4RTRA

Complex of escherichia coli dna adenine methyltransferase (dam) with adomet and a 5-bp non-canonical site (gttta )
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
244
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
molecule keywords DNA adenine methylase
total genus 84
structure length 244
sequence length 270
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtrA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtrA01
4PYNA 1JG2A 3C6MA 3NDIA 1KXZA 2Q41A 3UJAA 2IBTA 1KPHA 3BWMA 3FPJA 5FQOA 3LX6A 1P1CA 3MCTA 5DX0A 3BKXA 3FUTA 4F84A 3M70A 3JWGA 3MCZA 2HMYB 3P97A 3I53A 4OBWA 5H02A 3PS9A 5EEGA 3C3PA 1FP2A 3B89A 1Q0TA 2FK8A 3MQ2A 5EOVA 3LDUA 3C3YA 1L3BA 3V8VA 3I58A 5LQAA 3P2IA 5K0FA 5KVAA 3DULA 1G38A 3G2MA 5IH3A 3G2PA 4RTPA 3HM2A 2AOTB 4DF3A 2XYVA 10MHA 1RJEA 4ER0A 2GPYA 4AX8A 2N47A 1O54A 3GRVA 3EVFA 4YUWA 1KR5A 2ONZA 4OA8A 3HCAA 2NXJA 1NW8A 4KWCA 1VQ1A 2JHCA 3KQTA 2BZGA 3DUWA 2PV0A 2B78A 3VC1A 3BXOA 3KQMA 4OX9Y 1FP1D 2B9EA 4Z2YA 4K6MA 5LQJA 2P7IA 4ER7A 4GEKA 5DM0A 5CCXA 5DM4A 5DTRA 2P40A 3O4FA 3H2BA 5E1BA 2JHAA 2ZBQA 3KQVA 3P9CA 2H1RA 4GF5A 4ZTBA 1NKVA 2O05A 3HVIA 1FBNA 3KPWA 4PYMA 3TOSA 4M7RA 2IDKA 2C7OA 2NP7A 1R8XA 4P7FA 1O9HA 4QQNA 5DM2A 5EMJA 4AZWA 3IYLW 1RJGA 4DCMA 2G8NA 3DH0A 5FUBA 1P1BA 4Y30A 5CVVA 3LCUA 2YXDA 1F38A 3IV6A 4FS8A 2PBFA 4RX1A 5ICGA 5GINE 3WSTA 4CKBA 2EJTA 2YTZA 1RI1A 2FPOA 3OZTA 2HTEA 2PWYA 3GRRA 1JTFA 2PX8A 4RTRA 3BWYA 3BUSA 4PINA 5HIIA 4HG2A 1VL5A 4PWYA 3SSOA 2YUIA 2OO3A 5EMMA 2ZIFA 3EEYA 3EMDA 4PYOA 3E23A 5T64A 4GBED 1EIZA 3FUVA 2ORED 5DWQA 3EVEA 1QZZA 5E9JA 2NNWB 2ZBPA 2HWKA 3DOUA 4YMHA 2PY6A 1BC5A 4HRAA 2I6GA 1R74A 4YUYA 5E8JA 4LECA 4A6DA 4ER5A 1RJDA 3PLAE 1N7IA 4PIPA 2IDJA 3LCCA 2ONYA 5GWXA 1V39A 5C9ZA 2YXLA 2F8LA 2NXEA 3OU2A 2IH2A 1YFJA 2P3QA 3LBYA 4P58A 2LD4A 1JQDA 3P9NA 4IKPA 3KQSA 5HOQA 1VP3A 4P7KA 5DXJA 3AXSA 5K8VA 2UZ4A 3NMUF 3UJ9A 1WXXA 3G89A 4BLUA 1AQJA 2UYCA 1U2ZA 4EKIA 2DULA 2VDUE 3FPGA 4RTOA 5GM2A 2O06A 3P2KA 3QOXA 3GIWA 3M33A 4O29A 3SR4A 3HTXA 4R6XA 1ZHFA 2QRVA 3MTIA 3RIEA 3S68A 4FGZA 3X0DA 1YF3A 1JTEA 4U7TB 3M4XA 2ADMA 5K0NA 5FADA 5K0CA 4F85A 2DPMA 2BR4A 2C7PA 1HMYA 4AZSA 5ICCA 2OZVA 2QYOA 5G02A 1IM8A 3LPMA 1KYZA 1SG9A 2XYQA 1RI4A 5K0JA 2B3TA 3IHTA 3OZRA 4HGZA 5DSTA 1P39A 4RVHA 5E9WA 3KQOA 2NXCA 2FCAA 2ZZNA 4M37A 1M6YA 1QYRA 5MHTA 3TKYA 1JR4A 4NECA 2CMHA 5DX1A 3HP7A 3LDGA 5EMKA 4AZTA 2BM8A 3UWPA 5T6BA 3A26A 3ERCA 1JQEA 3KQYA 2EG5A 3GNLA 2YX1A 4XUCA 1D2GA 3G5LA 3LDFA 2AVNA 2JG3A 3P2EA 2P41A 3HCDA 1JG4A 4E2ZA 4RVGA 3BGVA 4FR0A 1JQ3A 3RODA 4PIMA 4X61A 4C05A 4PGGA 2I7CA 2PJDA 4RVDA 2AOUA 3KPUA 5DM1A 3SSNA 1TW2A 4XUDA 2OKCA 4P7GA 3GRYA 3FUXA 4HGYA 4PCLA 4C03A 3NW9A 4QPPA 2VZ9A 5K0EA 2XVMA 4IWNA 5FWAA 5EPEA 3R0QA 1KIAA 1L3CA 3FTEA 3UA3A 3T7TA 3FUUA 2G71A 2G70A 2P8JA 3A25A 4H0NA 4HC4A 2BH2A 4CTJA 4E31A 2IIPA 4BY9E 1DUSA 5HEKA 1N2XA 3A4TA 1G60A 2FHPA 3LHDA 3LKZA 5C1IA 3UJ6A 1Z3CA 3UJ8A 1G6Q1 4F86A 4QVKA 5CVUA 5HFJA 3TRKA 2XYRA 2Z6UA 3SXJA 4BLVA 5D1HA 3AXTA 1I4WA 3MAGA 4E2YA 4RWZA 2Y1WA 5KYGA 3P8ZA 4PNEA 1YFLA 3QOWA 1WXWA 4E30A 1RI3A 5DPMA 5U4XA 4MQ4A 2IGTA 3HEMA 1YB2A 3KU1A 2AN5A 3EMBA 3NWEA 4GC5A 2HR1A 1XTPA 2OPBA 5KQSA 1ZQ9A 5GIOE 1XJ5A 1WZNA 4E32A 5BP7A 5F2NA 1I9GA 2VDWA 5E2AA 1N7JA 3MB5A 3TR6A 3UJDA 2ZSUA 2GAFA 2PT6A 3CJTA 1ZKDA 3GXOA 4LWOA 4AUKA 4HH4A 4CXMA 3Q7EA 2P35A 5GIPE 4MHTA 4V0RA 5FHQA 5LR6A 1X1DA 3G8BA 3BGIA 3DMFA 1I1NA 3OFJA 3ELYA 2IP2A 2QRVB 3UA4A 1X1BA 1HNNA 2JH8A 3G88A 3MTEA 2KW5A 4OBXA 3TFWA 2WK1A 3TLJA 2FK7A 5CM2Z 4YV0A 5LQNA 2G1PA 3AJDA 5K01A 2YQZA 2HNKA 1NE2A 3PTAA 4EVIA 1X19A 2PXCA 4C06A 5EZQA 3BWBA 4WXHA 3HVJA 1R8YA 2NYUA 4C08A 3OE4A 5LQRA 4QTTB 2JH9A 2VP3A 3HA7A 3R6TA 1MJFA 1O9GA 2ERCA 5E1MA 3KR0A 4XUEA 2GH1A 1YZ3A 3FZGA 2I9KA 4MWZA 2ZZKA 3DXYA 5DTQA 3CBGA 5BW5A 4PYKA 1TW3A 2Y1XA 4U7PB 3FYDA 5ICFA 1WG8A 3B3JA 3O7WA 5IKMA 3BWCA 5GM1A 3TQSA 4EKGA 4C4AA 2Z6QA 1NW6A 3GDHA 5HILA 4KW7A 9MHTA 4R05A 4YUXA 5FTWA 2CWWA 4BLWA 1BKYA 5HIJA 3ORHA 3L8DA 4RYLA 5D1NA 3CGGA 3ME5A 3T7RA 4C04A 5DX8A 1XCLA 2ZBRA 3FPHA 1SUIA 3UFBA 1FJXA 3GO4A 5CD1A 2I62A 2C7RA 3ID6C 3LL7A 3UJBA 2AN3A 3T7SA 2YXEA 5K05A 1B42A 2AZTA 3ELDA 3PX3A 3GU3A 3VC2A 2IH4A 1L1EA 5FA8A 1XDSA 1JG1A 3FTCA 4KDRA 3B5IA 4ER6A 3FTFA 5EC8A 4E2XA 3B3GA 1DCTA 2K4MA 2CL5A 1X1CA 2H00A 3U81A 3T0IA 3CJRA 4E70A 2AR0A 3CVOA 4FSDA 3FUWA 4FZVA 4LG1A 4QDJA 3IEIA 3DTNA 3FRIA 3GRUA 3SGLA 2ZWAA 2FYTA 2NXNA 2FRXA 2PVCA 5DSXA 2V74B 1SQFA 1JSXA 1SUSA 3RW9A 5HIMA 2AS0A 1VP9A 4RTJA 3M6WA 5LQKA 1WY7A 4OQDA 3CCFA 3I9FA 3EGEA 1D2CA 3SMQA 5K0LA 5K09A 2UYQA 4HSGA 4QTUB 4AZVA 7MHTA 3VYWA 3M6XA 4QQKA 5EIWA 5GP1A 2ZZMA 3OE5A 3BZBA 4KDCA 5B1SA 5DXAA 4GOMD 4DKJA 3GCZA 1M0EA 3OU6A 1YZHA 4KIFA 5F2OA 2UYOA 2WA2A 2PSSA 1EAMA 1R18A 1UFKA 3EVBA 5EHIA 4BP3A 5HIKA 8MHTA 3KPYA 5ERGB 4FSXA 2P3LA 5KQRA 3FPFA 3OCJA 1IXKA 1X1AA 2BR3A 2PT9A 3PFGA 2O57A 3DMGA 1Q0SA 2PWPA 4X1OA 3TM5A 2ZIGA 1XVAA 5M5BA 2WA1A 3M6VA 2EX4A 3D2LA 2ZULA 3G8AA 3I5UA 3LSTA 4KIGA 4V0QA 5CVDA 2ZLBA 4RTQA 3CKKA 3KQPA 1KPIA 1G8SA 1KP9A 4RTNA 3EGIA 4RTKA 3EVCA 2PLWA 3HCEA 