4WH0A

Ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
202
structure length
201
Chain Sequence
SFTYKRLDKNDAAVLFVDHQAGLLSLVRDFSPDEFKNNVLALADIARFFNLPTILTTSFEDGPNGPLVPELKEMFPQAPYIARPGNINAWDNEDFVKAVKATGKKQLIIAGVVTDVVAFPTLSALEEGFDVFVVTDASGTFNPVVRDAAWARMTAAGAQLMNWFSVGCELHRDWRNDIEGFGAILGGHLPAYANLIQSFGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Crystal Structure of a Hidden Protein, YcaC, a Putative Cysteine Hydrolase from Pseudomonas aeruginosa, with and without an Acrylamide Adduct.
pubmed doi rcsb
molecule tags Hydrolase
total genus 76
structure length 201
sequence length 202
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 4wh0A00
3TG2A 3TB4A 1ILWA 1J2RA 4L07A 4H17A 3UAOA 4WH0A 3KL2A 4WGFA 1NF9A 3O90A 2B34A 1XN4A 1YACA 3S2SA 2WTAA 3O93A 3O94A 1X9GA 3OT4A 1NBAA 3OQPA 3R2JA 1NF8A 3HB7A 2A67A 3LQYA 4L08A 3EEFA 3V8EA 3TXYA 2FQ1A 3R77A 1IM5A 3HU5A 3MCWA 3O92A 3IRVA 2H0RA 3PL1A 1YZVA 3O91A 2WT9A
chains in the Genus database with same CATH superfamily
4YJ3F 1XVTA 3TB4A 1WB6A 1I2BA 2QLJA 3R5JA 4OFXA 3O8BA 3ESZA 3RROA 3WQSB 4DEXA 3LBNA 1Y1TA 3RS5A 1IK4A 5ARDA 2OBBA 1TGYA 2LCFA 4HL6A 3TAUA 1QHNA 4OA5A 2ZVDA 2VYCA 1ADCA 1F4PA 1FBTA 1PS9A 2A3NA 2FUG6 2H57A 2H5LA 2I78A 3CLUD 3OHPA 2QMEA 4XUCA 3VJMA 2QTTA 2XUIA 4AN0A 2IHBA 3RIGA 3UCFA 1FDUA 4O5AA 4E2WA 1Q21A 2Y76A 2FY8A 3L1UA 4C07A 4XDYA 1QOQB 2O2DA 1ISFA 1MPXA 3NRBA 4MO2A 4WBNB 1T9GS 3HCRA 1SCKA 3X2SA 3W6ZA 4BUCA 3EF1A 4YRGA 2DG2A 3SZRA 1D6JA 3I05A 3HJNA 3KLPX 1MB9A 1XMOB 1GFSA 4LVOA 4V0NA 3ODPA 3FCYA 4A8JB 2HV8A 1NI4B 2GM5A 3IEMA 4DA7A 3DYBA 3GN1A 2YY5A 1HL7A 6LDHA 4KK3A 1JSRA 3Q6MA 4ZC1A 2AWOA 2ECPA 2RGNC 4C7OA 2HSZA 1ORVA 2CC2A 5EXDA 3VSCA 2IS2A 4EB0A 5LA6F 2XEDA 3DEHA 2B4YA 2Q8QA 1CHNA 1L7EA 1BA3A 3PR3A 3TIVA 1G21A 1TEHA 4L9RA 4Q9NA 4DQUA 1GZ7A 3HN6A 3MGKA 4GHWA 4MR7B 4U63A 5AW8A 1T4MA 3A9TA 2V0GA 3D3WB 3BKWA 1DC5A 2ICAA 3MILA 2YVQA 3I5UA 1R74A 3DUWA 4QSMA 4HGQA 1BKDR 1QZUA 4ARSA 1NVDA 1UC9A 5TS3A 1RYFA 2FPPA 4QDZA 1L5LA 2LCQA 1QV9A 1VL0A 4PHTA 4PGGA 3TLXA 9LDTA 2V55B 3FTEA 2C5EA 1N57A 1O77A 2IP1A 2NO5A 3ER6A 4X5OA 4B2YA 5I5EA 4LRYA 4LF6B 1XCLA 2ODBA 3SYLA 3VKGA 5AKIA 2WJGA 1VE6A 4EUFA 5JTUA 3SNKA 1P73A 4CDMA 4BASA 5M04A 3AJEA 1AF7A 4F1KA 3Q9NA 1QAOA 4ITRC 3JYOA 5J4YA 3G89A 3TIFA 2B0CA 4F5WA 1F9EA 4FR2A 1UXGA 3KO8A 2EDAA 5H7XA 3SFTA 2Y0PA 2ASVA 3FYHA 3KE9A 3PQ4A 1AHNA 3HZHA 1YJCA 4Z9BA 1O94A 4ZEMA 3N5CA 1DXYA 3UGTA 4JUAA 4U02A 3GLVA 1AXGA 1KQ3A 3CY6A 3A0RB 3GGOA 5IJ9B 2WG0A 1UBTS 1TU0A 2V3VA 4AJIA 4D0GA 3VXKA 2H18A 4BX2A 5I9LA 3UHPA 5JSZB 2HWWA 3KSRA 5TF0A 5LKAA 1WMEA 5CP8A 4ZU6X 1HKHA 3TSZA 4YJ2F 2DUWA 4X91A 4BAZA 4AI6A 4XI9A 2QZ4A 2A94A 2C99A 2ZVQX 1DEHA 5EIHA 3OCZA 4S2EA 3Q2IA 5FA6A 4FYIA 1I94B 3SQXA 4GNKA 4MS1A 2XB6A 4N0QA 1I4WA 2V97A 5TQ0B 3IL2A 3PNLA 4ZAGA 2B4AA 4ESVA 4QOGA 3CKLA 1QRUA 1WMBA 1HI9A 3BCHA 5FOUA 1D3AA 4TMYA 1IN5A 2Q5IA 4Y8VA 5JS7A 1L5HB 4F2GA 3IHLA 3PK0A 2QXTA 3TXAA 1NUAA 3UKJA 2CMFA 2Z43A 5GM1A 4MIEA 1LPSA 2G7ZA 2GEUA 3IXQA 1GQ2A 2ZITA 2D8MA 3ZK7A 2AF3C 2IW3A 4L8LA 1SURA 2Q6VA 3ILVA 4EBBA 3I1JA 2O7QA 2VXBA 5HZHA 1CKEA 2LNDA 4HDCA 2YWEA 4HNTA 1VKOA 1TRHA 4OLFA 2SICE 4I36A 5IAKA 1NBEA 1CZKA 2IYTA 1EFPA 1XEXB 1GQYA 1YXMA 1DAHA 4N5MA 4X84A 5SY6A 1SOMA 2O8BA 1Y63A 3TLKA 1NUTA 1F4VA 1X7DA 1T2AA 2VSQA 1QE0A 4M0EA 4CV3A 2ZPAA 4MV1A 1RZUA 3BAZA 4FGSA 4MO9A 1T36B 4C1BA 1SXQA 1Y6JA 1OQAA 1ZI8A 3TK1A 3TUJC 1CP2A 2HV9A 2P62A 3UJPA 4URXR 1K08A 1KQPA 3FH0A 3L9XA 4KQFA 2PY6A 1QORA 4RS3A 1VHWA 3PXAA 1U28A 4FWIB 3VYWA 5L4LA 3T1YB 5B3JA 1PHRA 4OKIA 4NFLA 5DN6D 3RYTC 3A3PA 4PGAA 3VI3B 1IXZA 2ZJ7A 2WF6A 3L7JA 3PRKE 1HV8A 5T7BA 2QENA 1XHLA 3R0IA 3HUUA 5BSTA 2ZUTA 1ZCFA 5F76A 4FIZA 4QQRA 2DPYA 4EA6A 1R0YA 1BC5A 2VAXA 3KRTA 4N3CA 4PQFA 5FPYA 2VRCD 3E1SA 2IXDA 4CEIB 5EWLB 4U2CA 4K9MA 1PUJA 2BKUA 1NYTA 2G63A 4GT1A 4PICA 4URFA 2GN8A 2FN4A 4R51A 3R3XA 121PA 3A58B 2AZXA 4X44A 1N6OA 1I10A 1CRWG 4LBZA 5A7HA 2QD4A 3I1FA 2IRWA 2ZULA 1A1SA 4IFBA 1XNHA 4B81A 3W77A 1NVVQ 4JZYA 2AN3A 4PGMA 4ZT5A 3SBEA 3ANMA 1TVEA 2EFYA 3FCAA 5EOVA 4OHFA 1QDEA 3PT5A 4G4SP 4A1FA 3BBPA 5M7EA 3HKCB 1SHLA 1DBRA 2WZCA 1SD5A 3CF4G 3DMFA 5ESXA 2D0DA 2PZLA 3SX4A 4PZCA 3BWXA 5KTKA 4TVOA 4HDAA 5B2FA 4JI0B 2GAJA 4M0KA 1NF9A 1SBQA 3ZGVA 2CHVA 3LWBA 3O26A 5ELMA 2R6ZA 4DCOA 2F8MA 3DV0B 4OKSA 4E12A 1NWCA 1PUIA 3TSYA 2QN1A 2PT5A 4OHRA 3GHHA 2B8JA 5FUXA 4FU0A 5I7SA 1LS1A 2P5SA 1JDPA 1OXKB 3KJZA 4E3ZA 1W34A 4IIYA 3CWQA 1RBYA 3W79A 1E3TA 1GL3A 2GM9A 4FEGA 1W4LA 3F46A 1T2EA 4D1YA 4PVCA 1B6RA 4I50F 1LRLA 5AKXA 1LF5A 5FWXA 1UJCA 5AVUA 3MUFA 3THWA 3ICEA 5BQOA 2TMDA 3O74A 4OLBA 4BFUA 3HY4A 1JGTA 3OEHD 1SD2A 2C3OA 3FDZB 3LVRE 1VG0B 3RSHA 4C88A 5ITSA 3HKBB 3ZUGA 1V5GA 1XYVA 1VSUA 2P3LA 4R8MA 3F3MA 1T3HA 3KWLA 1CLEA 1JIQA 2JA1A 2JGFA 2YS6A 4EYKA 2KLBA 4ZEOA 3P4XA 3QKSA 4XKJA 3TJMA 2NO4A 5JSQA 3FWHA 2Q3EA 3EEOA 4MV4A 3BIWA 1Z0UA 2XQFA 3U7EB 1DTWA 3CNLA 1BX1A 4GDMA 3GQBB 2B9EA 3NH6A 3WQHA 4GOJA 4HSEA 3FJYA 4F8JA 1C9KA 4W5QA 3ZD6A 1AA6A 3DMYA 4GSKA 5K45A 1E2NA 1ZICA 1G3RA 4ZP1A 1RIIA 2X4GA 5A0TA 4ON9A 4RFSA 3K9LA 3MCVA 3OZAA 1RTTA 3ITNA 2EFJA 1SXJA 