4WH0A

Ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
202
structure length
201
Chain Sequence
b'SFTYKRLDKNDAAVLFVDHQAGLLSLVRDFSPDEFKNNVLALADIARFFNLPTILTTSFEDGPNGPLVPELKEMFPQAPYIARPGNINAWDNEDFVKAVKATGKKQLIIAGVVTDVVAFPTLSALEEGFDVFVVTDASGTFNPVVRDAAWARMTAAGAQLMNWFSVGCELHRDWRNDIEGFGAILGGHLPAYANLIQSFGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
molecule tags Hydrolase
publication title Crystal Structure of a Hidden Protein, YcaC, a Putative Cysteine Hydrolase from Pseudomonas aeruginosa, with and without an Acrylamide Adduct.
pubmed doi rcsb
total genus 76
structure length 201
sequence length 202
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 4wh0A00
3OQPA 1YZVA 3S2SA 1NBAA 2A67A 3TXYA 1J2RA 2WT9A 1NF8A 3R77A 1X9GA 1YACA 3OT4A 1NF9A 3PL1A 3TG2A 3EEFA 3MCWA 1IM5A 4L08A 2B34A 3HB7A 3HU5A 3O90A 2FQ1A 3KL2A 3LQYA 2H0RA 3O94A 4WGFA 1ILWA 1XN4A 3O93A 3O91A 4H17A 4WH0A 3TB4A 3V8EA 3R2JA 3O92A 4L07A 3IRVA 2WTAA 3UAOA
chains in the Genus database with same CATH superfamily
2QQ5A 4ARCA 2H1IA 3IQHX 3QKRA 3O4VA 3K71B 1ODJA 2NV0A 3WYEA 4XJTA 1G63A 4YJ3A 5KNLA 1JVNA 4P86A 1TUEA 4Y18A 3GGDA 3OCVA 3UEOA 3S0JA 4Y2GA 1Z5GA 3WR5A 5JVDA 1EFDN 1C3OB 1SOVA 1Z22A 5DGDA 2G77B 1S02A 1UKVY 2QRMA 4PPNA 5G2OA 4EJSA 2GQ0A 1FS5A 3FPHA 4XB2A 4EGSA 5CPBA 1TFRA 4CF4A 1KEKA 4ZVTA 4PLFA 4CMIB 3CX6A 4C5AA 1KFCB 1ZXLA 5FWNA 3SCZA 1F51E 2WABA 1RXUA 1L5HB 2FTKE 2GK3A 1YH3A 3DHVA 5CA0F 1EX1A 4MWZA 2I1QA 4MV5A 3ZE9A 4G5YA 3M5PA 4FMBB 5A9RA 1WY7A 2WVAA 3DYIA 1M2VA 5BYJA 1NXVA 1DBVO 3QVXA 2HIMA 1XTTA 1YS9A 3PE3A 4Z2YA 3KKZA 1D2AA 2DHQA 2WZDA 4LGMA 3K9LA 5DSXA 5TS2A 3V42A 3U5TA 3DCJA 3I2KA 1AQYA 2ZJ0A 3NTLA 1S3FA 3BJZA 3TLMA 2BZ0A 4AX4A 4G0OA 1UZAA 3MJRA 2CD7A 1JHZA 1J0DA 4MJ3A 2J3KA 5K0BA 1E18A 2CXRA 4M7RA 4E2WA 2DTXA 1PGNA 5FI0B 4CG2A 1CR2A 1L5RA 2AI3A 1NU8A 3NU1A 2JK0A 3GG2A 4Q4CA 5IHPA 1OIWA 4H7FA 4BQPA 4GZLA 4JUBA 3BD8A 3O92A 5CDTA 2Q9CA 3TX6A 1Q1BA 5C7IO 2IXEA 4O4JB 1CS4C 3O84A 1P1IA 2C97A 3PR2B 2F9MA 4P5PA 4TUYA 5BVGB 2GBFA 3SEQA 1ZLXA 3W3AD 4AT1A 5ALWA 3MRVA 1RZ3A 4E51A 5JCOA 3IERA 1VLQA 1JF8A 3AUKA 2BKUA 2F59A 3BMNB 4ALLA 4CV0A 4ESOA 4V0MA 3RIHA 1JA9A 1RIIA 3QSGA 1E9RA 1GKYA 4KXUA 4NZ9A 2KW5A 3LPNA 4I5IA 2AZXA 4FFPA 3N76A 2QI9F 3LZDA 1VE7A 1WOYA 2PS1A 2UDPA 1G0NA 3ZIUA 1R0LA 5DP2A 3RTCA 3FGNA 1I4EB 2X0JA 4DTIA 1SKBA 3DE3X 5JBQA 1E2LA 3PRYA 4R2KA 2X13A 4DTCA 4MS4A 2VJOA 5IM4A 1JZQA 4P58A 3RIEA 1CLUA 1W8IA 3AF4A 2G36A 4QQKA 4CODB 5LD2B 1EE1A 5KC8A 3QLUA 3PNPA 4N6GA 2VK8A 3VKFA 4DF3A 2GETA 4G2NA 4NJMB 2RAUA 1G98A 2GNAA 2H08A 4RX1A 4Q4HA 1C1DB 4QEKA 4XSGA 1SBIA 1LSJA 2HX1A 4MJXA 3R0VA 1L7NA 2VHVA 4DJFC 1Y9JA 1YT5A 3M6WA 1T3TA 5J58A 4JQCA 1OH8A 1TB4A 3DAPA 3T54A 1SU4A 1NVWQ 3TLKA 4NFLA 4HDNA 4OMUA 4YDQA 5T7BA 5J63A 1OLSB 3CJTA 4CT0A 4JP8A 4GU5A 1CDEA 4UXIA 2QVBA 3H9EO 4FEEA 4UPVA 3JSAA 4AS3A 5B55A 4ITRC 3QF7A 1P17A 1VIMA 4FT4A 3VSCA 3ZHYA 5GJCA 1ZUIA 3ASVA 4B44A 2OAP1 1ABBA 3BIJA 5AKKA 1CYEA 3WVNA 4PPQA 3W5VA 1LF0A 1NNI1 2OXEA 3K2EA 5DWQA 3CG0A 3L06A 5AVYA 2X7XA 2BZGA 2DR0A 1FNBA 3EN0A 2GUGA 3AF0A 5E6SA 4WN3A 1NVUQ 1SXQA 1TIKA 4R7TA 4XIFA 3HKDB 1H3EA 1MH1A 1XB2A 1IDN1 2QPTA 2R66A 1CFZA 1W9HA 4Y7CA 3WGMA 3CH4B 4YRRA 3ZNOA 1U8XX 1GN9A 3IT0A 3LC2O 3PC8A 1KORA 1TAGA 2BGLA 1IH8A 4NYIR 3RVOA 1YKGA 4YJHB 3VYRB 3ZGLA 1SXPA 1KO4A 1UQTA 5C31A 3T9BA 1E1CB 3TB4A 2RC6A 2YL2A 3JWPA 1IN4A 2QM7A 4CIYA 5LB2A 3HHPA 4D6PA 1R12A 2HBZA 2IU0A 1E1NA 1B6RA 2FPWA 3R3SA 4MUGA 3RFFA 3CE9A 5A04A 3E23A 1Q0QA 4P1ZA 4PVCA 3KOXA 5BSGA 2C8VA 3U09A 3W05A 3MTBA 3W3ZB 4J0JA 4R41A 4DGSA 4OQZA 3WYCA 4CLXA 3KKEA 4AUNA 1JDSA 1JT2A 3BWDD 3Q9UA 2DH6A 4JYAB 2I65A 2QWXA 3P9SA 4PWYA 4ZZ2A 1E3WB 1E9AA 1M5UA 1Z0SA 1U8EA 2VDJA 4GH5A 4ZAGA 3ZD8A 4YCMA 5AVWA 5M5BA 3ABSB 1KKUA 2XGGA 1QP0A 3G79A 4EZIA 1Y5IA 3MQ2A 2C1EA 2OPBA 3FF4A 4P2GA 1GO2A 5BR8B 3BORA 3OLZA 5FNVA 1D6JA 2WVGA 3LWBA 3E1KA 3QOFA 3QKRB 2YQ5A 4Y2QA 2YFQA 3RFCA 4RPKA 3E61A 4YBRA 5ESWA 1SEPA 3O8QB 4KK3A 1GPMA 5ALLA 2RHJA 3IKVA 3HEMA 3ZDZB 3RQIA 1A69A 2B35A 1L4YA 5HW0A 1MO5A 3B6EA 4TMKA 2ID9A 3CPEA 3EDRA 3PYXA 2V6IA 1MVNA 3DTVA 2W6ZA 1LK5A 2HPHA 4DDTA 1UBEA 2ST1A 3W6PA 2WE7A 1JH9A 5JTTA 5H5JA 4CMHA 1N2CB 2ODTX 4PANA 4E1BA 4L75A 4WOPA 3NDBB 1L1EA 3HXKA 1NVGA 1NBMA 2I2FA 3FPEA 2AZ4A 2G07A 4O1HA 4TLLB 4K9LA 2AI1A 1T4CA 3NHRA 1Q16A 1TLFA 2A5DA 1JW9B 3U39A 4F1WA 1DRWA 2SKEA 3CLSD 1D6NA 4JQZA 2QN9A 2VJQA 3RLIA 5KVQA 2HC9A 2FRXA 3OQJA 1ZMTA 4HFMA 3RD5A 3KJHA 4MO2A 2PUBA 1GZ6A 1CQPA 2G28A 2EEZA 3AP3A 3KZNA 1OGJA 1GPAA 3HKEB 3ND7A 3WGJA 2P69A 4NAHA 4DSNA 4W5TA 3K8OE 2EC5A 2EARA 4KKXB 4MUXA 4UM8B 5M2QA 4XB6B 4JB8A 3C7KA 1NW5A 2ASEA 2ETVA 1KMNA 4LHVA 1S2DA 4XIJA 1WUJS 1NYLA 1ISIA 3AKZA 4AK9A 5JZOA 1GNRA 10MHA 2WTNA 4QXRA 1N3IA 4R1NA 3LOPA 4FOPA 5JCZA 2M32A 3OOHA 2QX7A 4IEFB 5CTAA 1PHPA 4BMDA 3TECE 1AXRA 2KI5A 3LLMA 5G4KB 3L82B 1L4BA 3GDFA 4DMMA 3CPSA 4E14A 2JFBA 3NAGA 4BFUA 2C7QA 2Q8PA 3TTVA 4TXNA 1Y82A 3QOXA 2Q0HA 2YXBA 3EA0A 3ZHQA 2H7XA 4BIIA 4EB6B 1SMKA 5KNBD 4ZGWA 5FAXA 4XYLA 2AJDA 1X9GA 2YN0A 4AFNA 1F2TB 1EFTA 2WNSA 4M9ZA 1EZZA 5BR4A 5IVPA 3FVTA 4DGQA 1HG0A 