ9A 1Z75A 2PKQP 4FD3A 1J0XO 4D3DA 1R37A 2ZCUA 1QRRA 3SVTA 3DO5A 2I67A 3PFFA 2IODA 3IP3A 3NTRA 4BO6A 1YWGO 3PIIA 4KUGA 4NFSA 4UUMA 5DP1A 5IN5A 4ZU3A 2GYYA 4C7KA 1ULUA 4J90A 3H6KA 1U3UA 1DAPA 5LC1A 3WOHA 3RU7A 4FJ1A 4RVFA 3JQAB 1E6UA 4AL4A 2LDXA 2IXBA 2GD1O 1VPDA 1EVYA 1GV1A 3LC7O 1T2CA 2GPTA 3FBGA 3MTJA 1D7OA 4IJWA 1E0DA 1VJ0A 3OFSA 2A35A 3PEFA 3AU9A 4XX0A 1U28A 3JD0A 3TL3A 3L6OO 5C3MA 1Z73A 5CEFA 4EJ6A 1H94A 4MVJH 5AXBA 4A0SA 5G4KA 2PV7A 2D4AA 3AFNA 5EN4A 4I8XA 3ZU5A 4FPXA 2OP0A 3LDHA 4WLEA 3PQDA 1TEHA 3WGTA 4D0RA 4IQGA 3RUEA 1AHHA 3ZNQA 2I9PA 4ID9A 3Q2IA 4LN1A 2CFCA 5B37A 3SC6A 4DXHA 1IYZA 3ONFA 2V6MA 1AXEA 1VJTA 5JBIA 1ADBA 3GT0A 1VL6A 3PGJA 2PFGA 3FN4A 3V1YA 3DAFA 5ADHA 1P33A 1GAEO 2OBYA 2FN7A 2DPGA 4W9NA 5COQA 1XSEA 1KVQA 3DBRA 1I3KA 4RZHA 4LISA 2O4UX 2VZ8A 2Q1UA 2VHZA 1Z74A 3P7MA 2VOJA 4BL5A 5ENVA 2AHRA 2NQTA 1YQGA 3C8MA 2EWMA 5ILGA 1I01A 3S2IA 4BNVA 1YBVA 3PYXA 4BGIA 3ZHZA 3OJ0A 3QVXA 4DA9A 3HZZA 2Y68A 3GOHA 1G6KA 3GVIA 4YJHB 1MC4A 5A03A 2DKNA 4WPGA 4J0FA 3E1KA 5C37A 1QYCA 1VKOA 1ZCJA 4IDAA 4KWHA 4L76A 2P9CA 2GUGA 4UVEA 4DTIA 1KYQA 2VHWA 4MVJE 2B0JA 4IJVA 2IZZA 2TMDA 5FF9A 4G2NA 3I4FA 1Z6ZA 2DLDA 4GLLA 3F5SA 3TJRA 2Y67A 1R66A 2JD2A 5JS6A 3KEOA 3TWOA 2VWHA 4UVDA 1UUFA 1K89A 1B2LA 1YL6A 1X0VA 1HDGO 1PJ2A 3WQRA 1EQUA 2FR0A 1DLIA 3RSHA 4HBGA 3A4VA 4J4BA 2FY8A 4XGNA 5TT0A 4L4XA 1CF2O 4J4TA 4XYMA 1L7DA 5DCUA 3WGOA 1B3RA 1IUKA 3JD4A 3KRTA 3F6YA 3VHRA 1RWBA 3Q6IA 2VNSA 3OF2A 1GD1O 3PXXA 2NU6A 2X0IA 4KTVE 2O3QA 4P8RA 3MWEB 4QTZA 3T7EA 3M1LA 1T4BA 4ESOA 3AUTA 4XIJA 5L4LA 1QYXA 1WXDA 4YA6A 3JQAA 3H2SA 4XB1A 2PGJA 4Z0PA 2B35A 4Y98A 4ZRMA 4MIYA 3TOZA 3DTTA 4H7PA 1QYWA 1U4OA 2DVMA 4I08A 4KMSA 1NR7A 4RQUA 3WTBA 1QLHA 2I65A 3LZ6A 1N7HA 2B4RO 4A2CA 4CM6A 5IN4A 5JXWA 4DIBA 1T25A 4BKPA 1H6CA 1YVEI 2TMGA 4DLLA 1HE4A 4EUHA 6ADHA 1H6BA 4IS3A 1YQDA 2PTGA 4UVIA 2HMUA 2Q99A 1GEEA 2CVZA 2Q49A 1IB6A 4ITUA 1Y9AA 1O0SA 2HMVA 3CZRA 5T5QA 4B7XA 4U7WA 3QWIA 1M76A 2BELA 2Q4BA 4OXKA 4LRSB 1PU2A 2WD8A 1T2DA 3GH3A 3KZVA 1CETA 2AMFA 1A9YA 3BMQA 4TKLA 5ITWA 1ORRA 1GUFA 2JCVA 2O4CA 2W90A 4HFMA 4NBWA 1HDYA 5LCXA 1NQOA 3DHYA 3IKTA 2GNAA 2VTDA 2X0NA 1MUUA 1VE9A 3JQAD 4BB5A 2C5AA 5BNTA 5KCZA 3FWNA 4B3HA 5KOIA 1T1RA 1QSGA 4PZDA 4CLOA 3HDJA 1SPXA 4RVGA 1XCBA 1WPQA 2B4QA 3F1LA 1PR3A 3QVTA 3S2FA 3OQ1A 3BXXA 2NVWA 3M1AA 4XCVA 2YQ4A 1K5HA 2CSUA 2ZK7A 3P19A 1P9LA 3JQFC 2C20A 1A72A 1B3BA 3RBVA 4RCVA 3H5AA 2O7QA 3OHSX 2EW2A 4DRYA 3AI3A 1U2GA 1ADFA 2JJYA 2EF1A 3HB4X 3PHHA 4IQ0A 4PZCA 3WGGA 4NI5A 4HWKA 5KTKA 4KZPA 5EIOA 3LSYA 5EPOA 4B7UA 4D3SA 4YJDA 5FEUA 2G82A 2VN8A 2E37A 1CEQA 1X7HA 3A1NA 3HE3A 1U5AA 4QFDA 1EFLA 2J3JA 1H5QA 3NJ8A 1LSOA 1BGVA 2C82A 4IDFA 3GQVA 2DUUA 3DHNA 4EW6A 5EJ2A 1N9GA 3ZWBA 1E3IA 1ULSA 3K30A 3PWSA 3D4PA 4N54A 2ET6A 4E3ZA 2P9EA 5T8KC 4TROA 2NV6A 3WIEA 1NASA 3PWKA 4Y8VA 2VNAA 3LLVA 4AJLA 1E7WA 3EMKA 3GG9A 3G79A 4I9UA 3G1UA 1O9BA 2AEJA 3HADA 2OORA 2CVQA 3PRJA 4YJFA 4E5PA 3KSUA 3KSZO 4LVUA 5THKA 1YJQA 1PZHA 2AQHA 3W8DA 5ITVA 4WKGA 4EJMA 3I83A 3QY9A 3QA9A 2YV2A 5IDQA 9LDTA 2UV8A 3ZWWA 3KYCB 1EK5A 1AUPA 1MGOA 2WJPA 2ZB4A 3ROQA 2EJWA 3T7CA 1F0YA 4H16A 1SEVA 1V8BA 5KVSA 4QECA 4ROSA 1QXSA 3VZPA 1XKQA 1Q2XA 2YQ5A 4N5MA 1I24A 1O8CA 4YEDA 1LRJA 3WJAA 1NAHA 1Z7EA 3KHUA 5AYVA 1HE2A 1DIGA 5CDUA 1U1IA 3ITDA 3FNFA 3E48A 5K9ZA 3L4BC 5HWSA 1NVTA 3ZNNA 2X86A 5KKAA 1F8FA 2J5RA 2QG4A 5MGBA 3Q0EA 4ND3A 4R9SA 3OECA 4E2YA 5JMWA 1KEVA 3PFWO 3MEQA 5KVVA 3KUXA 1HDCA 2ZQYA 4B3IA 1EE9A 2F00A 1LRKA 3QRWA 4BKQA 4YT4A 1D8AA 2GCGA 3LT0A 4J9UE 3CZMA 3FNHA 3JQ9A 1KERA 1KVRA 1LNQA 1CRWG 3ROMA 3EYWA 2PR2A 3HN2A 5ILOA 2GN9A 4W99A 4J91A 3W1VA 1LLCA 4R1SA 4A7PA 3RROA 2C2YA 2AG5A 1H9AA 3KV3O 2DUWA 3H7AA 1DC3A 4XQEA 1P0CA 4ZD6A 3GGPA 1HYEA 4RVUA 2DTDA 2O3UA 1YBAA 4CLHA 2VYVA 4DLAA 1LDNA 2OZPA 4BNZA 3RJ5A 1KVTA 4PG8A 4HKTA 3P5SA 1XYGA 4M1QA 3GN1A 1ENPA 1HZZA 3CMMA 4PLZA 1DOHA 4ZQGA 1ZMOA 2R00C 3GAFA 4PCVA 3H9GA 3X2FA 3IL2A 1ISHA 2JL1A 1MX3A 1E6EA 2ZYGA 1C0LA 2FSSA 1R4NB 2EP7A 3MJCA 4ZQHA 1P0FA 1PEDA 4BMSA 3ENNA 4KQWA 4I5GA 4WCFC 3E8XA 1PS9A 3MOGA 5BQFA 5LDHA 2Y99A 1DJQA 1PR9A 3RBXA 4JJFA 2Q1SA 3O03A 3ZN2A 2RHRA 1M6HA 2EHDA 1OC4A 1W0CA 7MDHA 3NT2A 