3EUWA 1E2BA 3DULA 2I6GA 1TZMA 4NQRA 1OTXA 4AJ1A 4ACAA 3F7OA 2ORED 1J24A 1MQAA 2ZOSA 2IHKA 4TQGA 4DNOA 5KTMA 1W93A 4LDPA 4ZEWA 3UPDA 2I1WA 3FYTA 3I53A 4X1YA 2RG1A 5T8KC 2WJAA 1GJRA 1MC1A 2VJOA 3TNJA 4ZKEA 3ZY4A 6ABPA 3WYGA 2CCKA 2FP4B 3SX0A 4FFDA 4BXOA 1G4UR 1ZNWA 2JI4A 3OT5A 1TUEA 4Z4CA 2P90A 2KB0A 2E18A 2ZAMA 4JLPA 4ZTBA 1LU9A 3OU6A 4I9GA 5GZ6A 2HZBA 3MTEA 3E4DA 1C50A 1FUEA 4HY3A 4RVSA 4BLQA 2VZ0A 1E2JA 1SBIA 1YBFA 2R68A 2R8YA 2PAFA 3NUQA 4L8WB 4UAGA 5LIRA 2BC9A 3R23A 2BFEA 1UDBA 3OPXA 3BJZA 1BCRA 2M2IA 2XWPA 3DLCA 3FFAA 3K0AA 3MAGA 3QZUA 5G1OA 4RK1A 3COVA 4NBSA 1XZJA 5IUNC 2FMHA 4GI3A 1IL0A 2FW0A 5FPPA 5LNK1 5I48A 3T94A 1NATA 5KKAA 2IZOA 3ST7A 2XXAB 1F3OA 2VSOA 1SUAA 4I0WB 5EXPA 1NQOA 2A4KA 2FOXA 4UE6A 2XYVA 3BL6A 4MV6A 2PQ2A 2VL7A 4FDUA 4ZAYA 2OPHA 3LBAA 2BKLA 5LZ5A 3JY6A 4IJMA 4QPZA 4BTVA 3KBBA 2KJQA 5IK2A 3WWEA 4B7XA 3VKUA 5BN5A 1DLJA 4OV6B 3D2CA 1K9SA 3QEAZ 4KRFA 3O4JA 1JHRA 3QKRA 2J09A 4LE1A 4C4PA 3ZY5A 1GRVA 2DEUA 2HK6A 2H2IA 3A1WA 1SCJA 2H7CA 3H42B 4RVFA 3UJ9A 4O4IF 3SZOA 2WZQA 2XGSA 4B73A 5JIBA 4P54A 1Z8NA 2PHZA 2AFIB 4KHZA 3SBXA 4OHCA 5BSHA 1KO4A 5A62A 3V8MA 1YASA 3QE3A 1LV7A 2I4OA 5IVKA 4H1TA 1B0ZA 3I9FA 3K9NA 1TQ6A 6Q21A 2VPWA 5LQUA 2GF2A 1VBMA 1NLFA 4HQRA 5CDFA 1IXKA 4HMOA 5TT1A 3BZBA 4IQFA 3OZUA 1EWYA 4CM4A 2D13A 3WMXA 5FCDA 2NZVG 5DCLA 1L3BA 4G56A 2Q3MA 5AM0A 4BE4A 1YIAA 2YOHA 2FJPA 4ARIA 2YQ4A 1M8JA 2QUZA 3D02A 1X7WB 3OZEA 3SHTA 3ZQUA 2J0VA 3A10A 4IIDA 4ZWNA 1SGWA 3PUXA 2JDID 4RPIA 5AVSA 5JZMA 2P6OA 1XG5A 2C03A 2E2WA 1NFFA 5FR1A 1XTRA 5H16A 3V4SA 1NBHA 1MB0A 2OK7A 3P27A 1PKXA 2FG5A 4LDQA 4ZT3A 3ZE7A 2W00A 3EQ7A 3AB8A 3LX4A 2UYOA 3U3OA 4MW5A 3UMRA 5MHTA 4Z3DA 4GM0A 5IDQA 1R64A 3DQPA 2YJ5A 3EQZA 3L8DA 1IVYA 1H8EA 1NQXA 2QGNA 3IAAA 4HB2A 3ZYZA 3MTGA 3AVOA 3H99A 4BWGA 4QJ3A 4AS1A 2O8FA 3ZLVA 2AN1A 2ZIAA 3LQ4A 5F1OA 3U17A 4EA9A 2Y99A 3F6BX 4AM8A 1FTSA 1VBNA 2PRYA 5DEOA 3PXGA 4XYEA 1XROA 3OZVA 3ESQA 3HDQA 5T3UA 1UAAA 2RIPA 1QP8A 1K5HA 5CVJA 4ZVSA 4ZO7A 1XDGA 1LX7A 3NNDA 1N7HA 2EP7A 4KEAA 1BS1A 4NJOA 3VJKA 4RMJA 1Z45A 4L15A 2VC2B 2FN9A 4DNFA 1PJ8A 1ZD4A 3MGGA 1LTHR 1WCV1 3S1SA 3KQSA 1DI0A 1PSDA 1YCFA 2W2OA 3CRW1 3PE3A 3NHRA 4HWGA 4P4SA 1XNRB 3KNZA 1QONA 3NYRA 4D3SA 3LMKA 5AVTA 3TAHA 3WBJA 3F78A 2CUZA 4B74A 1ZN2A 1JILA 1JN0A 1GCGA 3SC4A 5FTJA 2I62A 2QN6A 4Q9HA 3U3ZA 4GRIA 2XY4A 2QMHA 3ICCA 3RUCA 3TFQA 1Z2OX 3QKIA 4K1XA 5IKMA 3U2QA 1QVRA 2PX5A 1V5IA 1P77A 2ZRGA 5DMHA 1G6KA 4KK4A 4B5KA 4LUCA 1ES9A 3UM9A 2E4UA 3AFOA 1RPZA 4PG7A 4WKCA 4P0QB 1KDRA 3K16A 3KYDB 4DQVA 4BV3A 5CTJA 3TJZA 3K0SA 1XSEA 2FGJA 1DKQA 4CG2A 1UBOS 2OO7A 4EO7A 4KAFA 3QTTA 4QICA 5DHAA 4PINA 1GGEA 4MKXA 4DIFA 4DJFC 4F86A 4DJAA 1M7HA 3PB3A 1YT5A 4K88A 4OQNA 3UXHA 5CM2Z 3EA5A 2NU6B 3L3BA 4FN5A 4R1OA 1HKUA 4JUFA 2W6OA 1RRCA 4IHJA 4MGHA 3VKWA 1B3RA 4UCQA 1U2PA 4JJ4A 1TW3A 2Q6IA 4NOLA 5EE1A 1L4NA 1VCIA 3UT5B 3W3AD 2Y67A 3F6YA 4DR7B 1VL1A 2H16A 4NCXA 3DZFA 3U0VA 3FPKA 4M86A 4HDMB 1ESEA 2DJ5A 4F97A 4CIAA 3HFJA 5L3SB 1E9VA 3I0NA 1L7PA 3KDSE 4RZHA 1ZD8A 2OCBA 4NE7A 2C5SA 4JNKA 1P60A 4LGVA 3T4EA 1R0CA 1V71A 3BILA 4LDJA 4MVWA 4U2DA 2O7RA 1YVUA 4ZD6A 3S7TA 4F4FA 2VBCA 1MXHA 5DBFA 3WO1A 2VHEA 2YJ4A 2G1UA 4HTAA 3JRXA 4MPTA 4RS4A 3GD5A 3ZHOA 1L8XA 2E55A 2PFSA 4JA2A 1W6UA 3ZDYB 1UWVA 2XGOA 3K3PA 5KWJA 3HA3A 1AA9A 4X8OA 1T5LA 2FZKA 3I61A 2H3EA 2I66A 1RI2A 2XRZA 2QV0A 4BGDA 1QHHA 3WWDA 2IIPA 1KOFA 2OUIA 3HWX1 1LPOA 1A5SB 1DFIA 2ZBPA 3BL8A 3M0EA 3P19A 4K1LA 4KVFA 3EARA 5IJAA 2GASA 4TXHA 4K28A 1RFGE 3B85A 3C7DB 5F3WB 1YK1A 3LT0A 4TXNA 3PNPA 3FR8A 3V34A 3ZK9A 4ZFNA 1JG7A 1O5OA 3WK5A 2PM8A 4XGIA 4CQLA 1YRQA 2HWUA 5M2QA 1TTHA 2FMIA 4HVCA 3EPJA 2A58A 1JE1A 4WOPA 4F71A 1FRFS 2AR0A 2NQ8A 3COYA 4O4HF 4FMCB 2A1TR 1HNXB 3PFHA 2WRZA 3HO1A 4IGFA 6AT1A 4EG1A 4WLEA 5KWEA 2JLAA 3WAKA 3TUZC 8GPBA 3D8NA 5KKNB 1ZR4A 1VCNA 3KPWA 4GD3Q 1DC6A 1CRPA 4Y98A 2Q0XA 1CUBA 4Q6WA 3ZIAA 5G4LA 3TZQA 1M2WA 4OHUA 1C30A 3NR2A 3DVAB 5PGMA 3VNBA 1KS9A 3QXCA 1R6AA 1X3SA 4DIEA 4YVFA 4M1TA 3VX3A 3AHJA 1TZCA 1E5DA 4QSHA 3S8MA 4IAOA 2GTHA 1V26A 3KQHA 1EA5A 2CUNA 3U7JA 1OPRA 1IJBA 2EW2A 2PUHA 4JLDA 4LX0A 3RS7A 3ZHCA 3ZXXA 4CV2A 4EATA 3AUJB 1KKLA 4OJKA 2SCUB 1ZSVA 4XCQA 3T5AA 3T7CA 3ZCUA 1L4KA 4J3FA 3AUKA 1YB5A 1Q11A 3AKZA 4OPMA 2VTDA 4D02A 1QP0A 4JJ7A 1JKJB 1E89A 2Q2NA 2CFIA 4F9FA 1UAYA 2GN0A 3ELWA 3FYUA 4G1FA 1H9AA 2PKQO 3IESA 4QNMA 3VTAA 4BVHA 1E3JA 1R0RE 2Y27A 2O3RA 1M8GA 2KQUA 4K05A 4TTIA 3SQMA 1A96A 1MA0A 2YN2A 4XLLA 1Y82A 4JGGA 5ALEA 1NXWA 1Y0BA 3C97A 5IDXA 2HY7A 1Q0TA 3ZJ5A 3G9QA 1DOHA 2I55A 3X1ZA 1EBBA 3R0VA 3TQIA 2AEJA 2GBPA 2XLBA 3OLWA 4FLFA 4J9VA 4AG3A 3I30X 2Z57A 1L5NA 4LSZA 4XWKA 8ATCA 3TQQA 1E0SA 1KAQA 4O2BF 3OCJA 4II3A 1BFDA 2QVZX 3K15A 1Q0RA 2AJCA 3R09A 5DYIA 5FF9A 4LJYA 3DTVA 4HN4B 1E6WA 2I6SA 2A0YA 3DL7A 1R0KA 5I3ZA 5IWAB 4ISBA 2BBWA 4X61A 2NUAB 3GVCA 2RI0A 1I0IA 3GLKA 1VHQA 1L4GA 4YMLA 2B1JA 5AOAA 5BOSA 3MG9A 3I92A 1UKYA 5ECDA 3AHFA 4QRDA 3D4OA 2IYYA 2QK4A 2XADA 1RAAA 4Y2TA 1ATIA 3UJHA 1Y3HA 3A14A 1ZPDA 1PQPA 4G0XA 1V9SA 3O94A 1I7QB 1TYBE 4RY8A 4MUKA 3UJAA 4LECA 1SRQA 1TA0A 4KE9A 2GBCA 3ZWQA 4BIIA 5HG0A 1GNSA 3ORYA 