3U31A 4DHEA 5IM5A 3TPFA 3FFBA 1IATA 1RPTA 4FDAA 4KXMA 4NQZA 2FFQA 1JT9A 2FZVA 2ZSIA 5JZMA 5EMJA 4RSGA 1XNHA 4MAAA 4HGZA 3LK6A 5HJ2A 1WF6A 3HR7A 4Q1VA 3T7TA 4BXOB 2QRVA 2OSBA 2KBFA 2ZXUA 2WQZA 1T91A 2J30A 4IJWA 1Q6YA 1M1YE 1AQLA 2PV0A 2X1HA 3DVLA 3EIOA 5TQ0B 4OGWA 1TVCA 5U1PA 3OM8A 1QANA 1ZG3A 3AHIA 3ZG6A 1W5BA 3ZEAA 1J20A 2I9KA 2PLFA 4A0FA 4AIIA 3WMWA 1U7UA 1OAOA 3KLMX 2XYHA 3EQ9A 2E5LB 2HW8A 1IOVA 1F48A 4D9NA 4DIBA 3PJDA 1Y34E 3PUZA 4GR9A 4JDPA 5CP8A 5DI3A 4EHBA 1C3JA 3TO5A 3SIPA 1JLKA 2PSHA 2XTAA 5LUAA 2W22A 4DY4A 4TN1A 2OBYA 1KOFA 2F1JA 4TN5A 5DM4A 5LBTA 1M67A 3ITNA 4W7IA 2ZGVA 2PK3A 3IAS6 4M37A 4RTKA 3N8HA 4HLNA 4QU5A 1FDUA 4L07A 1ADGA 1PG5A 3X3HA 1W94A 2DFPA 3KOUA 1UXGA 1WSWA 2SHKA 4WK6A 3BD6A 3D7LA 1MW8X 1KK3A 4ENQA 1QFMA 4DMGA 4KDCA 5HKKD 2LD4A 4OOEA 4HLUC 2XKKA 1MHPA 1QF7A 2B8NA 3P4XA 3QTLA 4GWGA 1D7OA 4CV2A 4MOWA 3M6AA 5IBQA 2FHPA 4DJAA 4JOSA 2ZT8A 3VTKA 1DG1G 3RT9A 4DQUA 2OKGA 3FPLA 1PR9A 3F6SA 1JAIA 3SHQA 3B48A 3I61A 2E3JA 3JAWA 1ZOLA 2G1UA 3C85A 4XGRA 4B34A 2AXEA 2GD2A 2G9VA 2O2EA 3CE6A 3T61A 5K0GA 4A0SA 2JH3A 3WGHA 4D8VA 3H5VA 3H05A 4EEKA 1A2KC 4C30A 3V5NA 4AZVA 1XD8A 1ZIYA 4G3XA 4LSMA 4DKJA 1RZRD 2I3ZA 2HFJA 3BH7A 4J0HA 4QYIB 1NKSA 4LDRA 2DPGA 1GAXA 4QQRA 2DU8A 2ZB2A 2BC9A 4RGVA 2AN1A 4PR3A 2ZYGA 1R2QA 4XM2A 3Q7PA 1JWLA 4BLSA 1GRQA 3KHUA 5BV2P 3GN2A 4OHFA 4LGVA 3B70A 3EARA 4BJ6A 4PHHA 5HTOA 5BY2A 3TVDA 4BJ3A 1XTIA 3R5TA 3EXG2 3QPDA 3Q3EA 3PFCA 2E0IA 8ADHA 3NRJA 3OZIA 1Z6PA 4JYMA 5GGYA 4N3BA 1OMOA 2QMOA 5CA1A 1ISFA 5DYWA 2R8OA 4R16A 3VKGA 1MIOA 1O89A 1QB8A 2PZJA 1CF9A 3OE1A 3SHTA 5IK2D 1SHUX 1MOZA 1NE7A 3HLYA 2HF2A 4HYQA 5E6RB 1YJAA 4NSNA 2ODNA 1CW2B 5FPTA 2P9GA 3Q72A 4ZVRA 2J87A 4R51A 1W0JA 4JJKA 5F51A 1OXUA 3AEUA 3B52X 5EXXA 1E6WA 4JJFA 1VXRA 2IS1A 1MDBA 1R0KA 2A4MA 1T8SA 2X9QA 3AYZB 3NS7A 1CF4A 5H9VA 1PNTA 3BGSA 3I30X 4HB0A 5JEDA 4RA9A 1T9KA 4BMNA 4IWXA 4L6IA 1GFZA 3FKSD 3DZ8A 3EYAA 5IKXA 3U2QA 2YW2A 4G5GA 2EP7A 1KP2A 2A14A 2G4CA 5H8WA 1ICIA 2WMYA 1EESA 1HMYA 3SX0A 2DJIA 5TF4A 4MDEA 2W2QA 3ADKA 1M8JA 5EIHA 2CUKA 3L6CA 2PYDA 3PU6A 4LGYA 3C16C 4PLTA 3OURA 1YONA 3OQHA 1SG6A 1CY1A 3QYJA 4UBLA 4Y0VA 5IXSA 3RSGA 3U48A 5KX5F 1I5OA 2H63A 2BFDB 2VZ0A 4HR7A 3THYA 2NQ8A 3DGFC 1US8A 3MTIA 1E20A 4HSEA 4OB8A 1XDDA 5L3SA 3K6SB 3H9QA 5EWJB 1MGOA 3EFBA 2XOKD 4G5SA 4TTTS 4NU5A 4RESA 4ESHA 4UE2A 4YMVA 1IY0A 1XE3A 3NHJA 1SUFA 2J67A 4BRUA 2V7UA 4CIWA 4S1PA 3W0LB 2VO1A 2PKWA 5KOHB 3VZRA 4EA6A 3JALB 4IOMA 1HURA 3ZIAA 4EFNA 4IVNA 2H17A 3JD1A 1SHJA 2BKXA 5DHQA 3TQCA 1FUUA 3JASA 3WK5A 5ADWA 4OHOA 3N8GA 4XSHA 4JLBA 2JD2A 2OQVA 5JSZB 1B8PA 2X4DA 2IHVA 2RH5A 5G0VA 2Q46A 3CNNA 3RU7A 2J41A 3ZI7A 2I4IA 1DCTA 3RYIB 1CUCA 2YCBA 5EUQB 3PEWA 3IBTA 2D5LA 1EBUA 1Z4IA 2ZPTX 3JALA 1XZNA 4MI3A 3AL0C 3DJFA 4REQB 3DDOA 3UT6A 4MV9A 2I7DA 2RB4A 3BEOA 2GPJA 3TRIA 3WWDA 4V0RA 2MR6A 4R5MA 2C5AA 2G3YA 1ABFA 5CYOA 1ZY2A 4NABA 1E7QA 3UCFA 4UD6A 1II8B 2FZ5A 4KXQA 5AI9A 1EG7A 3AM4A 5FXMA 1MA0A 2P9ZA 3T4EA 5JXHA 3HYSA 3MTQA 2OP1A 3RT1A 2OBBA 3EGXB 4FOSA 4I14A 1VJ0A 1BD4A 4Y6SA 3QPUA 2PR2A 1J0XO 3HACA 2NTYC 3LYLA 4U7FA 4BC1A 4EHIA 4NECA 1X9HA 1SD5A 1UBUS 3VR6D 2CHFA 3FNGA 3U4DA 2MJLA 3KQQA 3ESDA 3FB4A 4KHZA 3BL6A 4ZC8A 2ZRPA 4PG6A 4A73A 2BBWA 4GI1A 4BZXA 4MYRA 1E63A 3RUEA 1OW3B 3KJNA 4FU0A 2R8YA 3TLAA 3UFXB 1HDEA 5C8XA 3I6IA 5DU2A 2ZI3A 3O73A 4LF5B 3L77A 1UC9A 4F11A 3B60A 1KDOA 1SVLA 1MQSA 2RHOA 1BJKA 1PL7A 3JRWA 1BXRB 2A1IA 3OUTA 1WXQA 3QTTA 3L8HA 4N82A 5AJWA 5DF1A 3RRZA 4I4CA 3ABZA 3J81k 1VCNA 1SVSA 2AR0A 3ANXA 1S8FA 4JBHA 2CDRA 2TYSB 4DIDA 5JPDA 4MYDA 2RIPA 1U1FA 4MMYB 4ZMSA 3IP1A 5BOVA 4C1BA 1WHTB 2D6FA 3HS3A 3A6DA 4IRUB 5H4HA 4XOIA 3DMNA 4PZCA 1KFKB 3VR6A 1NOIA 1UDAA 3R6WA 1ZCJA 4FMCF 2AI2A 1THGA 3A6GA 5C18A 2XB9A 4QUHA 4AW9A 1ZINA 1D2CA 2B8JA 2GPSA 3N86A 4M0DA 1I0IA 5E2AA 4ZYYA 2B78A 4WZBA 2JDIA 2Y1FA 4PIMA 5CCDA 5BUSA 4TXLA 3FFXA 1QUFA 1VLHA 4LRSB 3ANLA 3K0HA 3KTFA 2LUOA 4V02A 5CK5A 1EJBA 2IPXA 2WJAA 5AI6A 5A0FA 3GLGA 4BNIA 1CQZA 1GR1A 5BSHA 4H0FA 3RK4A 1LPNA 2ZIUB 1XJ5A 2J0UB 3IR6A 4KFRA 3A10A 2WKQA 5AIAA 2VT6A 4GYKA 3M2PA 1RQ2A 2LCIA 3HJFA 4KYIB 2B4RO 5B7GA 5FOWA 4C2TA 4NK4A 2PX0A 3GR6A 1LVHA 3P26A 2QD1A 4E4TA 1Q11A 4LJKA 4MS3A 4CN8A 5HRAA 2QDKA 1VE3A 3W2HA 1T9HA 5JCPA 2XCOA 3JQ9C 4YAOA 1Y5NA 1H2EA 3O8RA 1KMCA 2YXNA 4A26A 1W5AA 1UXHA 1JLLA 4G09A 3SLGA 1H5QA 3E0XA 2XODA 3TLXA 3CKMA 5HRUA 5FYDA 4FX2A 2ORVA 4G5RA 1EFUA 4TTRA 4HVLA 2Z83A 2CLIB 3ND8A 2NZXA 2WWHA 3ZEIA 3EZ2A 3B36A 1MEOA 3DCYA 3DXYA 4MVJH 1ZFNA 3JD3A 3QBVA 1TZBA 2OR3A 2QAGB 2K5UA 4AWAA 2OLEA 2H9IA 1ISMA 1EQAA 5DLEA 3INRA 1TTTA 4HDRB 4IG4A 2I3BA 1IWBB 1JR6A 3RVDA 4QT0A 2FUG1 1Y1KE 5FUMA 2UXBB 2OENG 2BE9A 1KVSA 2Z4TA 1EFCA 4EAAA 8GPBA 5JS8A 1ZX1A 4JJ8A 1SK8A 5GY7A 3RM3A 4EB6A 3PSHA 4RFSA 5DW3A 2VYCA 3EZ7A 2YFHA 2VJMB 2H07A 1XZAA 4XJXA 1YR2A 1CQWA 3KWLA 5EIBD 1PJZA 2GPAA 1R4AA 3W1WA 3W7BA 2R60A 2R8EA 4YB8A 5A0TA 3G2JA 4HQ0A 1QQ6A 3HDJA 1Q15A 4GD3Q 1W6RA 4XM1A 1YRYE 5EUCA 4UHEA 1Z4KA 2IQIA 2QYSA 1ISHA 1QGYA 4TV9A 2HK7A 2C7RA 3HM2A 4GI7A 4DBLC 2JLCA 3K6RA 4EY7A 1RKQA 2GJ8A 2HA0A 1OOEA 4OHMA 3OFNA 3F6BX 4YAKA 4BBZA 