4RTRA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and a 5-bp non-canonical site (gttta )
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
244
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 244
sequence length 270
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtrA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtrA01
3P2IA 4X63A 3B3GA 3CCFA 3MCZA 4RTMA 4YUWA 3EVAA 1IY9A 5DX0A 2P3LA 3AXSA 3GNLA 3BT7A 5DM1A 5FCDA 3FYDA 1KR5A 5HZMA 3TQSA 3PFGA 3H2BA 4BP1A 3TOSA 5FHRA 3GRZA 4Y30A 3LX6A 3M6WA 2A14A 4WXHA 2ZIGA 2Z6UA 4DF3A 3WSTA 5DRYA 2NNWB 2P3OA 5DT2A 2AVDA 3OU6A 5LQKA 2PX8A 1JG1A 3NTVA 5D1HA 1QAQA 2YX1A 3AWIA 3LECA 1JG2A 3HCFA 3KR0A 5T67A 4EKGA 3VC2A 3SSMA 10MHA 5FA8A 5CVEA 1SUSA 3BGIA 3THSA 5EKUA 1I1NA 2B25A 3B89A 4BY9E 1KIAA 5C9ZA 1L3IA 2CL5A 3BKXA 1L1EA 3OFKA 4RTLA 4YV0A 3OE4A 4PINA 5EG5A 3BUSA 3AY0A 3FZGA 3EVDA 2NP6A 1ZQ9A 4RTSA 3Q7EA 5LQJA 3T7TA 2B78A 2AOTA 4AUKA 4OX9Y 3G5TA 4C06A 4PIPA 5T6BA 2PBFA 2AR0A 3SM3A 4PCLA 4LWPA 1X1CA 4BLWA 1QANA 4R6WA 2BH2A 4EK9A 1RI4A 4X41A 4HGZA 5D1NA 1VE3A 2Q41A 5KS2A 3FTFA 2XVMA 5DTRA 4GOMD 1DL5A 2EJTA 4GC9A 4C04A 3LCUA 3NWEA 2H00A 3P9CA 5GOZA 2AN5A 3LKZA 4OBXA 4ATNA 2JH9A 3L8DA 4IV0A 2VDUE 4O29A 3MGGA 3UA3A 1NE2A 2XYVA 5EMKA 1NW3A 5E9JA 2ZIEA 2E5WA 1I9GA 5DM4A 4KDRA 4L7VA 4BLUA 2PX4A 4YUZA 2ZW9A 1ORHA 2IIPA 3O31A 2HTEA 2CMGA 3NMUF 1WXXA 4B17A 2C7RA 3HTXA 2C7QA 3LKDA 5EMLA 1RJDA 3B3JA 3HA5A 2VS1A 5EIFA 3HM2A 2XVAA 1KPIA 4GC5A 3TPZA 3PX2A 4RX1A 2PLWA 2PSSA 4PWYA 5EMMA 4PYJA 3FTDA 2P41A 2K4MA 1SUIA 2I7CA 3HP7A 5K0CA 4AZVA 5BW5A 2OKCA 2QRVB 3MAGA 3ER9A 1RJEA 1G38A 4RTPA 1UFKA 5ERGB 3PFHA 2UYOA 4E70A 1TW2A 5EKXA 1F3LA 2UZ4A 4PYIA 3KQYA 2WA1A 1O9GA 3GWZA 5FULA 4RYLA 2UYCA 2F8LA 2NP7A 3NWBA 5C0OE 1VIDA 3JWJA 1MJFA 4FSXA 3U81A 5EGSA 1QAOA 1QYRA 2BM8A 2XBMA 4P58A 4OQDA 1RI1A 1XTPA 5FHQA 2BR3A 4C4AA 3DLIA 3M6XA 3D2LA 2AVNA 5EPEA 2AOXA 5FUBA 4QQKA 1TPYA 3S68A 3BGVA 3G5LA 1KHHA 4EMSA 2JHCA 2B2CA 3THRA 5K05A 4F86A 2DULA 3GRVA 3FPHA 4HG2A 3M4XA 3FPEA 3P97A 1G8AA 3B3FA 3KQQA 4MIKA 4XCXA 5EIWA 1X1BA 4V0QA 1X1DA 3PTAA 5K8VA 2ZFUA 2ZZMA 3G89A 5DM0A 5FA5A 4C08A 3JWGA 4YV1A 1TW3A 4G56A 4YUYA 3SVZA 2OBFA 3OPNA 3UJBA 3FUUA 4C03A 3HCEA 4F85A 4RVHA 2FRXA 2AOUB 4P7KA 3HA3A 3DMGA 1Q0TA 4LECA 4PGHA 2N47A 4PYLA 4QQNA 1EJ0A 5EC8A 1FPQA 1X19A 3KQMA 3ME5A 4RTKA 2YQZA 3KR9A 4PYMA 1EG2A 5E2AA 1YZHA 2ESRA 5DXJA 1D2CA 1FP2A 1M6YA 1UIRA 2O0LA 2YR0A 3DXZA 2NXNA 3KQTA 3R0QA 2FK7A 2R6ZA 4E33A 3UBTA 3G7UA 1KYZA 3MTEA 2PXCA 5E1MA 5ICEA 2H1RA 2PT6A 2ZBQA 3A4TA 5EHGA 3KPUA 2OB2A 3GCZA 2QRVA 3MERA 1SVUA 5E1BA 5G02A 1IM8A 5DPMA 1N7JA 3TKYA 3I53A 4E32A 3R9XB 4FT2A 2ORED 4PYNA 4OQEA 4RSRA 5HFJA 4POOA 5F2NA 2QY6A 1X1AA 2WK1A 3FTCA 5K09A 1INLA 2PT9A 2IH2A 3SGLA 3C3PA 4M38A 4U7TB 3O4FA 1R00A 3MB5A 4HTFB 3DMFA 2PVCA 1JSXA 1NT2A 5E2BA 3A26A 4CTKA 1OR8A 1YFLA 1T43A 2LD4A 5DRTA 2GH1A 3KQSA 2JG3A 4GF5A 5LQUA 3HVJA 2GAFA 3KQWA 3K6RA 4X61A 1SQFA 2IBSA 4PCAA 3EEYA 3KKZA 3T7SA 5EOVA 5K0BA 2DPMA 1WG8A 2ZIFA 1L3CA 3P71T 1ZG3A 3G2OA 2OYRA 1P91A 5K0EA 1KP9A 5EVJA 1YB2A 2ZBPA 1U2ZA 3AXTA 3PT9A 1FP1D 2P7IA 5HOQA 2NXEA 1NW6A 3DP7A 3OU2A 2I9KA 3HEMA 4WVLA 3UJDA 1RJGA 2Z6QA 5JR3A 2ZBRA 5KQSA 2OY0A 3QV2A 5U4XA 2IGTA 3P9IA 2GS9A 2PKWA 3KR2A 1VBFA 2PXXA 2ZLBA 1VL5A 1WY7A 3MTIA 4QPNA 4ER6A 4YV2A 3HNRA 5EQJB 3G8BA 3KQPA 3ELUA 3BWBA 3K0BA 1SQGA 5HIMA 5CVDA 5GM1A 5CIYA 2O57A 3GJYA 3GXOA 3PB3A 3LBFA 5DX8A 4PGGA 3ELYA 5CCXA 2P7HA 5IKMA 3OU7A 2OO3A 3GRYA 3EMDA 4E2WA 3CBGA 3DLCA 3HCAA 2QYOA 3SXJA 4DKJA 1UWVA 1Y8CA 3P9KA 4HH4A 1AV6A 2PXAA 2FHPA 3M6VA 3BKWA 5DTQA 1WS6A 5FTWA 2G70A 1XDSA 3ER8A 4BLVA 2P3QA 2AOVA 3NDJA 3EVFA 2I62A 5K0GA 1JQ3A 1P1CA 2FK8A 1DCTA 4KDCA 1BOOA 5E1DA 1XJ5A 2QE6A 3AJDA 4HTFA 3LGAA 1MHTA 4ER3A 5FWDA 4Z2YA 3VC1A 2EFJA 5EMJA 1XDZA 5ICGA 3VYWA 2VP3A 1SKMA 3OZSA 7MHTA 3NVKI 2ZSUA 3IV6A 5M5BA 4A6EA 2PGXA 5B1SA 2CKDA 3T0IA 5E1OA 4R05A 5K0LA 5FWAA 4XUCA 3NVMB 3GRUA 1I4WA 1JG3A 2JH8A 2HMYB 3B7PA 2AOWA 3HVHA 4F84A 3FPJA 5CUQA 2G71A 4MHTA 3BWMA 1O9HA 1KYWA 4PYQA 3CKKA 3EVGA 5BW4A 5EZSA 3SMQA 5K03A 1D2HA 3DXYA 1YZ3A 1RI2A 3UJAA 4P7FA 4HC4A 5FQOA 4PIMA 5EEGA 2EJUA 4CKEA 2PWYA 2FYTA 5K0JA 5LSAA 3EMBA 2H11A 3RW9A 3TRKA 2Y1XA 5GIPE 4GUAA 4RV9A 4IV8A 3UJCA 2V74B 3G88A 3LBYA 5DWQA 1BC5A 1YF3A 3KHKA 2GLUA 2O07A 3G8AA 1WZNA 2BR4A 1R8YA 5FQNA 2YVLA 3NDIA 2ERCA 1R74A 3EVCA 5H02A 1Z3CA 3OZTA 4C07A 3UA4A 1AQIA 1N2XA 1G8SA 2Y1WA 2ZULA 4LWOA 4YUVA 5MHTA 4ZTBA 4U7PB 4CWAA 2V7EA 1BHJA 4KWCA 2KW5A 4EQZA 3FUXA 1NW8A 4EKIA 3P8ZA 1DUSA 3C6MA 4FZVA 5CM2Z 3G2PA 4RVDA 4X1OA 3FPFA 3T7RA 4RTJA 3TMAA 1NV9A 1RI3A 3BZBA 1JR4A 5FADA 2I6GA 4ER5A 1L9KA 3A7EA 4PONA 3TM4A 5LR6A 2JJQA 5LQRA 1NW7A 3REOA 1H1DA 2YXEA 3GO4A 1R6AA 3DMHA 2WA2A 3TLJA 1KXZA 2HWKA 3E23A 3DULA 3SR4A 3UWPA 4E2YA 2NXJA 5GIOE 2GA9A 1YUBA 5JUWA 3G2MA 4M36A 1ZGJA 3HCDA 1EAMA 1JTEA 2PJDA 4LG1A 4Y2HA 5K01A 3BWYA 3RODA 1RI5A 1RJFA 2AOTB 3HA7A 3KPWA 2PX2A 4BP3A 4QVGA 2OPBA 4OA5A 3SSOA 2JHPA 2NYUA 4XUEA 2YTZA 1R8XA 2G8NA 4KIFA 2ADMA 5KYGA 4DQ0A 3FTEA 1G55A 4QTTB 4A6DA 3X0DA 