4RTRA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and a 5-bp non-canonical site (gttta )
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
244
Chain Sequence
b'KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKPGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 84
structure length 244
sequence length 270
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtrA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtrA01
2GAFA 2NXJA 4RTMA 2QYOA 4GOLD 3GWZA 4M38A 4DCMA 3PB3A 5HIKA 3IYLW 1SKMA 5HIMA 3UJDA 3FUWA 1YB2A 1TPYA 3A7EA 3PS9A 4YV2A 2N47A 4AZSA 4DKJA 2PBFA 4ER6A 5FHRA 1R8XA 1JSZA 1KP9A 4ER3A 2OO3A 1WXXA 3LDFA 4X61A 2BR5A 1RI3A 3EGVA 1G8AA 2CKDA 3M6XA 5E8RA 3BT7A 3A25A 1R00A 1WZNA 2YTZA 3HCCA 3ME5A 5FADA 4YV1A 2PVCA 3FZGA 5GP1A 2ZZMA 2QM3A 3EVBA 3FRIA 3FUUA 3G2PA 4KDRA 1XDUA 2B3TA 4XCXA 2PLWA 1D2CA 5ERGB 2I6GA 3TFWA 2FK8A 3G2MA 3CJTA 5CCBA 2IDJA 3G5TA 3HCBA 4HGYA 2B2CA 1N7IA 5CD1A 5GWXA 5K0JA 1I9GA 1XVAA 2IP2A 5DM4A 3KQTA 3R3HA 1VPTA 2YX1A 5GM1A 4PYNA 4U7TB 5EOVA 3NDIA 4E30A 1D2HA 3DXXA 3EVAA 4E32A 3LHDA 5FWDA 3OFKA 4EMSA 1MJFA 3P8ZA 5KYGA 4OX9Y 3FPEA 4KW7A 3G7UA 4FT2A 5JR3A 3NVMB 3M33A 3KR0A 3M70A 4PYIA 5DXAA 3I53A 4AUKA 2UYHA 2DULA 4X1OA 2NYUA 4KDCA 5P8WA 5LR6A 5EGSA 2IH4A 3HVKA 1O9GA 3B3FA 4RVFA 5CIYA 2PGXA 4DQ0A 4PYMA 5F2NA 5E2BA 5EPEA 2JG3A 1M6EX 3FPJA 1NW7A 2B78A 3FUXA 1NV8A 5LSAA 2ZWVA 5EMLA 2P3OA 5ICCA 5DWQA 5DX0A 4QTTB 1P1CA 4YMHA 3R9XB 3HEMA 4XUDA 3VSEA 2EX4A 3PVCA 1G6Q1 3OU7A 4PYLA 2Y1XA 4PONA 4PYJA 2QE6A 4RX1A 1JTFA 3PTAA 2OYRA 1UWVA 1XTPA 1DL5A 1VP3A 1FP2A 4R05A 2NXCA 1T43A 1KHHA 1ORHA 5K01A 2IDKA 2VDUE 3ER9A 3DR5A 3NVKI 2AS0A 2FRXA 3LECA 5CVUA 1ORIA 3DUWA 3UJBA 3R0QA 3AY0A 2VZ9A 1PRYA 2NP7A 2ZTHA 4YV0A 1RI2A 1FPQA 4M37A 5DRTA 2CMGA 2BM8A 2GH1A 3LBFA 3BWMA 2AN5A 2GLUA 4H0NA 3GCZA 1SQFA 3E23A 1F3LA 1OR8A 1Z3CA 2IPXA 3KR1A 4G56A 4LG1A 3G2QA 4X60A 2XYQA 4C05A 1XXLA 5U4XA 1X1BA 4Z2YA 5BXYA 1XDSA 3GRYA 5IKMA 5LQRA 1EJ6A 2ZVJA 2BR3A 2Q41A 4BY9E 4BP3A 1NV9A 1TW2A 1VLMA 3HVHA 4ER7A 8MHTA 2OZVA 3PX3A 4R8RA 5DTQA 5KVAA 3CVOA 4AZTA 5ICGA 3GO4A 3SSOA 3PX2A 3OCJA 4M36A 5K0NA 1YUBA 3BWYA 3CKKA 3SXJA 3LDUA 1FBNA 3LCUA 3EMBA 3ELYA 3G8AA 3IV6A 1EG2A 2HTEA 3TPZA 2BZGA 2AVNA 4RTOA 2O0LA 2YXEA 4EVIA 1WG8A 3C6KA 2G1PA 3PFGA 2PXAA 3LSTA 2AOXA 4GUAA 1NW3A 3GU3A 3TKAA 2WA2A 1JG4A 4JXJA 2XYRA 4MQ4A 3X0DA 3SVZA 2IFTA 3B3GA 3DTNA 1QZZA 3HCDA 2AOVA 2GPYA 3HCFA 5LQUA 3I9FA 5EG5A 3UJCA 4RTPA 4AZWA 3P9NA 4GOMD 5GOZA 3GJYA 4E2WA 2ZFUA 1G8SA 4PYQA 3VC1A 2IH2A 2IGTA 1FJXA 3HTXA 5CUQA 5B1SA 5EMMA 3MCZA 5GM2A 3EEYA 5K0GA 4IKPA 2ZIGA 1X1CA 4V0QA 1X1AA 2P3QA 1SQGA 5FA5A 2PJDA 2PX8A 3HM2A 4AX8A 2HR1A 4OQDA 2OKCA 2XVAA 3E7PA 3AWIA 3HA7A 4PGGA 5DT2A 5C0OE 4E2XA 3ELUA 3HA3A 5DTRA 1JG3A 4O29A 5EMJA 2AN4A 2PT6A 2UYQA 3B5IA 3REOA 1L3BA 3FPGA 3R24A 3FTEA 3HNRA 3OZTA 5K05A 3VYWA 2QRVB 3VC2A 1V39A 1ZKDA 3MAGA 3SMQA 3KQOA 2HNKA 2ZLBA 3LPMA 4RTJA 3FUTA 5HIIA 3EEOA 2XBMA 3F4KA 1RI5A 4FS8A 1L3CA 4BLUA 2KW5A 1Q0SA 3AJDA 5EKXA 2OBFA 2ZWAA 5E9WA 5T64A 3THRA 4RSRA 1QANA 1QAOA 2ADMA 2PV0A 2YQZA 3UBTA 2Z6QA 5GIOE 1I1NA 2F8LA 3S68A 4QVGA 2BM9A 3DMHA 4BP1A 2C7OA 4IV0A 3BGVA 3DLIA 3OZSA 4HGZA 1H1DA 4OBWA 3CC8A 4E31A 4EKIA 2ZIEA 3K0BA 1JSXA 3P71T 3T7SA 1KYWA 1SUIA 1RJDA 2P40A 4YUXA 4HH4A 3GNLA 3UJAA 3FTDA 4OA5A 2GB4A 2CL5A 3SX0A 3LKZA 3C0KA 4GBED 4KWCA 3FYCA 3FUVA 3KQYA 1VQ1A 4RWZA 5FWAA 2DPMA 2PXXA 4V0RA 4MWZA 5EMKA 1JQDA 3P2KA 3NW9A 3THSA 2UZ4A 3GXOA 3EVEA 3KQSA 4R8SA 5DM1A 1P39A 3UA4A 1NW6A 5HILA 5EEGA 4HRAA 2JHAA 2V74B 3EGIA 3QOXA 3JWHA 1EIZA 2AZTA 4QPNA 3EPPA 1NT2A 3HA5A 2GA9A 3MTIA 5FQOA 1SVUA 4C08A 2ZCJA 3DXZA 1EQAA 1R8YA 1IM8A 2NNWB 3LGAA 4C06A 4DMGA 5JUWA 3KQMA 2O07A 3TOSA 1G38A 3JWGA 2EG5A 3SSNA 1DCTA 4EKGA 3DP7A 2WA1A 4R6XA 1TW3A 1QAQA 4X63A 3KQWA 4Y30A 1MHTA 5DM2A 1N2XA 1XJ5A 1IXKA 1KYZA 3DH0A 3C3YA 3HVJA 3KQPA 5EIWA 4C4AA 5K0LA 5EEHA 1BKYA 1SG9A 2XVMA 5K09A 3LL7A 2VDVE 4PGHA 2C7QA 3BGIA 2CWWA 3H2BA 4QVKA 1RJGA 3LBYA 3LCCA 3OFJA 4RTSA 2ZBQA 3KQVA 2AR0A 5FCDA 4RTRA 2AOUB 3OU6A 3EVCA 3IHTA 1XDZA 3CBGA 1R74A 4AZVA 5DM0A 1UFKA 3KPUA 1QAMA 5KS2A 1ZQ9A 5T6BA 2G71A 2YXLA 3P2IA 4FT4A 5E8JA 4LWPA 5FULA 3GRVA 2ERCA 2ZSUA 1IY9A 1PJZA 2K4MA 2QRVA 3K6RA 1WY7A 3G5LA 2PX4A 1M0EA 3NDJA 3RODA 1JTEA 3LKDA 4DCGA 4OA8A 3Q87B 3JWIA 3T0IA 1JG1A 1NBIA 2FCAA 4C03A 3ELDA 2H1RA 3EVGA 1ZGAA 4RVHA 4A6EA 4BLWA 3ER8A 5E2AA 1VIDA 3E8SA 3G89A 3GRRA 4RYLA 4UOEA 3BXOA 2I9KA 1AV6A 5D1NA 5ICFA 4R6WA 3AXSA 2R6ZA 4RVDA 4DF3A 4IWNA 4PNEA 4F85A 1G55A 5ICEA 3KKZA 5MHTA 4FGZA 3MTEA 3MERA 3SGLA 1YZHA 4FSXA 3CCFA 1R18A 3EVDA 4QDJA 5HFJA 3A27A 3OE5A 1HMYA 4YUYA 5K8VA 3FRHA 5M5BA 5CVEA 2NP6A 5FUBA 5HZMA 2EJUA 2JJQA 2PWYA 3UJ7A 2ZZNA 5F2KA 4GEKA 2PT9A 3I58A 3FTCA 2PKWA 4ER5A 3B89A 3KPVA 4ZTBA 3MHTA 2EJTA 1O9HA 4XUCA 1X19A 3MB5A 3BGDA 2P1DA 3UJ8A 2FHPA 2XYVA 2YVLA 3P97A 2OB1A 4MIKA 1ZGJA 3ANXA 4PYKA 4RTQA 1JQ3A 2AN3A 3UZUA 3R6TA 2P7HA 4P7JA 1AQIA 3Q7EA 3KU1A 3TM4A 3WSTA 1AQJA 2BH2A 3ERCA 4PINA 1INLA 3EGEA 4GQBA 2Y1WA 3NJRA 3A7DA 3DXYA 4HTFB 2NXNA 2VP3A 5HIJA 4C04A 4P7GA 3DOUA 