3PPIA 2QRNA 1G7TA 4KWEA 4D1YA 2QPLA 4Q3AA 4RV5A 1PKXA 2KSQA 2OOKA 2PXHA 2XI4A 3D4NA 3DO6A 2W6CX 5D5HA 1K5GA 5E2BA 2WJIA 4OBXA 2YIMA 4I1PA 2JI6A 2R97A 4HDSB 1LZLA 2UVPA 1I94B 2VQEB 1NYRA 1WA5A 1Z4OA 4X97A 3LDGA 1G1AA 3KD2A 2QZPA 3PA8A 4MPTA 4GP9A 4MA4A 3ICOA 3C8ZA 4Q7LA 4ALNA 1Y89A 1LY1A 1PR2A 3WB1A 5IJXA 3TB6A 2C20A 4LDPA 1BW9B 2O57A 2V7EA 4LJ9A 5KYVA 2P11A 3IDZA 4IDCA 1MAVA 2RG1A 4BVLA 3HXQA 1FNSA 5CXSA 3P27A 3PUVA 5FUWA 2ETXA 2Q5JA 3AIOA 4X00A 4DHWA 3LX6A 2A9FA 2GESA 1N2CE 1C0PA 1RLJA 1Z2CA 4IUBS 4EHKA 4MIEA 5CXUA 3KQHA 4D26A 3DJYA 1GYQA 2FSPA 3E0QA 3H7IA 3EXG1 4KLZA 5KX5B 1QAMA 3PDHA 1PJLA 3DD1A 3RPEA 2GPTA 4L51A 5E95A 3NAQA 5LVAA 2K7FA 4NCAA 1EJ2A 4OHWA 3HCNA 4ZCLA 1JNYA 1P18A 3V3KA 3TLYA 2Z4SA 3D2AA 4BDTA 1HDXA 2PIDA 2FDRA 4PYQA 5BQPA 1J8VA 4ZTZB 2J1LA 3FTPA 3P2MA 1QLWA 4JKIA 4KR9A 4KO8A 2IY8A 2H2HA 1XLTC 2BW0A 3MCZA 4J7AA 4AJOA 4IPTA 1MX3A 2BF7A 2HHAA 4HX5A 1V6SA 3U7IA 2X0DA 4CM8A 5B7NA 1T26A 2O05A 2Q6VA 2OLKA 3DC2A 4Y1EA 1JEAA 2H2GA 3I0NA 3K9GA 4L5YA 4MWEA 4W9RA 2CUTA 4ZV9A 3VH1A 4D0LB 5AUPB 1KU6A 4EENA 1A27A 1XQVA 2FSVA 3D5TA 4Y9RA 1Y0BA 2E2WA 4JBWA 1G16A 4M46A 3SFZA 5JARA 3RFTA 2JJQA 3JZFA 4YN3A 1WDLA 3Q98A 1NBAA 5IAEA 1RTTA 1Z56C 5HEKA 1NJ5A 4U3JB 2IWHA 2YHUA 5B30A 1BKDR 2D7DA 2CWWA 2NTEA 1GPJA 4I50B 4LSZA 4BVKA 4JU9A 3DEYX 1TAUA 4UE6A 4IDFA 1G8PA 5HIAA 4CETA 1THTA 3OCCA 3T4UA 4BO4A 2FWNA 4F8EA 1D6SA 3VU0A 2B98A 2EDCA 3U19A 4N54A 2Q2WA 5AHOA 3SU8A 2HQSA 4Z9XA 8LDHA 4YAIA 4RE5A 3VYUB 3FVWA 1USGA 4XX0B 1WO8A 2I4LA 3OPMA 1B8NA 1W47A 3PIIA 2ADMA 3FPJA 4JL8A 4LTDA 1CT9A 4TKMA 3C3MA 1JQBA 1RKBA 4ZU6X 1TA4A 4B2IA 4JJ7A 1HDYA 5HOEA 2C5HA 1C0LA 5HUHA 3OMLA 2VK1A 3T06B 1RAIA 2Q3CA 3RSCA 3GFQA 1KFBB 1QG0A 3U44B 1VI5A 3PGLA 4G4SP 3RVBA 4AUMA 2WKPA 2X5OA 3DZCA 4Q9AA 1H0HA 3ELBA 3KYDB 3FGOA 3E05A 3SHVA 4CCSA 3QKTA 2R2GA 1M34B 3LUKA 2JNWA 4GPBA 4RFVA 1WD5A 1XROA 2ISSD 3H4VA 3L18A 5ELLA 2H5IA 1L4LA 2NU9A 1BE1A 3PICA 1GZ3A 2V3VA 2YYSA 3QMPA 3LHFA 3E22A 2CDCA 3HUTA 3LYHA 2OHGA 2WYHA 1X1BA 4G8DA 1YR9A 3BQ9A 2FLKA 4RORA 4XUCA 3ELYA 5IW8A 3HPQA 5I3ZA 4P36A 5LP6B 3W06A 1TVEA 3NI2A 1XAIA 1OWMA 4XEHA 4EPVA 2GWRA 4ASUA 1AOXA 2C31A 2C1ZA 3EWIA 4WESA 4I50A 3MTGA 4CKWA 3BFXA 1SULA 1X39A 4G1BA 6ADHA 1AS0A 5B2EA 1G6HA 4RVCA 1H85A 3DQZA 3DVAA 2FX5A 3IUSA 4XWYA 2CVPA 3TWOA 2J0QA 3O91A 3ONFA 1Z0AA 1Y4UA 4CKBA 2V9CA 1LLQA 3AERB 4NJMA 3X1YA 2V9PA 5U4XA 3IUMA 2W11A 2FW0A 2IV2X 3ZK7A 2Q1WA 5B7PA 1A2OA 5JQGB 2EWMA 1QQBA 4J0DA 1QR2A 4YEDA 2AKAB 4WJLA 5BW8A 5C53B 2PMFA 2IU3A 3CB4A 4TXJA 3GUYA 5CH3A 4UNQA 4YVFA 4YCLA 3C1AA 3RSSA 4M8LA 1Z6TA 4EG4A 2TSYB 4TPKA 3WLQA 4B3TB 2EZTA 2HCBA 1QO9A 2FSVC 4M38A 4BLVA 4BX8A 1FU4A 2EVWX 3FDFA 4CF6A 3KYDA 5J59A 3OQBA 4RZ2A 1KDRA 3UC5A 1PZMA 1XCJA 4K6OA 3AV0B 4MRMA 3W4KA 2YVUA 4ND4A 2G9NA 3ZOZA 4DLRA 4AJLA 3WLNA 4R8SA 2V5AA 1Z7YA 2AQHA 2EV9A 1NW8A 5KQMA 1KEUA 1V5GA 4AJPA 1N7IA 1E6EA 3I92A 4RS4A 2IOHA 3EB9A 4UEOA 3A6LA 3RBVA 5KVAA 5EMNA 4AKGA 4TOIA 5KYXB 2AK3A 3A3NA 3EVZA 1XU4A 2N9UA 3PBKA 3DKIA 3GBVA 2BD0A 5C5IA 2CT8A 3K9WA 5LIRA 2PWBA 3CF0A 1PL0A 4GVLA 2FRVA 3HNOA 4BMPB 5CH5A 3LY7A 5HF6A 4CKWB 4WY8A 1KXZA 1AE1A 3G9TA 2BFOA 2RAPA 1PG0A 1SUSA 4AF7A 3OF2A 4ENPA 4QXAA 1UXIA 5EI5A 2ZYUX 3EIUA 3T8YA 4EAQA 5HKLA 3F5MA 2FP3A 4DPKA 5H02A 1NZJA 2F3UA 2RGDA 2EYQA 2NUTB 1EDZA 1YK1A 2WF6A 4WD3A 2VA8A 3RYTC 1EHCA 1QS0A 2NQ2C 3BICA 2E87A 4JGGA 1FCJA 1L1QA 4LDZA 5G0WA 1LV8A 5ES4B 5JEEA 5EIXA 5J4YA 3O4HA 4ZTUB 3UKJA 5FJJA 1M2VB 1YC5A 2WF5A 3BN3A 4V1CB 2VPZA 4JITA 4JLJA 1JVBA 5KKAA 1XD2B 4TMYA 4D3DA 4FJ2A 4B5KA 3K6SA 1QFSA 3PF8A 1HFJA 1NPYA 3LK7A 3EPJA 3QWBA 4YRGA 2OD7A 5LR6A 4GPD1 1RVV1 4XFKA 5JAMA 1YDMA 4JYCA 4JC8A 3Q2OA 5CFMA 1KMHB 1FXSA 1WUHS 2PMKA 3OCWA 4N12A 3S1AA 4YCNA 1ODIA 2A8YA 3GLHB 4K88A 4PG4A 2WTXA 3VH4A 1LNZA 3NHLA 1ODLA 3V8BA 1U9ZA 4IIXA 4ECEA 2CXPA 1FDWA 2BEWA 3MHPA 4DA0A 5REQB 4N3GA 2FEMA 3WG9A 1HG1A 1ZBQA 1YOBA 3TSWA 3IXMA 3K96A 2XWJI 5DIFA 4LSWA 2QAGA 1W0KD 3OLQA 4PRYA 2FWMX 1HFEL 1ZVKA 4GM1A 3AETA 3JYLA 5JXJA 5IEJA 2I4OA 3JVVA 3WY9A 1DMSA 4FIZA 4DA6A 4PVDA 3ZH9B 4RD3A 3O31A 3AVWA 4YCSA 2DQKA 4Q9LA 3KM0A 3S55A 2R6CA 4PG7A 1DDIA 1TO6A 4ZI7A 4AROA 2NZJA 1F7UA 5BV0A 5BOSA 2PUEA 2YRWA 1ATZA 1OWPA 2PV7A 4FX5A 5GONB 2OPHA 2EGHA 3EW7A 3PYMA 4C0JA 3HCAA 1CZNA 1I4TD 2PZLA 1L5KA 4HWSA 3Q11A 4P3XA 1CEXA 4NKRA 1GYPA 1GDDA 5FV7A 1SH7A 2AOUB 1DAGA 2CFSA 1NUQA 4LWOA 1WXDA 1I6KA 1Q1GA 1N3YA 2JBAA 4OK6A 3K7EA 1OC2A 1NXXA 4CIVA 4EHDA 3DDHA 3FZYA 3T7SA 1V6AA 4YR9A 1O8CA 4HY3A 3ODPA 4Q1AA 2PA3A 3TNDA 1MAWA 4ZVLA 3Q88A 2ZI9A 3A26A 5ERXA 3M6VA 4S24A 5BR7A 2J85A 4DIMA 4RTNA 3UJCA 4LYDA 1X1TA 3D8BA 3TVYA 3AM1A 1VYTA 3L6EA 5JCJA 4C4ZA 3JRXA 2IXFA 1M6VA 1U1EA 1B0UA 2AG8A 1G8FA 2OO5C 1DKQA 1KP3A 5LYJF 1TT5B 1N5KA 3I3OA 2ECOA 2YWGA 1NVBA 1JPJA 5IK2A 4BNGA 4YMGA 1RTKA 3DDSA 2NYVA 3ED5A 1TD9A 1M7GA 1SCKA 2GEDA 2XZPA 3EIWA 4FXPA 3VR5A 3V4SA 2O3QA 2JEZA 5JNSA 2JFPA 2RH4A 3K1ZA 5H7XA 4C06A 5C46F 2R8PA 1QOQB 3AUYA 3DE0X 5AWFC 4A2CA 3GK3A 4CLHA 2Q2VA 4KE6A 4KFSA 4UBIA 2YQZA 4LHXA 4Z2AA 5DGXA 3CR7A 3AEKB 4BE9A 2OK8A 4JS0A 1V16B 2BFAA 4CL3A 3ZI4A 2Y92A 2PSSA 1CY6A 3J80A 