3EGEA 3M6UA 1NKVA 5F2KA 3E8SA 1XCLA 4FSDA 5EEHA 9MHTA 4NECA 2AN4A 3V8VA 3R3HA 2OB1A 4QDKA 1NW5A 1ZKDA 4AZWA 4DA4A 4X60A 3F4KA 3CGGA 5GWXA 3ERCA 5CD1A 1AF7A 3JWIA 1M0EA 4DCMA 4RVFA 3PVCA 5BP7A 4ER0A 2P8JA 5LQAA 4RTOA 4YMGA 5DM2A 5LQNA 4ER7A 8MHTA 1QZZA 5HIIA 2VDVE 4GQBA 3A27A 3OFJA 4CKCA 3ELWA 3A25A 3FPGA 4E31A 3M70A 4FR0A 1M6EX 1XVAA 3HVIA 2ZCJA 5IH3A 2GPYA 3P2KA 1V39A 4V0RA 1XXLA 3NW9A 3TFWA 3EVBA 3IEIA 3EGIA 1VP9A 4GBED 5DTMA 3I9FA 4QPPA 3CJQA 4EVIA 4IWNA 3P9NA 2ONYA 3MQ2A 2AOUA 4ISCA 3EEOA 2ZWVA 3LHDA 3B5IA 3HCBA 2P40A 3CVOA 3GRRA 2G1PA 3NJRA 5DSTA 4YUXA 5ICCA 3FRHA 2HR1A 4HGYA 2FPOA 3KQVA 5KQRA 3UJ9A 3EVZA 4KVZA 3TM5A 1VQ1A 2JHAA 2IDJA 4XUDA 2PY6A 4DCGA 1L3BA 4K6MA 1FBNA 4RTQA 2PX5A 2O06A 4PYOA 3OCJA 4R6XA 2Z6AA 2IDKA 2HNKA 3ELDA 5E9QA 4PNEA 1EJ6A 1VP3A 4HRAA 3KPVA 3QOWA 3FUVA 4DZRA 5CVUA 5E8RA 2EG5A 3FUTA 3Q87B 5K0NA 2G72A 3C0KA 3LDGA 2PV0A 4KRGA 1EIZA 3E7PA 3PS9A 4RTNA 1Q0SA 4E2XA 3DH0A 3I64A 3KPYA 2ZTHA 4FGZA 4AX8A 1P1BA 3M33A 3VSEA 4AZSA 1NBHA 4DMGA 1HMYA 4OBWA 3PLAE 1ZGAA 3LCVB 1BKYA 2BZGA 2P1DA 3BWCA 5BXYA 2C7PA 2ZZKA 4P7GA 3A7DA 4RVGA 4YMHA 1G6Q1 2CWWA 1KPGA 3FUWA 4H0NA 1VLMA 3BGDA 2R3SA 1G60A 1XCJA 4FT4A 5LQCA 4RWZA 5EHIA 3KPJA 5GINE 1ZHFA 4P7JA 5DXAA 2PWPA 3LDFA 5CVJA 3CJRA 2CMHA 3EVEA 3GGDA 3OZRA 4GOLD 4M7RA 5E9WA 3UJ6A 5EZQA 1ORIA 2BR5A 3GDHA 3G2QA 4PYKA 4QVKA 1O54A 1PRYA 5DSXA 2AS0A 3O7WA 3UJ7A 2ZVJA 4GOND 1AQJA 4MQ4A 2IBTA 5E8JA 5DLYA 5T64A 5K0FA 2AN3A 2B9EA 2QM3A 1NV8A 3OE5A 4C05A 4CTJA 5C1IA 3MCTA 3GIWA 2VDWA 3FYCA 5HIKA 3HCCA 3CC8A 4CXMA 2BM9A 1R18A 1JQDA 2UYQA 3CJTA 2HV9A 4FP9A 4QTUB 5KVAA 3IHTA 3R6TA 1F38A 3IYLW 3DTNA 4R8RA 3V97A 2O05A 2IP2A 3ANXA 1FJXA 3TKAA 3ID6C 2UYHA 2B3TA 5HILA 3C3YA 3I58A 3R24A 3DOUA 2ONZA 5CCBA 2EX4A 3ORHA 3PX3A 2AZTA 3QOXA 1YFJA 4KIGA 4KW7A 2OZVA 2YXLA 3EPPA 4MTLA 4GOOD 2IFTA 1IXKA 1JSZA 5CVVA 3P2EA 4MWZA 3JWHA 3TR6A 2IH4A 2ZZNA 1EQAA 5DX1A 3BXOA 2OXTA 2IH5A 5HEKA 2FCAA 4FS8A 4UOEA 4M37A 3KQOA 3LL7A 3RIEA 2ZWAA 1B42A 3DUWA 5GP1A 1PJZA 3EGVA 5ICFA 3UJ8A 3UZUA 3I5UA 4AZTA 1KPHA 5GM2A 1JG4A 1D2GA 4RTRA 1QAMA 3FRIA 3HVKA 3LCCA 4HSGA 5HIJA 1JTFA 4E2ZA 3C6KA 1WXWA 3DR5A 1XDUA 4QDJA 4E30A 1NBIA 3GU3A 3SSNA 5F2OA 2NXCA 3LDUA 1VPTA 3LPMA 1JQEA 4IKPA 4DM3A 3LSTA 3KR1A 2VZ9A 3DXXA 3E05A 1SG9A 2GB4A 2P35A 2YUIA 2YXDA 4R8SA 3UFBA 4CKBA 2C7OA 1N7IA 3KU1A 3SX0A 3MHTA 2XYRA 4GEKA 4OA8A 4JXJA 2XYQA 1P39A 5P8WA 2IPXA 1HNNA
chains in the Genus database with same CATH superfamily
3MC1A 4WPGA 2PD4A 2ZYRA 3EPJA 2A1TR 2GD2A 4FQ8A 2DFPA 2MSLA 5DM1A 2QY9A 4XH9B 3H9CA 3HU2A 3L8HA 3FVVA 3M6IA 2DHQA 5SYMA 4V3BA 3DHVA 3RUEA 1GFIA 4MI1A 3DLHA 2H16A 2IRWA 1O8BA 2DUMA 4AROA 4WXHA 3T06B 3WRXA 1GPLA 3OO0A 3WSTA 3JZAA 2QTNA 3V4VB 4JYZA 1QIGA 4ETNA 2MTBA 3BSSA 4BECA 4DIFA 5EQDA 1XRPA 4KSBA 3ZE6A 3IR5A 3FI0A 3NXKA 4F9EA 1EVEA 1PFKA 10MHA 2JVJA 5HUJA 1QH8B 2V96A 5AVTA 2GZSA 4KBFA 4ZYZA 1RFGE 3PQ7A 4PQRA 1HDOA 2DHRA 4FEYA 4I5IA 5A4FS 4LIPD 4LSWA 3I9NA 4Y9UA 2WJVA 5HZGA 4QOFA 4IQ8A 3DBIA 3OHSX 5G0UA 3OKFA 3CUWA 5LQJA 4I46A 1PEKE 1FF9A 3G8DA 1J5XA 3GGPA 3CLUD 1VHLA 2X7JA 5F78A 3ZE0B 3I1JA 1L4UA 4C0KA 4ZEMA 4Q15A 1QONA 1ZD1A 3A6KA 3KLPX 4PLCA 4NESA 2PBZA 2AR9A 2D1QA 1FLDA 3TOZA 4NS4A 1U9CA 3QBJA 5H1YA 4LF8B 3NG1A 3OUUA 4BX9A 1MO5A 3II6X 3NBMA 4D5EA 5CXUA 3ZHYA 4O29A 1CUYA 4WJZA 4ZP1A 1XZPA 2NUAA 3NBUA 4EPTA 4RWEA 3I83A 4BLUA 4EF5A 4AF8A 4CEIB 4U2DA 2OCBA 3IUYA 4O08A 5I7UA 5JQGA 3E9NA 1N2CB 3A70A 5L6LB 1GHTA 1JYFA 1O4WA 3C7KA 3OKCA 1KI6A 3DEJA 2X41A 1QGUB 3EFOA 3G1TA 1P3JA 2PLWA 4RJIA 1R4NB 2G1JA 3BHJA 2C4MA 2I7CA 2VJKA 5DEOA 5JS2A 3TYXA 5D5HA 1KRWA 4V0ME 2K7FA 2W6ZA 3E82A 4Q02A 1AKWA 4NEHB 3QHPA 3BRCA 5SZHB 4ROTA 1RE0A 2UYOA 1V26A 4YRGA 3MCUA 1MRZA 5AW7A 1L5HA 4TSKA 4F2GA 1O9GA 1PEDA 1GGMA 4YT8A 2F8LA 2Z2JA 1CQZA 1DWOA 2JEOA 2VJNA 1CUVA 2HH9A 2ZDHA 3PHLA 5EUBA 2VHZA 3JWJA 1MJFA 3HLTA 5L9AA 1MVNA 3BK2A 2JEZA 3EXHC 2XWQA 4G6ZA 2AFIB 2BEKA 4QOGA 4W9NC 4WN3A 1ABBA 4MUEA 2R62A 2APJA 2PZAA 1VL2A 2VIIA 4PRLA 3FOFC 5EPEA 5ALHA 1ESNA 1B23P 2FW9A 5FUBA 3PQDA 2OENG 2PMEA 5LMZA 4ZCSA 1FYVA 1KAHA 2IWHA 2WJ3A 2DH5A 3WL7A 4PZLA 3M4ZA 1SXJB 2GARA 2O1SA 2VYND 4BZXA 1L4BA 2DUJA 3TXAA 4CKCB 5GTDA 3B3FA 5ALEA 4Q5IA 4XCXA 4KAXA 5K3BA 2ANBA 5BUSA 3H5TA 3UW3A 2UXCB 1K7CA 1ZSYA 2IA5A 3NFRA 1GKUB 2NN3C 3ORQA 4PYRA 3TVYA 4AT1A 4D8UA 3EQ9A 4CTOA 4J0GA 2JGMA 3AF5A 4RD2A 1JA1A 2EFCB 1KAOA 3R3UA 1XXHE 2V55B 4C03A 4C1NA 2YV4A 5AKKA 1Q0TA 2J8ZA 2N47A 1AS0A 1TL7C 2ZB7A 3H13A 3NHKA 1HGXA 1QFZA 1U0GA 3O74A 4MUAA 4UHCA 3RDPA 2ZBEA 3SLKA 4BO0A 4EDHA 2PMKA 3OY7A 2V4ZA 1D1PA 4PN7A 1FFCA 4LNAA 3SZLA 3EOAI 4RQBA 1H2YA 3HHPA 4DQVA 1G19A 3PXDA 1SCDA 3UT5A 3PA8A 4J4BA 1HOXA 1XTZA 4BQEA 2EYQA 2QP9X 4W99A 2EAUA 3CLTC 2FQYA 2GN1A 2XJ9A 5AOAA 1KZGB 3KJZA 2UUBB 1GXSB 2M6LA 4FS3A 1C3OA 4NBLA 3R7BA 3KQUA 1GZHB 4CU5A 4DCUA 1M1UA 1EVZA 3OZGA 3PLRA 4Q66C 4XD2A 1PBTA 3RSQA 1H3NA 5AH0A 3UHFA 2GBGA 4FDTA 2Q8PA 2POQX 5IVIA 2CVOA 2WKRA 3FMPB 1INLA 1T2VA 1OF1A 4AXBA 2IH2A 2Q3FA 2ACEA 2QI9F 4K9RA 4XQ9A 2FDRA 2R6HA 3HLKA 4CGZA 2R5FA 2WJAA 4ABTA 3SBEA 1XCOA 