3B7PA 3NWBA 1PJZA 2P7HA 3UJCA 4IV8A 3HVKA 2CKDA 5JR3A 2EJUA 3GGDA 2OXTA 3SSMA 5P8WA 3A7EA 3V97A 2ZFUA 2ZVJA 3I64A 1NT2A 3MERA 2P3OA 2GLUA 3AY0A 3EVGA 3O31A 4G56A 4PYQA 2VS1A 4YUZA 1QAMA 4RSRA 2BR5A 2ZTHA 2ZW9A 4YUVA 4PYJA 4GC9A 4M36A 1NW7A 5BXYA 3EPPA 2PKWA 3PT9A 4OQEA 3EVAA 1ZG3A 3K6RA 5DT2A 3JWHA 2HV9A 2G72A 3HCFA 1RJFA 1YUBA 1UWVA 3E05A 3KPJA 3KQWA 2ESRA 1ZGJA 3DXXA 4YMGA 5T67A 4FT2A 1G55A 4QPNA 1D2HA 2AVDA 3SM3A 1MHTA 3R9XB 1QAOA 5DTMA 3C6KA 5JUWA 5EHGA 2PX2A 3ELUA 3OZSA 1EG2A 1FPQA 2CMGA 4KVZA 4OA5A 3ELWA 5EEHA 1XDUA 1AQIA 1KYWA 1XXLA 4PYLA 4QVGA 2OYRA 3LCVB 2GS9A 3FRHA 5LQUA 4GOOD 2PX5A 2OB1A 3GJYA 5EKXA 1WS6A 2AOVA 3PFHA 2AOWA 2UYHA 1RI2A 4CWAA 5C0OE 3HCBA 1ZGAA 3HVHA 4ISCA 3FPEA 5BW4A 4R8RA 4Y2HA 5LSAA 1SKMA 3NDJA 2PGXA 4C07A 4PYIA 2V7EA 3C0KA 3HCCA 4DA4A 4ATNA 2AOTA 3BKWA 3PB3A 3VSEA 1NBHA 3NTVA 4JXJA 2R3SA 5HZMA 3R3HA 2JHPA 1EJ0A 1NV8A 1VE3A 4YV2A 5LQCA 3DLCA 3P9IA 5EVJA 3K0BA 4X41A 1L9KA 2OBFA 3QV2A 4CKEA 3BT7A 1NBIA 2QE6A 5EQJB 1P91A 3LGAA 1UIRA 4WVLA 4HTFB 1BOOA 3E8SA 3NJRA 3GWZA 3UJ7A 2B2CA 4GUAA 3AWIA 3ER9A 3UZUA 4FT4A 3THRA 2PX4A 4POOA 2H11A 2IBSA 2IH5A 3E7PA 3OFKA 5FA5A 3DR5A 4FP9A 5EG5A 3G2OA 5FULA 2AOUB 3DLIA 3Q87B 1NV9A 3R24A 1ORIA 1XDZA 4EMSA 3KHKA 1AF7A 3LECA 5ICEA 2OY0A 2GA9A 1JSZA 3FTDA 4CKCA 1EQAA 4E2WA 1NW5A 2E5WA 3JWIA 5CVJA 2NP6A 3LBFA 3OPNA 5FQNA 1VLMA 1ORHA 4RTSA 1DL5A 1OR8A 4MIKA 5E8RA 3OU7A 3P71T 5FWDA 1VIDA 3HNRA 3M6UA 5EGSA 5E1DA 2Z6AA 2EFJA 4DZRA 4R8SA 1KHHA 2O07A 4GOLD 3CJQA 2O0LA 1M6EX 3LKDA 3A27A 4L7VA 3NVKI 1IY9A 3TKAA 1EJ6A 3PVCA 4RV9A 1T43A 4RVFA 4B17A 5K0GA 3ER8A 4CTKA 1SVUA 5E1OA 4X63A 4EQZA 3PX2A 3UBTA 3GRZA 1JG3A 3EVZA 2AOXA 2A14A 3DP7A 2R6ZA 3KPVA 2P1DA 1XCJA 2ZCJA 1Y8CA 1SQGA 3MGGA 1VPTA 4RTLA 1PRYA 1VBFA 2JJQA 1TPYA 3KR1A 4HTFA 3SVZA 3TMAA 3THSA 4GQBA 1QAQA 4PCAA 5CUQA 1R00A 3KR2A 5CVEA 5CCBA 2AN4A 2IFTA 4M38A 4RTMA 1R6AA 5DRYA 5F2KA 1QANA 3P9KA 5EMLA 5EIFA 3MHTA 3EGVA 5KS2A 1KPGA 4A6EA 5DLYA 3TPZA 4KRGA 3G7UA 4UOEA 2XBMA 1BHJA 4R6WA 3DXZA 4P7JA 3SX0A 1NW3A 4LWPA 2YVLA 3FYCA 1AV6A 3A7DA 2C7QA 4ER3A 4MTLA 4E33A 3KR9A 2OB2A 5CIYA 3HA3A 1F3LA 2ZIEA 2IPXA 3G2QA 3JWJA 5EZSA 2PXXA 2XVAA 5FCDA 2B25A 3DMHA 5FHRA 4QDKA 5E2BA 4IV0A 4BP1A 3TM4A 4X60A 3REOA 5K0BA 3HA5A 1RI5A 5EKUA 5E9QA 4DM3A 4PONA 3EEOA 3ANXA 4YV1A 2VDVE 2QM3A 3BGDA 2QY6A 3CC8A 5DRTA 4DQ0A 1L3IA 4DMGA 4EK9A 1H1DA 4GOND 3KQQA 4PGHA 2BM9A 2GB4A 1INLA 3G5TA 1G8AA 3KKZA 3NVMB 3F4KA 4XCXA 5GOZA 4DCGA 3B3FA 5K03A 3EVDA 2YR0A 2ZWVA 2PXAA
chains in the Genus database with same CATH superfamily
3PDHA 3HYNA 1J2UA 2P2DA 3LX4A 2OCXA 3O8RA 4P3PA 2V6MA 5M7EA 1DJNA 2G1AA 4HQRA 2HMYB 1G6KA 2J6CA 3D8NA 1KL7A 2I1WA 1AKQA 3KP1A 4M0EA 4OBWA 4TT8A 4WI1A 2BAGA 2FF5A 5F51A 1RWWA 2PR2A 2XITA 3LBIA 3UFXA 1E2UA 3L18A 3FOZA 3HM2A 2XCQA 1XFAA 4W8OA 1WOYA 2BBOA 3DDZX 3KLNA 1NQVA 1XCOA 2CLSA 2IE0A 3EF3A 3FCAA 5BSGA 2WFLB 1Q16A 5FUWA 3HCAA 1TYZA 1DCKA 3IMEA 4WCFA 2JD0A 1R6VA 3RU7A 2GZRA 3JW8A 1T29A 4UCFA 3KDAA 3MBOA 3UJHA 4DT1B 1YQUA 1FRQA 4GVXA 4MV9A 2DHDA 3PU6A 4QJIA 3O4RA 1ZITA 2ADOA 2FRVA 3IE0A 4YWJA 3W05A 5LQJA 1CUSA 4DMKA 3M2TA 3WB0A 1UMDB 1DV2A 4ZVRA 2XTNA 1FYDA 3GI1A 3STXA 1P1IA 3H8SA 3LUAA 3Q41A 1NKVA 1YCFA 3KJGA 1I0ZA 3ABIA 3GH3A 4GM0A 2P6MA 4M0MA 4RLHA 4M7RA 1V35A 4REQA 4QJBA 4BJ6A 3PUXA 4P7FA 1PX0A 5REQA 3W4KA 2QR3A 1FDWA 1JA0A 2B9VA 3PHLA 1Q3TA 4MR9B 1EWRA 4WOJA 4XLZA 2XUIA 2VSXA 4NF2A 4TWJA 5IW8A 3RUAA 4EY5A 2QQFA 2NNLD 2ZRCA 1W93A 2B99A 3DCIA 1TCUA 4YACA 4HDQB 4C1BA 3A1VA 1HG1A 2EJTA 1ZM7A 2X8JB 2YTZA 5FTKA 2CLFB 4REOA 2BT4A 2O8NA 3ITDA 4LPKA 3ROMA 4EZBA 3SC2B 3K5HA 4PQGA 3JYQA 1LX7A 2X8WA 4ZCIA 3WK9A 2QTRA 4AP6A 5SV2A 3NM4A 4XWKA 2MSWA 1QGUB 3EXIB 1JKIA 3GQVA 3H7IA 1L5SA 2AFIA 4DDWA 3FOWA 2Q5JA 4ZYWA 3RC3A 2UUOA 1ISPA 1OLSA 1VKOA 3IFSA 3DKVA 3IQWA 4HT3B 1VJGA 1C7JA 3SS8A 2BEKA 2G9VA 3E5MA 3QVWA 1XLWA 3EXFB 4EA7A 1QQTA 2IUSA 3NU1A 1PW7A 3VR1A 3WQHA 3MXTA 5C18A 2WZDA 4U7FA 5AIBA 2JIMA 3PPXA 4LJ5A 4OLJA 1TXGA 2WE8A 1G8GA 5CITA 4F5YA 1AKTA 2FUG6 3DPIA 2B20A 2ON6A 4M0PA 5CFLA 3OZIA 2IH2A 3FMPB 4UUOA 5CJJA 2IEYA 2ACEA 1XEFA 1ZCZA 4ENVA 1G5PA 2I6QA 5F73A 3NWPA 1W75A 1K5DA 5DZSA 4ECEA 4IZOA 4Y6LA 3UGJA 1T6XA 3G9TA 2X15A 2DSTA 1EP3B 3KQUA 1C3XA 3T4UA 3W79A 5ITZB 4HWSA 1PL0A 3MMNA 3CF4A 4EARA 5I7RA 1ILEA 2ZUWA 4D79A 2PE5A 3HGTA 2FOXA 3UC9A 2IU3A 1FF9A 2R2AA 2OV3A 4JELA 1VLHA 2QRHA 4XWGA 3LBHA 1IN1A 3K35A 2OA0A 1V11A 2JAPA 4GG1A 1V9LA 3ADCA 3DL7A 4XQEA 3T1YB 2F55A 4ALKA 2IZ6A 3V8EA 2R6JA 2OZLB 1ZGHA 2F8SA 1N5JA 2WTBA 1F8GA 2X5JO 1CUZA 4PFJA 3SEAA 3WGGA 2NTVA 3HJRA 2B6HA 1ZA1A 4KKXB 1NIJA 4Y2QA 2VRCD 3RLIA 3PHCA 3OO0A 4AO7A 3G2IA 3Q9UA 4X20B 1SUPA 2CMHA 4AG5A 5HM8A 3L6UA 3RJ9A 2O8FA 2IOFA 3UWPA 4CIWA 2B8NA 5L3SB 1NI3A 3O2JA 1VRVA 2M98A 3H6GA 3O8LA 4OKSA 3T9FA 4EG0A 3TF5A 4W7SA 2EZ8A 3OJXA 2QHXA 1E63A 1PSDA 3C6ZA 3GCXA 4W7IA 4CLRB 1PJ3A 4EH1A 4F4FA 3DJFA 4IMIB 1Z8FA 4G4JA 5I7UA 5F5LA 2HCTA 4R7TA 5BQ5A 3R9WA 5FIUA 5FFNA 4E2ZA 3M3PA 2M6RA 1EDEA 3GL9A 3CF6R 1C8KA 3FIUA 5J5VA 1UZMA 2WF5A 2Y6UA 3P20A 3QWFA 3I42A 5EIHA 4BB9A 2FW0A 2WC1A 2M6LA 