4RTRA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and a 5-bp non-canonical site (gttta )
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
244
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 84
structure length 244
sequence length 270
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtrA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtrA01
2AOVA 3DMHA 1O54A 5HIJA 1WXXA 3IV6A 2VDWA 4AUKA 3HVKA 4QDKA 1RI2A 2XYVA 5C0OE 1N2XA 1BOOA 3CBGA 2CKDA 4YUVA 2EX4A 2O0LA 1O9GA 1RI3A 3DXYA 3THSA 1G6Q1 3HVIA 3G8AA 2FK7A 3C3YA 5JR3A 3FZGA 3EVCA 3P97A 5DT2A 4F85A 4GOMD 3BZBA 4KIFA 2UYCA 4YMGA 4RTRA 2IDJA 1KIAA 4PCLA 2GLUA 3I58A 2AN5A 3G88A 3CKKA 4ER3A 4IWNA 2V74B 3P9CA 5DXAA 3S68A 4M37A 5DM4A 4DCMA 4HTFA 4BY9E 4MTLA 1ZGJA 4M38A 2C7QA 2C7OA 3BWBA 2B25A 3ELYA 3FTEA 3R9XB 5DM1A 3GIWA 1G8AA 4RX1A 3FYCA 4OBWA 4MIKA 1NW5A 4DKJA 4QVGA 3GJYA 2ERCA 3JWJA 5EVJA 5FHRA 5BW4A 5EMKA 2P3QA 3BGVA 3B3FA 4PYNA 3SX0A 4CWAA 3I64A 3OE5A 1VQ1A 3EEYA 3FUVA 2HNKA 3G2PA 3GRRA 4RSRA 2BH2A 2AOUB 1L1EA 3MCZA 1L9KA 5DRYA 2IH5A 2H00A 1DL5A 3LCCA 3T7RA 3EVGA 3ER9A 2JHPA 5LQUA 4IV8A 5K0NA 2H11A 3OPNA 1EJ6A 3GRYA 3A27A 3OU6A 1VE3A 3DOUA 3LX6A 5K0FA 1SQFA 1BC5A 3F4KA 5CVDA 4CTJA 2G72A 1SVUA 1VP3A 2PV0A 5CCBA 2GS9A 1UIRA 2UYOA 2ZULA 3TPZA 4JXJA 1QAOA 2AOTA 2BR3A 1JQ3A 1NW6A 1JG2A 4RTPA 3MB5A 3EVZA 5E1OA 3SM3A 3NMUF 4PIPA 2GPYA 1SQGA 3MERA 1U2ZA 3P2IA 4DCGA 4GOND 1R8YA 3GGDA 3KPWA 5CCXA 2EG5A 3EMBA 3DLCA 1AQIA 3FTDA 1WZNA 5KVAA 2VP3A 4RVFA 1NW3A 1AQJA 2ZBQA 3BWYA 3DMGA 1TW3A 3KR1A 2AOXA 3LGAA 5LQKA 4CTKA 4DM3A 2PT9A 1RI5A 4V0RA 4WVLA 4C04A 3KQOA 3OZSA 4M36A 5DTMA 5EHIA 5EZQA 4ATNA 4GBED 4RTQA 2G71A 2PX4A 2Q41A 5EC8A 3L8DA 5T64A 2QRVB 5EMMA 4DF3A 1R18A 3GCZA 3KQSA 3LHDA 4PGGA 4BLWA 4YUWA 2B78A 1HMYA 4PYLA 2P7HA 5HFJA 3SMQA 3EGVA 1KPGA 2CMGA 3H2BA 4XUCA 3R0QA 4RTKA 2PBFA 3KR2A 2P8JA 5LQCA 1ZQ9A 2QE6A 3DH0A 3KKZA 5K0EA 2HMYB 1YZHA 1DUSA 1WS6A 5M5BA 1I9GA 2EFJA 3G5TA 2PWYA 3NWEA 3SSOA 3PVCA 4P7FA 5DM2A 3G89A 4A6EA 4ER7A 2OO3A 2B9EA 4GC9A 4QTUB 2JH9A 3HM2A 1NW8A 2P1DA 1VLMA 2NXEA 3E23A 3I5UA 2G8NA 5FUBA 3TLJA 3EGIA 2XBMA 3CGGA 3MGGA 1HNNA 4FS8A 4X61A 5DLYA 5DXJA 1M6EX 2ONZA 3LSTA 3DULA 3M6VA 3NWBA 4XCXA 3EEOA 1Z3CA 5DX1A 1XDUA 3EVDA 1F38A 3FRHA 2BR4A 1X1AA 2CMHA 5K0BA 2ZLBA 3UA4A 3ELWA 5GIPE 4DQ0A 3CCFA 2O07A 4G56A 1KPIA 2O05A 3LKZA 2YUIA 5H02A 5LQJA 5FTWA 3EVEA 3LCUA 3M4XA 2QYOA 3M70A 5EIWA 1OR8A 2IGTA 3BWCA 3MTEA 3HCEA 4ZTBA 4H0NA 4O29A 3UJ8A 3KU1A 4OA5A 5EHGA 1N7IA 3GU3A 2ESRA 3TRKA 3PX3A 3QV2A 1X19A 5K03A 1R00A 1Q0SA 1IY9A 3B7PA 4YV2A 4R6XA 1FPQA 3KPJA 5K0JA 1ORIA 1QAQA 3OZTA 3Q87B 5KS2A 1ZKDA 1WXWA 3HCDA 3SR4A 2I7CA 2OB1A 3G2MA 2P3LA 4HGYA 4R8SA 5B1SA 3TOSA 3EGEA 4DA4A 2PXAA 3UBTA 4PYMA 4XUDA 2HWKA 4P7KA 1JTFA 3R24A 3KQYA 5FWAA 2YXLA 4FT4A 2HV9A 2BM9A 4F86A 4YMHA 3KPUA 3LBFA 1EQAA 4RVDA 5K0GA 4OBXA 2B2CA 4E32A 3GRZA 3DTNA 2AN3A 3LDFA 4CKBA 2IIPA 2PWPA 3A7DA 1JG4A 1YUBA 2I62A 2N47A 4GC5A 4V0QA 1YZ3A 1L3IA 1NBHA 1TPYA 2NNWB 1Q0TA 2YX1A 4RVHA 3HCFA 3OFKA 2JG3A 5DPMA 2UZ4A 3BT7A 2C7PA 3SSNA 2CWWA 3C0KA 1VPTA 5DRTA 2Z6QA 2LD4A 1X1DA 3OZRA 5BP7A 4R8RA 3E05A 2PX5A 2IPXA 3FPEA 3PFHA 1L3BA 5DM0A 5BXYA 2JHAA 3BGIA 1JG1A 4C05A 4PCAA 1X1BA 3NJRA 5FA8A 3TQSA 3B89A 3VSEA 2YTZA 2AN4A 3KR9A 2F8LA 4DZRA 3VC2A 1ZG3A 2OBFA 2PJDA 5EMJA 4EMSA 4QQNA 5ICCA 5KYGA 1YB2A 3G8BA 4U7TB 4FT2A 5IH3A 3AXTA 2Z6AA 1P91A 5EGSA 4PGHA 4C08A 1MJFA 1XDSA 3PT9A 1V39A 2OB2A 2AR0A 2PXXA 3GRUA 8MHTA 1XVAA 4PYIA 2FRXA 1SKMA 2O06A 2Y1WA 3KQQA 3KQWA 3A25A 3HA3A 2EJTA 3KQTA 4WXHA 4E31A 4QPNA 3BKXA 3T0IA 1ORHA 3UWPA 3PTAA 2PXCA 3HEMA 2AS0A 1KPHA 3AWIA 3JWIA 3P8ZA 3FUXA 3LBYA 5CM2Z 3T7TA 4KRGA 4IV0A 4PYOA 2ZBRA 1BKYA 4LWOA 1NV8A 2FK8A 2VDUE 4X63A 2ZTHA 4FR0A 5FWDA 3CJQA 2G70A 3GXOA 4P7JA 5EQJB 3BWMA 5K8VA 5FADA 4OX9Y 3HA5A 2FHPA 5LQRA 5CUQA 3UJDA 1AV6A 5DTQA 2ZZKA 5GP1A 3TKAA 4EK9A 4F84A 4IKPA 1G8SA 2AZTA 3TM5A 3FUUA 4RTOA 3O7WA 5DWQA 5HZMA 5E9QA 1NE2A 3GDHA 4Z2YA 2Y1XA 5LSAA 4YV0A 5CVJA 1JTEA 5D1HA 1KR5A 4L7VA 3A7EA 2NP7A 5FCDA 5DX8A 3G2OA 2P41A 3TR6A 1JG3A 2FYTA 2P35A 2ZIGA 4A6DA 5K01A 5GIOE 3ELUA 2GH1A 4RVGA 4C06A 2R6ZA 3OE4A 1XCLA 1BHJA 1AF7A 4QQKA 9MHTA 4C03A 1PJZA 2OYRA 1O9HA 1T43A 1JSZA 2BM8A 2E5WA 4KVZA 5DTRA 4ER0A 2PVCA 3T7SA 1UWVA 1RJFA 1FJXA 1SUIA 2VDVE 1M0EA 2IH4A 3G7UA 3UJBA 3UJ9A 3E8SA 3ORHA 3FRIA 3HCBA 3O31A 4HTFB 1NV9A 2JH8A 1IXKA 1RI4A 5EZSA 1ZGAA 4X41A 2IDKA 2I6GA 3B3GA 2O57A 4KDRA 5EEGA 2OXTA 4E2XA 2YQZA 1KXZA 2WA1A 3B3JA 3BKWA 4HC4A 5DSXA 3BXOA 2ZWAA 3UZUA 2G1PA 1R6AA 2JHCA 1QYRA 1KHHA 3V8VA 1QAMA 2PX8A 3O4FA 3LDGA 1G38A 3DR5A 2P7IA 5CVVA 5FHQA 3D2LA 5KQRA 2YXEA 4MHTA 1G60A 1RJEA 3HVJA 2WA2A 3P9KA 4R05A 1D2HA 2XVMA 2FPOA 2PT6A 4P7GA 4RYLA 4R6WA 3A4TA 4P58A 5E9WA 4GUAA 3SVZA 4KDCA 4RTJA 4PONA 1H1DA 2XYRA 5GWXA 3TKYA 1XDZA 5E9JA 5FQNA 3LCVB 4U7PB 3JWHA 3SSMA 1RJGA 1EAMA 3M6XA 5CVEA 4BP1A 4YUYA 2A14A 1JSXA 1KYZA 4GF5A 3BGDA 3PS9A 4C4AA 5T6BA 4POOA 4PIMA 2AOUA 4YUXA 4QTTB 2HR1A 4AZTA 1RI1A 3MQ2A 3REOA 2DPMA 1UFKA 3NW9A 3M33A 2ZVJA 2AOTB 4RV9A 3AY0A 1JQDA 5IKMA 