1XMIA 1GJRA 3DSRA 3HXPA 1V5EA 5C3MA 2FEOA 2PSJA 2YFHA 2FZVA 2YOGA 1T43A 4GZLA 1A7UA 4RKRA 2FH5B 2R4UA 3OFNA 4KWIA 3ST7A 2OPHA 2CLLB 3DFUA 4EJ2A 3B1KA 2WICA 4IQ4A 3TE6A 1SA0B 5AM5A 1IHYA 2ZSBA 3T7SA 1RWKA 3BB1A 4JLWA 4XX0A 1EVYA 3GBPA 1Y42X 3P71T 1T3SA 3IA2A 5T3YA 4H77A 3W77A 4IUCS 1DINA 1GQRA 4DA9A 2X5NA 5KIAA 4XKJA 1U2ZA 3BVPA 4XJVA 4DEXA 5ECDA 5HOQA 2CXHA 1II8A 5KNCH 4OP2A 3K0HA 1G6KA 5B30A 2NAFA 3MEQA 1JUDA 5JALA 3QUSA 4AG5A 5HS4A 2FV8A 1FW6A 1Z2OX 3IDFA 4KK4A 5TVGA 3V4PB 5KQSA 1GZVA 1JQLB 5IK2A 3NHLA 1C7FA 3ZDFA 4PSKA 4QPNA 1D5WA 1JEQB 4JKIA 4YP6A 5F5XA 4DTCA 4YCMA 5BNTA 4OOFA 2QLFA 5DHQA 3CB2A 4CM9A 2H06A 1YE3A 3JQGB 3HGMA 4OOEA 1EEHA 2BRUC 5K3DA 1KGDA 2N46A 2O57A 3F7MA 4J76A 1PV4A 4J75A 1ZPDA 2FQQA 2TMYA 3A1TA 4JI6B 1A77A 2XVYA 3I12A 1TMYA 2LR0A 3OE7A 3PNOA 1MJNA 1KGSA 1CQWA 3CSSA 2VYQA 5DCLA 4XJTA 1WQ1R 1G291 4C6TA 3I04A 1ZD5A 3P9KA 5L7WA 3VGPA 3PUVA 3U4HA 1PT5A 1QGED 2NTYC 1XDSA 4LVCA 4MHSA 2C2XA 3NATA 2I6QA 1PR5A 4CKXA 1H66A 5K0SA 2OQRA 4Y67A 2R60A 1ND6A 2QX8A 4N39A 3DKRA 1USIA 5B7NA 1P9LA 2OXRA 3FD8A 3ONEA 5EMJA 2QTFA 3VR6D 5IX8A 4L0DA 4LDRA 1E1RD 1PVVA 2QE7A 4OJMX 4XXHA 4X65B 3DWIA 1W7AA 2RAFA 2H0AA 1YMVA 2BYTA 1FVFA 1MPXA 2R5WA 3DEYX 3R20A 3K0AA 3TRFA 1NFRA 2H63A 5FBKA 2PUDA 3OBIA 4I5FA 5E6RA 4CDMA 4P2GA 5CUQA 5FV7A 4JJ4A 3D6VA 2HT1A 4F93B 4H31A 1OJ7A 3AFNA 3I01A 3PUKA 3WDMA 3OF5A 1JEOA 1DIBA 3UJAA 3KCQA 1XRJA 4U9UA 4ALNA 4EL5A 5JH7B 2AZDA 3WNZA 1OGJA 3GJRA 4NR0A 4MEJA 2C9OA 1XZMA 6REQB 5I9MA 3SE7A 2DC1A 4MW5A 2O07A 3MYRA 4N47A 2I4TA 3JPWA 3QX8A 1Z35A 1NFFA 3RI3A 1MQ8B 3EVCA 1NGSA 1Z3IX 2E85A 4UTVA 4BRSA 5MFZA 4M8LA 2Y1WA 1Q0HA 1I6WA 1VCOA 3R7AA 4YCNA 5JECA 3NFYA 4ZTBA 1W1WA 2WY2D 3T4PA 1Z6AA 3L0OA 1GZDA 4O4IF 2ZWOA 2ID4A 3LLVA 1K7YA 4FZVA 1AZLA 3C1AA 1EIWA 1E2LA 3PF8A 4X24A 4YRAA 1TQDA 4L4XA 1JR4A 4NZPA 1OFUX 3OPVA 1XTIA 1H1DA 1V3UA 1KXZA 1N0UA 2WE7A 5CB4F 2RHDA 3IQFA 4B3BA 2UVPB 4FFVA 1WD7A 3PC8A 2G17A 3UWPA 5A4AA 5F98A 1Y9ZA 4EW1A 4H7HA 3BFVA 1RLUA 2HBYA 2LXNA 2Z08A 2VZ8A 4HAZA 3FVTA 2HO4A 4HXYA 4XDYA 4C20A 4NZ9A 5LLTA 2JKYA 1ISSA 1H4QA 5AJUA 3RODA 3A06A 3AL3A 3TCXB 3GUCA 5B4TA 3ZBQA 3O4HA 2UXDB 2BV3A 5C81A 1KDRA 3WMXA 4IHQA 3IFSA 5AVXA 4G5FA 1GPUA 4MYCA 4OK3A 1NLZA 4N7RA 4XR9A 4GP9A 4HDCA 1NURA 2BKVA 4QTTB 3ETCA 4MAMA 1OIWA 3E2MA 4ESHA 2J3JA 2PX3A 5CXSA 3RVKA 4AY2A 1MHPA 4J2OA 1Y6FA 2YL2A 3LC0A 2OB1A 2WFMA 3TTTA 4CLDA 1A5SB 1RPJA 3ZGLA 2P4EA 4YJ2A 3QSYA 2B8WA 4M55A 1I01A 1YOVB 1PGPA 3U1VA 4P54A 4IDNA 3ZY3A 3ZJ5A 2Z1MA 4ZJYA 4LE0A 2V45A 3VO8A 3A4VA 5HIIA 2R1VB 1YR6A 4K8OA 1Y8AA 2Y68A 4IIGA 2XUKA 3HMKA 1TD9A 2QMEA 2QR3A 2WPDD 3ELWA 2DHCA 4N5IX 4DQDA 1ADCA 1WCYA 3GJSA 3R7FA 3GHHA 2QW8A 4V0OA 5CNJA 3EC1A 2XUFA 4UNQA 3TFWA 1A3CA 1RKXA 4MUKA 4EAQA 1QBGA 4Q3LA 3QTTA 4MHOA 4UAUA 1P1KA 3EIUA 3P9NA 2XNKA 1ZUNA 3LHDA 2UUAB 3EDQA 2OECA 2HR1A 1K6JA 4HLUA 5TGTA 3AI7A 5GONB 3VTFA 2FPOA 2GCOA 1RQ7A 2NO6A 3CO0S 3NDRA 4ASUA 3D5QA 4CFSA 1H3FA 4NOKA 2C99A 2WU8A 1ID1A 3BERA 2D1FA 4FKBA 2JARA 3H4TA 1P2DA 2QQ0A 3PNYA 1JR3A 3WNBA 4G5SA 4Q7EA 3Q8WA 4RW0A 1BKDR 5K99A 3F1LA 2Z6AA 1X8LA 3ELDA 4NENB 1TYCA 3VO2A 5KU1A 1B0UA 1YI1A 2JLBA 3U7HB 3HWSA 1N6HA 3S4YA 3EEQA 4M0UA 3NCHA 1U6KA 1G21E 1OWNA 4RABA 1ZMOA 2G6BA 5CVUA 3FUTA 3T7AA 1P1IA 3IIJA 2YXBA 2JZCA 3K1TA 1VOTA 1XZJA 2V4UA 3E7PA 3T15A 3VR5D 4K0KB 2DETA 4GI7A 3AVYA 2RGEA 1BCRA 4CCSA 3BBLA 1PV1A 1XKTA 5EERA 1ZJ5A 3UT6A 2W48A 3AQIA 2MJLA 2XUDA 3OF3A 4IOJA 4AMVA 2GKOA 4JKOA 3HBNA 1E1CA 1VJRA 3RIXA 3WMEA 1H2HA 2H1CA 4IXTA 5L3QA 1WSDA 1FQKA 4PHGA 1U8FO 1WEHA 1LLUA 1G60A 4BMPB 5AUPB 1Z33A 4EUFA 5JS1A 3DFIA 2X14A 3HV2A 5CTJA 1HDRA 5E6UA 1QQBA 1QTQA 5FLEX 4BBPA 2OLKA 2E5LB 5CVJA 2CMHA 2Q29A 4M7RA 2QAGC 1QS0B 3RRBA 2PIDA 4L5YA 1XU9A 1DZ3A 1BYUA 3FFAA 4HGPA 4X3OA 1L7RA 1J09A 1CYDA 2OHGA 3HUUA 3MS2A 4ZOCA 5H0IA 1RLTA 2FPPA 2O3SA 1WA5A 4Z4IA 1PZGA 3ZLTA 3IE0A 1X77A 1QRDA 1S3GA 1VXRA 1RHJA 1VM6A 3EEFA 4Q9AA 1SB8A 4MQEA 4UEJA 3WYNA 1EXVA 3RFFA 4FW8A 3ABRB 4MW4A 2X19A 3UMRA 2V6JA 3SYMA 4QE3A 3VPBA 4FP9A 4LNUA 2JFPA 1GM5A 1JKXA 1E62A 2IWRA 1RXIA 3PHGA 4FZ3A 4EW2A 4GT1A 3CTMA 4K9PA 2UUPA 5JRJA 4ARIA 1KAGA 2AE2A 2OFOA 2B3TA 3I1IA 5INTA 1MV8A 2WHPA 1NLFA 1SXJE 4WZBA 3FCXA 3RLIA 2PH3A 3QA9A 2IYSA 3W3AA 1JFFB 2PCLA 3OURA 1E64A 4REMA 1ZJJA 3UOAB 1WU8A 4AD8A 2VC2B 1S89A 4MWZA 5BWNA 3OCYA 4IIFA 2C2WA 3WLRA 4ZI7B 1YJBA 4DEYA 1GDTA 2FPGA 2IH5A 3QXHA 4WFIA 5KDDA 1Z6PA 3IV9A 2FMHA 4H17A 4J2HA 1GFSA 4KK3A 2KE5A 3BTOA 3FOAA 3LTNC 4JP3A 3MTAA 4PO3X 4WOBA 3EUAA 2Q6IA 1DAHA 4CODB 1JEYA 3MINA 4X1YA 3V9AA 2NOAA 4LOIA 3LWZA 1STOA 4FHEA 3ACDA 2HIHA 1Y8QB 3MGKA 2LKDA 3VR4A 1NE7A 3O3NB 2VYCA 4C9BA 5T8KA 2X0EA 2Q5EA 1LK7A 3QPUA 3D3NA 4ENPA 3TLAA 5L45A 2O1EA 1ZXLA 2QMUA 5FA6A 4DWOA 3NHSA 2D0OB 1MB9A 1DAOA 1DELA 3IGFA 4YS6A 3H9QA 3ZCXA 2QVLA 1JSRA 4I81A 1IONA 1KERA 4EKEA 1TTQB 2HGSA 2YHUA 4DMRA 1ENYA 2PJRA 2EP8A 1GGJA 4FNOA 2XYRA 5B53A 5HRAA 2O2SA 5C4GB 2NADA 2DWCA 2Z2YA 3B38A 3DE2X 3GLSA 4G0ZA 4LA4A 2XIJA 2QMYA 2Y0EA 5LIPA 4X63A 2XYGA 1TFUA 2AG6A 2HAEA 3CCFA 3HYLA 5AJVB 1Q2UA 1A9PA 1YZKA 2F3RA 4YWJA 1YI8A 