4RTRA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and a 5-bp non-canonical site (gttta )
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
244
Chain Sequence
b'KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKPGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
molecule tags Transferase/dna
source organism Escherichia coli
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
total genus 84
structure length 244
sequence length 270
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtrA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtrA01
4RTNA 2AOVA 1JSZA 4GC5A 2IH5A 1D2GA 3C3PA 1XJ5A 3HNRA 4PYQA 3FPEA 3TRKA 3TFWA 5CVUA 4E30A 4GQBA 2NXJA 3JWGA 5BW4A 4X63A 4HH4A 3LDGA 3NJRA 4F86A 2G70A 5DT2A 2PGXA 2BM9A 3KU1A 2AOTB 4KW7A 4YV0A 3SVZA 4RTKA 4DZRA 2AOTA 5E9JA 1V39A 4RTSA 3FTFA 5G02A 1QAQA 4FSXA 1JG3A 5DSXA 1R8XA 5GIOE 2XVMA 4FS8A 3K0BA 3MTIA 3BWCA 4AX8A 2P3QA 4PYLA 2G8NA 4C05A 3RIEA 5H02A 2UYHA 3DOUA 1F38A 3DH0A 1NKVA 5K09A 1R00A 1SKMA 2ZIFA 4ISCA 2FCAA 2XYQA 4FR0A 4FZVA 2EJUA 5HEKA 1QYRA 2IDJA 3QV2A 2NYUA 2PX2A 1JG2A 3AXSA 4U7TB 1N7IA 3DMGA 5K05A 5EZQA 3NW9A 1XXLA 3KQSA 5CM2Z 3HVIA 5F2OA 1KYZA 2O06A 5EMJA 2C7RA 3VSEA 2CL5A 3BWMA 3M6VA 3KQWA 3FTCA 3D2LA 3HCBA 1FP2A 5HIJA 3ELYA 3E7PA 3FUVA 5HIIA 3NDIA 4FSDA 5IH3A 1F3LA 4DA4A 4EQZA 3TM5A 1G8SA 3EVAA 1RI1A 3KQTA 3OE5A 3I58A 2AOWA 3PX3A 3SR4A 1VBFA 3EVDA 3AY0A 2GB4A 5LR6A 1TPYA 5D1NA 5EEHA 4DF3A 3PFHA 1EAMA 3SX0A 2I7CA 3A4TA 2ZWAA 2PXCA 4PYMA 3IV6A 1QANA 1VLMA 4CTKA 2JHCA 5DM0A 5ICEA 2CMHA 5DRYA 1TW2A 4XCXA 3C6MA 4XUCA 4PCAA 5DSTA 2ADMA 2OKCA 3HCCA 3DXZA 2GA9A 3K6RA 1KPIA 4PCLA 5MHTA 3AWIA 5T6BA 3TQSA 4KVZA 3SM3A 2JG3A 4M36A 3R6TA 3UWPA 1AV6A 1ZGAA 3GDHA 3LL7A 3DULA 4R8SA 3GRVA 3P9IA 4YUWA 2GH1A 4HC4A 4PWYA 1EJ6A 2XBMA 2ZZNA 2HNKA 2H11A 4Y2HA 3VC1A 5E2AA 1YZ3A 3KR0A 7MHTA 3DXXA 3CJTA 1ORIA 3UFBA 5C9ZA 1NW7A 4LWPA 4GOMD 3CJQA 5EVJA 5HOQA 3UJAA 2ZZKA 2B3TA 3ME5A 2FK7A 3EMBA 3FUUA 3LECA 3HVHA 4KIGA 3HVKA 3KR2A 1KPGA 2ZWVA 4Y30A 4CKEA 5EPEA 4YV2A 5E8JA 3CCFA 5T64A 3G2MA 4PYKA 3S68A 4C03A 2UYCA 2ZFUA 2P7HA 3BWYA 3LHDA 3CGGA 2P40A 1BOOA 2CMGA 3KHKA 2ONYA 5EHIA 1JTFA 3T7RA 2BR5A 3BWBA 3G5LA 5EMKA 3TKAA 3FPJA 3GWZA 3NVMB 3X0DA 4C4AA 5LQCA 5GM1A 4DKJA 3KPJA 1JG1A 4YV1A 4C08A 1EJ0A 3BZBA 4R6WA 4H0NA 3NDJA 4OQEA 4X41A 2R6ZA 3C3YA 4M7RA 2BH2A 2P3LA 3UJ7A 5GP1A 5JR3A 5FHQA 4P7GA 2AOUA 2GAFA 5E1OA 1NW3A 4DCMA 1AF7A 1WXXA 2PT6A 5EEGA 5FADA 4P7FA 5LQRA 3MTEA 5CVJA 2FK8A 4RTJA 3FPGA 4KWCA 3PS9A 3DXYA 5FCDA 2ESRA 1TW3A 1U2ZA 2HTEA 3MB5A 4OBXA 5IKMA 3T7TA 3ORHA 2O57A 3KPUA 1G55A 4HTFB 3M70A 3B7PA 2QRVB 1QZZA 5K0CA 1KPHA 4HTFA 3P2EA 3M4XA 3OFKA 3HA5A 5F2KA 1YUBA 4CKBA 2C7PA 2WA1A 4MTLA 4BY9E 1VL5A 4CTJA 4PONA 1JQEA 5FHRA 3M6XA 5ICFA 2PXXA 1WZNA 2P7IA 2YQZA 4FP9A 4IV8A 4PIMA 5DWQA 4E32A 3I5UA 5BXYA 5GM2A 3EVFA 5FULA 3GXOA 3DLIA 2CWWA 4EVIA 2C7OA 3GRRA 1D2HA 2YXDA 2ZBQA 4YUZA 1ZQ9A 1VPTA 3LBYA 4L7VA 2ZTHA 3R0QA 2AS0A 3EVGA 3DTNA 1R18A 2GLUA 3UJDA 10MHA 3KQMA 4PYOA 3ANXA 4HG2A 3LKDA 5EMLA 5K0BA 4U7PB 5LSAA 1SQFA 3HCFA 1HNNA 2JHPA 2UYQA 3KPYA 3A7DA 5EC8A 3AXTA 2ZIEA 5C0OE 2NXCA 3SXJA 4LECA 3TM4A 2IBTA 3GGDA 2HR1A 8MHTA 4AZWA 1FBNA 1JSXA 4RTOA 3G88A 3U81A 3NTVA 2VZ9A 4BP3A 3MQ2A 1X19A 2EFJA 3SMQA 3CVOA 3BT7A 4P7JA 3A7EA 1H1DA 1EIZA 5K0NA 1WXWA 4O29A 5DX1A 3PT9A 1B42A 3OCJA 2H1RA 2PWPA 4RVDA 2YXLA 2CKDA 2I6GA 4C07A 2BM8A 4EK9A 5DM2A 3TKYA 1I4WA 1KHHA 3EVEA 1FJXA 2V7EA 2K4MA 1WG8A 3CBGA 5DTRA 1EG2A 5EIWA 4E2WA 3BKWA 1VIDA 4X61A 2FRXA 3THRA 5CD1A 1JTEA 3JWIA 4GOND 3FRHA 3OZRA 2O05A 2VDVE 3AJDA 2ZIGA 4QQKA 5EOVA 5GINE 1SVUA 4OX9Y 3NMUF 1BC5A 2ZW9A 5CVEA 3LX6A 3NVKI 4AZTA 3JWJA 4HSGA 2QYOA 4RTPA 4PGHA 4RSRA 5LQAA 4RTRA 3LKZA 5CVVA 2AN4A 3FYDA 3R3HA 5U4XA 4GBED 3HCDA 1NW8A 2EG5A 1VQ1A 1XDZA 1O54A 3CKKA 3ELWA 2PBFA 3HM2A 2ZBRA 5M5BA 3MGGA 3PVCA 3IYLW 3FUTA 4JXJA 4KDCA 2B9EA 4BLVA 4POOA 5GIPE 2I62A 4R8RA 3M6UA 4YUXA 3KPWA 4PYNA 3PTAA 4AZVA 2PV0A 1R8YA 2WA2A 5F2NA 2Y1WA 2F8LA 1YFLA 1INLA 4DMGA 3B3FA 3DUWA 3THSA 4RTLA 3EGEA 4QDJA 5HZMA 3PFGA 2AR0A 2UZ4A 1KXZA 5GOZA 4BLWA 1KR5A 1VE3A 2ERCA 3A25A 3LPMA 3MCZA 4RVFA 2GS9A 3LCUA 3HA7A 2UYOA 3DMHA 3C6KA 4EKGA 4ZTBA 3LBFA 4MWZA 4PNEA 3G8AA 3O4FA 3VYWA 3GRYA 3PB3A 1Z3CA 5DRTA 2JJQA 3EEYA 3O7WA 1M6EX 2LD4A 5DX0A 3V8VA 2FPOA 3I53A 4X1OA 4M38A 3EVCA 5EHGA 1N2XA 3NWEA 3CC8A 3HCEA 2BR4A 3MCTA 1BKYA 4GUAA 1OR8A 4CKCA 1XTPA 4K6MA 2Q41A 1ZGJA 3MHTA 2P35A 3EMDA 1Q0SA 5K8VA 4RYLA 4PYIA 1NT2A 3LCCA 1X1DA 3JWHA 5E8RA 5K0FA 2YX1A 1P39A 4YMGA 2C7QA 3GU3A 1M6YA 3HVJA 3GIWA 1D2CA 3OFJA 4BP1A 1RI3A 4DM3A 4E2ZA 5LQNA 2ORED 3T0IA 1M0EA 2AZTA 1ORHA 1IM8A 2OXTA 5K0EA 2I9KA 2Z6AA 2NP6A 2ZSUA 2BZGA 3GRUA 3BGDA 2O0LA 4B17A 1O9HA 2AVNA 3UA3A 3Q7EA 4A6EA 3FRIA 3KR1A 5DTQA 3IEIA 1O9GA 2HV9A 2B78A 4X60A 3UJ9A 4OBWA 4QDKA 5P8WA 2ZCJA 5K0LA 1L3IA 3M6WA 3FUXA 4QPNA 5KVAA 2ZZMA 2FYTA 5DPMA 2Y1XA 1ZG3A 1DL5A 5HFJA 2VS1A 3UA4A 4E70A 2G72A 1ZHFA 3E05A 1P1CA 2PY6A 3GCZA 3FTDA 1L3CA 3A27A 2PLWA 3P8ZA 4E2YA 1KIAA 5B1SA 3OE4A 4ER6A 2PXAA 1KYWA 3LDUA 3MAGA 5DXAA 4DCGA 1L1EA 2WK1A 1MJFA 1XCJA 