2W8ZA 2VAWA 3GRZA 3MCTA 3OOYA 4IJUA 1KDYA 3WYFA 1KI1A 3N1UA 3F74A 3EOZA 4XGRA 3T3GA 4U6QA 4A2QA 4DCCA 1NYRA 3OC0A 4LMBA 4YT5A 4I66A 4ZOEA 2ATIA 4IS2A 3BWDD 4PPGA 4H27A 4CXMA 1KEVA 4Q7MB 5TIIA 1SCDA 4ML3A 4C20A 4DLRA 4E46A 3W7VA 3O2QB 4U7WA 3VBCA 4J16C 1WZ2A 2QRUA 2QTWB 1E59A 1PW5A 2PU5A 3PDIA 1EK5A 4O4JF 4XEUA 4ZCLA 4EVRA 5K03A 3JVIA 2GTIA 4G1UC 5GJCA 1DJLA 4H0FA 4MICA 2EGUA 4OEHA 3HL4A 1RI3A 4A6DA 1XVIA 2ZRDA 2W2NA 3W5SA 3VC1A 2IYLD 2VVTA 3H05A 4MQLA 1ISIA 3G2LA 1FFSA 3WX0A 3L6RA 3HO8A 2ZT8A 1ORHA 4M76B 3IT3A 1OZHA 3CV3A 4NBTA 4RQTA 4OAPA 4MUHA 1OFVA 4FKZA 1N34B 5ADHA 1ZKDA 1ZM9A 5FPHA 8LDHA 5CA1A 1Y6QA 2H4ZA 1HUQA 5GONB 2RFLA 5DYTA 4KQ2A 4UATA 1E3WB 2YZGA 2CHQA 1Z4OA 5E2AA 1AHHA 1L5SA 4PLFA 3WB0A 1G17A 1F5SA 5ETJA 2FMXA 2M1ZA 3OQIA 3IAEA 4YCJA 3P2JA 3VR4A 4E5PA 3SQLA 2WD8A 4EL5A 4YX9A 1FW6A 5M3BA 4QM7A 2EFEB 1QH8B 4HB3A 5KYXB 2F3UA 5F51A 4Z1MA 2YWGA 3I2GA 4B9AA 5BW5A 3KU4A 3COSA 3VGJA 5KDDA 4QECA 3C7KA 3GFGA 4B80A 5DSTA 1DAFA 2KBEA 5FBRB 4MA0A 1PJZA 3CG4A 3T7AA 2OV4A 2ZUBA 4JCOA 3NCTA 4WDRA 4X1IB 4ZPXA 3D5TA 1TKRA 3UK0A 2XF2A 3R7WA 3V1KA 2ZCJA 1YS7A 1IBMB 4ZVPA 4CG3A 4X41A 1P75A 1LB1B 4OKNA 3GWZA 1GQRA 2X1VA 3GOHA 4N7RA 4B34A 1YL6A 3M5WA 1DUIA 1A9OA 4G4GA 1SKQA 5ECYA 4U7GA 4D9IA 4BNJA 4WJZA 1K3UB 4QU0A 4HATA 1NBME 4LDAA 3L8YA 1YQDA 5ALKA 5LBIA 5FTNA 2P6MA 2IHUA 5A2GA 5EKUA 4ZQFA 3CVYA 3ZVKA 5EAIA 2YV2A 5ALRA 4AMBA 4AMZA 4CKBA 3RYFB 3GAAA 1LGYA 2C5FA 4FT2A 3LGXA 4XPZA 1MIOA 5I7WA 1TYZA 2QQ0A 4XDGA 4E13A 4RJTA 3Q0EA 3QVGB 5H70A 1F51E 1BD4A 2QW1A 1BCSA 2C2ZA 3ROQA 4DT1B 821PA 2DLCX 4OQQA 2BOVA 2FSVA 3A7DA 1OLXA 1VP3A 1RYEA 2UUPA 2R66A 3AF3A 3DM5A 4W82A 4W9NC 4W1SA 5KOHA 4DSZA 1F7VA 4RJKA 4OB6A 4YV0A 5BSMA 4DVGA 5C1PA 1SD1A 1QMGA 1XD2B 2MWMA 1P4SA 3U5TA 4RIIA 1Z4LA 1SHTX 5AVJA 4JI6B 2QP3A 4FSDA 5C7YA 2C7OA 1X1SA 2OHJA 3T5BA 1AQUA 1E2UA 1Q2XA 2HDWA 5EZ5A 1PZGA 3CYFA 4PX5A 3ROEA 3X1DA 3FLMA 1ZD9A 1U80A 4O2AB 5C8VA 2WK1A 2GSWA 1GZ5A 4LWOA 5KTYA 3NAMA 4EM6A 4CMCA 2IJGX 4C7VA 5CXQA 3FA2A 3VJRA 4MYRA 4DMRA 2IGBA 4EFMA 3VAAA 4HAYA 1P4AA 1NKVA 1K8YB 1W5AA 2B1GA 4NZYA 6NULA 3BD9A 1GCUA 2C31A 1NSFA 4AK9A 5DF1A 4AO8A 1QJCA 2YV3A 1I7NA 4MQBA 2HIHA 5AI8A 2PKRA 4WZBB 3SX2A 4ADSG 4ZIRB 4L4SA 5ER9A 2I4TA 1GPJA 4D9BA 5HCNA 3AIMA 3WFIA 2QVXX 2J5QA 3V4VB 1ZMRA 3DF9A 4KMMA 3DWGA 4QTUB 1T4CB 2BDTA 4QVKA 1EUDB 5DGTA 4E5VA 3G82C 2I3BA 3HVKA 4HD8A 4NAVA 1Z7GA 4Y0NA 3TZCA 4F3CA 1CQIA 2B94A 1CXZA 2OM2A 4HNQA 4I9UA 1FP4B 4EW3A 1C3LA 1LBHA 1X74A 1AQLA 4GI5A 3TCXB 4TSKA 1IPHA 5I45A 1RKQA 4UTPA 1KL7A 3AHIA 3R41A 5JMOA 4GIBA 4EKIA 1YFJA 2Z3ZA 2HREA 2Q9CA 4KLRA 3WZMA 2OE2A 3CNNA 4MHOA 4BE9A 2CVHA 4QYWA 4G0YA 1NHWA 1T5IA 1ZK3A 1HG0A 4FPXA 4EYEA 5BN4A 1U0TA 1BGXT 2FSPA 4TZ6A 3B51X 1USVA 4TLCA 2K2WA 3IDZA 1OGJA 4M87A 4W7SA 4EFNA 1A9PA 1W2GA 4OU5A 1SOUA 3JALA 3C14C 3ENVA 4ERXA 3V3KA 1U2RA 3B2NA 1F8XA 3F71A 2CXXA 2RBGA 5WRFA 4J94A 4UPDA 3GK3A 5GOTA 3WGMA 3MD0A 2Z56A 3RIHA 3FXAA 2RKOA 2XUPA 4IMJB 3RWBA 1UUFA 4A2WA 5K3CA 1WTCA 1XRLA 4S12A 3AO0B 4EMTA 3ZDFA 4KGDA 4JIMA 2EBFX 1YB2A 2ZSAA 4RKQA 3OCYA 1UF9A 1W47A 4PLWA 1XHFA 2O1XA 3TI7A 4FHZA 2P69A 1WKCA 1Z0AA 3QG5A 1C8VB 4B87A 4DS3A 4RFVA 1OLSA 1YCDA 1NONA 4QUDA 1CVRA 5BSEA 4RIEA 5DXAA 1D2MA 2H8KA 2QORA 3MT0A 1NRXA 4QDJA 4DAEA 5B7NA 5AICA 5TE9A 2DBRA 1KAHA 4P35A 1Z8HA 1J99A 4TLBA 3EDRA 5DHSA 1NU6A 5JJIA 2YHIB 1CPYA 1GNQA 4LISA 3C7CB 4V3BA 1O96A 5L7YA 2OAP1 3LOPA 1NRWA 4IQ4A 2LXNA 3A04A 4BY9E 1SFRA 1VL8A 1KARA 1P4JA 2XD9A 1WHSB 5J5VA 3T5CA 3VNRA 4ALMA 4EX6A 2X2EA 3WRVA 4MS4A 1UBGA 4IM7A 2FZ5A 4ETIA 1R3UA 3L1HA 3OH8A 2Z1MA 4HAOA 1U5BA 2MINA 2AQKA 1MOSA 2AGVA 2V7QD 2NNWB 1M6VA 1NYLA 4FW8A 4Y1FA 1JYSA 4B8ZA 4DYVA 3KT6A 2A6PA 3AXTA 1P0FA 4NMLA 3U7QA 1Z6ZA 2C5HA 4TVBA 2Q1UA 5EWMB 4BBAA 3T9DA 3DB1A 4P4UA 5KMGB 4C30A 2Z8ZA 1G66A 2EQBA 2GLUA 1JAYA 2I29A 2P68A 1HFWA 3OZTA 2A67A 2H1RA 1TIKA 2HF7A 4LK3A 2W2VA 2XMBA 4QGFA 3CSDA 5EL0A 4D45A 4DVJA 3ZCXA 3GJRA 3NTQA 3VC3A 4U9UA 2X1MA 1O6FA 2X42A 1XLTA 2ONZA 4OSEA 2P2DA 5F4BA 4ZI7B 2J1LA 2ID4A 3QM1A 2JHAA 3TCNA 3GFVA 4B79A 4MIKA 4MWGA 4QJ5A 5CK4A 5EQDA 1DFGA 3BWCA 3MHTA 4OX9B 1ZJZA 5DTQA 1KEKA 4L0QA 1E5TA 3AKYA 3RKRA 4LA4A 4B6RA 1WEKA 4V0MA 1GPDG 3JTMA 1KSHA 1J23A 4BQIA 4YRMA 1BO6A 1KBQA 1X13A 2JANA 4JZKA 4CEJB 1NL3A 4E6EA 3C41J 3CKYA 1QCCA 2YJNA 2Z98A 5AKYA 2C20A 3VR2D 1FSSA 1K2VN 1QFSA 1C1DB 1UBMS 2C3PA 1LV8A 1MX5A 2DFVA 2NU7B 2W2KA 2F1JA 3KQTA 5CDGA 2HA4A 1U0RA 1FCJA 4EITA 4JJ8A 4WFJA 3AI3A 2WM2A 3D3JA 3M3PA 3LQ1A 2H3HA 4IGKA 2JJ8A 4K0RA 4PNEA 2XRFA 3OI7A 3GAZA 2Z6QA 4Q03A 2FN8A 1FX0B 3EIXA 2PKYX 2F43A 4Y2VA 4CCYA 3OIWA 2YASA 2R7KA 5CDSA 3DT6A 2OGWA 3M4ZA 3PFFA 2C2WA 1NKTA 3E48A 4RZIA 4YR7A 2UZ4A 5HMLA 1ZUWA 3T5GA 3EMKA 5DW0A 3USCS 1JR3E 3JATB 2ZDHA 1CUWA 1A9RA 3RYIA 3PUVA 3W5UA 5CFMA 4D8WA 3WA7A 2HYIC 2WJVA 4EGAA 1DEXA 3Q40A 3QYAA 2IZ0A 1T9DA 3L7CA 5BQPA 2AIRA 1LNSA 5GJBA 3B13B 2I76A 2TS1A 4JBWA 1KQGA 4C7KA 3CUVA 4XVQA 3X1KA 1YGYA 1PRYA 3T3IA 1YZQA 2C54A 2P3SA 3C3XA 4DUZB 1CY2A 2O0LA 3FGZA 1A2BA 4V0LA 5E6SA 4UULA 3K92A 4HLUA 1ECFA 1MX9A 4C4YA 1WY5A 2Z5GA 2WHRA 1XQ6A 5E3IA 2HRDA 2OWDA 3QYJA 2JKZA 