1TUBA 3ECSA 3QG5A 4LJSA 2WKSA 3GPBA 3VU3A 5IF9A 1EX9A 5IJZA 1L5NA 4ZYWA 1NAHA 4YJDA 4N8SA 3DB2A 5BQOA 2UUOA 2Y93A 3QLVC 4G0YA 4MVJH 4YO8A 3UCFA 3W05A 2KX7A 2BM0A 2O7RA 1K0FA 1RHKA 1L7QA 2FOLA 2GEKA 3BFJA 4MR7A 4W5JA 4ARAA 5EJ4A 1DBRA 2Z5LA 4LKOA 2A5FA 4HWTA 3I6MA 2B99A 2O20A 2P5SA 4HN9A 5KDOA 4YROA 1FNBA 4WK2B 3RK4A 4MUYA 2GM3A 3HCFA 3IQIX 3UWOA 1DOAA 4G1EB 3CNHA 2ZDGA 3ZDAA 3KTFA 4EYKA 2JJ2D 4GNKA 4LNHA 1LS6A 3Q3GE 2XB6A 4GHWA 3FJYA 3NQ41 2I4OA 3B89A 1G5IA 4PAQA 3RSLA 4AN0A 4MMXB 3QE2A 3OFKA 1UKAA 4B3DA 4WE3A 4GLLA 3PDUA 2XE7A 3RT1A 5EG5A 4F0JA 5JTUA 4R69A 4U7JA 4QL3A 3ZV4A 4YCCA 3GDGA 4YMVA 2FX5A 3SQNA 2X0FA 2CUZA 3SIWA 4OX9Y 1VSUA 3S8EA 1NM5C 2DH6A 2VDPB 1UBRS 4HFJA 3NOXA 2PH7A 3OTIA 4PIPA 4CLRA 1GSIA 2HQSA 5I9SA 2IHUA 4OHPA 3VDRA 1P2SA 4LTDA 1N5MA 3CX8A 4JJ6A 4CL0A 2Z3VA 4D0RA 2Q41A 1E18A 2JIRA 2XUZA 4IXMA 3DQQA 3F96A 2IQIA 1L4KA 1M1NB 4Y1RA 1Q12A 4ND6A 1DL5A 1EYZA 1M2OB 4Q1DA 4WCFC 5FL3A 5KYUB 3L6DA 1I24A 3DXFA 1GRQA 3LF2A 3OQVA 4JB8A 4RF4A 2VKTA 3WLPA 1QF9A 1X7DA 5IKOA 4LF7B 1CE8B 2IS2A 3MCAA 2CXRA 1KBOA 3R77A 1RZUA 2YOFA 3CZCA 4FYIA 4NV1A 5EJ8A 1IWPB 1UDRA 2ZR7A 2X0JA 4DLVA 4OKIA 1XPOA 4GD3Q 3MWEA 3D6HA 1ORHA 1Q1QA 3GLUA 5TXGA 2G9RA 1MRNA 4NYIQ 2CMGA 4G9EA 2BHNA 2C29D 2VJCA 5AHWA 2ZIWB 3V8QA 1PL7A 2FE1A 1O6GA 3RIYA 3ET4A 3L04A 1S3IA 1TIKA 1V2GA 3A1FA 3HM2A 3IMCA 3OX3A 4ZT6A 4URVR 2PSSA 4QQ8A 2I8AA 5EMMA 2G5GX 3WKAA 4AM8A 2PGOA 1G6OA 1DCKA 1OFHA 3ZVKA 4E08A 5A62A 4N7BA 1I10A 4C0SA 2AT1A 5IUNC 3ER6A 1GVHA 3QK7A 1G38A 2F3TA 4H1WA 1WZ2A 3ZG6A 1X14A 5IU6A 1T8WA 1UPFA 3IPLA 1DJLA 3UB3A 3K70B 1YASA 2HUNA 3HUDA 2WVGA 3WZLA 4K9SA 2VCHA 4KGZA 2R1UA 2ZE5A 1NW9B 4GRDA 2A9PA 1QIDA 1J7JA 2B4AA 1ETHA 2IOFA 5KZMB 3EBPA 3FGNA 2Y66A 4FFMA 1SOAA 1SWWA 4QSHA 4JLKA 3OPXA 2A4MA 5KKCA 4W1QA 3O84A 5KQGA 2JIQA 4I4NA 1CK4A 3P9PA 3O1IC 2O3RA 3BE5A 4LZNA 4G1MB 3UEOA 3ZE9A 3EVTA 1CQIA 3CVYA 2JHCA 5JSUA 4ZCPA 2ZS8A 4TLMB 5ADUS 5EJ7A 5IABA 4DLBA 4UBMA 2EHDA 1OI2A 2OCPA 2QLTA 3RADC 3O2JA 4G0NA 2FN8A 1PGQA 2AK3A 4FYPA 5IBQA 1LPAB 2ZYUX 4AJKA 1WPRA 2WD8A 5KSOA 2OZLB 3OPNA 3RIMA 2RHMA 4UMEA 1PWZA 1UXIA 1E5DA 3OPYI 1NRWA 4CFZA 2MYPA 5DMHA 1W46A 4PGHA 3TL3A 4A8JB 4DDTA 4MMYB 4QAQA 1P9OA 1M34E 821PA 2H65A 3RWBA 3CH4B 4O02B 3WVNA 1EWTA 3GC6A 3NT2A 3A3OA 1PR1A 3LA8A 1KFCB 1VSVA 3QF4B 1YVDA 3JQ9C 4Z53A 1KYXA 1D2CA 1FP2A 4GECA 1QSGA 2XVXA 4L02A 1P5HA 4JNKA 1E3TA 3WC4A 3Q7IA 1LFAA 2X40A 3HB7A 1E3JA 4P22A 4HDKA 2DKFA 5LYJF 4LZLA 1TKAA 3BH6A 3IESA 3NEYA 4TSFA 1J5EB 2CV2A 3I53A 1YB5A 1NP3A 2ZEJA 3O3OB 2R2GA 2C1EA 3EZNA 4NOMA 3OZCA 4MS4B 5HTOA 2B8NA 3AUKA 2QY6A 4EA8A 4CBVA 1MAUA 1W94A 2QG4A 2RJNA 4FI3C 1XWFA 2AEEA 2AXQA 3KD2A 4GPZA 1MKYA 2Q45A 4O5OA 3ROQA 3THXA 4QXPA 3SHOA 2G5TA 4D3XA 2AW5A 2ORVA 4YACA 4TWIA 4D4LA 1GIAA 2PVCA 3JTMA 3H5AA 4OL0A 4QBIA 5IW8A 3VHLB 4ICIA 1L4GA 1OGYA 2NO7A 2OV4A 1RXWA 3EXAA 3K0FA 2PJZA 1IZZA 2FX2A 3MWDA 3O8DA 3W6NA 3CEMA 4EQ6B 3VI4B 2I1VB 1CEEA 2C4KA 5K3AA 1S2MA 3QVXA 4O4JB 1FP7A 4LOAA 4ZVPA 3S2GA 3V6LA 4B76A 1Y81A 1XKLA 1WKVA 2B4TO 3LZDA 2JCXA 4Y6OA 3I6ZA 2DPMA 1IOWA 3NLLA 4RQUA 5GQSA 2NM0A 2ZIFA 4JBLA 3VA7A 3ENWA 4QSMA 2W70A 1KP9A 1PTJA 3AUTA 4M21A 2FB9A 3R8FA 1GFZA 4BDSA 4QPCA 3FPAA 2VHVA 1C3LA 1V48A 3SF0A 5TMDA 1U3CA 4PR3A 3EHEA 3BS4A 4C5BA 1AX9A 3NM6B 3KRTA 2ZM6B 2X0IA 5CA0B 3SIRA 1BFUA 2EHJA 2OY0A 3VR3A 2VDLB 1F7UA 4HUQA 4U02A 1A7JA 1FDSA 1MEJA 1VBFA 2OV6A 3PGJA 4CIVA 4JV5B 5A5DA 2Q2NA 1UXOA 3GPIA 4J3FA 3TB4A 4G8DA 4Q16A 5J4HA 1Y8RB 2O48X 4IGAA 1BCSB 1ZONA 3JPYA 4IKEA 3T5TA 2Z9BA 4BGVA 3QTLA 1ZM4A 1CBUA 1NXQA 4EJSC 5IVKA 3LBFA 2ZRDA 4M2LA 5HQ3B 4ZU6X 4PLHA 4FDVA 3S55A 1M75A 4XLLA 2J9FA 3E03A 1BDMA 1SM4A 1TVMA 4TKUA 4DWWA 1ZJWA 3EMVA 3E9YA 4UUNA 4WGGA 2I0FA 3OUZA 5DBOA 1RQPA 1WS6A 2BE9A 2XOKA 4OVKA 5F3DA 2I4LA 2CFIA 2HMTA 4HJXA 2Z8YA 1MPTA 4L5AA 5EPOA 2CL0X 5FBZA 1BKSB 3GF4A 4KN5A 1JQ3A 4AQDA 4OJNA 3H7IA 1NJ8A 4P92A 5ALJA 1CP2A 4QARA 1JDBB 1VXOA 4FB5A 4XQGA 2CD9A 2ZI6A 3FNBA 4ZGGA 1X39A 1HX7A 4X3CA 3T3OA 1G9TA 3PFCA 3VYWA 5ICGA 4DIKA 3EXEB 5K6AC 2JEYA 2ZSUA 4IDCA 2G4VA 4HAVA 4N54A 3T0GA 1YDMA 2PGXA 3CH7A 3QI2A 5F1PA 4IKOA 4DMLA 2XDWA 1RS0A 2AN9A 2I5PO 2R44A 1DQSA 1N1EA 3ND5A 2YJZA 1POWA 3GFFA 4EY4A 4TXMA 2O8CB 4OHYA 4KITB 1WHTB 2CHQA 3FPJA 1I7QB 2G71A 1K8RA 2IYVA 4CQNA 3VNSA 2PFSA 5C52B 1AHIA 5J47A 3A4IA 2WWVD 1NYQA 3TGPA 3K09A 5EZSA 5K03A 5IC5A 3LOQA 1Z4KA 2YNMA 3PYMA 2VI5A 1QGAA 3FHJA 4P7FA 3INRA 4RD6A 5EIXA 1BZYA 1LWOA 1SKQA 2PWYA 4LV5B 5FI0B 3SKYA 2XR1A 5B3KA 3TRKA 1QRSA 2I6UA 1QIJA 1ONPA 1QV6A 1DQPA 1ZK0A 1M0WA 1F48A 4KUGA 1E0KA 1WZNA 3PXGA 1PIWA 3D43A 3DEZA 1VE1A 3DA8A 4KFTA 1IPEA 1PKEA 3S5UA 4AP6A 2ERCA 5CEFA 1G2QA 1LB1B 2R8ZA 4I55B 3HJGA 4MDYA 4G63A 3R41A 3U3KA 4UMVA 1S3SA 1V4BA 4P3PA 5DLQC 1R0SA 5EWLA 1CS0A 2IODA 1XNHA 3P8ZA 4Z1MA 3KKOA 3C3JA 4AFNA 5IPFA 1EE2A 4LF4B 1T36B 1NV9A 2XUAA 3LAWA 5E38A 3ABOB 5KAPA 4RK7A 1P17A 4AULA 4BP9A 3GG2A 3R7SA 1E7MA 3DE1X 4X6UA 1Q95A 4DRXB 4F3RA 4QTYA 5IT4A 1LSJA 1ZW1A 3KZVA 3GOQA 1VJCA 1F1JA 1QG6A 4GKAA 3KBOA 3MJEA 4PAMA 3UMSA 4D8YA 2CCKA 2VUHB 1E3LA 1P5JA 1H2FA 