1VL5A 5D1HA 4RTNA 3GIWA 5E1BA 5FA8A 4E33A 5BW5A 3M6UA 3TMAA 3BWBA 2G72A 3D2LA 2JHPA 5DSXA 4ER0A 5CVVA 5K03A 1JR4A 1X1DA 4HSGA 3L8DA 4E2ZA 3KHKA 2ORED 4Y2HA 5CM2Z 1NKVA 4B17A 1KPIA 1JG2A 1L1EA 3PT9A 4QQKA 3BUSA 5E9QA 3TLJA 1EJ0A 2PX2A 5DSTA 5GINE 5GIPE 2R3SA 2BR4A 2B25A 4KIFA 5EC8A 1F38A 2HV9A 4F86A 1I4WA 5DX1A 3TKYA 1DUSA 4PCAA 3MCTA 5CVJA 5T67A 4F84A 1KIAA 5F2OA 2AOUA 2P8JA 3NWBA 5EKUA 1P91A 3OZRA 3TQSA 1NE2A 2V7EA 3A26A 4CTJA 5DLYA 3UJ9A 3M4XA 3ELWA 1AF7A 5HEKA 3V8VA 1YZ3A 4GC9A 5E1DA 4YUWA 5FTWA 3FTFA 1Y8CA 3C3PA 2LD4A 3BKWA 2C7RA 3PLAE 5LQAA 4P7FA 4L7VA 3DULA 3GGDA 3ID6C 3DMGA 4HC4A 5EHIA 3CJRA 2OXTA 3I64A 2P3LA 4HG2A 5C9ZA 5E9JA 3BZBA 1FP1D 1VE3A 2AOTB 3GRZA 3NTVA 2H11A 3E05A 3PFHA 1VBFA 2EFJA 2ONYA 2OB2A 1RI1A 1NW8A 1NW5A 2FK7A 2GS9A 3CJQA 3RIEA 3DMFA 4P58A 4CKBA 4BLVA 2PY6A 1L9KA 1XCLA 1ZHFA 1Q0TA 2OPBA 3P2EA 2NXEA 4QQNA 4WVLA 5DX8A 3T7RA 2PWPA 3LCVB 1R6AA 3MQ2A 2JHCA 4PCLA 2VS1A 3TM5A 1VP9A 4RVGA 5H02A 3G2OA 4QPPA 4QTUB 1YF3A 1WXWA 3UJ6A 4CWAA 1U2ZA 3T7TA 7MHTA 5G02A 5DPMA 1KPHA 5DRYA 4KVZA 3KR2A 3NWEA 2HWKA 2PX5A 3TRKA 1ZG3A 1YFJA 2PXCA 3AXTA 2Z6AA 1UIRA 1KXZA 3QV2A 3FYDA 4ISCA 4M7RA 4CKCA 2E5WA 4PYOA 2OY0A 3JWJA 3UWPA 1BOOA 4HTFA 3EVFA 4GOND 3HCEA 3HCAA 1N7JA 3G8BA 3SM3A 1O54A 3SR4A 2ZW9A 2ONZA 4CXMA 3OU2A 2YR0A 2AOWA 1BC5A 2ZZKA 4NECA 4DZRA 5K0BA 2WK1A 2UYCA 5KQSA 1D2GA 3B3JA 4CTKA 2I62A 4ATNA 4X41A 5C1IA 3KPYA 2IBSA 3GRUA 4P7KA 2ZIFA 3M6WA 2G8NA 1KPGA 3A4TA 4EK9A 3O7WA 5HOQA 1M6YA 4GF5A 4YUVA 4LECA 3P9KA 5EHGA 3OE4A 3DLCA 4YUZA 5EZSA 1RJFA 2JH9A 4K6MA 3FPHA 5CCXA 4KIGA 2HMYB 4FR0A 3NMUF 2P41A 5LQNA 4GC5A 5CVDA 3EMDA 4DM3A 3SSMA 5KQRA 1YFLA 5LQKA 3KPWA 2P7IA 3KPJA 3IEIA 5LQJA 5BP7A 2IBTA 2I7CA 3KR9A 2O06A 3P9CA 5DXJA 1RJEA 4PIMA 3O31A 5BW4A 4XUEA 1P1BA 3MGGA 2ZBRA 3TR6A 4RV9A 2YXDA 4YMGA 4MHTA 1B42A 5EZQA 1RI4A 4PWYA 3P9IA 3BKXA 2H00A 2YUIA 5FHQA 2Z6UA 4RTLA 2JH8A 2B9EA 3HVIA 4CKEA 4FZVA 9MHTA 3HP7A 5LQCA 2AOTA 3BWCA 4FSDA 5K0FA 4QDKA 3B7PA 3UFBA 3OPNA 1NBHA 1EAMA 3LX6A 5EQJB 4A6DA 4DA4A 2O57A 2ZULA 4KRGA 5EVJA 2FYTA 1G60A 2O05A 3QOWA 4WXHA 3UA3A 5K0CA 4E2YA 5E1OA 2IIPA 1WS6A 2A14A 4U7PB 1XCJA 5E1MA 2C7PA 1L3IA 3RW9A 1KR5A 2ESRA 3C6MA 3LDGA 5K0EA 4GOOD 3CGGA 4POOA 3G88A 2PSSA 2QY6A 3U81A 10MHA 5EIFA 3GDHA 4FP9A 1SUSA 1BHJA 2G70A 2IH5A 4E70A 1JQEA 3EVZA 4C07A 3ORHA 1HNNA 2AVDA 2CMHA 2ZBPA 4LWOA 2FPOA 5FQNA 3I5UA 5IH3A 4OQEA 4EQZA 4PIPA 3KQQA 3V97A 2P35A 2UYOA 4IV8A 5DTMA 4RTKA 3O4FA 2VDWA 3M6VA 1QYRA 4OBXA 3FPFA 4MTLA
chains in the Genus database with same CATH superfamily
4M38A 4N0DA 1SKMA 3DEJA 5HIKA 3KDAA 3AF5A 1J2RA 5FLYA 1JHXA 1Q44A 1YB2A 1R0LA 3AEZA 4HQFA 1TI7A 1AA9A 2FUEA 2GZAA 4LYFA 3A6LA 4MZDA 3D7RA 4HH1A 4FM9A 2H08A 1F4LA 1NZJA 3DT8A 5LQDA 2NU9A 2QUZA 4KV7A 3G9ZA 1N2OA 3FNBA 3LDFA 3O91A 4WKBA 1NM5A 1DLIA 3NEYA 1SKQA 4E5VA 4CFSA 3EGVA 3LOPA 3KCNA 2GM9A 3E3NA 2ZXUA 1O9BA 1E3SA 4AUEA 4BRSA 4EKDA 1VJ1A 3OJEA 3CM0A 5FADA 1TYDE 1VE7A 2HLPA 3KRTA 4YAIA 3CSUA 1YRAA 1L1QA 3WYBA 5CAEA 1KJNA 3GT7A 1NI4A 4ZO7A 4B7CA 1IPEA 1BGXT 1C1DB 2OVBA 2Z4SA 2ODTX 3QTLA 4G0XA 4BQNA 4O4HB 3RUIA 3TTUA 1DG9A 1P2DA 4I4TF 4MWCA 2C96A 2Q28A 2VYQA 2GEJA 3DBLA 2X3YA 3WB0A 1U63A 1U0LA 3K9BA 3AL0C 2RGNC 1C7IA 1ULAA 3RROA 2VHJA 1FNBA 1FMCA 2J6IA 3AONB 2JFYA 1U28C 3EFOB 4F6RA 1NVUQ 1DMRA 4A23A 1EZ4A 1EFRD 4QDZA 3A10A 3A6JA 1F4PA 1NOJA 1RTKA 4KW7A 2NT4A 2W48A 3BN3A 4AS3A 1HT1E 4D9KA 1VKHA 3NC4A 3BMNA 1Z12A 3O8DA 3QMPA 1F6WA 2NYUA 4X3CA 5CGQB 3RLIA 5C46F 1HYHA 2XODA 3KO8A 3NDPA 2V7WA 3Q72A 4U8HA 5CIYA 3QEAZ 2C07A 4G5XA 1C9DB 3MWGA 4WXRA 3OJXA 3P1JA 4L2IB 3I6IA 4QDTA 4E5KA 1P3DA 2I55A 2B8WA 2QN1A 3T4XA 4NIMA 5HF6A 5B7GA 1CR6A 1W5FA 4QOIA 4QTTB 4LHEA 1XZNA 4XGQA 4BX0A 4U39A 1WHTA 5F51A 4P84A 4AF6A 1OWOA 1VGQA 1PTJC 3CTMA 4QM6A 4DPMA 1Z0IA 1XEWY 2HTFA 3BF8A 1S0UA 4F91B 1YBAA 4OI0A 2BJHA 1T43A 2YCLA 1G2OA 2VP2A 2OV3A 2QMZA 3OOSA 4QEZA 2B4RO 2ATIA 3DR5A 3K72B 4YCSA 4Q48A 1C2TA 1RWKA 1HE8B 1JIKA 2IKQA 1TYCA 3ABSB 3K6SB 3I45A 3PPWA 4RD3A 3OD5A 5D8DA 5J5VA 5A7FA 4KWHA 2BM8A 4PICA 1CV2A 4URZR 4ZO6A 2HK6A 4O4JF 4IS3A 2P1ZA 1OX5A 2WYWA 3B78A 4UMFA 2C2YA 1T5SA 3HV2A 2J7PA 2OQVA 1P4GA 1ZCAA 3R5XA 4RQAA 2IPXA 1U4NA 3OWXA 4PS0A 1UJ6A 2F48A 1H4VB 4JY7A 3IE1A 2WDZA 1KI4A 4FKMA 5H80A 4D0GA 2PS3A 3OHPA 1C1XB 3B7GA 3R09A 4ML3A 5CBPB 4O4HF 4IUYA 4ZZ3A 4HDOB 1RFGE 2NU6B 1TW2A 2WMOB 2RJOA 3KOOA 4A2PA 5JAPA 4ZVOA 5K3EA 1ILEA 2OZVA 1PGNA 3BQMB 1N2SA 3AKEA 3PGKA 5BQPA 3ZGNA 4C9BA 3U49A 3OCYA 1G20E 3NETA 3TW4A 4M55A 3WQSB 3KTDA 1JPUA 1UBHS 1YRBA 2W2QA 1K66A 4EUFA 1CQJB 1MPXA 1SUDA 3IP8A 3QNWA 2GCOB 3JQFC 2C4WA 2R65A 3LCUA 3ZI7A 3R3VA 4B7UA 1GCOA 3H11A 3RUCA 2FN7A 2WU3A 2YC4C 3DLHA 3NDBB 3MTAA 4LVCA 1FUUA 2G1PA 2HJHA 3LSTA 2FZ4A 3UY4A 1BIFA 2ZYWX 2X9VA 1W47A 4HH3C 2WA2A 4MQ4A 4ZICA 1O6FA 2VJYA 4RVOA 4YP6A 4D0RA 3QPCA 4YBZA 1TZ2A 4ZQEA 3B3AA 3IJPA 3ETJA 3ZU5A 5IT0A 1Z6XA 4IZHA 4JYZA 2AB0A 2QVYX 1WAMA 3CNQS 4E4YA 3HWRA 13PKA 5GMOA 4HLUC 1RQ2A 4PCVA 2LVBA 3I76A 1N1MA 3Q9LA 4JUBA 1B73A 2NPOA 2VKTA 2DHQA 4GXRA 2AQIA 1LDMA 2HJ9A 1JHMA 3RSGA 2PX8A 3B6JA 4V0ME 1A4UA 