4BLVA 3KQMA 4ISCA 2VS1A 4CKEA 3KQPA 4RTSA 1NT2A 4GOOD 5CVUA 3NDIA 5E1MA 1F3LA 3NDJA 5GOZA 3NVKI 3A26A 5K0CA 5F2KA 5GM1A 2NXNA 1DCTA 3Q7EA 3EVBA 4LECA 5CIYA 4Y30A 5ERGB 2VZ9A 4CXMA 2PX2A 2K4MA 3FPHA 2PSSA 3KQVA 1Y8CA 1SUSA 3RIEA 5EKUA 3G2QA 3FPGA 2IBSA 1MHTA 1WY7A 4XUEA 1IM8A 4K6MA 2ZBPA 3EPPA 3OU7A 1QANA 2AVDA 3LL7A 3P71T 4PYJA 5EOVA 1XJ5A 3CVOA 3GWZA 4GEKA 3P9IA 1YF3A 1XCJA 1NW7A 3K0BA 3LECA 4E70A 2QRVA 3AXSA 5JUWA 3HTXA 3PFGA 5FULA 3U81A 5HIKA 1SG9A 2NXCA 3CC8A 4HH4A 4HRAA 4B17A 3FUWA 4AZWA 2ZSUA 3SXJA 1JQEA 3P2KA 2GA9A 4EKIA 4E33A 3FUTA 3R6TA 3HCCA 3K6RA 5K0LA 5K09A 5GINE 3DUWA 1YFLA 3OFJA 4KWCA 4BLUA 5K05A 3PLAE 5ICEA 3TM4A 3FPFA 2PGXA 3P9NA 2GB4A 5C1IA 2ZW9A 4QPPA 4AZSA 3GO4A 3NTVA 5DX0A 5T67A 1FBNA 3MTIA 3PX2A 4UOEA 4NECA 1WG8A 4OA8A 5E8JA 5FA5A 4AZVA 2NP6A 4RTMA 3X0DA 3ELDA 1VBFA 3QOWA 4FGZA 3UA3A 1R8XA 3UJCA 4LG1A 4OQDA 3ME5A 4FSXA 4OQEA 3I9FA 3C6MA 4BP3A 3E7PA 2UYHA 3P2EA 3DP7A 2JJQA 3FPJA 4FP9A 2ZZNA 2YXDA 2FCAA 3ERCA 4AX8A 3UJ7A 3NVMB 3C6KA 3R3HA 3I53A 5E1BA 2CL5A 1D2CA 5CD1A 2ZFUA 3KPVA 2ZIEA 4E2ZA 1INLA 4E2WA 3C3PA 1QZZA 3OCJA 2ZZMA 3DXXA 4EKGA 1M6YA 1VIDA 3MCTA 4HGZA 4DMGA 5E2BA 2BR5A 3TFWA 3ER8A 5HILA 2HTEA 1I4WA 4RTNA 3G5LA 4FSDA 5EKXA 3IYLW 3GNLA 2ZCJA 2NXJA 3FYDA 3JWGA 3ID6C 5DSTA 5EIFA 3LPMA 5P8WA 2PY6A 4MWZA 3B5IA 1B42A 1FP1D 3RODA 3FTCA 1ZHFA 4PYKA 1JR4A 1NBIA 2OKCA 2QY6A 5ICGA 3IHTA 1EJ0A 3HA7A 3VYWA 2AOWA 1I1NA 2OZVA 3FTFA 1L3CA 10MHA 5LQAA 3M6UA 3HCAA 4PYQA 1VP9A 1TW2A 1R74A 2H1RA 3THRA 1P39A 3UFBA 2PLWA 4ER6A 3WSTA 4E30A 4EQZA 4EVIA 3DLIA 5GM2A 4HG2A 3IEIA 3UJ6A 4X1OA 2Z6UA 3HP7A 5LQNA 2QM3A 4LWPA 1KYWA 3DMFA 2ADMA 2YVLA 5HOQA 5KQSA 3CJRA 2IFTA 4GQBA 4YUZA 3AJDA 2B3TA 3UJAA 5F2NA 2PKWA 2UYQA 2IP2A 3VC1A 5BW5A 1VL5A 3GRVA 5E1DA 3CJTA 4QDJA 2EJUA 3QOXA 2KW5A 5HIIA 3TMAA 4C07A 3MHTA 2C7RA 4M7RA 1P1BA 4E2YA 5D1NA 3SGLA 2ZWVA 2P40A 2WK1A 5EEHA 1YFJA 3EMDA 2R3SA 3DXZA 1P1CA 3EVFA 5EG5A 2ZIFA 3RW9A 1NKVA 1G55A 5EPEA 3LDUA 5HIMA 1XTPA 5MHTA 5G02A 2NYUA 4HSGA 4PWYA 1XXLA 3LKDA 3MAGA 4X60A 2XYQA 4KW7A 4FZVA 3KHKA 5C9ZA 2DULA 4CKCA 1FP2A 2OPBA 1N7JA 3OU2A 3HVHA 3KPYA 1PRYA 5E8RA 2V7EA 4PNEA 2ONYA 1KP9A 3ANXA 3PB3A 5E2AA 5FQOA 3KR0A 5HEKA 4GOLD 5LR6A 1EG2A 5EMLA 4KIGA 4ER5A 4YV1A 3V97A 3HNRA 2OY0A 5F2OA 2I9KA 1RJDA 2AVNA 2P3OA 4RWZA 3M6WA 2BZGA 3BUSA 4PINA 5ICFA 2ORED 7MHTA 2XVAA 2IH2A 2YR0A 3EVAA 1D2GA 1EIZA 4RTLA 1X1CA 4MQ4A 4QVKA 5U4XA 2IBTA 4Y2HA 2GAFA
chains in the Genus database with same CATH superfamily
1FLNA 3TRJA 1O54A 1C3JA 1NFQA 4CTOA 1RI2A 3QLVC 5A3QA 4A2PA 1V3QE 2FUG1 2EKBA 4O1MA 4JGGA 5JROA 3FYUC 3USES 4IEIA 5AT1A 2JI8A 1CYDA 4R9NA 2IBMA 3TO5A 1KYYA 1ZU5A 2JCXA 2E2WA 3FZNA 2FB9A 2C2YA 3PK0A 2SCUA 2IV7A 4BGVA 1M33A 3BZBA 5AXDA 3U48A 2RB4A 4YMGA 1O5IA 4HD8A 4EA8A 4NU5A 1HLGA 5AKYA 4A92A 3K6KA 1VLLA 2D59A 2X0FA 5DCYA 5HUJA 1GAEO 2AXNA 4S2UA 3UJPA 4BY9E 2C7OA 4MK4A 3H2IA 3VR6D 4C0AC 2WE7A 3IP9A 5JSHA 5LB4A 3SJCA 1BQ4A 1G8AA 1ODTC 3OHSX 5ECYA 5EHXA 4X1YB 1C3OA 4L0QA 3F7OA 2EJWA 4G5YA 5EY5B 1OX4A 5EMKA 4AULA 2FMXA 1OAKA 3ZKWA 3O4IA 3OE5A 3NRBA 4CM6A 1T36B 4J8PA 3AIMA 1YQXA 2QL5A 4GPD1 4BYMA 1E2LA 4FYVA 1E2PA 1TX4B 3GNQA 4Q9DA 4UATA 1AK1A 3AI7A 2NQ2C 2QMEA 4CF5A 4UQPA 4HB2A 2GILA 2YXPX 3QE4A 1K63A 1TM3E 5K0ZA 3JD3A 4LSGA 1QGYA 2H11A 5CYGA 4M54A 1EJ6A 5BYJA 2Q2NA 3WGVA 3EHEA 4KH0A 3WJ2A 2XMGA 4CQMD 4AJ2A 4DNOA 5DHQA 3DNMA 1BQ3A 1KZHA 3NKLA 5TEWA 4ZVSA 2JAWA 3ZIDA 4NDAA 4Y2QA 1DMSA 5DNWA 5ALQA 1II8B 4H3VA 5HJ7A 2ZSAA 1HETA 4GOND 3DHNA 4N6GA 5DHUA 1ZESA 2D4HA 3C1AA 4AG5A 2EG5A 3EPJA 3BQNB 3EMBA 1AQIA 1RYBA 3G2HA 1U9IA 3OQIB 1WCIB 3FOWA 3R0IA 4JSRA 1BWQA 2QRKA 4UVEA 4XYBA 3GLFE 3E8MA 1MAHA 1T9GR 2GRUA 4Q00A 3ENWA 3R7BA 4CDGA 1GPKA 1RI5A 2CK3A 3PDUA 4V0RA 3TEFA 3VPDA 2WHQA 3A3PA 5EZQA 3ESXA 3WISA 3AB3A 2R8EA 1JQLB 1WVIA 1YVEI 1Z7YA 1HDYA 3HKDB 3O82A 5CDGA 1CQJA 1EI9A 2PH1A 4YNBA 4AZ0B 1TKCA 1RFGE 4CF4A 5DWDA 1RZVA 4N18A 2HMAA 1W19A 2F3QA 4G81A 1F2DA 2WD7A 4KQWA 1EWQA 3IUQA 5BWNA 3HFGA 4JHLA 3T1QA 4ABYA 2ZJ4A 4KVFA 3SLKA 3ZYCA 3ZDQA 1K3TA 3KU4A 1T2UA 1RAGA 1ZA1A 4PC1A 4JBXA 3ZU6A 4ZI2A 1NQAO 4PG4A 2PPLA 2VT7A 4HH1A 2OYCA 2NPIA 3T1VA 4AN0A 3I8XA 1U2EA 2O2EA 3DKVA 1YKGA 3M4JA 4D3FA 5JYCA 1L4LA 2YHIA 3EMKA 4ON9A 2G04A 4PBSA 4ZCQA 4EHBA 3A37A 4RCYA 2ZJ0A 2ONZA 2D6FA 4IDOA 1MHPA 4YJ3B 1I30A 4IDDA 5DX1A 2HQRA 1M1YB 1M3SA 1T8YA 3CPJB 2ZLBA 4I9GA 5LN1A 4N9WA 2W6NA 2YZNA 1PD1A 2Q62A 3DM9B 1C8LA 3IOBA 3JATA 1CNEA 1Q1QA 2QYOA 2VHCA 3GLGA 1G8FA 3OIUA 2DPHA 4QULA 1H2ZA 5LVAA 1GJRA 1F0NA 1YASA 3GU3A 2ESRA 4QTZA 5H3CA 2VHEA 5J59A 3FNFA 4G25A 1L5LA 3QV2A 1GZUA 5HCUA 4D4MA 1R00A 3LY7A 4EW6A 1O5OA 5K03A 3BOSA 2OK7A 3TX2A 4EUKA 3ZDDA 1ORIA 3OZTA 1QHYA 1QZXA 1UJMA 2KBEA 2MSWA 3Q87B 5FWYB 3EF3A 4HXYA 1QIEA 2JNWA 3EW7A 3G2MA 1X3SA 4UZSA 3P2OA 5AUQA 5IX8A 5JFTA 4J1QA 4EQ6B 2GUGA 2GHRA 1BW9A 4UU1A 5HFAA 1VE1A 3DAHA 4DNQA 2WSSD 1D2AA 4ZOEA 4Q34A 3C48A 4G0VA 4OFZA 1GKLA 4PU0A 5JH7A 3T38A 1G7TA 1X2EA 3JV7A 3NBXX 5JALA 5GAJA 1KVQA 3LFUA 3VOBA 4G5OA 1Q2UA 2XUDA 3KZMA 4HQKA 4J4HA 4J9VA 4KZPA 1BDJA 1NVEA 1P2DA 1Y37A 2YZGA 