2NO0A 3NWOA 4RE5A 4WZ6A 5KI6A 4QVGA 4ZV7A 2Q2VA 5EJIA 1DFIA 2XQKA 1AKTA 1R0YA 5DNUA 5B4VA 3QMPA 1BYIA 1RABA 1S1CA 5KYGA 3MOGA 4R83A 2TSYB 1VLLA 3TL6A 4KJXA 3W8FA 4JJEA 1JU3A 3H2IA 1FFHA 3E15A 3ZI7A 3LNTA 3DV9A 1X2EA 2WAXA 2WJZB 3Q3HA 1KVQA 5B1EA 3MT0A 5IWCA 1G66A 1P29A 4N0QA 3JSXA 4Z9FA 3WHLA 3DFFA 3F4KA 4ZODA 5CG2A 3OQ6A 3ERCA 1P45A 1LD3A 4NAHA 2XCRB 1V16B 2XWBF 4QNNA 3E58A 2I29A 2GILA 4JI8B 1A2OA 1QZZA 2WM2A 3C14C 3EN0A 1V11A 4KQCA 3T9CA 4JI0B 3WGGA 3NBQA 4GOJA 4EB8A 1ZUIA 2ZIXA 4R9RA 2FUG6 3L7MA 2ZJ4A 1NUAA 2R87A 2NU6A 1RJWA 1RW4A 1MJ5A 4Q4HB 4UCFA 4Y9RA 3W78A 3OPYB 4K9QA 4G1VA 3P2KA 3AP3A 3DTYA 4R0NA 1CNMA 4DIDA 4PG8A 1O96B 2A9FA 3EDYA 3GPLA 2QTMA 2BFEB 3IT0A 4JN6B 2L69A 3WGMA 2PH1A 4YP1A 1RSZA 2QKYA 1IG0A 1DKUA 2XSZD 3QW2A 5CVTA 4O2RA 1XQVA 4BASA 1ZA1A 2MINB 2XPCA 3RVRA 1BD4A 2VPPA 1OLUB 2KS6A 2X4IA 1IVYA 3BJMA 3N87A 4ZVUA 1A4UA 1DSSG 3TQTA 4RDCA 4N41A 2C2OA 4TWZA 1DRKA 2PH5A 4WESB 1L4EA 3KZ1E 7YASA 3UAWA 1J90A 1UJ5A 3SF8A 1H6AA 1JR2A 2CLIB 5DHAA 2XITA 5FPYA 4DPMA 1ID8A 1RBMA 1ECLA 2AB0A 2J5RA 1C1YA 3BIOA 2FJPA 3CB4A 5K5EA 1EJ6A 1SBZA 4EVRA 2I99A 2C3PA 3C16C 2R68A 9ATCA 3D8RA 2FWPA 1ZR4A 2G72A 3O82A 1WV1A 4GZ6A 1MAWA 3BGWA 4RH3A 2ZR8A 1PFVA 1T4BA 2DFVA 3WLNA 4XRGA 3TJMA 5KNCA 5C7YA 1XJQA 3E2PA 3WQRA 5CEJA 1KJ9A 4LXIA 4KTVE 4AZSA 3TBHA 3K70D 3HSSA 2JDIA 1P75A 3GQVA 3FPCA 4Y2UA 2R2AA 4DLUA 2C5FA 5LQMA 1R0KA 4L3OA 4WY8A 5TEWA 1T0UA 2OEPA 1G2OA 1TM2A 4BFXA 3G49A 5EI5A 2JJYA 3G0GA 3RVMA 4X92A 1E2FA 2Y6VA 5CHYA 3VHRA 1N8TA 5EHIA 3YASA 4QXOA 2HMVA 2OFWA 3H7AA 2FN3A 2PWPA 1DUVG 1XD2A 3RYTC 1QVWA 1V6SA 3D3JA 3UJ6A 3PQEA 3Q98A 2B20A 3IBSA 4OXRA 2ZBUA 3N6VA 4F85A 2XA9A 4UM9D 4HNAA 2ZJ2A 2DFKB 4UXJA 3U60B 3BMNA 1QHXA 2TECE 1OBOA 2BUCA 2XMPA 2RGXA 3RU7A 3J81k 4UHKA 1T26A 1ZIXA 3TWOA 3G0OA 5C5DA 1Z7YA 3G85A 3MIZA 4RORA 2Q7OE 4ABYA 3CC8A 3KQKA 2YN4A 1DC6A 3CJTA 1O08A 2BEVA 4GR4A 3UV3A 1M6WA 2D0PB 6YASA 3O8OA 3PBKA 1SCBA 4TS3A 1CR4A 2HREA 5JDCA 2C9YA 1IBSA 1GGKA 3IX7A 1X1SA 2GVZC 2PGDA 4UARA 5DLDA 1JXMA 3FWYA 5KSPA 2Q3CA 2WLTA 1E3QA 1WV0A 3GRKA 1OZFA 3T7DA 4IGIA 5ITZB 2GFIA 4CV2A 4CETA 4GOOD 2DOKA 2PZMA 5TPZA 3GELA 4L5CA 2FFJA 2O52A 2WUFA 4PEVA 4QULA 4XR4A 1Z34A 3EBLA 4FGUA 5DDIP 4HN4B 5JBIA 4I6GA 4Y18A 3GD5A 5ALVA 5A0VA 4MKZA 2Y1FA 4ZIRA 3OQ1A 2HRQA 4LSMA 5K05A 4LWPA 1QVVA 4RZUA 2H9YA 2HU8A 1NNEA 4DY4A 2HCTA 3ICCA 1GN9A 2IYWA 1BQ4A 1TYZA 4DCPA 3GH3A 1XDUA 1FSSA 4YJ3B 3A2MA 3B6IA 3VNVA 2IELA 1ZXXA 3GW8A 1OGIA 1G5HA 2PUVA 3AYZB 2Q27A 4B40A 1SHKA 1BXGB 3LFTA 1G63A 4ZVVA 1JQEA 4WOKA 4EI8A 5LIRA 2XXBA 1RC8A 2H29A 3EGDB 4WEOA 2FF5A 1C8BA 3QPDA 4MV9A 3BJZA 3VAZA 5TIIA 4R8SA 1P19A 3I76A 4CDNA 1JJVA 2PU5A 5IJ0B 2GWRA 4OV6B 4ZRMA 2C7OA 4D9FA 4RK6A 1QORA 2PLNA 3C5CA 4C7OB 1ISPA 1Z2DA 3TVTA 5AHRA 3ASUA 4WACA 4LHXA 5L3SA 3K05A 2FP3A 3RS8A 2PUEA 1HG1A 1QR6A 3HR4A 3EVAA 1PZNA 4DR5B 4LHEA 3RS5A 1PO7A 1SU7A 4MV7A 1NSYA 3N39C 1SMKA 2ODWA 2WZBA 3TOSA 2DLCX 4C0QC 1YONA 5CNMA 4BNWA 2OGTA 3WX0A 4C0BA 2QTHA 1MX1A 4DTIA 1J8FA 2YZGA 4BOYA 1UK6A 4WFQA 3CMCO 3T4UA 1IXRC 1W2HA 3M4NA 2AC4A 4L8VA 3OZFA 4CR8A 3NTVA 2QDKA 3VKHA 2WD9A 1RWBA 3FMOB 5TRTA 1QCDA 1PTKA 5FNVB 3HHEA 1TZCA 4C4OA 5E7QA 1QFYA 5AKXA 3RLFA 4WRRA 3Q7SA 2FOIA 4QDTA 2B37A 5B6PA 1Q1ZA 4B74A 3IEUA 1CY1A 1WB6A 5C9ZA 5C8YB 3QUTA 5FTLA 3WLQA 1HYHA 1Z8NA 3AOEA 5I5GA 4HWPA 4YV0A 4OQQA 4QZVA 3KFLA 1MOZA 4DY6A 3AU9A 3PDIA 1UP7A 2B0CA 1C7IA 3CSDA 5E0KB 5CA1F 5KTKA 2C82A 2D59A 4C0HA 1BWRA 3G5TA 4K9KA 1U3UA 3WWPA 5DBFA 4ZAXA 3GFRA 5FPSA 1JW9B 4BLWA 2OHJA 2WE8A 2B5WA 3V7UA 2BHSA 3H84A 3REQA 3M3PA 3H0EA 4RVSA 3M4JA 1AQNA 1IJEA 1QJ4A 1QWSA 2XVMA 5CFZA 4IX1A 1C0LA 3KYCB 3Q7QA 3NWEA 4C4PA 1T4GA 3EAGA 3B7WA 1B2RA 2WF8A 1E0SA 2PKCA 3A3YA 3GH1A 4F4JA 3PEYA 2UVQA 4M3NA 4L15A 2B7BA 3FGOA 4OHUA 1J0CA 3I2GA 2Q07A 1Z6TA 1ZS9A 2GR9A 4H3VA 4ZVNA 2RH9B 5KWVA 5DM4A 3SS9X 4I8XA 3C3EA 1A71A 3WKBA 4DCJA 3LMKA 1D6NA 3RFTA 5HJ5A 1IBKB 5L6MB 4CHGA 4QTZA 1Y34E 4D7AA 1G8KA 3KV1A 2HY7A 3IQXA 1YS9A 1HEIA 4NOJA 3GEDA 5EMLA 1GRVA 1YT5A 3K9NA 1QZ3A 2VS1A 4OFWA 3PWTA 1T4CB 3L4BC 3WOHA 4P5DA 2UYHA 4UXHA 4B32A 3HP7A 2WIGA 4RHEA 5ER9A 1ZH0A 4H7EA 3DHEA 2ACWA 4H1HA 3T3NA 3CEJA 2ODQA 1TLFA 1PAUA 2OLJA 3H19A 4CHTA 2OHHA 4UM9B 4B6QA 1TDJA 3X1JA 3BDAA 3GUYA 1CZNA 4N0MA 2P6OA 1Z0FA 1VHDA 3JQAA 1I13A 3LBHA 4MA4A 5CW2A 3TOCA 4E09A 1J00A 2WNSA 4F06A 1XLTC 2IHKA 5IC4A 1C1XB 3RARA 4BB5A 3C3CA 3SX2A 4K6KA 2XWPA 4RULA 1ZM3A 4S12A 3S1LA 1QRAA 1NQAO 3FMFA 3U40A 2A86A 4H1VA 4L0MA 4P58A 2G0AA 1QRUA 3WK7A 3R3WA 4UULA 4WBNA 1A82A 1QLJA 1RAHA 4JJIA 3DDWA 4O5AA 4IDGA 3MTDA 1CUZA 2IL1A 1TPYA 1ECPA 4BGEA 1GV0A 3EWAA 2VA9A 1L0BA 2JHGA 1X9GA 2GRUA 4N6GA 1OZGA 1YBFA 2RGWA 3G59A 3IVGA 3RG2A 4I99A 5LNK6 2YHAA 1RJ9A 3IKJA 4COOA 5FA5A 4MKFA 1OVGA 2TYSB 3KWLA 2CNOA 3FDIA 2NAPA 3AMVA 3JQBA 3HZRA 2XGSA 3G6WA 3A2NA 1MAVA 3AIKA 3ESBA 3K6KA 4G86A 1XLUA 3P9ZA 4L4UA 4UTZA 4HDQB 3LXUX 3KJHA 4YECA 4C4YA 2I34A 3FJ1A 3NTOA 3LUKA 2R86A 1VE7A 4F2PA 1X6VA 1OA0A 4LMBA 1BGXT 1Q83A 1ZRHA 2Q0QA 4FYMA 4P53A 4PYMA 4TKVB 5CH3A 3ZNPA 2CJYA 1NYRA 4EITA 5AKIA 4F3YA 1AUPA 4JVSB 