2JKVA 4D43A 1PL7A 1UXHA 3AOEC 2HCTA 3ZGYA 4XYBA 1P1JA 4YAIA 2HSDA 2V7PA 2NLOA 1YDEA 2EEZA 1C1XB 4KP7A 3A06A 3ETDA 4BO1A 3BA1A 2VYVD 3G17A 4IUYA 4JBIA 3UW3A 2VUUA 1QLJA 4TQGA 1I3NA 4CM3A 1E3SA 3GVXA 1U3TA 3RU9A 4BNYA 4XJSA 1H9BA 5EERA 2G0TA 4TZTA 3EGOA 1PWZA 3DHEA 4EJ0A 1TT5B 3GVPA 4TSKA 1E3LA 3FHLA 4YTEA 1ZK3A 4AJPA 1H93A 5L45A 1H6DA 4YT2A 3C7CB 3I9LA 1XHLA 3K8ZA 3MJEA 3OA2A 1UAYA 1DBVO 1OFGA 3AM5A 1ZO8A 2PD3A 3T4EA 1UH5A 3QVSA 1QP8A 5GZ1A 4NK5A 3TFOA 1GPDG 4FDAA 1Y9EA 3E9QA 4WCDA 8LDHA 2YDYA 5IXSA 3WX0A 1Z45A 1EQ2A 5FFFA 4MKXA 3DBVO 4WLFA 3WMWA 2J3HA 1JAXA 5T8KA 1MC5A 4CV1A 1E1KA 4KWIA 4PVDA 4DQXA 1HYHA 5JDIC 2JCXA 4CL3A 4IDDA 1PWXA 3FI9A 3V2HA 1GU7A 3O4RA 4CM9A 4I9NA 1NQTA 1HSZA 1YB5A 2GASA 3ZHYA 4IIUA 1C14A 2RCYA 1WAMA 5ICSA 4U0JA 4TVBA 2WE8A 1GR0A 3BHMA 2YHIB 3RBZA 4IGFA 1D1SA 1XQ6A 4HFRA 1PJCA 1DXYA 3GA0A 4JN6B 4QUKA 1YS4A 4AJEA 2V65A 4BNFA 1YXMA 4II3A 2JD1A 4GH5A 3K96A 4YT5A 1KC3A 1W6UA 3I9JA 2NU9A 4R4JA 4BO3A 4JBGA 3TSCA 5KIAA 1MG0A 1UZNA 1IZ0A 3H9QA 2AQIA 1NTOA 3LVFO 3PHIA 4PLYA 1I3MA 4IY1A 2VZ9A 4AVYA 4BGUA 5DF1A 2YY7A 4XQGA 4RZIA 1PGQA 4GWGA 3L4BA 2FR8A 1JDJA 2Y0DA 1ZSYA 5I8WA 2O2YA 4CM8B 4LMRA 4RGBA 4Y6RA 4E5MA 2D5CA 4FFRA 3GVCA 4DMMA 1Y1PA 1EVZA 3KB6A 2VZ0A 3C3XA 3RC9A 4CMJA 5FWNA 4Q3NA 4IXWA 1LUAA 3V1UA 2FHSA 4QEDA 2CDCA 3AI1A 1NX6A 4GI2A 4CLDA 4BNUA 3CE6A 4D0SA 4CMHA 2Q1TA 2WYVA 1A5ZA 3OJLA 2RHCA 4EDFA 3HDHA 3KVOA 4IMPA 3RD5A 3KTDA 4K28A 3FWZA 1CQJA 1L7EA 1DHTA 5F1PA 3KLMX 4LW8A 1VM6A 3OJEA 4Y6PA 3WYBA 3IJPA 5IFLA 4Y6SA 4FFMA 3WG9A 3EZLA 5I8ZA 4B8ZA 3GFGA 3ZNPA 4PLPA 3ZCXA 2GF2A 3QQPA 4DYDA 4Z9XA 4Q39A 4YRBA 4NG5A 1LQTA 3WMXA 3NAQA 1A71A 2CMDA 1RJWA 1DIRA 1FDVA 1RYEA 2R00A 3ONEA 1AXGA 3D0OA 3VPSA 4ZGWA 3D1LA 4L8VA 1CWUA 1I0ZA 2IDZA 3IIEA 3UOGA 4C7JA 3CEAA 4FOOA 2EKQA 4RVDA 8ADHA 2NUAA 2NSDA 3GZ4A 4J6FA 5JCXA 2C29D 2PH5A 2NU8A 5B4UA 2VUTA 3ZHBA 2I3GA 4UVGA 3DAPA 1YBMA 3CPSA 3AK4A 4M86A 1N2SA 3GDGA 3W4JA 1JTVA 4XRGA 1HETA 4CMGA 1HTBA 2GRAA 2W98A 4YB8A 3R0IA 1NPTO 4H3VA 1EFKA 2R6JA 3EVNA 3QWAA 4CM7A 2ZIZA 4B7CA 3QIVA 1DRVA 4NMHA 1DJNA 1NHWA 3BHJA 3DZFA 1QKIA 3ASUA 2DPHA 5TIIA 1I10A 2Q3EA 4CUJA 2OO5A 1RM5A 3DB2A 1GZ4A 3RCBA 3F5QA 4AICA 2DBZA 2H1SA 4J7CA 1YH3A 2Y93A 3JQDA 3PI7A 1TXGA 1CDOA 1B8PA 3JQ8B 4WOJA 3ICCA 1GZ6A 1UDBA 1WVGA 5T64A 4XIYA 3LYLA 4BV8A 4E2WA 4R3WA 4NR0A 5A02A 5TT1A 1KVSA 4EUFA 1PL6A 1UP7A 3CTMA 3WS7A 4FB5A 3E18A 1O5IA 3JYNA 4GX0A 4IZIA 4IBOA 5KWEA 1FDUA 4R69A 1LJ8A 4NHEA 3RFTA 3R3JA 4DBVO 1ENZA 1C1DA 3KOUA 4CJXA 5EESA 3WFJA 4IDCA 1GYRA 1UDCA 1Q7GA 4GGPA 5IJZA 1ONNA 3B70A 1HZJA 5A1TA 5DOVA 2J5KA 1NFQA 5AOVA 5JDIA 3GRPA 3NEPX 1MG5A 3K73O 3Q11A 2WE7A 3DC2A 1ZJZA 4LRTB 4BIIA 4DPLA 1R0KA 3WGHA 3MWDB 1E1LA 4EITA 2YV1A 1I30A 2X9VA 1NBOA 2YHUA 4ALKA 2J3IA 2QQ5A 3IUSA 1IE3A 4MPDA 5G0VA 3JQBC 3RIHA 4A03A 3TRIA 1PJ3A 3KSDO 1PQWA 3QE3A 4JROA 2PK3A 4PLTA 4PG7A 3FTNA 3HDQA 2O50A 3EUWA 2VUSA 3Q9UA 2PNFA 4GKVA 2Y1EA 5A3VA 3WBBA 2GN4A 2HMSA 2JHGA 3KYDA 4ND5A 3JQ7A 4U8GA 4AJ4A 2O48X 1JW9B 2H63A 3C7DB 4M55A 3W6UA 4IS2A 3H2ZA 1PZEA 4I1IA 3AFMA 2Q2WA 2PLAA 4YRDA 3PHJA 1WP4A 1PGNA 2VHVA 1LC0A 1M75A 3F4BA 3LT2A 1X7DA 1MV8A 3QSGA 1N1GA 1ZNQO 4M8SA 5JO0A 2AG8A 2RBEA 3WIDA 2B5VA 1BXZA 2D1YA 1DDOA 1XELA 3PGXA 4IZHA 3NJ4A 3KLPX 4B4OA 1I8TA 3MZ0A 2CNBA 4D46A 4ONEA 3VH3A 1T2AA 5AXCA 3SX2A 1C0IA 3SXPA 2WEKA 1R15A 3R3SA 1OC2A 2UUPA 5BR7A 3D7LA 1RYDA 5ES3A 1J49A 1ZW1A 4Z6KA 1E7MA 2BLLA 4J16A 1ZIDA 2P5UA 2YUTA 1WWKA 5I7FA 1PQPA 3DFUA 4IIVA 1GYPA 4Q3EA 1LXCA 1DIHA 3HG7A 4W7IA 4F45A 2HRBA 4P38A 2Q50A 3TFQA 4FC6A 3U49A 2GR9A 3C7AA 1P77A 1GADO 3LT1A 1DEHA 1G0NA 1T2FA 1W8DA 2DBQA 2VTEA 3EAGA 4JQCA 4XYEA 1NM5A 1PJTA 3QHAA 5CG1A 3DONA 2Y1OA 1J4AA 2DBRA 5EQFA 4CMAA 3LT4A 5KJ1A 4W82A 1XU9A 3G3EA 3H9UA 4FFLA 3I23A 5G2OA 2R2GA 1GFSA 3IOYA 5BNFA 3W6ZA 3MJ4A 4PRLA 1R0SA 5JC8A 4DREA 5B4TA 5IDYA 1E77A 3UN1A 3VVCA 1JU9A 5AXDA 3KETA 4AG3A 3JD3A 4BNGA 1YO6A 2VT2A 4DLBA 3M2PA 1EBUA 3BMNB 4I5DA 2F1KA 3FBTA 5HBRA 1PL8A 4YJGA 4EI2A 3V2GA 3DBHB 5DULA 3ONDA 3CUKA 1BWSA 3GFBA 1RM0A 2BHLA 4CMIB 3GEGA 3VTZA 3BTVA 2P4QA 2AEFA 3GPIA 1HE5A 4OSPA 3Q3CA 4WJZA 5EL0A 3UKOA 4RPJA 3JV7A 1T2EA 3PWZA 2QRLA 4EZBA 1U4SA 