2H57A 3A06A 1K86A 5DEOA 5T6MA 3T52A 1S2IA 3IKMB 4A0QA 3HZHA 3B12A 1PVDA 2CLIB 4BQOA 2FR0A 4BO5A 5LBTA 4C4SA 1Q3KA 1WXIA 2I2WA 2WUDA 4G89A 2IU6A 4QPZA 2YYAA 2QVZX 1Y1RA 5LMNB 1U2GA 3A3OA 3SNHA 1Q11A 4HDNA 4L4ZA 4R2KA 1XF9A 2EFDB 1R9MA 1R9GA 3PTZA 1QH0A 4FFNA 1JT2A 5LZ8A 3E4CA 2IELA 3VDQA 3H1FA 4PPFA 3UJ6A 2JD1A 2WOOA 4TMKA 5DNEA 5IC5A 3MLBA 1PQYA 4W6QA 4C89A 1G6Q1 3F4LA 4DIEA 3SC4A 3ET4A 2FR8C 2F9FA 4FNOA 2QUKA 4A6XA 1YMQA 3AXTA 4WOBA 5K5EA 3WO0A 1HTTA 1S9DA 3QEMA 1DKPA 1PL8A 1T6ZA 3HRHA 4JC4A 4DNFA 2C54A 3JSXA 1B74A 5AQEA 1VJTA 2PMBA 2QTVB 1E1YA 4M87A 2RK6A 4CEJA 3EMBA 4DQLA 1UBJS 3KXPA 2RHTA 4IY1A 4JBHA 4MGIR 4L16A 2QSUA 4QPCA 1MG5A 3LAWA 3EW9A 5D01A 2PLNA 5CFQA 1Q1EA 2GK4A 1OIXA 2QTZA 3MUFA 1WB6A 5HFAA 3ZHSA 3ILVA 2WJAA 4Z99A 1SR8A 1J2JA 1K3UB 3N2IA 1JZTA 1RYEA 2NV0A 1ZESA 2HIAA 4NZMA 1J1ZA 4ZEXA 3QVOA 3W5VA 2YJNA 5HJ5A 3JD3A 3LQFA 5GIPE 2OWEA 1N2ZA 2Z8YA 4NBUA 1X1DA 1T2VA 3G8BA 1BDHA 2CLKB 1I1NA 2YWXA 3T95A 3OEED 8OHMA 4LFCB 1Y48E 3UB3A 1ZH0A 1ZOSA 2ZUSA 4PC6A 3R0JA 2A0FA 2I0FA 3DV0B 3O9ZA 4X6UA 3H13A 3PNSA 3HSSA 5CVCA 5K51A 3R7NA 2Y3IA 5JLJA 5EZQA 1ORVA 2KPOA 2JGAA 3OQ1A 3ERCA 1JEQA 2HHLA 3TWOA 4EGJA 2I6SA 2JI6A 4I4TB 2XE4A 2JCXA 1O9GA 1KQGA 3V6LA 1GCGA 3IVMA 1C29B 2V9CA 4Q4LA 3V7FA 4W8HA 3GJ3A 1P5FA 2EXXA 3JZMA 1GUYA 1JQBA 2ZTVA 2K2QB 1D6MA 2GHIA 1UBEA 2DR3A 3AG6A 1WVIA 3TQSA 4BQQA 5EE9A 3HL0A 2YV3A 1ONNA 4G8CA 2J3HA 3O73A 2CWWA 3EBPA 3BXGA 4RGYA 3M6LA 1BRMA 2UUPA 5D1NA 1X94A 4QULA 4RA6B 2NZWA 5IDXA 4RMIA 1SG6A 1DIBA 2R87A 3E1GA 4UCQA 5T4BA 4DG8A 1GNPA 1XVTA 2BEWA 2F1KA 4ZCMA 5IUNC 1KZ9A 3RVBA 4D8VA 1Z12A 2B8WA 3IKLA 1JHRA 3GEGA 2A86A 1TD1A 2JLWA 4FEAA 4BO8A 4JLVA 1BH2A 1JG1A 3SF8A 3T5MA 1B43A 3NI2A 4LDZA 4R9NA 3RWOA 3SIRA 4E2XA 1QP4A 1ZJYA 4YBRA 1NUUA 2G09A 4E70A 2XUGA 2AR0A 3RVMA 4RF4A 2LW7A 1ZWKA 3AU8A 1MXFA 3QSGA 3ZLTA 2XXAB 3P5BA 2GZHA 2V45A 4S05A 1CUUA 1JIIA 3KU4A 1XA4A 1ZRNA 2Z57A 3UPDA 3V32A 1C3VA 3ESCA 5BT8A 1MJGA 2O3SA 1TKCA 1KZ7B 3LSYA 2BCEA 1J09A 1LW6E 1L4YA 2XQJA 3EZ7A 1JSXA 4JITA 2WVHA 1O5TA 4JQZA 1NUTA 3M6WA 3ZJTA 2RB4A 3Q1LA 1N2HA 3L1JA 4R1MA 6PFKA 5KX5F 1W52X 1YS9A 2YJ4A 4KACA 1KDVA 5B64A 3ASVA 1KH3A 1JDZA 1DRKA 3PD7A 4AZVA 7MHTA 1ZCBA 2VH1A 3F7TA 5IRCD 3RVOA 2Q5IA 4D2IA 3DYIA 2UZAA 4AZ0A 2KLHA 4PNZA 1JXMA 4C0WA 3GCZA 4EEZA 3DBHB 1VLJA 4DIDA 1ZICA 2QUIA 3CLTD 3DKKA 2XCTB 1GN9A 1XF1A 4M9CA 3I3SR 4DUGA 4PG8A 1GNLA 3DGFC 2YVUA 4JUIA 2HZBA 3RF7A 3VZRA 3GX1A 2FFQA 5IUKC 3RVQA 5JCXA 3NKLA 1JH9A 2WWWA 4YAWA 3W78A 4NKRA 4QEKA 4A7PA 4AYTA 1K9VF 1NNSA 3GFFA 1BWQA 2ATIA 2LIPA 1ML4A 1HQYE 1G41A 2AMVA 4ALIA 4J0EA 4Y18A 1P17A 4ADSG 1H22A 1SD2A 3C7KA 3RVKA 1C9JA 2EGUA 4ASUA 5BWMA 1ECJA 3OPYA 4QLOA 4ZCRA 1E7QA 4MUMA 3EC2A 3EA5A 4II7A 3BHIA 4WQMA 3WBJA 1Y9AA 4JQSA 4P0PB 3U17A 2YY5A 4QDOA 2YC2C 4M36A 3QU9A 1YJXA 5DCUA 1BCRB 1GG2A 3RG8A 1ZG3A 4BQEA 2ZEJA 1I94B 1AF4A 2LXNA 4XASA 3SFTA 1RJWA 2G4CA 1BD4A 1RJFA 4RNCA 2Z3WA 3A8TA 3HKBA 3K2IA 1R0BA 3FW1A 1QRDA 1DC3A 1EGVB 1EVQA 2F3RA 4ZOLF 3SKXA 3WK8A 5DYGA 1P2SA 4DCPA 4DXHA 3RYIB 4HXFB 3NAZA 3PR3A 4INJA 5EHGA 2PX2A 3WI7A 5D3QA 5ALYA 4R8MA 3RHZA 3QLTA 3WGHA 1OT5A 3AEQB 2ZQYA 3RS7A 3WIUA 4U2BA 5EJ2A 1TFUA 1XAIA 2CT8A 3L7MA 3H83A 4UHBA 1E0SA 3CZ4A 3N6VA 1WS6A 4LSMA 1T13A 5EZ6B 3DZIA 4ND6A 1E6MA 3EDMA 4R51A 2YFHA 3AJEA 1D4ZA 3HVHA 4JT2A 3B1YA 3VU0A 3ZWAA 4R8RA 4Z1MD 4J49A 1G19A 2HK6A 4AM8A 4BV8A 4F3NA 3FWHA 2QUHA 3MTAA 1E64A 1MR3F 3VU9A 4JOCA 3M6FA 1SO8A 3KJFA 4Q48A 3UAWA 4ATNA 3BKWA 2HMVA 4DJEC 5CBPA 1GGKA 5LA6B 2VZLA 1QHSA 1XN4A 5CXXA 1P9WA 3GJ7A 3UV3A 2EFGA 1QHXA 2HQ1A 3JQ9C 4BP9A 4G3XA 3MPUA 1B26A 1FJ2A 3GQBA 2GR9A 1RHMA 2A9RA 5J59A 2ZBEA 2JLYA 1YXMA 3ANYB 1R12A 1XRJA 3UJ7A 1V16B 1KARA 1KERA 3EJWA 4FZRA 1HX7A 2FH5B 2QMEA 2CYAA 4CMEA 1ZNWA 2H2AA 2AG8A 3NNDA 3PGKA 2ONCA 3M9LA 4JWTA 4LHVA 1N2SA 1ZUNB 2JNWA 4A8TA 1N8NA 4EFKA 2A35A 2P9FA 2YVAA 1P8AA 3FPSA 3ENQA 3KZ1E 4P86A 2GSDA 4G09A 3CLUC 1W85B 4LK3A 2QSZA 3TEJA 4CGZA 1DKUA 4B84A 1IAVA 5GJVC 1NNUA 1DL5A 2PX3A 3COZA 4CF6A 2JDID 2FXIA 3LTEA 5DKFA 1GRVA 1N6PA 2V8OA 3B6KA 4KAAA 1GUDA 2FKAA 3CISA 1T6YA 4LHYA 1HL7A 1SOMA 4R8SA 2QZ4A 2ZPUA 3EMVA 4ZPXA 1JU3A 4IGAA 3ZDDA 2X4IA 3KEFA 4MGZR 1V5EA 2R1UA 2RDMA 2Q9UA 1FX0B 1RQXA 2EZTA 3IP8A 4JA2A 4Q7KA 3V2GA 3PGVA 2OILA 4D6YA 4EELA 1PSZA 3DBRA 1XBTA 1EG7A 1PK9A 2W4IA 4X63A 3TNJA 4CV2A 5BSKA 1E4OA 3IE1A 3WGKA 4KFSA 3T1HB 1CD5A 1EP1B 1LKZA 1ATZA 2A5YB 3LUJA 1SQGA 1R9NA 3TD9A 1E69A 1OH8A 1WPXA 1TKRA 3ZH9B 1A7UA 2AXEA 3D3JA 3FX2A 4KVAA 1GT91 2XF8A 3SR3A 1XNJA 2X58A 4NEGA 3P9XA 1HE3A 3FNBA 1DI0A 4KEAA 3BBPA 3RARA 4MICA 4CBVA 3PXGA 4F3KA 1EWKA 1XGKA 2WWIA 3DE5X 4BGIA 5EIFA 3O1LA 1IMJA 4NNJA 3VR3A 3QKRA 4PR0A 4DA9A 4EJ6A 2QLJA 1AN0A 1B0ZA 2GD6A 1HI9A 4XD7A 3NS7A 3ZCTA 4UOEA 2IOFK 2G1KA 2V54A 4D4LA 1AKUA 3O8CA 1ZL2A 5KYNA 3I2IA 2OB2A 3CRW1 1WEHA 2E0IA 3EIOA 3OA2A 1M2NA 2VBCA 2H2FA 4PLGA 4W99A 1NYTA 1U98A 1BH6A 2QS9A 3EODA 3WGUA 1G8FA 3CR7A 4IX1A 4FLEA 2WWXA 4NTZA 4E6PA 2COUA 4MQ6A 2Q5CA 3EXEB 1ZRHA 3OM1A 4DR6B 2VI5A 2BEVB 2I3DA 4DS3A 3G13A 1K6EA 3DDNA 3HJCA 2IW1A 3RFVA 2XVXA 5ER9A 1PFQA 2EIXA 