3FPFA 1UIRA 5T67A 4ER5A 1G38A 2QE6A 5KS2A 4R05A 3RODA 5CCXA 4PGGA 5K0JA 3G2OA 3DLCA 3GRZA 2IPXA 2NNWB 4ER0A 4RVHA 2IFTA 3G89A 3OU7A 5CVDA 1KP9A 2JH8A 2YXEA 3SSOA 2OB2A 1NW5A 3E23A 4F84A 3FTEA 2NXEA 2AOUB 1G8AA 3E8SA 1JG4A 3O31A 4MHTA 4P7KA 2OY0A 4MQ4A 1RJDA 4LWOA 1R74A 5HIMA 2OB1A 2JHAA 3OZSA 3OZTA 4RVGA 4CWAA 3FZGA 2FHPA 5E9WA 3G7UA 4E2XA 4WXHA 4HRAA 1ZKDA 1EQAA 1XCLA 2XYRA 3PX2A 2BR3A 5ERGB 1XVAA 2QRVA 4PINA 1NV9A 4GEKA 3PLAE 2G71A 3LDFA 5K0GA 3ELUA 2OBFA 2ZVJA 5E1DA 4ER3A 1IY9A 4RX1A 1PJZA 3TMAA 4ATNA 1VP9A 3G5TA 5DLYA 3SSNA 3GO4A 3KQPA 4AUKA 2H00A 2KW5A 4LG1A 3EVZA 3A26A 3KPVA 2DPMA 3HP7A 2OO3A 2QM3A 3ID6C 3B5IA 5LQUA 2Z6QA 4V0QA 3LSTA 5DX8A 1DCTA 2ONZA 3BXOA 5DM4A 4C04A 3B3JA 1P1BA 3TPZA 5EKXA 3KQQA 3KQYA 1RI4A 4XUEA 3P97A 3P71T 3HA3A 1JQ3A 4KDRA 2E5WA 4IWNA 5C1IA 4DQ0A 2P1DA 5E1BA 5FA8A 2VDUE 4GOOD 4A6DA 4WVLA 4QPPA 2HWKA 1FP1D 1NV8A 2AOXA 4NECA 4RV9A 3UJCA 4YUYA 5K01A 3P9KA 1X1AA 4FT4A 2PSSA 1I9GA 3C0KA 4Z2YA 3F4KA 3WSTA 5EKUA 5FUBA 1HMYA 4HGYA 3CJRA 2PX5A 1I1NA 2B25A 3P2KA 5CUQA 5E1MA 3TLJA 2PT9A 3G2QA 3QOXA 4QQNA 5CIYA 1IXKA 3EGVA 3REOA 2P41A 1Q0TA 1Y8CA 3BGIA 5LQKA 4PIPA 2JH9A 2XVAA 4FGZA 3SSMA 2AN5A 3TR6A 1X1CA 2Z6UA 2GPYA 4E33A 3VC2A 4HGZA 1PRYA 4M37A 3V97A 5KQSA 3EVBA 2O07A 2PWYA 1YB2A 3FPHA 2AN3A 3BUSA 3RW9A 4BLUA 3ELDA 4UOEA 1NE2A 5CCBA 4QVKA 1AQJA 1SUIA 3P9CA 3GNLA 2AVDA 2YUIA 2ZLBA 4MIKA 4R6XA 1QAOA 2YVLA 4QTTB 2PX8A 3DP7A 5DM1A 2G1PA 1G60A 3I9FA 4GOLD 2DULA 3P2IA 3L8DA 4RWZA 5KYGA 3H2BA 2IH2A 1NBIA 3UJ8A 3UZUA 5FQNA 3I64A 2VP3A 2EX4A 3G8BA 1WS6A 3TOSA 3LCVB 5KQRA 3ER8A 2QY6A 5FTWA 2V74B 1WY7A 3KR9A 5EG5A 5EMMA 1XDSA 5HILA 3R9XB 4GF5A 1VP3A 1R6AA 2R3SA 3QOWA 1T43A 4V0RA 5BW5A 2IBSA 2PKWA 3MERA 4KIFA 4QVGA 1YF3A 1JR4A 3B89A 4C06A 5ICCA 3R24A 2EJTA 1MHTA 3OU2A 2IH4A 4QTUB 3OU6A 5GWXA 2YR0A 2NXNA 1RJGA 1N7JA 1YZHA 3LGAA 5FQOA 2OPBA 5LQJA 1XDUA 3FUWA 3OPNA 5EIFA 4E31A 5D1HA 2P3OA 4EMSA 1L9KA 5HIKA 5K03A 3HTXA 2PJDA 4IV0A 1FPQA 2OZVA 3UJ6A 9MHTA 2HMYB 3KQOA 5EGSA 2OYRA 3UBTA 4XUDA 1QAMA 3T7SA 1RI2A 1UFKA 1AQIA 2IDKA 5DXJA 2IP2A 3G2PA 4OA8A 5EZSA 2ZBPA 3GJYA 2NP7A 3HEMA 4OQDA 4AZSA 3EEOA 1RI5A 1NW6A 4G56A 4KRGA 1NBHA 3EPPA 5E2BA 1BHJA 3FYCA 3ERCA 4FT2A 3BGVA 4P58A 5JUWA 5FWAA 3B3GA 3KKZA 3DR5A 3SGLA 2P8JA 2PVCA 3P9NA 4GC9A 1SG9A 3HCAA 5FA5A 4YUVA 3ER9A 1L3BA 1YFJA 2VDWA 2ZULA 4EKIA 3UJBA 3KQVA 3M33A 2IGTA 4YMHA 4RTMA 1G6Q1 5BP7A 4ER7A 1UWVA 1P91A 4PYJA 3EGIA 3BKXA 3IHTA 5EQJB 1X1BA 2A14A 5E9QA 2PX4A 2B2CA 3NWBA 1RJEA 4F85A 1SQGA 4OA5A 5FWDA 2XYVA 5DTMA 2N47A 4RTQA 1DUSA 1RJFA 3Q87B 4CXMA 1SUSA 4IKPA 2IIPA 2YTZA 1JQDA 3DMFA 5ICGA
chains in the Genus database with same CATH superfamily
1C1DA 1MIHA 1D4FA 3ADBA 1E2JA 3COVA 1N2OA 2X4IA 3N2ZB 1Y8AA 1RAAA 3NYWA 1PNTA 4G4IA 4BNGA 1HPLA 2PRSA 2XTJA 2A30A 3PSHA 4PIVA 4EA9A 2W48A 4I9GA 3QA3E 4PO1A 4BNVA 3WZ2A 4BV8A 3VU8A 3OTOB 4WZZA 3TMYA 5D86A 3DAFA 4EYSA 3O0DA 4O2BA 2ZRIA 2MIIA 5KX5A 4TTQA 3EA5A 3THYA 4GI2A 1LPNA 1TEXA 3DYVA 4HFMA 1XEFA 2D2IA 5IVPA 5A4KA 4Z4FA 3B6ZA 3LOPA 3ZW7A 2YMPA 3BWCA 4LISA 5KUTA 1FFBA 2HJWA 4FU0A 3KEOA 2JAUA 2O2GA 2QZ9A 4LFBB 4JGGA 1F38A 3WRXA 2W6ID 1LRKA 2GBLA 2H2AA 1BMTA 1L7NA 1KJZA 4P80A 3DVAB 1YBHA 1QYRA 2DJ5A 2A9VA 3D2AA 3NWPA 4PC2A 4ZAFA 3IQXA 3E2PA 1RZUA 5D5QA 4R1UA 1N7IA 4V39A 2KWIA 5EZQA 1CETA 4C4RA 4EKNB 2W0MA 3LCJA 4MWGA 3BRCA 3PUXA 3RTAA 1LX7A 4R2XA 5EUCA 2V5AA 1UBGA 3JRNA 1FJHA 4FHCA 1QV6A 4DCUA 2WG0A 2AFRA 3M6VA 4W7IA 2IZ7A 3L4BC 3NXSA 1QVRA 1TM2A 1JILA 1MC5A 3O91A 4IDDA 5B7QA 2GI4A 8GPBA 1B00A 1PJBA 4OKSA 4YCCA 3NHMA 3MMZA 3TD6A 5JD3A 1CS0B 4KR7A 1F5NA 4UJ5A 1IIBA 2EFHB 4XZ3A 1XK7A 2WP0A 2HSDA 4CCWA 4IVQA 5DNUA 5AI9A 4MIEA 1C7QA 4QHSA 1RQNA 4PVDA 4LC0A 1XLWA 2LDXA 3HB1A 2QAGA 3I9NA 3IUPA 3CUYA 4PYMA 3B6JA 4UXIA 5L4LA 4MA5A 2M32A 2HCFA 2FN7A 3GCGA 3K1JA 1NQOA 4PG6A 1C7FA 5TEVA 9LDTA 4TROA 1DHTA 3LLSA 5AXDA 4FEYA 3N0TA 1M7HA 1YULA 1ZGAA 2XUHA 1P62B 4OHVA 4E1AA 2BFFB 2TMKA 4D5EA 2HNKA 2EKLA 3DC7A 4YXWD 1AHPA 4JJZA 2DWCA 1O1YA 2Q5CA 2V58A 3N8GA 4WKPA 1PDWA 5C1PA 2F6RA 5I47A 3U1VA 4C2AA 1IBCA 1QE0A 2YJZA 1AURA 3CE6A 3EMBA 4L6CA 1V7QA 2IUSA 3ABRB 4UBOA 2W6ZA 3CE9A 3GHHA 3WGVA 3KX2A 3CSDA 2UXBB 3L06A 3ZGLA 3L04A 1J20A 1XG5A 1WMFA 4V38A 4RS3A 1R3UA 3URKA 3OIDA 4XUGB 2V8OA 5EUBA 2YHBA 2IODA 1JTFA 1BOOA 1U8CB 3R7BA 1ZVQA 2D54A 1IHUA 4QEZA 1ZXXA 4Z9XA 2FSSA 1MXFA 3AG6A 1C7JA 1EDDA 1GLVA 2Y2UA 3A6KA 3EXHB 3K71B 5T8KA 3JZMA 3IUYA 1WHSA 5D84A 3ZQJA 1NXVA 3MIZA 2AFHA 1UBKS 5JO0A 2XMBA 3H42B 4D9MA 1HUQA 4RPJA 1XHEA 5JZOA 1Y4UA 5EVCA 3PUIA 3ROKA 3VISA 2B9VA 1V1JA 3RC3A 4IEIA 3WLOA 1WXXA 1THGA 3BRWD 1RCFA 4B3FX 3CZQA 3FTPA 4RPLA 4M89A 2F90A 2IPMA 3DT8A 4A6XA 1E4VA 2QGZA 1VJ1A 4QU9A 2W90A 2ZJ7A 1NFQA 4X91A 2X23A 1TT5A 3ITDA 5KDLA 5BSHA 1OIWA 4F60A 5EHZA 3UMYA 3K0HA 4K2HA 4ND1A 4WZBE 1MOZA 2Q6VA 1CPYA 1QBGA 3LCMA 1EQUA 3QUQA 3NBXX 4FBMA 4RORA 5FFFA 2PCJA 5DI3A 2MYTA 3ROFA 1XAHA 1WW3A 1Z5NA 1PJ2A 4JC4A 2VT2A 1J1IA 2JLYA 4RKFA 1G8HA 4N5MA 2P6MA 1T9KA 2HCBA 3N8NA 2VP6A 3S28A 3ANTA 3K0CA 3R5SA 4CMIA 1GV0A 1BTOA 1BVYF 2CNWD 1N2CA 1E1DA 1EE2A 3JQ8B 4F3NA 1E3QA 1IG3A 