1FS4A 1NURA 4H3HB 1K2VN 2PL9A 2WM2A 3ZQKA 1A9ZA 1KKLA 2AJBA 1SCNE 1TF7A 3CUWA 3H5VA 2DXIA 4H0CA 5EMJA 1S3GA 2Z30A 3PUJA 1BCRA 1Y9ZA 2XUKA 1I1OA 3KVNA 3R3SA 4Y6QA 4BJ1A 3PLNA 5BRNA 1X3LA 1YDFA 3MQFA 3G49A 1GNTA 3AJEA 4C2UA 2O2GA 2UYYA 1ZISA 4JASB 3DLAA 1LI5A 1SXJB 2A4KA 4KXMA 2HEIA 3GY0A 3HWWA 4S3MA 1I36A 1JJBA 1M66A 2BCGY 3PNYA 4MS4B 4OP2A 2G1JA 3WP0A 4URFA 4AI6A 4A7PA 3RSHA 3Q9SA 1V45E 1DC3A 2CLMB 2PRJA 1CQIB 2GZMA 3DLIA 2VWGA 3FYUC 3GEGA 1M1YA 1UBUS 1XZ8A 2XUAA 2OMKA 2Z3WA 4GLFA 4RZIA 4EGCB 1I7DA 2GYVA 2YWBA 2IV3A 1JSXA 3UPTA 2CMDA 4PIVA 4RJJA 2IP4A 2LKCA 4YUXA 1MH9A 2PKQO 4GR4A 2CL5A 2FP3A 3BAFA 4BRWA 4CV1A 2RK4A 3GN1A 2GASA 3UM9A 3CX8A 1OWPA 2VSXA 1NP3A 1K4YA 3AKYA 5C80A 1V48A 4YAOA 5CMLA 4F8YA 5EIEA 2EFEB 3ZWKA 3OICA 1F48A 4WASA 1P39A 4KQCA 4LHZA 3WY9A 4EA7A 1KEUA 3QU4A 2C4KA 2FWRA 3DHVA 1XL0A 5FLEX 1U98A 2QX9A 3O8QA 4L4YA 3ORRA 4DGSA 4RIIA 4AQYB 1TGYA 3EBLA 2ENWA 3OHMA 3D6VA 2RGGA 2NQTA 2OHXA 3IMFA 3KQMA 3KVYA 1RPTA 2LTAA 3LXMA 4JGGA 1S1CA 4JBIA 4MV7A 3TOSA 4ASUD 5ALJA 3JZAA 1G5IA 1E2HA 1W30A 4KAAA 3NUQA 3EQ2A 2I4IA 4OHWA 4CPDA 1MHTA 1KH2A 1G7CA 2XJ9A 3NBXX 4F3TA 3ZD8A 4K8RB 3WGHA 5DDIP 2Q6KA 2QL9A 3DDOA 4C87A 2IUSA 3KQPA 3VR6A 1YAHA 1UAAA 3W5IA 5K09A 1TA9A 2NPIA 1EEHA 1DAOA 1E3EA 5AVRA 2ZYAA 2ZVQX 4CQJA 5EXXA 1A7KA 4P3XA 1G4UR 2CBZA 1ORVA 1TZKA 2C2XA 3BFVA 4JLWA 4D6YA 1BU5A 1NL3A 3HCNA 4XGKA 2P1RA 1R9NA 1OFHA 2AR0A 4JLSA 3LY5A 3V48A 2OGSA 1GDTA 3PQEA 1M2WA 2RHRA 1ZQ9A 2NV6A 2WD9A 4K3VA 4Q24A 2WF6A 2DTDA 4NEHB 2HO4A 2V9CA 3JARB 1ZXBA 1G9XA 2B69A 1EX1A 2KS6A 4QOFA 4TLEA 2G0NA 2FX3A 2XDWA 5SY6A 621PA 4PAOA 2C77A 2G04A 3K6RA 4XYEA 1ORTA 4PYRA 2FMIA 2HYDA 3PXCX 4QAQA 1GKKA 5BSRA 4IH9A 1SG0A 1JTEA 1SVMA 2HZ7A 4XCQA 1Y7PA 1TRKA 2E4ZA 2J07A 2AQ8A 5EJEA 3ZV4A 2VBFA 3N2YA 4OLAA 3PKZA 2B34A 4Q1FA 3MUEA 5C7OO 5DNCA 4OOEA 3UHPA 2X0RA 1TM5E 4Q7JB 5EFZA 2QUAA 2LCIA 1YGYA 4GKBA 3IL2A 2Q5QA 3TRFA 1RCUA 4D92A 3ZLBA 3PWSA 3OT1A 1EWKA 4P35A 5A3JA 5ADWA 3NBMA 4ZU1X 1W36B 2R86A 2B21A 2FRDC 4MWDA 1JU4A 4NOMA 1GTRA 4CKBB 1U2EA 4UNQA 6REQA 4FSXA 5JMOA 4G25A 2X6TA 1A71A 1BXRB 4KAJA 2QBYB 2BZSA 2VP9A 3C1OA 4LRUA 1SBTA 3S1AB 5LP1A 1G3RA 1VPDA 2EJUA 2GRJA 2QP4A 4L0CA 2AMYA 4GEKA 5ALYA 2A9VA 1I51A 5AK6A 3AVQA 1Z39A 3FTCA 3I58A 1AIPA 1ZN7A 2UVDA 2IEYA 2AC4A 3KPVA 1YR1A 2VEDA 2EJTA 2WFLB 3AJ9A 3EEIA 1X19A 3QOFA 1Z6QA 2DLNA 2P1DA 3O4GA 4PX2A 1UBTS 3AF0A 3JTMA 4ZARA 4FGUA 3D81A 4FONA 5FPSA 2Z08A 5K3CA 4DJDC 2OVFA 3TXYA 4MZXA 3DWFA 3F4BA 2JJ2A 3FN4A 2Y68A 4QYXA 3ZTTA 3ETHA 5B6PA 1GZVA 1RXYA 1QVAA 3GJ0A 4LJYA 1L5FA 5ADVA 2AT1A 1GR1A 3HCRA 3SS7X 1ZSVA 4PWZA 5BW5A 4P34A 4RF2A 2A1UA 4Z0HO 4DLVA 3JR3A 4AJ1A 4TSKA 3GMTA 5B6IA 1T2EA 4HJRA 2BEJA 2VHTA 3BHJA 4WH0A 4D3XA 2XRZA 3AHEA 3O0DA 4QTYA 1RHQA 4MVJG 3IAEA 4QDUA 1BW9B 2EGUA 1BHQ1 1PD0A 1OX6A 4GMDA 4NFLA 5E3JA 3L4JA 2ODQA 2HV9A 4GEGA 1C0PA 2E5FA 2PZJA 2HCRA 4NU0A 2WG2A 1JNYA 3H3JA 2FN4A 4PAGA 5IJAA 3FA2A 2XADA 1S7CA 3Q6NA 5EWLB 3W2FA 1EINA 2ZR7A 3RV4A 2V97A 1TGVA 5T67A 2A33A 3ANYB 2GUWA 3IO5A 3WL3A 2JLYA 1W5BA 3L8CA 2WVHA 2B83A 1GKUB 1QQAA 3WMWA 4BNKA 4ND8B 3L46A 3V4PB 5ICMA 5DBGA 2NVUB 2ZTLA 2JVIA 1H1LA 3R5TA 5FIUA 1JH9A 1OE0A 3BKWA 1UM8A 2W6IA 1L5WA 4L3VA 4O5AA 4RPIA 2F3PA 4EUNA 1JLLA 2DUMA 2V4ZA 2X1LA 2LGJA 2ZJZA 3C14C 3L7CA 3AWDA 5KAPA 4HQNA 1F7UA 2DUWA 3FKQA 3R7SA 1KQGA 3PHLA 4C6HA 3B2NA 1PG5A 2ZTUA 4MYCA 4NABA 4ZALA 4JC8A 5IVKA 3KUCA 4JQSA 3WLOA 3GN2A 1GT6A 2YJTD 3UXYA 4IGAA 1KP2A 5IF9A 1P8AA 1Y4SA 3C6ZA 3H5LA 3U5TA 1M73E 1NVEA 2C2GA 3VNVA 2P4QA 1DCMA 3AF2A 1U5BA 1ZMTA 2IXEA 2QM0A 2FMTA 2ZUEA 4WVLA 3OEHD 5M7EA 2IW3A 2OECA 3PWKA 4O2BB 2HKIA 4N6GA 1I2ZA 3MF4A 4OGGA 3RGWS 5IVHA 5AD1A 1KS9A 3ANSA 4NS1A 4PF1A 4D1YA 4F12A 4P22A 4D7AA 4CWAA 5M34A 1FRFS 5T5QA 3T7TA 1HYEA 2I6SA 4YREA 4YACA 3DGEC 4KVZA 1KAOA 5IG2A 1N3LA 4AY6A 3ZR4B 4M8KA 1X8KA 1QG4A 4KXNA 1J8FA 3JR7A 4CKCA 5HHTA 4AJPA 2IIQA 1SK9A 4XYGA 3BBPA 3NIDB 2Q1WA 2PYZA 4KXWA 1RLUA 1E4OA 3SM3A 3STVA 1Z6YA 2YXNA 2KI5A 1WSBA 2ZIXB 1AU9A 2GF2A 1KQPA 2HNAA 3IVGA 2IXFA 2WPDA 3HG7A 4JJIA 4YQYA 4LE2A 1Q2XA 1EX6A 4N0MA 2NUPB 2NU9B 5GOTA 3AETA 1KMMA 3VMMA 2F6RA 2XKJE 1SVSA 3IT2A 1XALA 4LYYA 4M1OA 3PL1A 2WF8A 4ZZIA 2B20A 4QXRA 3UJ3X 1HL3A 1U9IA 1WCXA 4XVRA 3FOEC 1XLTA 4XKJA 3TD6A 2DSTA 2PLNA 1TTTA 2RAVA 4F7DA 1JIJA 1V8BA 4OK5A 3KFVA 4RZHA 3OPYA 4V2UA 1GQQA 5CAEB 3ZU4A 1NI4B 4M7PA 5BV2P 1ZFNA 4YPOA 1VBKA 2A94A 4EX7A 2I22A 2NZWA 1XCBA 2HSWA 3DBLB 3DZDA 2BLLA 2G6TA 4Z1MD 3PEWA 4ZZ2A 2R8YA 4C20A 2PZAA 3LRPA 5DXJA 5FOUA 1IBMB 1OAOC 1XG5A 1ISHA 2AKEA 4IIVA 1E20A 1DXYA 1P1BA 2QTRA 2VPZA 4IX9A 3ZHQA 3QKIA 1GKLA 3TR6A 3ZK8A 1DAHA 4MVJA 5EE0A 4W99A 1V7PC 2WJ3A 3I2YX 2XWBF 2YWJA 2VCYA 3SQDA 1Y4AE 1RPNA 3P9IA 4O2BF 5FHQA 3ADBA 3BMNB 1AH2A 1LS1A 1RAAA 3BWCA 2GBLC 5K0FA 5LMUB 1T25A 1YDGA 4ZC8A 5JG7A 1XSEA 5IM5A 3H9QA 5D6OA 3EH2A 1ODJA 4NOLA 5DT9A 4JP8A 2B4AA 4ZT2A 4QOJA 3WOHA 1M5TA 4NBKA 3SEZA 1WHTB 3HRKA 3MCVA 2NN3C 4C14A 2EF1A 3I4CA 5B4TA 2NO1A 1BKDR 3LDGA 3RW9A 3U48A 2CLDX 1C0EA 5B1IA 2DEUA 3UFXA 4CM9D 2IZ6A 3DZHA 2OSVA 5DBHX 3TZHA 2QY6A 2G06A 4FP9A 1GPAA 3LT2A 