4LYJA 5EVCA 1IAVA 1Z8DA 1F4LA 3LLMA 5JMOA 5FRDA 4FYJA 1YQ9A 3OEWA 4H6PA 4QU9A 3TRDA 4J0IA 5LOVF 5CLHA 2H52A 1E1RA 3AUAA 4P3OA 2OEPA 1G9SA 3WSWA 2DECA 2GJKA 4IJ5A 1B7GO 1MAWA 3H5LA 2C61A 1Q7EA 4K9KA 3FGPA 1UPUA 4L8FA 1RVDA 3A4NA 3FCEA 3JSXA 5ENZA 5JNWA 3SP1A 3D7SA 1J24A 5ADWA 3DWFA 3UC9A 5I7EA 2J7KA 3AETB 4DCSA 4BWFB 3FSEA 1IXSB 1MH9A 2ANCA 1ONOA 1IBLB 1DINA 1D07A 5EMJA 1JLHA 1CQZA 4QQNA 2VHVA 1YQQA 3V8EA 4ZOBA 4WQMA 4B4OA 4CZ2A 3QI7A 2YYSA 3M6FA 2PGNA 4HN4B 5E4TA 5EGSA 1JFVA 3ND8A 3NHPA 3OOJA 1ZK0A 1X94A 1Y8RB 4QYIB 5GVRA 1KDRA 1WB5A 1KYQA 2LKDA 3HWRA 4TT8A 5ES3A 3MJHA 1F8YA 3AI2A 3TAUA 2PHZA 3IVMA 3FHCB 5EZYF 2EJTA 3F90A 2XBUA 2XQVA 2WI8A 3C74A 3K5HA 3O21A 1SUFA 3WLJA 4BYGA 2FWIA 4Q3LA 4CODB 3CB2A 1ESCA 1NMZA 2B2NA 3JD0A 3G0IA 1GNVA 3WMGA 4C0JA 2B36A 3FUXA 1A2BA 1B6TA 1PUIA 1YDFA 4KRGA 2QJOA 4P4SA 4RSHA 1BKYA 4X63A 3UWMA 4BO1A 4P3PA 2ZTHA 1E58A 3CJQA 1XPUA 1KGDA 1AXRA 3MWEB 3Q15C 3O5AA 4FHFA 4NOMA 4U9UA 4PSDA 4TZTA 5K3FA 1SCDA 4F84A 2BMVA 2EQ5A 2B4QA 1FU4A 4XDGA 3TM5A 3ZHQA 3FUUA 4RJ2A 5EJ6A 1K98A 1NMQA 1X8LA 3E5RA 4J2TA 3EGXA 4O02B 4YPFA 4PGFA 2VA8A 4O3MA 1RWMA 3CEHA 3LBAA 3Q0TA 3BEOA 1X9HA 4KZKA 5CVJA 2G5GX 4UARA 4DB4A 1Y4UA 3D8BA 1X80B 1BEUB 2VDWB 1RMTA 2KLBA 3I2JA 4PPYA 3W6ZA 5AJVB 4J3FA 5F77A 5G4KA 3OMWA 2GH1A 3Q8MA 1LBTA 3KB1A 1KJ8A 3L8ZA 2DBZA 1M1XB 3H11B 2OHHA 1OXVA 1G8KA 1HE2A 3Q7IA 4Y6OA 1P7WA 1TVKB 2J1LA 3X1YA 2XF8A 2ID9A 3M89A 5I6DA 4MR9B 5I7UA 4JR1A 1FQWA 5MN4A 3EQ9A 2CJFA 1L5KA 2QBYA 3T5DA 4O4LA 3G7UA 2ZCVA 4D81A 4PCUA 2G77B 4I08A 3E8SA 3FRJA 5SZKB 2PG3A 5FIUA 1XRSB 2I4TA 3BJIC 3USCS 3G0BA 4OJMX 5CLLA 1NVMB 4QPDA 1Z2OX 2P3SA 2ZWPA 2JI6A 3BXOA 1E3WA 2I7XA 1XNRB 4DQUA 1KHHA 3PRYA 4R8MA 2PX8A 4E12A 4UEQA 4RD0A 3HNOA 3IP1A 1KQOA 1SG0A 1ZRNA 3B82A 4HGPA 3CLVA 1GA1A 5EE1A 3A1DA 3AHCA 3WL3A 4TMWA 2B7CA 1I9CA 1N5KA 1TUEA 2A94A 1ZINA 3H9BA 3DE2X 4YHBA 1ZOOA 1CHDA 5INTA 4AT1A 1UBHS 2WZQA 2XAUA 3ENVA 4PYRA 1WSDA 2VXOA 3RRFA 2WNHA 4LX0A 1WMAA 2GK4A 5F76A 3FCXA 4O0LA 4FI3C 4NZPA 1QJ4A 3CWCA 2ZR9A 3QK7A 4PRLA 3BFXA 4GSKA 5TEVA 3K0SA 1IUPA 4HLUA 4WJZA 1ZI9A 1HL3A 2Q5OA 5IKMA 1M8PA 4XWYA 3WLSA 1A9XB 1TYBE 4RTSA 3ML1A 3K1TA 3FGZA 1KTVA 4G37A 4QQFA 2K6GA 5E1MA 4ZGWA 3KOMA 2DPGA 1C9NA 4GS5A 4Q4JA 2OHJA 2VAPA 3OQ6A 3FMPB 4XWOA 1YS4A 4G01B 5FFFA 4LE1A 4BFVA 2CJPA 4Y2JA 5CXXA 2VWHA 3T0FA 5I4IA 5D6NA 2GK6A 5JLJA 2N0SA 1Z0UA 1FEZA 4H59A 1S96A 1CJTC 5DV9A 4PR0A 3UXHA 1GZ3A 1MU0A 2FPMA 1UDXA 1TF2A 3B6MA 3MYYA 4G5FA 1JFRA 3VBEA 5CFMA 1LK5A 1AUQA 1PJCA 1YL6A 1FDSA 2ECKA 3SS8A 1GLNA 1GNPA 1QS0A 1UOPA 2FX2A 4QA9A 3VI3B 1MT0A 2BRUA 3AC0A 2GWHA 3K0BA 5AI6A 3GUZA 3WA6A 3UGJA 3HADA 4PAQA 3R0XA 4LMRA 3KT8A 4JYBA 3RE1A 1NXXA 4BTEA 4ZCLA 3SXJA 3P2KA 3H86A 5JCOA 1UKZA 3FUTA 5F73A 2XYHA 1UADA 4HWPA 4OP2A 1W1IA 3ZHTA 3FPFA 1KZYC 5CCDA 2CLHB 2IEBA 2D7CA 2W71A 3G5MA 4LV6A 3IV7A 4WKBA 3HH8A 2PKXA 3OCXA 3V4ZA 1VDZA 1P45A 1ZW6A 2IDMA 5AJTA 4YI5A 1Z25A 4UBKA 4YGYA 1KOLA 1RJ9A 3VGJA 4C14A 1OB2A 5C81A 3N8IA 3D2BA 4JA2A 3GBVA 2I3AA 1GUYA 1PN3A 2C7GA 1WUTA 2QTVB 4FGZA 2PZ8A 4FXPA 5B1IA 1R8XA 3TCXB 3VZBA 3L0DA 3DZFA 3RFTA 2B98A 3HUUA 1TM4E 3LLVA 1S6YA 2OQVA 2JFYA 1QHSA 1ZQ1A 5KTOA 2A58A 1C29B 4QDOA 2D74A 3N53A 3HJGA 4FIZA 1X15A 2FFHA 4IHAA 3RS5A 2YINC 1INLA 3GV0A 1QZZA 3I04A 4JKOA 4XIIA 4ZT2A 1RIIA 4BNGA 2XQIA 2QAGA 4S12A 1TFUA 3K0HA 4OQMA 3HFJA 1JTVA 1YAHA 2Q9AA 3GY0A 5BUCA 5KKAA 3BE4A 3F5FA 2IYWA 2IVZA 3VR6A 4HNVA 3UB2A 2NXJA 1WDWB 2P9HA 3QUQA 3C3BA 4D6YA 2QN3A 3K1YA 1XP5A 2QT0A 2WICA 3U13A 4D9EA 5K0SA 3ND5A 1W5SA 4LS3A 3F7NA 2NN3C 2OZLA 1RXEA 1WVMA 1T5IA 1WVGA 1JMKC 1CVLA 5DGDA 3VPCA 4OIFA 1T6BY 5JANA 3TAXA 1N3IA 3C3CA 1IQPA 5I9SA 1N4AA 5CH3A 2C5SA 2FZGA 2VJAA 1U02A 4E30A 3IUEA 4M76B 3T1HB 3VJKA 2B21A 4M8KA 4RPCA 3RWMB 2WYUA 3LP6A 1RYDA 2BGWA 1H9CA 3WA7A 4CQMA 3VSCA 3AJAA 1KYWA 4MHSA 1IG0A 5BWBA 4DQDA 4IIJB 2B3TA 1UFQA 1M8KA 4HDSB 2QD3A 1CK4A 4ZU3A 5HZKA 4Q47A 3VZDA 4EY5A 4JP2A 5EUQB 1FUYB 1M1YE 1A9RA 1FFDA 3X1DA 3U1VA 2EKPA 2AXPA 5FNVF 2JLSA 2HO5A 3BYZA 1WRBA 4ZZ3A 2QEQA 3DPSA 5A6SA 3R7FA 2PO7A 3O9ZA 2KSQA 4N03A 1OFHA 1PJSA 2XXJA 1Q95A 3L5OA 5ALSA 4AP9A 4NFHA 5C7YA 1GZ5A 4G0OA 1ZVMA 4PG8A 3WR5A 1AB5A 1FVXA 4JLJA 1MH1A 2QRZA 1G55A 1NXVA 1UP7A 2VHYA 3HACA 2V97A 5IC5A 2EFHB 2I2BA 4CL2A 3DHYA 3JD1A 4PWYA 1ZIOA 4DA8A 3S2SA 2XCIA 1U99A 3F2IA 1IM5A 4ZOCA 2B83A 4V0MA 3MRVA 4OJQA 1V1MA 2FFRA 1SCUA 1FBTA 1G63A 3AGQA 4L4RA 1LY1A 2H59A 1T1EA 1L2TA 3ZZTA 4I1OA 1U2DC 2QV0A 4KMSA 2D2VA 4ZAYA 4DXAA 4D0SA 4L3OA 5EP1A 1ENZA 5FQOA 3RSQA 1P4HA 2W6CX 3BRWD 3KR0A 4GOLD 1O57A 4MJXA 4MMYB 1KY3A 1IJBA 5CK4A 5HEKA 4F0JA 2VBGA 3HNRA 4I9NA 4IOJA 4XRRA 4NFSA 1CDDA 3D1VA 4YT4A 1GGEA 1QZ3A 3ESAA 4MRRA 2ORED 5KWIA 1OW3B 4OQXA 4PSUA 1IB6A 1T4GA 2VNKA 5DNVA 3KLOA 4J0JA 1DB3A 3AP1A 3MCUA 1APBA 2X6TA 3SEQA 5ISMA 2DFTA 1U4NA 4O4JB 3DMHA 4GLLA 4OQYA 2CBXA 3ADBA 1RAEA 4BQSA 3FNRA 3ZE9A 2CKDA 3ADOA 2O8VA 4X7PA 3AWDA 5H3LA 4MLCA 3DAGA 3DVRX 1SVNA 2JEZA 3O8RA 1U28A 3QKRA 2QXYA 1TPZA 2VNAA 2P6NA 3A2NA 5IARA 1FK8A 3P4YA 1KQGA 2G5TA 4PQGA 2C4HA 3N6RA 5M29A 3I83A 2O5CA 1QFJA 4CRWB 