1NE7A 2ZBQA 5BWCA 2QJTA 1OTYA 2J0VA 2D8MA 2IYAA 1R18A 3NG1A 2NZ2A 4MS1B 3KK0A 3I34X 3JVVA 1ZI6A 3LKDA 4F45A 3FKJA 5BRAA 1OB2A 1HNNA 1EUCA 2X1HA 2CK3D 4L3OA 4B3RB 1T1SA 2BEWA 1CJSA 3CZCA 4KFCA 3MW8A 3G1TA 4QXRA 1TD1A 1VYTA 2DERA 1BYIA 4BKRA 2H9IA 5FLXA 1CZHA 4RM2A 4HATA 4N0PA 2PRZA 3EOBI 3SFVA 3BT7A 1Z6ZA 2MTBA 2R1VB 5IUJC 1QO9A 3EXG1 3IT2A 4OHXA 5IDXA 2I99A 4O29A 5KINB 4J6EA 3NEPX 4KDFA 3FDJA 3CF4G 5JPDA 4DLXA 4HNTA 4HZGA 3BFPA 3TOVA 4C9BA 1O6GA 2AA3A 4DIFA 3W5AA 1LTHR 4D3YA 2V7EA 5KOIA 1B2RA 4L78A 4RA9B 5MGBA 1Y6GA 3DUFB 3JWIA 1E3EA 5G2OA 4ESOA 4UAVA 5KSYA 2QLBA 4CQMB 3C5HA 3S1LA 4DLBA 4WBNF 1KJWA 1BE8A 4U0JA 4D8UA 3RC2A 4XWKA 1P4HA 1KK0A 3BPSA 4AWAA 2FMKA 1Z4NA 3IIJA 4IEEA 4D0GA 4M1KA 2GEVA 1D09A 1FVOA 1XDZA 2G06A 3N0RA 4ZV4A 1JEOA 2ZRFA 4BNWA 2RD2A 3DLPX 4POOA 3A4MA 2BKUA 2YZGA 3FB4A 4O4LF 4RY8A 2CJYA 5EERA 4REQA 2J5RA 2AZMA 3SLGA 3TTUA 1IMJA 1T8SA 4XFDA 4AZVA 5CDUA 1J06A 5FLKA 2R1TB 4D8WA 4JGIA 1ZW6A 4N4AA 1N5LA 1OZAA 1CJBA 2DUJA 3I5AA 2H7YA 3IXLA 3SYTA 3VZDA 2O0HA 4K26A 2VCHA 1OH6A 3N8HA 4OQ4A 4WLFA 3KLMX 3TN7A 2JD0A 4FGUA 2J31A 2DETA 2B21A 3II6X 2I5PO 3I9V6 3K1ZA 5FTLA 2Q3BA 3AGQA 2PVSA 3IXQA 1R15A 3NGLA 4H6WA 3I9KA 1YONA 2W0SA 1J2UA 3ZWPA 2UYOA 1XF9A 5HK9A 5K8CA 2BMDA 3AJ8A 1H8HD 1K98A 4DG9A 1R9NA 3MWYW 3F7OA 1OLSA 3V8VA 4A27A 5IS2A 2B8TA 1IEXA 5LVAA 2HUPA 3COPA 3ZLTA 3MWGA 5K4AA 1DBVO 1GNVA 2YWBA 3EMDA 3UMCA 1BFDA 3PFWO 4RYLA 4BDSA 9LDBA 1C8BA 4J0KA 3LQ2A 4EY4A 3EPLA 3C8HA 1XTVA 3HY4A 3REQA 3ADDA 4L08A 1N5RA 1NBAA 4TMYA 5C52B 1M1XB 3QA9A 2IHYA 4HO1X 1COWA 2I9KA 3NJ8A 4WN9A 4HL6A 4RETA 3WL6A 2NP6A 3WQQA 3HO8A 3RVPA 2P9HA 1U11A 3C7KA 4J6FA 1I6KA 5H68A 3VDXA 1I0ZA 4B33A 2NTVA 4M8LA 2R2AA 2UZ1A 2UVPB 4K1LA 2YCBA 3ZX4A 4OK5A 1CUAA 3GAZA 5HCUA 2PMDA 2Q9BA 1TYCA 2IPLA 3UA4A 3ZY3A 1TZ2A 2FRDA 2CGEA 2QUZA 4B4WA 1KSHA 1U7PA 2B1RA 2J5BA 1XRMA 1AGNA 3RVQA 1FYEA 3IBCA 4MULA 4KQCA 1WD7A 1HG0A 2H16A 4TZ6A 1IZ8A 2EP7A 2PR7A 5SZJA 3RBVA 4G5GA 1L1EA 4OUDA 4P2BA 3AYXB 3RG2A 4DLUA 3WB0A 3Q1KA 5BWMA 3H5NA 2Z09A 3KSDO 1I24A 3NIGB 4IUYA 5AKXA 4ZRMA 1USKA 1PUIA 3JVUA 1DIBA 2HN9A 4QYTA 1YGYA 2C03A 1ZBDA 2BVNA 2IPXA 4FZJA 4F4HA 2JGRA 3M2TA 4MKHA 4TVOA 5B4VA 3PQ3A 5ES4B 1YQUA 3Q3HA 1N6HA 2ZAOA 4RZSA 3OLVA 4GM4A 3Q15C 1Y3IA 1MENA 3OQHA 1R6TA 2NXEA 1SUFA 3DUFA 3EGOA 3R5FA 4RJIA 3RD5A 3CUUA 3VOTA 4JKOA 2CLMB 2W2NA 4GIBA 3WLPA 1Z63A 4LWOA 5TE9A 4FZ3A 2GF0A 2WMOB 3ZNQA 2HA7A 2GEUA 5E9WA 2CNNA 3DZBA 3WLFA 3LRXA 5LB4A 4D9CA 1EWTA 3KETA 3ZHSA 1ZL0A 2E1PA 3C3AA 5J9FA 5JQGF 1FJGB 5ERGB 1P0PA 1RT9A 4OXYA 1L5NA 1EXWA 4EPWA 1WVMA 2G71A 1BZYA 3USZA 1M1UA 4ABTA 1H65A 3G8CA 1G63A 1WPQA 1E9FA 2JFHA 1D1SA 4BKPA 4HWOA 3LWBA 3TOXA 3GJ3A 4AJ1A 4RD2A 3KQPA 4KTVE 2NVUB 4XPIA 3AO0B 4BO8A 1C0LA 3VKGA 3F3YA 4WASA 1BMDA 4KNYA 1F2TB 1TZJA 4UPVA 4WCFA 3WGOA 2R25B 1AKUA 4I1UA 4A8HA 4AULA 4DDKA 4WNYA 1C9YA 1KC1A 5DSZA 7GPBA 4AKIA 1MO4A 1UBUS 3GN2A 4HXFB 3TNDA 5IF9A 2P2CA 4CFYA 3MUNA 3B9RA 5C1IA 2WAAA 1XJCA 4NG5A 1E1QD 4Z4CA 3AESB 1Y6ZA 1NXOA 4JIGA 2ODPA 5CYFA 4IQ0A 4ALNA 1KRWA 4NSNA 1E1QA 3KD3A 1HZJA 4YUYA 3L77A 4XTRA 1X1AA 2QN6A 1DO8A 2P2ZA 3UB3A 1C8VB 1IPEA 4CLEA 4PLTA 5HQ3B 4X0EA 5EKUA 4D3SA 3AY6A 1XMVA 4AO7A 1ULUA 5ISMA 4I81A 1VDMA 3HRKA 5AKGA 4QUJA 1X7YB 3IAM1 4MW6A 5BXQC 3ICCA 3NHRA 2QW0X 3TIIA 2OMKA 4WHMA 2D4HA 1EX1A 4U2CA 3TE6A 1ZNZA 1V6CA 2XUIA 4PPGA 4H3SA 3REOA 2XWJI 3BGIA 3F8TA 4RHUA 5JSQA 2JH9A 3JQEA 4TSKA 3PNLA 1EHCA 1RWBA 1Q7TA 2BKAA 4RY9A 1B73A 2NVOA 1TMOA 2PKQO 4CBVA 1M2VB 4KMOA 4M37A 2VATA 1H3FA 2MYPA 3VC2A 1XQ6A 1UKBA 4MK4A 2ZSEA 1PR2A 3OA0A 4A03A 4BXOA 1H2XA 3RW9A 1GSAA 2CCGA 3QLEA 1GQOA 1DTWA 4IDFA 4AMZA 1OH8A 4JP8A 3NDBB 3OESA 2HSEA 5LA6F 4POAA 3GFPA 2FDXA 1PWXA 2YUIA 2ZLBA 4PZAA 4OH1A 5TEWA 1NXSA 2PSFA 1JR3A 2W9XA 4QTTB 1ZXBA 1BXZA 2A1UB 2OQRA 5IWCA 1XZAA 5CT5A 2G1PA 1G0OA 3NT4A 5IVKA 3ISVA 2JI4A 1H23A 5IDYA 4F5EA 1CF4A 3C5VA 1YNOA 1YI8A 2C2HA 3Q9UA 1QO0D 4B45A 1E99A 3ZI0A 2GJKA 4A9AA 2FGJA 4ZVVA 1WZUA 4MYUA 1FNNA 1UXJA 2XJ4A 1MF7A 5EG5A 5JH7F 2WAMA 4KDEA 4OYLA 4K03A 3WAKA 2AMYA 4IEFB 1ZM2A 4DS3A 1A69A 4N0EA 4Q15A 1MTZA 2VRCD 1C8LA 5BW5A 4KIFA 4UTXA 2O8CB 2QMZA 2H08A 4Y6SA 3TLCA 1G20B 1PT6A 3BIXA 4YS6A 1ECBA 1QYCA 3ZE2B 4DJAA 4RL6A 4BVGA 3LW7A 2OQIA 3O9ZA 4HEHA 1VE5A 4RKQA 1IJKA 2OPBA 3FWHA 3MJSA 4KX3A 4ZHSA 4ZEWA 1GR0A 2P3OA 5K03A 1GV1A 2X41A 1XA4A 4IV0A 3OZBA 2OZVA 3H11B 4IZHA 3TX2A 1KQGA 4PTYA 4TS9A 2P6NA 4RMHA 1UXGA 2GYUA 4QSHA 2X8BA 1UFKA 3X2FA 4N8SA 4RJJA 5JCXA 5EZSA 4GHWA 3DEJA 1QFYA 2JK1A 3UJ3X 3R3ZA 1FRZA 1NFRA 4JVSB 1WA5A 2ZRGA 4PE5B 1RE0A 1JJAA 3JAKA 3VR5D 1DFGA 1MR3F 1PTJA 4WZAA 3DR3A 3IUJA 1T2EA 5H3CA 3UOAB 5JI3E 3GEPA 1G18A 4QYMA 1R37A 1TYAE 4PGAA 1K6MA 4PLFA 5BYJA 3RH0A 4GI3A 2CEKA 2J1LA 1HBJA 4R1NA 3AZOA 3BFXA 3GZJA 3IT3A 5K5EA 1NBME 3A0RB 1OFTA 1UQUA 1E4EB 1HNXB 1P91A 2CHGA 2Y76A 2YWDA 3A4VA 4WXMA 5EJ5A 3NH6A 2RHWA 3ET5A 4A8PA 3LOQA 4II7A 1PUJA 1QQTA 4IH9A 4BB6A 2PQMA 2B2CA 1L4KA 2V4MA 4YN3A 2QRGA 2PEZA 3CEJA 4B2LA 3ZDXB 1HFJA 3L1IA 4NX2A 3DPSA 4AUNA 1QZTA 3OX1A 3TRJA 1I0LA 4EFKA 4DDTA 4PSKA 3OKPA 2HXYA 1WCYA 2VJAA 2KHZA 4FGSA 4MB6A 3ANMA 