4TMXA 1CNEA 3L6BA 1UFRA 1SCUA 2H6EA 4R0NA 5FQNA 2A5FA 3KQVA 2P2ZA 1ZJJA 1EAMA 2OHVA 3CLKA 4W5HA 1IZ8A 3VR4A 2O2SA 2B9EA 1EK6A 4M60A 2C04A 2PLRA 4CW7A 3F73A 5AKLA 5I7HA 1XEFA 3ADDA 4X1IA 2MTBA 3Q0TA 4EFDA 4TV9F 3WLRA 1V1MB 4FGUA 4FWIB 2CC2A 4B4KA 1FQKA 2QRZA 2QU7A 4IDPA 2HU7A 1G5RA 5E4TA 4D98A 1BXGA 2P6UA 3GPBA 4EH1A 4JI3B 4F4IA 1XZIA 2HJHA 3ER6A 5CCXA 4EOGA 5FL7A 4UFPA 1PV2A 1M2HA 1SQ0A 3O5AA 3GDOA 2XTNA 2NXCA 4U63A 4JJAA 1Y6GA 2ID7A 4G4JA 4H59A 3D5QA 3P19A 1GT6A 2EDAA 3KWFA 1BKYA 1Z6YA 1CUVA 3M1LA 4BPBA 2A0WA 4Q5IA 1Z4PX 3UVEA 2CLDX 3IAM6 3WNDA 1A9TA 3MS7A 4AY4A 3PHLA 1M2KA 5FLKA 1Y5LA 1NQXA 1G291 1WPXA 1JEQB 3CUVA 4FFBB 4CFYA 4XYMA 4TS9A 1DRJA 3DKPA 4X6UA 3GEIA 4JOCA 3V3TA 1HQCA 1QCDA 1UAYA 4RD4A 3IE2A 2CSUA 1RRFA 4BECA 1JJVA 2ZBDA 1K6MA 2Y3IA 2RHCA 1FDSA 3NAMA 4HVAA 3UTDA 1Y4SA 4Q21A 4RA9B 4GGPA 3WGKA 3BM5A 1KEWA 4NZMA 5UKDA 4CPDA 4BFTA 3IMGA 4M7WA 5LZ2A 2OESA 4L8FA 2RBGA 2IKSA 4NPCA 1NZDA 1SRRA 1CLEA 3VHXB 1T1SA 4CF3A 3SF8B 1KYVA 2XBLA 3DE4X 1Z5VA 2F7SA 2X8WA 3BAZA 3OEWA 4OYLA 4MWSA 3TCNA 5KTTA 2Z5LA 1Z63A 1ENOA 1JIIA 3TLEA 4QJ3A 4B7XA 2Z9DA 3FTFA 4L4YA 2ATVA 7ABPA 1E2NA 1MG0A 4NBRA 2DHRA 2BGKA 1DTWB 1JL3A 1G8MA 3CRW1 3C7CB 3LCCA 4BO2A 1F4LA 3LM8A 3K09C 4F46A 3NHYA 5JDCA 1XRRA 1GAWA 1B4DA 1NIJA 1PK7A 1XNJA 2I22A 4YP5A 2NVUA 2H51A 2JGFA 4Q9HA 1O4WA 4B45A 2BFNA 2YTZA 2VHQA 4TRNA 2VHYA 5EHZA 4I1IA 2PPLA 4WCFA 5E0KB 3CH6A 3FWYA 4DMKA 1T2DA 1B76A 2W4QA 4N5DA 3UMGA 4UNPA 2PGAA 2M1ZA 5CAEA 5LNK6 4MTCA 4D97A 4A0GA 1JTVA 5AI8A 4ZCMA 2XVMA 2XYQA 3HCDA 5KJFA 4PFSA 2YXLA 2C54A 3Q10A 4KHPB 4YMUA 2P0YA 4QDJA 1VLJA 1I3MA 1U6JA 3W5SA 2KYRA 4BVHA 4LE0A 3U4AA 4DC9A 1XHEA 4HDQB 1VMIA 1FXUA 1CVLA 3HXPA 1ADCA 4Q9JA 1UZMA 2VRBA 5IVIA 4Q3NA 1Z3IX 1URPA 3KUKA 2BGTA 3SVZA 3UBMA 1DQSA 4MB6A 1EWQA 4ON9A 4YO8A 3OHSX 4ZDKA 4DLTA 4OHZA 4C4AA 4GW3A 4WY5A 4XXHA 4HNGA 1W2GA 4FUQA 4B7UA 1XVAA 2P1RA 4YUWA 2X2EA 3LT1A 3ZY3A 1TQ6A 4IH1A 1TIBA 3DZFA 2ZRNA 4C2AA 5IASA 1E4EA 1O5OA 1OXKB 2JCYA 2Q4OA 3IDOA 3EZXA 3THOA 1XTZA 1ULZA 3ZCSA 4DVJA 4EG7A 3V1LA 3CNHA 2B9VA 2VYNA 4BQSA 1TEXA 1VPTA 4HGRA 3Q7EA 5DK6A 5A6SA 4XLLA 3VMFA 4AY2A 4IINA 1VI2A 1YNSA 2X19A 3H3XA 4PBRA 4F6CA 2H4HA 2PKYX 5D3KA 3R0XA 5IAJA 2G1AA 4QPNA 4X93A 3AHEA 2FK7A 3W5IA 4B76A 3NEAA 1YOVB 3D7SA 2IW3A 2XXJA 5HJ7A 2EJUA 2AVNA 4W63A 2OG1A 2R11A 4ICIA 2WDZA 1KZ1A 2WTMA 2G5CA 2OFWA 2XECA 3U1TA 3WLTA 3A04A 5HK9A 1ZI6A 2VPQA 2YJ6A 5BQOA 2X14A 4N8EA 2X76A 2YR0A 3ZU2A 3MJSA 3FNHA 2AF3C 1UF9A 2AC4A 1OZAA 3C3XA 4FTWA 3NFRA 4D8YA 1SOUA 1TMOA 2VBCA 3TZKA 5CLFA 4EY6A 3C3CA 1YZKA 1UP4A 5F3DA 2GTPA 2PGDA 3Q9LA 2QRVB 2GZSA 2SCUB 3ZUGA 1YRWA 4HLDA 2GYYA 4J0GA 3UWPA 4X62B 4P4SB 1U7WA 3ZI0A 4G4SO 2C9OA 5J43A 4O2BB 2OHHA 4R2JA 1X42A 3R8XA 1UPBA 5BYAA 1YS1X 1FDVA 2CXHA 3A9WA 3KFXA 4Y67A 3S2FA 1VOTA 3UFXA 4ZN6A 1NLYA 5I9SA 1AA6A 4W5OA 3H86A 2CBZA 3KSRA 3RS8A 1QH0A 1R27A 1XKQA 2I4NA 4QPZA 4ENSA 4NV0A 5EPUA 5IP5A 3O47A 5B36A 2B6HA 3ZWXA 3OEEA 2HXSA 4Z0TA 1HQKA 3TRHA 3U4QA 3H3FA 4G0VA 1UJBA 5BXQC 4R6WA 3AJEA 3CIOA 3EXIB 1PNOA 3MTAA 5ALIA 2CLLB 5FA6A 5TJHA 1VDMA 3TSAA 2RKOA 5CLJA 2B37A 1Y33E 1M34E 1S2MA 3QVGA 5HF5A 5EXTA 4WKOA 3LUGA 5IWCA 1F6WA 2XNKA 4IBOA 1GPDG 4URFA 4DNQA 1GZHB 2FCRA 1QSGA 3FBTA 4Z3DA 2H3EA 2FZGA 3GPIA 1P9NA 4H2DA 4MQMA 2DUWA 2IU6A 2JGJA 2HJWA 2OAEA 3UTCA 2YZGA 3E3OA 4BJ5A 3CMMA 1VSUA 4MZDA 1TQ4A 1W36B 4NFSA 3HLTA 3GLVA 4BP3A 5DRYA 1O6ZA 1B14A 1QC5A 3K0KA 4O1MA 1M0EA 4GDFA 2YOFA 1T4CB 2CLFB 2P79A 3SKVA 3KAJA 1QU2A 3ROKA 4CIBA 2KLBA 1WW3A 4IS2A 2FOXA 1LC3A 2BN4A 3IHLA 4RVOA 4UVGA 5TRTA 3ZHBA 4E2ZA 3TM4A 1A4RA 1IL0A 1JIKA 1OYWA 2G88A 5DB4A 3WOVA 3ZXSA 3H8WA 3D8TA 3HN2A 3QVTA 2H1CA 3KT0A 2CNOA 3TIXB 4BEWA 1BDHA 1VHLA 1MHTA 4N3NA 4CIXA 1ZIOA 1UBGA 4Z4CA 2CNNA 3Q40A 3MLEA 4I1VA 4MROA 5IDWA 1Z5OA 4JX9A 3AF2A 3RH0A 3ESRA 3FTQA 3KKNA 4NV1A 3QFFA 3ZKAA 1UZNA 4G1VA 4OQQA 3H16A 4E0BA 4QDZA 1E99A 1QZZA 4P3OA 5FR1A 1Y6QA 2E4VA 3H2IA 4NF2A 3GO4A 1P1CA 3WWOA 4ZCRA 1Z18A 2N3ZA 1D6MA 1PWXA 1OXMA 1AQUA 1S6YA 3MAGA 3QVOA 1R5JA 4NBTA 4PCLA 3TL6A 2GKOA 4FS3A 5DNUA 1RYEA 3NM4A 3NUZA 2H1VA 1KYZA 1E92A 3UJ7A 5M04A 3UJPA 4YDRA 2IYUA 4Y98A 1P0QA 4IMIB 1LLUA 2IPMA 4X3OA 3L8DA 1GOTA 1EDBA 3LVFO 4RKWA 3R7AA 3AONB 4ZODA 1DHRA 4NCHA 3S1AB 4Q48A 1BDJA 2AZDA 3KFLA 3BXGA 4FLEA 4CV3A 5DHTA 1H8HD 1JPUA 4O4HA 3TDKA 4DE5A 4UBMA 2VQ6A 1MV8A 3DAYA 3KJFA 4FFVA 4NH0A 2PCJA 4ZI7F 3TJMA 2H9YA 1PVVA 2YYYA 4OI1A 3ROFA 1QFJA 4UDNA 3TJRA 5C8DA 3PEUA 3DZKA 4YJ2A 3UGJA 4PLPA 4YGXB 1HNXB 2Q50A 2B5WA 4G89A 2AVDA 3O4FA 4IIJF 4AXBA 4C3VA 1VDZA 5JQGA 4RULA 2BJWA 2CLKB 4YP7A 1U8YA 3HBFA 4CTMA 1CTQA 1IZ0A 1V8OA 5GJWC 2GS9A 4M1WA 5J4HA 1Q0UA 4EY5A 3HWSA 1LRLA 2FJ0A 3TLJA 5BN4A 2WHPB 4UVHA 2XMQA 2YV1A 3W9UA 1NR7A 1O94A 1JG2A 4G9GA 4PEVA 1NC1A 1T3GA 2HRRA 4L3VA 4BMCA 1F2TA 3P94A 2J7KA 5HG0A 4TMWA 3PTZA 1L5WA 2FN3A 4LRUA 5K6AC 2CEKA 4G5XA 1HO3A 2JCSA 3T12A 2CLSA 3NWEA 1P60A 1WXEA 1IK6A 5FI5A 4MKGA 5EY5B 2JFZA 1O9BA 2A3NA 5KQLA 1QQ7A 4CKBB 1L0BA 5GM1A 4IAOA 1GV1A 1CR0A 1GUBA 1A7AA 1X3SA 2M9MA 4GG1A 4OGGA 4U7WA 4DV3B 3RUHA 1A9SA 1NM5C 1AGNA 3CVWA 2GZDA 3L0ZA 3CWQA 4DQLA 1U8UA 