4HS9A 2A9JA 1XPOA 4YRLA 2BLLA 3RD5A 1XZCA 2JATA 3CZ5A 1J7KA 5J59A 2W70A 3DHNA 4UMFA 13PKA 3IUYA 2IQIA 1OC2A 4P84A 3DCNA 4M0FA 2H0RA 3OAAD 2HLDA 1ID8A 2VK2A 2FF7A 2Z04A 4AB1A 2RGBA 2JEOA 4BQEA 4ENVA 4J1SA 4ZOLA 1L4EA 2OC4A 1XALA 2VRNA 4JD5A 1P1KA 1IRXA 2VAPA 3BWMA 1AGRA 1P2FA 3WGYA 3E15A 4AZTA 5K4HA 5KU1A 1UBRS 2REBA 3C6XA 2DU8A 1BHO1 4DR2B 2VTBA 3UA4A 4J0GA 1PFVA 1M2GA 1Z06A 3MRVA 3CPEA 1HRKA 2A0FA 3D7RA 1X7HA 2AOTA 1ZEJA 4RXUA 4N39A 2I7XA 3C6BA 4W1RA 2XBMA 1Q95A 3Q3CA 3H0EA 3SR3A 4MVJD 3SMVA 3U3MA 1C3VA 4D80A 2XCTB 4L5AA 4ER6A 3F8WA 3QLUA 3LZCA 4NK4A 1QIDA 4RSGA 4BJ1A 1Y7LA 2CSUA 2JHGA 1GDDA 1O95C 2GPWA 1KWKA 3Q8LA 3TLMA 4J0DA 3PQ3A 1M83A 3KJQA 3PL5A 2YTZA 2BW0A 2IU4A 3TSAA 2ZIXA 3M9XA 2RBEA 2V65A 4GZ5A 3AUSA 1U7TA 1ZINA 5DLEA 4EPVA 2OLJA 3TM5A 4HWRA 5JG7A 4DUGA 4DIBA 3NETA 3ZZ1A 3WBKA 4X85A 1Q5PA 3OFSA 4B5LA 1ENPA 4UM5A 3U3KA 4PONA 2GPJA 3DFIA 3ZWNA 1GUAA 5CEEA 1JKFA 3L7AA 4CTJA 3UHFA 1A8QA 2Y92A 1KS2A 2V6BA 3OSZA 3F47A 2WQ7A 4BLPA 1E94E 1TECE 3F3YA 4IWNA 4NV3A 5JZSA 1MDFA 2MYNA 4QZVA 3UAXA 4EYQA 4ZQHA 1BNCA 3BTSA 1N4DA 1ZSYA 4PY2A 3HG7A 1Y1KE 2IOFA 2OGUA 3I04M 3PEVA 4FNOA 2OQRA 2YBDA 4L95C 1M10A 3H3FA 4OQ4A 4JT8A 3EXHA 5JCXA 4AAYA 2J0UA 3G7NA 3USZA 4OYYA 1NWHA 5DM60 2ZRBA 4WWHA 2Y1DA 2EU8A 4I9HA 3ZEIA 1L1RA 3KT0A 4ZHSA 3U44B 3IB3A 3MGCA 3UUEA 1JWLA 5BVGA 3PNYA 1RLOA 4KWTA 4NICA 3M33A 1NBAA 4WA7A 5HQ3B 4ZVNA 3KKKA 4G4IA 1MO6A 5K3SA 1P8AA 1P3JA 1U6IA 3A1TA 3OSUA 1EPUA 4ZV7A 4ALLA 2EWVA 4AN4A 4DA8A 3EFOA 3GGDA 4C05A 4E31A 4UFPA 3W5DA 1LPMA 4YAFA 1Q19A 4OM8A 1WRBA 3VR6D 1MJ5A 5IP5A 4Q1FA 4HZGA 2ZYGA 5TC4A 2FF5A 2H1OA 2EG9A 4H16A 2GJ4A 3PT9A 4J4HA 2DBQA 3DO5A 3OTQA 3FPEA 1W0JA 3OM0A 4Q4CA 3U19A 4TWZA 2OFXA 5JXGA 2GH1A 3CKKA 3HCOA 2EJTA 2D1SA 5IN5A 3VTFA 3TFWA 4GQIA 3IV9A 4YRPA 4ZV9A 2IWHA 2D1FA 2O1SA 5JNUA 1AXRA 2ACEA 4ZVQA 3ZJ4A 3BH0A 3TVYA 1YQ9A 1JSLA 5TPWB 5JNWA 2XPCA 4JN6B 2JFBA 1KMCA 4XYLA 3KQKA 5FWDA 1AZSC 5AM3A 2GBLA 2C98A 4DFDA 1NVEA 1TU3A 1NF3A 2C2KA 3WL8A 1TK9A 4ECEA 1DO2A 1J8YF 3W4JA 4F3TA 3BMNA 1DBQA 2ZUSA 3SYNA 5ERYA 4LJRA 3NBQA 1K27A 5IABA 2FCRA 5ES4B 3FE2A 2PX8A 4IIBA 1QP4A 1VLZA 2B1IA 2JCSA 4FHFA 4FGJA 4YDRA 4TT8A 1C1YA 1YDFA 3N6RA 2RAVA 4IIGA 2O48X 3EXAA 5FKJA 1K66A 3B1KA 4NJEB 1TZKA 3N8HA 3VZCA 4YCNA 3ZDRA 3S2YA 1RWOA 1JEQB 1E9SA 2PR2A 3NHZA 4MQFA 4CQMD 2C9ZA 4XUGB 4YK7A 4AYWA 1SCBA 2ZU0C 4LJLA 1U9ZA 4Y9UA 1FDTA 4DM7A 5FLXA 2QW8A 3HTXA 1JQ3A 3JVDA 4O4LB 2H5IA 3PUHA 3MEQA 4XGNA 5B6PA 3R5HA 5FUQA 1A97A 1TUBA 4HGOA 1CV2A 2GI4A 4JXKA 4F4CA 5I4KA 3W3AH 2R0QC 1ZIXA 4J0KA 1Z25A 2M1XA 1PNQA 4QXQA 4Y7DA 1KQNA 2OO5A 3TSOA 1YIDA 1XJQA 1R3DA 2XUJA 4LXHA 3TOXA 3GEHA 5BRJA 3WDKA 1EE2A 4PRLA 4RMNA 2MR5A 3WLFA 4DLPA 1YMVA 1AV6A 1H8HD 2WU3A 4U5QA 3PITA 1ZGJA 2OSVA 5HDQA 4DHWA 5KYUB 1NJ6A 3OJEA 2LDBA 3HPQA 5A9SB 1BSVA 3GP3A 5JAHA 4A82A 5ICCA 1Z17A 3L5OA 1OXVA 5G3YA 5K8TA 1RCTE 1HPLA 3ZXIA 3K70D 4I9FA 1GPNA 3RJ9A 4NKRA 4UVHA 1KAEA 3VQTA 4N1AA 4N8SA 1S4QA 3M4NA 3RDPA 3AOEC 4EZIA 4WKNA 4UUPA 2L19A 5DHFA 3RSLA 2P2CA 1NSYA 3RGGA 2BM8A 3AF0A 3DM9B 2Z30A 5ALDA 4BFSA 4NBWA 1CX9B 3DEZA 3NTOA 3N2EA 4Q4DA 2WFLA 3GUHA 3IQDB 3PBKA 1QH1B 4LY6A 4YGYA 4G5OA 5G0TA 4YAEA 3IV6A 3UMGA 1RD4A 2PL1A 1YB1A 3OY7A 3PUIA 3LYHA 3FNBA 3Q0IA 3SKYA 3KWJA 5BVHB 1E2PA 4EUKA 1B93A 2VCYA 1WDKA 3I1YA 2X6QA 3OO1A 4UTVA 4TV9B 2XMDA 3T9CA 3SSNA 2V7BA 4IWYA 5IT4A 2YICA 3W1WA 4B7ZA 4ZVRA 1TA9A 2BP7A 1EZZA 1N2SA 2QG6A 3O83A 4GBMA 2UUAB 3O8NA 2UZ0A 1GADO 5ESRA 2QTCA 1XWFA 1V1RB 5JPIA 1WY7A 2IHJA 2BGJA 4RJ2A 2WU8A 1CRLA 5IAOA 3HVJA 4MGEA 3QQ5A 4PZYA 1CCWA 1V1MB 4HRXA 2AYXA 1AUOA 4MW0A 2GJAA 3HV2A 4RCYA 3HKEA 3STUA 5JFTA 1YS6A 5DRYA 1U2ZA 2I99A 4U0KA 5FWYB 4D4HA 1GTSA 2C3YA 3QFRA 3G0IA 1AO0A 3GJTA 3TRFA 1IIBA 4CQMA 2A5FA 2B8TA 2F3SA 2R86A 4QXPA 1WW3A 5KZMB 3VHRA 3MWDB 2A88A 3GJ6A 4W8OA 3KQUA 3FDIA 1WPGA 1VMAA 2JCYA 3A8TA 3AP3A 3DCJA 4GGOA 2CEKA 1UAGA 3EOBI 3UEOA 3JQBC 1QDUA 4K6FA 3QG1A 1E4EB 4Z9YA 4EJMA 5T6BA 4DLLA 3DD5A 3GJ0A 1SEVA 3A1FA 3SYRA 4U3JB 2HYDA 4PV7A 1R6BX 2VZLA 5E0OA 3DBRB 5LP1A 1VG1A 1PL0A 3HYSA 4HQ6A 4L0DA 3ZQ6A 3WR5A 5IM4A 4LE0A 5TEVA 2CNWD 2IZ7A 3E7DA 1SZJG 1VGRA 1G8FA 3GA5A 3HLKA 3KXLA 3OJCA 4DJTA 3KSAC 3AW8A 4ND6A 3CRQA 4DSTA 2I91A 5BNTA 2JFFA 1VJGA 4ILKA 5CB4A 5GM2A 3R3UA 4QUJA 3G3EA 2GEFA 1DHTA 2Y1WA 1UM9A 1VJRA 5FORA 3CVXA 1R4MA 1TGVA 3Q9UA 5TPZA 1FQKA 3EWSA 1NBMA 3U37A 5BMOA 5IULC 1IY9A 1NVMB 2G9ZA 2ONKA 2ZLBA 2CUTA 4NULA 5BPFA 3RVMA 1AGYA 4UCWA 2BI4A 4JITA 5CITA 2IY7A 2R11A 1GIAA 2IODA 2UVPA 2HQBA 3FMOB 4GPIB 5LLDA 1SOVA 4MYTA 4HFJA 5E6UA 4XDZA 1ZX1A 2YRXA 2YIJA 4XFDA 4OGGA 1JECA 4Y6PA 3MOIA 1JLHA 1SVNA 2DQZA 3BFJA 3CCBA 3VOTA 2UU9B 3HACA 1GAQA 2OHIA 3KCQA 3RRZA 4NZ9A 4M0MA 2PUTA 4NABA 4QDOA 2BM9A 3LP8A 4UU8A 2ZRJA 3EW7A 5MGBA 1US8B 1KPIA 1YI1A 1IDN1 2R7LA 1ZD5A 1QF9A 4RGVA 2FR1A 3RIXA 3X2FA 2PWPA 4GPZA 3C6QA 4RH0A 3C5HA 4D57A 5GWXA 4FFMA 4YUWA 1C29B 4EY6A 2O2JA 1A8UA 2OD9A 1ZLYA 4TM8A 1NMZA 4V2UA 1PCXA 4FFBB 5F2OA 3LWDA 3TIXB 3WSVA 2PWBA 2R6AA 2TMGA 4B8YA 2PA0A 4BZWA 3IP3A 1P17A 3MWFA 3QI2A 4FCWA 1SU6A 5HIKA 3DCYA 2QZ9A 4TLLB 1JA1A 1ARZA 3Q7QA 3LHDA 5CPBA 1A4XA 2MSWA 