4NBWA 1D2GA 2NO0A 4MKZA 1NDHA 4Z49A 3FPEA 4Q9IA 2HTFA 3A6JA 4DLZA 3ASZA 1Z4QA 2BF4A 3HFRA 3VVMA 4M3NA 4HH4A 3U4QB 1WQ4A 3V2GA 1E1NA 2A35A 1HFWA 4BQOA 5LUAA 2C4NA 4X3OA 3ZH2A 3KTAB 2PUVA 1P4AA 1KKLA 2WOJA 4FOSA 4F6LA 2VSFA 1UJMA 3L8MA 3KXPA 3LRPA 1HE8B 1L5HB 1AF4A 2RHOA 4ZCTA 1I3MA 4OKIA 3IEMA 2HSGA 3ND8A 4UOZA 2GWRA 1KZ7B 1POXA 4FGKA 4QXMA 4NFSA 4ZV7A 3RU2A 1HDEA 4CNQA 1C1XB 1W52X 4H60A 1DCMA 3U4IA 2K7FA 1NXXA 3Q3CA 3HY3A 1E79A 4ZK6A 4R7ZA 2F59A 4OHFA 2XOKD 3HB4X 4D4GA 4C2UA 4KWTA 4YJDA 1YL5A 2NYUA 3WGZA 2F3RA 5DNVA 4NBNA 4JLBA 1QGED 1E98A 2XOKA 4IQ4A 4NJMB 1KZHA 4D97A 6PFKA 2IX3A 1H9CA 1ZOLA 4NJMA 4EUKA 4ZVOA 2VJLA 4PU0A 1NU6A 2B37A 3IB3A 4M6WA 1VL0A 2EFYA 3BWMA 4WKOA 2FKAA 1IOWA 2FZ5A 2ZSHA 4ZDJA 3OFND 5LDGA 1XA3A 3RYTC 2BHRA 1ENZA 3MGKA 4AS3A 5ICMA 3EVAA 4YLEA 1RI1A 2DH5A 4B3IA 2AOWA 5ARDA 1V16B 2JZNA 3RRYA 1J2YA 2BTQA 2IXFA 5LR6A 1NMXA 5SYMA 4B3GA 2H1IA 1QQBA 5M2QA 2JA2A 3F90A 2PXCA 3IV6A 2OCBA 2QG6A 4J0FA 1QOZA 1DDGA 4CTKA 1WZ2A 2QBYB 3GV0A 1H6DA 3OTGA 4PX2A 4UHEA 2PPLA 1FJ2A 1EVQA 1T2AA 3G0GA 4HDSA 3F4BA 3Q9SA 2OKCA 1F4PA 3LV8A 1CVLA 1CEQA 3KEMA 1VFNA 3PHCA 4ASUA 4EF6A 5HUJA 5FWXB 1VPDA 1MN6A 3R6TA 4IO0A 4DXDA 1B6TA 2R00C 2PSDA 1W9HA 3DM9B 3LGSA 5ITZA 1YZKA 4TYYA 1W7AA 4BGEA 3UAOA 1HDCA 1NLZA 1QLJA 1RHJA 2ATEA 1J9GA 5BPFA 1JJBA 4D8VA 4J8PA 4YRSA 2IVZA 1RM5A 4MWTA 1AMOA 3I5YA 1G4UR 5AI6A 5EWMA 3E5HA 3N07A 3MLAA 3FXAA 2FK7A 4MEJA 1KVUA 1XEAA 2YJ5A 1AU9A 4MXDA 5C7LO 2VDPB 3S5JA 2WF9A 3U2QA 4EM6A 2Z2YA 2YBDA 4RIIA 1MFZA 4WFQA 4MB2A 5EPEA 4AY3A 4YRMA 4YV2A 2VHUA 4FZRA 1Y5NA 2LV8A 3TOZA 3P7MA 1KY2A 2YICA 2HWYA 2ZFUA 1EFCA 1PLJA 1OWPA 1CZRA 2JC3A 5P21A 1KO7A 4NK5A 4REMA 1T1RA 1SQ6A 1KO4A 3BWBA 1GHTA 1E77A 3JWEA 4B6FA 4RFSB 1KH2A 4IV5A 1ZJZA 3NKVA 4HRYA 4X41A 3GFFA 1XCPA 2VA8A 4OEHA 3AOEC 3AUUA 5AJTA 3UJ7A 4X44A 5BR4A 4RXUA 4D3ZA 3SLKA 1BHQ1 4RHFA 1OU0A 4P3OA 3WLQA 4BV2A 3KE8A 2IZ5A 1Z7WA 4FEGA 1ISFA 3DXYA 3DZCA 1MJHA 1XT6A 2HBZA 3P94A 3ZXXA 1A9TA 1G19A 3CX6A 3KEQA 3SZLA 3W06A 3ORHA 1O5TA 2BLNA 3EUFA 4R7GA 4Z0HO 3FF4A 1UP4A 1P3JA 3ZI7A 2JI7A 5E3HA 4D4LA 1EUZA 1DAGA 1FDTA 5BUZA 2EHDA 3T3OA 4W82A 4FQ7A 4IWXA 4CJXA 3P2EA 3K0AB 4BX2A 1TEVA 2A59A 2D7DA 4LZPA 2HSWA 5GY7A 1JFTA 2VJYA 4IS2A 2VIIA 5HDBB 5ICFA 1UDWA 3M4YA 3BD6A 2ZYAA 1HOXA 1VBKA 2XNSA 1KMNA 3EGXA 4WBXC 4AMUA 3M3PA 1NDUA 2XMQA 4F4DA 5CA1B 3C4QA 4DPMA 3KS9A 3BA6A 2KQUA 1QKKA 2GASA 1E3MA 3OTQA 1FFXA 3W7VA 1DP4A 2DSNA 3EQ7A 4PYOA 4G0YA 3O8NA 1C7ZA 1MFPA 1PQYA 4LZJA 4E4YA 2ZEJA 4N65A 1IYZA 2X42A 7MDHA 1RR6A 2OD9A 3NBKA 4RY2A 3TX6A 4XGKA 4JB2A 4MAMA 5H1YA 1I4EB 1DTSA 2OC9A 1VCIA 1JA1A 2ZJ4A 4EHJA 4NJOA 4YJ2A 4EI2A 1LJLA 2DPGA 4MTCA 5LLSA 3FSEA 3VVCA 2FPKA 2IT1A 4MLZA 4II3A 2PSJA 3PICA 5FI5A 3EQ6A 1XEXB 2C7GA 2EP5A 1T8PA 3K20A 5EP1A 5FH9A 3KUCA 1P7YA 1NVMB 1TQ2A 3HLTA 2A9JA 4CTNA 2NT4A 2W22A 2CFRA 2WLSA 1T6XA 221PA 3CF4A 3OCJA 4AJOA 1FRQA 3K2EA 1XVVA 2I6GA 4M0DA 3ROTA 1ZK2A 3KOZA 3VKWA 5KVSA 4DNFA 5THXA 5FUXA 1OVGA 1RAIA 2CNOA 3RSHA 4I46A 2DCMA 1RWNA 2MT9A 3AILA 5LKRA 1US8A 2J5QA 1Z62A 1ID8A 1H0HA 3LFHA 1ZC4A 2GAJA 2OORA 2WD9A 1QK3A 1X87A 1JPUA 2PH7A 4U02A 3BE4A 1X7WA 3DEIA 3NFRA 4UZFA 4ZOQI 3SIXA 3VR3D 1JMKC 3UAWA 8ADHA 2E5LB 4KYIB 1IUNA 3P2YA 4HZIA 1CQWA 2PYDA 3QX8A 3V2UA 2HIGA 5HQTA 1U1FA 3I73A 3AP1A 1HDYA 1KQ3A 2YC2C 4ZQIA 1G2OA 3WK4A 3BVPA 3GH1A 3GQVA 2ZBRA 4FE7A 3TW8B 3A4NA 4EUEA 3PTLA 1Q7CA 2B9EA 4FN5A 2AYYA 2BFBB 3O9MA 4K1XA 5U1PA 4DT1A 4F9EA 2ZRCA 4YYZA 1CULC 1H4SA 4OHOA 4KN9S 4R9NA 3WRYA 3LZDA 1QTIA 1I7QB 4IJWA 3C41J 4HAZA 5TQVA 2PZJA 3LC2O 1X9HA 2XVYA 1TAGA 1EVYA 1Y8RB 2ATIA 2C04A 2JGNA 3JQDA 1XNRB 3HKEA 2BSQA 5KZMB 3CKYA 1CVIA 1NXTA 4O4IA 2DPYA 3GI1A 1YCFA 2A7XA 1CX9B 2P2LA 4NJEA 1AQ6A 1MVLA 2KSQA 3KDSE 4PNEA 3G8AA 2V7QA 4WIAA 1KDVA 3GRYA 4UCQA 1FYXA 1SBTA 1IU9A 2JGEA 3U40A 4GZ5A 4NDZA 1O87A 2TSYB 3FOBA 2GKGA 1K6IA 1T1GA 5FBQB 3OEYA 1ZOIA 2DQZA 2N0SA 3HCEA 1EK1A 2H2GA 4TV9F 1OMOA 2FW9A 2PZ8A 5DHFA 1G21B 3O3OB 4ESHA 4YHHB 3IBSA 5FOVA 4U39A 4DV2B 3RRFA 3BDIA 4K6OA 2P1RA 1SXHA 3EXEA 3T0IA 2RG7A 4CV1A 1X74A 4L07A 1A72A 4G8BA 1GWNA 2OQ2A 3IFSA 4L5JA 5TR9A 1RM0A 3JQBA 3VH4A 3UFXA 1QHHA 4KN5A 5LBTA 1WHTA 4GMFA 1II8B 5EJIA 3MGAA 3DE5X 3OEWA 3KR1A 4UARA 3PUJA 1IHYA 4Q4HB 3JARA 3LYUA 1FQKA 4ZPXA 3GBPA 4BVBA 1UC4B 1E9AA 5AK0A 4RE5A 1K97A 2XYGA 2Y1XA 2FQYA 3PZBA 4DV1B 2DUUA 4WSOA 1Z2DA 2I55A 1LLQA 1AXRA 1P1CA 2J0EA 2JJYA 3OY2A 5I6DA 3P8ZA 3OECA 4KI0A 4TMFA 5BRNA 4A2CA 3HU3A 1W0JA 5B1IA 1VG8A 3KO8A 3OE4A 5TNXA 3E15A 1E1CA 5G53C 1YT5A 3ZLBA 1YIAA 1VMAA 4LBZA 4DCGA 2AHRA 4YO8A 2YV5A 4TTJA 1F0KA 1KQPA 1MG5A 2IA5A 3TZBA 4M4SA 4MMYB 2YZKA 5CA0B 1TO2E 4QUEA 4KE7A 3ZE0B 3P9RA 3I09A 1WXHA 3NEJA 4IMJB 4LTMA 1F6DA 1XAGA 1C30B 2FEXA 1UBMS 3ZHBA 1PG2A 2GPWA 3ROPA 3A9TA 3SBEA 4PX9A 5DBEX 3MT7A 3DBRA 2XUDA 3MWDA 5JISA 4O5OA 3H3XA 2C54A 5KYXB 4IZ6A 3ZZ0A 1NZJA 2DX7A 2RIPA 4HDOB 4QOHA 5KU1A 1X7XA 4AKGA 2QVLA 3G2LA 4G1MB 4LXHA 1LWOA 3W79A 1JE0A 1ZWKA 5FOWA 4BL5A 3KJZA 4FFOA 5JQGA 3EWSA 3OVMA 4RADA 3DCNA 3UMGA 1W85B 3CH6A 2NSHA 3PNMA 4Q39A 4ENVA 1BCRB 1UOOA 1TMKA 1JXQA 4UTPA 1A8IA 2ID7A 4BBPA 5E1DA 