5G4LA 3Q2KA 4MIOA 4YVFA 3TL2A 3AM3A 3PJEA 5CEEA 5HM8A 3AM4A 5ER9A 2X9GA 3U9LA 2CZCA 3K92A 3CIFA 1BXGB 3JQEA 3O8QB 5KJEA 1CJCA 2EJVA 3ZWAA 3PTZA 4N18A 3N7UA 2QZZA 3ZI0A 4ALJA 1GQQA 1DIAA 1DC6A 2PD4A 2CDAA 4WGGA 5DBGA 4DC0A 3ST7A 1IZ9A 1DFHA 1M2WA 2DQ4A 2P9GA 2GSDA 3AWDA 4ALLA 1HSOA 2IXAA 2ZB8A 4FOSA 4WLVA 5JDCC 2I66A 1NP3A 4YAGA 1K6XA 1BTOA 3SLGA 3JQ9C 3VPXA 1XR3A 4DMLA 5JAQA 3W4IA 4DPKA 1SO8A 1NHGA 1GQYA 3DL2A 3AY3A 1HDXA 4WASA 3VPGA 2ZTMA 2VWGA 2FOIA 1A4IA 2I5PO 1UZLA 3OETA 2X58A 4NBRA 3PQEA 1GPJA 2VT3A 4J43A 2B83A 2PKRA 3TZQA 3CKYA 1GEGA 5I7SA 1ZJYA 1MA0A 4OJNA 3UFXA 2B5WA 4BKRA 4CMEA 3RUAA 1HL3A 3JQBA 4DIOA 1LX6A 2WMDA 2X9NA 4BOYA 2FMUA 2VHYA 4YAEA 4AJIA 4TMFA 1ZK0A 4AJOA 2C59A 1XA0A 4PG5A 4YACA 3L6EA 1XU7A 1BDMA 1FDSA 2Q45A 1R4MB 4RVSA 3UUWA 4MOWA 3ADPA 3OBBA 4PFJA 3KO8A 1BG6A 1KOLA 3DFZA 3INTA 1HLPA 2EG9A 1QR6A 2EIHA 3BMCB 1E7QA 4QO8A 3E5MA 4KUHA 1W4ZA 4CM1A 1KY4A 2HRZA 4RJTA 4RLSA 3U4IA 4NJMB 4D7AA 1NWHA 1SC6A 4ZN6A 4W4TA 3KEQA 2BFAA 4GPD1 4IDBA 4L74A 1NAIA 1QG6A 3ZNOA 3O9ZA 3BMNA 3PHLA 4D45A 2QYSA 1DC5A 5BT9A 1XEAA 3UICA 1EVJA 1GZ3A 2BFPA 3IS3A 1QYVA 4L4RA 1U3WA 3DTYA 3BIOA 3ENKA 1A27A 1B15A 5U9CA 1HE3A 3WQSB 2OOSA 4OL9A 2Y66A 4R1UA 3BTOA 4GLOA 4HP8A 4YJHA 1GY8A 4O1MA 3TQHA 1SB8A 3C1OA 4E4YA 1VKNA 1C0KA 2E82A 3ICPA 2BI8A 4J0EA 4R68A 4MVJA 1EUZA 5JE8A 1E7YA 1DPGA 1LLUA 3B20A 4BO0A 4DVJA 3VH2A 1BVRA 1Y8QB 2BRUA 3WGZA 1SMKA 3B1FA 4GBJA 4BO7A 2V6GA 4FFNA 4TVOA 1DAOA 3EZYA 2X4GA 3NV9A 4WEQA 1YQXA 2UDPA 4U6QA 4Q3AA 4CM5A 2B37A 1LA2A 1TB4A 4RPGA 3COSA 5TJ9A 2Z95A 5L4NA 4J1NA 2B36A 4NBTA 5G0UA 4XZ3A 1X1TA 1TLTA 3WR5A 3ZWNA 3B1KA 5ENDA 4E12A 1GQ2A 3LU1A 3LF2A 1PTJA 1FXSA 3EK2A 1Y5MA 4XQCA 2DAPA 2G1UA 1ZXBA 2Q46A 4FSHA 5L53A 4ALNA 1ZSNA 4ZQBA 5TQVA 3SEFA 3GHHA 3G49A 1IOLA 1WMBA 1WZEA 4ND2A 1G0OA 7ADHA 4L9RA 1IULA 1HKUA 2NVBA 3AJRA 3U4CA 3KM0A 3OQBA 1EDOA 4MVJD 5CG2A 2C2XA 3VPFA 4OO3A 2X0JA 1ISIA 1N8KA 1RM4A 3L4SO 3TZCA 3WJ7A 4K9DA 4AJ2A 1XIVA 5TSDA 5FI5A 2PZMA 2OXIA 3WWYA 5A3JA 4M87A 3A9WA 3ZWOA 3MJSA 1Z82A 4OOEA 1CERA 1Q1NA 1TA4A 2ZTUA 4RORA 1I2CA 3OIFA 3VDQA 3M6IA 5JC1A 4HFNA 1UAGA 2H9IA 1PGJA 4DPMA 5EINA 4QFCA 1PZFA 3JQCA 4L75A 4TZKA 5GY7A 1R4MA 3EVTA 3MTGA 4XGIA 4D79A 1ARZA 1ML3A 1JWBB 1HYGA 4LMPA 1KC1A 2A92A 1D4FA 1UZMA 2FP4A 4IDEA 3PJFA 4N5NA 3DMTC 4NDNE 1BHSA 4E21A 4B4WA 2JFFA 4NJMA 5JW6A 1LU9A 4MINA 4YWJA 3K2EA 4U6SA 5JDCA 3AW9A 4XJTA 4XEHA 3WWZA 4MVJI 4UUNA 4DIFA 2FR1A 3D3WB 1M66A 3FNGA 2VQ3A 3QP9A 3JD1A 3GGGA 4Z3KA 2BKAA 4RO0A 1X14A 2I99A 1LDGA 2FWMX 3HQ4O 5JO9A 1MLDA 4GSLA 4PLCA 3ZW9A 3T4XA 3EW7A 2DFVA 3WYCA 3H4VA 3C1TA 3OSUA 2WD7B 3BAZA 1W73A 1N7GA 3FPLA 3GNQA 2ZB3A 2JHFA 1ZFNA 3KXDA 3RWBA 1Y8QA 1O89A 5U4QA 4F46A 4RDHA 4MVJF 2Q4EA 4WLUA 3RUIA 4JJIA 4Z9FA 2HK8A 4BNKA 4BO9A 3DBLB 1B8VA 1IY8A 5A4DA 1GUYA 2GZ1A 1U5CA 3ROPA 1IHYA 3NKLA 4AJNA 4OYRA 3JQ6A 1ZEMA 3F3SA 4WNCA 4Z3DA 2NU7A 4CMKA 5L7TA 3GK3A 1NVMB 3IDSA 1O94A 3IKVA 3I4CA 3F4LA 3H9EO 3FF4A 3I52A 1PS0A 3GNTA 1T1SA 4GVXA 5IZCC 4Y67A 1VJ1A 5COBA 3FD8A 4M54A 1JVBA 3ETEA 3A14A 4RLHA 3WFIA 3Q1LA 1IL0A 1E3EA 1XDWA 4II2A 5T57A 2Q1WA 3KYCA 4FS3A 1PS8A 6LDHA 4YQZA 2Y05A 1YB1A 2EKLA 2GZ3A 2PY6A 3DWFA 3KYBA 1BSVA 1YOVB 4Q3CA 2CVOA 5JNLA 1JLLA 4MVJM 1BMDA 1HEUA 2X0RA 1RKXA 1IPEA 1LDBA 2YYYA 5AXAA 3S8MA 4GMFA 4CR8A 5A9SB 2JD0A 3JD2A 3CINA 3RJ9A 3QLJA 2ZATA 4RF2A 4TKMA 2Z1MA 3UCEA 1YB4A 3OP4A 4B8WA 4BO8A 4QT0A 3VVBA 4BNIA 4R1TA 1U7TA 5GZ3A 2NADA 1LDYA 1X7GA 5CP8A 1KIFA 2XXBA 2ZB7A 2EGGA 1D1TA 2DTXA 4BMVA 3UF0A 5JSFA 2WDZA 2P5YA 2Y1GA 3V1TC 2J8ZA 3NYWA 2C5EA 4WEOA 4XR9A 3LC2O 1O95A 2Y1CA 4PLFA 1XQ1A 1UXJA 4WLNA 1HDRA 4PGFA 5IAAA 1UDAA 3FCOA 3HJAA 1DSSG 3SC4A 4O0LA 4IDGA 2PKQO 1E1MA 1XLTA 4INAA 4Q3BA 2WD7A 2PZLA 4ZICA 5I9LA 1F14A 1GCOA 4RPLA 5A5EA 3C85A 1ID1A 1PGOA 4ND1A 2BGLA 2YZ7A 1DHRA 1LSSA 1ZXLA 2Z5LA 4OQZA 1YDWA 1HDZA 1E3WB 5I7VA 5HS6A 3WNVA 5HTOA 2VOEA 4N7RA 4NJOA 5K0ZA 3ZWMA 3IJRA 5IZ4A 1LSJA 1LQUA 1ZUD1 4QX6A 1EUDA 4UREA 3NGXA 4TRNA 1JKIA 1EVIA 3IC5A 3DMYA 1R4NA 4GSKA 2PGDA 4KDEA 4OKNA 1FK8A 4OMUA 4UUPA 5TS3A 3GMDA 2VCYA 1L1FA 3DMTA 2YFHA 3D4NA 4NBVA 4J3FA 1P31A 1ZVMA 3ZV3A 1ZBQA 4XRRA 4BGEA 4IM7A 2AEMA 5B4VA 1MXHA 3QV1A 3D3EA 