4QM7A 2CL7X 1KAQA 1M1NB 2NXWA 3B8HA 2ZB8A 3K35A 1ZM7A 5BNWA 4PHTA 3Q3JB 3QJYA 2PS0A 1UBRS 1SOMA 3I32A 3R7NA 4X8MA 3WWOA 1GEEA 3A4YA 1MIOA 5JZOA 5IASA 2CJYA 3FYCA 4Z3DA 2Y0DA 4EZIA 3DC7A 4OBWA 4PO9A 4GP7A 3V4LA 1GZVA 1WV0A 1JDNA 3UYKA 3O75A 1Z22A 5HKAA 1MRNA 1QZTA 3QXCA 2C3PA 3ZXYA 3FMVA 4OJNA 2R47A 3BZUA 3GBPA 3KJEA 4GYWA 1IVNA 3LYUA 2J9FB 2VPZA 3UOWA 2X9VA 3CRZA 4R69A 1Q44A 1CERA 1MT3A 1KJNA 4EI9A 5JQGA 3O3MB 1YUMA 2A3RA 1H8EA 2Z2JA 5FOSA 1DIOB 2OP1A 2VTDA 3N39C 3Q1LA 3QOFA 3K1AA 4IBOA 4WEQA 1XOIA 2IXGA 1Y5RA 2K2QB 5CH5A 4EPYA 4B83A 3A27A 1W581 3H5NA 1GTRA 3LKBA 2IYZA 2GKSA 2IKSA 3JU3A 3E2IA 3VU0A 4MS4B 1BDBA 3MXOA 4LXTA 2QSYA 3GZNA 4CM4A 2YS7A 4B79A 1EXWA 2GERA 2ORVA 3CRW1 1P7ZA 3PA6A 1F12A 3BG5A 4RV5A 3T61A 1HEUA 3UYLA 5YASA 1E4VA 3P2IA 1ZONA 3NM5A 4W5HA 4I4TF 3U61B 1IEWA 3KPWA 1TUIA 2I4MA 4TS9A 3BJEA 4BQRA 2ASVA 1LLFA 3DTYA 2IEIA 1NIPA 4RVFA 3O73A 3W6PA 4EOGA 3DMGA 1RCTE 3UXMA 2CJWA 4F97A 2FAXA 3ZJVA 2A5LA 1U4SA 4XFJA 4EW3A 2XQFA 4J7CA 2Y99A 2PD6A 3ET4A 5IJ9A 4J2OA 2J3LA 4IFIA 1L5VA 5K6AA 2BSQA 3LHDA 1O95D 4M8SA 4INOA 4ZO6A 4JXZA 1HY3A 4XQCA 3SOPA 2P7HA 4NYJR 2AKYA 4UUBA 3WGYA 3P9RA 4RTKA 2F1IA 2YYYA 4F45A 1T0PA 3Q1KA 3ZQKA 4XW2A 1ZQ9A 2VHQA 3DH0A 2WU3A 1S02A 3OQJA 4S1WA 1DUSA 4CNQA 4CLEA 1LVHA 3ETNA 3T0GA 1YCGA 3QFCA 4DIKA 1XDBA 3AV3A 1AS2A 1EM8B 3VU3A 1L8XA 3FDIA 5FUVA 4GLFA 2F9MA 3LAWA 3K94A 2NZUG 5FL3A 2FG7C 3OLZA 4O2BB 5G53C 5HKLA 3GZJA 3SS9X 3KUUA 4FGLA 1ZUD1 4K26A 3UO8B 1SHLA 3DZGA 4ZO9A 4CQJA 1JE1A 1XVTA 5IVDA 3M6LA 3IRVA 1FJ2A 5B57C 1HDOA 1M10A 2C2GA 2XGGA 1OZGA 3ABIA 3HU2A 4RDHA 5B3LA 3CCFA 1DV1A 4NCIA 4L0DA 2YUIA 1DRWA 3IP3A 5CEJA 1KJYA 4D9GA 5EIWA 2R2GA 1YDMA 3DYBA 3RIGA 3SJUA 2IUSA 3L0YA 2PBZA 2W22A 4TT3A 4V39A 4KQHA 4UEWA 2MSEB 3NVDA 4QEKA 3HGQA 1VYVA 3KJXA 2P0YA 4G85A 4XYGA 5CT6A 3DT6A 4R6XA 3ZDCA 2OLJA 1HORA 5AVVA 4OKSA 1ORVA 4MVWA 1C7EA 4N39A 1LRJA 2AEFA 2G7MC 2OHVA 4MI6A 4QBFA 3TOSA 4MZDA 1II9A 4US0R 4PYMA 4F4CA 4ARCA 1GQSA 2PUDA 1V4BA 4O2AB 4F3NA 1OI2A 1PTJA 1C9MA 2IPOA 4F4JA 1EQAA 2PGLA 3V42A 3GUHA 1W34A 1KI6A 3VR2D 1S8NA 1U2GC 2IJGX 5JCXA 4JVLA 3SIXA 4GC5A 4K9QA 1UOEA 1OFVA 1N2SA 1EX9A 5EJEA 4AVYA 1D0VA 1X7XB 4AL4A 1U1DA 2GCPA 3AI1A 3RVOA 3BK7A 5EJGA 1DXHA 4J0QA 4X8LA 2MCFA 1P9RA 1DFIA 2CCKA 3OX4A 1BRTA 3GLFA 3T3NA 4X6XA 2HHCA 3G8DA 2TMDA 3KKQA 1J6UA 3OOHA 3OZRA 3SIWA 4DV2B 2Q50A 1YU9A 3E05A 1JDPA 1AQUA 3A10A 3OE7A 5ESXA 3WK4A 2XD4A 4YY3B 1REQB 4R2MA 4A2CA 4DXDA 1IY0A 1US8A 3EPRA 2XB2A 1AZTA 3QELA 4PLVA 3CPHA 3KR9A 1U8TA 1X39A 3KHSA 1W4BA 4B71A 4LF7B 4H6XA 5JD5A 5A1TA 4QSHA 3KOZA 2Q4BA 3NAGA 1AE1A 2CFCA 2PU5A 3AXTA 4QFBA 4QPJC 4RPKA 5IH3A 3RGWS 3VYUB 1IWOA 1IN8A 2F9LA 3MXTA 4M8NE 1Z74A 4TYMA 2JVJA 3AEUB 1VFNA 2AR0A 2PXXA 4U7GA 4ZPXA 4ZMRA 1XVAA 4I8IA 1U94A 2PR7A 4CLRB 1C3VA 3H5RA 4CPDA 2YICA 5JWHA 5EJ5A 4LXXA 4MA4A 2AWOA 1Y5NA 2WE8A 3KQQA 4XOUA 1S7GA 3FFAA 1JLLA 1JU4A 3VX3A 4HL6A 3EZYA 4C3VA 5EJ7A 4RULA 3F3YA 4GRDA 5HVNA 2C2MA 1AS3A 2VUTA 4R40A 1JWLA 4WEOA 5BYAA 4DCPA 3DHWC 7YASA 2HHLA 3E5HA 4GZLA 4BNDB 3O4HA 3AF0A 1CB7A 2DFKB 3CH5A 3PLRA 3NASA 1KI9A 4LUCA 5HS4A 2ZB7A 3G23A 4MB2A 2PO5A 3BFVA 3C98A 5CJ2A 4BCCA 1GAJA 4OHYA 2I76A 2ZZKA 5AIAA 4LBWA 4MRSA 5ERYA 3RTDA 5KYUA 3SFZA 4IKPA 1QFYA 2AZTA 3NH6A 1I6KA 2ORIA 3DFZA 2ECQA 5E9QA 4YIHA 5J58A 3LRXA 2ZBEA 4YAJA 3ZZMA 1CYEA 1YS2X 4C2AA 1XJWA 1MC8A 1ZRSA 2OQRA 4W5RA 3E9MA 5CAEA 4XQ9A 3NG1A 2E1RA 3ZU5A 4DZZA 1U4OA 3RYFA 2R6ZA 4HWSA 4LGVA 3AL2A 5EWJA 4LZNA 3VUEA 1FLVA 1TTTA 5J2TA 5H3HA 5DCLA 2GKGA 4Y2VA 4H08A 1IJFA 1ZBQA 4YEDA 1XL1A 4BAUA 4MPPA 1O9HA 3D3JA 3QPUA 2UZAA 5DTRA 5EWLB 3RBZA 4AJHA 4KE7A 4C76A 3Q8KA 3FI9A 3PQ8A 3LXRA 4WNAA 3IJ5A 1FJXA 4LDJA 3ZHCA 2A0UA 4J16C 2B4TO 2CCGA 2CDRA 1LDEA 1QK4A 1ZM4A 1HTBA 3AI3A 3DVSX 1YKFA 4Y6LA 5FTKA 4HTFB 4BP9A 1GPDG 1IXKA 4GIBA 5TQ2A 3U3XA 4B7XA 2W6MA 4D9NA 1EK0A 4TPKA 2ATEA 2HBZA 3IAAA 4DCOA 4FFPA 1ENPA 2I1LA 1SJ9A 3GRPA 1R37A 3NS7A 4G65A 2QVLA 5FBQB 3MA0A 3E4DA 1TADA 2CV2A 2EWVA 1EVEA 1GA6A 2BEWA 2PH5A 1N1GA 4I4NA 4NJMB 2H1OA 3ZLJA 2YXEA 1I0IA 2NUAA 4YB8A 1VPLA 2AUNA 5KYWB 1XR3A 4D3SA 2P2YA 2RHRA 4IINA 4Q7EA 4XRGA 2HIMA 3A4TA 2B8TA 3VVMA 3EUAA 4N0MA 3WGZA 3GVPA 4KB5A 5JT1A 1M8GA 1C4XA 1ZH2A 1P0IA 3CTMA 5FI3A 3U4MA 2YY7A 1W35A 3F96A 3LJKA 4FILA 4OB7A 5JS6A 4KBYA 1WZCA 2H16A 3UUGA 1T8RA 2AEMA 2A84A 4Y6RA 3G2KA 4XGKA 3RLFA 3P9PA 2I67A 3JQDA 3NRJA 3ITKA 4MUEA 4OHKA 1NF9A 2C9ZA 1WMFA 2IV3A 3DEHA 4WFQA 3MQ2A 4JJ7A 1Z39A 2ZPUA 3EVTA 2WIKA 3DZIA 1K2VN 1TVCA 4C0XA 2VSQA 1NDUA 4H17A 6PFKA 3OLQA 4LQLA 3HLYA 5K2OA 3KP1A 3ROMA 4MW7A 1YS1X 2UAGA 4XIYA 2DY0A 2WU4A 4RSMA 1DCTA 1UBJS 3ITNA 1SVKA 2IUTA 1VLHA 5IEBA 4BNUA 1TJ3A 1TJYA 2VDRB 3OBIA 4YIKA 4X6LA 4N3CA 1J5XA 4MLDA 4BBJA 5C53B 1MFZA 2POCA 2WWHA 3GHYA 3KDSE 3WNBA 1D4AA 2EKDA 2J07A 4TL6A 1IM8A 4YXFA 1U1GA 3DD5A 4W5OA 2OTCA 3C3EA 3KVVA 3TYXA 4H7IA 4D8XA 5LA6B 3FVRA 3R6DA 4PZ9A 3KLNA 4YJGB 4B46A 4X84A 4Z54A 3EOBI 4U7WA 1Z5ZA 1UPBA 3LNCA 4LHWA 2MSCB 1MO6A 1Q0UA 5I7WA 1E79A 3IA7A 1ID1A 2XWBF 3ZR4B 1XMQB 3K70C 2ZUWA 2D5LA 3HTXA 5TVGA 3PFGA 1ULHA 5HIKA 1WW8A 4UHKA 