5IHXA 2KPOA 2WF6A 3R0QA 2IU0A 1H2XA 2Q4TA 3K35A 1IAVA 3GFPA 1YJAA 3PWSA 4EX7A 3UBTA 1EFAA 3D4LA 4ZK6A 3ET5A 4JX8A 3AUFA 1Y5LA 1P5RA 3W2HA 4EHJA 3CRZA 4IVNA 1TIPA 3GEHA 4M0LA 5CITA 1N7JA 3SEFA 1KJQA 4CL8A 1E89A 3T7IA 2BEWA 2HI0A 1WHSB 3AY7A 4B34A 3U61B 4CMIA 1DX4A 4WKPA 1JAXA 1N7HA 5FLYA 2QPLA 2FP4B 4PFJA 5JZMA 3E9DA 4OAPA 3BORA 3COSA 1J49A 2WVJA 3BQMB 4ZYXA 2CLKB 3MB5A 4RZ2A 2WD7A 1QQAA 2NPOA 3KFVA 3K0KA 5I5EA 2NTVA 2VOEA 4DV7B 2X8JB 5IJXA 4CTKA 1WO8A 4U2GA 3CNBA 1UEXC 4XQCA 4BDTA 4S05A 3QVLA 3UBMA 5JSZB 4M98A 1U98A 3RNLA 2H92A 2XOXA 3CEAA 1UBGA 1A9TA 1GAJA 2R25B 3RRZA 5AUOB 4YAIA 4YQZA 3KKZA 4AY6A 4JLAA 4FMPA 2ZRHA 2J6CA 4HQFA 3OCVA 4HDSA 1LA2A 5IYZA 4B4KA 1DEXA 1L7BA 1RMQA 1RWVA 5EVJA 1X7XB 4X9XA 3WIBA 3P9SA 3ML1A 2CXSA 2P4QA 1QKIA 1ULUA 2DFTA 3OECA 4GFDA 1S6YA 3NBXX 2AMVA 1ZMXA 2LDXA 2V9CA 2WWGA 1J0XO 3D6FA 3MWYW 3ONNA 4MS3A 4RDIA 3RKUA 4R2MA 4CM6A 1MIOB 1N6OA 2B1JA 1TUGA 2Y4OA 2BGGA 2FEMA 4CF3A 3LBIA 1Y6GA 4OLJA 4HB3A 4PCUA 3HNRA 5CR9A 3U9SA 1ONNA 4OHXA 3IS3A 1T3HA 5HIMA 4GDFA 2NVBA 3E9CA 2W8ZA 2HX1A 1KVSA 3LLUA 1CZRA 3SBDA 2VHUA 5A4IS 3NBKA 2BFNA 3QHQA 3AFHA 1L7MA 1IH8A 3LUCA 3HCAA 5HJ7A 2NVUA 3NTRA 1GP2A 1E63A 4HH4A 1W52X 1NVMB 3ZHZA 1T91A 1Y4DE 3UMGA 3M6VA 2FR1A 4X8MA 5AW6A 4DLPA 1Q77A 2Z2KA 3EVFA 3SWWA 1TA0A 5ERYA 2FK8A 1W4AA 4GYYA 1T15A 4L07A 5KHLB 4D82A 3F8SA 5IFLA 1BW9B 3ETDA 4FWIB 5F9MA 1E2JA 5IBPA 2W4MA 2ZRLA 5EUQB 4FZJA 3V8NA 1JB1A 1B74A 1VLVA 4D9MA 1X7HA 4J2TA 3IAUA 3PQCA 1C5KA 1OE0A 3C1UA 5D5QA 3QUQA 4UASA 2NGRA 5KCMA 2W2LD 3IP7A 3UB4A 1ZUHA 1XP8A 3A9VA 3L40A 1QBKC 4JSRA 5IAJA 1G20B 5JFGA 3CKLA 4XUCA 4TVBA 4XWWA 1KOJA 2NPIA 3OM8A 4YXFA 4GKKB 4YR9A 3DCIA 1QO0A 5AVKA 5FO1A 2Q1SA 4BO6A 2F9FA 2I67A 1ES9A 4Y6QA 3HXQA 4Z4FA 4W7IA 4DBVO 2ACKA 2HA6A 2JA2A 2AI2A 2XMQA 3BIFA 3I09A 2AGVA 4GX1A 4Z8XA 3RVPA 1QQ5A 1EGHA 2EJUA 2P2NA 2FYTA 3UK1A 4EI2A 3U6KA 4B6SA 1IG3A 1MQ9A 1UZNA 3FXAA 4GUDA 4IYJA 4YAWA 1SOWA 3SLGA 4QM7A 3JATA 1HDYA 1E60A 1A9XB 1Y9EA 4TLDA 4QD3A 5D5PA 4ZDIA 3E5NA 1R8YA 1SUAA 4G26A 2YVLA 1JGTA 5FQNA 5E0OA 2ARKA 2AUNA 1J24A 1PK9A 1SHTX 4LCJA 4A82A 4B31A 1AGYA 2IYXA 2GZHA 2J46A 3EXIA 2A0FA 4M1KA 4YUVA 4DR3B 1BMQA 1EUCA 4MGKR 3N2KB 3NRJA 4AG6A 4QXQA 5MHTA 4NU5A 2V7EA 1BHJA 2G40A 1B3BA 3BSWA 2H07A 4E1VA 5CX4A 5EIBD 1IRXA 3IVRA 1SELA 2GCGA 4W7HA 3UJNA 2C77A 2ZKLA 3IAHA 4EB3A 4QGSA 2DQZA 4H4CA 4YRBA 5LQRA 5LR6A 3DT9A 1V9CA 4JR1A 1XL0A 5JVDA 1ZKMA 2ZTMA 3GLKA 3JSAA 4KQKA 5GIOE 1U28C 1TVKA 2PUGA 3AEKB 3ACCA 1N5OX 2IZ0A 4TL9A 3R3YA 2HMSA 1GNLA 5C5EA 4DLAA 1HKHA 2DQ4A 1QQ6A 5B3LA 1Y0BA 4H7IA 3BWYA 5DOZA 1M67A 1KHTA 2QBYB 4NZYA 1WCIA 1Y6ZA 4NXMB 3VISA 3TMKA 2P9GA 3HJUA 3U16A 1W5BA 3USZA 2F62A 1QE3A 1ZC4A 3LXRA 3TNDA 8GPBA 1N2HA 1BDBA 2Z5GA 4HXFB 2JFHA 2NZUG 2HZBA 1J97A 3U3OA 4BAZA 5LUBA 4OMFG 1XVTA 4FFDA 2PSEA 5JSFA 1VKOA 4M0EA 5J2UF 2NZ8A 4X44A 3E7WA 3IH5A 1RKQA 1SBTA 4ISBA 2ODNA 4UHBA 2BTEA 3STWA 4I4TF 3VR0A 4RVFA 4TVOA 2O8DB 3AKCA 4DWVA 6NULA 4ECEA 4P4NA 3G9XA 1OFIA 3Q3VA 2EZUA 2HQBA 2JJ1A 1ADBA 3DL0A 3SJBA 4BFTA 5KTYA 1IU9A 2LNDA 4YVFA 2GVNA 4MDFA 4MEBA 3FPGA 4KZPA 3MWJA 4KXVA 4E31A 1Q1AA 5C8VA 4KLCA 2H1LA 4R9UC 3HN2A 1TO1E 3AK4A 1W47A 3A6FA 4V0RA 5F7JA 4DA0A 1NF9A 4DUPA 1CJMA 3EVBA 3R3XA 4Q4LA 5PNTA 4UUPA 4IIDA 2HNBA 1N5JA 4ZVQA 3CVVA 3DZGA 5F3WB 4IRMA 2XKKA 4EIWA 4YUXA 1P7WA 2G1PA 4UM7A 4D5GA 4L3WA 3FR7A 3H2HA 1XMQB 4BLTA 1AIPA 1AXGA 3I8SA 4IICA 5FH9A 1HL7A 2YWDA 3NHMA 2G9NA 1ZAYA 2EARA 4JBGA 4KOEC 3AUJB 2D4HA 1B43A 1VQ1A 4B84A 3PJRA 1QHIA 1K5HA 1Y3BE 3IVCA 4K9OA 2PGIA 1H2WA 1R6XA 4BKQA 3WB0A 1E1LA 2BWJA 1ZINA 3UC9A 3K2IA 5B3JA 4ENRA 1SUPA 5B1YA 1M3SA 3EE6A 1Y4ZA 3QKSA 3KB1A 4EG1A 2VNJA 1P77A 4KRGA 3VDMA 2RGRA 3A58B 3KDSE 1Q0SA 1SWVA 1V7PC 2C4WA 3CBQA 3UFXA 2W6PA 4X1IB 4Y1FA 4JB3A 2NUTA 1IEWA 3S27A 2BIFA 3WGKA 4B3SB 4IH1A 2FW8A 2P2GA 4H1TA 3FCEA 4MR9A 1DOHA 4RBNA 3QPVA 3W8NA 4EYQA 2WQ6A 5LVAA 1KPGA 4HEA6 1Z13A 2H7YA 4Q1CA 3SC2B 1XCJA 4CCYB 3JVVA 1BS2A 4BJ3A 5THKA 2ZP1A 1T5HX 1OUMA 1ZHFA 3Q2IA 1ZP6A 2YDYA 4WXPA 2QD4A 2C88A 1FYWA 2FMIA 2PZ8A 3ICOA 3INYA 3QJYA 1O1YA 3TSYA 4YDRA 3S70A 5BPHA 3DEFA 4Z9BA 4X1KB 1I2MA 1D03A 2FPIB 4WT7A 2Z58A 3B9BA 4DV2B 4GRAA 2V7VA 3QRWA 3AUUA 4GOND 1XT6A 3N75A 1QRTA 4HXGA 3NHFA 4GMDA 2RONA 1R15A 3W79A 1GL9B 1LF0A 4LRXA 3IALA 2PGNA 4P3YA 4C05A 3M6LA 1K3UB 1QPGA 2D0DA 1FJGB 1V1MA 3JCZA 4Q1AA 5AW9A 3LK6A 2IKQA 4CXMA 1IIBA 2CJPA 2IUTA 2W9XA 2UYQA 1WDLA 2WUWE 1JHRA 1UPAA 3E61A 2R8BA 2VF2A 3R3JA 4R3NA 1KXJA 1TK2A 2H85A 1YBMA 1TYAE 1USGA 2WIAA 4G3XA 4Q7KA 4R8RA 4D96A 1PJ8A 5IM4A 4KBYA 4CGYA 2P9YA 3K1AB 3PUIA 3A9UA 4HX2A 5KX5B 4JK3A 2WYVA 4KE7A 2Q21A 3Q0TA 4Q48A 3R3SA 1GL7A 1E2EA 3AI1A 3BJIC 5D2CA 1HQDA 1PYOA 2OZVA 2YC2C 4MWDA 3DR3A 3TPFA 2NT4A 5HG0A 3NTLA 2G5CA 1DKRA 3P2EA 4H7DA 3TLZA 1OB2A 3PP8A 4BKRA 1B0PA 4LHSA 1OIVA 2AUMA 2OBLA 3H86A 4E6PA 4DSZA 1NL3A 2FCAA 3W5VA 5KYTA 2IYPA 2XV1A 3C5VA 3TSOA 3LG2A 4OFXA 4UFNA 1B42A 5ICFA 3QEBZ 5IK2D 4IJVA 5J2TF 4WNAA 1OBHA 4MW0A 4BS9A 3P4YA 1JBEA 3V4SA 1ACLA 1WW3A 3SHFA 2AYZA 2GK4A 4TUYA 2B5OA 1IY2A 4CM9D 1OLXB 2MMCA 1WXWA 4S1PA 