3LF1A 1TT7A 2AXQA 1KEWA 1N1EA 1Q0LA 1D3AA 1YKFA 2G76A 4CL8A 3WNQA 1DRWA 2DC1A 3NT5A 1CYDA 5LDGA 2IEBA 4PN3A 1RM3A 2WWRA 1C1XA 4I9HA 1Y81A 2NACA 2YFQA 2BD0A 3PYLA 4HNHA 4HV4A 4S3MA 1K6IA 4FFOA 4MVJG 3K2BA 2EW8A 4O63O 3NTOA 1SB9A 3GHYA 1JA9A 3E6AA 3GZNB 1TT5A 4XR4A 3WDSA 2HJSA 1VL8A 4KUEA 4NBUA 4U5QA 3AY7A 4R5HA 4WECA 1VSVA 4RVHA 4ZQEA 2X5JO 3VZSA 2XOXA 5H82A 1KEUA 3ZWPA 3STHA 1U2DA 1E92A 2XAAA 4J1SA 2IYOA 3P2YA 1WZIA 4PLHA 2I3AA 1TVEA 3JYQA 2OBNA 4BVAA 4DQVA 5F1KA 3EY4A 3TN7A 2NVUB 1VI2A 1KETA 1NFRA 2C7VA 4P4NA 5L51A 3HWRA 3UH1A 2VHXA 1Y7TA 5GZ6A 2A9FA 2NTVA 3ORFA 4A26A 4TRRA 5CDTA 3GRKA 1DIBA 4Z0TA 3ITKA 4CLRB 5CAEA 1A4UA 2CY0A 4E5YA 1FMCA 4A27A 4QXMA 4W7HA 1AGNA 2HK9A 3RI3A 3OJFA 4R1NA 1FDWA 5IZCA 1G1AA 1LI4A 4U0KA 3U0BA 3RKUA 4GAEA 4FW8A 4CR6A 2NTJA 4AJ1A 1I2BA 2YHIA 3TNLA 5KNLA 3DR3A 2ZJ0A 4F6LA 5A05A 4XKJA 4CV2A 2EP5A 2C07A 4UEJA 3ZHXA 1E3WA 5HA5A 4F3YA 1P1KA 2RH4A 4L4SA 4Z9YA 2NQ8A 4PLVA 4YCAA 4AJHA 2I6TA 5FI3A 1Q7CA 1F06A 4QO7A 5TC4A 2GDZA 5C7IO 3V8BA 4BQRA 2EGHA 3ZU3A 1A7KA 2W4QA 3OQ6A 1S6YA 4IINA 1ZMTA 1LLDA 3I9OA 3VPHA 5G4KB 3GF4A 3HFSA 5DBIA 2JAHA 4CM8A 4ALIA 5JY6A 3K6JA 2UUOA 2IE0A 5BNIA 4UEKA 3IP1A 1C0PA 1DB3A 5F5NA 4E5NA 2W8ZA 1LDMA 1VL0A 1AE1A 4EEZA 4P22A 5I9MA 4NH4A 3D5QA 5KJCA 2IZ0A 4UEOA 4L0QA 4RF3A 3WLFA 1U9JA 4E6PA 1KEPA 4CMEC 3DBRB 4I5FA 1UJMA 3ABIA 5DCYA 4XD2A 2XXJA 3NGLA 3QVWA 3DDNA 5TGDA 2BGKA 4CQLB 4F6CA 1WLYA 3RC2A 4QSMA 4J49A 2DFDA 2NWQA 3ROKA 3QWBA 4MKRA 1BXKA 2VYND 2V6BA 1EMDA 1YL5A 4BGVA 4E2ZA 1ENOA
chains in the Genus database with same CATH superfamily
1ZHHA 1F48A 3RVKA 2P4HX 2ADMA 2AGVA 1OU0A 2I8LA 2OFPA 3CVWA 3W05A 3FUCA 2NAFA 2QHXA 1T26A 2D1FA 3JYOA 4O5OA 3LK7A 1GCUA 3KSBC 2BISA 2XMRA 4FGUA 2EKPA 4JNKA 3TB4A 3PNMA 2IXDA 1KKMA 3ZWVA 2WNIA 1AN9A 1T2NA 3FCEA 5L4SA 3H0KA 1PJRA 1M8JA 1G3RA 1M0SA 4AY3A 2QVBA 2B0CA 4QU8A 1B6SA 4JSTA 4YMLA 1V0JA 2XB9A 1GZUA 3L77A 5AJTA 3U3MA 1I6MA 4MGKR 4URFA 4DJTA 5IBPA 1KYTA 2DRIA 1YDHA 2VAVA 5LZ4A 3QI2A 1Z5ZA 3HDTA 3MGGA 3CRZA 3GJ0A 2WSBA 1N8TA 4JYBA 4IXTA 3T4PA 2A6PA 3VISA 2NU6B 4NMXB 2C4UA 3ZZNA 2A78A 3UB4A 1IY0A 2PXXA 2ZSDA 2XVAA 5EGSA 3H2KA 4P4TA 3VDNB 3AU8A 2AF4C 1KYZA 3EIXA 1RKQA 1N7JA 1ODTC 1ZRNA 4F5YA 1MABB 4KPYA 2XUDA 4HEHA 2ZBGA 3DO8A 1KNQA 1AKQA 4NV0A 4K6FA 4PFKA 5JASA 1W44A 4HMPA 1GAQA 1NJ1A 4S1WA 1DPFA 4BXOB 3WIVA 4E3WA 5F5XA 1IG3A 2ST1A 4MA5A 5BOVA 3R9WA 1Z38A 4V0OA 5JCPA 3H1EA 1FBNA 3NWPA 3PC4A 3CEJA 4CUKA 5KWIA 3MD9A 1Z15A 4L2IA 2R1TA 1OGYA 4O1IA 4BFVA 1JSRA 3ZJ5A 3DTVB 5E1OA 3NASA 3RAGA 2Y77A 3JRXA 4PYRA 1JQLB 5EWMA 4AP6A 4D4HA 2D13A 1Q0UA 4YR7A 2CBGA 3L40A 3Q8WA 4EUSA 2JGIA 3ZR4B 1NVKA 5PGMA 2FSUA 2DWPA 1L4HA 2ZRQA 1Z7YA 3L7CA 2CUKA 5KYNA 1KTIA 3ZTTA 2P2DA 1UK9A 4INJA 1VMAA 5FTWA 4DXAA 1RI1A 4U7FA 2JFQA 1EGHA 2O2CA 3N74A 2YWDA 4H7EA 4K2HA 3ZE1B 1O0BA 1J1ZA 3PLNA 4NS4A 3I62A 2NTYC 2AW5A 3M82A 5EZ6B 2RHOA 4GBGA 1FCJA 4TT3A 2VJNA 2PSSA 2VJLA 2HDNB 3QLVC 4IL5A 3V7YA 2A1IA 1ZU5A 3CO0S 4BQFA 1H23A 2CF6A 1Q2UA 3T7AA 2GPWA 4M99A 1E5QA 4ZK6A 2XTMA 4CQLA 3WRXC 2UVDA 2WWWA 3D2AA 3EDRA 4UPDA 4GMGA 4TMXA 4J1TC 2C9YA 2CXUA 3O74A 1D9ZA 5JCJA 5BSFA 2OCBA 1E8DA 2AJCA 3AUYA 1V26A 4W1SA 4R2LA 4CM6A 1LDEA 2HBYA 5JAMA 1Z47A 2F2TA 1LBTA 3GJ5A 4O02B 3HBMA 1FF9A 3FPCA 4MP3A 3D3JA 4NPHA 3R1IA 1PV2A 2Q9UA 5KSPA 3ZBQA 1GCAA 4E30A 5MN5A 3KB8A 3EULA 4B7AA 1DKPA 2W2KA 4YQYA 2EFYA 4LTMA 2CMHA 2CKMA 2Q4RA 4RPHA 5ALHA 5K0BA 3EJ6A 4IUBS 4NC9A 5FUYA 1ACLA 1DOZA 2QRHA 4EJSC 4QFMA 1A9PA 2BZSA 4PQGA 3MJFA 2GN8A 4R41A 5K3AA 1E2NA 3SJ7A 1M6YA 4A0GA 4C6TB 2IIBA 3EMVA 5MHTA 1RPNA 1WTAA 1NVEA 1ZCZA 4HQOA 2HF8A 1MMFB 2EU8A 1ISMA 3I8SA 3IP5A 4HWPA 4UULA 2VJDA 3U7IA 2GJAA 1Z37A 4JASB 1L5KA 2VHCA 3VKWA 4O59O 1F5NA 3CXRA 4NU6A 4IIYA 4RSHA 4MCJA 4TT3D 2PLFA 2Y92A 4IXMA 2VO1A 2GXSA 4WBNF 5BQXA 3L8ZA 3DZKA 1ZI8A 2VXCA 3HBJA 2BCEA 2ZRKA 1ZONA 3TTUA 3N0XA 3CBQA 1DTSA 5DLEA 3UFBA 2UU9B 3URMA 5LIRA 4DV1B 3ZCRA 5EMJA 5JCJD 2I6SA 3RYHA 3S2SA 5C52B 1ISGA 1KS9A 2J46A 3VOSA 3FCXA 4CMCA 1I2MA 1YONA 4M89A 4P4SA 4PV7A 1QJ4A 5AQ1A 5JNTA 2ZBEA 1L4MA 2G5CA 2HA4A 2JARA 4FJ0A 2Q5EA 4OPMA 3RARA 3PGKA 3DLBA 2WKPA 3DZGA 4GHWA 2HNAA 3MRXA 3THYB 4QPPA 1OAAA 1KYXA 1U9YA 