2IIVA 3K8ZA 1OF1A 5EGNA 2ZSUA 5FBRB 3UBMA 1JFLA 4WBNA 3D6JA 5LKAA 4Z0HO 1L1RA 3UK0A 5GINE 2E6UX 1XZNA 3HU5A 2XRYA 1YL5A 1Z6ZA 2XR1A 5CFZA 2WWIA 2O23A 3B9QA 5ICEA 2WD9A 2XMRA 2REOA 3OF3A 3P9NA 3PRHA 4N6NA 4WZAE 3OCCA 4RCVA 2AG1A 1ONNA 5J9FA 3EC1A 1NMEA 3ZZNA 1JJBA 1CR4A 2FUCA 2Z0MA 1EA5A 1YS9A 3V2HA 4F1JA 3HUDA 2P2GA 3MTIA 4UOEA 4EX7A 3HHPA 3MG9A 1NFFA 3X0DA 2X2PA 4UCXA 1MTOA 2XT6A 3AILA 3B6EA 2WW8A 2UUPA 1T10A 1U98A 1ZD4A 3G59A 4FYXA 4LOAA 4OQZA 4OQEA 3U62A 4BKRA 3EUFA 1HV8A 2DAPA 3W8DA 5TMBA 5JH7F 3C6BA 1XTJA 1GU0A 1MR3F 2MSKA 3ADPA 3KWLA 1YS6A 3PTZA 1PX0A 4ZQGA 2A1UB 2QTRA 2X5OA 2AMVA 1P60A 3E61A 3NP9A 4YX9A 1IN1A 3U7RA 1A5AB 1BA3A 1GRNA 5T4FA 1EBBA 4PLHA 3VTKA 2UXDB 2X3FA 2X8LA 4DPMA 1JT9A 4QXRA 2G63A 3RUAA 3WLLA 1JHQA 3WBBA 3UMVA 2FP3A 1PFQA 2FFQA 2GNOA 4JBNA 3L1HA 1DKPA 2FX3A 3GNLA 1LFDB 3IS3A 3KTOA 4P31A 4PEVA 5HHTA 3UY4A 1CUYA 2QLTA 4L9WA 2FPKA 3N05A 4OHPA 1GNTA 1CFJA 1FP1D 1Q16A 3R5FA 3RKUA 3ZNNA 4D42A 3H2JA 5F9MA 5TV2A 1SU7A 2EC5A 3GFVA 2IY7A 3GXBA 1Z17A 1IY8A 1LZKA 5I4BA 5JNVA 3CW2A 3ZS8A 1TB4A 1D2NA 2HMVA 2X76A 3TI9A 3ZJ5A 3RRYA 1RLMA 4CMAA 4ND3A 5C5CA 1NSFA 1R74A 1L4BA 4Z53A 1GOTA 2PLWA 3ZV6A 2QUHA 5M3BA 2XTJA 3W8NA 4CF6A 3IUMA 4HX2A 4WMLA 3BORA 2QAIA 3L07A 4QM6A 3B5JA 2Z6UA 2QE7A 3L40A 2CSXA 3ZJUA 2YVLA 4D4LA 4ZYUA 4BAZA 1CX9B 4HGQA 5EKTA 2I2CA 3N6VA 4C20A 2XRMA 2JJ2D 1HDEA 3CX8A 2G9UA 1XMXA 3ZNOA 5T3UA 4AK9A 3KKNA 1ZMBA 2OC4A 1AVTA 3CJTA 1VJGA 3LX8A 1JALA 3A6DA 3MPUA 3IX7A 3OP1A 4GVLA 4PXAA 1HFWA 2YY6A 2P4EA 3RS3A 1GNLA 2WJYA 3D6TB 4LYFA 3P9YA 5D1NA 2FW9A 2NVOA 4BNLA 5AIBA 2JKYA 5JTTA 2VRWA 1G6HA 4K28A 2OO5A 4BO4A 1PBTA 1RXSA 5TARA 3HUEA 5EE3A 1MABA 1O95A 5F1OA 3TBHA 3VZPA 5HIMA 2NPOA 1RYYA 2Z6VA 4HGRA 1SU6A 4UEOA 1PD0A 2B1RA 1JQ5A 1RXIA 2C8KA 3G9XA 2WJJA 4BX9A 3KUKA 4D8UA 5JDIC 1T9CA 2FPUA 1B6SA 1QG4A 2Y9MB 4TX1A 2IWHA 4LY9A 2VDJA 3KQHA 4FHGA 4YACA 1N7JA 1IHPA 1SWWA 4HF7A 3TJZA 2X1MA 3E22B 4S35A 3U4AA 3WADA 5HK9A 2VK8A 1SB9A 3PL5A 2OM6A 4GXTA 3ANXA 5E2AA 1T6YA 1PT5A 2GAAA 1A8PA 1QYVA 4FDMA 2IKQA 4S0XA 2Q6TA 4XD7D 1EG2A 1KC1A 4F72A 2ZUBA 5TPZD 3WIOA 4R1QA 1NTOA 2WYVA 3IIIA 3QVVA 4O4LF 3M6WA 2AT1A 3BUSA 2FWJA 3LUCA 5D3QA 1XCPA 4F71A 1Y6GA 3LIPA 3NQ41 1U0NA 4B3DA 4U4AA 3SZOA 4C88A 1VLJA 5BVHB 1NIJA 3M5CA 3N59A 3TGPA 3B2NA 1X1EA 3KKOA 2JRCA 2ZBUA 4IIHA 4BMXA 3RYIA 4YDSA 2AQIA 2ZRAA 3C3YA 3G8AA 3JD2A 3DFFA 3PF9A 4IZHA 3EVCA 3JASA 4OVKA 4DCNA 1RAFA 4ETWA 3FKJA 3JYOA 3TQTA 1K6IA 3GG2A 4LMPA 4YUAA 1V5FA 4URWR 1M2EA 1QHFA 2LNDA 1Z73A 4MVCA 5A71A 3CKKA 3TLAA 4NOJA 3FY4A 2PS3A 5H4GA 5FBZA 2NZVG 2QXUA 4KH1A 3IE0A 3CZAA 5JSUA 2BPOA 4MTLA 3LC0A 4C30A 1Z82A 1JLSA 3I9V6 5DM1A 1P9OA 3QVGB 4B3FX 4AKEA 1U2SA 5AI8A 2Q5FA 1ND5A 2X0KA 3DBLA 2RGUA 3I6BA 1M34A 1ZUNB 3GJYA 3EZXA 5AM4A 3LCRA 3EDOA 1CUSA 5CXUA 1NRJB 5LQMA 2HO4A 3L4KA 2Q5QA 1O96B 1NUTA 2C84A 2RK3A 3KCNA 1VQ1A 3PWZA 4V02A 1EFCA 2G9NA 3RTCA 2GAJA 2G09A 3ZY2A 5JXJA 4PZUA 2AOUB 4H7HA 4MIOA 1O0SA 1T8TA 3E1GA 2FZVA 5JARA 3UG7A 4H3KB 3R7WB 1WABA 2QRMA 3ROXA 3LCCA 2WJZB 1KNXA 4QO8A 5HCNA 3F2VA 2HQSA 1IEXA 1FDTA 2ZYDA 1M1UA 3P0JA 2Z1DA 3EQ8A 4M89A 3S6JA 2EG9A 2I22A 3KKEA 4CEHA 2O8DB 1TK9A 1VPDA 4P36A 5AKZA 2W2TA 2OZEA 3WYCA 5FFMA 5CCBA 1Q74A 3EB9A 4IIUA 4ZYXA 4QUBA 3BXFA 2P9GA 1FFYA 1RACA 3EGCA 4MW1A 3M3HA 3GLKA 4R2XA 3RC9A 1ISJA 4O4IB 3KB6A 5G0VA 1L5RA 5FKJA 2FW8A 1U2ZA 4YCAA 3DV2A 4Z4CA 1PNTA 3ICWA 5CCXA 4I4CA 4TSFD 3LYLA 1HEYA 2KLHA 1NP3A 2PT7A 4Z1MA 5KVAA 3BERA 4QRHA 3INTA 2HLHA 4ENWA 4IH9A 3CN7A 5A0FA 1J2JA 1N5RA 2G9RA 2QPTA 3QXGA 2GBLC 4G41A 4QARA 1ADCA 1EBFA 4RC9A 1FXUA 2XWQA 4EB3A 4MW4A 2PX4A 5AI9A 4OI4A 4WKOA 2YVAA 4OX9B 3UXYA 2B37A 4QRDA 4RXUA 2QLFA 1E1QD 3KD2A 1WPRA 2F17A 2J3JA 2HSJA 4DWWA 2FMFA 3ONNA 1E3IA 5BOVA 8OHMA 4PSKA 2P4UA 3ON5A 3W5VA 3ROKA 1NHWA 4JWKA 4KN6A 3WLNA 2JJ1D 4AKHA 2EZUA 3BIWA 3IBTA 2X41A 5IJXA 3PE3A 1T6ZA 3DCJA 2FZKA 4ZAFA 3E9CA 1QRUA 1R5OA 2BISA 3N74A 5BN5B 4CG3A 1V47A 4AS3A 3ZD6A 2CHFA 5ALFA 3THWB 2MWMA 2OV2A 3DONA 4WADA 3I5UA 4K88A 3GPCA 2XY4A 1TCCA 2CZGA 3IDAA 2X0NA 3OG9A 1XAIA 4CG1A 2YWCA 1I4EB 3GOQA 4MVJP 2GVZC 1JHXA 1QWSA 2C3OA 2HCFA 1O8BA 1CKEA 1X1AA 1S4QA 2OSBA 2V7QA 4NCKA 2PRIA 3FSRA 3Q5GA 3AV0B 3HXPA 5CB4F 3I6MA 4I5EA 1T9HA 1VCOA 3PSHA 1OFIA 5K20A 4JKIA 4U0KA 1ENYA 1U9JA 3D8UA 3HB5X 1F2UA 3D4PA 3IR5A 1AQLA 4JBIA 3C3WA 3HVUA 5IAGA 4MICA 2MMCA 2GSWA 3C5EA 4LRXA 5AH0A 5BVGB 3FAKA 4AMGA 1GV0A 1N6HA 1SHKA 2OB1A 3CU5A 3V8MA 2BMWA 4UTRA 2B7BA 3GFFA 2NSJA 2HREA 3E2PA 4G67A 4LWZA 1N75A 2YHBA 1FRVA 1ZEJA 3BAZA 2C57A 4YP9A 5JMPA 1GGMA 2CCJA 3UMBA 4CIYA 3ND9A 1UBGA 3MTGA 1W94A 3H97A 2FWRA 3GJSA 3NHSA 2W43A 4MKGA 1CUFA 1UXHA 2GXUA 2Q5LA 2PRJA 5A3JA 4J1TA 3RRXA 3SZRA 4Y1EA 3BILA 4BJ6A 2HQBA 4EY7A 4Y9RA 5LZ4A 1L5QA 2X15A 1RRCA 5EE5B 4RK7A 4AKTA 3CVXA 1CJUC 1MLDA 2W2QA 1LDBA 3RNLA 4CM7A 4PZAA 2ZSHA 1ICIA 2D5IA 1COWD 3I42A 5DDIP 2H9AA 3JQQA 4B80A 1X1DA 2IEZA 4XSVA 3CCBA 5L40A 3HSYA 3R8FA 1GG2A 1QV9A 1FVFA 2I3ZA 4MV7A 4UFOA 4HX9A 1C0LA 3U3ZA 1Q92A 1HNWB 4YCSA 4F1KA 4TRRA 3W5BA 3KRTA 4YONB 4MDHA 3UENA 4RDXA 3BN3A 4L85A 3ISVA 3WRVA 