5TX7A 5KTMA 4XJTA 3PQCA 5MF6A 4PAGA 2P2CA 4B1FA 3LHFA 5KNDH 5AT1A 1KBQA 3EK2A 3GN1A 5I4IA 2ZWVA 3RSGA 3IILA 4LJ7A 1K7YA 1YRBA 4KLNA 2CXNA 1DTWB 1KPHA 2IPLA 1ANKA 1IEXA 1OY1A 1E99A 3LX6A 4W1PA 4ZT4A 3ZWCA 5GADl 2IYVA 4ZV7A 3FUTA 1NVEA 4OI4A 3A0RB 1OC2A 3GLGA 3HZRA 2ZJ3A 2H65A 3WRWA 1HC7A 1Y5MA 3C3PA 4Z7NB 1Q0TA 3CTPA 4RMHA 4ESHA 3FWPA 2AE1A 5DO9A 1IJBA 3CYFA 2EZUA 1UBTS 3S2SA 1BROA 3FR8A 4BMYA 4RTPA 4HAZA 1IULA 4B3TB 4PPYA 4X6YA 4XPIB 5AVOA 5KVCA 3WHKA 4NP6A 5TGZA 3ZZMA 5FWNA 1PFYA 2ODPA 3CX3A 3V1YA 3NP7A 3SBXA 4HBZA 2ZJBA 4R84A 2RGDA 2BGKA 3UMBA 4JI2B 5C8YF 3OWOA 4S24A 4Z0NA 4KWEA 5L3RA 2H5IA 1RQGA 3UHPA 1E1RD 3D31A 1XV5A 5T41A 3WQRA 3VNRA 4MA5A 2IEGA 2QMUA 1A5BB 3E82A 1BXGA 4C43A 3R74A 5C35A 3KQMA 3JV7A 4GI7A 1H2BA 1SCBA 1U8UA 1YAJA 3R7SA 4X65B 4E11A 4UQOA 4YO7A 1FTGA 1P2VA 1N5DA 5DE3A 3W9YA 2O4CA 4X8MA 3C6QA 4NFSA 5EUMA 3WYEA 4BMSA 4DCCA 4L5JA 3FSEA 3S2ZA 5L8VA 3Q8MA 4L0DA 4RCVA 1IJEA 4UM9D 1O9HA 5DBIA 1GR1A 3NHBA 1Z82A 2W42A 3WNZA 3IYLW 4I3GA 4NMHA 4REQB 5LWQA 4S2EA 3M9XA 4PLFA 4QEZA 3B5JA 1OKKD 4Y30A 1TM2A 4RPCA 4Z2AA 2XOXA 4RZ3A 1I30A 2C77A 5DNYB 5BMOA 3RC2A 5BPHA 1HSZA 3K70B 3NBXX 4KDEA 5HF5A 1JX6A 2VJOA 3F0TA 1MNQA 1ECLA 2PX8A 2ZXEA 4QNRA 2MOKA 3BUSA 4MRAA 4LTNA 5DLEA 3HB5X 1OH6A 4PVCA 1R5JA 2G1UA 4C3VA 1QZ3A 3I2FA 1VFNA 5IJ0B 3OZGA 3GP5A 3MCAA 3WNDA 2ZVQX 5E9JA 3A9RA 2FUCA 3OLVA 4UNPA 2PDAA 4UHDA 2ZE6A 3BHJA 1EDOA 3BFXA 3EDOA 3SYLA 3OICA 4AKTA 2Q3JA 4Z53A 1PS9A 1Q15A 3FKJA 4YP9A 3R40A 2AEMA 3D81A 3VYTB 5F9MA 3I0ZA 3AKCA 3CE9A 2IDJA 2VUHB 3K8OE 3R75A 2PX6A 3VOSA 3U60B 2R85A 2C83A 3UUFA 3JQ7A 4R2JA 1IXRC 1TO1E 2C31A 1J0DA 3QLUC 1KEVA 1N6RA 3WNCA 3ZWKA 2HK7A 4XLLA 3L0YA 2Q3DA 3AI3A 2V7VA 3F71A 1NQUA 5HOQA 1U4OA 4WXEA 4MS3A 2YWCA 4W5JA 3HXTA 1CR4A 4MIEA 3K53A 1EUQA 1O3YA 3I62A 1AQJA 4EECA 2ZREA 5IS2A 3C14C 3ESBA 2YQ5A 3O74A 1JBQA 5K6AA 2BMWA 3WYNA 2YCLA 5I45A 1QMGA 4EUNA 3HTXA 1I5EA 2OORC 4XWAA 1M83A 4XIFA 2WHEA 4DXAA 3OCYA 2F1OA 3BQNB 3HFRA 1JTEA 3IUQA 4N54A 3C1AA 3AILA 4Q9IA 3V4SA 2N9UA 3IJEB 4S3MA 3G2NA 1DQPA 2AFHA 4KJXA 1ZRMA 2HPVA 4RLFA 3M1AA 5A04A 1QRTA 2AV6A 4D82A 2QYOA 1N2CA 1L1RA 3PNMA 4MMXB 5TC4A 1E6KA 1ZZGA 3H6HA 1SG9A 4BJ5A 4YRZA 2OKGA 1J5XA 3SICE 4HXYA 1I2AA 3R5JA 2ZRAA 4YJ2F 5CB4B 4NH0A 5JZ9A 1M2VA 2XRZA 5A4JA 3IR6A 5DBOA 1XD2B 2HV8A 2PGNA 2VOJA 4M60A 1G20A 4TRNA 2JZNA 2BE7A 4W5HA 4KI7A 4TLEA 2BM8A 1CUFA 1ZUWA 4BFCA 4D41A 4HDMB 4KZKA 1OV4A 5L45A 2X8AA 4MYHA 2OCDA 4G0VA 3OKFA 1Z6TA 4XUCA 4ARVA 1VYVA 5IZCC 1SXPA 1KO5A 2GASA 2AVNA 2W2NA 3NIBA 1SKYE 3A1UA 5JOQA 3OQOA 4I9HA 4XPIA 1JQ3A 2YOHA 3H3JA 2ZYGA 4FFVA 3CFYA 5GONB 4D0SA 4IL5A 4JI8B 1Z5WA 1ZJZA 1U6JA 1CJVC 3G59A 4PLVA 1UKCA 3NBAA 5IBQA 2ASEA 4TLMB 1Z5VA 1OGYA 2OKCA 3HZOA 3JD1A 1E2FA 4A6PA 3IDOA 1XKTA 2VFAA 2NAPA 2PUTA 3IDSA 2G17A 5EPEA 2D4HA 4IO0A 3SVTA 1NVBA 1QFYA 4HLQB 4B3CA 2JHGA 1YR6A 1Y9JA 4E5MA 3IMCA 4OQZA 4MARA 4RPGA 4D92A 1Y3AA 2FHPA 2XA2A 4UHFA 2YS7A 4MR8A 4AMUA 4NDNE 1HY3A 1H6AA 1YS1X 3HMQA 3O9VA 5COAA 1XDBA 5TXGA 2FX2A 4CMCA 1TEZA 4XDYA 3F3YA 1DC4A 4I99A 1CUEA 4GU5A 5D1HA 3SXJA 4BS9A 2WJ4A 2CFIA 2POQX 2Z4SA 4DQXA 1UMKA 2D59A 3OUTA 5I7FA 1E9RA 2Y1WA 2XXAA 1NVAA 1YR9A 3VU8A 4DSNA 3VDNB 1D2MA 2FP4A 3P0HA 4JZKA 4D98A 2IGTA 3PEEA 4BFXA 1ELOA 1YB2A 2AN5A 3MNFA 5ILQA 4GMKA 2O2HA 5CHYA 2IHYA 4BB6A 4MLCA 2PRKA 2IIBA 5F2NA 2IXDA 1Q0HA 4HDSA 4TSFA 4A15A 4UNIA 1E8DA 2ICAA 1N7JA 3TR6A 4BBPA 1VLQA 1WL8A 1Q7TA 4G97A 1D3AA 4O4HB 5K0BA 1NZDA 4KQCA 3PLNA 3KXKA 5H59A 2H1WA 1RXWA 5BR8B 1JSCA 5F98A 1X1BA 1OFUX 4OGKA 5IXYA 4BL5A 1CJTC 2KW5A 1HE4A 1P2TA 2AFIB 2B7BA 4JL6A 3TLXA 5KYYB 3IBSA 1Z8DA 1P74A 2GBIA 3E15A 3T7CA 3K73O 1MP0A 4MZDA 1SCIA 4W6ZA 3ZI0A 5AFSA 3B8EA 2BGUA 3T3GA 1II8B 2ZRFA 2H2GA 2W2QA 5AKEA 5AOBA 3HXQA 2XMGA 4NBVA 2XT9A 1OPRA 1RBQA 2WIKA 4RHFA 1U0HC 4HRVA 4ZFNA 4PGAA 4QYIA 5E1MA 1SURA 1W19A 3A9WA 1U02A 2ZRMA 1OA0A 3S7ZA 4UBMA 5FBKA 1QHIA 1E3MA 3FGZA 3KEMA 4K2AA 1EB9A 1TRHA 4I1RA 4O4LB 4OQYA 1KH1A 1Y3IA 4K6OA 5KTYA 3V7NA 2Z6QA 3FCEA 4F97A 5CA0A 2E5LB 1ZP6A 3KT0A 4JBXA 4IDBA 2XVZA 3JVDA 2R6R1 3G0IA 4MJ3A 1N2GA 5HIJA 2VK2A 2XRFA 1PJTA 4K6HA 3UOWA 1V0JA 2ZUDA 2EG9A 2VUIB 3TI7A 3HKBB 1CVIA 4L50A 4ZVNA 2D13A 2WKWA 1A2OA 2EW8A 1CWUA 1KIFA 5AVXA 4EOGA 2W2KA 1P0CA 4ZGWA 1JRLA 2AMLA 1SVMA 2K7FA 3ACCA 4B7AA 3AM3A 3IOCA 4YJFB 1Y0BA 1W0KA 3DWFA 4YI5A 5H68A 3I4LA 1VPVA 4FW9A 2JS7A 4Q7MB 3W5IA 4QM6A 1KK0A 2EFEB 3HBAA 2YZ7A 4IQFA 2H17A 2XNSA 5BV7A 2HSZA 1XMVA 1DPGA 1KC3A 1QKKA 3DAOA 4BBZA 1RMYA 2GNOA 1W0JA 1PR6A 3ZE8A 5DWVA 1CFJA 2XJ4A 1C9NA 1MIHA 5EE5B 1NMQA 1MA3A 4QDJA 4FGWA 3UT5B 1X7XB 2C7GA 2JPDA 1T0HB 4LHSA 3PC7A 4ZQHA 4AB1A 1RVDA 3B8HA 2XVYA 2LZ0A 3KB1A 1PR2A 1ADCA 4F4IA 2MT9A 3ETEA 3GHHA 4UAUA 1X1RA 1FC0A 2WJHA 1EEXB 4YCBA 4AUNA 3INYA 1WXHA 5AXCA 1MPXA 3CPJB 3IB6A 3OPMA 5BSTA 3RYFB 2REOA 1K6MA 4J4BA 4X44A 2IHVA 4C5BA 2XI4A 1WTCA 3ZDZB 1FSFA 3LY5A 4X8LA 3VH2A 4BAGA 2XTZA 5KOHA 2CW5A 4NZNA 1E1CA 3OCJA 4L5IA 3MRVA 2GWHA 3LUGA 3C3AA 1IN8A 3ND7A 4X6LA 1OF1A 3PWSA 3B36A 1U2SA 3TNYA 3I05A 2C8VA 3VNBA 4PFQA 1I6KA 5EVCA 2P30A 4G1CA 3SZUA 4ZI7B 2EJCA 1M75A 