1WDTA 1PJQA 3BK2A 3EMDA 3HFGA 3LRTA 3PNQA 1K7EB 3ZHSA 2IX3A 1X15A 4LX0A 3HCOA 1WHSB 1IPHA 4U2KA 3EXIB 3RS4A 3T41A 4DMUB 3G2MA 1SWVA 2GCNA 3EFOB 1I4OA 4QRDA 3QV2A 3RK4A 4JP3A 5C7LO 1AZWA 4C5BA 2HZ7A 3VC7A 3VKGA 3NFYA 4OGKA 2FW8A 2OTCA 3H65A 4MO2A 2D4HA 821PA 2XQGA 2NTNA 4D25A 4P36A 2MMGA 4ZOLA 2QUIA 1J1IA 3ESRA 4X8MA 3KTFA 1OX4B 5BRJA 3ADOA 4OGWA 3H18A 1Y63A 4WZBB 1FOEB 1AA6A 2ZRCA 4N01A 2PT6A 2YNMC 5KAPA 1JBKA 2ID9A 2LTAA 2W7TA 4RVNA 1AKRA 2AN1A 2XMBA 1GZ5A 1M1ZA 1X3LA 2Z8XA 4XIIA 1JFVA 1K4MA 2GCEA 4AG6A 4AO7A 3SR3A 4B6FA 2W2NA 5AKLA 3TKAA 4A2WA 5C7OO 5KTSA 1UODA 2YC4C 4UHCA 4AC9A 1YHYA 4CMIA 1KDPA 4RQAA 2FFBA 3U1VA 4BRWA 1ECPA 4RAQA 1Z2EA 5ARCA 1F12A 3Q3GE 5FUWA 3ZKWB 2VQEB 3U81A 3OD1A 2YC2C 3O4HA 2FSIA 5D3ZA 1PT7A 1I5OA 3LQ2A 3A6DA 3GAZA 4QM7A 2ECOA 5BSKA 4QLBA 1R4ZA 3OIGA 2G63A 1XV5A 3JTEA 1QV6A 5AICA 2VQFB 2XB2A 1S8AA 2IUTA 3QLUC 1UMDA 4CMBA 1WUIS 4AMZA 3AIMA 2JAPA 3SGLA 4B3FX 3NH9A 3LY9A 1V1RA 4ZI7B 4B34A 2O2GA 3GIDA 3HB1A 3O2NA 1J5PA 4XDZA 3NKFA 4XJVA 2R8OA 4XQ0A 3EW9A 4HDRA 2Q28A 2MINA 1U8YA 1MOQA 3SG0A 3EXFA 2W6MA 5KKNB 3SPXA 4DCPA 4E32A 4J7UA 1RWQA 2GJ9A 4V2UA 4L02A 5C4MA 3CE9A 5ILQA 4F6RA 4QDZA 5IKPA 3IEMA 2GN1A 1NJ5A 3HNRA 3CR8A 3D7MA 3EGEA 4HQFA 2QRVA 4CKBA 2IDKA 2QLNA 2DJ5A 2RGWA 4EUEA 1FQWA 3B8EA 3P5BA 3TLEA 4BNWA 1UXGA 3RNOA 1EBFA 5FL3A 3PQ2A 4FINA 3E1SA 2JB9A 3KV1A 1O5OA 4Q9NA 4ENQA 5IJ0A 4P84A 3T0FA 3VNUA 1KR2A 4FC7A 1GSHA 4JUFA 3ZVRA 4H6VA 1P9OA 5TQ0A 1CZRA 1U7HA 2GA8A 2PZKA 2UAGA 4LDAA 2PLRA 4DSUA 4RX1A 4W6ZA 3PQ8A 1XNGA 1V8ZA 2K7ZA 5LP6A 2HHCA 2QAGC 1MJHA 2YZ2A 1R0ZA 4DBLE 1EJBA 1B7GO 1DTWB 4AD8A 5CYFA 4RL4A 1XZBA 1HOTA 2D00A 4MP6A 1SAYA 1ZK1A 5H9VA 3KEFA 1RSZA 1YHZA 2ZTVA 1UPFA 4UHEA 3UTDA 4BQOA 1TDJA 3OA0A 4IFIA 3TGWA 1WKVA 1TK9A 4F3TA 2BMJA 3D4IA 3D64A 1IG0A 3P9SA 1E7SA 3GLFB 1C7EA 1NBMA 1TZ2A 4D41A 1DC4A 1V37A 1NL3A 1KL7A 1QMPA 2YFYA 1L7MA 3T9CA 4FOTA 4HDNA 1AK9A 2WJ6A 2PG3A 1C7ZA 3A6EA 3ZHCA 1PE0A 4IIEA 1MRSA 2YXNA 3RVRA 2H51A 2VSQA 4TGLA 3NIFB 5FLXA 1S8OA 1ZSVA 2BF4A 1U8ZA 2B3DA 2IYNA 3E7XA 2OGWA 2PKXA 1P1FA 2VJYA 2MSCB 3F8WA 3M33A 3OMLA 1RC0A 2IEYA 3OG9A 3PTLA 4LWOA 2Z6VA 4URZR 3VTAA 5B7NA 1M10A 5G53C 4OU5A 3HFRA 4AY2A 1PN3A 1P1IA 1FB5A 1UXKA 2F3PA 4CIXA 3HRKA 4LHXA 3DMFA 2BFMA 1A9ZA 2DEUA 1PAUA 1J2UA 4OXXA 2IE8A 4CEHB 3FTPA 1PSWA 3B1ZA 2FSFA 4WDQA 5CHEA 4WKOA 1TM3E 1NP6A 3DPIA 2UVQA 3PXUA 3H42B 3TS1A 3FNBA 2VA9A 1YS6A 4HV4A 5HKKA 4P5PA 4YFYA 1GV0A 2HMTA 4R7TA 2GERA 5J23A 4K86A 3MWKA 2WM9B 1QTRA 2BUAA 4IILA 5F1OA 5JOQA 1U8EA 4YRZA 3DOJA 3DVQX 2H1IA 1V3VA 3R6WA 3Q1KA 4O4LB 2A5JA 4D4JA 3ZK8A 5THQA 3KT3A 3DQPA 3GDOA 2IUFA 4JP1A 4CYMA 5HKAA 3MCWA 5B1HA 5DYNA 1JG3A 5CDGA 4JYAB 2ZG6A 5FOWA 3UEOA 5CA1B 5IH7A 4B8YA 1T3HA 1ONSA 2JIMA 2LDBA 4Z49A 3G9ZA 3AKDA 2GZDA 3ANLA 3KUUA 2FSVA 3HYNA 1WSBA 1CZHA 3P0RA 3QZUA 4YAJA 4QGBA 4CG3A 1TM5E 1M73E 4L9WA 4D0GA 1F4PA 4Q1AA 1V35A 4KQHA 1H2HA 1HFJA 2GD6A 4P54A 3K0HA 3TOXA 2C57A 2H5LA 5HBGA 3RVDA 5LXTA 1KI6A 3DCNA 1WUTA 1EGQA 4YDRA 2Q2QA 1U8TA 2EZ4A 4MYUA 2HL6A 5E4JA 1VECA 1NW4A 1OE0A 1P9RA 2RH9B 1QP0A 4ZEOA 4FZRA 5I8PA 3TZ6A 4EFKA 2CFOA 5IAJA 1ONOA 3E5HA 2FRDA 3E9CA 2X4LA 4N6OA 3L8MA 1NI4B 2GN2A 4LNHA 4WFJA 1XMOB 4FGLA 3TDKA 1P1RA 5EMHA 5CLQA 3VU0A 3JZAA 3KLBA 4EW1A 2XE6A 3PFNA 5EKDA 4EGFA 5KKCA 1KEEA 3AEKB 1NSFA 1THZA 2B9EA 4LGVA 1FFHA 1H6AA 1V3UA 3IUPA 2YDXA 2GO7A 4RK0A 1XMJA 4X93A 4RMNA 1A9TA 3NB0A 3MMZA 3TX2A 3OEWA 5E3HA 4O4IB 4MX8A 1TW2A 5JALA 5P8WA 4B3CA 2MYUA 2HW8A 5FCDA 1Y3AA 3M3HA 2BBTA 3CMCO 4KQIA 3W9UA 3GUYA 4HGZA 3ZIAA 3WLEA 3HI4A 4D44A 3FPGA 3OP1A 2FMIA 5B57C 4EQZA 5J2TA 2C98A 2HLHA 4QPCA 2ZRBA 4LSMA 1EFTA 1QORA 2IY9A 2J0UA 4JCOA 4A0QA 4AB1A 3K53A 4NFHA 3RAFC 4AZ0A 3SBOA 1UP4A 1ZK4A 4XASA 1UBKS 2R7NA 4BQPA 1YD7A 1ULBA 3UT5A 1NUAA 4D9JA 2MSLA 3IBYA 1BH2A 1Y8RB 2XGGA 3EZNA 4D6YA 4B6RA 3DDUA 2J6IA 3QOFA 3T34A 4W5QA 1X13A 2C7GA 2I4TA 1Q77A 3JALA 4GRAA 4FCTA 4N0MA 1X1EA 4R2KA 3T7RA 2O8EB 2HIHA 3R6DA 4W63A 3R5KA 1PIWA 1F0NA 3K0FB 4O2AA 2QP9X 5FNVF 5L3RA 2BGGA 4NBSA 3RAPR 2R1UA 3WDKA 3LBHA 3S5JA 3K6SB 2I7XA 2PNJA 1QH0A 3LUGA 1CY6A 2BI7A 2R8PA 2JK0A 4W1RA 5C31A 2R0QC 4MEAA 3R7FA 1E18A 5SY6A 4O2BA 1W9HA 1XJQA 3D4OA 