4FHGA 4M9RA 3SJBA 1AQ6A 1JHRA 2VAVA 1C3VA 1N9GB 2QMOA 4RL4A 5MN4A 4LWOA 1H4QA 4PS1A 3IOEA 1PWYE 5AI5A 4JC5A 5MFPA 2J0SA 2E87A 4YJGA 5EZYA 2XGOA 1YZUA 2GAIA 3KBBA 3PI7A 1P9OA 3QM1A 5JI3E 1QIHA 1M0TA 3W2IA 1EDZA 1F0YA 1T9GR 2H5LA 4H08A 4M87A 3ZJ4A 4MDFA 2GEUA 2QYOA 3F3MA 2P2NA 1E98A 1GL9B 4PC2A 1J24A 5HIMA 3UJDA 1J07A 3DZJA 1PQYA 4MCHA 2ASEA 3PFWO 3THXA 5FHRA 3CISA 4NY1A 1FDSA 1OT5A 3GMSA 4G4GA 2VQSA 3H2HA 4C30A 1E8NA 4G65A 3I5YA 4CDMA 2L17A 4JI0B 1ZUHA 5HMLA 1KZ6A 2BELA 2QZZA 4FGLA 1ZOIA 1RYHA 4B3SB 1PGJA 3F67A 3EVBA 3FRIA 1NVTA 2VJAA 3JYOA 4B47A 4X6XA 3FAZA 3AUAA 4HPWA 4OXKA 1EP9A 4LTNA 1U1FA 1E2JA 2DHEA 2GZDA 4TWBA 2C9ZA 5J1TB 3H11B 3FPKA 3Q41A 4COKA 2NMVA 3NBAA 1HEYA 4O6VA 4IMRA 3CW2A 2IYPA 2CXNA 4MITA 4FMPA 1F0PA 4PPFA 1BGVA 2FXVA 2NO9A 5JNLA 1U9ZA 5G53C 1V41E 1IJEA 3OZCA 5FJJA 3JQQA 1T3SA 2YXPX 1UODA 4FYPA 3C70A 4TMVA 1XF9A 2MSEB 3TRDA 4YRSA 1A9TA 2CHVA 1IDN1 1ODFA 4M49A 2GPBA 2P62A 4Y3UA 1MB4A 3SZLA 1T1JA 4B2PA 3M33A 2GJSA 5A9SA 1GSHA 1A82A 1T6BY 1XYYA 2RAUA 5JQWA 3W5SA 3F0TA 2N1MA 2AKAB 4CM3A 1H69A 1ST3A 3HVKA 1D2AA 2YOGA 3FHJA 3H17A 1KORA 3NOXA 3U4GA 1Z0DA 2GFHA 2NYRA 3A1NA 4UULA 2I9KA 5ENZA 4CL2A 1EJ2A 4UUBA 3UK6A 2GPNA 2V9PA 1JGTA 1P1FA 4HT3B 5E38A 3N7UA 3TG8A 1G6Q1 5ALVA 4FCTA 2A5JA 4TVKA 2B0CA 3K0FA 1BCRB 1U9JA 1XTPA 3EW9A 5J5CA 2FWNA 1TB4A 2AYYA 2YXBA 1CRLA 4G5RA 6GPBA 4D4GA 2FFAA 1C81A 3ANNA 3S5UA 5K01A 2IU6A 4U9IS 4H16A 3SQNA 4ENUA 1JX6A 2CV0A 3QELA 1N77A 3AB3A 5KCZA 3TTVA 3UJBA 4A6PA 4Q0MA 4UDOA 3RIYA 1GV1A 1S2GA 4EDHA 1RI2A 4MRRA 3L7IA 2IPLA 1SXJE 2MMGA 1TQ6A 4CR6A 4M1YA 2HA2A 1BU8A 1FTWA 1FTQA 3V1YA 2HA0A 1JE1A 3FCSB 4WXPA 1OR8A 4KUHA 2QD5A 1IBKB 1QM5A 4BECA 1V43A 3FFAA 1Y34E 2C8VA 1BX3A 4RK0A 4RNCA 5BXYA 2FKAA 1NJ8A 3DZGA 1II8A 4U7GA 5I7UA 5LQRA 4OLBA 4AKHA 5L40A 1CC1S 4MRPA 4HSEA 1EFLA 2VG8A 2R68A 1VMKA 4RE5A 3CLKA 2FQXA 4DG9A 1Y3FE 2EKDA 2VHXA 3OF3A 4JX8A 5FO0A 3L0OA 1QNLA 3VX4A 5KYUA 5KOHA 4B85A 1ZN9A 1F8UA 4CT5A 2ZSKA 3DLPX 3E22A 2HRBA 1MDFA 3C24A 1LVUA 3AR4A 3PENA 3O8QB 2AR9A 1QIGA 1EZ1A 2QTCA 4GSYA 3MAJA 4REOA 5LM3A 1MAUA 1WG8A 2RHGB 4OF4A 3Q8MA 1PN3A 5A5DA 4XIIA 1QYWA 2AOXA 1NW3A 4BUZA 4H3KB 4NXMB 4PG7A 3X0DA 4GMXA 1E9EA 2RIRA 4WDQA 4WEOA 2GPYA 1G16A 2MYPA 2G76A 5T41A 1NVMB 3P9NA 4UBJA 2ZFUA 2GMWA 3HYLA 4PYQA 5EJAA 4TSFA 1FTSA 2XT0A 3DW3X 1CQXA 3QI2A 5DWVA 3L4SO 3JVEA 2C4TA 3RJ5A 1SCUA 3PZRA 1XZIA 4QU0A 1UUFA 1TZBA 1MX1A 4X00A 4V0QA 1A4RA 1X1AA 4JLNA 4DEYA 1N78A 2IPMA 4JYAB 4C2TA 1KAMA 4E15A 4Q16A 4RELA 1NXXA 1DC4A 3RFCA 1XT6A 2VP6A 3VVLA 5DM60 1KS2A 4E3ZA 1W87A 1BXZA 1YB6A 3KXKA 5AOAA 3R9XA 1ZL2A 2VPXA 4JAVC 1WDLA 2IYFA 2NVBA 4A03A 1YBMA 4ZCRA 1HKHA 7REQA 1XU7A 1JKXA 3GJ6A 4IP0A 4U2KA 5B58C 1DS6A 3M82A 4TQGA 3JZDA 4QPCA 2E4WA 3VC2A 3G0HA 2Z2KA 2I3BA 5G1OA 2W93A 3MIZA 1BDIA 2HSJA 5K8TA 1YQWA 3PXXA 2P77A 1QRDA 3CWQA 4IEEA 4F8JA 4Y6SA 5C1DA 1EI9A 1ZUD1 4G07A 3EIWA 1J2JA 4AF7A 3PIDA 3OT1B 2QTNA 3S68A 3Q8KA 1TRHA 2PL5A 6REQB 1ONPA 1H1DA 2DG2A 3N2NA 4IGIA 1K6JA 2R00A 4LC1A 1F9AA 3KJIA 3TTTA 1YZVA 1KMQA 4BX8A 1FDRA 1Z6AA 3WWZA 4Q3CA 3DD1A 1CVRA 2GB4A 4EPWA 3SX0A 3ZHCA 1AS3A 3FCUB 3CF0A 4KPGA 3OZEA 5IT4A 3X1DA 5KHOC 1YS1X 2EOAA 3LC1O 1QGOA 3ZCXA 7AT1A 1DC5A 1U99A 2YWHA 2HH9A 3C1AA 3GXOA 1P0IA 2EP7A 1Y9JA 1J8VA 3NIGB 1PV4A 4HR7A 5AJXA 2EX0A 5BR8B 1S02A 1NBOA 2C04A 1OPXA 2A35A 1C29B 3QOXA 4H4DA 2CYBA 1N8SA 5BWBA 3EPJA 3Q3VA 5DOVA 3VZRA 2V7UA 4C08A 3DXZA 3R0VA 4ZOAA 1G8HA 1DXOA 5LMCA 2X13A 2PH5A 3PIRA 3KL2A 2JEZA 5ALTA 3VR1A 1T5TA 2XXAB 3KQWA 3BMQA 5LZ8A 5JSKA 3UCFA 3TPCA 2C9OA 3PFIA 4OHFA 4BUJA 3ZIDA 5IS2A 3HEBA 4ZHQA 2XVMA 4EEZA 4BFXA 1KI7A 3BGIA 3IURA 2CWWA 3H2BA 5JJLA 1X7WA 1UQUA 1VJCA 3I5MA 2ZBQA 2IF0A 3DO8A 4RTRA 1ISRA 1DBQA 4W5NA 4Q21A 5DM0A 2R6CA 3WKDA 2RGWA 1DFGA 1JR3A 2QW8A 4GP6A 2QG4A 4EB3A 5LOVA 2FN3A 3HR7A 3JASB 4EO4A 2FGKA 1Y6QA 2BKEA 4BLRA 2BHTA 3P2IA 3EHDA 2FUNB 1T6ZA 3G0CA 5ARCA 1H1LB 5YASA 4YAFA 4C4RA 1GUYA 2QRVA 3GJ5A 4F71A 1XIVA 2XI4A 1WY7A 3I37X 2AZ4A 4HTAA 4WXMA 5ENDA 4CL3A 1AK2A 2ZJ2A 4C89A 4DSOA 3PDUA 2IOYA 1XZPA 2F43B 1FQKA 3O95A 1ZGAA 4F72A 2VNAA 1XBTA 4DA9A 3EVNA 3CQ9A 3F7TA 4UOEA 2XA2A 2D3TA 5CDFA 4E1BA 4I9NA 5D1NA 1MPTA 1GWNA 4PZEA 3A9SA 3ZWQA 4RZQA 3OETA 4BVJA 2JFBA 4J76A 3TECE 2OQRA 3HDTA 4HS4A 1GSAA 3RVBA 4LY9A 1Q7CA 4N03A 4G0UA 3EH1A 4B34A 2M32A 3V3TA 3PUKA 3E2IA 4LOHA 4BIIA 4GPEA 3VUEA 3S1SA 3JYNA 4ROTA 2WC1A 4Y2XA 1P5JA 1PWXA 2VDKB 3MT8A 2OA0A 1GU0A 1XA4A 4ZCPA 1PR6A 2ZB3A 3OWOA 4XUCA 1CBUA 4HWGA 3PFCA 4EI8A 1Z83A 4LZWA 2PUVA 2XYVA 4P0TA 1E62A 3PK0A 4WZBA 2Q6TA 1XCMA 5C8DA 3D0QA 4PX9A 4YLGA 4MCAA 1GQRA 1LBTA 2KB0A 4S1VA 3WSTA 5JC1A 3L1UA 8ATCA 4CKCB 3DBOB 4FHZA 5L4NA 2Y1WA 4HNRA 5J2TB 4RF5A 1D2NA 2AJLI 4C1NA 1UJNA 4ACAA 2J7PD 3A31A 4MWGA 4ZYLA 4RV5A 1TO2E 4LOLA 5DSXA 4F4HA 5K03A 4OBEA 4LJ9A 2E4AA 1PJ8A 2XE4A 4MP3A 1S8NA 4QWMA 5IAEA 4E2ZA 2P67A 1CUBA 1A5BB 1TIKA 2JL1A 4B83A 1LPAB 1W48A 1YCGA 2K6GA 1F38A 3OTGA 5AO9A 3B2QA 4F86A 1U9CA 4V1CA 5IZCC 1GUFA 2MR6A 5BT9A 1ZU4A 3E1SA 2OOSA 2XMRA 4U4AA 4DV5B 4EGJA 3MCTA 4AWAA 4B84A 3OPYB 1KIAA 3BE4A 1W0KA 1ZRMA 2J5RA 2AOUA 