1ZN9A 3BE4A 4ITUA 4R9SA 1P0QA 1ODLA 4OXQA 5AI6A 3TLGB 4Q82A 1ID1A 4YPOA 1ULSA 4ZAFA 3EX7C 2C1EA 4YV7A 2B98A 1J9EA 4LRWA 4JLWA 2O8EB 2DE0X 4PW0A 3SJBA 1YNSA 1AZTA 2YBEA 2PUGA 2Y1XA 3WGIA 1I9CA 4UUBA 1W4RA 1G5QA 2OCPA 3A4NA 4CMBA 4DMUB 1WP4A 4KN8A 1U1EA 2EBHX 4I8DA 3RYHB 2GARA 1PSWA 5J1TB 3I6BA 3KR1A 4W6QA 2QZPA 4DDKA 2B21A 2H06A 1HSOA 1ZD2P 1TU4A 1B6TA 1J2YA 4P5PA 5D3MB 5IPFA 3JQ8B 4HLDA 4HSGA 5BMVA 4MA5A 1AH2A 3QE4A 5J5AA 4OGLA 1O97D 2CLHB 2KYRA 4Y2XA 5TDHA 2W2XA 4J6EA 1IWOA 1W9HA 3HXLA 4ND4A 2F9MA 2LD4A 2BFOA 4LY0A 1C7JA 4FFOA 3DEJA 1HDCA 1CZRA 1EK6A 3C3AA 1FVFA 4PQRA 2A9FA 2ZI5A 2O2YA 2P0EA 3BYZA 3O31A 4G8DA 4PC1A 4JMPA 5EVJA 4BATA 4BZXA 4H18A 1TT5A 3I9MA 1L7VC 4YT8A 4X6LA 5THKA 5KAMA 4FS8A 3B6MA 5C4IA 2IIVA 1CY4A 3L7NA 3MFQA 2XWQA 2GPTA 3D6VA 1UK9A 4XPIA 2PIAA 1E9FA 1N9GB 3V33A 3WLRA 3AVTA 3FSGD 3W4KA 5ADVA 1KETA 3G2HA 1DT3A 3NHPA 3W2FA 5HXAA 4AKHA 5JZOA 4XM2A 3PF8A 3T7RA 1QLJA 5JQGB 2BRUA 2QVGA 3ZTTA 4NV1A 5FOSA 2PRIA 3MMNA 4UAVA 5GY7A 2QG9A 2PVSA 4KDFA 2DWCA 3P0FA 1QOPB 1CUDA 2IPOA 2RHLA 1W19A 3ABQB 3EGDA 3FVTA 5JQWA 2HMWA 3HC7A 1SBYA 1WUKS 4MCIA 3H7AA 4TKUA 1MT0A 5F1KA 3WMRA 1MCZA 5JTTA 3SJAA 4IHJF 2PDAA 4GOLD 4RK4A 2B78A 1M6HA 1USIA 4KAAA 1JR3D 1V8FA 3M6FA 3ZW7A 4AZSA 3ONDA 1HNNA 2BKVA 1UOEA 3FFXA 3KWFA 3EVEA 3U3RA 4DQXA 2OY0A 3ORRA 3KZCA 4P0TA 2JCGA 4RHFA 2VP3A 3E9RA 3K8YA 2VRWA 2C97A 4MGIR 1RWPA 5IYZA 3B82A 2BTQB 2OV2A 1QYRA 1QRRA 2O2SA 3NCHA 4I4CA 4G4JA 1QKIA 1XCOA 1B2RA 3NYQA 4DRYA 3T12A 4IIEA 1CULC 1K8RA 1N0WA 4KX5A 2OXTA 4KQ1A 1QANA 2LIPA 2ALJA 3P9ZA 3JQ7A 3A32A 3W6PA 2CBZA 1RJEA 1Y3IA 2CKDA 1M0WA 2IDZA 4KYVA 5G0VA 3CRRA 2P75A 5TNXA 3AQIA 4EYSA 2OXEA 5CG2A 2F1IA 3LKVA 3ZC3A 2A4MA 3R3VA 1JYFA 2HD4A 1UADA 1QYIA 3A28A 3CJTA 5KQRA 3PKJA 4CR8A 5COBA 1Y1PA 3U9SA 1CETA 1GUDA 2VUSA 3H3XA 1CWUA 1ZIPA 2QEQA 4CCAA 5CDHA 4REQA 3FRIA 3OLXA 4RD2A 4MB6A 1E1MA 1WB5A 5HM8A 1QV6A 3BCRA 1N78A 4M8SA 5BYKA 5JSKA 1EFCA 1K68A 1PGPA 2ZXFA 1EP2B 2RHDA 3D8TA 1FFBA 3R7FA 4ZYVA 2O3QA 3MWLA 4G4SO 1ZJYA 1RLJA 1JFLA 1YZLA 1F4LA 2NTYC 3G79A 3GIDA 3Q72A 5AM5A 1W36C 4HUQA 3CC8A 5JEEA 2FLKA 4WERA 1JH8A 1I2MA 3QX3A 3F7TA 1ZM2A 3KWMA 3F2VA 4WSOA 4O3FA 4CLOA 5EJ4A 3AFIA 2AI1A 1NXPA 4D42A 3Q10A 3W78A 4IDDA 2AC7A 2DQYA 1P3Y1 1RWVA 3V7FA 4P5EA 1PZNA 1P4GA 3KSDO 5AI0A 2NVOA 3FOFC 3NPAA 3IPAA 1UBJS 2AHRA 2CHEA 2HLPA 2OECA 4HUJA 2ZIGA 3RW9A 3LW8A 2QL6A 1ZU4A 3LPCA 1TUIA 4OFWA 4R05A 1QCDA 1YKFA 1OIXA 3HI6A 2VPYA 3OJWA 2HQ1A 2RGXA 3FETA 1L5QA 1IY0A 4H3KB 1PG0A 3ETCA 1P31A 1T25A 2ZAOA 3T41A 4A0FA 3WRXA 4IXWA 4CFZA 4BMOB 3CVWA 1QO0D 3IP7A 1P80A 2ZJ8A 4OI4A 5BT9A 4AF6A 1CEYA 2Q3FA 1OV6A 2R62A 4EEZA 4XDHA 2DPXA 4ACBA 2WHQA 2X9QA 2RDMA 4D6YA 1B0PA 3LYUA 5K09A 4DDHA 1W36B 1OXBB 2CXTA 2ZWPA 4G5XA 4N7JA 1U4OA 3X43A 2ZJOA 3ICVA 5T4BA 1Z2NX 1PTJC 2O4UX 2W0SA 4TV8B 1DKRA 1FP7A 4PHGA 5ALLA 2XE8A 1G5TA 1JR3A 1N5DA 3P94A 4D9EA 3L04A 3E3OA 1Q15A 2IXFA 3B7PA 3SC2A 3O8OB 3K05A 3WNVA 1NMSA 4BEVA 1PJCA 2RARA 4HX2A 1O08A 2Z5FA 4OXRA 3GP5A 4INJA 2XTMA 4XW2A 1Q1EA 4JI4B 4CDGA 5CD9A 1JAHA 3D4IA 2QNIA 5LMNB 4FYKA 1DRJA 5H5JA 2PT9A 1TMOA 2GBGA 1GN8A 2HNBA 1B43A 2BGLA 3C8MA 3EY4A 3ZJTA 1JDNA 1IG3A 1N7IA 2VLBA 3NB0A 2B8WA 3DOOA 4P2BA 2VEOA 1W85A 3QMWA 4BYMA 5K6AC 1KAOA 3DVLA 1ZD3A 3DEFA 3FI9A 4CWAA 2W2LA 4LY9A 5AJHA 3TYXA 1HA3A 2PSJA 3DZGA 1U8EA 2QV7A 3BIXA 3T9FA 1C2YA 4EO9A 4V1CA 2G8LA 3IMEA 1UQUA 1V3UA 1YSCA 1M2FA 2X0DA 1Y4SA 4IF4A 1V11A 4AJOA 1EHCA 2IUEA 5LB2A 4R8RA 5AXCA 3UK7A 3NWJA 3B20A 4KW7A 2Y66A 2G3YA 3MVEA 1H0KA 4MGYR 2QRQA 4ZHQA 3VHQA 4JC8A 4CFSA 1MR3F 1BKYA 2DQSA 2DQKA 2V6IA 3RYCA 3I01M 2F1OA 1V9LA 2PTGA 3IYLW 5HBRA 4JI7B 1LCIA 1LDNA 4H4EA 3WLEA 1G59A 2Q3CA 5A02A 4JUBA 3PEYA 1F0YA 5JSHA 1CRQA 1FVHA 2GPYA 2VWQA 1GO2A 1HFKA 4L76A 4MQMA 4EKYA 4PLGA 1VLJA 1RRFA 1DRVA 1AT1A 3U1VA 3AHEA 5KYTA 3VPDA 1KDPA 2PQ0A 3G0CA 3AT1A 2X3UA 3QOXA 1XEWY 5FULA 2NIPA 3LK6A 5D5QA 5IZ4A 3KJFA 2MHCA 3MHPA 1D2EA 1E6CA 2OA0A 2B20A 3L43A 4J49A 4V0KA 5CBKA 3A1CA 1H4TA 5HE8A 2VOJA 4IRXA 4P93A 3LUAA 4MJ3A 4JLUA 4L75A 3PQ7A 1VPLA 2DUNA 1XJ0A 1AN9A 4ENPA 5A1TA 4MR9A 1T26A 3KYCA 1EM8B 2OHGA 3QF4A 3CX7A 1JV2B 1ACMA 1S9DA 1VKNA 1ESNA 1UFQA 3FUXA 4MP3A 3PQ6A 1EM6A 2BGTA 2ZT7A 1GUFA 2AUTA 2AJ8A 1PWXA 3Q7IA 4JH0A 1GSIA 5DLPA 1PD0A 1V41E 1XZBA 3R1IA 5F1PA 4JKIA 2R3SA 2HCFA 1NBIA 4BS9A 5CA1F 1L3IA 3GLIE 3FSEA 1W25A 4QOEA 1RQGA 2WG1A 4NMWA 3IAHA 1NZFA 1YCHA 3NHLA 4C7JA 5I9NA 1RJWA 2I5PO 1QK5A 3O84A 3FZEA 1PT6A 4QGBA 4ZJPA 4ZOQI 3U6BA 1FA9A 2QP4A 4A5SA 4H1WA 4OYHA 2GEDA 5ALUA 3ICPA 2Q99A 2PJZA 3UWMA 3W7BA 4DMCA 5CT8A 3G17A 1FJXA 4Z2AA 3F3KA 1YBVA 3AWIA 3N6VA 3R5SA 2FZGA 3KSUA 2I87A 1NX9A 1Z5PA 2X1LA 1DKOA 1I80A 3VX4A 4K9NA 3F98A 2F59A 5REQB 1FYFA 1TCVA 3GLUA 4UHDA 1VLQA 1D2HA 2A1UA 1KI2A 2NXWA 2ZUVA 1IN1A 3QFHA 4BJ6A 3LT2A 2D2FA 5FT9A 2SHKA 5HRAA 3DDUA 3TOCA 1Y5MA 2XOXA 1EK0A 3DC2A 1B00A 3GOQA 3VAYA 4BKOA 1XNGA 3L02A 3PC8C 3PRJA 4KUEA 1LLCA 2FEPA 1YZHA 5JZBA 4ID9A 4LVUA 4ER0A 4MHSA 3W05A 3GLTA 4LW8A 3MF4A 4FMBB 1ESCA 3DE4X 1TEVA 3ZHUA 1JZSA 2NN3C 3DOEA 4NCIA 3RAGA 2WUWE 4PEVA 3EIUA 3IUQA 1I5OA 4YMHA 1A98A 1DPFA 4QL3A 5IRCD 1FNBA 