3EGDB 4Q3DA 4HQRA 3TKLA 4GKJB 5B3JC 4GRDA 5HDBB 1YIOA 1VPVA 2XMSA 3ZOKA 2XYRA 5IMBA 1JFFB 1CUXA 1YGYA 2FQYA 4LFAB 2J3KA 3BICA 4XSHA 4ZJYA 2O3TA 1X94A 2VDNB 4V0SA 2IYPA 2LKCA 2CJYA 3MT9A 5FOXA 3ZIAD 3COJA 3QPCA 5EIWA 3DZIA 2EX4A 2H1HA 1CUUA 1KXJA 1VPLA 2P68A 5LBIA 1N2CE 4OX9B 4I4NA 1JZSA 3NOXA 2DBVO 4G9BA 4MB2A 2GXAA 3HLYA 5TPWA 2QB5A 3BYZA 2QTVB 3MBIA 4FILA 3L0CA 4LJAA 4DEVA 2ZT5A 3SN6A 1C9YA 3DAOA 1ZMXA 3G2IA 3U7GA 2EF0A 3G2NA 3IODA 4RSGA 5DLYA 5U1PA 3RFVA 4L73A 2RHGB 4PSUA 3IVAA 1MQ9A 3QELA 2JFGA 4YYEA 2BF7A 2IT1A 4COKA 2X5KO 3DBLA 4HZIA 4Y7CA 3TLCA 3RKRA 4DW8A 3PK0A 1MJGM 1V25A 1G4HA 2QTZA 3B2QA 4X91A 4E07A 1TO2E 3F7NA 4L5JA 1LRLA 3WQQA 2WB4A 4TS4A 5JZ9A 4J03A 3VPAA 1SKAA 1Z39A 2FSPA 1XVTA 3HU5A 4NFYA 4WXYB 4FWTA 3PV0A 5FLYA 3UXYA 4R9VA 3MCTA 3GZTB 3IP9A 4BUCA 2Q3MA 2D6FA 2H4XA 5DN6A 4JA0A 1YBFA 2C94A 2WWFA 1NPYA 1KDZA 1OR8A 1M2EA 3VOAA 2JLUA 3WWPA 1F7UA 3K0BA 4HNQA 5E2AA 4H1TA 3HJFA 2B6NA 4KIFA 4GX2A 1N32B 5DJ5A 3DE3X 2V9PA 3U19A 1N2IA 1DLJA 4GM0A 4RNDB 2B4YA 4POAA 2OCGA 2C7BA 3HJGA 4C2AA 4OOFA 1FNNA 1R9JA 1BW9B 2VZLA 3TD9A 1XZGA 4TTRA 2MR6A 3IKMB 5K6AC 2HAEA 3QSYA 1QQ7A 3GFPA 2QVXX 1KQOA 2QU7A 4FE7A 4Q05A 3RQSA 3TFWA 2FFQA 4CM9D 3RS7A 1OJ7A 4Z1OA 3OT5A 5K8TA 5CPFA 2JGFA 4U2CA 1YOVA 1A95A 5KC8A 4B6PA 5K5EA 3N2YA 3ZW8A 1G8YA 1HT0A 1Z0JA 4MIKA 4F2HA 1LBEA 3CZPA 1TPYA 1PG2A 3WBFA 3G0GA 3V4OA 5LBUA 1PG5A 2JIOA 1A2KC 2RK3A 4OJYA 1U28C 3CUUA 5HCNA 1V7QA 3D7KA 1VB5A 3F3KA 4CR7A 4ZANA 1PJBA 4YT8A 4YDQA 4G81A 5BQPA 1FNCA 2O2SA 4BFSA 10MHA 4H7KA 5DN6D 4JBNA 3OOWA 3ZDBA 4FCCA 1FX1A 4MP8A 3GB9A 1K8RA 1WO8A 2J9GA 4GQAA 1Z2OX 4IIHA 4UAGA 3KYDB 1SZJG 1JMVA 1L1EA 3MS2A 3JQ7B 1QHFA 1EE2A 2R8BA 3ESZA 4UXIA 5HF9A 1TMYA 4P53A 1QGUA 4C08A 5F64A 1OBOA 4GBED 4FBMA 1GFZA 1V2GA 3G0CA 5K03A 3KJNA 1TMGE 2DY1A 2V5VA 3I05A 4NOLA 2XVZA 1JPVA 1QZUA 1NVVR 2VDLB 3BJEA 4X7RA 1E5LA 1G8AA 3DT9A 2OUIA 5CIQA 5LB4A 1FEZA 5T4HA 3SYRA 1DKRA 4BJ5A 4AKHA 3PE6A 4ADSG 5HPYB 1QTIA 4WUVA 1FSGA 4K46A 4PBTA 1T6NA 1R12A 3SXJA 5T3UA 3KL2A 1XP5A 2JGNA 4C04A 1T36A 3L07A 1SC9A 4ND8B 1E6WA 1U7WA 3C48A 4FIDA 2ZYUX 4PAGA 2I91A 4RM3A 1RDFA 1FXUA 1G8HA 3O90A 1BX1A 1PR4A 1CJBA 1AHIA 3JVVA 4N0DA 5C51B 3HXQA 3ZCPA 1JFLA 1XT6A 3CBGA 4RA9B 5TF4A 3R8XA 1B6RA 4IHAA 4ZHQA 5LL6P 1JDUA 3PIDA 1V3TA 2G67A 3LKZA 3P71T 1J06A 4CQMA 1DJLA 4NPAA 2GHIA 2PX4A 5FHQA 4CG2A 4KYVA 5JLAA 2Z1NA 1IFXA 2EXXA 5KNBH 4WOCA 1FDRA 1VTKA 2HV9A 4XX0B 1KOJA 1A2BA 5DTEA 1U8AA 2WKSA 4GX1A 2IYZA 3HP4A 1Y1RA 4BLOA 4EUKA 1GL3A 2O3RA 3EQ9A 2WYWA 1I2ZA 4OHBA 1J7KA 3NCTA 4K6HA 2LGJA 2XHEA 3OZXA 4MLCA 4K5QA 4QJIA 1U0JA 3TRHA 5C5IA 4KXVA 4MR7B 3VX3A 2X8LA 1KEZA 1PV1A 1YZ3A 2NZXA 2RG7A 3H8VA 4OH1A 3RYIB 1JXAA 3VXKA 2QUAA 3I5XA 4PG6A 5A0VA 4WXPA 3LLSA 4Z54A 3VH4A 1Q0ZA 3C6MA 1QHGA 4BNHA 3OHPA 1N5DA 3RIEA 4FGSA 1SXIA 3RRFA 4MJLA 4V24A 4F0JA 1VDMA 3INRA 1GIAA 2ILTA 4KK4A 2ZUVA 3N2EA 3SEQA 4DHWA 5JSZB 4EG4A 1G21A 2OWDA 2R62A 3ABRB 2R4UA 3K70B 4CQMD 1Z6GA 3LUPA 4UHKA 4YJGB 1SVSA 3Q3JB 4ND4A 3NT4A 1XX6A 1NR1A 1SPBS 2BKEA 3FSRA 2V7BA 4JYCA 4KIJA 5FV4A 4YJ2A 1GKYA 5EJMA 2HBQA 1VPTA 3I3SR 3BB1A 3GA5A 3ILHA 1H66A 5COAA 4R8KA 3KDSE 4FUTA 2YWEA 3ZE8A 4UMVA 4PNEA 1MAVA 1EH5A 2MSNA 3LC1O 5BURA 2PU5A 1WDMA 3FCUB 1QPBA 4S1TA 4U5XA 4GOMD 4AUEA 5GJBA 3IDAA 2JCYA 3AR5A 1Y6FA 5LOVA 1H0HA 4JENA 3DEYX 4UAUA 4YCJA 2GPAA 1ZEJA 3KWJA 1RACA 5BO5A 1FW6A 3DXYA 1GTRA 1DBIA 2QRKA 2Q2VA 2O23A 5CDYA 1MO2A 1NLZA 1PJLA 4ZA2A 3WV4A 3Q0IA 2CC2A 4CKYA 1ESEA 4KXXA 3LWZA 3KZ1E 4R1OA 3FZGA 4DTCA 1BU5A 1QGZA 1WMSA 5CXSA 1K7FB 2IXGA 3L6UA 2JGDA 3SHVA 3O2JA 6CHYA 2QL6A 3PZRA 5BSGA 4Y7DA 2WP0A 3JSXA 3UUGA 2QPAA 1OY1A 1U0LA 3OFJA 4D81A 1DL5A 5BSVA 2PKQP 3G2HA 2ASEA 2IU0A 5BW6B 4OATA 4JJ8A 3AVUA 1JMYA 1R37A 4NX2A 2J5XA 4BIMA 4KFRA 2WTMA 5A71A 1UXOA 3PFFA 2IODA 3NTRA 1QH1A 1RP7A 1UPTA 3GCGA 3NM6B 4NXNB 1UBTS 1YWGO 1GTJ1 3PIIA 4UUMA 5DP1A 1CY7A 1DOAA 3GV0A 4DCJA 4J90A 6REQA 2GEBA 3H6KA 2ARKA 2UZ3A 1PK8A 1AC5A 3SY8A 3RU7A 3ORYA 5CK4A 4TMTA 3FSEA 1E6UA 2VNKA 2D0OB 4H7HA 1F2TB 3QU7A 5HFJA 2IXBA 1N6IA 2RGUA 5JWHA 4DDHA 4P7KA 4D8XA 1VPDA 2HRRA 1SVNA 4JC4A 1GV1A 4KJZA 2XVXA 3K32A 1FS5A 1L0BA 3TQRA 1GPWB 1CV2A 3MTJA 3V4ZA 4EJFA 1EESA 