2GM4A 2DPGA 3B1ZA 4O5OA 1N1EA 2H9YA 2LW7A 4P5DA 4KN5A 1NU8A 3AKDA 3ZS9A 2Z5LA 4E12A 4JR1A 3SXUB 4WY2A 4IQFA 3TVTA 5E1DA 5TSDA 5B3LA 1RXIA 4YUWA 1B8UA 5FTWA 2JGEA 3C3PA 3GFTA 5IC5A 2LD4A 5H5JA 1D8AA 2VNSA 3FD8A 5BW6B 4D98A 4LV5B 3AUXA 2OFFA 4R1OA 4DLWA 2SBTA 3D1JA 3TF5A 1V8FA 2IKSA 3ZE1B 3SVLA 2P3LA 2IEIA 2NV0A 3GH1A 4H35A 4GYKA 1VCMA 2G09A 1H2BA 3C5HA 5AJZA 2QENA 3TL3A 3QYAA 4L74A 3QYFA 1VBFA 1Q3TA 1S96A 3QKTA 4P58A 1DZIA 1JG6A 1CUWA 2QRHA 4BO6A 4JMLA 3FSGA 1QYXA 2FMHA 3HXLA 3L8MA 4BO1A 5A04A 1DIBA 4QEDA 1EVZA 2YZGA 2BN4A 2QMHA 5NLLA 3TUZC 2Q0SA 1M6VA 1G1MA 1MQAA 3AERA 3LS2A 3ZE8A 2JHCA 5CFOA 3UMRA 4XFKA 3GAZA 4LFCB 1G2QA 2IX9A 3G2OA 3O21A 3RYTC 3NB0A 4GLBA 5KWEA 3AY6A 4D8TA 3HJHA 1IEXA 1YQDA 5IANA 5FB3A 2HWKA 5BN5A 5A06A 1U2QA 2CL7X 4UTRA 1UIRA 1JHQA 4JUFA 1W1UA 4X3PA 4LZAA 4WINA 4YJGB 4HD8A 5EZYB 1E3QA 3ICOA 1KQNA 1Y1LA 2BFCA 2Z04A 5IYZA 1E6MA 4HTFA 4FMDF 1H6CA 4D5GA 3EVFA 1A9SA 3KT3A 1SB9A 4YV7A 3HUDA 4DCTA 3RUPA 1WMEA 1O54A 1ZZGA 4JLKA 4H6VA 3I6ZA 2ONZA 4UUQA 1R0KA 5CPFA 4YTEA 5JXHA 4ZVPA 2YV1A 1J00A 1SB8A 1BC5A 1Z4JA 2C2HA 2NTNA 2WWFA 3HKCA 4M9UA 4NECA 4GPBA 2Y6VA 5KOYA 5JCXA 5KQSA 3THXB 2REQB 2UVPA 3LOQA 1L1RA 4LRWA 1N0IA 4BO7A 4DIEA 3HY6A 4LE0A 4WA7A 1QHFA 1Z5WA 1H66A 3WR5A 3U5ZB 5FEMA 2X22A 4GQIA 3SZ3A 3AOEA 4GVPA 4MVJF 3VH4A 2BBSA 2J46A 4W5JA 1HE5A 3GOHA 1PK9A 1FEZA 3CZPA 4GC5A 4BVLA 1ST2A 2PFSA 1E2UA 3C7CB 3X1JA 1U0OC 4CVNA 3T15A 4F46A 2R8OA 4BJHB 5KMGB 3K16A 3P9CA 4UUMA 1RJEA 4B4WA 1UZUA 4EG0A 5JRJA 4UU0A 2J7KA 2XQJA 2ZBRA 3PKJA 3STHA 3ROFA 3A3YA 1JA1A 1HH4A 3P7MA 4GPIB 1RPAA 1XDBA 2P2CA 1WO8A 1O94A 3L0YA 2G7ZA 1P5HA 2A0YA 3QU7A 5AKKA 4X97A 3VR6D 4PXSA 3BQ9A 5A9SB 1P72A 2H1OA 3EJWA 2PD6A 5UKDA 3B6EA 4CKEA 4JV5B 3PQCA 3WLTA 1RQPA 5JSZB 3CIFA 4DCOA 4NYIR 2QF7A 2FPRA 1TEZA 2XGJA 2JRCA 2ZRJA 3ZD6A 3ZLTA 5EQJB 2EBHX 1JW9B 2ZRBA 3OZUA 4KMRA 1UBCA 1PZHA 4Q4LA 2UUAB 3EIHA 1MVOA 4E2YA 4QRIA 1JXOA 1XO1A 5EZYF 2A14A 4BIMA 2HWWA 3DVSX 4MUGA 5CD9A 5HZKA 4E46A 4XI9A 1KEZA 1ACLA 3K0FB 2GKGA 4YJ2B 2EW8A 3FVQA 2R1VA 3CGGA 3KTOA 4AS2A 1QV6A 1DCFA 2D2EA 1Y3IA 2A5GA 2QGFA 4RF4A 1DG3A 5AKIA 5EIFA 3BXFA 1NRIA 3CLUD 1AUPA 3VJKA 4CM1A 3PHJA 1UBKS 1RWQA 2PEZA 1IULA 3C74A 3QELB 3QLUC 2GO7A 4NG4A 2L82A 3RYCA 1KHTA 3HY4A 4ID9A 2FSSA 4V2IA 4W8OA 3S3TA 1SOAA 3MWYW 3QX9A 2HRRA 2II6A 4MWBA 2F3UA 1YHZA 1L5MA 1Y6JA 2EATA 4A0QA 1ENZA 4PIPA 2JAUA 3E7WA 4TYPA 2R8PA 4TTVA 4UXJA 1M8KA 1RJ9A 4A1FA 4UBIA 4RTMA 3KYIB 5D7NA 2WUVA 2YFKA 1DTEA 3RVPA 3EGCA 5TQ2A 5CLFA 2XW6A 2CDCA 1II8B 4OLJA 4XOUA 2BKAA 4DNQA 5I4CA 1SUPA 4JI4B 1ZA1A 1QCCA 4UZFA 4QU5A 4TQAA 1NN0A 4DV0B 3DDWA 4RZ3A 2NTEA 1SXQA 1UM9A 5HJ5A 1VG0B 5KOHB 5BYKA 2AXEA 3JQAA 5KYUB 2IUFA 1RU3A 3BZUA 1JIVA 1PQ4A 2W70A 3FUUA 3E22B 1B8PA 1XDUA 2B3TA 2AEFA 2X42A 5AW4A 1U0GA 2JJ2D 4KE9A 3B1FA 1Z4KA 1EXWA 3EXFB 1VLLA 1ETUA 2PLRA 1M2EA 3LHSA 3ETEA 3N2GA 1KMCA 1UJ2A 4JUAA 1HKUA 3C87A 5IVDA 3WMGA 4QUKA 1PNOA 4DR2B 3USZA 1TVMA 1YRWA 2VDRB 1OV6A 1I80A 3PWZA 4HWSA 3S7ZA 4CMAA 4X85A 3PR1A 3OAAA 1QZ3A 4XWGA 3VZPA 5ALSA 1LC0A 1M1NA 1LLQA 1OHHA 2X2PA 3RVQA 3WLSA 5K8VA 5F4ZA 3OFKA 4W5TA 2O3JA 1LH0A 1N2IA 4QIHA 5ESXA 1D1QA 2JAHA 3TTSA 1T4BA 2E82A 2ZVPX 1GTL1 421PA 7ADHA 3GLGB 4BPRA 1SCUB 5E7JA 3VM6A 2DULA 3CR3C 5I45A 1M72A 4UFNA 3DB2A 1YJQA 3GYGA 3OMWA 1ZD4A 5GGYA 3MJDA 3O74A 1I3CA 3U0BA 4DE5A 1ZXXA 2R66A 1Q1NA 1HO3A 1M6EX 1SKBA 2PQ2A 2E6KA 3CUEF 4UHDA 4MV8A 5CLLA 1FRZA 3WLJA 3ZCVA 4D6XA 2PJRA 3OJLA 1NJ1A 2JVJA 1KJ9A 2P3OA 5C8ZA 4V0OA 2R7MA 3TQIA 4LRTB 4IR7A 3R9XB 1VRVA 2BOVA 4FOPA 3VSEA 2ZI4A 4DIUA 3RK0A 1IONA 7REQB 4RX1A 721PA 1DO2A 3P45A 3HE3A 2W6ID 2RGUA 2YZ7A 4H6XA 2WF7A 4ZI7A 4XD7A 3L93A 5EP2A 3SQLA 1BFKA 3NVKI 1FB5A 4NMLA 4ZVRA 2AI3A 2WSSA 4UARA 3OUUA 1YR2A 2OGTA 3H5TA 1QX3A 5MN6A 3R0QA 4Q9AA 1EYZA 4Y18A 4CMHA 3EQ7A 1YJBA 3N6RA 3CZ4A 3OZWA 1V11A 3QI7A 2DTEA 2BEKA 3DHWC 4RHFA 3AP1A 5CFNA 5EI5A 3QPDA 1QR6A 4OSOA 2PRZA 4YJKA 1LLCA 2UZAA 3GDWA 1F3LA 4MRAA 2E48A 1GAJA 3G2QA 5EN4A 2OAP1 2ZAMA 1EGVB 2HK7A 1IN7A 2NV2B 3ZWOA 3X44A 4B46A 1Z3IX 2W2PA 2WPNA 3G68A 2VPTA 3CLTD 4D45A 4TKVA 4BY9E 2EJBA 5CM8B 4RKWA 4ABYA 4ER7A 2X9QA 3RBZA 4KQXA 3LHFA 3D43A 4YRKA 1TA4A 4LIPD 4R01A 3ZWMA 2RI1A 3HB5X 2GPJA 2CVQA 1IEVA 1GU1A 1OBFO 4INZA 4LSZA 1OJLA 1E3IA 1SZDA 1WB4A 4FZJA 4X1YB 3BSFA 3T7KA 3EMBA 3HJAA 2O19A 2PO5A 1SAYA 4PNHA 2YHIB 1CQZA 4ZEOA 1F2UA 1DXHA 3P9PA 5L95A 1JAIA 2D0OB 1KZ1A 3JZFA 4W82A 3MT9A 3I6YA 2CLIB 1FS6A 2PVPA 3RC7A 1IB0A 1JBQA 2PXAA 3PRYA 2FHSA 2X77A 2CXRA 3LX5A 3ZHOA 1WL8A 2RAFA 4CKWA 1DRUA 3HCDA 4RDIA 5I7SA 2I66A 3W8NA 3UJCA 1IOVA 1GTJ1 4JL5A 3BMQB 3I3OA 3M34A 1T13A 4M60A 3CRMA 5CLIA 4CGYA 1RRGA 4E2WA 3HTXA 4ZHQB 4G1FA 3W34A 4FXOA 3VU1A 2BKXA 1WUIS 2ZIGA 3KD2A 3FWYA 4HQKA 3CB4A 1FZQA 1L4YA 4POAA 4YCBA 4LFBB 1O58A 1X7WB 5HKLA 3B1WA 5M2QA 1E64A 2CFOA 1S3FA 3ESDA 1IQRA 2WLTA 4M8SA 2PS0A 2QQGA 4ZCSA 2IHYA 2PH3A 3FSJX 4J4HA 1JG3A 3VRHA 1GQ2A 2XOXA 3HJCA 2XE6A 1FY2A 4OH7A 4PPQA 5LOVB 4JVMA 3L0ZA 4RGYA 3REOA 3KJXA 5HUQA 1WW8A 3FYTA 1DDIA 2OPHA 2HCBA 3R24A 3OZTA 4J9UE 3D7SA 3G7NA 1KNXA 2QRVB 4HB4A 1R15A 2IX3A 2QRUA 