3N2GB 3EIQA 7MDHA 1SUAA 1SXJC 4O0MA 4LJAA 3L4EA 4GKKB 4F9FA 4L78A 1U4OA 2UZ3A 1JXOA 3I9V6 2P7IA 4GS5A 4M1EA 5K09A 1BVYF 2E1RA 1BMFD 4K6MA 1RQNA 2YWRA 2HLNA 1XEXA 2C2WA 4G1FA 2MSLA 3UKOA 3O83A 2WU1A 3G85A 3WLJA 1GAJA 3DW3X 4D9CA 2ZJZA 1P75A 3PXUA 1DIAA 3KSDO 1ULHA 2HCFA 4G0QA 1LPBB 2WF8A 3U4GA 5DPMA 3V4PB 3ETHA 5AKEA 1XDUA 2MOKA 3A4YA 1PZHA 2CUNA 3AP2A 3E6AA 2E55A 1CJKC 3E5NA 4BN4A 2W7TA 1QRAA 2AXNA 4E12A 2WD9A 2Z6VA 4ER5A 4CTOA 3PA6A 3OZFA 1EJ6A 4B2PA 3H11B 3PZRA 3NKFA 3C3YA 3V7WA 3T7JA 2ZPUA 1Q20A 2ZSHA 3EWAA 3H1FA 4JEIA 3HSSA 1NF3A 4J1NA 5HF9A 2DUJA 3ZYCA 1M75A 3LKZA 4GLFA 4A15A 5ECYA 3ZQUA 1XNRB 1MXHA 1H2FA 4ZYWA 3NUGA 4BAZA 2N0SA 5F33A 4OHVA 1MC1A 2AJBA 2WSMA 3V8NA 3J7TA 5CFOA 4OUDB 4IGIA 4AWXA 3UJBA 4MQFA 3U40A 2VTVA 3WLAA 2DKNA 2YVQA 3QWHA 5KI6A 1PYDA 1ZUHA 5BURA 4IG9A 1WZNA 4JR1A 4FYIA 2VBFA 3GGOA 4Z51A 3HBNA 3MCWA 4U2CA 3F4BA 1E5XA 4ID3A 1OT5A 2IDZA 1A9XB 4GE0A 3QKSA 1LDMA 1SUBA 1G4AE 3P0HA 4UM7A 3ZY5A 4B4DA 4DXHA 1N2GA 1C2TA 1WZCA 2W0SA 2VRWA 5SY4A 4F21A 4MRMB 3GD7A 4RIHA 2NXWA 5FWAA 4J0KA 1L4HA 1IY8A 2JZOA 4WI1A 4LJ8A 1U6IA 2QN6A 1RKUA 4MDFA 1MD9A 1NA5A 3LO8A 5KSWB 4NMXB 1U9CA 3E8MA 4BB5A 5HA5A 4F85A 3A1TA 2HIHA 1KR5A 5AKJA 3GJ5A 1N1GA 1W88A 3QNMA 1Z35A 1M0SA 2R25B 3C8HA 3HYRA 1G3QA 4JP5A 3TTXA 4CVNA 4DMUB 2ODEA 5BNIA 4FCVA 1YZYA 3GDHA 4NLLA 3SXUA 2A9KA 4MR9B 1NN3A 4O59O 4DA4A 3G2MA 3I9KA 4HH3C 2IITA 1IN8A 2QL9A 3IELA 3K1AA 3ZGXA 4DJEC 1W85A 2ZRHA 3WV4A 1LWOA 1KNQA 5IUKC 1IXSB 5AKZA 3R9XA 1DWOA 4L76A 1H3FA 2WJYA 1USIA 1L5HA 1DINA 4J3FA 3MBIA 3DL4A 2XB4A 2C5LA 3KDPA 4KL8S 5CA0A 3AO0B 5KPJA 3SS8A 5GJVC 3FOEC 3HPRA 4MUBA 1BYUA 3OJFA 4S0XA 3EAFA 3NH9A 2NV6A 3BSFA 4WK4B 4A8HA 4CI0B 4KP7A 4ZAYA 3FROA 4ZVKA 1PEDA 1K6JA 1VRWA 1W59A 4DUGD 5CU7A 3PV0A 3WNQA 3UJAA 4OHYA 2IHUA 1GGJA 3HL4A 1N8KA 5KWIA 3IBYA 5J2TF 3RW9A 4JLDA 2NQTA 4BAGA 3BWEA 1Z0ZA 1ZRHA 3MNFA 5ABPA 3Q9SA 1CJVC 1M34A 3K0EA 4GYWA 1C5KA 3PYLA 4WNCA 2PX2A 1O94D 3N58A 2AA3A 1AT1A 1CQXA 1YRAA 1RWVA 4LEIA 4K28A 2GEJA 4L6AA 4BMOB 2HV8A 3GEPA 2JA1A 3IEXA 3GNTA 1SUEA 1PUJA 3Q87B 4KMRA 4QPCA 2Z5GA 4EFLA 1YZUA 1T2NA 3LPAA 1F20A 1XXHA 2XT9A 3KYCA 1XK7A 3RC7A 3CJRA 5MFZA 1KWGA 5CFLA 4CNQA 1LBIA 3B9PA 3ROXA 1JHRA 3BMNA 1KEEA 4W99A 8ABPA 4AKTA 5DM70 3UN1A 1C1HA 3WFIA 3THXB 4EBBA 3COSA 3VO8A 2EJTA 5JXIA 4MICA 4UEKA 3WNVA 4QM7A 1NI3A 2EYUA 2GF0A 3BMCB 1TMYA 1LJ8A 1D2EA 1C3OA 1SR8A 4E13A 4LJ5A 2ZS7A 3PL5A 5DSTA 3T5TA 4MRRA 4B3CA 2GJ4A 3ZQKA 3EGIA 1C3XA 1GUYA 3K72B 4K6FA 4MVJM 1NQVA 3L7LA 3WGTA 1QQAA 4P4UA 2JJ2D 3GJQA 4QQFA 2D5CA 3GFRA 4BFVA 3DVQX 2FQQA 2F9FA 3H6GA 3AX6A 4H1HA 1PEAA 5TE9A 2CSXA 1O4VA 1FNMA 2ENUA 4BNVA 1JU4A 4HTAA 2H4FA 3UMYA 1LRJA 4DA9A 4XDZA 3L1HA 1OY1A 1P7CA 4PINA 3U37A 3U4MA 4BY9E 1L7PA 2C1XA 1KK0A 1AXEA 5BN5B 2IK8A 3WHKA 2W2NA 4FZ5A 2ZUWA 4OB7A 2ZTSA 3AVPA 3RYFB 4P33A 3RREA 5IJ0B 5KWEA 5CNKA 1E66A 2LR0A 4C4SA 5K0SA 3I4CA 1OFVA 3ROTA 6ABPA 1HT2E 3VYSB 5FT9A 4F5EA 3F49S 5IH7A 1FEZA 3L4BA 4YUAA 4FYPA 3EOBI 2EF0A 2OB2A 1GCIA 2CBGA 3NC1C 1XFAA 1SIBE 2PL5A 5IDQA 1TYDE 4QOIA 3G2HA 3K9QO 3MILA 5DHSA 3RWBA 3MGAA 4A10A 4IXMA 2QX9A 4XPZA 3OOSA 4IILA 4S2EA 4RPIA 4WVLA 5L4LA 3ZWNA 2RJNA 2VPYA 1QPZA 4KIJA 1IG3A 2XUKA 4LC1A 1BHJA 2B8WA 2W8BB 2REXB 1WTCA 1MVLA 2HO5A 4F1JA 1P1JA 4YWHA 2EZUA 4KGZA 4A0HA 1E6CA 2OC9A 2YIJA 2Z3WA 4IFIA 1LDBA 2F8MA 2GX6A 3Q9NA 3EY9A 4JP2A 1X74A 4WFKA 5FYQA 4X7RA 1VKRA 4DARA 3D31A 5JHGB 1T5HX 2I6TA 1XEWY 1ENZA 3H2ZA 3WDSA 2Z43A 4G41A 3EEIA 4LI3X 4FVTA 5BRJA 4BMVA 1V7CA 2RH8A 3VC1A 4EATA 5A5DA 5F7JA 2YZNA 3FPAA 1R15A 1DZ3A 3K9BA 3BTSA 5CT6A 2RGAA 1P3DA 4QRIA 1GNLA 1R5NA 3TL2A 3AKDA 4ARZA 5B6JA 4QU8A 5FTNA 1PR6A 4OD0A 2I6FA 1QZTA 2O3SA 5FFNA 4OHBA 4GOOD 4EM6A 4DWVA 1HR0B 1E60A 1IN1A 1IUPA 1JDBB 3ID6C 1DC6A 3OY7A 4QDXA 3EH1A 1JDJA 1ZKDA 3FOZA 4LPKA 2G5TA 4S1VA 1A5SB 3WL5A 4WECA 4RY0A 1JP7A 1POWA 1XCBA 3ICPA 3OQIA 4WGGA 2Q5OA 3OX2A 4ZOBA 1CUJA 1EB9A 1TF5A 4B8YA 4M8KA 3KS9A 3OLCX 2J48A 2OECA 3BILA 2FPMA 4P4NA 4QYXA 1J21A 4UNSA 3S5UA 2Z5FA 5LQMA 1S2NA 2JASA 2ISCA 1H42A 2VNIA 5KJ1A 3T5BA 4AKIA 3G7UA 4PZDA 1KRXA 1R74A 1OT3A 4OGKA 4JI0B 4PRLA 1J1UA 2FUG6 3VNRA 3P4YA 3SYLA 4EX7A 3TOZA 2I6GA 1CB7A 4ZANA 1E2KA 2CE2X 1J7KA 1PNRA 3RWMB 1SUDA 3WHLA 2RGNA 1ZGAA 4WEOA 2O8BB 1Z68A 4HMPA 3GGPA 4U1RA 4F5WA 1DQRA 3L07A 4D9KA 2O2DA 2XXAA 3L8CA 1A9ZA 2F1KA 1QIGA 2AOWA 2WV7A 4IJQA 4P3NA 5CXXA 2DUNA 3IP9A 5K3SA 5DXAA 4TKVA 2XCUA 2H1SA 2H1OA 2C42A 3O0DA 1ONBA 1V7QA 4EMSA 3JAKA 3QE3A 2BFMA 1K9VF 4RUKA 3TL3A 1JR2A 1XZMA 4OYRA 2OQRA 1JG1A 1X1CA 3M4XA 4O33A 1LCIA 1UT8A 3P0IA 4OAQA 4RQAA 4DDWA 2JLUA 4KR6A 4E07A 5EJ9A 1NG9A 2IYOA 6Q21A 4U2BA 2Y1XA 1UP6A 3TQQA 1A5AB 3A27A 3VAAA 4GFDA 5KQGA 1RRVA 1QH1B 2G0AA 3PCTA 3MQFA 4LXQA 5G3YA 4BKQA 3JY6A 1M6YA 1PT6A 1U0FA 4GC9A 4R9SA 4YCDA 4OQFA 4J0QA 4U9UA 5CIQA 2ZYRA 2QJWA 1TYZA 2B5OA 1VCHA 2KM1A 4LXGA 4YFYA 4DLKA 4B3GA 4PX3A 3TIVA 1YAJA 2ZQYA 3YASA 1TL7C 1IBLB 3CKLA 4HAYA 1ILWA 1E8MA 1S96A 2O0LA 3BK2A 3CRNA 4O4HB 5A7FA 4P31A 1QH1A 1YRHA 5EFZA 5CVTA 1MJ5A 2JGLA 3DFMA 1TUGA 4KJZA 4PS1A 1X92A 2YY7A 1X7ZB 2V6MA 3V7FA 3W8EA 3QU9A 2C3PA 4I5EA 3OI7A 4RK5A 3T7KA 