3H13A 3L07A 5THXA 2JBHA 4QOSA 3UBMA 3W8FA 2JFZA 3AJAA 3QMMA 1AKEA 1L5VA 3OHSX 3D7LA 2EKQA 4IOKA 4R01A 2P11A 3UKOA 4URHA 4QREA 3FOBA 3CZCA 2HJRA 3AY0A 1VMKA 3ICOA 4MARA 1QHEA 3M34A 4JQCA 4NNOA 2R00A 2BCJQ 3B5JA 3DO8A 3JQFA 2ZB7A 2MT9A 4DB4A 3KLNA 4J75A 3IDSA 1Y33E 1X92A 2E6UX 5T5QA 2G82A 3SSMA 3C3CA 4M0LA 4U6SA 3IAUA 1JTVA 4G81A 3BB1A 1DRWA 1K8XB 3DMTA 1ZOSA 2P27A 2Q5JA 4MVJH 1VRWA 2XA1A 1DAPA 4O25A 4CM6A 4G5RA 1ZAYA 1FFEA 5BNWA 1II0A 2PMCA 2V9PA 3HU1A 3R8CA 4HAXA 1LVGA 2IL1A 4WQMA 1K8ZB 4PCAA 2O2HA 5LP6C 1U3CA 3L46A 4MWDA 1F1JA 2D0OB 1VJ0A 3CR8A 1RQRA 4LJ6A 4XX0B 3KTOA 3QW4B 4M1EA 5AMXA 3DJFA 3UJ3X 1NXQA 1OZGA 2YQZA 5BUZA 1KMNA 4J1QA 3F3SA 3QNUA 1TQ4A 1MH1A 3ZIUA 2C0CA 1GFZA 1YR9A 4HQFA 1ZK2A 1R9MA 3QVLA 2V5AA 4COKA 1PFUA 3HBMA 5EJ6A 1SKAA 2OFOA 3UJ8A 4UCFA 5LQRA 3Q87B 1GZ4A 3JYHA 1Q91A 1PJ3A 3L8CA 4K9KA 4M53A 4N0MA 1ZEMA 4QPPA 4ZVLA 1RQPA 2JFUA 4JP1A 4OB7A 4OOEA 4UKDA 4AJLA 4INAA 1ICIA 4NYMQ 5K1ZA 1R8XA 1MU0A 2RKBA 2WP0A 2BBOA 3KZMA 1Q50A 3EBPA 5KJFA 3DLBA 3HKDB 4ZU1X 3G85A 1T5DX 1OI7A 4LGMA 1RJGA 4WBNA 1N3BA 4JOSA 2JKVA 4QYTA 1GZ3A 4X20B 4MB0A 5LP6B 1XE3A 2C58A 3TR6A 2MSCB 4WN9B 4EABA 1MPTA 1L6RA 1OI2A 2FW6A 2OYRA 4EHFA 3OTOB 1FXSA 3K9FC 3EJWA 1KZ4A 2AC4A 3EFEA 2AJDA 3KUKA 2W5UA 3ITEA 5CYPA 4A8JA 1NZJA 3AY3A 3CBGA 4OHPA 5CT4A 1MO5A 4JI8B 1GQQA 4FB5A 4DJJA 1DQRA 2YRWA 4K2AA 1ADYA 4LZPA 5ELXA 3IQFA 4NR0A 2WW8A 3G68A 4C0LA 1X3LA 4B4UA 4AX4A 1HORA 2C4WA 2GKOA 3U7IA 1ZM7A 3D6MA 4YRQA 3CM0A 4R5HA 1L7RA 4UD6A 1FS4A 4MR7A 4RH1A 3QVJA 1U7ZA 4U8HA 4D25A 3UMSA 3LUHA 4NP6A 4WOKA 4JDPA 1E58A 1NJFA 2NO6A 3D3WA 3IDOA 2C7BA 2H2FA 4Q19A 5H02A 5LN1A 4QATA 4M6WB 1JHMA 5CB6A 1E98A 3NW9A 1MV8A 5F5XA 3CLSD 3SVTA 3C39A 1MZPA 3UXEA 2CLLB 2AN5A 5CXUA 2RK4A 4J0CA 2PU7A 4KQEA 5CAEA 5EJ5A 3RARA 2M9MA 1F2VA 2PCLA 5JLAA 4FZ3A 3VH1A 4Z54A 3FNRA 2FX5A 2RGNA 5DU2A 3DOJA 2IXGA 1W1WA 3LCRA 4GOND 1RHQA 2OXIA 4U7TB 2I1QA 2ZUWA 4RTQA 1FF9A 1Q0ZA 3X1MA 3H8SA 4FUTA 5F23A 2ZJYA 3I1IA 1S2IA 4M98A 4CN8A 3BICA 4WDQA 4TYNA 3O2JA 2DF8A 1Y3DE 3D0RA 4KQWA 3G2QA 1Q1GA 1FC0A 2AX3A 5IJ9A 3RANA 5LLTA 3RG2A 4J29A 1JHQA 5JSZA 3QWHA 3AIOA 1EQUA 3CLTD 2Z08A 4X71A 3BIJA 2D0PB 4EGFA 4ZZ1A 4DR5B 3KHKA 3HZOA 2JF0A 4YP1A 4LOHA 9GPBA 3AR9A 2AOVA 2WTEA 4H08A 4MUYA 1NXXA 2ZYIA 5KYVA 2FSIA 3ZLUA 1C1HA 4TLDA 2H9YA 3HRKA 4YUZA 2OCDA 4BL5A 5TQ0A 5CNMA 3ZHYA 3ZZTA 3I2JA 1Y9ZA 1AQ6A 2FPMA 1PL6A 1VHDA 2JFHA 2WC1A 5AK5A 4EFLA 1N2OA 2Q29A 5BNFA 3G0HA 4ESEA 1IZ0A 2OV3A 1L5HA 1Z07A 3WL3A 2I80A 4D6XA 4Q3DA 3ZCRA 1LDEA 3GCGA 3PLAE 1XCMA 4RO0A 3IOBA 1T5HX 2WIBA 2AN9A 1X19A 3B1FA 4JFAA 4NV0A 1KC1A 1R9JA 4PZDA 2WJZB 4ZREA 2WT9A 1D6MA 2HK7A 1P4RA 2OZEA 4UJ3A 3VPFA 3KUCA 3T1VA 2AZDA 1X70A 3UOGA 1QB7A 3M6MD 4YEDA 1P9WA 3U39A 2NPFA 1I14A 4YRFA 4DF3A 3IUJA 1TZJA 2E5LB 4NCBA 1X1EA 3V2GA 4GRAA 4PHHA 3O2NA 2IK8A 1FFCA 4RADA 3LM8A 1X9GA 1PJLA 2E4XA 3R4VA 4L5BA 2P0YA 4A03A 4CKWB 3VNUA 1U0SY 1W30A 1JLLB 1K4KA 1N2GA 2JBAB 2Z2KA 3EVDA 3R6LA 5D85A 1T36A 4Z4FA 1P33A 3WL5A 2JFNA 5H81A 2C2HA 3BH6A 3F5DA 4YRJA 5BW6B 2GHRA 3N76A 4C04A 5I7AA 3COWA 3U13A 2XUAA 5JBIA 4BP9A 1ORDA 2JD1A 4YXWA 4KR2A 1T6XA 1YBAA 4UVEA 3O21A 1X1CA 1IQ0A 5ALTA 4PO8A 3RRJA 4PYNA 2JH3A 3FF4A 4L07A 1AJEA 4XQGA 1LDMA 3AKDA 3IHKA 1PJSA 2E85A 3VR3A 5B58C 4OLAA 1U1DA 4OXNA 1NW7A 1E6LA 1T9KA 3DDOA 3RM3A 3ZJVA 4BJ5A 1O5IA 4ETMA 4DLAA 4DV6B 3JYLA 3R0QA 4CEIA 2QVCA 4G84A 2ZYTX 2D0IA 4MV9A 5EWLA 3A26A 3AFMA 2FFBA 3M82A 4P38A 3FYDA 3L7BA 1E3EA 1XU7A 3ZWXA 4MDFA 2WPDD 1A88A 1AB5A 5DO9A 1A5ZA 2HNAA 2IH4A 3L8GA 3EAQA 4RTKA 2ZBVA 3DDSA 4JGBA 1PG5A 5ALQA 3VPGA 2YMQA 3CUEF 4YUXA 1T3TA 2HPVA 3D5QA 3KQWA 3UJDA 4E21A 4EUNA 5D01A 5E1DA 1YL5A 3HKCA 4A6EA 1COWD 3NOVA 4K2HA 3OFND 1CVIA 1MO4A 1O0SA 3BHMA 2Z1NA 4ZYTA 5B3JC 2FQYA 3RVKA 3AY7A 4FFRA 4GOOD 5BR1A 4WZBE 1UK8A 2QLMA 3I3OA 3PHBE 2OBMA 2JGDB 2A5LA 2XGMA 1ZBDA 3HYLA 4K9SA 1Y7HA 4C14A 5LZ2A 2IYVA 4KR3A 4EA8A 1D9XA 3DV0A 2VATA 4N47A 3MSCA 1E5XA 2LWIA 2V98A 1ZRNA 4ZCSA 1O1YA 1OAOC 4JB2A 5HZMA 2X0EA 1P2BA 3IT2A 4L5JA 4ZOLF 3FNIA 1EFPB 1QG6A 2OLKA 4ICIA 1OKKD 3Q3EA 2XJ4A 5IKPA 1S3GA 4ENTA 4A5OA 3OTWA 5HKBA 4ZTZB 2VF5X 4WRRA 2GZ1A 4QU8A 1SB8A 1ISGA 2P9GA 1EVQA 2XMRA 3FVRA 4Q1CA 4LF8B 1JJVA 2LR0A 3K9QO 2EHJA 4HX5A 4JJZA 5LMCA 4KQIA 1CRZA 2HGSA 1DNPA 5IJ0B 5HRCA 3RVOA 1Z0IA 3FDZA 3WNDA 2R6FA 3KG2A 2NXEA 2P7HA 3PVSA 1F5NA 1P5ZB 3HKBA 2H1WA 3GV0A 1Q44A 1H2BA 1UFOA 3IPLA 5A9TA 3OCCA 4WKOA 2QAJA 1SXHA 4XSGA 4Z9AA 1M1NB 1GKUB 2B2CA 3ZGXA 2XDQB 1XGKA 2CBXA 2NQTA 4YJGB 1ZH2A 1GTMA 2OG1A 3QU2A 1S8FA 1ZUNB 3ADBA 2VJCA 3ESXA 1DGQA 2DLNA 3NOOA 4JI5B 4Z9XA 4DB2A 2EW8A 2QGFA 3JWJA 4M49A 2V7VA 3V8VA 2VDUE 3OUTA 4LXYA 1OOEA 2RBKA 3IIKA 4ZC8A 2HU7A 2ZRFA 4KE6A 1FRNA 3BGOS 3DYIA 2ZZMA 3WJAA 5JU6A 2HJSA 3T5PA 4IHKA 5I7UA 3PR2B 2ZETA 4IDGA 3GDFA 2GYYA 2XSZD 4EI8A 1KVUA 1NF8A 2ONYA 2GD0A 3CT4A 4ABTA 1DC7A 4MYSA 4WKPA 1JDVA 4J03A 5A4IS 2E21A 4Q12A 4G0NA 4UCXA 1O3YA 1C0KA 5E4JA 4FWBA 4YLGA 3C6MA 2BEJA 2CD7A 4B7AA 1SA0B 3TTUA 5CDYA 5JWRA 5KYGA 1XRJA 3BKXA 3JQGB 4ZMBA 3G1UA 1BZYA 5I9TA 1T8TA 2J9RA 3R7DA 4G65A 2Z6VA 1E2KA 2IPAB 3BTOA 4UOQA 2X23A 4KR7A 1OH5A 3E0QA 1TJ5A 