3IQDB 1DELA 3CUSA 4Z51A 2DY0A 3KWFA 2GQ0A 1UT8A 3DM5A 4MVJD 2GXQA 4NWIA 5HIIA 2XDYA 5JS8A 1HPLA 4TL9A 1D4OA 5CFRA 3MJTA 1N4AA 4D6PA 2DWCA 3ZE2B 2X4GA 2ADOA 3LGSA 1JBKA 1PL7A 1TVEA 1VG8A 2QI9F 2XPCA 5LA6A 5GVSA 1B16A 1D0SA 2XLBA 1KO5A 2JVKA 2ZRMA 3BPSA 4NZ9A 4OFBA 4BP1A 2C7OA 1ZVMA 2DWOA 3K1AB 4JYPA 3TKLA 4E31A 1KSHA 3NFYA 2OFOA 1DI0A 1Y7HA 5IJ9A 1G6KA 3VPCA 2H18A 5WRFA 2C2WA 2KWIA 3FVRA 1NNI1 1GA4A 2W6QA 1M2VA 2X4LA 3EGOA 3IXLA 3IR5A 1B23P 4B3GA 1FRQA 4L5YA 4M22A 2REXB 1Y3HA 1I13A 5DHRA 5B53A 3WIDA 4IVNA 4LGCA 4Q5IA 5AXBA 2WOJA 4J0IA 4QD3A 4NV1A 3CZMA 4PN7A 4TKZA 3VPFA 5JD3A 1XDDA 3TGWA 1M34A 2QUKA 1NT2A 2GK3A 2GA9A 1Y4UA 1HTTA 1O1YA 1DVRA 1RABA 3BORA 4H7JA 4OMFG 3FSRA 4TS4A 1VLHA 2PU7A 5JUWA 4ZXPA 3O8CA 1XZBA 1GFWA 4QATA 4ZC1A 1JKJA 3E84A 1FDWA 3FDJA 3P0FA 4EY6A 1AKYA 3V8PA 4LDZA 3RPEA 4IZOA 3MS2A 4RHCA 4OO3A 5CRIA 3V9AA 2Q9UA 2VCHA 3U3MA 5JPCA 1IHOA 3E5HA 2AD1A 5G40A 1DKLA 2HMAA 1UADA 2NLOA 3KOMA 4JL8A 4DJ5X 5LOVF 2HGSA 5L53A 2JGNA 1P0PA 2CLSA 4H7DA 5EIWA 4E07A 1HE3A 3RNOA 4EWLA 1SG9A 5JYBA 4KRYA 1EM8A 3W7AA 4IDEA 1M8PA 3LL7A 2VDVE 4YGYA 1R4NA 4A6XA 3MMPA 3TQTA 1AF4A 3PC8C 3LFTA 3DP9A 3HYNA 2WAMA 1UPXA 1N5MA 2ZB8A 4ENSA 4OKNA 2QA5A 2C54A 2FX2A 2AOUB 3QKUA 2QX7A 3ZZ0A 4GI5A 1T9HA 4WNYA 4TQUS 4HMQA 1RM3A 1MTOA 1UXGA 2WVGA 3PEEA 3OEYA 3GDFA 1LJLA 5L3SA 4JENA 2BC9A 1CR4A 2KBFA 1KEVA 1PZGA 4MQUA 1QORA 4XZ3A 3GEPA 2FEMA 4Z4CA 1UZLA 4QU8A 4HWTA 4TV9F 4TVOA 5C37A 1QH8A 1ACJA 2BHSA 2JJMA 4FMCF 3UO8B 5F1PA 3TW6A 4BZQA 4Z4HA 1KTIA 1XYVA 3TAXA 1G3MA 2B7BA 4CR8A 1OW3B 2Q21A 3W9YA 4B8WA 1CUFA 1CETA 2H1RA 1C3XA 3QVSA 1U8EA 1EPUA 3QFSA 1VM6A 4K87A 3RF7A 1O6BA 3AXSA 5COBA 2WIJA 5FUWA 2F00A 3IBTA 3FCYA 4JJFA 4R98A 4DZZA 4ZCIA 1MTZA 4XH9B 4BMXA 2FR1A 4OJQA 3O8OA 1VMEA 2AH5A 3QFRA 3OE5A 1KDTA 4HZUB 5CNMA 6YASA 2PWYA 1BVUA 1M1UA 5DKFA 1M6VB 3ANTA 3OLWA 3RBVA 1K27A 1YJXA 3M9WA 5DLDA 2P8SA 4GXTA 4J75A 4HBGA 3A11A 3JQBA 4RD1A 5AJTA 3MGAA 4XPIA 2JJ1A 1QYCA 4C0KA 5C1PA 4IG9A 3RIXA 2A4MA 3PJGA 4Y1RA 3OQVA 3T7AA 1P81A 4MIKA 5HPYB 4I1PA 1PQWA 3DD5A 5BN5B 1ZWLA 2AN3A 5H82A 3PPXA 2Y9PB 2P7HA 3KU4A 2C3UA 4QX6A 1AQIA 3N8DA 1NQAO 2QN9A 3R7FA 3F46A 1VIMA 4J94A 3F8SA 2BFCB 4NPHA 5CK4A 4HTFB 1Q1AA 2VP3A 3L6UA 5IYZB 4CEJB 2IS4A 3A6GA 4QNNA 2IXGA 5I4IA 1XJCA 5CVCA 1U1GA 2RG1A 4K9QA 1X92A 1CRWG 5FTNA 3EYWA 3QF4A 3RRZA 1B2LA 1KFCB 1WMDA 2WAXA 5T4FA 3HKCB 3WGQA 2VHCA 5ABPA 2WJJA 2P6PA 2WINI 2YIMA 3NPAA 2K2WA 4B17A 2PX2A 3H1BA 1BJKA 2B25A 2XB4A 1Z6ZA 2DBRA 3QWBA 4GUDA 2D1TA 3LO8A 1XD9A 2BMWA 2SKEA 1E2FA 3WNBA 1GRVA 3ZY5A 4RV4A 3QNUA 5AT1A 1Z34A 2I80A 4AVYA 1YVDA 4YJ3B 1ND5A 3CO0S 1TEHA 2IYOA 4MMXB 1N8KA 4RL6A 2VJOA 1HDOA 5I7AA 1TTPB 3DVLA 4A0SA 1WUTA 1JPVA 1R64A 1CP3A 4UVEA 4B3DA 5SICE 4KQWA 2HNBA 2IPNA 5FF9A 1KETA 1DAEA 1YA8A 2YFQA 1XEWX 2XAUA 2BI4A 3F9RA 4LJ8A 3VU9A 4B2YA 3CVXA 2I2BA 1Q7EA 2BRUA 4I6GA 4BC1A 4A2QA 4PSUA 4FS3A 1M67A 3PQFA 4LSWA 4TSFD 2L19A 3T0FA 4BOYA 3MZ0A 2FKNA 3SBOA 5BNZA 2DE0X 4NULA 2XLCA 4CKEB 5DI3A 2OXCA 1NVVR 3EXHC 4OAQA 5EESA 1NUAA 3ORSA 2AFHA 2B35A 3ZZMA 3WIBA 3CXUA 2ARKA 3QFCA 4OQZA 4WDRA 4YLYA 2QLLA 2EFJA 5CITA 4P0PB 1NW5A 3I9MA 1OXKB 3S55A 1UJMA 3QXSA 4LDQA 1PW5A 1TMGE 3IAM1 2PZFA 5F3RA 3VNSA 4J7CA 4QHSA 3R7LA 2QN7A 3ZDXB 2ZE7A 3ZNQA 1NLFA 5DTIA 2X5JO 2H06A 3R3YA 3LQQA 5IYZF 2V3CC 3FDXA 5J2UA 1CCWA 4EGSA 1ZLXA 2R1VB 1DG1G 2XMCA 3JWPA 3LQ2A 4JI1B 8ABPA 2H1VA 2CZQA 1NR5A 4QOGA 2DWPA 4JYCA 5AI0A 3UT6A 3Q98A 4Z49A 2O5VA 4JKYA 7MHTA 3GDGA 3OQBA 1RIFA 4PANA 5DRYA 3T38A 1H2XA 3ZTYA 1QUFA 3RYCB 4PQGA 1V4NA 3IERA 3NJ4A 3IAM6 2CNWD 1T8UA 1Q74A 2IYTA 4KTTE 1FC0A 2FR8C 2UUBB 1WKCA 3A05A 3ADOA 3IOCA 4OHCA 3ZWPA 4R31A 2VUSA 3TSZA 2IYQA 2OBNA 3CW9A 3N59A 4WOJA 3WGGA 1A8HA 4CM4B 5IUNC 4Y98A 3OJWA 1O7JA 3CVJA 4UUNA 5K0BA 1XU4A 1LY1A 2VVTA 2ZI3A 4TLAA 3RYIA 4QREA 3HJTA 2HJSA 1H8HA 3RSQA 4ZGWA 3R9WA 1IL0A 4ZTUB 3K0KA 2IBSA 1MRNA 3CH4B 4PSDA 3ZHVA 2X0EA 3MPOA 1QHIA 1UM9B 1XWFA 1NPDA 1L6RA 3FB4A 1OLSA 2IYVA 1A5TA 2B7CA 2VHZA 2AN1A 3JQAB 4C4PA 4UNRA 1I3LA 5IKPA 4O8ZA 1SUEA 1IWBB 2CL0X 2R6HA 1D5WA 4DDTA 5JAHA 4K9OA 4RPCA 2O0HA 5AKLA 4FEAA 1CW2B 4YRRA 4P4LA 2BBTA 2VPIA 2Y0BA 5K3OA 3N2GB 4X5OA 3T9BA 4PC1A 5HJ2A 3WTBA 4DM3A 3T1YB 3M5PA 3JQDA 4YP5A 4NFHA 1JQKA 3M6IA 4UMDA 2FG6C 3N75A 4ZRNA 2DPYA 2B92A 2XIQA 3NHWA 3EF0A 4BS9A 2L2QA 3RLFA 2HIHA 4E88A 1Z6GA 5THKA 1REQB 1X14A 2F55A 1V95A 2QKYA 3M6LA 4R4JA 4A2WA 1GQSA 5IVIA 2J9ZB 3LRTA 3RIMA 2IELA 2P6RA 2YMQA 3QMVA 1FSPA 1J70A 3GLGE 3HVIA 4MO9A 2DH5A 3OO1A 2WP8J 3T9DA 1MOSA 1A8QA 2OK7A 5KYWA 1E5QA 2FG7C 1EAMA 4RIFA 4TMZA 5D5HA 2ZULA 1A8UA 1LK5A 2C5GA 4L28A 4HWKA 1JR3D 3LNCA 2P6MA 4UTZA 5AK5A 1WS6A 5KSOA 1F12A 2PUHA 1XCJA 3A1VA 2ZUUA 1JQLB 1KSGA 1BXGA 4GGMX 4AJ9A 4B4DA 3I2IA 5KWSA 2VSYA 1NI3A 4GOOD 2TYSB 2TMDA 4TTQA 3EOAI 1VYUA 1J1ZA 1G7TA 1QLJA 4KZKA 1W25A 3IR7A 4UEQA 4F6LA 1SUSA 4ZI7B 3P9QA 4D56A 5HOEA 2N0SA 3A0UA 3EXG2 1JQEA 1ODKA 3IEUA 3SP1A 4J16C 1B3RA 3NTUA 5T8KA 2R6JA 4BE9A 4DMKA 1QO9A 4G0YA 1IHPA 2G88A 1ZESA 3JYQA 1C1YA 1V11B 4MJ3A 1ZGCA 4KN6A 4QXOA 4EQZA 1B0UA 4D8UA 3Q88A 4IV8A 3QITA 1ECFA 3NRJA 