1M6WA 3OJXA 1OIXA 4PYIA 5EE0A 1P77A 1M83A 2BMFA 3RDPA 4O4LF 3M83A 121PA 2FVYA 4RHTA 3NBFA 4RV9A 1M66A 3MPUA 2ZYSA 3LXMA 2VNKA 2HOQA 4IQ0A 4Y1RA 4ZOCA 5JR3A 4IUYA 2F55A 4PLYA 1XZCA 3N8KA 2X9LA 4MPPA 4XLTA 4ZXPA 1P9RA 2Q07A 3OLYA 4P54A 3WGYA 2ZJ6A 1VPVA 3H65A 3HZRA 4TSKA 5AP9A 2G4LA 4ER7A 5MDHA 2HTFA 3H19A 5IT0A 3JYHA 3S27A 3UF0A 4PZUA 4WZAE 2OAGA 3B89A 4HAIA 1SU6A 4O2AB 2DY1A 3T9CA 3ESAA 4NU0A 3RSOA 2ZK7A 3JAWB 4B47A 1Z8NA 4DA8A 4Z4GA 4NY1A 5IVDA 3RNOA 1E4OA 4P53A 2QZJA 1LEHA 5EZ6B 1QDUA 5DVZA 3SZRA 3UG7A 2JI7A 3AXSA 1XAJA 3AUFA 1FNDA 3C3PA 2HK9A 2I9PA 2GM9A 2X3YA 2ZAYA 2ZIVB 3LPDA 3MFYA 3AVQA 3BXEA 1I5EA 4FI3F 3G1TA 2CMHA 2QBYB 3RBZA 4LN1A 2GJSA 2QE7A 3JQPA 4I08A 1GVHA 3LAWA 3X0DA 2NUAA 5CBPB 3PQ7A 2O52A 3UH0A 3SVTA 3EVGA 5EJ4A 5D6OA 5HXAA 3E1GA 1ORVA 4PGHA 3V46A 5A9SA 3WIVA 4UEWA 4TMVA 1DAIA 1JFVA 1E9FA 1ZWLA 5AOCA 3NM5A 5ITWA 5E7QA 3BMOA 2QBYA 2JD1A 1GUDA 2FN8A 2X0NA 2RKBA 3WC4A 2AMVA 1VHJA 3CNOA 3O1HB 1DU4A 4WCFB 1BKSB 2ZUEA 1SC3A 3LGXA 4IO1A 4X1KA 5EJ7A 4X3PA 2JAHA 1REQA 3SIXA 5L7WA 2WFLA 1TRKA 1D2RA 1ZD2P 2HIAA 2J4CA 2UUOA 3CLTC 4TGLA 1IZZA 1N9KA 2OVBA 3L8YA 4WBNF 3AESB 3SD7A 1T6BY 1X38A 1NY5A 3OT1A 4JIGA 3VMMA 3ZVRA 4P7KA 3IDFA 2JJ1A 2NVOA 3OTGA 5HKAA 3C45A 2X8BA 5LOVF 3QITA 2W6JA 1I7PA 2PEZA 2QUJA 3DYVA 3AFNA 2QJRA 3CT4A 3F6YA 4LKRA 3VSDA 3R4VA 2CVHA 2CKDA 4LQLA 4RHXA 4UTVA 2IBMA 4RADA 3FTNA 4R9NA 5ECWA 1W4LA 5IJ9A 4F7WA 3ZWMA 4P4TA 5LBIA 2ZB3A 5E1BA 2YZMA 2BMEA 4ZVUA 2O50A 1HORA 3GLRA 2GHRA 4G36A 3L9WA 1F0PA 3WAJA 1BOFA 3LVRE 4RTLA 1QG2A 1J8DA 6LDHA 4PM4A 3SG0A 4O4IB 1WKCA 1R6XA 2YS6A 3JARA 4RMJA 4XIYA 1T24A 2R44A 2W70A 4ZK6A 3M7IA 5M3BA 4ZOAA 3VH2A 3QXGA 2WR8A 3B13B 3F9IA 5F64A 1BXKA 5F52A 4HQNA 4JB2A 5TV2A 2DULA 2FHSA 4M9UA 1PF7E 2ZBPA 2C07A 4LV6A 1HA3A 1MOSA 3CXRA 3LFUA 2G70A 4IGFA 4NL4H 1WWKA 2G0NA 3N6VA 3RC9A 3WX0A 5FOXA 1NVMB 1PVDA 5A1JA 4PZPA 2I87A 5EXPA 3A6JA 3PXXA 2Z2IA 5KKNB 4J6EA 3KWMA 2J9YB 3I1YA 3CZCA 1CY4A 1NJ8A 2VHUA 3TKAA 4QNMA 3B6MA 5EFOA 4Q3BA 2WFLB 3LKBA 4F8JA 2C59A 2RCYA 4LOIA 2OGTA 1G4HA 2EFCB 3KZKA 1GLVA 5TQ0A 4C04A 4Y1RB 4A1FA 1GITA 1IM5A 2ECQA 3FCAA 1QKKA 4LNHA 1X8JA 3CBQA 2O7SA 2B21A 4I2VA 4H7KA 1K6IA 3D02A 3EBOA 4HF7A 4Z9YA 3TAXA 1DAHA 4KR0A 2ES4A 1Q0SA 3ILXA 1Z2PX 1V7PC 2V7PA 4ZOEA 3H4MA 5ALFA 3EXHC 4HK4A 1OASA 1WXIA 4E5DA 4F2GA 1NSFA 5AVXA 4FB4A 2FR0A 2OCGA 3LUDA 3ETJA 4KBYA 3DTVD 3FAKA 5COAA 3T7RA 1H8EA 4IRMA 4Q1BA 3BE4A 3IFSA 4IEIA 2F48A 3BHJA 4JR0A 4N7RA 4XM0A 1DIGA 3K0AB 2ZIXB 4N8SA 4REMA 2Q5LA 3GAAA 2G6BA 2IYRA 2YMQA 4RPJA 1XG5A 2XBMA 4PBTA 1XZBA 1EP3B 3CONA 1R8XA 3LQ1A 2C3YA 1AF7A 1P80A 5JFTA 3JRNA 1JAZA 2A0YA 5CX4A 3W78A 4B6FA 2H59A 1A8QA 1N75A 4M0PA 5K0JA 4EB0A 3H5AA 1Z13A 1V45E 4R4JA 5TVKA 3RS3A 1R0BA 2QIPA 3OE4A 4YCBA 3PCRB 5EZYB 3Q3IA 1OBHA 1JDNA 1H1LA 1P81A 3IPXA 4TKLA 5IKOA 2M6LA 1U5BA 5KNCA 4G8JA 4R6XA 2W2VA 1DOZA 3EEYA 2V6FA 4NG4A 4C0SA 4ZPXA 4PAQA 5AIBA 3U1BA 1DG3A 1XF9A 1T0BA 3ZKWA 5K3BA 3C7AA 3F71A 3GUHA 1YGPA 4Y8VA 1VHTA 4G0WA 1V43A 3GNQA 3KFVA 1S1MA 4WT7A 4MP8A 2G09A 2Q62A 3S28A 3R0JA 1PJAA 4TQGA 4AZ0B 3T3OA 1SVOA 3GCDA 1II8A 1BX0A 1R6BX 1VBMA 1WQ4A 1DV2A 5KDLA 1T1RA 1HK7A 2J9FB 1YKFA 3FR7A 4QDOA 3QXXA 5AJTA 4ZYVA 2AMLA 1HEIA 2ZXFA 1EDOA 1NX9A 4M0FA 3E27A 4U9HS 4X6XA 1QP4A 3HKBA 1AKNA 3L1IA 1M73E 1G2IA 2GT1A 1CULC 5T64A 3UAOA 1H23A 1ZK2A 2BCJQ 4B35A 1FTNA 4KQWA 2GM3A 3O8DA 1XXLA 1NYQA 3LUBA 3T1YB 2FEOA 1EFPB 1Q3KA 3EFHA 4LNUA 4Q00A 3ZX5A 2O1WA 5DYYA 3VPGA 2BJHA 3ND5A 5C8YA 1AHHA 4XWOA 2ECKA 1XZLA 2WD7A 4RZXA 4JEHA 1NRIA 1AO3A 3FCOA 4Y9TA 1VE1A 4UM5A 4LA4A 3SY8A 3OM1A 1E4VA 1EUDA 1K0UA 2XNDD 3O3CA 4L0MA 2FDXA 3ZU6A 3ZHUA 3ZJVA 1PT5A 1OQAA 1KKMA 1I1NA 1QO0D 1WNTA 5F1KA 3TKYA 4M7OA 4CWAA 1JZSA 2QTFA 3OP1A 4Z4EA 1IUNA 4L50A 3QF4B 1M1UA 3SSOA 5AVSA 1DBWA 4D4JA 3FNRA 3O1LA 3FLEA 1U3CA 3CMCO 3PLRA 3ZK8A 3LXXA 3D3EA 1KZ6A 1SBTA 2DFKB 4TWZA 2DBZA 2IP4A 5E0OA 4Q15A 1UK8A 1XD2A 2XBUA 3I6MA 1HKHA 2QD5A 1Z33A 5TNXA 4M76B 1PJCA 2CXSA 3MUFA 1SZPA 4A6XA 4D46A 1W1WA 5KYXA 4UOQA 4DG8A 2F3TA 5IUNC 1CRLA 4H4EA 4AYWA 3FE2A 3SF0A 3T1VA 1CJTC 2NO6A 1A8IA 1X1AA 3GN1A 4IMRA 3FZGA 3P32A 4PFQA 5EXSA 1MOPA 1SM4A 3U3MA 3ADOA 1IN5A 3EWNA 1Y8RA 3MJVA 1UWVA 2H06A 4D92A 1E9VA 2E4XA 2HA5A 5ECDA 5FFFA 5TGZA 1Q1ZA 5A4DA 3OUUA 5JPIA 2FPGA 2NNWB 1DEXA 1TO1E 5K8CA 3PGKA 4PZYA 1YIDA 3KZ1E 2AOUA 2AGVA 2VQDA 4BX3A 2FW7A 5F77A 5AW1A 2GN4A 1VJRA 4NOLA 3RYHB 5A5EA 1ZUNA 2EZ8A 3BE5A 3HG7A 2OFFA 3IXLA 4II7A 3UJNA 4UHDA 3ZY4A 4W9NA 3QV2A 1R00A 3U7FB 1ISRA 3GLFA 5K03A 4EW1A 2JCGA 3P2IA 4HWPA 3BWXA 1CUXA 5DTQA 4EUKA 1K3FA 1ZPDA 2C9ZA 4UAJA 1IB6A 5KOYA 1FYFA 2JAUA 1M6VB 2EQ5A 2QT9A 2OBLA 4KXLA 3KL2A 4YTEA 3S40A 2KB0A 2HGZA 2G80A 2WM2A 5B1SA 1EK0A 3IHWA 3CEMA 2EFHB 2BGJA 4Q24A 2ODWA 5TR9A 4JYZA 2Q6OA 1YHNA 2YVAA 4QATA 4H18A 4JC5A 3DE7X 3H8JA 3ZOKA 4BTEA 4L5AA 4URYR 2JATA 5DBOA 4Z9FA 1JIVA 3MIIA 2G7MC 3T3PB 5C81A 4PFKA 2HSGA 4DANA 4EI8A 3QMWA 3QVKA 3TZHA 3WGIA 2CXNA 4G81A 5EZSA 2W8BA 1SG0A 3T9FA 1G8HA 1J0BA 2GAJA 3DO5A 3KKPA 3EASA 3UJ9A 3ZDYB 1ID1A 3CLVA 4ENUA 2ACEA 2VUSA 1R6TA 1WDMA 1FLVA 2LTAA 1ZQ1A 4LXUA 2XRYA 4RLHA 4BB9A 3OOWA 2QG6A 