1XPJA 1IATA 5FTMA 4KV9A 4TTRA 2JKZA 2AJTA 2XBUA 5F1PA 1H1LB 4ENRA 4IMIB 4Q37A 3TLGA 1U9YA 1JKJA 3C1TA 5IVIA 5DLDA 3K4HA 4ARBA 2VZEA 3SK0A 2R1TA 2QMEA 1WCIB 1UT6A 3OLQA 1D3AA 1A1VA 4QHYA 3NOQA 4CCAA 4EG5A 3H2ZA 1M6HA 4TWJA 2QVYX 5AW2A 2Z5VA 4KEAA 2SICE 4L0QA 1TQ8A 2AMLA 2YFQA 4OXNA 4XI9A 3W2GA 3FFBA 4EB8A 4ZZ1A 1EUYA 1GSOA 2PFSA 3DFKA 3RBZA 5B4TA 2AC4A 1DGQA 4O2AB 2HWKA 2NACA 1NV8A 2ZAMA 3DSRA 1L7EA 1YD7A 2WIFA 3UJCA 3BX1A 1LBHA 3DDHA 1J5PA 3RASA 5C1DA 4YVFA 1U6KA 1VJRA 2F7SA 5D8DA 3F4KA 3IDQA 4NBUA 1LSUA 4IDBA 1X6VA 1A5AB 5FNVA 1JHZA 1SOWA 1POWA 4O4JF 3DW3X 4JQYA 1M76A 4NBSA 3RF7A 1JPJA 5CB8A 2H9YA 3VR2D 4V03A 2NUAA 3HWSA 2BZSA 2IYFA 2AG5A 1SCDA 2FSVA 4LJLA 4NICA 1P1HA 1GRCA 4MRAA 1Y3CE 4ZOCA 2FWMX 4BMOB 5DYNA 3KDPA 2NX2A 3N87A 1YHNA 2X3UA 5BUQA 5I4KA 3MB8A 5IABA 1NE2A 4YMIA 5HK8A 4MCAA 3WFIA 3BRSA 1R9MA 5KTPA 1N1DA 1EFVB 2IPOA 2R2GA 5H7XA 5KCMA 3MOIA 2WPDA 4K9MA 2QD1A 3LQYA 4JLKA 1DS6A 5L53A 4UUMA 2NYRA 1Z5ZA 3H1BA 2IJGX 3F2IA 4OSOA 3EAGA 1ISSA 1V8PA 4US2R 4YAJA 3R75A 3SQMA 5KIAA 3GA7A 4YPFA 3MWEA 1LVGA 5HF5A 2QF7A 2FX3A 3TOSA 4ALMA 3ER8A 3I9MA 1D8TA 1IN6A 2V6MA 1ZR4A 2J67A 4A8JB 3WICA 3VR4A 1EMDA 1HRKA 3K05A 2R751 1Q14A 2YIDA 3PYXA 1MVNA 1T43A 4V0RA 1SXJC 4LOLA 4E1VA 5JNRA 1KL7A 1HTTA 1OZHA 2HLDD 2RARA 2VKTA 4WLUA 3R24A 2QAIA 2ZRNA 1U02A 4CU2A 2YR0A 1BD3A 3BE8A 1ZUIA 1VKHA 2W2KB 4JBGA 4XM1A 5K6AA 1X7GA 1T8TA 4E31A 2CBZA 2R0QC 1T5HX 5F5LA 1AQUA 3PE4A 3EUAA 2OCXA 4LXUA 2OYRA 2KBFA 2HUNA 1I0IA 4KE6A 1Y7IA 2QLFA 2R97A 4IH4A 1FW8A 3TIXB 1AN9A 3LAWA 3ZWNA 4CMKA 4E21A 1LC3A 1E8NA 2E18A 1G98A 1KNXA 3HZOA 2H3HA 3N05A 4I6GA 5IAGA 3L1JA 3RSCA 3EEOA 2Q9CA 1E3SA 3B1VA 1AHHA 3CRQA 4G56A 3QQ5A 3BGWA 3JQQA 1TT7A 5A5GA 2ZB4A 1UJBA 4M8KA 2IXDA 2ZB3A 3SR3A 4P7BA 2IU0A 4A0RA 3N2NA 1KDOA 3E3OA 4DCOA 5HKBA 4AECA 1ZMTA 2DTXA 2XECA 3WL3A 1W8IA 3RJ9A 2XTNA 3ESDA 4IXWA 1NLMA 3A28A 3IERA 4M46A 2P91A 1RACA 4TKVB 4U7JA 2XVZA 5EZ6B 4FMBB 2JCBA 4KR3A 3QJ5A 2HFKA 5AHOA 4ZQCB 3KQKA 4BNXA 5CXQA 2R48A 5KX5F 2ILTA 3CW2A 3MD9A 3QPUA 4IIVA 2ZI7A 3W5IA 1EVKA 5BWNA 3BMQA 2DPXA 2Y1KA 4YRDA 3ZW9A 1RXUA 4LUCA 4PYRA 1TMYA 4MR8B 4QXAA 3LA8A 4IKPA 5GJWC 3DOEA 5FV4A 3N2KB 1JPNA 3BZWA 3E22B 3OQJA 4OMCA 3USCS 5LXTB 4KUGA 4JVNA 1K2VN 3K8ZA 1KYYA 3JQ9C 1VGQA 4NYMQ 4XLTA 1L4HA 4JR1A 5BMVB 1FYDA 3CN9A 2FPIB 4YJFB 1PR9A 1ZQ1A 2IYWA 4KQEA 2E4AA 2KJQA 1TFRA 1KBQA 1NI5A 2YJGA 3BK1A 1U8XX 2QI9C 3C48A 3GUCA 4LZWA 5CK5A 5AKLA 1SOMA 5BSGA 3LDGA 3DBRB 1CU1A 4JMLA 4GW3A 2I4LA 4R1QA 4K28A 1T29A 1H4TA 3D1JA 5REQB 3HYNA 3OAAA 4MKRA 4F2WA 2A5DA 1QAQA 2PO5A 4QJ5A 1G9XA 2BW0A 4WOJA 3BL8A 3E0XA 2Y68A 1F0YA 3C7CB 1SC3A 2YWCA 4OQMA 1YI1A 1O94D 3HDQA 1T6BY 4B83A 1TK2A 3P0IA 4ZOBA 5DGIA 2ZIFA 4MQFA 2CVPA 4E09A 3PCRB 5L7YA 3MLEA 3QV2A 2CFOA 1PN3A 2Q8PA 3D8TA 4J16A 3ZWMA 4B1FA 5KNBD 3SJ7A 4YBZA 1YJ5A 1DC5A 2BFOA 3AQ4A 2VRWA 4HJRA 5ALHA 5BV0A 2QHXA 1UWCA 2DBYA 3HVIA 4DAEA 5HM8A 1XZJA 1JIVA 1PWEA 1Q2XA 2HCRA 2HIAA 1UAYA 3DHVA 1U5BB 2MSKA 2WVHA 1U8YA 2YFHA 3HJTA 4RK6A 3RAPR 3T3PB 2Q3JA 1QIMA 4O4IB 4P83A 4BUZA 5JS1A 1K7EB 1H2RS 721PA 1UJ6A 3H0EA 4XD2A 3IODA 4KXXA 1I2DA 2WFAA 1VBFA 1P9WA 2CLKB 3OCWA 1O95D 4DF3A 1EP1B 5C7OO 4FB4A 3DEAA 3AFIA 5KNDH 4RPHA 3ZQ4A 4N3GA 3UMBA 2NO6A 4GRDA 3RVRA 2CMHA 2VP2A 4FLMA 4IJ6A 3SIWA 4YQFA 2HXSA 5A9SA 1EFPB 4ZC1A 2QMUA 3EUWA 1CCWA 2H2IA 5BO5A 1TA0A 3TTWA 2YS6A 6ADHA 3IUBA 1YVDA 3BEOA 4JL6A 3PEVA 1PJCA 2A5LA 3KU4A 5I9TA 1KE2A 2YKGA 4FDMA 3N53A 4Q3NA 3GRVA 3OOEA 4XKJA 1ORTA 2GH1A 1AVTA 2JANA 1EXMA 4YHBA 3RIGA 5BNZA 1NYQA 4HN9A 5ALLA 1KO8A 2NU7A 2UV8A 4R4JA 1N92A 2FRDC 1Z5GA 1ORIA 3JYNA 1F12A 2IEZA 5DMXA 3FRJA 2FZEA 4M7WA 1N0IA 4CYMA 3AUJB 2B3TA 3KOWA 5F3WB 5G40A 2XGJA 1BX0A 1S6YA 1L5YA 1TCBA 3P4XA 1JFRA 5ALYA 5B3JA 2Q0SA 5I9SA 1Z0KA 4CKEA 3CHYA 5JAIA 4XQEA 421PA 2O52A 3Q3EA 2QTWB 5AHXA 4C0JA 4GMGA 4QDZA 1OYVA 3PP8A 1UBNA 3LL4A 2PL5A 4ZK2A 1E18A 3GG9A 4PEVA 1OC4A 4MHOA 4CE6A 1IY1A 2PXHA 1ODKA 1V8DA 4F6CA 4OQEA 5E7MA 5AJWA 1GUDA 1GJRA 4J94A 5ER9A 1IN5A 1UIMA 1Y4AE 4A3SA 5ELXA 4CEJB 1WP9A 3UUWA 1LV7A 2AOUA 4NNPA 1NW3A 3EC2A 5G4KB 2ZBDA 3ONFA 3MTEA 1II0A 1NTRA 2Q45A 3SC4A 2YN0A 4X20B 1TW3A 1ZGBA 2IOYA 3K2IA 2WSYB 3T4UA 4Y9SA 1PR6A 5U9CA 2NXWA 4U00A 1K3UB 1S1MA 3R3VA 5BR1A 5IXJA 1QFMA 2FGKA 1PU2A 1SCUA 1FXSA 1W35A 3A1DA 4X1KA 5ALWA 4GX5A 4XVRA 4F5ZA 1KPHA 3B8EA 1FQJA 4PZCA 5K3FA 3T5AA 1U0BB 5T4BA 4FHZA 4AJ4A 3QU2A 1CEXA 1RWMA 2BI8A 4BTVA 1DRUA 4Y2PA 4MVJI 3WDLA 1Y7HA 5IYZA 3BYZA 3MTGA 1UAAA 2ZT5A 2G40A 2NW6A 3N58A 1WSAA 1C1HA 2PXXA 1SKUA 4AK9A 4JP3A 3V8BA 3T7KA 1NF8A 3E9NA 2CNWA 2PA3A 3ENWA 4KQHA 3EF1A 4Q4JB 5TMBA 3EZGA 4G5HA 4RHYA 3ZD6A 1A5TA 3RFCA 3TGLA 3O47A 4XIYA 2IV7A 4JAVC 5KEIA 4WE3A 3ZOKA 2AJBA 1W49A 4NI5A 4H6VA 3P9YA 1L7QA 2OAEA 3PXGA 1ZMRA 3UHFA 1NVGA 2OFPA 1SVMA 2XAAA 4KBGA 5EMLA 4W1RA 4HG2A 1DBIA 1FFXB 1N4DA 1SURA 1TQDA 2CXPA 1WDTA 3FHLA 3A8TA 1HYBA 2CV2A 1KETA 3A05A 1C0IA 1MABA 4HZUA 5T4EA 2XA1A 5DTJA 5DBIA 3VI3B 2ZRPA 2WJPA 1DC3A 2WYVA 1SOUA 1TQ6A 1W4LA 3UH0A 3N8KA 3TMKA 4ERXA 2VZ9A 1U4OA 2OHVA 4MW5A 5FUQA 2Z43A 3UG7A 1WL8A 3F3MA 4GECA 1HNZB 4GI5A 2RIRA 5A4DA 1LSJA 