5AW9A 3FYUC 2HTFA 4GOXA 3BVPA 4LY9A 1S1CA 1NI5A 5AOAA 3DLAA 3T94A 3NTUA 3J81k 3AY0A 4W5RA 4IDEA 1I2CA 1SQ5A 3A4NA 5G3ZA 3QIAA 5C51B 4GDFA 1S2GA 3NYQA 4DMHA 5CDSA 1UMBB 2H3EA 2PFGA 2XTJA 1KZ1A 2XMPA 2HV9A 3ONVA 2UVPB 2JBAB 3TQCA 4JR1A 4FEGA 2QN8A 1Z6YA 2VNIA 2OQIA 1SBTA 1SZJG 4R01A 2ZVPX 5T67A 3NV7A 3R9XB 4DMLA 3FYHA 4UD2A 1B6TA 1YU6A 5KTOA 4TQUS 4A8JA 4OUDA 3PDJA 1Z2DA 2CXQA 3J81A 3L93A 4J16C 1EM8A 1XAGA 5HJ2A 3WL5A 4QVGA 2FE1A 1GIAA 4WY8A 5ABPA 3GUHA 3DOIA 1MCZA 1KEEA 3K6SA 3PFIA 4JQOA 1IQUA 1RBMA 1RYDA 3HABA 4FC7A 5AMXA 1BIFA 3ABOB 4RIFA 4RZUA 5JAQA 1CXZA 5IM4A 1NW9B 3LPNA 4ZP1A 1JEDA 5CYOA 3D4LA 3WL4A 2OT3B 4LZZA 2DLDA 1E1DA 2KSQA 4JC8A 2CV1A 2GD0A 3ENNA 3RKSA 3PB3A 4HWOA 3SX4A 5ICSA 1NYRA 1KFJB 1OTYA 3L49A 1BXKA 1VE3A 5CU7A 4FKBA 2UVQA 3DLCA 3P9IA 1B2RA 2YV4A 5FR1A 1NOJA 2ZSBA 5JIBA 2OAQ1 4LF9B 3EXEA 4HTFB 1M1YA 3BQMB 1R5BA 3RK0A 5B6JA 1J0XO 3F5QA 4YJ2A 3THRA 1YUNA 3FSJX 3BN3A 3PYLA 4LIPD 5JPIA 5FA5A 1P2FA 4P54A 3RJMA 2HHCA 5FULA 1EDDA 3LBAA 4M1KA 4Q1FA 1F8UA 1ENZA 2V7QD 3GJ5A 4UATA 3VI4B 2WDPA 4QUHA 3G9QA 3O47A 2ZRJA 5BNZA 4MJLA 3W6PA 1QO0A 4QHSA 4XOIA 4IDOA 2SCUA 3PSHA 4QBGB 3ZPXA 4NJMA 1JEAA 2D1SA 1JDBB 1WO8A 2D1RA 3H18A 4ZOBA 4CMIB 5JTUA 4D4JA 3MBIA 1GZ6A 2CJXA 2UZIR 4PF1A 5EGSA 4ARUA 4TUYA 3THXB 1Y3HA 4P5EA 1AO3A 5BWOA 2P0AA 5ALWA 3OX1A 3HUEA 1E8NA 3GJ6A 3WKAA 3D54D 4BLTA 3JD0A 3LWNA 3PCTA 3C16C 4B17A 4E88A 4YRMA 5TV2A 1BQ3A 4JY7A 5E1OA 4RQUA 2VRWA 4B3IA 2SECE 1OJLA 2CBGA 3AM5A 3D0QA 1YZQA 3LT4A 1J4AA 2QI9C 1RAGA 3MSCA 3QNMA 2C57A 521PA 4YT2A 5JAIA 1LDBA 1CEQA 3AF0A 4GKAA 3LZCA 2EVWX 4LRXA 4O1HA 4YP1A 3U9TA 2GN6A 3WLLA 4EI7A 4YCSA 5A3JA 5C7OO 3AUKA 4CM7A 1G8PA 1PLKA 2FR1A 5IYZA 1MABA 3BHMA 3OX4A 3O90A 1IHDA 1OFGA 2C9CA 2N0SA 4G0YA 2YFKA 4GLBA 1H8HA 3F78A 4ARAA 1IBRA 4HEJA 3H65A 2ZXUA 1JBKA 3BDIA 3K3PA 4BN5A 4I50F 4LOJA 4PCUA 3TKLA 1TEHA 3PQEA 1JNXX 1PJQA 3JZFA 1XRNA 5K9ZA 4A6EA 2LPMA 1EHIA 1XVLA 3K9CA 4BNNA 5JCOA 2WUWE 3S2IA 4RF2A 4WZAA 5IKPA 3EDRA 2NACA 3PGLA 1JYFA 3DT8A 4LHZA 1V6AA 1E2HA 1SY7A 2YXPX 2W6QA 3H4IA 5FR2A 5KWVA 2XUQA 4OMDA 1LQ2A 2W8ZA 1Z0JA 1N3LA 3OTQA 1GSOA 3E3NA 5FHRA 5H83A 4CF7A 4B8ZA 4CMJA 3EPKA 1ONPA 1JHVA 3HU1A 1S6YA 1T36B 1L4KA 1LZLA 1RI5A 1SQ0A 1LJLA 3B60A 3RBVA 3UK1A 4IEFB 1WXEA 3T3EA 2JZCA 5LOVB 1NY6A 1A69A 4XGQA 4E5NA 3DVQX 1K7SN 2AW5A 3BMOB 1FNBA 3GZ4A 4DNPA 2I8LA 2R8PA 4PGHA 2A3NA 2BM9A 4MO2A 4CU2A 3EG5A 2GXSA 5CXSA 3OF5A 4YDQA 3KV3O 1QCZA 2FCRA 2YV5A 4DG5A 1IIBA 4YCNA 2WUFA 3L0DA 3PE3A 4WGGA 3GLUA 4B5KA 5I3ZA 4JGIA 4D9IA 2C2BA 5SY4A 4C5CA 2WTAA 4EMTA 5I3CA 5BVHB 2RIRA 5DNVA 2WUVA 2B69A 3DZDA 4DSUA 5AI5A 5C8YB 1YB7A 1GTRA 3IAM6 5DASA 3JPYA 1M74A 5BW8A 1J5PA 3IH5A 3E9QA 5FLYA 1GPDG 3E9MA 3I6BA 2QPAA 4DYHA 2W90A 4L0CA 4O2AF 4WXMA 3S5JA 2O8VA 4TKZA 1MF7A 3RPEA 5B7QA 1RC0A 2RHMA 3ICWA 5TE9A 2QAGC 4HNHA 5LQAA 4LF6B 1LPMA 1NXOA 1GYQA 2IUTA 3G2PA 2NZ2A 1EWYA 4KWIA 2VT7A 4JEIA 3S99A 2CFTA 2VSNA 1NSYA 2Y0CA 2ZJOA 5JASA 1TLTA 2DQSA 3U7JA 4WADA 4YUWA 1KR5A 1NXVA 4CLOA 3ZDFA 1XTQA 2JHCA 2ZTUA 3VU9B 4A92A 4EBBA 3WAGA 3IMFA 3I8SA 2GJAA 4O1MA 3DFUA 1U8EA 4GRDA 4K2HA 4FFOA 4FQ7A 3U4AA 4DDVA 1OGIA 2I4IA 3O1JC 3WGVA 1SULA 2Z83A 5TEWA 3E9EA 2O3TA 2BEVA 4O3FA 1AHIA 2CB9A 2ZBQA 4MVJI 4B8WA 4GF5A 1UKEA 2P65A 4K9RA 3KPWA 1PTJC 4YJHB 5TMBA 1D8TA 1N0WA 3GT3A 1DAGA 4P08A 2IDKA 3I2JA 2ORYA 4PTYA 1R0RE 1GCAA 1HUQA 1R8XA 1SJ9A 2QV7A 3B1VA 4QQNA 4D97A 4F8YA 3N0XA 3UO8B 4KUEA 1RJGA 1GARA 3PQ2A 4KBGA 4WACA 4X7MA 5FUBA 1SCJA 1E3WA 1IFXA 3DV2A 4MUNA 2ZBVA 4Q5IA 1NR5A 3A9UA 4RX1A 3WSTA 3ZVLA 1UDAA 3KB8A 2XQKA 4MDHA 4D4GA 4RY9A 2OPHA 4FM9A 2XMDA 2Q4OA 1X6VA 2VBFA 3I2KA 2GHRA 1P4GA 2D0PB 1FQKA 1W44A 2WT4A 1KVUA 3PCXA 1YE8A 4B6FA 1MO5A 1FLVA 1X7GA 1T2AA 2HRDA 2HXYA 2OO3A 3CZAA 2ZIFA 1LDEA 1Z4MA 8LDHA 1XWWA 1WPRA 5C32A 1PGJA 2I7VA 1T9HA 2A84A 2EOAA 4QG3A 3FUVA 5DWQA 3I01M 2EKDA 5FOTA 1Y6GA 1NJ5A 2RE8A 1NBAA 2C5FA 1DWUA 3H16A 5HKBA 4ZCPA 3LUDA 1JPVA 3DOUA 3LFHA 1SHZA 4HRAA 4R2MA 4Y9UA 3GVPA 3WMWA 1EVLA 1UT8A 2P79A 1UJ5A 4UTXA 2IIVA 2R8XA 2JLSA 2JLZA 1KKUA 2EEZA 2RBGA 3OJ0A 3KWLA 2WV7A 1IHXA 5DOVA 1ADGA 1GKYA 1U9JA 1JIJA 4ZA2A 2WIDA 3PPVA 1HT1E 1QPGA 3V8QA 2ISQA 3I9V1 3N3AC 4LMPA 5IFLA 2LD4A 1KI7A 5IAOA 1ZVVA 4A4DA 5IVDA 1AVTA 1QOZA 1X7ZA 4HFNA 2C59A 3FDZA 3G3EA 4HGPA 4I6EA 4RH3A 1VYUA 1FXWF 4AX4A 2CXUA 5F33A 2C2WA 3G89A 4OK6A 3E3LA 3GJQA 1XK7A 5CX1B 4BFUA 3FPCA 5D86A 1XAJA 3VR2D 3X2EA 3VR6D 3ZZTA 1KMHA 5JZSA 1MAUA 1KJNA 1GPH1 3G0CA 4C9BA 6REQA 5LOVA 3X0DA 4YFYA 1SU6A 2JBWA 3S81A 1YF3A 1Z37A 3VKFA 4EHJA 4PSCA 4AD8A 3VKHA 1KOGA 2H8KA 2C9OA 2FEWB 2WJZB 2GPNA 2ZSKA 5INTA 4ICIA 1GZ4A 1WUJS 2OZVA 1E6CA 4TKMA 4X8OA 1OA1A 3WLMA 2AFHB 3GFVA 4LOKA 3Q10A 5K0JA 2XWJI 3JVUA 3QUQA 1PV4A 3IEUA 4IGIA 4RVHA 3FPLA 4IJMA 2RAUA 3L4BC 1T3HA 1XZQA 1QYRA 2IXFA 2P2SA 3FFXA 3TKYA 4CCWA 1NSFA 1OZ0A 4J7CA 1FYFA 1UZNA 2JFPA 2YDYA 3AKYA 3H1PA 4MRNA 3LY8A 1AH2A 4YP7A 5IM4F 3TSZA 4MWBA 5AR1A 1E4EA 4FFRA 4X3OA 1KKMA 2JCYA 2EG5A 3CUTA 3I6ZA 5G0WA 4UQLA 5J47A 5DIZA 2OCKA 1WABA 2ZT7A 4LZWA 1T9CA 1CRWG 1EFUA 1M6NA 1DLJA 3OCVA 2OCYC 3FKSA 2YDXA 4F93B 4FW8A 