5LOVB 1QYIA 1R6DA 1ULSA 4F93B 2DETA 1HM5A 2VQSA 2Q41A 3G2LA 3DLIA 3N8IA 3SC3A 1YRBA 1Z39A 3BJRA 3LGAA 4M4SA 4MW5A 4EKYA 5LP6F 3V6MA 3JPYA 4MYUA 3PWKA 2VWPA 3HKBB 4S12A 4BX0A 1OBVA 2WYUA 3EZ6A 1ECCA 3GQBA 1CUYA 1XELA 5AVOA 4BC0A 5E1MA 4A1OA 4C6RA 2XGMA 3EQZA 4P8RA 1I2ZA 2WA1A 1UBCA 9MHTA 3KLNA 2I7XA 4F71A 5C8ZA 2GF9A 2JW5A 4BFSA 3KR9A 3L7YA 4QJ4A 2CHEA 3STXA 4D3ZA 2ZSFA 5M29A 2WT4A 1EFAA 3C5HA 4AKEA 1BMDA 1NP3A 1HXHA 4RZSA 4M0UA 4KRGA 2IEZA 3L0OA 3WLFA 1VL6A 2HADA 2X1LA 2WIJA 3PEVA 4DCGA 1JE0A 3EZLA 5I47A 3Q8MA 1WETA 1WOMA 1KA9H 3V2UA 3ZHTA 1LBHA 5KVCA 2Z8YM 3F90A 4Y6PA 3KTAA 4J94A 2QXTA 4ME6A 4N01A 5GP1A 1K08A 1P4JA 1SXHA 3O8OB 3WJ7A 2O3RA 2P1ZA 1SURA 3QI7A 2J3EA 4UMEA 4QUJA 2DHDA 1FMCA 4Q3LA 1YS2X 4GZMA 3EEFA 3QG5A 4YJHA 1UFQA 2O8CB 2JC3A 1Z7BA 3K1AB 5AW7A 2D2VA 3DHEA 1N2ZA 2ILVA 3KYIB 3PFWO 4P38A 3N2ZB 5F5LA 1QZXA 3PUHA 3G6WA 1R4MA 3GJ7A 3O8OA 2PUVA 1P1FA 5LCXA 2WT8A 4D0GA 2G67A 3K1YA 4CMKA 1Q7EA 3VO2A 2VYND 1QNLA 1M8PA 5IJAA 5JVDB 4EG1A 4O8ZA 5LQKA 2JG3A 2X7HA 1J5XA 4LI0A 4BGVA 1Y7IA 5AM0A 1CQIB 1PBTA 1DIHA 1RP1A 4FYVA 2Q9UA 1FFBA 4ZRNA 3CSUA 1YQTA 3V33A 2WWWA 3DE1X 4BWYA 4DV0B 2W98A 1IBMB 5EHIA 3INTA 3N7AA 1HQDA 3QA3E 1IY1A 4FE3A 2PBFA 4I9UA 1FVFA 3O8LA 4LRWA 1Z0KA 4J0IA 1F8YA 2O14A 3GDWA 4UTXA 3OMXA 5NULA 5HJEA 1EM6A 2NTVA 4E2YA 5IZCA 5JSQA 2C4MA 4IDHA 3WHPA 3M82A 4M22A 2VTBA 4BRZA 3M4YA 2F90A 1E94E 1Y6JA 3LMKA 4LRXA 4TV8A 1K27A 2ZTVA 3ONDA 1GZ7A 5EL0A 3RU3A 1AMNA 3TAUA 4HADA 1XTVA 1I7DA 5JC8A 4MZXA 2YHIA 2BMVA 3BH6A 4I99A 3VOSA 1A8UA 1BH2A 4EYGA 2DB3A 4FNGA 1B74A 1FRNA 2FA9A 2V3WA 3ITKA 4MW1A 3SXUB 4B2LA 4E5UA 1Z25A 2XB2A 3LUJA 3WSWA 2XGSA 2BDTA 1DC3A 2A30A 3QEOA 4YAFA 3RODA 2F8SA 1HX7A 2AR7A 2PPVA 1L4FA 4CTKA 2PE5A 2WC1A 1XXHE 2AC2A 3RO7A 4RJKA 3BCSA 3EH2A 2WJWA 1UM9B 3E7WA 2P6RA 1JE1A 3JTMA 2HLDD 1F2UA 3C1OA 1IFXA 2QAJA 2Y0DA 3OPYA 4HD8A 3R3ZA 1BD3A 2HQBA 2BFBA 3WL8A 2J33A 2J59A 1TM3E 2WK1A 2WNIA 3F67A 3P2EA 3SIWA 4AJ9A 4JXZA 3FOFC 1U2EA 1YL7A 5EHNA 3MMPA 4US1R 1UK7A 4HPJB 4B3SB 3CLSC 3M5DA 1KQNA 4ZZ3A 2QD3A 2H11A 4OKIA 5JD3A 1O87A 3T99A 4X41A 4D8WA 4OP3A 4Z9BA 4FMDB 5CFQA 4KPYA 1NW3A 1NWHA 3IEVA 1XJ0A 1Y1RA 1P0MA 3JQFC 5C5CA 3TGPA 2GZMA 4PYLA 4CDRA 1LBQA 1O6FA 1UQUA 1WCYA 4PLCA 4PO3X 3WOHA 3SC4A 3W77A 1CV2A 4D43A 4YRKA 4GL2A 1H8HA 4TL9A 3EQ2A 3C2QA 3DMYA 5IAAA 1M8FA 2Q2QA 3DZDA 4IIHA 1ORRA 3ANYB 3ETNA 2GN6A 3CTPA 3WNZA 5IJZA 4ARAA 1C0EA 4MMXB 4YCJA 3H3JA 5KTNA 3T3HA 4YRFA 2AOXA 1V4BA 2X5NA 4MUMA 4KLRA 4CTNA 3U7JA 2G06A 1B3BA 1RADA 5EJ5A 4H3VA 4I4TB 3LP5A 4KFUA 2R1VA 3NTQA 5A6SB 4AIRA 1ZOIA 1SZDA 2JEYA 2P35A 3F8WA 4ZGGA 2AYYA 1AC5A 1K1EA 1R4NB 2VHTA 1PJBA 3D0RA 1QORA 2D2FA 4IZHA 4N7BA 1J0EA 4J16A 4U6SA 1KF0A 3JWHA 1GGMA 1SVMA 3OM9A 3OX1A 3ONWA 4IO0A 3USZA 4R1UA 3WLPA 4ETNA 5GV7A 4MUFA 2XUIA 1XZDA 1BU5A 2O2IA 3PRKE 5EP1A 2Q21A 3ZHSA 4Q7QA 1LSOA 4LV8B 3L7MA 4LYFA 1PR1A 4O4IF 2IRWA 1IM2A 5GQSA 1U0SY 1ZH8A 1J97A 1DX6A 1Y98A 2C94A 3AOGA 4PXAA 1DJOA 2RKWA 5CX1A 2ZAMA 3UK0A 4E22A 2C5EA 2UKDA 1L8XA 5BMVA 1SC6A 2O20A 4R8KA 3FWNA 3K73O 4QUDA 1PFGA 1Y48E 2AFIA 4GF5A 1LX6A 5C1BA 3LI2A 1XEAA 1WTAA 5PGMA 1XF1A 3B6IA 4C7BA 1IXKA 3MLAA 4H60A 5DWDA 1BXRA 5L6MB 2DLDA 3BT7A 2Y0EA 4RWZA 2Y1DA 4W6QA 4YRTA 3BJEA 2O5EA 4IZOA 3TG2A 4YT2A 4B9AA 1L5SA 2WU8A 4C5CA 5C8YB 2DM6A 2IFTA 3WIBA 4L57A 4N41A 4HDSA 4M49A 4C0WA 4NIMA 1TA9A 1S4QA 1JYFA 3OE5A 3GB9A 5AI4A 1EVIA 5F21A 3OT1B 3U4QB 4L4SA 4M1SA 2P0EA 3VZPA 2BMAA 3VR5H 4E3ZA 3C41J 3WB0A 5BNFA 1U2SA 1CKEA 1S8AA 2VOEA 2W2PA 2QKYA 1RP7A 4KOAA 4LUCA 5BSWA 1XR3A 5F35A 1YBMA 1B42A 1MB3A 3C7TA 5IFKA 1U31A 2PFKA 1V5WA 3ZK9A 1FQWA 2OXFA 1UFKA 4PQGA 1T0HB 3NPAA 1JR3E 3OFJA 4RD0A 3TPCA 3MGKA 4R9UC 1J00A 1LWNA 1ORWA 4HGPA 3VHXA 1P7YA 4QDTA 3QBEA 4M9CA 4CGYA 5AVRA 3BEDA 3C3WA 3S99A 2QNIA 3B1FA 4N5NA 5DYGA 1W93A 3N0RA 3R7FA 1OGIA 3UXEA 5LU9A 3E3AA 2WYOA 3ACCA 1RXSA 3JTEA 1XPOA 4OFBA 4WJKB 2F43B 1N6OA 4TKVB 2OGSA 2VDNB 3D8UA 2IYFA 3F9RA 4Q1CA 4J1TA 2HHCA 1IVYA 2BGGA 3LWNA 4AD8A 5KVSA 4F06A 3GEGA 2QJOA 5H4GA 3H5IA 4JP3A 3NT5A 1T8UA 2FN4A 2ENWA 2ZVDA 3D54D 3DUWA 3F3SA 4HWRA 4YP9A 3TTSA 3LJKA 4HV4A 1A88A 1GG8A 4B3IA 5JMWA 5A71A 4UULA 1FTQA 2PD6A 1VIYA 2CJXA 1DX9A 1XRJA 4V24A 4E33A 3TOCA 4EPWA 1AY0A 3THWB 4RZIA 1TE2A 1SOWA 3FMPB 3AFOA 3QEMB 4R01A 2P77A 5CDHA 1JHXA 2P3OA 2J7PD 3EULA 3Q6IA 3VVMA 1KP9A 3GLSA 4MKRA 3PUJA 2A5JA 3FVQA 5D01A 2EFYA 4LC9A 5G1PA 1I30A 1VM6A 2ZS9A 4LZAA 3OPQA 4L85A 3I5UA 3ASUA 1E5DA 5H0IA 1J56A 4FNAA 1RAEA 2I1LA 3LBFA 4PSCA 5HQTA 1AKUA 1ND6A 2FB9A 4HUQA 1JKJA 1UDCA 1GNPA 2VDWB 4U2KA 1AGPA 1SXJB 3UHJA 2Y67A 1O8BA 4HBZA 4TTJA 1I13A 1H2RS 3HNPA 4XRGA 1FS6A 3ZX4A 2O1SA 3IHTA 1LDGA 2FZKA 5FQOA 3E3LA 4S04A 5A0VA 1YWGO 3ZIAD 3JWIA 3PFBA 5JAOA 1BS9A 3P9KA 1VA5A 1RZUA 4HCJA 1R0WA 2R1TB 3OPVA 4JQYA 4R2IA 1I36A 1QZ3A 4WXMA 5EJ8A 1KFJB 4LBVA 1IOZA 2BKEA 3NYRA 4NARA 4NU6A 2W6JD 3FI0A 3UK1A 3VGJA 2V6GA 4TVSA 2GYWA 1NSTA 1I01A 2JGDA 1SHTX 4ZT2A 4V2UA 4U02A 4EUEA 3X1KA 2JB9A 3EIXA 7ADHA 2IPLA 1Y7HA 2RK6A 3KHTA 4O02B 2FUCA 4YRCA 2R1TA 4GUAA 3BERA 1AZWA 1V8ZA 4D02A 1YVPA 4KQ9A 2CBXA 3ZHXA 2QW1A 3BC1A 5JADA 4NYMQ 1XT6A 1ZJYA 