5TDHA 2DF8A 2JRCA 4P92A 5DX1A 4DTCA 1HT1E 2E55A 2O8DA 4P5EA 4GGOA 4FS3A 4RVDA 4OI2A 1Z0ZA 2PSHA 3WIEA 4CZ2A 3T4PA 1NJFA 2ZS8A 3EB9A 3FZQA 4HUQB 4M8SA 5DM2A 4F7WA 1P2UA 5FWXA 4OJYA 3V2HA 3UV3A 5BSFA 2P78A 1HT2E 3C7TA 1FEZA 1S8FA 4XSGA 3WRYC 4WEQA 2GM4A 3GJ0A 4BKOA 3QKUA 2P9TA 4YPVA 2RH5A 4GP7A 1NM5C 2O8FB 1SVUA 4HTAA 4KFRA 1BC5A 1VPVA 2AEFA 1J25A 3JWJA 4M98A 1A5SB 2QYOA 1LK0A 1YQXA 2QUIA 4YYEA 1YUMA 1QC5B 2J7PA 3LVRE 3LUGA 1G21E 3E5MA 4Z4GA 2NSYA 2YVUA 2Y66A 4RQBA 4QYSA 4MQFB 3G8DA 2P75A 2PH1A 2XA9A 4XDGA 1HLPA 3HJNA 4U3JB 1SULA 2VVTA 4A0HA 3ZYZA 4PYNA 4QPZA 1J0AA 5ERXA 1THTA 3WRWA 1Q1AA 3EDOA 4NOMA 5PGMA 1ONBA 2HI0A 2VPXA 3KJXA 4GWGA 3RJMA 1HE2A 1KVRA 3D64A 2CNDA 1QU2A 4RSMA 1V1RB 4BGVA 1P33A 2ERCA 3EA4A 4X24A 2C1EA 1E62A 2C3MA 1PL7A 1Q0ZA 4PPFA 2CT8A 1F17A 2Y8EA 1MOQA 3AF2A 3GELA 3NC0C 3IPCA 4FFMA 4AQDA 4O33A 4Q0MA 5T6MA 4ALIA 4D02A 2EXXA 4AXBA 4BFWA 1XMSA 2VJMB 3DBLB 4WOBA 3NNDA 3DFZA 4ENPA 2H0RA 4BFCA 5ESWA 2IYEA 1OILA 4FKBA 3K35A 4M38A 2J0UA 5CT6A 4KV7A 5ALKA 1N9GA 1Q7BA 2XUOA 1F7UA 3AK4A 1G6OA 3PYLA 4UBNA 5DCYA 3LHKA 5E38A 2QBYA 2XB6A 3LCCA 4DLVA 1X1DA 2ZUCA 5DKFA 1X8JA 2J46A 3PIDA 1XZEA 5E8RA 3MUOA 4G5YA 5MN5A 2QTNA 1BE1A 2REQB 1GFIA 5D51S 3D2BA 3JAKB 3E27A 1ESCA 2YWHA 1XN4A 3UMRA 1V6SA 4QYWA 1Z22A 1X70A 1BX3A 3B38A 4MCJA 4EATA 3CA8A 4LKRA 4EZIA 5A06A 1K27A 4GFDA 3U62A 5IASA 4WJLA 2VSOA 3EVNA 2H5LA 2JFVA 3EASA 3MYYA 4L85A 5H4HA 3PGA1 1I6MA 1SUEA 3LUPA 3D8BA 4LYDA 5BV7A 1T2UA 3B51X 1R0CA 5E6RA 3P5BA 3IMGA 1DIHA 5J2TB 4RD3A 1ZG3A 5T4HA 4GXQA 2IKQA 1N1EA 4YP7A 1JQJC 3DP9A 2BMEA 1S1CA 3EC1A 1U7DA 2IU3A 3ODPA 1LW6E 1VL8A 2O3SA 3RSFA 3WHIA 3GYBA 4JOQA 3I9JA 2PUFA 5KKNB 5TGDA 1M2WA 3WBJA 2C20A 3FKSD 5A0TA 2XDQB 1ODSA 4JU8A 5IUNC 1GVNB 4J0QA 5AI4A 3HNPA 4A73A 3UIEA 3JAWB 3U60B 1S5PA 4JUIA 4MDFA 4NCBA 3M5WA 3U44B 1G8FA 4B84A 3H5RA 2VSQA 3KSZO 1SM4A 2O20A 3B8HA 4TL9A 5GOTA 4JNCA 2ZRDA 4ND7A 4ZO7A 2HHHB 2C97A 2V55B 4XWAA 1CUXA 2D8AA 3QFRA 1TB4A 1YC2A 5FJJA 4Z51A 1YKGA 5CDGA 4PTLA 3TH5A 1Q1QA 4HB4A 3W0LB 2O2EA 4TXMA 1UOPA 3OQPA 3UWSA 3OIUA 3X2SA 1MZVA 2OB1A 4M9CA 3OZTA 1MNAA 3CVJA 3RT7A 3D8SA 2JCYA 1IK6A 2I2CA 1WUJS 3H11A 1EQAA 4GO1A 2PU7A 3HCRA 2IUFA 4XM0A 4D96A 1Z88A 2A6PA 4U5XA 4EPTA 1PFGA 4FLEA 4IDNA 1L4UA 4JFAA 3K4PA 2I6TA 4GDFA 4YAWA 4HQNA 3X3HA 3CPJB 5EQTA 2IOFK 4E5SA 1PYDA 3FNRA 4HNSA 5DBFA 5E6UA 1B1CA 2BFDB 3GJRA 5D7NA 4F3CA 1F51E 2XY4A 4IDAA 1UFVA 1IAQA 1IIRA 5BSKA 4HDKA 3GMTA 5FPPA 3WNCA 2VSNA 2OGTA 2H00A 1HO3A 3NGMA 5CP8A 5L6MB 1QPZA 3FSJX 1K5PA 2BMJA 2ONKA 2V6GA 2NZYA 3F3SA 3B5IA 4RZIA 4UCXA 2DHQA 4B6JA 4V0QA 5LOVF 1I3OA 1VECA 2MSDB 4AS2A 3MNFA 3WIBA 1Q1GA 1E7QA 2Y4OA 1JKMA 5DM70 2CL7X 2CXRA 1YK0A 2CVOA 4XUEA 1UBTS 4OJNA 1CUWA 1JQ3A 2BSAA 3L1HA 3NBZC 4JT8A 5KMGB 1IDN1 1KZ1A 2O5CA 1VHDA 3AERB 2C96A 2P1DA 1ETUA 1IOZA 2Y4NA 4H6PA 4OFXA 4X8HA 4BVLA 5AW7A 4URXR 3LGXA 4WVLA 3PDIB 3NKFA 2B1GA 3P1JA 1KO5A 1GA1A 5MDHA 1B8UA 1ATZA 2DZDA 4WXPA 4YDRA 3H7IA 3S8YA 1SUWA 4LVNA 5A9SB 5JNUA 1NN1A 1PK9A 1VL6A 2Y0PA 3FVVA 3SQNA 4D1YA 3ZVLA 5BNWA 1OA0A 1RPJA 1S9DA 4I9UA 4PGMA 1HMYA 5ADWA 1I1NA 2JB9A 1YBVA 1TRHA 3ZXSA 1GQQA 4AZ0A 3E03A 1XJWA 1VL1A 3GJSA 1KYIA 2I9PA 2OCIA 3VZBA 4MR7A 2NLOA 3RSGA 4FGZA 1QFSA 4BNDB 1A95A 4HEA1 5IPFA 2RFLA 1JMVA 4Q1AA 2C5BA 2WR8A 1Z7GA 3K9NA 3M81A 5CPFA 3TPFA 3U09A 2HLPA 3VGPA 4DE5A 2YN2A 2XE8A 3QE3A 2XYHA 4US0R 3TF5A 2QPLA 3KUUA 3QHQA 1Q15A 1DXYA 2HMAA 5DISB 3LPCA 5CCBA 1FLNA 3RGWS 4DL9A 2UUAB 3DB1A 4IDOA 1HLGA 4TKUB 1IEQA 1SUAA 3VPXA 4A5SA 1E6MA 4I08A 4BQNA 4K7JA 4IJKA 3R3WA 3OWXA 4H3HB 4OAQA 3KM0A 4IOKA 4YO7A 3PNBA 3UJ8A 4QGBA 2P9GA 1Y5IA 3TR5A 1OXSC 1TLFA 2EX4A 2PZLA 3RUPA 5A4IS 2IYXA 1AOXA 2OAP1 3BSFA 3CX8A 4V0LA 5H0IA 5K7SA 5A5FA 1I7LA 2MSEB 1V8OA 5FOTA 2ZRBA 2EGGA 1L6IA 3DBHA 3PD7A 2GZSA 4H7FA 3D59A 3H5WA 3LOUA 3SYKA 5C7IO 4BP9A 7YASA 2LWIA 1OX5A 4D9GA 1YIDA 1IZZA 1BCSA 4Q16A 1KDZA 4G8DA 4F4JA 4HLNA 2WV7A 1ZBQA 1JZQA 2PA0A 1NJ8A 3MQFA 1ABFA 2GBIA 4JUAA 2XNKA 2O8BA 1U5AA 4D9KA 1FLDA 1J5XA 2AW3A 3R0IA 2JK0A 1JGTA 2ZYWX 4S24A 3GVHA 1QHNA 2G4CA 1IXSB 2IYRA 2CDRA 2QE7A 5NULA 1G4HA 4M0KA 5JYDA 2P2GA 1M6VA 2ROQA 2OYSA 3FJOA 3WYCA 2DOKA 1CW2B 5I7HA 3BULA 4YCMA 1A9RA 1NUTA 5BR8B 3ZHCA 1AUOA 1QGUB 2PK3A 2QUHA 3PGLA 3QY9A 4KITB 2P4QA 2H0QA 1SUBA 2ZBPA 2WMYA 4G0ZA 4HK4A 3JD4A 5E4FA 1S3GA 4KVAA 3I37X 3HZRA 3T3IA 1CK4A 4M0FA 4YAIA 3QLVA 3GN1A 2I4MA 2Q1WA 4OK3A 4UHCA 2XB4A 4GQIA 1V9CA 3B9QA 4O3FA 3IKTA 2B35A 4OXKA 5MFZA 1QJ4A 1GA6A 3H83A 3ANSA 3IB6A 3SBOA 3SGLA 3T5BA 3H99A 1NF2A 3P9NA 3FLBA 2Z5LA 1S96A 4UREA 1HTWA 2BONA 4W5NA 4FX2A 1QHHB 1BDMA 4R98A 2FW8A 1DPFA 3D7NA 4PZDA 2WSLA 2AKYA 2V7TA 5L4NA 3RUAA 1PG0A 2OHXA 4CF3A 2FMTA 1WQ3A 3ZDDA 1YO6A 4OBEA 4KAFA 4UDYX 2DP4E 4X93A 2D1RA 2GAAA 4IIXA 4EL5A 5H8WA 3CSUA 3SOZA 1VLZA 2VLIA 1I32A 5E9QA 2EYQA 2M9MA 1YQWA 1ANKA 2GZ3A 4LRUA 4PC3A 5FV7A 3CIFA 3W8RA 1CJVC 3E18A 2HHAA 1WOMA 1AY0A 2IUUA 4YB8A 4IXDA 3RAJA 2XXJA 3G5MA 1A9QA 1KZYC 4EHDA 1YDMA 1TF7A 1NURA 1P1IA 2VG8A 3U3OA 4F8JA 3D4NA 1R0ZA 2F4NA 5AVVA 3U7QA 4GQAA 4ZQGA 2DR0A 3AETA 5F2OA 3HNRA 1HNWB 1GNQA 3WK7A 1MA3A 1RZRD 1MO6A 