3STYA 4Z6KA 1C0IA 1UPFA 2D54A 2VCYA 2C95A 3FF4A 3KPUA 2BKLA 2IRWA 3PL5A 4WH0A 3OE7D 1P4SA 3SLKA 4JYCA 3S2YA 3R3UA 4CKBB 5JBIA 5KYXB 1F20A 5AXAA 4C20A 1BVYF 3VYVA 2QUBA 3MS4A 3WV4A 1AZWA 1KYTA 1N75A 2JK0A 2PVPA 1GTMA 5SYNA 5F1OA 3JTMA 4KODA 1V47A 3WYCA 3NHSA 2G77B 4FFDA 3W5AA 4OOEA 2G71A 1X0XA 3UW1A 1RYHA 1V7QA 2BMEA 3I52A 2BTEA 2KWIA 5GVSA 3IT2A 1VKZA 3OESA 1E0KA 5KYUA 1JKMA 3PKZA 3QYJA 3LKZA 2Y2VA 1BEEA 5B5SA 3HO1A 4F9FA 1JA1A 1PJ8A 2X8BA 4J7UA 3ZE7A 4X20A 5FBWB 2EC5A 4GE3A 3SKYA 1JLRA 3HJNA 1GAEO 4RHXA 3B1KA 2ZJ4A 2QTHA 4ZXFA 2VDLB 2VHEA 1AMUA 3JWPA 4MQLA 1JA9A 1GUFA 1XA3A 1YRQA 4RWZA 4U7WA 4AWAA 1VLZA 3QFFA 2Z6VA 2H2HA 1L7DA 1F8XA 3HV0A 1MOPA 6CHYA 2TMDA 4V1CA 3T34A 5GIOE 4LKOA 4Q9LA 2W6ZA 1XJ5A 1PZEA 5EPUA 3R7AA 4RJTA 4P93A 4TV9F 3VSCA 1P6UA 3SNKA 4ZPJA 4C0SA 2I8AA 3KRTA 1ZNZA 3NCHA 3MB5A 4OYYA 4WASA 5E2AA 3UMYA 2NYVA 1YRHA 2D5BA 3TZLA 2QQEA 3Q7EA 1FRVA 1DFGA 3ET5A 3PXCX 3UKOA 2Q1WA 3ONNA 4UFPA 4XWOA 5IZ4A 1CJSA 4R2LA 3VVLA 5A9RA 1TKBA 5LR6A 4IBOA 3EOAI 1N0VC 4HNAB 4IS3A 3W5JA 1FUEA 1BEUB 4MOWA 2YZ2A 2HMAA 4UBIA 2H1FA 4TT3D 1USKA 2RCNA 2V7UA 4JD5A 5TRTA 1KU6A 3EE6A 4K9LA 3F7MA 2HY7A 5C3UA 2J85A 4B3XA 3U39A 3IC5A 3H1EA 3UIEA 1P3DA 4RDCA 4N7MA 1KQOA 1ZH6A 1SB8A 1SBNE 1B16A 1HT3A 1SVKA 3DFFA 3DOCA 3RUPA 5YASA 3D43A 4ZZ3A 5B4UA 3HA7A 3MWEA 4D6XA 1SOAA 4DLTA 4OK5A 1HDYA 5JS6A 2XMBA 5JWOA 3AI1A 3HSYA 3L0BA 1TUBB 2B8TA 3F8TA 3F3KA 3GAZA 5KU1A 3TZQA 1CS0A 4N65A 5TIIA 5IASA 5DI3A 3RFTA 1K66A 3BWCA 5GM1A 1Z47A 1ZBQA 4ENUA 1PHPA 1A9PA 3H5RA 5I8PA 1W6RA 5FTWA 4BGDA 2I65A 3J7TA 3ZLUA 1JFTA 1GNVA 1O4WA 4TT3A 4F0JA 1YBAA 2O7VA 3X1XA 1QVWA 4UXHA 3ORHA 1OWMA 2X6QA 3CGGA 1LRKA 3A3KA 4MKXA 3WKDA 1DWOA 4K9KA 1SUIA 1R6DA 2HJHA 5ADUS 1OUMA 1FJXA 5CD1A 1CRLA 2A67A 2GRAA 5HA5A 2C7RA 3B6IA 4HL6A 4ODIA 2YIJA 2J31A 5ALFA 2M1XA 1CUXA 4N47A 1MD9A 2DBRA 2YMQA 1U2DC 3BH7A 4KB5A 4DSTA 1ZMRA 1XZ8A 4PSVA 4JI5B 2IH4A 3C3BA 1I2ZA 3IVCA 2EFHB 1J00A 1F60A 1ZINA 1MENA 3ORRA 2V7TA 4HS4A 1IZ9A 5D3MB 3FTFA 1U7ZA 3N1UA 3B3GA 2O6LA 4XR9A 4F4HA 1T9AA 1X1CA 1FDSA 3RFUA 1VM6A 2ZIXA 2C3UA 4UMEA 4E6EA 1KFKB 1LLCA 4L28A 2VNAA 5I7EA 4J94A 1WXFA 3L8MA 3ND8A 4YY3B 2VQSA 1NT4A 4LXHA 1Z6XA 1ZWLA 4AC9A 5B58C 1WM1A 1RPJA 1G7TA 4MLDA 2WDZA 4QFBA 4QECA 4UHKA 1A8SA 1AB5A 2HWUA 3UQYS 4J0KA 3AOGA 3TOVA 4ZV4A 2VXBA 3SJAA 1XZLA 3ABZA 1QE3A 1SQFA 1BZYA 4HLCA 4UDYX 3VJLA 1OX4A 3WIEA 1QB7A 1XU4A 2QD4A 3AEXA 4CT4B 1M2HA 4WLEA 5KJ1A 3TTXA 2IOYA 4KREA 3ZGVA 1PKEA 2IUYA 4PC1A 2HDHA 2J4CA 2D5AA 1TVMA 3F6YA 2EW2A 2QQ5A 4QHTA 3VH3A 3AM1A 2QJFA 4D3SA 2YJGA 4V38A 1T35A 2ETVA 1E3IA 4Q4JB 3M0EA 4XGRA 4ETNA 5CA0B 3M1LA 4DR1B 5AW2A 4BVAA 3ZLJA 1PWHA 1E9AA 2I99A 2QVBA 1X1AA 4HZUA 3BB3A 2HU8A 2IYUA 2X8JA 3QX3A 1ZK0A 4JNCA 3PL1A 3TM5A 3AGPA 3INGA 1LBTA 1F2TB 2WA1A 3IQGX 4Q7QA 2DFNA 4XE5A 3IVRA 1ODLA 4BO1A 3JY6A 3P19A 3NT5A 3ZZNA 3TLYA 4H9GA 4E1BA 3ZD7A 1RWVA 2R47A 4TMZA 5CNKA 1USWA 2E18A 4H15A 2IXTA 3GUCA 3UUGA 1L1FA 5KWEA 3GEIA 3B53X 4QOEA 3WWYA 2IPMA 3R4CA 3VKGA 4RD3A 5CLQA 3RGGA 2JASA 5FL7D 4MUKA 4POAA 5LMCA 3ANSA 5J9FA 4F21A 3F3MA 3T9AA 4QUDA 3AJRA 1GPYA 3FMOB 3DMYA 3KSDO 3QW4B 1SWVA 3QELA 1JJBA 4Q02A 3ROZA 1OB5A 4ZTUB 1PZXA 1TQ6A 4RPJA 1ZVQA 1ZN8A 3MWDB 5FBQB 3VAZA 4ETWA 1M76A 2QRKA 3G17A 5IG2A 5FFMA 2X19A 1YKSA 2DG2A 3V2HA 2P9CA 4GGPA 3G8YA 3KYBA 3Q7IA 4LDPA 3UHAA 5LYJF 4URHA 5HE8A 4DMUB 1RJ9B 2PLAA 5FPYA 2D1TA 4BCCA 4JASB 3BD7A 4EWLA 1WMEA 1XXLA 1Z4QA 2GS9A 3FRHA 4FI3C 3GMTA 1NLMA 4EPRA 2XX3A 3RV4A 4DCTA 3G1TA 2QTFA 4K7JA 5JZOA 1H2WA 2CLHB 1K8YB 5C0OE 4WJZA 4CMAA 1QX4A 2JJ1A 3HB0A 5FI3A 4RUKA 3RRNA 4YRGA 1GUAA 5E3HA 4MPDA 3GJSA 1EHCA 4Y2HA 3T6KA 2DUUA 5IBCA 3LQRA 1F4VA 3EAQA 1EP9A 4XI9A 3VPSA 1QLJA 3QFCA 3VSEA 1BU8A 3EXHB 1GAXA 4R9VA 2VTDA 1YR7A 3HDYA 1KDOA 1LLDA 2BFCA 2WW8A 4UUBA 4B7CA 4NR0A 4NBWA 4HDRA 2HRBA 1EJBA 3LFTA 5LDGA 4CKEA 1A4UA 1LI7A 1P91A 1UPAA 3LGAA 3OFVA 3V8RA 2VUSA 5CIWA 5CP8A 3ZY4A 4EYEA 1P1HA 4HZIA 3LQ4A 3ZWNA 4WLVA 3AWIA 3I83A 2JJ1D 3I37X 1KQFA 1XRSB 2P9GA 1X7XA 1T6BY 2PTHA 2JIZA 2ONJA 1GTL1 4URVR 3D2AA 1ZK3A 4URUR 3ZOKA 2OP0A 2A7QA 4C7KA 2XNDA 2IH5A 5EG5A 3GJ0A 1UXHA 1VDMA 1YKGA 2NU8A 1NXXA 3LUHA 3PWKA 3WK6A 3QVUA 3CZRA 3IVXA 3TZHA 2X0EA 1N0UA 1V4NA 4RH1A 1L2TA 3KT8A 3IKVA 5KNDA 3AVXA 4IV5A 4DQDA 5LKRA 4XJVA 4DRXB 1IWOA 2O6HA 4RHCA 1PG0A 5KNBD 1DZ3A 3OZWA 1XZGA 4S04A 3BRWA 2AFHE 5F1YA 1F2UA 1HEIA 1VIDA 3IAXA 3NGXA 1N8TA 3U44A 2XPCA 5JNLA 2Y92A 2WG2A 1VA5A 1UAYA 1H1TA 3KFXA 4L4YA 5KMGA 4I2NA 1ZCFA 4B73A 3NVKI 1R0CA 4KFRA 3LP8A 3TFQA 3DB2A 3R1IA 4RV9A 3PR2B 1AX9A 3ICOA 2GZ2A 3GLIA 5ALTA 5KDDA 1JR3D 2NUAA 4BIIA 1T34A 3SZRA 2E6UX 3ZQ4A 2A14A 1F1JA 2JHFA 3L92A 1NRXA 5JWRA 1R0ZA 4MUGA 4F38A 1Z63A 1MX3A 4IM7A 4W5OA 4M0LA 4KO2S 2J3KA 3VZSA 3ZWXA 2VYVA 4DDTA 3IJPA 8GPBA 4IJWA 1MVNA 3QKWA 4HDAA 4UQPA 5CGZA 5E4JA 1EIWA 1QIGA 2A94A 1E89A 1AD2A 4TM8A 2AN4A 4TTRA 2ZUTA 3RSQA 4ZOQI 3PHBE 2RH4A 3JR7A 3ISVA 5SY9A 1QANA 1U1CA 2BGJA 3U7EB 1MX1A 2HSWA 3T3HA 5ELLA 2CC2A 4RACA 3UWSA 1PDOA 3GUZA 5ALMA 4CEHA 2FUNB 1L5FA 2CLEB 1LBIA 2IUFA 2F43B 2H4JA 3F2IA 1MO4A 4PTZA 4DC1A 1YDFA 1XZKA 