3DHEA 3PDCA 3U49A 2ZI9A 2NTEA 3PNKA 2GVZC 1J8DA 1B0AA 2FP4A 2H4YA 2C88A 3A06A 3IUNA 3NIWA 3PDWA 2QRNA 4YRCA 3ZU5A 1QG4A 5K4AA 5AKEA 4EIWA 2P6NA 1Z08A 3OWOA 2NYRA 3OOSA 5JFGA 1E2IA 4KV9A 3IUEA 4MQ5A 2LCIA 3SHVA 5DLQC 4G2TA 3V1YA 1NP3A 3LYAA 3MIZA 5ITZA 2Q49A 1ENYA 1UMDB 1H1LA 3QHAA 3PQCA 3ND6A 4IMPA 4JC0A 3GPCA 1N6NA 3A1EA 5LQSA 3THWB 3HMQA 1KPHA 3TOZA 2CVQA 4B2IA 3EVFA 4HAWA 2ZJFA 1J2RA 1RXIA 3LWNA 3QPCA 1MNQA 1R4ZA 2DT5A 3GEIA 3M5PA 3OU7A 4XIYA 3TTWA 1U9JA 3HJAA 4JLJA 1XPJA 4FEAA 4BE7B 2IA5A 3WE7A 2OQVA 5AW0A 4PQEA 2PRJA 5T8KA 5HUQA 5I8WA 1PT5A 1BFKA 1RACA 2F3QA 1FYVA 1OWNA 1WUHS 5GJVC 5LIPA 4D98A 3QKSB 3AUYA 4GBGA 3WGJA 3PHIA 1IBCA 2FRDC 3OZGA 1JMYA 1RLTA 2AJLI 3LE8A 3LDHA 3UV7A 4PFSA 3QKTA 1D5CA 3IEPA 3FDJA 3FRHA 1UT5A 2P9YA 1F8YA 1TDJA 2R7AA 3O8QB 5IMBA 5JAPA 1E2EA 3LLSA 5KIAA 5L4NA 2OD2A 4C89A 2AFIA 1ZOLA 1VI5A 1Z9BA 1HDXA 3I83A 3MZ0A 2UKDA 4P4NA 1U8ZA 3AEKB 4P81A 2D2IA 2OV8A 4GX1A 2CXOA 4TWAA 2QYOA 1IBSA 3PXBA 5TMDA 2GCOB 4EX7A 3H83A 1UC5B 4B85A 2XDYA 3GJ3A 5IVPA 3ZPXA 4PANA 2JGIA 1IN6A 4NPCA 2R60A 1JU3A 5FL7D 2RGUA 1P9RA 5EUBA 1MQ8B 1EGMB 7REQB 3WIDA 5K0SA 5FUYA 3OCUA 3WWZA 2AMFA 2B5WA 3HB7A 1X7WA 2EKBA 3JQ9C 3K7EA 4TYPA 3V4FA 3E7XA 3SZMA 3GCZA 1YE5A 3QEMB 4RF4A 3RBVA 2FG7C 3WISA 2QTRA 4KXWA 5GV8A 5BUQA 1D1PA 2DHDA 1J0AA 4HVTA 3RASA 2VHXA 3M2PA 4Y2UA 4BTEA 5DXJA 3TG2A 3BK7A 4XIIA 4C6SA 5K8JB 3FOZA 4REOA 4PSDA 3B9BA 3COPA 1ECLA 2D2EA 2XUKA 3A2KA 1U0OC 4AFNA 1LKZA 5AKLA 1Q14A 4TL6A 1XV5A 1SUIA 4TLMB 1RC8A 1FDRA 2GM4A 1H6CA 2WSMA 1RQXA 2BVNA 2R1TB 4PFQA 3I09A 4L2IB 5EP2A 5K7SA 1AB6A 2O2ZA 3Q7RA 2YY7A 4GWLA 3DZJA 4OA8A 3CPJB 1TM5E 4X3PA 3P71T 1C8KA 4Y30A 3LDUA 1GCIA 3GR6A 2B4RO 2I2FA 5KTPA 1YU6A 1DU4A 1RABA 1QC5B 1OZFA 2R4UA 3B7GA 3IJRA 1GL6A 1VG9B 4PSAA 4R54A 4UPEA 2A2ZA 1P7WA 4ZDWA 4BBPA 1WZEA 4AW9A 2EQ5A 5HJ7A 4X7MA 3RR2A 2BR5A 5FI5A 1MRZA 1M2VB 1XBTA 2GESA 5F7JA 3L0PA 3TPCA 4B8WA 2X58A 4PIPA 1U11A 2VH5R 1P8JA 1UDWA 1XZFA 3VR5D 4R0NA 2WM3A 4XWWA 1IEXA 2Z8YA 3ZDDA 1P9OA 1QFMA 1R5NA 4M9RA 3R9WA 3E2MA 2B2NA 3WK8A 2OG2A 3KYDA 3SXPA 4R1LA 4LHYA 1A9XB 1F1BA 1RRGA 4HH0A 4L6AA 4QVGA 5EHNA 3TQRA 1VSTA 3TZKA 3U4CA 1ZY2A 1JJBA 3GUVA 3EZ7A 4G8BA 4LZNA 3CN9A 2OBLA 4DQLA 4NYIQ 4JLKA 3OM8A 4R2WA 4I99A 2NU6A 2FWRA 2ZJ3A 2QDXA 4KBYA 5G4KB 2W42A 1T8PA 1INLA 4RV4A 1NUHA 2CHFA 5A0FA 3UT5A 5ITVA 3UJ7A 4R1SA 4POAA 5ADUS 3I2IA 2B61A 2HAEA 4U6NA 1CUCA 1CY8A 4HDMA 3V8QA 4CTNA 5FL7A 5HF8A 1PT9A 3HV0A 2WMNB 3M89A 1THGA 1SEPA 4I6GA 3T1NA 4BGEA 5AP9A 1PFYA 2WM9B 1ECPA 3CN7A 1N0VC 2WF7A 3DOHA 3F0TA 2VFAA 4X94A 5IM4F 1EQAA 1CF9A 5DGCA 2XUGA 2QJRA 1NBWB 2C84A 5IAJA 3DDZX 3U3JA 4D5GA 2GF9A 3U7RA 3M49A 1JHUA 1TKCA 2OQ2A 2Y1FA 2GZSA 4FT4A 4B4KA 1SVOA 1BIFA 1DQYA 1I7DA 3D8HA 1JR2A 2VJLA 5CB4F 2B36A 1F2TB 3ZOZA 3EFHA 2CK3A 2JJ2A 1P1FA 1LS6A 3ETLA 4IUCS 5E9WA 4BB9A 1ZESA 1G2OA 4FI3C 5LQNA 1BAPA 2VRBA 3INGA 2O0KA 4HK4A 4LJ5A 1WB9A 1XN4A 4M1YA 5AVVA 2PGOA 2YIMA 4Z4GA 1IHUA 5CCXA 4LIPD 1KO7A 5DHQA 1W6RA 3C48A 4F84A 2UAGA 3P9NA 5A04A 3ZJUA 4K8RB 3T4XA 2DHCA 1POWA 4NCAA 1BE0A 3OO0A 1E1QA 2YZKA 3CCFA 1UDRA 4M9UA 4O29A 1X9IA 4F11A 4K6CA 4N12A 3HHPA 3IB6A 1CUZA 1KP2A 2XAUA 4ZT6A 3A6EA 2Q6LA 3IRUA 5DKFA 4AZ0B 3U4IA 4GX0A 2OD7A 4GPBA 2YMMA 4XR9A 1LRJA 1TYCA 3BG5A 1AS3A 3CLRD 3HP4A 2R85A 2HPHA 2RONA 4ZZIA 3SFZA 1N5JA 3ER9A 4WGFA 2PUBA 5ARCA 1NA5A 3DVAA 4NZZA 4DIMA 3SU8A 2I54A 1XTUA 5E7JA 5GVRA 3ZK8A 2ZTSA 4KQKA 2M6SA 1MHPA 3CWCA 3II6X 2W22A 5G53C 3LFTA 2I1LA 5G0SA 1T5TA 5CPFA 3PNVA 5D7BA 1YONA 4JELA 3WGOA 1BH6A 2DQ4A 3ZE8A 2PVCA 2XR1A 1OC4A 2PZBA 3ADPA 4KTTE 1VGQA 4JYCA 4EKNB 3RTGA 3P9XA 3M9LA 2B6NA 3WAJA 5KREA 4WK6A 4HMQA 1E9DA 2BD0A 5D6NA 5JJCA 4NWIA 5DEIA 1BXZA 5FEMA 2C7VA 1EI9A 3DEYX 1JKJA 1WX1A 4QGHA 5AKZA 4BVBA 1GAWA 3ELBA 4MRNA 4BWVA 3DKVA 1MG0A 2N1MA 4DN6A 2WE8A 1QU3A 4AECA 1UFVA 2C9CA 3MBIA 1I4DD 3OQ1A 4G9BA 4JP5A 4NMMA 2O0JA 1EQ2A 1UXHA 4BNNA 3DE6X 1QF7A 4AZVA 1QM5A 5LQMA 1JEYB 3EVTA 3G02A 3GROA 3QJGA 4OK5A 2FUNB 4ZVKA 4YY3B 4UREA 3TO5A 3VO9A 2MYPA 4OI2A 5F7ZA 3WQBA 3RTBA 3KQLA 2JAHA 1I2CA 3KE8A 1XLUA 3CF6R 4Z7OB 5KSYA 1CJTC 3QTLA 3N2KB 2WOOA 3NXKA 2HR1A 4EMUA 1EU1A 5BMVF 1CP3A 2BT4A 2AF4C 1B41A 2YNMD 3IJ5A 2JI8A 4ZPJA 5JADA 5TMPA 4HAUA 4MTCA 1RAGA 1NAIA 4XB2A 2XOKA 2NNLD 1YTLA 2WYWA 5TX7A 4BMNA 4BWYA 1N2XA 4DMGA 4OI0A 3T3OA 1G2IA 2WYHA 1ZZEA 3FKJA 3NHFA 2MSNA 2ZI7A 4OU4A 3V4OA 4EHJA 3OTIA 1L2TA 2OBNA 2JHPA 3PC3A 4CL8A 1S5PA 2J3MA 4IXMA 2PJUA 5J3JA 5IASA 1UIRA 5EHIA 4AIRA 4QO7A 2VNIA 3WB1A 4LV5B 3GLRA 1U7XA 3KLMX 4CLXA 3DE1X 3IDAA 4MI6A 2BGWA 4KQ6A 3LDFA 4JSYA 5C7OO 1KYZA 1L1QA 2H7XA 4R0MA 4F45A 4QBHA 3U4HA 3NTRA 7GPBA 4AJHA 5KNBA 1UOQA 4C03A 4G0MA 1S1MA 4QUIA 2JLVA 4OP2A 3SY8A 1W29A 1DFHA 3PPIA 2VKQA 3RVBA 1UJ4A 1W8DA 2ZYRA 1KXZA 3JAKB 2DT8A 1GARA 3TQSA 4LWZA 2VF2A 5T57A 3G8CA 1VMIA 2M6RA 3WGGA 1OBFO 3VPXA 4UNRA 4P98A 3EA0A 4MR8A 3IVCA 3HCPA 1FFYA 5F7XA 2WF8A 2QQEA 4RD0A 4YROA 1KNXA 2WPNA 4KWCA 5BOVA 1DSSG 1PZMA 3KDPA 1BQEA 1OUMA 1ZMXA 2YJGA 4JI3B 3SHWA 2BHTA 4MCAA 4DQDA 1P2VA 3L82B 4B48A 4Q3CA 1VBKA 1KP3A 5BWNA 2C4NA 1CJMA 1MGOA 2FU5C 2G77B 4YRNA 3NFYA 3L1IA 3PI6A 3DMGA 