4IFBA 4F8EA 2JGFA 2VPIA 1H6DA 5IDYA 4J7XA 1Z4KA 1OGYA 2ZR0A 3L1VA 5HJ5A 2BBTA 5FXMA 4BQIA 3Q7RA 2ZVQX 1H6AA 4KO2S 4LVOA 2QHXA 3GELA 2PZFA 2A92A 2W7TA 2QN2A 1N1EA 1JH9A 4U7DA 3IOCA 4DRXB 1QIJA 2Y1WA 3JX9A 3WG9A 4EO7A 2XIQA 3E84A 1KAOA 4F4HA 3ZYZA 4M9SA 1GSOA 4MR8A 4FE4A 1YXMA 3EZ7A 2G1AA 1G19A 3WMWA 1S9HA 2WF9A 3HEMA 1RAHA 2AS0A 3W5IA 3T7TA 1GPH1 1A77A 2QNRA 3GLVA 1E77A 2ZDGA 3JQ7A 3ORRA 3WX0A 3EC7A 5E3JA 1AJEA 4TZKA 2VP4A 3IR6A 5FADA 4BLQA 4C1NA 4ZGGA 2QTGA 3AEKB 1P19A 3ZE0B 4AXXA 5IF9A 4PC2A 2D1QA 3QPDA 1NAIA 1V8PA 4PFJA 2RKWA 3KSBC 1WLSA 2GD1O 1U7TA 4OBEA 2OORA 5DWQA 4BVAA 5I4KA 4MW2A 3VV2A 1SC9A 2Y1XA 5LSAA 4OGLA 1KR5A 2UVQA 4RH0A 4BJ3A 4CN8A 3A7EA 1Y0BA 3K0FB 3PEFA 2QF7A 2PSFA 3DHEA 4DLAA 3O8OB 2IHYA 5CBPB 2XUZA 4H1TA 5LLTA 2P35A 3R3VA 1RRVA 4MGEA 4ZJPA 2DUWA 2WTMA 4BO8A 4B1FA 4C06A 1FNBA 4UNRA 4G84A 5IT5A 5ALNA 3RU7A 3VR0A 4QQKA 2XF2A 2X1LA 9MHTA 2GSDA 2JIBA 4LRQA 1LRLA 3IAHA 4OKNA 2JLYA 2E5WA 3HBNA 1A7UA 1R3DA 3LX4A 3T7SA 3OPQA 1J8MF 1UWVA 4EKYA 2C4TA 4YLYA 4RJJA 1ZIYA 4H7FA 3TTVA 2CXSA 3MWDB 4H7DA 4M3NA 5LYYA 3GBSA 3MS2A 4OREX 4AJJA 1NV9A 4W5QA 2QSUA 1IZ9A 1SR8A 4XUGB 1NLFA 2C1ZA 3GA5A 3IKVA 1F8FA 1MDFA 4RFSB 5L95A 3RFCA 3BKWA 4ZOLA 2WA1A 3MJDA 3DL0A 3FB4A 4IHJA 4TWBA 2RGEA 4YJFB 4AECA 4DQLA 3QX7A 3N2KA 5JS1A 1M9NA 4EP1A 3V6MA 4W9NA 3V8VA 3AVYA 2Y8EA 1Y3HA 1IBCA 1NXWA 1U0LA 4NCHA 4ENQA 3CN9A 4B9AA 2WSLA 2FSVC 3C8HA 2H51A 2JARA 4MHTA 1U8AA 2GN8A 1XHFA 2FPOA 2Z8XA 1HPLA 2P2CA 3FZEA 4ECEA 1JVNA 3OT5A 1LV7A 3A31A 1GD1O 4G26A 4J4TA 5AM1A 3RNOA 3OEHD 5KSPA 3VRHA 2WDZA 4RNCA 4EA7A 4HNUA 4AQYB 1ZLXA 2HY7A 2XYRA 3OJLA 2YFHA 1XDZA 4NL4H 3KDAA 4UM9B 2J7PA 1KRWA 3WLMA 1IN6A 1NA5A 2V0GA 1UMDB 1WQ3A 1JSXA 4WY8A 4REQA 4R1PA 4JGIA 1XKTA 3AVQA 3NPAA 3JZIA 1XCOA 3IBYA 4B4WA 1AF4A 1ML4A 2A59A 1JQJC 1BJRE 1L8AA 3H8WA 3KQMA 1CRLA 2HDHA 5K99A 1OZHA 2J4DA 3P5BA 3E8XA 4Z1OA 1ABFA 2FEWB 2OHXA 3FKQA 3IH5A 5AHXA 3OKCA 2IYUA 1DKNA 3G85A 3WVNA 1JXOA 3LHSA 3OZCA 2JJ2A 3B1JA 3IDQA 1CUDA 2P75A 2XNDD 3HN7A 1G6KA 4DHEA 3GX1A 5CFNA 3LRTA 5BMVB 4CXMA 3Q7QA 3CPEA 1XEXA 4NENB 4RHUA 3VOAA 4HNQA 2CLIB 1BWRA 1K7EB 1EDEA 1FFSA 4NONA 1GT6A 3EDYA 1HFJA 1S5PA 5CDYA 3VO9A 1Y4DE 3PWTA 4K6MA 5CGZA 2GARA 1V16A 4B48A 3WYEA 4FZ3A 2AUTA 1TZMA 2CD7A 5BNZA 4HHEA 6Q21A 3GEHA 4WWHA 2JFQA 1PL7A 3KE8A 3PPIA 4KXYA 5IBPA 1JPVA 1QH0A 2CFOA 2G4LA 2N3ZA 4HLNA 4FKZA 4WW0A 3T4UA 2H8GA 1GAXA 5AHKA 2ZSEA 5KTYA 4KGXA 3KL2A 3PQ5A 4HH4A 1QMPA 4YXWD 1H8HD 1XA4A 3M7IA 3V2UA 4YT8A 4FZ5A 2YNMD 3X1KA 5AVUA 2PQ2A 1CHNA 1YZYA 3M9XA 4KFSA 3JYPA 4ZU6X 2OUIA 5K09A 4YRNA 1NF8A 2OVFA 4CIVA 5LZ2A 1R10A 4JSTA 8GPBA 4WZBB 4F92B 3O93A 4QNNA 4BX0A 2ZU6A 3KKKA 2AYXA 2GB4A 2CHGA 3HP1A 3WHLA 4HOYA 3NTVA 3NXKA 4BS9A 2VWPA 5F7OA 4D57A 3L6BA 4A7PA 3ZOKA 2A5FA 4II3A 4DJFC 1RWNA 1T9AA 1Z68A 2IU4A 2ZI9A 5AVJA 3SEZA 3SX4A 3AF3A 2XECA 1G4UR 2HWYA 2IW3A 3RQSA 4AW9A 1U8UA 3OM1A 4J76A 4PO1A 2TMGA 1ZISA 3C6MA 3I9FA 4BP3A 5DHPA 3TTXA 4NNJA 2PUBA 2R44A 5BN3A 5CFLA 2YXDA 7ADHA 4P0QB 4U6QA 3AF1A 4GU5A 4HB0A 4HWKA 3D8HA 3VDRA 5K2MA 1D2CA 1GL7A 3KPVA 2QUZA 1RPTA 3V7YA 2Q4OA 1GV1A 1ZO8A 1MX5A 2FMKA 2ZGVA 3N3AC 3FKSD 1VIDA 4IILA 4LXQA 3F3MA 4MRVA 3IMGA 4FFBA 4WN9B 5EINA 5SV2A 2HYIC 1PO7A 3Q7TA 4DMMA 3L8EA 4MVJG 1QYDA 1EU1A 2R86A 2JEYA 3PXDA 4KQEA 2YXBA 3GGCA 1DQRA 1KU6A 2GN9A 3UUEA 4BXOB 1NVDA 2HH9A 3PXAA 3UK1A 4PN3A 5JI3E 3KZXA 4KI0A 1NWCA 5ALOA 2QW0X 1ABBA 1B42A 2BKLA 1BN6A 1W85A 2O4CA 1D3AA 2AFVA 5BN4B 4CI0B 1F0KA 2G9VA 2J0VA 2YVQA 4MO2A 1H42A 5JXGA 4YFVA 2BKAA 2VRBA 1F5SA 4AO7A 5LQAA 2C2ZA 3QFHA 4MGKR 1E66A 1R6VA 1JAIA 2FZWA 1L5GB 3WB2A 5BUQA 1JKFA 2R6DA 3WLPA 5GONA 3EA5A 5SZJA 1KKLA 1W73A 2OR3A 2FETA 5GM2A 1X1QA 2V7XA 4ZEMA 4Z49A 4NDNE 3QYPA 4QLAA 3W3AH 1GSAA 1A71A 2Z5LA 3DEJA 4NZYA 4DAEA 4EJ6A 3VR5H 3HJFA 2FPIA 4QPCA 4XH9B 2RH4A 2ZSJA 4RZQA 3UJAA 3VPAA 4AG3A 4NHOA 3S2IA 3VNAA 1SURA 4YQYA 1GZ4A 2V4MA 1NHGA 3QOXA 4OLBA 1RWVA 2RHBA 3P0EA 1XZLA 4PHFA 4XGIA 3TPFA 1HE3A 2ATVA 2F3RA 3KB2A 3MSCA 4FYWA 1K5GA 4TSFA 5J63A 3R7LA 4BJ5A 5F3WB 3CISA 3IJRA 4JYZA 1MC1A 2J3IA 4WZAA 1EP1B 5TX7A 1RLUA 4C4SA 5IC6A 3CRQA 1GXSB 4LZPA 1FYVA 2FLWA 2J85A 2KB0A 2HZ7A 3QITA 4U39A 4Z8XA 3SR0A 1V3UA 4YDHB 5EPEA 4B3HA 5BT8A 1QGZA 4D99A 3OT1B 4JB2A 1E1MA 1E1QA 4JLBA 4H31A 2ADOA 5B3JC 1NNUA 2H1HA 4LGMA 4DV5B 1DQSA 1MC4A 3W05A 3W3AD 2HA2A 3J80A 3GH1A 4GFDA 2JJ1A 4IOKA 4CKCA 1FP2A 2R84A 5J2TF 3UOAB 3VR5D 4Y7CA 1DFHA 5ARDA 3D9QX 4CHTA 2FPPA 2GD0A 5D2CA 4TQ9A 3JQFA 1V7ZA 1T9GS 2OPHA 2LKCA 4P4NA 2NO7A 2UZIR 3IUPA 3CR3C 4Q1AA 1Q20A 4AJPA 3F4BA 4ABTA 2V6JA 1BVUA 4ASUD 1K4KA 4N54A 4D0NA 7MHTA 1GILA 3T7EA 1KK0A 1XL0A 4Z99A 3VKVA 3DOOA 3ORQA 4RTLA 3HJHA 2ENWA 3O2SB 5BV2P 1P0CA 1XTUA 1T4CA 2XTZA 1T5BA 3LQ1A 1F4PA 5DBEX 2YMQA 1NVFA 4MYSA 2ZBVA 4G36A 4ALIA 1Z38A 4AMZA 1TC1A 1O9GA 1RI3A 3LO8A 1K4MA 4G5SA 1XEAA 3EODA 3NDRA 1WBDA 1LPPA 2XXAA 3R1IA 3TLKA 5KJCA 1GPMA 4F5DA 1EVLA 2XW6A 1P2UA 1X74A 4D9JA 3G0OA 2GRJA 2X9LA 3ZQ6A 2RFLA 1O7JA 1R8JA 2EFYA 1XT6A 2I8LA 4HDRA 6GPBA 3QLUC 5A4DA 5J4VA 1ML3A 2CDAA 4R8LA 2IHJA 2HRZA 2OL4A 4RH3A 4LVUA 4I1YA 3HJNA 