1ENOA 1NW4A 1TECE 1L7OA 2MINA 2XXBA 3DYVA 3HDQA 2C7QA 2G9RA 4NHEA 4A8JB 5EZSA 2C5SA 4GECA 3REGA 2RC5A 3IO5A 2G8LA 4UHJA 4UUNA 4X60A 4GH5A 1YBFA 4EG3A 2H16A 4M99A 1G3RA 2OXRA 3PNBA 5K8TA 3E9YA 1U5BA 5KWIA 3SQXA 2VDVE 4K88A 2FSHA 4NIMA 5FUXA 3TLAA 1DG9A 5GONF 1RZRD 5K1ZA 3R77A 5DVZA 3ABQB 4L2IB 2ATEA 1H8EA 4R0VA 1TGVA 2D5IA 2WJ3A 2JEYA 5AOVA 4DMFA 4HUTA 4XCXA 1Z7YA 1NRIA 1G7RA 1UMBA 3DOHA 3H5WA 4H31A 1D2AA 3IELA 3DZGA 4P9NA 4PPGA 3EVDA 2OC4A 1I6LA 4RVNA 4BO0A 2J6HA 1MGPA 4YCMA 3C8DA 5FBVB 3VHXB 2WM2A 4UU8A 1CQXA 1DC7A 3ILSA 1XZNA 2BFNA 2R1ZA 2VDMB 3LRTA 3OCZA 4PNHA 4R81A 4DPKA 5JAUA 2WBLC 3MCZA 3JWGA 3ZWDA 2JIQA 3I53A 2FX5A 5K6RA 3QQ5A 4JBGA 1RMQA 3QG1A 4OHRA 4CHTA 1V41E 1AK2A 1IBSA 1UFRA 2DUMA 2JGDB 4LC1A 4LGCA 4H7IA 1ACLA 2WHPA 5KUTA 4KQFA 1EK1A 4I1IA 2BVNA 1VHTA 2CD9A 2HAEA 1PYDA 2IDZA 2VATA 3D2BA 1DAMA 3MFQA 5EJ5A 5I7AA 1AM4D 1O54A 4MNTA 5B37A 4KR2A 2P9YA 4CIDA 3ASZA 1ECCA 3RHSA 4UMDA 2WPDA 1DPFA 2NXJA 4OHBA 4RJJA 2JB9A 4XWWA 1V4VA 4Q1AA 1YZKA 2PV0A 5KNCH 3DJYA 4FBLA 5EIBD 5NULA 2D00A 2OLKA 1FP1D 3PFNA 4ITRC 4K40A 1OFVA 1XZAA 1FLAA 1N3BA 1X3SA 4YO8A 4TYYA 3ORFA 4DWWA 1RM5A 4EW6A 3V33A 1EFCA 3DD5A 2P40A 4KPEC 5E1BA 3P9CA 2C96A 3L6CA 3HGMA 4AN4A 1NF9A 5EFZA 4US2R 4F3TA 1L9XA 3EZ2A 3FIJA 4RQTA 4AZWA 2H0QA 1QS0B 3D4NA 2NO7A 2V7PA 5ECWA 3ZEIA 4Q6WA 1P1BA 4YJ3A 4OHZA 1Y9EA 1CNMA 3ONFA 2ZE7A 4XQCA 1FMTA 4DUZB 3I04A 5ICGA 5GINE 2H63A 4EW2A 4GYKA 1KYQA 2P68A 4D9GA 1QTNA 2LKCA 1FJGB 2FPOA 1JLLB 3OZTA 2VAVA 1V8ZA 4OI2A 4P98A 2F3PA 2QZJA 2QE7A 3W3AA 4FGSA 4I14A 1R88A 4PWYA 4RA6A 4PHGA 5JBQA 3D8RA 4CM4A 2JLAA 1U28C 1YHNA 1QB8A 2JFQA 3RRZA 3AESB 4YXWA 4P4UA 4CV3A 3U7RA 1J8FA 1Q1NA 3DVAB 5T64A 1ZOPA 1GITA 1OT3A 5BV0A 2BONA 1TK9A 1OROA 1PS8A 1FFWA 1Z73A 3GFPA 1VL1A 3BE6A 2I6GA 2N1BA 2PWAA 1B1CA 2OVBA 1MZPA 2P77A 2FOLA 4IX9A 1BCSA 3JZIA 4XFKA 4NCJA 4JJFA 1VG0B 2QD5A 4QUAA 4ZDWA 1Z3IX 3RDPA 2QE7D 5L4SA 1NDHA 2A57A 3NV9A 3KOWA 4BASA 5ES4B 3Q9SA 3GNTA 1SA0B 2JRCA 2FW6A 1X80A 2I29A 1M1ZA 1R66A 3MRTA 4A9AA 2OV1A 5TQVA 2CBXA 4CL3A 3NBZC 1EPUA 2VRCA 2I78A 2QPOA 3ABSB 5LZ2A 3VNVA 3OJFA 2PUFA 2RD2A 1LNQA 4GM1A 2RAPA 4K8RB 3PYMA 4BLUA 4P4GA 2EQ5A 1TO6A 2VT2A 3NAQA 2DUWA 2B37A 3N59A 1II9A 1NZFA 4EYOA 5AHOA 5IDQA 2O8BB 3KUDA 2FF7A 3H1AA 2NVUB 2AEFA 4H1TA 5ILGA 4ALNA 3QOXA 1G1AA 1G4AE 1DBSA 3HRKA 4KTVE 4L0QA 4M8KA 5KNBH 4PE5B 1PK7A 1CIPA 2HIHA 2HN9A 3OD5A 1U28A 1GEGA 2AZMA 3VA7A 1M7BA 5DB4A 4FYXA 3IAFA 4JJAA 3JAKB 2CVHA 1AKVA 3SMVA 2JF0A 3GLSA 5G02A 1X13A 3AP3A 4JI4B 3ESXA 1P31A 3HK2A 5ESDA 1FX0A 3I45A 2BFWA 1B2LA 3OZRA 3SHOA 2F1HA 4QICA 3K7EA 5KYXA 2FCAA 2AUMA 4KL8S 2BY4A 4BV2A 2Z43A 5BR1A 5MHTA 3NOOA 4XYBA 2GN1A 5JS2A 2NN3C 3CKMA 2HWWA 3U40A 2J4DA 4KLRA 2N42A 4RO0A 4MLPA 3U4QB 1S0UA 3G85A 2BMDA 4N6OA 4LDNA 1U9CA 4IHKA 2J87A 4PANA 4ZU1X 3JR3A 2B4YA 4IWXA 1V2GA 2YBDA 5IF3A 4EGAA 4N5LA 4M54A 2I03A 1CDEA 2JLVA 3DFIA 4PZZA 1OYWA 4DLSA 5EJ4A 1BXZA 2H0AA 2HU7A 2XUFA 3DVRX 5KOIA 3CNLA 1YE5A 4P38A 1JNYA 5B2FA 3ANNA 2ZUUA 4A5SA 4MQFB 3SG0A 1GNTA 4GZMA 1YQDA 4HH0A 1FRNA 2VKQA 4YRDA 2A8YA 1FS6A 3H6KA 3RBZA 1O0CA 3EQZA 1P62B 3T9CA 1C9KA 3IXQA 2CSXA 1L3CA 3M49A 4I8IA 1YNOA 3CINA 3AOEC 3O82A 1EK0A 3H1GA 4JVNA 2DF8A 1I2BA 1Y4AE 1T2FA 2C2YA 5LA6A 3VJMA 4CTJA 2IYTA 5K8LA 2RHGB 4D26A 4FYVA 3L77A 1LI4A 1E7RA 4QJ4A 1KOJA 4GPEA 3B6EA 3FHLA 1TUGA 4MWZA 3GFQA 5JSZA 3RUDA 1Z3CA 1T1RA 2AQKA 2YFQA 4QQRA 5F4ZA 2I6UA 3I2YX 2BFEA 2C2MA 2A1TS 3NC1C 3WP0A 2J9GA 1XZBA 2O1EA 4K9DA 4JYAB 4HHEA 3H75A 1M2EA 2VDKB 4U8HA 5FL3A 4HDMA 3RC1A 2NQ8A 1Y7PA 1LPOA 3AHDA 3CUYA 3ESYA 4H7FA 3VJKA 1V9SA 2E21A 2QU7A 2QRPA 4EF6A 5U4XA 5AJZA 2HPHA 2EYUA 1F6WA 3BM5A 3H9EO 3OPXA 5H3HA 3CO5A 5GTDA 1R6TA 3FETA 2I1QA 4OQMA 2OV8A 4WBSA 1WZNA 1VL2A 1C3EA 3JS5A 3LUCA 5FA6A 2WZCA 3WDLA 4MHTA 1NN5A 1BW9A 3GRPA 5JYBA 3TTWA 1QNLA 1V5WA 3H2KA 3L46A 2H07A 1U9IC 2B6NA 3GGJA 4FGJA 4IMRA 4BGVA 5ALVA 1EBBA 2IP2A 1SXJC 3UA4A 1FL9A 4FYWA 2GZ1A 2VH5R 4D0RA 5A4DA 3OTGA 3W3ZB 2R9VA 2HA3A 4Q1EA 1V1RB 1ACJA 1IWBB 1I33A 2NAFA 3PTAA 3Q7QA 4EVIA 1HQKA 4PX5A 1ZH2A 3BMXA 3HVJA 1NP6A 1TM7E 4F1WA 3A58B 4ZOCA 3IP6A 3R6TA 2DGDA 4RKYA 2P2YA 4C78A 5IARA 2ZM6B 4B8YA 3FZGA 5K3SA 4XDGA 1ABBA 4LVNA 4PYKA 1E5DA 1Z5UA 3OJWA 1EB8A 4QVIA 4RD4A 3RE1A 4X66B 3MXOA 2VSFA 1W4BA 4JQCA 3DG9A 1ZA2A 3L0IB 2FN9A 1R4MB 1XIVA 1NI4A 1E2EA 1NA5A 1RRVA 4HTAA 4IFBA 4IYJA 2I3GA 4OJKA 2PH1A 4ND2A 2FWRA 4TTTS 1SWWA 2J33A 3ME5A 2ZSEA 4TRMA 5DX8A 2QTGA 3EZNA 2X0KA 3L4SO 4KQ6A 4D74A 2VSQA 3DWIA 3E2PA 3LL7A 2CD7A 2IODA 3H86A 3QVMA 1I1OA 1TM3E 2EF1A 2PSHA 3LYHA 4EKDA 4DSAA 1XEAA 3Q72A 5HZGA 5A3SA 5K05A 1QHHB 4MW2A 5DHQA 3ASUA 5IAKA 4KOEC 3RK1A 3QITA 1YDHA 4EY6A 5C7IO 2TRSB 1ORTA 4BNIA 1J9EA 1T5BA 3LWBA 2F8TA 1SOWA 3ZYCA 1U8AA 2H00A 1VLVA 3ER6A 1UQUA 5K3EA 1PL7A 1T8YA 4ZOLB 5D3MA 4Q3EA 2HA2A 3EH1A 1MC5A 1M2KA 1PGOA 3CUKA 3HJBA 1R64A 1TU4A 2Z3VA 1Q50A 3BCSA 4R8LA 3ZI7A 1SUBA 3BG5A 2A0KA 1Z2NX 1TQ4A 3RW9A 4EP1A 4RTJA 1YI0A 1JEEA 3MUEA 4WOKA 1E32A 5DI9A 4DBLC 2TECE 1I0IA 2XYHA 1RABA 5CJ2A 2HREA 4JOBA 2ZYSA 2A9OA 4QASA 1UBKS 3WMEA 5GQSA 3Q3CA 2LBPA 4XJXA 3TXAA 