1LK0A 2OHFA 2IUYA 3A9RA 3EYAA 5IYZF 5C32A 2G88A 3I6QA 1Z6PA 4OMCA 3RREA 1IZ7A 1J07A 1LI4A 3OIVA 1CDEA 4KO3S 2DXIA 4R1NA 3GJYA 5DJ5A 3GWGA 4HYTA 1COZA 5AXAA 4ENSA 3KPYA 5GONA 2HXSA 1J49A 4MS3A 1TC1A 1E3WA 2VCEA 1KHHA 4PIMA 2GR9A 1S2MA 1T3LA 3K31A 1FSFA 3PGXA 1J97A 1FRZA 4J16A 2ZB3A 4C4SA 4ED9A 2I2AA 3WZ2A 3WOVA 3WRYC 3DTVB 5KYNA 3CRZA 1XQ1A 1K7XB 3KZ1E 2OYSA 3EJ6A 4UU7A 1QH8A 1VE9A 2PL9A 3EF3A 2CWDA 3OCWA 4I46A 4CMJA 1ZRHA 1NKSA 2XUQA 2E4WA 2ZWOA 3O7WA 1FTWA 4M46A 1DBSA 3A0UA 5ISMA 2WNIA 4RA6A 4AXXA 5JDIC 4F4DA 3R7AA 2QR3A 1Y6GA 3ONVA 1JSCA 4GRDA 4NTZA 5E1OA 2W6IA 2D3TA 2OORC 1BJRE 2H4FA 2IGTA 1WNTA 5CFNA 2RMKA 4JBIA 4X1IA 2G1JA 3JQ6A 4MLZA 1Q0PA 3P9CA 3PEUA 4R2IA 3DZKA 5DTEA 1C8BA 4NCHA 1XP5A 4BLUA 1RM0A 4IUBS 3DT8A 4QASA 4OHBA 3FSRA 3HNOA 3H6HA 5IHXA 1NRJB 3M1AA 2C7PA 1HSZA 2PV0A 4MOWA 1XTZA 1AUXA 4LMPA 2O1EA 2E1PA 3EHDA 3F5QA 4S1WA 2Z4RA 1T9CA 3N0TA 4MXDA 3WA6A 4D7AA 5A4FS 1Q92A 3PTZA 4F06A 3ZNPA 4DARA 1BQ3A 5FO0A 2GXQA 3RYFA 3TEJA 3ZWPA 2OESA 2AI3A 2PS3A 3LSTA 4HFNA 1ODTC 1XEAA 4X7RA 4O8ZA 3QVGA 1TADA 2AXQA 4NEQA 4CW7A 4ZO9A 1WAMA 4DT1A 4DA0A 1GGKA 4R2XA 5GMOA 4BLVA 2AG5A 4D82A 5KTRA 1ZLXA 5AHRA 5IW8A 3FOWA 4N7BA 3UH0A 1XWIA 3V7YA 5BP7A 2WIDA 4RZQA 1M6EX 1KWGA 3KQQA 5K3AA 1WXQA 4YYEA 1W8IA 1XMIA 2VT3A 4N5HX 2YXDA 3PU6A 5CA1B 3LL4A 4UVGA 2H6EA 2BN4A 3CCCA 3FYSA 4J4TA 4Y0VA 3NEPX 4RQUA 3GYBA 1DEOA 1YHNA 1E9BA 4O2AA 3DKPA 2NM0A 4B6PA 4ZYUA 4JQOA 5CJ2A 1QOZA 3OESA 4DWVA 5B1HA 1LQ2A 3FGPA 2R751 3JVUA 1Y5LA 3WIUA 3N87A 2FFRA 4JOQA 5EMNA 3EQ8A 1EJ2A 1LBSA 4ZCMA 4PFKA 3TKAA 4U7JA 2RH9B 5BWLA 5JUWA 2ZYVX 4AKEA 2RB4A 1G9TA 1X7ZB 2Z3VA 3IKVA 1T9BA 1Q7CA 1TYDE 4FYWA 3EE6A 3AJDA 4UHHA 4EZBA 2F3RA 4WZBA 4ZIRA 3KVVA 4NYJQ 3DV2A 1ZA2A 4EJ0A 2FSVC 2JFWA 4H15A 3O2SB 1XVUA 1XLVA 1RKUA 1YGPA 2DKFA 2FKAA 1T4CA 3AK4A 1YK0A 1G2PA 1EUDA 1KE1A 1WTAA 2BJHA 2D5LA 4QM6A 4ZHQF 2H7VA 4I1IA 4W5RA 1TIPA 4TOIA 3PGKA 1H22A 1VL5A 2B8NA 5IG2A 1FP4A 1URPA 2PG3A 1B8PA 1HH4A 2NVBA 2B82A 2CDAA 3O4RA 3RUDA 3GLFB 2VS1A 5HSGA 4J0EA 2O19A 1R9NA 3NBMA 1RM3A 5CX4A 2BI8A 3M1LA 2GPAA 2G36A 3AEXA 2HMUA 4XM1A 2QI9C 3QVVA 2EX0A 4TYYA 3W4IA 1XDBA 4MQUA 1NR7A 3D4PA 2IW1A 2BLNA 1R00A 1SBZA 1MIOB 2GEVA 4KLZA 3L41A 1Q74A 2H5JA 4IIUA 4BAGA 1T9AA 5BQXA 1DTSA 4A0QA 3T35A 3I5YA 4Q4AB 1FOEB 3CINA 3UB4A 1I2ZA 3AIIA 1IY1A 1JIXA 3F2IA 5A7GA 1MAAA 2MR6A 1GNLA 2WR8A 3R20A 3DW1X 2X14A 2NVUA 1C7ZA 1Z6GA 1QP7A 2C9BA 1H42A 1NVWQ 3RRYA 4QEKA 1QWSA 1F9AA 3SE7A 2XB4A 3ILXA 1L5YA 4J7CA 2WVJA 4REMA 2R8EA 2VK1A 2OMKA 5A1JA 4K8OA 3ASZA 3CX3A 2AR9A 3ORFA 4C3VA 3KZVA 1Z4KA 3RUEA 5AM2A 4DLBA 3DLHA 3URMA 5J5CA 1IBRA 3NPMA 1R8YA 4RPGA 3VU9A 10MHA 4EY5A 1XFAA 1NPTO 4IJVA 1OB5A 3T1TA 4AF7A 5I7HA 2PGLA 1T6YA 2WA2A 1KP9A 1P5HA 1NJ5A 4A8TA 1XTBA 3EGEA 2XZDA 2JIOA 4BHTA 2YHIA 3KEOA 3LUBA 3C1UA 1U2EA 4PN7A 3HGMA 3G2NA 5T4EA 4MPJA 4YMGA 4BFXA 1E2GA 2O0MA 4GH5A 5B36A 1WHSA 2WFAA 3MB5A 2GBFA 3HCFA 3NFRA 4LE2A 5KYYA 2YIVX 1NSTA 5JNSA 5AJWA 4UD2A 1ZH6A 2IYFA 3P0IA 1KJIA 2DX7A 3E5MA 4G8JA 3DHYA 3H9GA 4TZKA 4WFIA 3DTNA 1JIKA 4YAJA 1ZUD1 1WHTB 2H17A 4ODIA 3ILSA 4JVNA 4QOHA 5EWMA 2X4IA 3KSBC 5KMGA 5HBGA 1EE9A 2WU0A 1SY7A 3P9RA 3HQ4O 4LPSA 1D0SA 2ZQZA 1KY5A 2IHVA 4ID3A 3QHPA 2P79A 2PXAA 4IH1A 5IBRA 1KO1A 5BN4B 1D9ZA 3SLRA 1GYPA 2ID8A 1GY8A 4PG5A 3BOSA 1A9SA 4JL6A 3UOAB 4OX9Y 1TM1E 4Q66C 4ZI7A 3SJZA 5C8DA 3SEQA 4D0NA 4QQNA 3JALB 5L8VA 1KDOA 1QNFA 3FPSA 2QZJA 4OXIA 3H5LA 1DCFA 3JQAD 3VVLA 2A5DA 3TCKA 3AEUB 3T3MB 2VYND 3ZHXA 5KQMA 3UHJA 3IUBA 5FEUA 4F6LA 1AGPA 3AMVA 1E79D 4W5NA 3OZCA 4X8HA 4V0RA 5JS1A 1AY0A 3DB2A 1TYEB 2D4HA 2P9JA 2FSHA 1U7HA 4DIKA 2C5LA 3K9CA 5JY1A 4YUAA 4TQUS 3WWCA 3ZW9A 4RCZA 4BLOA 4EY7A 1NNI1 1NQ5A 3OMWA 3WC4A 3NJ8A 2HK8A 4IP0A 4HH4A 5A03A 3W90A 2ZRPA 1IOWA 2HWXA 1GG5A 3KIPA 1BWSA 1KEWA 4IHQA 4XQ9A 1OLSB 5K3EA 3C70A 3AUXA 3DMRA 2CLSA 4ARBA 5FJJA 4JT4A 5EP4A 4BFWA 1X1TA 3ID6C 4J90A 4NAUA 4BFVA 1RS0A 3RSZA 1KHTA 4IYRA 1FX0A 4HPXB 1IAQA 4MRSA 4ZXPA 1OT3A 4TL9A 5AIBA 1OYWA 4HFMA 2HHJA 4WCDA 4LK2A 5A05A 2QRVB 3PQEA 4DWOA 4G9EA 3JAWB 5JASA 3FTQA 3LOUA 4GMHA 3JATA 4NBVA 3THOA 5SY4A 4Q48A 4ZYXA 1NOJA 5I47A 1M6VB 1JDSA 3ML1A 3Q6NA 2XT9A 4DRZA 1ZI6A 3FBGA 5I3CA 2IEYA 1LSOA 4H9GA 4A8PA 5JAQA 3WYBA 7ADHA 2H1VA 5A4KA 4KFRA 4ZN6A 3IFSA 4DC9A 4ZJYA 4D3FA 1UBCA 3WHLA 2ODWA 1EWTA 1KO8A 2VDWB 3FWKA 2BBSA 2J6IA 1F0KA 2PGDA 3ESBA 2EFCB 1X8LA 2QHXA 1NN3A 4OXXA 2BGGA 3DOCA 3V3TA 3CHYA 4IEEA 5F5LA 1J2TA 4U2EA 3IULA 2X4DA 4IO0A 1IN7A 1A4RA 2I8CA 2OP1A 4EENA 4WBNF 3N58A 3RUPA 1HYEA 2OCIA 4BKUA 4GZ3A 3AL2A 4A92A 2HW8A 4EEKA 3WIBA 1BDMA 2G9VA 3LI2A 2AT1A 1AQNA 4BO4A 3IE0A 3VUFA 1DIGA 4K26A 1WVMA 4B33A 1SG0A 4IJ5A 2P3OA 3AUFA 4GLJA 3E9YA 4YJFB 4ZODA 1MB4A 5C53B 3T3PB 4Z86A 2ATCA 4E2ZA 4CM1A 2RAFA 3NHUA 1OX4B 2EAUA 3BFXA 3ZBTA 4JQSA 3ZUPA 4EYGA 5BY2A 5LYJB 3H1AA 3DZBA 4PLTA 3TNDA 3WFJA 1Y9JA 4F1JA 1E79A 1EVJA 3O75A 5FJIA 4DREA 2V45A 1XZMA 2QYHA 2NO7A 1MNAA 4FCCA 2ZE7A 2J6BA 4MX8A 1PV4A 4EQ6B 4DCGA 2ORWA 3JAMA 3QQPA 1Z5GA 3H9UA 5EMHA 2IZ1A 3ZE6A 1TPYA 4LDNA 3SP1A 2CSXA 4HN9A 3EN0A 1RZRD 2FV8A 2IYOA 1D6NA 3N2LA 3D4NA 1NVUQ 2F2TA 2F43B 2QMOA 4GPD1 4LDZA