1E61A 5K0EA 2IZ6A 3OFSA 1NDQA 1J2RA 1XRLA 1EFPB 3F9RA 3PT5A 3AU9A 1DQNA 4ARUA 3O4JA 2FDXA 1RT9A 4WTOA 3H8SA 4FR2A 1BYUA 1TA0A 2GM9A 4A23A 1H94A 4MVJH 4GMHA 4A0SA 4MS1B 2H8GA 1PD1A 2D4AA 2IYRA 4MRMB 2Q7DA 2YIDA 3CZCA 4CF4A 4MNTA 3ZBTA 5J58A 3L93A 4RE5A 4D0RA 4IQGA 4PZAA 3GT3A 2KMLA 4JKYA 2RFLA 5B37A 3Q2IA 1JQKA 1HBJA 3TD2A 4E2ZA 5CCBA 1IYZA 2B3TA 2WU3A 1HH4A 5FD8A 4LOLA 2V6MA 4FLMA 4XARA 4CF5A 5F78A 2A84A 1C4OA 1QO7A 3I2IA 3FN4A 3BDVA 2OBYA 4F9FA 2FN7A 4DSOA 4W9NA 4ZYXA 5COQA 1XSEA 5AVKA 4B44A 1PNOA 3DBRA 3HRHA 2CDRA 1QB8A 1QKJA 2F48A 2O4UX 3D54D 2Q0SA 4IFTA 2X13A 4LISA 5BQ5A 5EHXA 4KFCA 3HXOA 1A97A 1JE1A 2VOJA 5ENVA 1C3XA 2AHRA 2NQTA 3WV5A 2AFIE 4QJBA 1YTUA 4HQ6A 3S2IA 5ILGA 1I01A 5MF6A 1RBMA 3IBFA 2WDPA 1K97A 1UFQA 2D0DA 1YNOA 3QVXA 5AMXA 1NQXA 2QP4A 5DI3B 5CM9C 2BN4A 4UPVA 5REQA 1HE8B 1MC4A 3V2UA 3TXXA 5A03A 3D81A 2YMMA 4IDAA 4INOA 4J07A 5BOSB 1OBVA 4HS9A 1EP9A 4LXQA 4TLMB 4UVEA 1KYQA 2VHWA 3KTOA 4MVJE 4YLYA 2IZZA 2XVMA 1MEEA 1SOAA 4OA8A 4N1AA 2AZ4A 3I4FA 3EIOA 2DLDA 1YB7A 4GLLA 3DNFA 3TJRA 1ZW6A 5KOYA 2Z8ZA 5JS6A 2AR0A 2PUEA 4QTUB 3W06A 4BVHA 2G06A 2PKEA 4NEQA 1D2RA 1KZGB 2AK3A 2PN1A 2KS6A 3G5LA 4INPA 1C9DB 3DT6A 1HDGO 3TNDA 3W2FA 4DCCA 3WQRA 1G6HA 2E4YA 3FGZA 5E8JA 1Y3CE 2OMKA 3N8HA 2FY8A 1EIZA 1E5XA 2P7IA 4L4XA 4J4TA 1L7DA 5DCUA 3WGOA 1B3RA 1W35A 2CXSA 4YUZA 1RWBA 1W8IA 1Z83A 2VNSA 3HI6A 3Q6IA 3QTTA 5CW2A 1GD1O 3UGQA 4KXMA 2H4HA 2NU6A 2OC4A 4KTVE 2O3QA 1X1DA 1YZTA 1ATZA 1KZ6A 3OZFA 4X63A 1KAQA 3MWEB 2VNIA 5HQ3B 2HH9A 1T4BA 4RU1A 1O6GA 2RK6A 4Y0NA 1OH5A 4Z0NA 4YRJA 1FTWA 3GEEA 4IXNA 4WNAA 1MEJA 1Q3KA 3JQAA 2PGJA 3NVAA 3O3OB 4XB1A 5ECGC 1MABA 4Z0PA 1AHNA 3ZK9A 4QPDA 4X41A 3DTTA 1KQ3A 1J0CA 2CMGA 2OCIA 1SELA 4HDQB 1XD2A 3ADKA 2XJ9A 5EFOA 4KMSA 1K8YB 4P1ZA 5BN5B 1QQAA 3GROA 3T1QA 3TG2A 1QLHA 2A67A 1N25A 4B09A 4BXOA 1DKLA 2QDKA 3LX4A 4DM7A 4TYQA 2ZANA 4A2CA 1NUHA 3NTXA 4FZJA 5HFNA 2OD7A 3AJDA 4AKSA 2JIZD 2C4WA 3EGCA 4M0MA 3DTVA 4ROTA 2PTGA 2WWVD 2C4VA 2Q99A 1XYVA 1IHUA 2JBAA 4G5YA 3G2JA 2Q49A 4F12A 1OFVA 5BWLA 4HRYA 1O0SA 4G0MA 3LXXA 4KEAA 3CZRA 3KP1A 4TV8A 2ODQA 1RJGA 1GILA 5E6RB 3V8PA 3PC8C 3MQFA 2EIXA 2QSUA 3O0TA 2WD8A 3AVVA 4NZOA 3LY5A 3TLYA 4IIGA 4DR5B 2WWTA 5ECYA 1L5VA 1S3IA 4Q4DA 1OLXA 2O4CA 1HDYA 2JBHA 3RIMA 4V1CB 4Z1MD 1XEFA 4X5OA 3IKTA 2P3SA 2VDWA 2HGZA 2VTDA 3ECCA 3JQAD 1QWOA 1MZVA 2C5AA 4XWOA 2JGAA 3U17A 1U0SY 5KCZA 4MICA 1ZJJA 1IQPA 2WSSD 2OV4A 3KE9A 1T1RA 1L5FA 1QSGA 4FHFA 1QCDA 4L5YA 4Q4HB 1JJVA 1WMDA 4EYSA 1JNYA 4RV5A 1SXQA 1G59A 1S2OA 4D0NA 1L5HB 5TB5A 3W5SA 1TCUA 2B4QA 1PR3A 1JEYA 2DLCX 3S2FA 3OQ1A 3F5MA 4I5IA 5LZ9A 3BXXA 2NVWA 2FW6A 1JYFA 4MEBA 4Y9TA 4ZWNA 5I7AA 4A9AA 4OBXA 2B2NA 4MTCA 1TD9A 2F1OA 3FI0A 3OCVA 2CKDA 3L8FA 4EMBA 3IKLA 2C42A 3I6YA 4G8BA 2CSUA 1OZ0A 2XD4A 3JQFC 5EE3A 5ICFA 4EZIA 4DDTA 1G7RA 1B3BA 1QHYA 3LHIA 3H5AA 4G0PA 1AJEA 4ZCRA 3WL6A 3OHSX 5D5HA 1IHDA 1WIWA 3AI3A 1U2GA 5D86A 2EF1A 3NHPA 2H1CA 2RHWA 2QR5A 3AIOA 1I4DD 3QEKA 4UTRA 1SVKA 1NX9A 2C2OA 2YRWA 3SJBA 4COOA 3PUJA 1XVIA 4ZZ2A 4G89A 2HB6A 4YJDA 1JKMA 3A1NA 2E37A 1CEQA 1X7HA 2Q5JA 3M5DA 4V02A 3HE3A 4DMGA 4KMMA 5BW5A 1L7AA 3MIZA 3OQNA 3QF7A 4QFDA 2O7NA 3F4KA 3GBSA 4U8HA 5EYPB 1CY2A 4CCSA 3P2MA 1LSOA 2YJ3A 4Y2JA 4YUYA 6ABPA 4IDFA 4LMBA 3GQVA 4G56A 1HNNA 2J09A 1TUEA 2PRKA 2YH2A 3K30A 3NLLA 3PWSA 3RH0A 1DG9A 4B84A 1X7XA 2F8MA 2NV6A 4P7JA 4MGEA 3USCS 5JTTA 4AJLA 3NUZA 2C4HA 3C43A 3S68A 1XMSA 2D7CA 3NBFA 4G25A 4BX3A 1MO4A 1U7UA 2O8VA 2AEJA 4RZXA 3AGQA 1BFDA 4I2VA 5K0CA 4LVUA 3TBHA 5EE5B 4LYEA 1PZHA 1AMOA 4X65B 3VRHA 4DSZA 4FE3A 3IOCA 4D9FA 3BFXA 4EJMA 1FVOA 3QY9A 4B5KA 2WHPA 2DGDA 1WHSA 2C5FA 3W2EA 4N7BA 3L6CA 3U7RA 3EXIA 3DL7A 3MT0A 3EFOA 1AUPA 1MGOA 1URPA 3KKNA 3WWEA 2AYZA 2PKYX 4Y2HA 4BJ6A 3BWCA 5JEEA 1KU0A 1Q19A 5KOJB 1V11A 4A0RA 2ZVDA 1G9TA 1T9KA 2WAOA 1V8BA 4FEEA 1HRKA 5DW0A 4ROSA 5F12A 4MWSA 3MLEA 3VZPA 1XKQA 1EFHA 1Z6QA 3NBXX 1JR4A 3EG5A 3PL5A 4LXIA 3M6FA 4N5MA 4ZJPA 2XGJA 1LRJA 2HTEA 1YRHA 3KQPA 5GAJA 3DMRA 5KSWB 1T1EA 2QJTA 3OE5A 1HE2A 3H97A 3TOVA 2DPLA 4JODA 2WU4A 5C34B 3ITDA 1IAVA 4YRFA 3KQHA 1WB4A 5LWHA 3E48A 4M1OA 2FR8C 1NVTA 2BDTA 2OHFA 2QG4A 4WN3A 1RYBA 1VYVA 2H1RA 3Q0EA 4C14A 