1EQ2A 5A5EA 3DT6A 5ICSA 1EUQA 4ZV9A 2L19A 3IP1A 3RYFA 5A2GA 3KL4A 4KP7A 1P1HA 1JIKA 3OE7D 2NQTA 1JG6A 1Z5OA 2OBNA 3MXOA 2QSJA 3JX9A 2AEFA 5BNZA 1T8UA 3E05A 1JEAA 3R5XA 1N1DA 1Z45A 3QKRA 4ESOA 2A9QA 1LPSA 3VTZA 1BRTA 1UC8A 4K3UA 3AR6A 1OMOA 2WJ4A 4IHAA 3RRYA 4CIAA 3R8XA 1HNNA 1RYYA 2NX2A 2P79A 3FYUB 4YLEA 5HZKA 1Q0QA 4PLGA 1M2VB 3HJFA 5IJ9B 1U0JA 3AXSA 4RZ3A 2WMNB 5T7BA 1RYBA 3H3XA 1CRLA 1KO1A 2ZI7A 4XTRA 1QJCA 3ZQ6A 2QE7D 4EARA 5A6SA 2VHXA 3ZCPA 4BP1A 2NACA 2V7QA 1UBMS 3KKEA 3LX6A 4Y2TA 2ZIGA 3F5MA 2PBLA 3PUZA 4L4YA 3H4VA 2EATA 2ZJ5A 4JEMA 2IPOA 3ZXSA 2XKJE 4J8PA 3TG8A 1U11A 3VYSB 5JNUA 4YMWA 5C31A 2J9RA 1NWHA 3HSYA 4DJDC 4KFUA 5THQA 3U6BA 1NI3A 1JG2A 3PC8C 5FJIA 3U7QA 1IFXA 2O5CA 3WLIA 1U9YA 3KB8A 3FF4A 3P20A 4LOHA 3UCEA 4AJNA 1PW5A 5CVEA 1V1RA 5J40A 1JR6A 2F6RA 4MV4A 4N49A 1VCIA 3R4VA 3GZ4A 4DMMA 1JBKA 1KIAA 1ORRA 1BXZA 1G4HA 2BAGA 2JF0A 2PTGA 1TLLA 1B73A 3T1HB 2I54A 2EDAA 3LOPA 3PEWA 2Z8XA 5GIPE 4JC5A 3GLHA 2PWBA 4GXTA 1KO7A 4U3JA 2C07A 4HEJA 4RAOA 1GDDA 4ZO8A 1WW8A 3SM3A 1XC7A 3EG5A 4WINA 4DRZA 4EF4A 2PM8A 4BQQA 1CQJA 1DBPA 2JCYA 2FN7A 4XGNA 3RJ9A 5TQJA 2ZJ8A 5EE1A 3PUJA 3K6SA 5BPFA 1ULHA 4JL5A 4J0JA 4RIGA 1ADGA 2AIRA 3GCXA 5GOZA 2O2YA 3S1SA 2WFLA 2ZUSA 3LKVA 1GRNA 2AN5A 4I5DA 4OBXA 3VX3A 1NJGA 2ZATA 4NG5A 3UUEA 4TV8A 4ATNA 4F12A 5KQPA 3BD9A 1P2VA 3IODA 3WJ2A 1I7DA 2BSXA 2ZITA 1O0BA 5E9JA 3ZHCA 4NJMA 2OESA 1I9GA 2JVKA 2AD1A 3D7KA 4Z4EA 2Y2VA 3OQIA 5K20A 1Z17A 3MBKA 5DCWA 4DGSA 3ZD9A 3S2SA 1PX0A 2IUUA 3VKFA 1BJRE 1ENOA 2AX4A 1T9AA 2ZKIA 4KRFA 1HMPA 2Y4NA 3WGHA 3EG9A 4LJYA 5K0CA 5LP6A 1WBBA 3FTDA 3DEKA 1Q3TA 1Y5IA 4MQBA 4QEKA 1NOKA 3MAGA 4LJ4A 3MILA 4RK0A 5KOYA 4U6SA 3ZU5A 4LJAA 1E2HA 1DAGA 4KLZA 4CW7A 1U8EA 1BEEA 2JD2A 1GA1A 1V1JA 3MGBA 3ZXXA 3HS3A 3NGLA 4NMWA 1PUXA 4E70A 3O6VA 4KO3S 4KQIA 3IAFA 4EKDA 1A2BA 5FULA 2BY4A 3EZYA 5DI3B 3GJ6A 3IP6A 4FFNA 2WYIA 2F9MA 2EWMA 4Y2YA 4ZJUA 3QLUC 3ILSA 3FNRA 1DCFA 3QFHA 4HO1X 1RLJA 5EGSA 1QAOA 5HKLA 3GT4A 1QIFA 1XTPA 1B14A 1BMFD 3CCCA 4ALJA 1DJMA 4HVLA 2G08A 5IXYA 1NZFA 4F4FA 4ZYUA 3JRWA 4O33A 1AURA 5CLGA 3X2FA 4NATA 3OY2A 3QU2A 1LBQA 3WSWA 2JH3A 1OKKA 1UBFA 2D2IA 3O8RA 1PR6A 4IIYA 2PIAA 3JQCA 5JH7F 3SOZA 4OQZA 5EIWA 1FRQA 4JHLA 3WFJA 2WAMA 4K6GA 1ZK4A 1WMSA 2B7LA 4V0QA 4AS2A 5K8VA 4C08A 4G56A 5FDFA 3FB1A 3SVZA 1NLMA 2OBFA 3WAJA 1MA3A 4BZQA 5AHKA 4UHEA 1EFVB 3LBNA 2GPTA 2BI7A 4ALKA 1ESEA 2CFOA 2H31A 2XCOA 3BDVA 5BN5B 1L4LA 2MHCA 3Q6IA 3RHFA 3MJCA 1PJSA 1YCDA 2Y92A 1FDOA 2UZ0A 4O6VA 4K1XA 2H5LA 2ATCA 1C3VA 1CJSA 2BMAA 3NTXA 4WZZA 5CDTA 1P0IA 1T0PA 1ZK1A 3M83A 1VSBA 4CL2A 1MEEA 1UBTS 3ZXUB 1M6YA 1CY7A 2I1WA 4RK5A 2FLKA 1L7PA 1QB7A 2G80A 4GGPA 3A3NA 5E1MA 3SX4A 1ZC3A 3PHJA 2EFEB 4JP5A 2ZBQA 3JZFA 4MPRA 1GZ6A 5E7MA 4K8RB 1QOQB 1MVLA 2OK8A 3AV0B 1VJ5A 5JXIA 3TECE 3H1TA 1QOZA 1GTMA 1XTTA 1E7SA 4W9MC 2J87A 4CJXA 1W36D 1ZNYA 1T5BA 2V5AA 1FL9A 1CY6A 2V58A 2W11A 5AJWA 3GLGB 3G23A 2Z9CA 4M1OA 2AFVA 1ZVVA 3GN2A 4LDAA 4DCSA 1AGRA 1NT4A 4R98A 1D9XA 3IIIA 2A5YB 4D46A 2UYYA 2YIMA 3WQSB 3BMQB 4KPUB 1TA9A 1OR8A 1YFLA 1SURA 1ZICA 3HACA 3NUGA 4L9SA 4WK6A 5TMPA 4BVEA 3FSRA 2YS7A 3ADOA 4F56A 2W6IA 4HZUB 3PUWA 4UHDA 1HPLA 3K0AB 3QXCA 1NMEA 4IOKA 4UD6A 4DDMA 4L8WB 2EJCA 4HPWA 4A27A 2FRDA 1MJGA 5BMVA 4IGEA 4Q9DA 4WOCA 4Z2AA 5FUYA 1YGPA 5BOVA 5HPYB 2X4LA 2PANA 1KFJB 1NW6A 3IXQA 4QTXA 1Q0ZA 4WVLA 1SKAA 2F1IA 1KU6A 2I6FA 2QT9A 1LBTA 5B58T 3K70C 1J2JA 4MGHA 2PKWA 3M0EA 3FR8A 5C46F 1SBNE 4X91A 1O5TA 2B8JA 3CY6A 1OX4A 3DV0A 2VYFA 3V1NA 3SY8A 3W3AD 5BSTA 3CX4A 4YRSA 1WPXA 3DLTA 4YN3A 2WYHA 3EIEA 3L1JA 1XXHA 2FEPA 2QVYX 2FGKA 3GJYA 3L7KA 3OM9A 4FHDA 5DX8A 4BMDA 1OAOC 3PI6A 4MW9A 3T5AA 1QFJA 2OCLA 1R0RE 4PGGA 4A6PA 4MYSA 1J0DA 4IVQA 3IOYA 5HWSA 4PZAA 5HDQA 5KNDH 3PQ5A 4MRMB 2HPAA 1IUOA 4V2UA 5JISA 1DT5A 1Y8CA 3QVOA 2NQ8A 3ZKWA 1TJNA 4GE0A 2REQA 4HH0A 1IM5A 4P31A 2QAIA 5EWJA 3DCNA 1Z6ZA 1YBAA 4UDOA 4N12A 4P3KA 5ALMA 5F76A 5HX7A 3TDNA 4F3CA 1R8SA 3L8FA 1EJBA 2PG3A 5CURA 4A8JC 4EGJA 1OXUA 4MK4A 4U4AA 2XBLA 5BVGB 1JPVA 2BH9A 2AXPA 4JLMA 4ER3A 4B4VA 3A6LA 1VYTA 2G76A 2RHTA 2YHIB 2IXDA 2OOSA 1E9RA 3L3BA 4TTSA 3G2JA 5HKAA 2M98A 3VZDA 2FXIA 3V2HA 4D0SA 4I7EA 5LJLA 4M4SA 1MR3F 3OZDA 4HKTA 3TLYA 1GQYA 2P6RA 5CRIA 5DYIA 3WR5A 3H05A 4X8OA 2R8YA 4JBYA 1B1AA 1M8PA 5CGQB 5FJJA 4L5IA 2XH8A 5DW3A 4BLSA 2GUWA 3ZLVA 4CFYA 4PXAA 1D2HA 2E7ZA 4QBTA 4O1MA 3ZIAD 2IKSA 1YZ3A 3W6PA 1QO7A 4F1WA 5JI2E 3H2YA 2DFNA 1XIVA 3DG9A 2DWUA 3LV8A 4RD0A 4FDUA 1Q0PA 1M5UA 2HPVA 4AVYA 4Q4AB 1BD3A 4BHTA 5HKBA 2BCEA 1G16A 2YMQA 4OYYA 1GG8A 3RC1A 4B4UA 4O2LA 2GLUA 3DT8A 4PLZA 3V8BA 3MELA 2V1XA 4PBSA 1SVWA 3A05A 2EQAA 5F4BA 2EP5A 5AIAA 3ZBUA 3KCNA 3LIIA 5IBRA 2WSIA 3UA4A 1KVTA 2ZULA 1ZGGA 3CZMA 1JWAB 3CLSC 3ECCA 3PGKA 1RZVA 2JKZA 5FOQA 2P2ZA 3Q7RA 3V1LA 1QU3A 1NW8A 2PSHA 4H16A 2NNLD 5DNCA 1ZU4A 3WE7A 3VNBA 1E3WA 5KREA 3MD9A 5BSFA 4RPIA 4PGFA 4TXNA 2J0SA 1E0DA 2JCGA 5LD2B 3FCUB 1V37A 2HGZA 3GO4A 3F6YA 5JFOA 4HMOA 2WA2A 3E70C 8AT1A 1FMJA 4CEJB 1CLEA 1I33A 1ZJ4A 3MIIA 4KQMA 3W5IA 1BH2A 1Y3CE 2XB9A 4OQLA 5E2AA 5HVNA 4R2JA 1BEZA 3C87A 4RENA 