4HAWA 5A5FA 3GRFA 2FQQA 3M6VA 3MINB 2W2VA 1VXOA 4WK0B 4DC0A 1LA2A 1SULA 4M8LA 1K8XB 4AZ3A 4CF6A 2A58A 1H3FA 4PO1A 4TKUA 4BYGA 4KGXA 4D96A 4R2KA 3VFDA 5IP5A 4U0JA 4FLEA 3RTEA 3ZG6A 1I3KA 4DKJA 3EFHA 1DKRA 2C8JA 4N6NA 1WLSA 2KJQA 4Q82A 3EC1A 1JI3A 4IHKA 4TKVB 3V00A 2IHJA 2Y0DA 2O4CA 4QXAA 3E4DA 3KYJB 1RI3A 1ISIA 3EC2A 3NT5A 5E2IA 2PKXA 1JP7A 4YAUA 5L51A 5ILGA 3M1YA 4CR7A 1NVXQ 2XEDA 5GP1A 1XAJA 4R0MA 1IMOA 1ARZA 4JI5B 1IVYA 2I1LA 3HCWA 3LZDA 3FMIA 1D2CA 4DIOA 5BR4A 4N5NA 1O57A 5EHZA 5ALLA 1MC5A 3K4QA 3OCXA 1J9ZA 3HCBA 2PSDA 4HGYA 4HXFB 1QRTA 5AM0A 3RS2A 3LY7A 1U2DC 1M33A 3WS7A 1XVAA 1QVRA 1FS5A 3VNAA 3H6GA 2OOKA 4OI1A 3KL4A 3OIUA 1Y8ZA 5EOVA 3S44A 1A2QA 4R0NA 3Q3JB 3C3JA 1G6OA 4WSOA 3IIJA 3SFZA 1G19A 1MHPA 1R5JA 3TEMA 3RUFA 4BN4A 3G2NA 2O2ZA 4WFJA 2HYIC 3KJEA 4IIXA 4AT1A 3NVMB 4S05A 1LCIA 2NU7A 1XRLA 1OYWA 4WESA 4F11A 3DV9A 3LLSA 4C0QC 1Q0UA 4RJIA 4AKIA 3DT9A 3OF2A 2Z56A 4OXQA 1B0AA 4GI2A 4RXMA 2B9VA 1E9VA 1MVLA 5L7YA 3T5BA 1H0HA 1W0KD 2I2XB 3FUXA 4PQEA 2DLDA 4YT4A 2QIOA 3LUJA 4Z9FA 2F4VB 1HYGA 3T1OA 4ARSA 4K0RA 1ESCA 1Y3DE 2WTNA 4XUDA 2QZSA 1JR3E 3T3PB 3ESZA 3TR0A 4QODA 3AHJA 4Z2AA 1TEXA 3A1DA 2VJQA 1ND6A 3GEBA 4Q37A 4XVCA 5JZOA 3C48A 3IP7A 2R4TA 4W5RA 3FZNA 3OQJA 1CB0A 5L7TA 3U0VA 1ONBA 3CLHA 3C7TA 4P3NA 2CLFB 1NJ6A 4OJMX 4NBWA 1PR0A 4HGPA 4LI3X 3KLMX 4UVHA 3GLHA 1QVVA 1U3FA 3PICA 4OK6A 5LA6B 1P2UA 3IHLA 3TSYA 5CT8A 3KKQA 3ICEA 1JMVA 3LBFA 2IEAA 4J0FA 4S1NA 5B3AA 2A86A 5FI1B 5CDFE 1GZ6A 3H86A 4LDJA 4ZO8A 5I51A 1TKBA 3CF2A 3MEQA 2OWDA 2FVXA 3FSGD 3LXRA 5IJ9B 4DBLE 4M1SA 4DIMA 3GEDA 2GN1A 1UKZA 4Z2YA 5ALFA 2H59A 4Q7LA 4YECA 3KXDA 1WB6A 2BMEA 3H4IA 4DBZA 4EYEA 4GDFA 1VBNA 5TMPA 4HYYA 3I28A 1SMKA 4A36A 2RHOA 3H42B 1VMIA 3IXQA 4PHCA 1FFCA 1MAVA 2GOYA 4DQXA 3CCBA 2V7VA 3QUTA 3MB8A 1V1JA 1TJPB 1YUBA 4GZ6A 1ZH2A 1EUCA 2Z2JA 5K0NA 4QDOA 1YL6A 5TY0A 2OYRA 4BFYA 2CK3A 1DHTA 3IHWA 4MPJA 3ELYA 3OEEA 2FMXA 1V6AA 4MEJA 3UXMA 2C1XA 1T1EA 1M34B 2H16A 1DGQA 4PHGA 5BV7A 5K9ZA 1TVKB 1P4JA 4FE4A 3SC4A 3FOCA 2RGYA 3CF6R 3OIWA 4LZZA 2QW1A 2XOEA 1AOXA 3T7EA 2QX6A 2XUHA 4CL8A 2PH1A 4RLHA 3U16A 4DMFA 2XYRA 4XARA 1ZD5A 5LL6P 5F7OA 4K81B 4TM7A 1UOEA 1BROA 4KSYA 1W4RA 4EELA 1QP4A 2J9FA 2YICA 1MEJA 4H7HA 4Q1CA 4DLSA 3ISJA 3JQPA 4CE6A 1AZTA 4IXDA 4F2WA 2QD4A 1E1QA 2HMWA 3R4VA 2O8EB 3A1TA 4M86A 5EIHA 3BIJA 2K87A 5GZ1A 3MWEB 1R4NB 1RRVA 3IUEA 1I4LD 2QJWA 4IXNA 4O4IB 2IYXA 2P4SA 3RKUA 5KC9A 2ZR0A 1O6GA 2RHLA 2BKVA 2XGGA 1FUYB 5IULC 1M8FA 3EEBA 4RFSB 3D7LA 1XTBA 2V8BA 3GGOA 3HN2A 3TNLA 2DT5A 2AN4A 1U7DA 4QYTA 1C7ZA 2ZWPA 1FSGA 1WF6A 3AEUA 3I2FA 5LA6F 3ABZA 1ECJA 5FPQA 2IEZA 2C3OA 1H5NA 1WBDA 1D6NA 4NZMA 1X2BA 2QP3A 1QH8B 1PLJA 2ETXA 3DV0A 3NHPA 1O94D 5ITWA 2PCJA 2ZUFA 1Z6PA 1Q0SA 2WJZB 2D5CA 4WOBA 4X71A 5JMPA 3MNFA 5JW6A 1NJ5A 2RB5A 3FF1A 4YVFA 1MO4A 1ANKA 2CCJA 3QWFA 4NE2A 5DGXA 4JI8B 1AY0A 1VKNA 2AK3A 2WKQA 2NM0A 4UDXX 3MIIA 4BQFA 1IVNA 1E2NA 1IEWA 3LV8A 2C99A 4QJBA 4UATA 1Y6GA 1DARA 4TWIA 3DNPA 3G85A 4GECA 1W4LA 4MI6A 4BNDA 1UPAA 3WZ2A 3G2IA 3O8OB 4BLOA 1YRQA 3R0IA 3DW1X 4JP1A 5AI9A 4KVGA 4RS4A 2GK6A 1HTWA 3D7NA 3RARA 2NU8A 3I23A 3LP5A 2O1WA 1DRVA 3IQGX 5L3VA 1T1SA 2P78A 3RRYA 4MOWA 1Q22A 3MOSA 4D0LB 3ESXA 1XA0A 1TT5B 3JCZA 1RZUA 2G5CA 2PA0A 2O7QA 5ILOA 3NLLA 2AG5A 4XPIB 2WUDA 4DUPA 4P31A 4ZDKA 3SG0A 4D9BA 2CFTA 4Y1RB 5LLSA 4R8SA 1O08A 3BJRA 4XQ0A 4ZFNA 4TYWA 1T10A 3OT4A 4ZT6A 3LP6A 1XZKA 2HRQA 1GZSA 1P7ZA 1SOMA 2QTHA 4FEEA 5DF1A 5C53B 2A9FA 3GWGA 1AA6A 1RT9A 2W2MA 5KX5A 1Y8RB 2H9IA 1Z0JA 2VAMA 1C41A 2P9HA 3DBVO 3NASA 1KF0A 4E14A 2AE2A 5KNDA 3IEXA 2O54A 4WLNA 3PQDA 1IXSB 2ACKA 5DP1A 1DCTA 4UUAA 3QF4B 1THMA 4H17A 4UE3S 4B6GA 1DWUA 2R25B 2WIFA 3K94A 4X8MA 4Y30A 3DE1X 2HDHA 5P21A 2YRFA 4R3NA 2IW1A 2QQ5A 1DEXA 2RI6A 2ZRDA 5K0LA 5M29A 4OGWA 4LZNA 3T4EA 1OH5A 1PJ4A 4PGHA 2QSZA 1S2NA 1PD1A 4EMBA 1YQQA 2MSKA 2WWXA 3CX4A 3JATA 3JQAD 1GTVA 4IINA 4QVKA 2F3TA 2DFNA 2FE1A 3C41J 1MA0A 5JD4A 2I91A 3B6ZA 2VBIA 3ASUA 3KQVA 2XY4A 4NYJQ 1CJKC 1HZZC 1W581 4G0QA 4NBTA 1OXTA 4C7VA 4RDXA 2C94A 4RIHA 3T3MB 5IAOA 4MKZA 1JLHA 3WISA 4OGKA 3EGXA 3J80A 3DJYA 4M1ZA 2Z5VA 3PA8A 5FULA 2RARA 3W1WA 4LS3A 3OAAD 1U94A 2ZSUA 1OHHD 3TN7A 1PJZA 3IUSA 5KWJA 2SNIE 2BW0A 4J0DA 3K4PA 2E4XA 3GLFB 5D5QA 4ZQIA 4UW9A 3V55A 5KWIA 1XZMA 4BKUA 3CEMA 1PFQA 1U31A 3KT6A 3T0IA 4C03A 1P2FA 2F67A 3A1FA 3ELDA 3EVGA 4I08A 1MB3A 1XAHA 5TF0A 1GUBA 4DLRA 3B1XA 2X3FA 5F9MA 3G89A 1Y81A 2JFZA 1FYVA 3BXOA 1DAGA 2JCVA 2AFHB 3B60A 3WBFA 4MA0A 3QLJA 3ECAA 1DEAA 4ZVLA 4MUBA 4PEVA 1Z26A 3ZZTA 3OJCA 1Y80A 2OHVA 3VKWA 2RKBA 1IZ0A 4O63O 1K7FB 1Q84A 3BTVA 3FRHA 4W1RA 1YMVA 4JK3A 4EJ2A 5M5BA 2ZJ6A 1SG6A 2F64A 3RTGA 4J0GA 2M1ZA 3KUUA 4EL5A 2YDYA 4QWWA 1DFHA 4BTEA 3JAKB 2AGVA 4XD7D 3Q8XB 4DADA 4X45A 3E7DA 2CD7A 2WSSD 1YCDA 2V7PA 1IDOA 1Y98A 1KVRA 4LJSA 4ZT3A 3RRXA 3UZUA 1DEOA 5JI2E 2OD7A 1MOPA 4QUEA 4LN1A 1WPXA 4WZBE 4RGQA 4CLRA 3EZ7A 1I1QB 3LYLA 2VT6A 3MGCA 2GESA 2IOFA 1O5IA 3IULA 4K9NA 2NSJA 5IBQA 1T3ZA 1YTLA 3EAQA 1HRDA 3I1JA 3L7NA 1QFSA 3TLCA 3X1MA 1L4LA 4U2DA 5DGDA 3Q0IA 3VYUB 4KTVE 1Y1TA 4FEYA 4XQGA 3DBHB 2G0TA 