5CVUA 3JWGA 2GEJA 4H31A 5AXAA 3K92A 2HK8A 1V9SA 3MC1A 3IC5A 1ESDA 1Q7EA 1C41A 1CZKA 3LPAA 4TSFD 1Z0JA 2E1RA 2FFBA 1Y34E 2AOTA 1YAJA 3WA6A 5C7YA 1BWPA 4E5VA 5TSDA 2PMEA 4R68A 3PUHA 1M1YE 3IQFA 4CIVA 1D6MA 1UP7A 3P2MA 4JIMA 4X7MA 2P3QA 3CY6A 4LY3A 2YFYA 1GNPA 3CR7A 2EL9A 3GLFE 3H17A 2CLOB 4LPKA 3TW8A 3RVJA 1EINA 1VE7A 3PQEA 4MARA 2E4XA 1P3Y1 1PTJC 2ET6A 4FR0A 2OD7A 2L0XA 2G63A 8ABPA 1U7ZA 3GJ7A 5JH7A 5JXHA 4O4LB 2CZGA 4U8GA 2GCEA 2WQ7A 4P3NA 3LVQE 3HFSA 4CHGA 5AXBA 2WWRA 1ZN9A 2AQIA 2DJIA 3IQEA 5CYGA 1D07A 2F9FA 4JK3A 2IZ1A 2REBA 2XKAA 4TT3A 4TXHA 5AK6A 5F5NA 5LWHA 4KLCA 2H0AA 1VJCA 3UWDA 1SXGA 2C9ZA 2G0TA 4N5HX 4G63A 2I4TA 2YOGA 2CK3A 4MGKR 2E82A 5HIIA 4GWLA 4TMWA 1GN8A 4YONB 3EPHA 4R71A 1FP6A 1L9XA 1AZTA 1E9VA 5GTDA 2XRMA 3EC7A 3BH7A 4Q1FA 1ESNA 5F77A 2XB9A 5K9ZA 3HJUA 1EZZA 1TJYA 2ZWAA 3PL1A 2CXNA 2O3QA 2PMKA 1VLMA 4BQIA 5DM0A 4YJ3A 4DABA 2M6KA 3I1FA 5CK4A 4N7RA 3L9XA 3AVVA 4XCXA 1LBTA 1TUBA 3LG2A 1GOTA 2CBXA 3DEKA 3O4HA 3TKLA 5IH7A 3RADC 2CUZA 4IG9A 1QQ5A 1J8MF 1R6XA 1LTKA 3U6KA 2RHLA 3W5UA 1XRSB 3KVRA 4LE2A 1EJ6A 5BWBA 1K3TA 4FGWA 3CYFA 5C4MA 4M9UA 1H2FA 4TL8A 3DXXA 1PLLA 4M76B 4EYQA 2P9BA 3CLHA 4Z3OA 3LA6A 2Y1FA 3MBIA 1PSWA 3N3AC 1PL6A 1HEIA 2AD1A 1IBRA 3BK7A 4ZJYA 3OH8A 5IT5A 3QELB 3HVHA 4HQLA 4YH1A 3ETJA 2J33A 4Z8XA 4WWHA 5LN1A 1XU7A 4KN6A 3EIUA 5D00A 5ER6A 4KRXA 3V4VB 3ZCSA 1OXKB 3K53A 2LNDA 1PK7A 3IS3A 4J2HA 2Q7OE 1UK9A 4LXIA 2BR5A 1N75A 2ZJYA 4NONA 2AFHB 3FPJA 3TKAA 3U0VA 5H4GA 3PC8A 4WFIA 5DOZA 1NOIA 2I66A 2JRLA 2Z57A 1T5IA 3O8OA 3QH4A 4JL5A 4YLYA 3NDJA 4MDEA 3MOGA 2JIZD 3K8OE 3S6JA 1QKJA 5FHQA 1NOJA 2ZCVA 3WWYA 3NIWA 1FTWA 4B2IA 2A1IA 5EEGA 4JB8A 3NPMA 1ZN7A 3WE7A 1RVDA 2EX0A 3PHGA 5JLJA 2WB2A 5T41A 2HK9A 5JTTA 4MVJG 1AGXA 1ZU4A 4YJGA 3OHPA 3JD1A 4DA8A 3WGIA 4OP1A 5EIAA 2M6LA 3H4IA 5DN9A 1W85A 2PE5A 1YA6A 2VPIA 2ZT6A 3H1EA 4CN8A 5JQGB 2D6FA 4HYEA 4LFCB 4F1JA 3WLKX 1B93A 1H2HA 1P61B 1TJ5A 1ZL2A 1SBYA 3BRQA 3ND6A 5FYQA 3OUZA 5L4SA 5G1OA 1OKKD 1P1RA 3FNGA 2BHTA 3P9PA 2V1UA 3KSAC 4IR7A 4LJ7A 3Q85A 5ALPA 5JI2E 3V1NA 4MIYA 4PIMA 2BFWA 3V32A 2XWSA 1C50A 2IY9A 2EJBA 3R5KA 5IWAB 2GHQA 4BZXA 3WL7A 1J09A 2LUOA 1RABA 3BL5A 5CIWA 1PR0A 2CWWA 4AMGA 4ZFNA 3C6QA 3DV9A 1TAHA 1L7XA 2BRUA 1XZLA 4L7VA 1FXWA 1U1GA 2Z2ZA 5JVDF 3DTNA 1GQFA 1Z7EA 2ZBFA 1U9JA 3HB5X 4O8CA 10MHA 4H1VA 1Y37A 3T9EA 4A8TA 2NNLD 3JVDA 4TWIA 3DOHA 5K3EA 2I7TA 2D5AA 2W6OA 4WACA 2CHFA 2VL7A 2IHVA 1P6QA 1SKBA 4QBIA 3R4VA 1Z4LA 1H2BA 5DNEA 2FMHA 3LDAA 4Y6PA 1MPXA 1QR6A 3H2IA 1VYVA 3FNIA 1AE1A 1BS2A 3OI7A 1D9ZA 4UXHA 1XDWA 2RDMA 2FVYA 3TTVA 4F0JA 5BQPA 3HUUA 1FQOA 5IDWA 1ZSVA 5FNVF 4YAUA 1SWVA 1ZK1A 1UKAA 2AK2A 3EXFB 3R5XA 5EY5B 4AZ0B 1CUDA 1GZDA 4BJ6A 4LDRA 1MP0A 2CJXA 5FNZA 1CT9A 1IJEA 5AJZA 2H2HA 3TAXA 2H3EA 4KE9A 5H3HA 1CFJA 3BKWA 3PPWA 1E3TA 2FRXA 2BF7A 2IDMA 3KWLA 4E5YA 3ZWQA 3L7NA 3DZGA 2BKLA 2O05A 1GZ5A 1A77A 5EOVA 1WD5A 3EFHA 3DZHA 1EVIA 1X7DA 1B6SA 2LKDA 2DBQA 4BECA 1V96A 4CG3A 4OAPA 3HDVA 4Q1DA 1P29A 3K9CA 5U4XA 3M6LA 5IANA 2D5IA 3PWZA 5JRZA 2OGSA 2Z5GA 1VQ1A 3UMVA 1O9BA 4FYHA 2BSXA 4B2YA 3VBEA 2H8GA 3PVCA 2Z08A 2B30A 2AN9A 5G1NA 1E1RD 3CF2A 1HT0A 4MVXA 4TRJA 4HMQA 1QRSA 4X1IB 5L9AA 4KRFA 4NV0A 1AK9A 2QD5A 4QQRA 4ERNA 2PV0A 2E4UA 3QIVA 4YQEA 2OBBA 2RGDA 5ITVA 5F2NA 1ECGA 3HDYA 2XNCA 1IH8A 3WS7A 4NZOA 2J7KA 2ZI9A 1FTQA 4KNVA 2AL7A 3QUSA 1WPRA 4G1UC 3A25A 4GSYA 1QX4A 5KAMA 4R2MA 2CJFA 4E22A 5HVNA 1NIJA 3I45A 4NHOA 3LQRA 4OV6B 2FLWA 1VCOA 1OLUA 4F5WA 5K3SA 3SF0A 2B3DA 3C39A 1R6DA 2GHRA 3G0OA 4EMTA 3R40A 4NWIA 2L69A 1H4QA 1XXHE 3U3DA 4AP5A 1SWWA 4NJEB 1Q0QA 3N7UA 4OYYA 4EZBA 2GVDC 2PMBA 2CFSA 3PNSA 2X3FA 4NMWA 2NSJA 1WBJB 3AHHA 3QI7A 3T9FA 1PS0A 3FYUB 3T15A 2G1UA 2R4TA 2C42A 4ZAGA 4M7PA 1Y1LA 3M1AA 2XE6A 1X86B 5DGCA 3ZWYA 3ZTYA 5L6LB 4PLZA 5K8VA 4OHUA 2R44A 4UEOA 1NT2A 5H3LA 5J4VA 2PMCA 2JLXA 4QTXA 5KYUB 3QITA 4FFBB 3THXB 2TYSB 1JL3A 3K8YA 4I50B 3OFJA 1NZDA 3EGXB 4IOLA 2AIRA 4KQ9A 1PEKE 1YRQA 1IM8A 1C9JA 4WAUA 2HLNA 3E9DA 4HD8A 4F9FA 1JZTA 1WDKA 5DU2A 1WBBA 1QIJA 1KO1A 3PDJA 2Q7DA 4F96A 2KI5A 3EDMA 1ORWA 4XD7A 1K0UA 1DT5A 2X8WA 4QECA 2QN7A 1M2HA 1PZGA 4GX0A 4NMHA 1ATIA 2V6FA 3QEMB 2FYTA 3ZCUA 4TKUA 3CW8X 5ENVA 3FBWA 3IKVA 5D6NA 1YJCA 2G72A 3U5ZB 3NIDB 4AM8A 5CCEA 1ZHFA 3L4EA 1KH3A 3LSYA 1E0JA 1DAEA 1Y48E 1ZICA 2FKNA 3SJAA 1CQIA 4N03A 1U1EA 4JGBA 4FKZA 1SD5A 2P4HX 4Y2RA 1KYWA 2JHGA 5DXAA 3I62A 5AW1A 3NP9A 4HWTA 1AQLA 1GFZA 4CRWB 1IRXA 1G38A 1ZZEA 2FP4B 3C98A 1PJLA 1GNTA 1KKUA 2Z9DA 2GO1A 1N8KA 4KACA 3LHFA 5AKKA 3U44A 2X0KA 3M6MD 2IFTA 1TCAA 2C61A 1DDOA 2QTCA 3QMVA 2JH8A 3LQFA 5AKEA 3CLUD 3E23A 1I94B 2QX8A 5FOQA 2VXBA 1FY2A 1JG4A 3O31A 3D3NA 3Q12A 4FW8A 5G4KA 4MQ4A 4J4TA 3F97A 2I6QA 4YECA 2PZGA 4BFTA 3SKYA 3OZSA 4TV9B 4UNPA 3ORQA 2EOAA 3MMNA 3EYAA 3LO8A 4QDTA 4YGXB 4DQKA 3G0BA 1VE9A 1EVZA 2QPTA 4LK2A 2Y27A 1NA5A 4WXHA 4GVLA 3LE8A 4R0MA 3DYIA 3G0IA 5JY6A 1NV9A 1RM4A 4HWPA 1SIOA 1AS3A 2WIBA 1GM5A 3A58B 4PQRA 4WESB 3NOOA 2HQSA 2EEZA 4FCCA 5JECA 3ZY4A 3NWOA 4RF5A 4NAHA 4ATNA 5LZ4A 1VP9A 2OV8A 1QUEA 4ZCSA 2VRBA 3QGMA 4G5SA 3AB8A 3E2MA 2VF2A 4L15A 4UE2A 4MQUA 2DHCA 2OO3A 