4CW7A 1K98A 2A9OA 1P5HA 2VZEA 3BRQA 4E2YA 2GPNA 3PFWO 4RK4A 3A37A 5EJ7A 3KUXA 5SV2A 1E1CB 5D6OA 3ZKWA 4R40A 4HYEA 2F00A 2BR3A 2OBFA 2RJ3A 2B1IA 4L50A 2GCGA 3OLWA 1UM9B 1T6BY 1J70A 2ETVA 3EVGA 3IXLA 2OO3A 1X42A 2JANA 1TQ4A 3JQ9A 4J9UE 4WOBA 4ZCLA 4B0OA 3L43A 3LO5A 4ZVRA 3EYWA 1Z22A 2I6XA 4Y9RA 2GN9A 4K88A 2H17A 3UOAB 2YOHA 4L57A 4BEBA 3C3YA 3H1BA 4YV0A 3K8OE 2BL4A 1U98A 3AEXA 2DUWA 3KE8A 4IVQA 4IHJF 4MKFA 4XQEA 4ZD6A 3U1TA 4F7DA 3IAS6 4NL4H 1HYEA 4XTCS 2GX6A 2JRLA 2VP5A 1ZVKA 2JS7A 4KRYA 2C3UA 3PD0A 4NBNA 2WQZA 4CE6A 3P96A 3IVCA 4PN7A 2OZPA 4E7PA 4F97A 1KVTA 4KLCA 4BUZA 4HKTA 2NYAA 4HNTA 1W5TA 1XYGA 2BJWA 4HB2A 1LFDB 4M1QA 1BEUB 3BBLA 5EQJB 1XNHA 1ESMA 3LPDA 3UYKA 2P65A 1I9GA 1ZMOA 1S96A 4RGVA 3ZDQA 4PCVA 1SU6A 1ISHA 1PCXA 4MGYR 3FUXA 2HPAA 1W29A 1MX3A 1W94A 2JL1A 1C0LA 1PKXA 2FSSA 2ZYGA 2DPXA 3LDGA 1GPAA 1PEDA 3V8QA 1DAMA 1DUVG 4KQWA 4WCFC 3TAHA 3W6OA 1PS9A 3CJQA 3MOGA 4M0DA 3GXBA 2Y99A 1DJQA 1PR9A 2G4LA 2Z2IA 3MMSA 4I3FA 5AUQA 1YB6A 3RBXA 1KWGA 3HUTA 4JWKA 1XMIA 2DUJA 3O9VA 5AI4A 4ZFNA 3SZLA 7MDHA 4L8FA 4WAUA 3VSBA 4B87A 1HC7A 2V7WA 3M1YA 3SIXA 1SHTX 3UV3A 5C4IA 4DMFA 2IZ7A 4LV6A 3QQ5A 2FJ0A 2BP7B 5JSKA 1YFLA 3R3WA 2HSDA 1YDEA 4QC2A 2H2DA 3N7AA 3RSFA 3BK7A 2ZZMA 2B30A 2YQZA 3ETDA 4MLDA 3NJRA 3OQMA 4N03A 4IUYA 3I6BA 1P2TA 1I3NA 4TQGA 4XDHA 1Y5IA 3GVXA 3KQMA 2E5LB 4JSRA 1BD4A 3M8KA 1ODSA 4C5AA 3GLFA 2R97A 3ZG6A 2G70A 5FUMA 3TGPA 1X19A 1EXWA 3G2OA 4TZTA 3O83A 1H42A 3A1CA 4MV4A 1LF0A 1JDTA 3LGAA 4UKDA 4AWXA 4HTFB 2FXVA 4TSKA 4X7BA 3FHLA 4YTEA 4AJPA 2D1SA 2C7PA 2WFMA 1H6DA 3AF4A 4OCZA 3ET4A 2X5XA 3T9FA 3LP5A 3URKA 2R66A 1U80A 2W6IA 3UJ7A 3OA2A 4UOEA 1SVIA 4KDCA 1Y8ZA 1I0LA 1ZO8A 2PD3A 4LY6A 1KI3A 5DPMA 4PZPA 2CUTA 2IPLA 3QVSA 1QP8A 4EYGA 1SCBA 4YAWA 1Y9EA 3E9QA 3GCWA 3H2GA 2AG1A 1OWLA 4Q24A 1D0VA 3DC7A 4JLMA 4NBKA 5FFFA 4ZCPA 4GPIB 3RGGA 4AF7A 2Z1DA 3DBVO 4EHHA 4S05A 5T8KA 1LTQA 4C05A 4D5GA 1NYQA 1N2CB 3LQ1A 1O6CA 4ZCIA 2VBIA 1T10A 4MMZB 4CL3A 3WMFA 3B3FA 4L9SA 3V2HA 4QARA 1GU7A 4UBOA 2QD2A 5BQ3A 2OAEA 4XVQA 4YH1A 2PXCA 3EASA 3Q3EA 4H7JA 4I9NA 4JEHA 4UHDA 2WABA 2PKCA 3M81A 4NOKA 4O4LA 3VR1A 2F62A 4KXWA 1VFPA 1EM8A 2IXEA 3BE5A 1H1DA 1WAMA 4GC5A 4U0JA 4G6ZA 5FOUA 2EBUA 4TVBA 4MA0A 2JJ1A 2YHIB 3GRCA 3RBZA 2SICE 3G2LA 3KQSA 3GA0A 4JN6B 4QUKA 4MB6A 4F8EA 1IOWA 1YS4A 1D2MA 1CR0A 5L3SB 1CU1A 1R8YA 2JJQA 1FW8A 2R7AA 3X1MA 4BVBA 1W6UA 5AIAA 3BORA 1QE5A 2YIMA 5JS8A 5KIAA 2WY2D 1C8BA 1L4NA 2G08A 3PHIA 2JGRA 4IY1A 4L0DA 3RFUA 3NMUF 3D9QX 3OZWA 3VZCA 2YY7A 5JQGB 1HNZB 3HBLA 2O0KA 4XQGA 1NI4A 1VA4A 5BY2A 2ZPTX 4FGKA 3L4BA 4UZSA 3B5EA 5C1IA 2IYSA 4IUCS 5DNVA 1O58A 1ZSYA 1VCMA 5I8WA 1G8SA 4CM8B 5JMOA 1OB5A 3HZRA 1YZQA 4LMRA 2D7DA 4E5MA 4JMPA 2PWAA 1J25A 4DMMA 3UMMA 1WPXA 3G2PA 2P9ZA 3HVJA 1YRYE 2IYLD 4IXWA 4QEDA 3GRZA 3JWPA 3HWX1 2CDCA 5IC5A 1NX6A 3VVMA 4CLDA 4UD6A 5A6VA 3LWDA 1PDWA 1SHJA 1UEXC 4KDRA 1JA1A 2Q1TA 1A5ZA 3O3MB 4JLOA 4L5IA 4EDFA 4MW0A 1JH8A 3RD5A 1WCV1 5LLDA 4K28A 1MB9A 5KSOA 2RK4A 1TIKA 1G7CA 1RBQA 3DG9A 1Z5NA 2GBLA 3U40A 4O4JB 5KUTA 3IDOA 1TIBA 1VM6A 3CR7A 4Z4HA 1VHWA 3OJEA 4Y6PA 3QMWA 3HV0A 1CEYA 3VHLB 3RFFA 1BHO1 2HGSA 1I7NA 2ZXFA 3LSTA 2ZWVA 4Q1DA 4Y6SA 3EZLA 3BIJA 3OOEA 4ITRC 5FBQB 5I8ZA 4B8ZA 2O8EA 2C0PA 3ZCXA 3WQHA 1ZM3A 2W8BB 4A6PA 2HA6A 2GF2A 3QQPA 4LF8B 5I48A 3A05A 1V8OA 3DB1A 3CIOA 1PHRA 4TVKA 4YRBA 4NG5A 3K6SA 2O19A 3WMXA 2Q9BA 4MGIR 4W5OA 3FH0A 2R6ZA 3AR9A 1FDVA 3R6LA 3M4ZA 5AVZA 1AXGA 2WPDD 1MOPA 4G1VA 2NYUA 1GG8A 1X7YA 3FMPB 4BVKA 1R6TA 1HA3A 3D1LA 4L8VA 3UT6A 1ZJ6A 4C4YA 5H4GA 1FNSA 2IDZA 2OBXA 2HWXA 2PT5A 3RHSA 4C30A 1JFFA 3UOGA 4AT1A 4C7JA 4YCSA 1L7RA 1VCNA 4EQ6B 5BUCA 3MT7A 4QTYA 4PNZA 3LIPA 4X1YB 1ZOPA 1J99A 3O91A 1MO5A 1L3IA 2MSWA 2QLJA 4HBZA 3KYJB 3CPSA 1GUAA 1N6PA 1D4ZA 1N2SA 3QU2A 2Z3ZA 4IDPA 4JLDA 4OQMA 1T9CA 1I14A 2ZJ8A 5FA6A 4CTMA 4YUVA 3JVUA 2GRAA 3PPYA 3QHQA 4W8HA 2PV0A 2O8FA 1NE7A 5IJXA 3RS5A 4DAOA 4JCCA 4YCBA 1Y4ZA 3GIWA 2ONYA 4LOJA 3ODPA 4Q37A 1NR5A 3DCYA 3CRW1 1CKEA 1DAGA 1CC1S 1VPEA 1MCZA 2PRYA 1SK9A 4P7GA 4FYWA 1RWMA 2C9CA 3BIFA 1VSTA 2DPHA 2Z2KA 3UBMA 4FFDA 5TIIA 4JJ7A 4YDSA 4AXXA 2JVKA 1E9AA 1DWPA 1IAQA 4V38A 2H1SA 4J7CA 1XDZA 3PNPA 5JNWA 1NQVA </