1LI5A 3V8PA 2IS1A 1KJ8A 3FPSA 3N0TA 4A4DA 1RI5A 4YR7A 4OAQA 3X44A 1P2UA 2P9CA 4HQ0A 3SIPA 3IT1A 2QN2A 2QNBA 3ZWOA 5JV5A 2OO5A 3PDHA 4MROA 5B55A 3KLNA 1EX6A 3UHAA 3PR1A 2OQVA 3L6CA 2YTZA 3FM9A 5DIFA 2JIDA 5AXCA 3WLAA 3PGMA 4NNJA 5PGMA 1YKGA 3OH8A 1Z0ZA 3I8OA 1OIXA 2W2MA 1ZD9A 4UTNA 3FPBA 1T9ZA 3C8UA 1N6PA 1WNFA 4K46A 5CM8B 1USWA 5EEHA 3ZDZB 4PLYA 3U49A 4DHEA 1W36B 4NECA 1G8YA 4YK7A 5C35A 4B2IA 3F73A 3B6ZA 5JARA 1JSCA 5JHGB 2J59A 4PRZA 4XPIA 4AKEA 4UBIA 2XT0A 1FDUA 3CNOA 5BP7A 3LE8A 2QS9A 4G8CA 1HE5A 4QOSA 1JDBC 3HV0A 5LQNA 3ENZA 3L93A 2ZU0C 4KVFA 1Z22A 3H42B 3V48A 4CYMA 4KV9A 4DRYA 4ZEXA 4FBGA 2AC7A 4WVFA 4HNGA 3HXKA 1VYVA 5EJMA 3ZNOA 5JADA 4MCIA 3CUVA 5K6RA 2HSDA 2OBYA 2K87A 1E94E 3TPCA 4ZMRA 1OA1A 4JLOA 4HH1A 5AW5A 5I7AA 1RACA 2BFBB 4ZI5A 1XRRA 2J0UA 1D9ZA 2ONYA 3P2JA 4MS1A 1YJ8A 1C7QA 2GN8A 4BNHA 1RVDA 5K9ZA 3DBHA 1JDNA 3LA6A 3HKEB 1L5LA 3RSHA 3KV3O 2W83A 3QBDA 5AI8A 3SQDA 4QC2A 3L9WA 4HP8A 3ICEA 1IIRA 2EEZA 3NV7A 3OSUA 4IIJA 5J9FA 1JDPA 3RVSA 2AKEA 1AN0A 1E6WA 1Y63A 3DD5A 5LL6P 4ID3A 2PX5A 3CIOA 4BB6A 3HU3A 5HKKA 4R6XA 1WSWA 3KZMA 2RGUA 3KTDA 3IKTA 3JQ7A 1YA4A 4PNEA 2R7KA 2WJWA 3E4CA 3AY3A 2DTDA 3L0BA 3I9KA 3PV0A 4GYWA 1JBQA 1MV5A 1RLMA 4Z3DA 3KALA 1J07A 1UPCA 2I2CA 2RKBA 3I28A 3VOBA 3Q87B 2HRDA 2MSNA 1EXDA 3B2EA 2IHJA 4AWBA 1NI4A 1T2CA 1HA3A 2EYUA 3ITKA 1KJZA 4NRDA 1OX5A 1U0TA 3UGTA 1UBLS 2P67A 3Q9NA 2A78A 4XDGA 5BN3A 5HCUA 1TYBE 2ZZKA 3WDKA 4M9ZA 1F12A 4G5GA 3ADDA 1VYHA 1EM8A 4L2IA 4BATA 1XDDA 1X0XA 1GKIA 3P5BA 4FWBA 4GBGA 4UPVA 3RJMA 1XEFA 1ZOLA 1KZ4A 4MW2A 1JH9A 5NULA 4WXEA 3OZRA 4NMMA 4X0EA 5FLKA 4CF7A 1JEEA 1UEJA 4US0R 4UU8A 3T3GA 2BKAA 2CDRA 4LHVA 1UBEA 1WF3A 4E12A 2C84A 1FUEA 5CEEA 5G1NA 3R3VA 4Z4CA 3UV6A 4OMDA 5T64A 2GBLC 3A2LA 1I4DD 4MUFA 5DJ5A 4G0XA 5BSWA 3DVAB 3ZV5A 3UM9A 1GITA 1EM6A 5DSZA 3CEPB 3DNMA 1JFRA 3E1KA 2Y1OA 1RRFA 3F7TA 2Y2UA 3ORRA 2HV9A 5KVAA 1MHTA 3PYXA 3IKMB 4KMRA 4PFSA 2X7HA 4GYJA 4CQMA 2O05A 5CAEA 3TTWA 4M0PA 5D6OA 1Y4AE 3NBAA 4MYUA 3TKAA 4WDQA 2ZE6A 3O4IA 1O6BA 5A7FA 1L9XA 3T6KA 2O8BB 3COVA 1ZYUA 3OZAA 3R24A 4Z4QA 1U9IA 4C7KA 1O5OA 3SFZA 1NN1A 1D6JA 2PGAA 4JYAB 1ZH6A 5CJ2A 5DBEX 3CXUA 3HGQA 3O2NA 4P34A 5CVVA 3RSGA 2GCNA 4JJFA 4KODA 2DWOA 3GYGA 4QQFA 5JC1A 5DX1A 4LSGA 2A9OA 2H1FA 1XAGA 3DE5X 4YDSA 2WB2A 2H3EA 1QUEA 4M37A 1GPKA 3FBWA 5JNRA 4FCWA 1FP4B 1EA7A 4RM3A 3A04A 4CMHA 1V43A 5C53B 3FRIA 5LQDA 2HC9A 1CERA 2DVMA 1V8ZA 4V0SA 3L4SO 2XZOA 1J2UA 2I3BA 3L2OB 4FZ5A 3F98A 4QBFA 4YIKA 3AUSA 4B35A 5DNVA 6Q21A 1JN0A 4CNBA 4NICA 1S01A 4S2EA 1ATIA 4BFUA 3NYRA 1JHZA 1YAHA 2ZAYA 3GP3A 3NEJA 1UZMA 4Y1RB 2NSDA 4S24A 4WBSA 5BR8B 1T29A 1G8HA 4P82A 4ZOLA 3V46A 2PU7A 2GA8A 4ID9A 4EYOA 2HADA 2XOKD 4NCHA 4PLTA 2HXYA 1OC2A 3IE2A 3V32A 1HLGA 2R8EA 4E0BA 4R5MA 4LVOA 3E4DA 3ZCVA 3ZGXA 4HYEA 1CQPA 1EFUA 1IY9A 1JHMA 1K5GA 1QC5A 2IEIA 3EMKA 3TZHA 4Y2RA 5JO9A 3TCNA 1D0IA 1K8QA 2GK3A 1EPUA 3ZGNA 3PD1A 1FDVA 4TRMA 2V7XA 4LV8B 4QFCA 3CWZA 1B41A 5L3ZA 3BZUA 2G6TA 2WTAA 2XMRA 3OUTA 4L73A 2XY4A 4RPGA 3NHBA 2ADFA 4W5OA 1TK3A 4DNOA 4YDHB 4LC1A 2X15A 1YD7A 1BHSA 4MJ3A 4OGGA 4EG3A 4BNMA 1XTKA 3VSBA 2GF9A 1W5AA 2IC5A 2WUDA 4BVHA 2D2FA 4PRKA 2FETA 4AXXA 3FCYA 2ASVA 1NG9A 1K63A 3ZYZA 3E5HA 3B1WA 2Y77A 3LQQA 2QN9A 1XQWA 3FF1A 3OETA 2MCFA 2QZ4A 3IHKA 4WY2A 2J0QA 3FZGA 4EFNA 1I0LA 2E1RA 1IUNA 4PG7A 3A4MA 3QEOA 3RAPR 3U3XA 1XLWA 2GAIA 3DM9B 2GWHA 1X38A 1VCMA 2G9VA 3QVGA 2QUAA 4NCKA 3D3QA 4MP3A 1F8UA 1AE1A 3WL3A 4QVIA 1EBUA 1JHUA 4NZOA 1NUSA 1PHPA 4Z1MD 4J9UE 5A5FA 2DERA 1F9AA 1G3MA 1HFKA 3QFCA 4NK4A 1NVGA 2OCIA 5IN5A 4C04A 5CA0F 1UDWA 1Z8FA 5HBRA 2GCEA 3C2QA 2B61A 2XCIA 4GVXA 3SFVA 4EHNA 5JSHA 3SMVA 5KAMA 3UUWA 4PZ0A 4DNFA 1T3LA 2D6FA 1ODSA 1NE2A 1PL0A 3BN3A 2X76A 2CLDX 2PL5A 2HL6A 4LZJA 2NO5A 3AF6A 2ZW9A 3ZLJA 1D4OA 1HURA 3I2FA 4OQXA 3ZCUA 3K32A 4GX5A 5AW1A 1QP7A 2W2KA 1SQ5A 1OFGA 4DXHA 5IHPA 1L7NA 1NF2A 2OM6A 3R0IA 4OEHA 3HTXA 4MJXA 5TR9A 3BK7A 4D4JA 1R0ZA 1W48A 2R7NA 4C78A 4LCEA 4IR7A 3SIXA 4RX1A 3VPHA 1L8AA 2YYZA 1G8JA 1SUIA 3HKCA 5DLEA 1BO6A 1UKEA 2BI8A 2VPZA 1O95A 1M8GA 5B37A 3R8CA 2O2JA 2B0JA 2J6BA 1B76A 4XIFA 1KQNA 1F2TB 1O6FA 1P0FA 3Q5EA 3BILA 5A1JA 1FDTA 2ECOA 5IAAA 4F5WA 4ZC8A 1JHAA 4YJFA 5ISMA 2ZSDA 1L5YA 4RF3A 4HXEB 4IJKA 1M1YA 4MGYR 1H0SA 4PLPA 2Z2ZA 3SEQA 2JCBA 5JNWA 2CK3A 1QK3A 1CF4A 1AF4A 2WJJA 3BHNA 1SOUA 3CZQA 3IXLA 1GPJA 4MIYA 2GN4A 1XBTA 1M5RA 3TMYA 3DO8A 4K03A 1J39A 1NUTA 1V25A 1DS6A 2H5EA 3MMSA 1HC7A 2X2OA 3D2LA 1XD8A 5IWAB 5FPQA 3TQOA 4E2FA 3Q9LA 4MO9A 2GPSA 3MAJA 2GZAA 1KHHA 1JE0A 3WSVA 4AKHA 1CC1S 1M0TA 4B4DA 1X9HA 1YS7A 3ZLUA 4MGEA 3EOBI 2HRBA 3K1YA 4JQCA 4GOKA 3COJA 3B1XA 3H6HA 1TQ2A 4I6JA 4YI3A 2ZFUA 3HVUA 4YUYA 4X7BA 4YV1A 1X2BA 5IKEA 5K8JB 1F3OA 3AERB 1DX6A 3BTVA 1X7WA 2QENA 2JBAA 4IG9A 4WV3A 4BKPA 5I8ZA 4DNXA 3HJNA 3QELB 3VVLA 3WMWA 1JR3E 3Q6NA 3H6KA 2ZAIA 4I55F 4LQDA 2MU1A 3EFBA 2A9RA 3H18A 3HLYA 3P4XA 4G09A 3LGXA 2PT5A 1L5WA 3NO4A 2PLAA 1YHYA 4GZ3A 3SNKA 3VR1A 1R9JA 4X97A 2O0LA 2OQIA 1V5IA 3GAZA 3H04A 3ROFA 2LCFA 2CHGA 3O7MA 4E5UA 4AICA 3HWWA 1NA5A 3ETNA 3PFFA 4L28A 3AL2A 3CLVA 4GI3A