3AFGA 2HPAA 1S2DA 4ZT2A 4E13A 1EX6A 3NORA 1XV5A 2O8VA 3ZU6A 1BEEA 4MKFA 1ECFA 1QS0A 1JHVA 1SCNE 4IX9A 5GV8A 5J2UA 4Y2SA 2PDAA 4HYTA 4NCNA 2GEDA 2QTZA 4IWNA 5FJIA 4DQ0A 3QLJA 5A3SA 2WD7A 3WHKA 1QGAA 2BTQB 2EEPA 2FSPA 1FDWA 3LIIA 2A5YB 1D04A 3M3HA 4QPPA 4H7EA 2BN4A 2EWVA 3DTVD 3N6VA 4BVAA 5GPBA 4B3SB 3EMVA 2GCGA 1U63A 1N7HA 4E15A 1OYOA 3V4FA 1EFPA 1F3OA 1Y6JA 1TU4A 4HGYA 2PH5A 3NV9A 3VOBA 3IQWA 3TDKA 1B76A 1NT4A 2DLDA 1TKBA 2FX2A 1ADFA 4H15A 1Y8CA 2AJCA 2CDCA 4PBRA 4XQ9A 4PIPA 3ASVA 4BO0A 4JSTA 4Q3BA 2V98A 3OKFA 4WY2A 2Z6UA 1ZUD1 2GPYA 3LQQA 4N9WA 3T1VA 4ZI2A 2HRRA 1Z6PA 2YJNA 5CA1F 1C9NA 4D45A 2IYTA 5FBRB 2RK6A 2KE5A 4BLUA 5HKKA 4URWR 2WU0A 3INRA 2YWXA 5HJ2A 5KKAA 2H1LA 1KIMA 1QC5A 3AW9A 2FHSA 3KOOA 4JYCA 1N6KA 1NHGA 2R65A 1XTRA 4IP0A 1F8GA 1XD2A 2PX8A 3BMCA 1DMSA 4HLQB 1QOQB 1H6CA 4EJFA 3RAFC 1Y63A 1AHNA 1DOZA 3AHDA 1TO6A 4CT4B 4I9HA 3GVIA 4MUBA 4H3KB 4BLOA 4AMVA 1T0IA 2OM2A 1S2MA 2RHMA 6REQA 4LYGA 4I66A 4YRQA 4PSCA 4ID9A 2CB9A 2G04A 4Y2UA 1VJ5A 1RIIA 3ZK8A 1J70A 4TS3A 2LKCA 2AF3C 4IICA 4LJKA 4WZAE 1N3LA 4B7AA 3UKJA 5CDTA 2PKWA 5GMOA 1IBMB 4R3WA 5AD1A 5FBWB 3W2FA 3W2IA 4BNUA 3AFNA 3D1LA 1YZHA 1VRCA 2H4XA 2R7LA 1Z9BA 3BC1A 2R6HA 2WTBA 2QYSA 3N2EA 3UAXA 2ZUWA 3HTXA 3M3DA 2PSEA 3L9WA 3VPHA 1CEEA 9MHTA 2BP7B 1QXSA 2V7UA 2C8KA 1NQUA 1KP2A 2FFHA 1JSCA 5FF9A 3CRW1 3JCZA 4MQ5A 3A06A 3LQ1A 5DM60 1HDZA 3I9LA 2IF0A 3AL2A 1E4YA 2A1TR 2GN4A 3B36A 2JGKA 3HBFA 3THXA 1BO6A 4FKMA 5K8TA 1LI7A 2WZQA 2Y1GA 4QOSA 2W71A 4C30A 1PJ4A 4QZVA 1E5TA 2X9LA 1K8XB 2ORYA 2WW8A 3A1NA 3V4LA 1EBUA 1FE8A 3H4MA 3AF1A 1GAEO 3NTOA 4UEJA 3VPGA 2FW1A 1YE5A 3ZCXA 3KKZA 4KWIA 3ZOZA 1PKEA 4L2IA 4OQYA 1PUXA 2PQ6A 3ER9A 2JAXA 1L3BA 1TUGA 5EE5B 3V6LA 1IC6A 1OXXK 1U8TA 2CXSA 2ZULA 2WUEA 4YMHA 4EX7A 5BP7A 4KN8A 4H7DA 1REQA 2OV4A 3WWZA 1DNPA 2C5HA 3OZGA 3IA2A 3QBDA 2TMYA 4MQEB 4Y9UA 5LKAA 2N1BA 2CVQA 1JIJA 3MRXA 3DE4X 4LGYA 4YMVA 2ZSIA 5BOVA 2GCIA 1FFSA 3VPDA 4GGMX 3LO5A 4K6FA 5CB4F 3H86A 3GUHA 3COYA 1N77A 5WRFA 4U4AA 2HQRA 2LXNA 3IKLA 1DWUA 2LCQA 2IQIA 3RIMA 1J2TA 1I5EA 2DG2A 3KYCB 5JAZA 3SC2A 3PFCA 4B09A 5AK4A 1TVEA 4CT5A 2A4MA 1ZD3A 2X5OA 3O92A 4BC0A 3SQWA 2H29A 1IHDA 3L43A 3CEPB 2QGNA 3HDJA 4BB0A 1C5KA 3HKDA 5ALZA 2XEDA 2GFHA 3K8QA 4F86A 3T52A 4KW7A 1MB3A 2IW1A 4LJ6A 3VHQA 2NO5A 2R5NA 2VHJA 2XWBF 2PL1A 5LYJB 3ETNA 3I8OA 5EA2A 2MINB 3O2JA 1E69A 2KBEA 4HB3A 1R0BA 2GKOA 4K87A 1NP6A 1SPBS 2QTRA 3LZ6A 4UATA 3UYKA 5I7FA 1JE1A 2H48A 3U31A 1KFKB 3PPYA 4Y1RB 3JW8A 5BYBA 3NIFB 1QUFA 3JQPA 2XE4A 2FE4A 5I9NA 1XALA 2ZG6A 2P2NA 2Z2XA 1L7VC 1YACA 2ZTSA 1ZIXA 2XYQA 4HNQA 4ZICA 3ESZA 3VO1A 2AWOA 5G0TA 4YY3B 2B2XA 3WHLA 4MS4A 1HE1C 3AXSA 2I4OA 1VI2A 3OQIB 4AC9A 3FNBA 3BWEA 1BXGB 1VJTA 2PQ0A 2Q2NA 1Z07A 3Q6IA 3TIVA 5F1OA 4F9TA 4DUGA 5F9HA 2AMVA 1KU0A 1EFTA 4Y2TA 1ZLXA 1DJPA 3V7NA 4MGIR 2JGDA 2ZRJA 1ZJ6A 2AWNA 1GPH1 3NAMA 1FP7A 1G20A 1KNQA 3EDCA 1JFFA 3T7AA 5AVUA 4JZKA 4UBMA 3FUVA 4X94A 5K2MA 2ID4A 5JWHA 3GGPA 2HRQA 3V8QA 3T5DA 3DCJA 4NE9A 3I58A 3ROXA 1XMQB 5CB4B 4JCOA 4DZTA 1RJ9B 3PQ5A 3EVDA 3QVTA 2GB4A 3AESA 5KTTA 4BCDA 1B6GA 3C74A 2X8LA 4KO4S 4MMZB 3SX0A 1BJTA 1UPTA 4F11A 4PM4A 1EP2B 4LYEA 1HQDA 2PL9A 4HB2A 3F46A 4KPGA 4WNCA 4UZSA 5ALEA 1ZO8A 4MUGA 2O2HA 2HHLA 4PLPA 5KOJB 2XTAA 5KTYA 2O2ZA 3KJFA 4FI3F 1KOFA 3T34A 4TS1A 4PCLA 4BIMA 2H7CA 4FVTA 4P54A 4B75A 5T6BA 5JDCA 3TQSA 3V8RA 5JS2A 4A0FA 4RMGA 4RHEA 1T4BA 5ULLA 2ARKA 1V4VA 3O4JA 1XCMA 3DWFA 3OX2A 4HLCA 3WGNA 1F2VA 2OGUA 4M9XA 2VK8A 1JT9A 1QG2A 3VC1A 1QP8A 2CJWA 4ZMRA 2FPLA 1U3VA 3AINA 4WOKA 5LIPA 3FNEA 3K9GA 4AJHA 7MHTA 2DHEA 1BDJA 5I7EA 4OLAA 5EE9A 1MW9X 1OTHA 2VQ6A 1B15A 3R23A 3RCBA 1W4CA 1EFVA 4KQ6A 3TRHA 3IHLA 1YJAA 3V1YA 2I78A 2V7VA 3WRVA 4B8ZA 1T3ZA 1M6NA 2EQ5A 3M89A 2F43A 5KAPA 4AXXA 1D6JA 3CCFA 5H5JA 3QVMA 2HT1A 4COOA 2GK7A 1BFKA 5FPHA 2J9FB 5BR7A 2P7HA 4EL0A 4JV5B 3LHDA 4Z4QA 1NI3A 1KDRA 2BWJA 2ONYA 3OZXA 4EVQA 4IF4A 1EFAA 4KYUA 4CCYA 1KJJA 2CN1A 2XDWA 3Q8MA 1M1NA 4PLWA 1AGPA 4YT5A 3CRVA 1Z17A 5K6TA 4C08A 3CCBA 4JASB 3W2TA 4NE7A 3DOCA 4LV5B 4IJQA 4Q47A 3B1FA 3GFRA 4FNMA 3TIFA 3OQ6A 5JJ5A 3TWOA 2HBQA 1NR5A 1DWQA 3U0BA 4HEQA 1FF9A 2POQX 1SZPA 4P7FA 3ZV5A 3H3JA 4O6VA 5D3ZA 1SBNE 1XZ8A 3PRHA 1MVOA 1RWXA 2CJPA 2D62A 2WZDA 3RTCA 3PRKE 3U4DA 3M1YA 4YMSA 3HZZA 3UY4A 3D5EA 2YJ3A 3PENA 4N3CA 3D5TA 4H7PA 4HTFB 2CMFA 1S3IA 1Z4MA 2ZQ5A 5K0CA 1T0UA 4TTAA 5GVRA 1YC5A 1Y1PA 1NSTA 3QXCA 1GDHA 3DGEC 4MUEA 1ZXLA 2CF5A 2G09A 1CF9A 3EZLA 3I32A 5F2KA 4B6RA 2WSBA 2QVGA 2YZ2A 3OM8A 4FYWA 2NTNA 2VHZA 1B41A 5FHRA 3U7IA 1Z2CA 3IL2A 2P7IA 4OJTA 4E32A 4TZKA 1XNJA 1E5XA 4IFBA 4MVJP 5J5AA 1ICIA 5FULA 2IY8A 4G1CA 1CR6A 3EIEA 2MSWA 4LDZA 1VPTA 3SBXA 4OXQA 1E7WA 2WFZA 1BIFA 1OBOA 3ZD8A 2ATXA 4QO8A 4R0VA 1USVA 1RYNA 1RYYA 3OIWA 2FZVA 2UDPA 3SXJA 4Y1FA 2XTMA 5EWJA 3G59A 2CLHB 3GRFA 4WH0A 9ABPA 1LFAA 1UOEA 1WDWB 5B3LA 1QP0A 6YASA 3QHAA 2Q3DA 3V1MA 1U0TA 1QPGA 1T9DA 2XZPA 5F3RA 4A0GA 3ZZTA 1CR4A 4ZVSA 4INPA 3I8SA 1K2WA 4JI2B 1K4KA 3KKPA 1EESA 3FHOA 1NR1A 4FE4A 4JSYA 4K6HA 4P53A 1SQ0A 1MB0A 3G9QA 4GZMA 5IBPA 4DKXA 3WKEA 2QAGC 3FCCA 3IR7A 4GD3Q 3KYCA 4EK9A 2BISA 5LXTA