2NSDA 4MIKA 1YB5A 5FHRA 1E3EA 1QGUA 4PHGA 3DZKA 5DNCA 5LP6C 3QEKA 3LM8A 2V54A 4WXRA 3MQFA 3NAZA 5AR1A 5C46F 4Y18A 2PLAA 2JAPA 1CZKA 3U44A 1WPQA 1AU9A 1L5WA 3TIFA 2R87A 3FH0A 3H9QA 3L3BA 4C3OB 3RF6A 4XWWA 3KEQA 1WZIA 3ECSA 4AMYA 1RABA 2NTVA 4BIMA 3WYBA 1R4MA 4CKEB 1I7NA 2OAQ1 4MV9A 1Q83A 4OUDB 4UTPA 4XYLA 5LMZA 1Z63A 1GTZA 2BGKA 2FZLA 5G3YA 1WM1A 3GCDA 5AVTA 2VYNA 3A1NA 4YCLA 2PQMA 4U5QA 1FOEB 1VMDA 1NZDA 3N07A 2GS9A 1D04A 1SCKA 3EG9A 4DMFA 1QAOA 2C2HA 5JFOA 3SM3A 3J81k 4BNYA 1H0KA 5K5EA 3G13A 4D0LB 4HWGA 3DLCA 1JHRA 4JB0A 3BWYA 2AOXA 5EFOA 5ER6A 5FA6A 4WBNF 1FX0A 9ABPA 4EPVA 1OH6A 2GT1A 2GCOB 1TAGA 3CIOA 1SBYA 1OYWA 3KOWA 3EWAA 3KQSA 4DF3A 2OD9A 1ISGA 1O08A 2YZMA 2J45A 2P30A 3L84A 3VZQA 3NEPX 4R71A 4CEIB 4BC0A 2DLCX 5I9TA 4LXIA 1K5DA 4BNMA 2PQ0A 3IIMA 1DMRA 4BTVA 3FHOA 3IEPA 1U0JA 5IVKA 2YS6A 1M83A 1NC1A 1WW2A 3V80A 1GR0A 4EG0A 3D4IA 1OWNA 1PT8A 5FUYA 5AJXA 1UT6A 5JHGB 1X8JA 2B9EA 3AKEA 1Q15A 3V1LA 4TKVA 1PVOA 3Q41A 1OI4A 1YOVA 4M83A 4PX9A 4KAFA 4XI9A 3OC6A 6AT1A 5JNSA 3N8NA 3P7MA 3MN1A 2G8NA 3IVGA 3A1CA 5TPWB 3UATA 1TECE 4UDOA 5T57A 1DX9A 7REQB 1JR3D 1UC5B 2WG0A 3DULA 3G79A 3MD9A 3NWJA 5DYWA 1KJWA 2AMYA 3OQHA 3VZSA 1R4NA 2NO1A 3QVOA 1MO5A 3QPWA 3R41A 3T3DA 1PJAA 2N42A 3Q5DA 4J03A 4EAAA 1O8CA 2QG6A 3PCTA 1TNDA 4WSOA 4IXNA 3FAZA 1YRBA 4DGSA 4KK3A 1NMXA 4G1BA 4OA5A 2IYXA 3SN6A 1GGKA 1SGWA 2VCEA 4XJXA 3H0CA 2AK2A 5JISA 2OAP1 5ICMA 1D6MA 4A0HA 4AQ7A 5CFQA 1IY9A 1E0KA 4UDNA 2BEUA 3CRNA 3KPJA 4QATA 1IY2A 1QAQA 3O1JC 2BEVA 4ONEA 3VH2A 5K0JA 2HYDA 5A06A 4CLOA 4Q1VA 1OH5A 2B1IA 4BASA 4ZZ0A 2OHOA 1DT3A 4ND4A 1SKBA 3BPSA 2O20A 3MT0A 3CYFA 3KQYA 5BO5A 1V26A 2OK8A 1HL7A 2BM9A 2UZ1B 3H6HA 3IQZA 1I1OA 3DZBA 3LT0A 2MIIA 3D59A 2O8NA 3O84A 4NSNA 2D1SA 4Z86A 3T5AA 1N7GA 1NR1A 3AEYA 3WK9A 3V48A 1FYEA 3C1OA 4NF2A 1T5OA 4X7MA 1PJ2A 3P9ZA 7GPBA 3OHMA 3TOXA 4RVHA 3W9UA 1PW5A 5AW1A 5IP5A 1JNYA 4TYYA 5JCPA 1F7UA 1SQSA 2UZ4A 4M9ZA 1H0HA 1NUPA 4RVNA 2C7PA 2YWDA 1WPGA 3A9CA 4QDTA 5ESRA 3U0BA 2LZ0A 3WMFA 2I6TA 4Y1GA 4YRTA 2NQTA 3UAYA 2DWPA 4ZO7A 4FLFA 5AW8A 5DHFA 5L3SB 1K75A 2NQ8A 4Q1BA 3HL4A 4BRWA 4KITB 1ADFA 2ES4A 2RHLA 4IH4A 1JKJA 1OFUA 2E6KA 4OXKA 2QUAA 1TQHA 3DT9A 4K6FA 4LCJA 1AN0A 2E82A 2VLIA 4PCAA 4UBJA 4TRMA 3VPXA 1UIMA 1XRMA 1J21A 4B75A 1N2BA 1T1SA 4AY5A 2YMMA 4J0CA 1PK7A 2C4UA 3KFVA 1SUBA 3P0HA 5FP0A 1LWNA 2YFYA 4EMSA 1LI4A 2O3QA 2C83A 2YY5A 4P22A 3VISA 3IE1A 3U7GA 5CDFE 1N2JA 3VPGA 2NNLD 4DR2B 1FTQA 2XNDA 1JIKA 3WLRA 2R1VB 3B9BA 2HAEA 4RMNA 2RGWA 1HDZA 1P5RA 2ZT8A 2F8TA 5EL0A 2O2ZA 1DBVO 4BPRA 3BF8A 1O9BA 3U9TA 3HA3A 2QRPA 4BDSA 2AMJA 3BKXA 2IODA 2FN4A 3JQCA 3DMTA 3RTBA 4EJ0A 3U60B 1P8JA 4Y67A 3TTSA 4EL0A 1I14A 2BI7A 5K1ZA 4L9AA 1L4NA 2AHOA 2IYPA 2O1EA 2HLPA 2E48A 3D5QA 1ULAA 4KP7A 1IG3A 1KBQA 4KJXA 2KMLA 4MROA 1XZQA 1CUCA 1GL6A 1QF9A 3MB8A 4B0OA 2Q27A 4BVFA 3AERB 3BWEA 3TBFA 5ALMA 3S1AB 4TS1A 2R5FA 3BIXA 5GP1A 1YR6A 1Z75A 3OECA 3U7HB 4MUHA 1H8HA 2C5FA 1XZGA 3SOZA 1E61A 3S99A 1CULC 2CXNA 5AVRA 4G9GA 1HK7A 3MGBA 4X90A 4YJ2F 1FNMA 1VHWA 3IXMA 4LQCA 2X1VA 5DGTA 5EKDA 3UF0A 4DCVA 1RSZA 2NP7A 4KAXA 4F04A 5KVSA 1NNI1 2MR5A 3Q98A 3PUIA 4EZBA 5EWMA 5K01A 5B1YA 2X8JA 1KMHB 4AJNA 3B48A 1MJ5A 2QZPA 1MQ8B 4V3CA 3O4VA 3ZCTA 2YXNA 3VZCA 4YR7A 1T2EA 3RVKA 1SAYA 3C5CA 1C1XB 1TU4A 1UDWA 3PUJA 3PV0A 4Q01A 6REQB 3PR1A 5KX5A 2YWEA 2WWYA 1JSZA 2A6PA 2A5JA 4FYYA 4HZUA 1E7YA 4JH0A 1B74A 3K2IA 3M83A 4EYEA 1HZZA 2I3DA 1U0RA 3PGVA 4MHOA 3FPLA 1NJ6A 4Q6WA 2ZAOA 1GPJA 3UJ9A 1JXQA 3ANMA 3ASZA 4G4GA 4F5WA 4OO3A 2OA0A 1JWBB 4DIFA 3PNBA 1WMDA 5T3YA 4BJHB 5JS2A 3B3JA 2UU9B 4IG4A 1U1EA 2TMKA 4OV6B 1R6AA 2M32A 1KJ9A 4WCVA 1NQ5A 1QAMA 3LQFA 3MLAA 3EIOA 1Q7RA 3TR0A 4JJFA 2BFDB 2H4YA 4LDRA 2FDXA 5ETJA 4CT0A 5KQRA 1ACJA 1K88A 2VBIA 1GGNA 2ZR7A 1Y6ZA 3IAFA 4R6WA 4FWIB 4QAJA 3KEGA 4EUEA 5DBOA 4K9RA 1AD2A 2VSNA 3WQQA 5AXBA 2QG9A 1DXQA 4BNZA 2WMYA 2VATA 4ILKA 3R8CA 1TUBA 3B9PA 3CUYA 4INPA 3ZTTA 1PS8A 1QO0A 4W1RA 3K30A 3CFYA 4KFTA 1ISHA 4MYHA 1QDUA 3R7DA 1P1JA 1ZKMA 5D7NA 4G6ZA 4PLFA 1PW7A 3P4XA 1YMQA 1Z7EA 2VPYA 1R0BA 4YJHA 1IZ8A 1RKVA 3KWFA 2BONA 3QTBA 4KX3A 4DV3B 1W7AA 4BMSA 3EJWA 3GP5A 2VZEA 2DG2A 2IEYA 1RM3A 5DM70 2JFZA 1WTAA 2Z58A 1IPHA 2RJOA 3JAKB 2YKGA 4J1NA 2YWJA 4HAVA 5EJ4A 5JBNA 3E3MA 3O95A 3P2MA 3TZLA 3ZBUA 4B3IA 2ADFA 3MWFA 4DSOA 1UXOA 4O6VA 3VSAA 5K4AA 2IYFA 2H4JA 4NE7A 3ICEA 5GM1A 4LBZA 3URMA 4UTVA 4ZXFA 3JQ9A 5GPBA 4BGUA 2V03A 2EGGA 2XYPA 1UAGA 5F1PA 2AC7A 2IV2X 3T4PA 2Z4SA 1AKQA 2R7NA 2VP0A 2GEFA 4UPEA 2CNNA 1QR2A 1T15A 3D6MA 4Z9YA 4OK6A 1ZNWA 2AJTA 2A7XA 1N8NA 1ATZA 1BDMA 3H04A 3KV3O 4EF4A 4ZYYA 4FIDA 1XZFA 4XUEA 1SVSA 1PNOA 2ZUSA 3OU7A 2ZRDA 4FJ1A 2WFZA 5KU1A 2BJVA 4PYJA 4A8JC 3PC2A 4P2BA 2E37A 1FFGA 2J3EA 3GWZA 1CY4A 3MIZA 4IW3B 3X3HA 4AY3A 4ZHSA 2PWAA 3OURA 2CNLA 1DZIA 2F67A 2JB9A 4IEEA 1I4TD 1ISRA 3CZ9A 3H3XA 1I3MA 3HL0A 1RWPA 1EUCB 3UEOA 4WXMA 1JQEA 3M6IA 1FRFS 1G21E 4B84A 4LKRA 1EFDN 1GYRA 4OCZA 1KETA 4EM6A 4CHGA 4QYSA 4CMCA 2BMAA 2IZOA 1L4UA 3OZUA 1Y9AA 3BH6A 3U19A 3GRFA 1Q6YA 1OKKA 2ODBA 3FLAA 1DC5A 2L0XA 4IKEA 1LBQA 2NT4A 4E88A 1D03A 1HYHA 