4A3SA 4YRSA 3HS3A 1A5SB 1EGHA 1ZX1A 3CB4A 3OU6A 4KIFA 4C7XA 5LLSA 4DDKA 1JSLA 3USZA 4RD2A 2H1HA 1E94E 3ZHUA 4BNGA 3LC2O 1EDZA 2R4QA 3L7OA 2E4YA 2RK4A 3QPCA 4H3VA 2JAOA 2XEXA 2A78A 4P2BA 1QH1A 3EFEA 5JC8A 2IEDA 5HJ7A 3WRYA 1GGVA 4B2YA 4I6JA 1IL0A 1CDOA 2Z5VA 4D8UA 5HHTA 3QTTA 2ZLBA 4K0RA 5FNZA 1UFOA 1O03A 1YRWA 1G8SA 3HCEA 3HI6A 3KOXA 3NWBA 3W2GA 4NK4A 1E59A 1WCIA 1SBIA 4M49A 1REQB 2CKDA 3D5QA 2YYZA 2I6XA 1LW7A 2OXTA 3MWJA 3IODA 3SSMA 3V97A 2WILA 1T9GS 2EDCA 2A1UA 3BAZA 3PVZA 1SUCA 4YUZA 1QFXA 1WMDA 3EFOA 2GPBA 3F7NA 1PN3A 3HV2A 1ZK4A 2VPIA 4PSAA 1G0NA 1S8AA 3QU5A 3EPPA 5KSPA 5AWFC 5B3LA 4FE4A 1LRLA 4LOAA 4RKWA 3AV3A 4P83A 3I4CA 2IXBA 1QGYA 1PWXA 3RVSA 4BQIA 1W25A 1I7PA 1QZTA 4RD1A 4M8SA 1A4IA 1ODSA 1GVHA 1SPXA 1C80A 4GBMA 4CF5A 4QPNA 3EC1A 4XYLA 3AKZA 3TLGB 1KP3A 1KK1A 1QAOA 4ESVA 3LUKA 5G2OA 4XD2A 2Z5LA 1ZJWA 3MTBA 4MLZA 3CH4B 1L5QA 3LYAA 1CYEA 1CF4A 4TS9A 3U48A 5DNUA 1XDUA 1KYWA 3K30A 2FSFA 2AQIA 2Z8ZA 1RPAA 2PX5A 1GG5A 1VL0A 4XIGS 3BYZA 5T3YA 3EZGA 1UPCA 3DOJA 1IONA 3PFWO 4H3SA 3HCBA 3WISA 2ACKA 1N8SA 5F3DA 4CMEC 5GGYA 4J1QA 2O2JA 4HUQB 1UCFA 4RAQA 5IWCA 3CURA 3MT7A 3OZDA 2OYCA 2ZYIA 3NDJA 5KOJA 3CWQA 5L3VA 4C07A 3CLUD 1ZYUA 3QP9A 3BK7A 1YZTA 2DR0A 5F76A 3ZV4A 1RWQA 1BTOA 5B6PA 1ZXLA 3UVEA 4ROTA 3WWZA 4NMLA 4LBVA 1NAHA 4RVOA 4YQZA 4Q3OA 3Q2KA 1T9ZA 3GBVA 1OXTA 3U7GA 4MKZA 4O4LA 1RQ2A 4I4CA 2IU0A 3R3YA 1U8YA 3E8SA 4R1NA 3AHHA 4GUAA 4HMPA 5A1JA 2FP4B 5BMVA 2J9YB 2PX4A 3X2SA 4MV8A 4D9KA 4ZT2A 1Y8QB 3R24A 2QVLA 5JQWA 3DS8A 3KSUA 4JP3A 4I9GA 4CETA 2A2ZA 4JSTA 3P0RA 1EQAA 4HQNA 4LJKA 1O6ZA 3W1WA 1Z36A 2H1IA 2NU6B 3D7KA 4D4MA 2BI7A 4XVCA 1J49A 2VP6A 2ZWOA 3VR6H 4GNRA 4MIKA 1RRGA 2OCAA 3OU7A 3P71T 4BLOA 4E21A 3M6UA 3H0CA 3BQ9A 5LQMA 1PUXA 2EFJA 2GAOA 3C8UA 3EF0A 3V3KA 3ZEAA 4X5OA 1U3GA 1G20B 1HFWA 1V8DA 1NMXA 2JAUA 2E85A 2BISA 3A2NA 5JQGF 1X86B 2IYXA 2COKA 1G64A 4C3UA 3UJ3X 4DA8A 4N6GA 1CUWA 3COJA 3KOMA 2HLDA 2NGRA 2RARA 3GDOA 3TLMA 1LPNA 1ZXXA 4MGEA 5C2JB 1YASA 3NJ4A 3EXHA 3C3DA 3UQZA 4HCJA 3H3XA 4ZVKA 1JAXA 4RTLA 4HTFA 4MYDA 5IDVA 5TQ2B 4LS3A 3T5BA 621PA 2CMDA 4ZK6A 2OO7A 5B3JC 1E9DA 4MKHA 3FDIA 1TTQB 4Q24A 4YAFA 5JZBA 4NV0A 2IDMA 4K6FA 1P7VA 2X5KO 3ZS8A 1FS5A 1AGNA 2DX7A 4V0MA 3ML1A 4CM9D 1DBRA 3IUJA 1YC5A 3ZHQA 4IXTA 3VVBA 3ZJ4A 2FETA 2W2VA 2YVLA 3TXYA 5LQDA 2PJUA 5J2UF 1FVHA 3BPSA 3LCRA 3TLEA 3TYXA 2VUUA 1S2OA 4F4JA 2EARA 1HFJA 2B25A 2WU8A 3UKJA 4CMHA 2PUCA 5KKCA 3B6MA 4EX7A 1Q57A 1RZUA 5EKUA 2ZJYA 3CUSA 1X87A 3R9IA 3EEOA 3IIEA 1UJ4A 5JADA 3PD1A 4L4UA 2QY6A 2ZJAA 3AESA 5DRTA 1SIUA 1SXIA 1UKZA 5FBLB 5FWXB 3RIMA 4HUJA 3CV3A 3QWBA 1Z0KA 3WMGA 4MR8B 2XCRB 3GA7A 4M0KA 4BGEA 5DNWA 4H4EA 5DGDA 1VXOA 3W5HA 4AZ0B 1KI8A 3PITA 1NFQA 2ZJ1A 4BJ3A 4PYNA 1JG2A 2Q2VA 5B3JA 5JDCC 3UWKA 1KXZA 1SKQA 4HDSB 3C97A 1V8FA 3FGNA 5BQ3A 5KYKA 1P1CA 3KB6A 5TS3A 3W2FA 3M70A 3ENZA 1OAAA 3P97A 1E5XA 1J2TA 4KJZA 3PS9A 1NVTA 4RDHA 2PRZA 4GHWA 1IJKA 3NB0A 4BTVA 3I58A 5FTLA 4IIJB 1U3CA 1CIJA 4EEKA 4ZHSA 2WMNB 4TYWA 4ZT5A 3FGPA 5A3RA 2C9YA 2J1LA 2CE7A 4UKDA 1XLVA 1T5SA 1OLSB 2XHZA 2A5JA 1EFKA 3DDOA 3H1TA 2HLNA 3TAXA 2XIQA 2E7ZA 3FYTA 1NJFA 3IDFA 4AULA 3FXAA 1LDNA 4YQEA 2WU0A 4G23A 4QLAA 3VISA 4AJNA 1MB4A 1MIOB 3ZVNA 1KY3A 3WK4A 1QP8A 2TYSB 2JW5A 2X4LA 3W1EA 1KFBB 4EPXA 1N36B 4IICA 4ZT7A 3CHYA 5DM0A 5CCXA 1J07A 2WYIA 2D3WA 4KH1A 4Z4EA 5BSMA 5HIMA 1J0EA 1X7YB 4MV0A 5JEEA 5K8JB 1KBOA 1N5LA 1UZUA 3G0DA 3R8CA 3TOSA 4QUEA 1TM5E 5EJMA 5KJEA 2P90A 3ZDBA 2JJ2D 2XODA 4NH4A 1OU0A 3VDRA 2UDPA 4X84A 1R4NA 2GJKA 4O8CA 5ENZA 4A0RA 2VLIA 3QH4A 3ESQA 3LI2A 5FYQA 2HUNA 1EE9A 2YXDA 1PZGA 4GX0A 4BNYA 1KFCB 2XD9A 2Z4RA 4OXQA 2G04A 4KOAA 3ROKA 2DFDA 3ZDAA 3NBYC 3RS4A 4X71A 2X4GA 4LWQA 4JLKA 4QOIA 2HTEA 2BEWB 2Y27A 4YRKA 2VQ3A 4JXXA 3KD2A 4JR2A 5KB3A 3QLUA 4IAOA 3U3JA 3QYAA 4FIDA 2GWRA 3G8DA 4JCOA 5EMMA 2W00A 4QNMA 2VG8A 2EU8A 3PEFA 2VHXA 3JZAA 1W29A 3RS9A 5T57A 3PQ6A 5JYEA 3I12A 1UJ2A 4CJXA 3WDKA 2XBUA 2OG2A 3NATA 1SCKA 5IUJC 5L4LA 2XNKA 3R6DA 3SJ7A 1YVDA 1CDZA 3EZXA 1RAEA 2FZGA 3M1YA 1YZVA 5FBRB 5J5AA 2EKZA 1FP6A 1TIBA 5FNVB 3IRVA 3T4XA 4HLUC 1E61A 1F2DA 1MC4A 4N5NA 3UMJA 3ZGLA 3CVJA 2A9JA 4JEHA 5DXFA 2OQRA 1HXHA 1KZYC 3HJUA 1C8LA 3PLAE 3MVEA 4QWWA 3D5TA 4JLWA 1GXSA 1J8QA 1EZ1A 3NGLA 3RS8A 4EHBA 5AKXA 1CC1S 3LBYA 1EJ2A 4CEJB 4FOSA 1T8RA 4C87A 3QYFA 2XT6A 4XGIA 1I0LA 1UBHS 4Z3DA 3UJPA 1GGEA 4QFCA 3OECA 1D7OA 1HT0A 4K9QA 2GUGA 4PS1A 4HAUA 4NK5A 5IVHA 4CEIA 4BKPA 2UV8A 1XK6A 3B2QA 4MPPA 1VBNA 1MABB 4UUAA 1E1MA 2UYCA 5AJXA 1BS1A 4P36A 2I4MA 2PWBA 1EGAA 2JLUA 4OHWA 4KUGA 4TS4A 1EM8B 2HIMA 2O2YA 4MV3A 4OFZA 2QRVA 5TT0A 3OTWA 1A1SA 5LXTF 4E09A 4BV3A 2C5BA 4FCCA 2CCJA 1QH8A 1HMYA 2HFJA 2P8SA 3VQTA 5DHSA 3K1TA 1IM8A 3P7MA 4XJSA 4E03A 3DEKA 3IEPA 5AKIA 1U0GA 4HSEA 1OLUA 4GI1A 2H08A 3U31A 2QBYB 3B51X 1DXQA 3LXUX 1L8AA 3ICCA 4DCVA 1W5AA 1JFFB 1N4AA 1QV9A 3D3EA 3UF0A 2SKCA 1BFDA 1ADBA 1AURA 1BA3A 3SEFA 1P45A 4KO8A 3K0KA 4F1JA 1WCYA 4F5EA 4EB6A 1QOPB 1UR5A 2QG9A 4NI5A 4TQGA 4GZ3A 1XDWA 4I3FA 2RIPA 1VSBA 3CUVA 4JLPA 2RJ3A 4U9HS 4GRAA 2AYYA 5BUSA 3UGQA 5ITZA 3DPUA 1YDMA 1C7FA 5B2ZA 4Y2SA