4MUNA 3RYHA 3PL5A 1G41A 1EJ0A 2LE0A 5DSTA 1BYIA 2AI1A 2EJVA 1DJLA 4TPKA 4V0KA 3L0IB 4NZYA 3RV3A 3DGFC 3I2JA 2W7TA 3VZQA 4KPYA 3T1TA 4FJ2A 2IWRA 3SEQA 1OLSB 1SU4A 3A6ZA 2DWUA 4PSCA 5HUJA 1Z16A 3AP3A 4LGVA 5CVJA 3PUHA 3MOGA 1IZ7A 1NUQA 1NG1A 1UWLA 4JJ7A 4DEXA 1KRWA 4B76A 1V1MB 4IQ4A 4Q01A 2V7EA 3CZQA 1PEAA 2BH9A 1POXA 3OQHA 3X1YA 4Q7QA 1XYGA 3ST7A 4Z3OA 4JFRA 1XRSB 3RIHA 3T52A 1YJ8A 4HX2A 5TT1A 3GXBA 5FO1A 3FOZA 3GJTA 2PO7A 4HY3A 4IDFA 3TW8B 1IBSA 3CLUC 1F20A 1W52X 1IK4A 1Q21A 2BEWA 3GA5A 4BQIA 4HC4A 4F9FA 1XZAA 1NASA 4IIJA 4MGZR 1NMXA 4I4NA 2QLNA 1J90A 5J2UF 4RETA 2P2YA 3FHLA 1G3IA 1NJSA 4YFVA 4GHWA 3SBXA 3U9TA 1PL6A 3NAMA 2V7TA 3TWOA 2ONYA 4X65B 4JT9A 4Y8VA 3JPWA 5KYWB 5H16A 1CEYA 2XHZA 2C2MA 1A98A 2PJZA 3FWKA 4BLVA 5FEUA 4WZ6A 5I5GA 4KR6A 1AKMA 1L9KA 1M7GA 2VK1A 1QDEA 3C5VA 3BA6A 2ZUBA 4M1EA 4UEWA 1V5WA 4EFKA 4TMYA 2VF7A 3KIPA 1BE0A 1KY4A 3O4RA 4IVRA 4IXWA 4N39A 4OFXA 4XLTA 1O5TA 3AZQA 1L5LA 4RGVA 4RVCA 3GA7A 1L4EA 4ZRDA 3TFOA 4RVGA 3TFQA 2I4MA 3HYTA 4WJKB 4QPPA 4QTUB 4PHFA 3ZX4A 4ARCA 3K9HA 5EJ6A 1QRUA 1RWVA 1ZJYA 4ILKA 2JZNA 3CKLA 3MWDB 2FDCA 4KO8A 3AXTA 4KLRA 5CG1A 3K5PA 2W8ZA 3OKFA 2C4HA 2AV6A 1TKAA 2HRDA 2LDBA 4J07A 4NCNA 1FMLA 1P1JA 2ZR9A 4HH0A 5IK2D 2Z9DA 3H2ZA 1DC8A 1I7PA 3QWHA 3G0GA 4Q9JA 5TVKA 4WJLA 5HK9A 3FUCA 4XW2A 4TKUB 3C5WP 5DGTA 1U65A 4ZQGA 2BFMA 1E7SA 2IC5A 1H65A 3E18A 3WYFA 5ALIA 3FWNA 4KBFA 4DTIA 4RZ2A 5JANA 1NDQA 3FROA 3V4FA 2OZPA 3WHIA 3EGDB 3HU2A 4N0EA 1OY1A 4RK6A 5A2QA 5TQ0A 1HYQA 3I52A 1YS9A 3AFHA 4RZSA 3WB1A 4C7OB 4DM4A 2Q6LA 5IJWA 4QTZA 3LY9A 2VAPA 4KXUA 4R9NA 4DLKA 1OF1A 3B20A 1RJFA 2C0QA 4QDXA 5DN9A 5A3SA 3CH6A 1K5GA 2B8NA 4KIGA 5E6UB 5EFOA 2VAWA 3OPQA 1WB9A 2BFWA 2QXUA 3PGXA 2FSIA 4D8XA 1T1GA 5LQNA 1U7TA 3GCGA 4G1EB 3ZWYA 4Y7DA 4REQA 2DC1A 2IDMA 1AKWA 1AHHA 3IP9A 2PMEA 2Q4BA 9LDBA 1NFFA 5MFZA 4EQ6A 3U9SA 1Q6YA 1ZU5A 3KR9A 5GY7A 1PYGA 4GBMA 4MYRA 3P5BA 4MK4A 1E8MA 5BW4A 1GXSA 3F6SA 1CUVA 3GIDA 4JBGA 3CH5A 2V45A 4U6QA 1U8CB 4GE3A 3D3JA 3Q3IA 2NU7B 4URYR 2XCRB 4MLZA 4CLHA 3UYKA 3UTDA 1XXHA 2GPTA 2TSYB 4RSGA 1U0EA 2ATVA 4LW8A 2WB4A 1D07A 5TNXA 2B37A 1KFEB 3HFRA 5JCJA 5JYDA 1YTUA 1JHUA 1P75A 3C7AA 1QUEA 1I4OA 3BMOA 2PZBA 2ZYRA 1Q1ZA 3AR9A 4S0XA 3OTOB 4HWRA 3RYHB 4YY3B 2ZYVX 2O57A 4ND1A 4KRXA 4RUKA 1THGA 3GUYA 4UBMA 5EVJA 4BAGA 2HQSA 4EB6A 4Y2SA 4DCJA 5E1OA 1L7NA 1QQ5A 2JH3A 3IP1A 3T34A 1OBCA 1USWA 2J4DA 3JYHA 1E2KA 1MXHA 1R9GA 1RYDA 2X8LA 2HHAA 1W34A 3V1KA 5KJ6A 5ESWA 1PKEA 1CUUA 2YN0A 1GAQA 1CDOA 2NZVG 1AS0A 3D8NA 4XWYA 3STTA 4WCFA 1QTRA 4LDPA 2W4MA 5JQGB 1BHJA 3CYFA 3QG1A 4DCSA 4H2DA 3GLHB 4C07A 3RAJA 4CRWB 2AVDA 1Y48E 4X62B 1VSQA 2JFVA 2WUWE 3OQIA 3C3EA 4A73A 1SA0B 2HU2A 1EK2A 4PPYA 4XRRA 3EXIB 5JJKA 1XQXA 1UPFA 4HAZA 5AVXA 1Z2PX 1QFZA 3DEIA 3PWTA 3UAGA 2ERXA 2PLAA 4UJ3A 4IHAA 3WLKX 4AW9A 4CG0A 1GIAA 1AC5A 2YWCA 1QIEA 1GYPA 3SIPA 3A7EA 2GZRA 3K6KA 1SHLA 4J2OA 1XHEA 3QE0A 1KI9A 3A3OA 3Q15C 1FSFA 3S8YA 2J41A 4D44A 4YMSA 3LBIA 4H7PA 2BR5A 3KVVA 3CIOA 2WUEA 3QIVA 1SVOA 4PC3A 1QP7A 4PGMA 3O03A 2JJ1D 3EVTA 4C7XA 1S9HA 3M6XA 4CIVA 1U9IC 5AVZA 1R00A 1MV8A 1XLTC 2OHFA 5A2GA 5JARA 3NC1C 3KKLA 4OHZA 1X7YA 3V4LA 4G4SP 4AYTA 2GHTA 5HVNA 4ZAYA 4I46A 2NOAA 3L4BA 4C5CA 4JCCA 1E3WB 4YRDA 4JXXA 2ZTMA 2MINA 4D4LA 4YUAA 3E70C 2B2CA 3PGJA 1RQLA 2V55B 4X93A 4XPZA 5ER6A 3EMKA 2P2GA 1DADA 2F9LA 1GUDA 2XRMA 2XNKA 3RRJA 2W6JA 1SD5A 4PXYA 1KYTA 4U7TB 3T9EA 1L8QA 3JVDA 4IGEA 4ZI2A 2J9FB 1U8FO 1LW6E 2HXSA 1TIBA 1IK6A 4OX9Y 1BD4A 2PNFA 2JGAA 2FPGB 3BICA 2Z57A 2AXNA 3WYEA 2Y6UA 4K86A 2NTYC 4RMJA 1UIMA 2WZQA 3ND8A 4BX3A 1WQ3A 3KZVA 4GRAA 4IFTA 2XH8A 5EGSA 3KD3A 3LUKA 3FDIA 2HLHA 3TCNA 1M2NA 2JEOA 4AX4A 3ONVA 3W5HA 2Y05A 2O2IA 2Z8YM 3AIMA 3EDQA 5CYPA 3VR0A 5LSAA 1AZSC 1BG6A 4IOLA 2OILA 4F21A 1Z2DA 2J6BA 4NS4A 1UZAA 1JIIA 3HEMA 2IQ5A 1UZNA 3AEUB 3QUSA 3O2JA 4TRNA 5AVJA 1HNWB 5JDCA 3BC1A 3SWWA 1QC5B 2ZP1A 1UWVA 2PYDA 5JZ9A 4JIGA 2XR1A 5A0TA 3KOUA 2J59A 1G3QA 2FOXA 4GX1A 3UENA 5F52A 4XWOA 1NBMA 3E4CA 3DV0B 3GFVA 5AMXA 1AE1A 2XF8A 2IYAA 2FPIA 4ZP1A 4JOBA 4ZK2A 5HP4A 3VTKA 1GL6A 4KQEA 2XUGA 2ZSAA 3LC0A 1YFZA 3BE5A 3JW8A 2CDAA 3E23A 3NV7A 4L5BA 1ML4A 4BNDB 5FBVB 2QPAA 1OGJA 4LG1A 3DLTA 4BP8A 1SCDA 3T5MA 4O0LA 4EPRA 4XRGA 3FNHA 1AJEA 1Z37A 2EARA 3UW1A 5CIQA 5J4VA 3MXTA 3RTAA 3HI6A 3H8VA 2X0KA 1FDOA 1IRXA 2VH2A 3WHPA 3B1JA 4ND5A 5A4DA 5JECA 3E48A 4KNVA 4DMRA 5ICGA 1ZJZA 4CDNA 3GGPA 8ADHA 1KBZA 1XVVA 3BWYA 4C0WA 1XMIA 5LU9A 4UAUA 3SYMA 1E58A 3LLCA 4TLCA 1Y3CE 3EW7A 2WJWA 2YW2A 4Y0AA 3S28A 2BZGA 1JEJA 4W9MC 2NUBA 2ZJ3A 3BF7A 1KFKB 1U81A 1KI1A 2ZRNA 2FWMX 1ID8A 2H4YA 3OY7A 4IXMA 2YJZA 1T6NA 3AQ4A 2J31A 1M74A 2RKWA 4U6SA 3DEAA 4R81A 4GP9A 3G5UA 1AB6A 2JAWA 4WKPA 1C1HA 2PBLA 1J99A 1A76A 3Q10A 3P4XA 2YWRA 1Y6RA 2BTOA 4ZGBA 2JDIA 4L3OA 1H8HD 3HV0A 4EA8A 2L18A 5IKOA 5C4MA 4HN9A 5A02A 4N7MA 4UUPA 4PBTA 3RQSA 4FOTA 1R6XA 3FSEA 4HBZA 1KYIA 3NG1A 2OHIA 1II0A 3EY9A 3GFPA 3L02A 4Q18A 3ZDCA 3FOBA 1L7AA 1JAZA 5G0TA 1KNQA 3BFPA 4PGGA 3UQYS 4Q3NA 4KXYA 4MR8B 5CDYA 2R0QC 1MJHA 1M8GA 2XD9A 2V3VA 3QXHA 1GA6A 4MV1A 1E9RA 1A2BA 1F17A 3WA7A 1R6VA 1A9OA