2AZ4A 5HUHA 3ZDAA 1WXFA 2GCGA 4M7WA 3VBCA 3C41J 3VI4B 1N0HA 2A0YA 4MPTA 1TU3A 3BH7A 3S55A 5CR9A 3MRXA 2MSLA 3DPUA 1L8OA 1FE8A 2PAAA 3SX2A 3F7TA 4H3SA 1YACA 4WL0A 3VJRA 2OBMA 3KEMA 3GEEA 3L8YA 5A62A 2R6HA 4PG6A 4D6PA 1RQLA 3HEBA 3KQNA 2WWTA 4WVFA 2ZZNA 4GI7A 2FCAA 1E4YA 2FWPA 2R4QA 4OHOA 1AIPA 3V1UA 2I55A 3JVEA 1UDAA 2KE5A 1MJGM 4YASA 2A5YB 1L1FA 4AX8A 1E2IA 4GPZA 2GX6A 1AZWA 2FGJA 4M49A 5IHPA 1KY2A 1LC3A 2WV9A 3PNOA 3Q3GE 2G0AA 3MUOA 4FBMA 4G63A 1IYZA 4B6FA 2FZ5A 2EOAA 2D0IA 1KGSA 3OD5A 1F4VA 1G8MA 3N0RA 3DDCA 2PLNA 5KWEA 1QSGA 1U80A 5AXCA 4FOOA 3FNEA 2KI5A 4NATA 4PICA 5BRAA 4YCDA 4E03A 4CM8B 3U5TA 3IVRA 2I2FA 1LJUA 1W88A 1U3TA 1G7CA 3KX2A 3NO4A 4NBUA 3HO6A 4HFJA 2O59A 2C96A 1HRKA 1WHSA 2XWPA 3RU3A 3NZEA 1K2WA 3BBLA 2VBCA 3KKLA 4KSYA 1GGFA 4LRSB 1FRZA 1OLSA 1MQSA 1W8IA 5ITZB 1ECLA 1I1NA 2RHGB 3O2QB 5CXSA 3SLGA 1BX3A 3WV4A 3FTFA 2OCPA 1Z4NA 1WB4A 4QIHA 5EIHA 4O59O 5AM3A 3RC8A 4KR0A 2JS7A 2ZQ5A 4L8LA 5FUQA 5KPJA 3ADKA 4L27A 1P39A 1STOA 1Z0KA 1U7XA 4UAVA 1HKHA 4B9EA 3DLIA 3T9AA 3R9WA 4AUEA 1LLUA 4WCFB 5B4UA 1JDJA 2P5SA 4IDHA 3QLVA 4QG7A 1J23A 3GJ7A 2QM3A 2ERXA 2Z9BA 3TZBA 3U5ZB 3K8YA 1MCZA 1KQFA 1DP4A 3FYUA 5DI3A 3QWBA 5LKRA 2Y1LA 5KC9A 2H4ZA 3OIFA 2IP2A 3CMCO 5BW5A 4QHYA 1XEWX 3Q72A 2YL2A 4UHFA 3RJ5A 4BB9A 3GPLA 4IIGA 3HXLA 5BSGA 1N5JA 3OTWA 2FSPA 1JPUA 1P1BA 1L7EA 4B45A 3AT1A 3VXKA 2NTNA 1A4RA 4Q3CA 3D7RA 3RBAA 1U8XX 1A8QA 1C3XA 4E07A 1L5YA 4XAQA 4HLQB 1UQRA 3U3KA 4P93A 4RM3A 5EG5A 4UXHA 1LPMA 1B14A 1QCCA 3C1TA 3KKPA 2BTEA 4ND6A 3H05A 5BQXA 3EMVA 2J8ZA 1VG0B 1NPYA 3ZXIA 1HE5A 2QTMA 4G1UC 3SQLA 5AW0A 1M6NA 3INNA 5JJ5A 3BTSA 1R6TA 3MAGA 3O0DA 1CJBA 1YV9A 1AS0A 1G20E 5BR1A 2BTOA 3A9VA 2QIPA 4P38A 3THXB 3ICOA 3RFVA 4DB2A 2CXHA 1VKRA 2XTNA 3TFQA 1KP9A 3CUUA 1CS0B 1ZH8A 2OAGA 3O9VA 1MOSA 1ORTA 1ZSVA 1UBLS 3S1LA 1XEWY 2WRZA 1V7PC 2BGUA 3A36A 3LV8A 4J07A 5F2OA 5B3KA 3C7DB 3EUWA 3U3DA 4UNPA 4BMDA 2I6FA 2QVZX 4JI8B 1XZEA 5K8CA 3NHZA 1ULUA 2X7JA 1QMGA 3PHJA 4H4CA 1IHYA 4JCCA 4ZOLF 5FAKA 4IHJF 3I09A 2AOVA 1VHDA 4WK0B 1NURA 1TTHA 5HZGA 4P3XA 5KTNA 5CLQA 1YJCA 1OI7A 2FRVA 4QU5A 4I5FA 5KTPA 3O83A 1QE0A 3THSA 1BCRB 1B2LA 4I7EA 5HRCA 5BPFA 4E5YA 3FZGA 2C5LA 5CU7A 4D6XA 1ZBDA 1HE1C 1O4VA 2RH9B 3FROA 5ILGA 4PPFA 4PFQA 2V3VA 3PNMA 4G5QA 2GLUA 2CNOA 3MJSA 5T5QA 2XUJA 4JX8A 2OSVA 1XXHE 1Q6ZA 4M22A 2FN3A 3QX9A 4NU8X 1J8FA 1Z2AA 1Y1QA 5DI9A 2HLNA 3UKDA 3ZWMA 4EEXA 4FOSA 1UFOA 1Q0LA 1TM7E 4F5ZA 5U1PA 4DMCA 4WRRA 3KXLA 3LPNA 3QXSA 3WWYA 1DKOA 3ELYA 1JRLA 3R9XB 4IYRA 4FPXA 2IWRA 5CPFA 2QJTA 1FMCA 4AB1A 1S8OA 3CF2A 4EFMA 3NJ4A 1NMYA 2E55A 2RHCA 1W6UA 2QP3A 3BIFA 2RKBA 1XQWA 3QKSB 3R5HA 3F6SA 2VXYA 3OIWA 5E0KB 4BKQA 4Q05A 3NOXA 1ZSNA 5K4GA 3MCZA 2GRAA 4MVYA 2IH5A 2W6QA 1H1LB 1IN4A 2EIXA 2MHCA 1YCFA 2QW1A 3WLEA 1AH2A 2FW7A 1BXRB 3RAGA 3A1WA 3V8NA 1XTVA 3PKIA 1P1FA 1PZHA 2CXXA 3DOUA 4RHXA 3DAOA 3OE1A 4HFNA 4P80A 1SB8A 4CTJA 3O8NA 3HV2A 3NRCA 2C31A 3OICA 4EG4A 2JA2A 2VXCA 1ES9A 1JJ7A 1VIYA 4ZRNA 4N65A 2QX8A 4AKSA 2J0UA 3MB5A 3NEYA 3GOHA 1Y33E 4PAMA 5CTAA 3Q6IA 1U6JA 5KREA 4YDRA 4BN5A 3OESA 2G36A 4D9KA 4CYMA 4IUYA 5IVHA 3NETA 2A9PA 2BVNA 5AP9A 5LQKA 1KMMA 4INAA 2ACVA 2PT9A 3AIKA 3UWDA 5HW0A 3EZFA 4LZLA 1KEEA 3PHGA 4INJA 3RYCB 5IHXA 2WF8A 3CLHA 3EXFA 1JXMA 2AFIE 3B1KA 1X8KA 4DEYA 3GEDA 3I0ZA 3EXHB 2YWRA 3K2BA 2B94A 3ZD9A 2WV7A 2DFPA 4CKWA 1MB0A 5JCZA 2QTFA 1DAOA 1FFHA 2FZCA 4IQ4A 1MBZA 1RPJA 3QVJA 5ALGA 4R2JA 5AUPB 5CEEA 5K0EA 4B6JA 1WS6A 2H17A 2II6A 4ZK6A 2EFJA 1EUQA 2PWYA 4D4GA 1N57A 3UANA 1P3Y1 4B2YA 4OI0A 1U7HA 3PGKA 2BDUA 2H2IA 3GMSA 2JI7A 5DEOA 2C82A 5AHWA 3M1YA 3RAPR 1MX3A 1M72A 3NAQA 3QLTA 4FW8A 3QNWA 2WLSA 1UZNA 1VLMA 2Q1XA 2XQGA 3FTNA 3TLJA 3ESDA 4HO1X 4LFAB 4R5HA 3MJVA 3L7DA 3L7NA 5GZ3A 3AY7A 2G5PA 1YR3A 1ZI8A 2C4VA 3EVDA 4UVHA 2P67A 3WLIA 4J43A 3BQ9A 3PFIA 5F1YA 4ZDJA 3T1TA 3D3EA 3K53A 2QTLA 2K2WA 5JVDB 1LPOA 1CZHA 4YRCA 4II2A 4M1KA 3RJZA 3LCUA 4RKQA 1EB9A 2ALJA 3BREA 4HDQB 5ESDA 2VIIA 2YMLA 4HDAA 3UJ8A 2UUBB 3KU1A 4N7RA 3D5TA 2JPDA 2COEA 2P6PA 3PX3A 5U4QA 1IBMB 5DP1A 3MWGA 1W36D 5A4JA 3W1EA 1K66A 3WTCA 3QVWA 2ZUDA 3I23A 4BBZA 1Z15A 3W5AA 1JEEA 1AKRA 4ENSA 4QXMA 1H1TA 4Z7OB 2P3LA 1W0KA 3C45A 3I0MA 1A2KC 4M53A 1AUXA 3SJAA 4IQ0A 4M0DA 4U00A 4YP7A 4O4HB 4CEJA 1TTPB 4M86A 2D8AA 3EWSA 2QGNA 3I2GA 1LX6A 4L50A 5JPCA 5GONF 1MKYA 4TKLA 4KFCA 4UNSA 2VQEB 2HT1A 3AW9A 2RHHA 4Q66C 4KV7A 4CKBA 3FNGA 2EFEB 5FPYA 2R62A 1PS0A 3O4RA 2DCUA 2XBLA 1DEHA 4HPWA 1KI1A 2DPLA 5HF6A 2WFAA 1R1DA 3ISJA 4TTAA 4PGAA 5EP4A 1Y5IA 3X1WA 2DBVO 1XA0A 2HDOA 3RRZA 1OBCA 3H87A 4TVSA 1NI4B 2J4CA 4EKNB 2ID4A 5BV0A 1U7ZA 1C1DB 1UBSB 1UZLA 3OTGA 3G02A 5LBUA 4PANA 2IPXA 4CQLB 3GWGA 1LNZA 1OLXB 1ORDA 1L3BA 4MYRA 2JKVA 2IZ1A 1UANA 2C2KA 2UUOA 2F1KA 3RHZA 1JG1A 2DLDA 3OOEA 3H1TA 4IL5A 5CJPA 2H8KA 3GVXA 1PR2A 3NIDB 4FU0A 3I9KA 1N5OX 2F8LA 2OECA 3AUXA 4X5OA 5F5LA 1UC9A 1NXOA 2Z6AA 3A06A 5ITSA 3CZRA 3OJFA 2BFPA 1BYIA 4MVJM 4OG2A 2OCAA 4KQGA 5TB5A 3V3KA 1V39A 2GN2A 4YPVA 3GRUA 1GVNB 5HPYB 1F8UA 3AW8A 4HGNA 4IXDA 2O06A 1SKMA 5B58C 3KXPA 5SYMA 4PQFA 4YRFA 2X0RA 1QE5A 1P31A 2HSEA