2C98A 3OZTA 1H5UA 2Y2UA 2R7NA 1KH3A 3I2HA 3JD0A 3P9XA 4IJKA 3S1LA 2VUTA 2VNSA 5LYYA 4D8UA 4DLYA 5I8WA 5F9FA 3C3DA 2FG6C 2ZEJA 1QF9A 2IUSA 3IT3A 1LGYA 2H0RA 3U6KA 4HDKA 2NGRA 4N0PA 2PQMA 5JMOA 5HKOA 3IUQA 3CCFA 4QTTB 3QY9A 3VU9B 2OCKA 2WFZA 1PWYE 2IIQA 1KSJA 4FJ0A 3JWEA 2QLBA 3A2NA 2C2KA 3LIPA 2JIBA 1W75A 3IIKA 2JS7A 5KVVA 1LPSA 4JODA 3SBXA 2GVNA 5AOVA 5JS7A 1Y8AA 5TVGA 2B20A 1Q22A 1PI3A 9ABPA 3DHNA 4XWAA 3IQWA 4A23A 4FKMA 5FBLB 2JLRA 2A9PA 2BL4A 3BD9A 3HM9A 4ISCA 4PHGA 4TZ6A 4PGGA 4V0QA 5ALRA 3WLIA 4ZTBA 1YQEA 1A2BA 1K98A 3HY3A 1G2OA 1XVTA 2RK3A 1A9YA 4RE6A 3WYBA 5LMCA 2HT1A 4JN6B 3HJUA 4BAUA 2ICAA 2ZBFA 3LQYA 5I8ZA 3NMUF 5ALQA 2ZAOA 1QIMA 3EEQA 5CTJA 3UWKA 3DCIA 2RGWA 2R00C 2QN3A 3BFJA 2B7LA 3ND6A 2XMRA 2ZVQX 4HAZA 4M6WA 2ZUUA 4E4RA 4I55B 1OXSC 3CUEF 5AOAA 5FNVF 3A2KA 3KAPA 1VKHA 4JJIA 1H22A 2XKJE 3JD4A 3D6NB 2JFNA 1M2EA 1M2OA 2NUAB 2JCVA 2WPNA 4KE8A 1KIAA 4GKAA 1SQSA 1UBLS 4FCCA 4XARA 5E9JA 5EZYF 1BHO1 2O48X 1I3LA 1J22A 3IBCA 2H2DA 1L7BA 4DV7B 1JJ7A 4KQJA 1F12A 4D74A 1ZJ6A 1G6Q1 3JWGA 5C7LO 2VAVA 2OC4A 4TSFA 1FK8A 1GQOA 5G0UA 3I53A 2GHQA 3RUDA 4FZ3A 5FL7D 1S3IA 2ZIEA 3HUFA 1U98A 2MYTA 4WZ6A 3O93A 3P9IA 4HTFB 4BV3A 4D45A 4M99A 2WAOA 3MWLA 4UDYX 1E2FA 3T34A 3HLKA 3EFEA 4UE3S 2GGSA 2DPLA 3M5CA 3MUEA 1ZGGA 2J6HA 5BWCA 4OVKA 2Z2YA 4IUCS 4Z1MD 3TF5A 2ERYA 2WOJA 2FE4A 4LX8A 3KXDA 1UIRA 4HUQB 4WXEA 5D00A 3LQ4A 5TQ2B 3RYCA 5LBUA 2ZR0A 3LC7O 1EXWA 4UZEA 5IS2A 5KYWA 4I19A 1W4ZA 4C5BA 3FSGA 3VJKA 4XTCS 3S7TA 3C8MA 2JARA 1P7ZA 1GU7A 3ND9A 4QPDA 5SZKB 1Z28A 2UYQA 1FF9A 5AR1A 3WLMA 4FGLA 4MKHA 1DT5A 2I6QA 3D6HA 1YKSA 3OCJA 1FFGA 3ULKA 1WKBA 2QTTA 4JOBA 1KHTA 5DNAA 4YRPA 3VZDA 4R0VA 4D4LA 3H5LA 5LDHA 1II0A 1EX7A 1PTJA 4L73A 5HMLA 4D9IA 4TKUB 1QYDA 1IBRA 3VV2A 2YN4A 1PFWA 3R9XB 4UPDA 5K8UA 4C2UA 4GXRA 1AVTA 1V95A 2HF8A 3N87A 4MR7A 1EYZA 5L9AA 2F00A 3RRNA 1SZJG 3D4PA 4QFBA 3RU2A 5K99A 1IK4A 3ETDA 1IPFA 3FIJA 2Q3LA 3IB3A 4X1IB 4B3BA 4AY5A 5C35A 3STVA 5C1DA 4ZI7B 1JX6A 5KNBA 2BWJA 5EJ6A 3E8XA 2ZCUA 4TXMA 3R8CA 2Q2OA 4B73A 1S2LA 4MV7A 5K01A 1WPQA 5IVHA 1XKLA 3WICA 2C3MA 2PQ2A 4YAJA 1JUDA 1PTKA 4TYMA 3PNKA 3R7NA 5LQJA 1EZ1A 4LYEA 4IDQA 1LVGA 1ULAA 4QASA 4QU0A 4RPLA 4TMTA 5IX8A 1PJ8A 3A36A 2FR1A 2PG3A 1H6AA 5K3EA 4BUJA 4CT4B 5B6IA 2VWHA 1XLWA 4AO8A 4G0MA 4BB6A 3IAXA 4BE4A 3MOIA 3UWOA 2IS2A 1WV0A 1JEQA 2EIHA 3EVAA 4K87A 3NBUA 1G7SA 4D9GA 5LXTA 3INYA 1O97C 1PFYA 2LCFA 4HNRA 2NP7A 3GOHA 4R1TA 1M0WA 3LCRA 3L84A 3EDMA 4NE2A 3NWJA 2QM8A 2WWVD 4H7HA 3AERA 5AMXA 4PR0A 1GZUA 2ZYTX 3IVAA 2VH2A 1GQFA 2WNHA 3GJ8A 1P44A 2G40A 2P6OA 8MHTA 3SQNA 1A82A 4XA8A 2J0VA 1PL8A 3TMKA 3R3UA 2JVJA 4YV1A 5LA6B 1OXTA 1S3GA 3AFIA 2R87A 4G23A 4K6KA 5FWXB 2R7AA 2QTCA 3LWZA 4AJEA 3OZSA 4F0JA 5H9WA 3HEAA 1BYIA 1P2BA 5ALEA 2B6NA 3H87A 3TZLA 1ZRNA 2OZKA 3VSAA 1Q2UA 3WYFA 2REBA 5BMVB 2QB5A 1DKMA 1YR1A 3AEKA 1F0KA 1O95A 2FP4B 5LYJA 1P91A 1CUGA 4DZZA 2XOEA 1ACJA 1TQ8A 4CNBA 2PFGA 1L7DA 3D9QX 1PBNA 2ZATA 1XEXB 2R6GA 2YDYA 3I9JA 4Q05A 5AK4A 2VYVD 2R8RA 2GI4A 4KFTA 3LBHA 3QKSB 2PMWB 3D3WB 1YL6A 3HU2A 4KVFA 3LUAA 5CA1B 2ZANA 3KSUA 3NJ4A 1UK6A 4HFNA 4QOSA 1BGVA 5CFZA 4MB2A 3OO0A 3R3VA 4HRYA 5C8VA 4MHOA 2QX8A 3V7YA 1Y8ZA 3FHCB 3FSJX 3JQBC 1TT5A 1F7VA 1G18A 3IALA 1DIOB 1P29A 3WISA 1GXSB 4YACA 1ODTC 1UINA 3IODA 5EUBA 5LZ4A 1IBSA 4JJ4A 3PTAA 2Y9MB 5KO2A 1DKLA 4W5NA 1BCSA 4KN5A 4PHTA 3UGQA 3V34A 1Z2AA 2VHWA 3L41A 4XOUA 5TEWA 2JGNA 5FP0A 3AWDA 1H0SA 4QFCA 2WUVA 5AM4A 3F74A 1L7AA 1VL0A 1YIAA 1C3EA 2QYOA 1Z4NA 1LTHR 4IIFA 2Y1KA 3LE8A 1Y9AA 1SB8A 1TCAA 2YIDA 3DAHA 3IILA 4UU0A 4ITVA 2WD7B 3GARA 2ZUTA 1DTEA 2O8CA 5LU8A 4MAFA 4LDNA 3KB6A 1RABA 2CZCA 4RHFA 2EKBA 1N9GB 1Q7RA 3TM5A 2HGSA 1R0CA 5ITVA 4F84A 1TECE 1WUTA 2HCRA 2Q5QA 4Q47A 1O6GA 5AQ1A 2AEMA 5C1PA 2GVZC 4QUBA 4DC0A 3FWHA 4LVOA 2PCLA 2W6OA 1HEUA 3O7WA 1KO8A 2ZYVX 3KC2A 5AKYA 2FFRA 1L7QA 4OXRA 3L4KA 5GOTA 2ZCJA 1FDIA 2QW8A 2Q3MA 2RHGB 3CVXA 3RADC 2V7WA 3OCUA 3OZWA 2W6IA 5FEMA 4YREA 4A03A 3F5QA 1HZJA 2ZWVA 2LDXA 2QA5A 1DKOA 1UM9A 2QGZA 2JGEA 2ZKLA 5ARBA 4ZARA 5KC9A 4L8GA 2NSJA 3EVNA 1RJGA 1YZFA 1DRKA 4V03A 1EP2B 1YAHA 3NNSA 1BMQA 3S70A 3L7OA 3D6JA 3GBSA 3LW8A 3DOCA 5B2ZA 2OGZA 1FUKA 4IYRA 4GSKA 4HB3A 4ND2A 4R8MA 1V0JA 2YJ4A 4LE1A 4PRZA 4X20B 3LL4A 1RI5A 1QV7A 4YV2A 4HUTA 1XC7A 4P7GA 2FMKA 1INLA 3U3JA 3X1DA 5G40A 5ER6A 3QFCA 5IJWA 4M54A 1I6WA 4MWDA 4EKEA 3UHFA 4FPXA 3WAGA 3GFBA 1UMBA 4W4TA 1ZA1A 4QYTA 4UOZA 1KO1A 1MZVA 3M4JA 1RMTA 1N5MA 4X85A 1U7OA 1NR1A 1H5NA 5AXBA 5FI1B 1GAEO 3PS9A 4CLEA 3P97A 4JFAA 5I9MA 1K4MA 2UZ4A 2VZ9A 5L7YA 3PKZA 2FR8A 3MCUA 1UKYA 2C5BA 3AI7A 3UBTA 3MCTA 4KO3S 2D1FA 2CGEA 1Y3DE 1YIOA 4JUCA 1SVNA 4D9EA 3O3NB 2FKAA 3M2TA 4TYPA 1LRKA 3FA2A 3IQZA 4BHTA 3KQYA 4YUZA 3BJMA 1I3NA 3ETLA 4P3PA 2FMHA 2FI1A 1Z5ZA 3CG4A 3SM9A 3TTYA 4J29A 1C2YA 1RACA 4YAEA 3U9TA 1CC1S 5K8JB 4M83A 1NKTA 4PYOA 3W5JA 2WSSD 1ZBDA 2H29A 5EEGA 3NWPA 2NO0A 2G8LA 2AOVA 2F17A 4KXYA 2IV3A 4RC9A 2VF4X 4FQ8A 1KARA 3CO0S 1DV1A 1QDEA 4WKCA 5JWOA 3S3TA 3A6KA 1QP8A 4QBKA 1TK2A 3I73A 1B0PA 1TVKA 1E2UA 1PJ3A 2OO5A 1E1QA 1RHUA 4JLUA 3DMTC 4I5FA 2H5JA 1VZ2A 4MB0A 3HA2A 5DM60 2ZR8A 1QB7A 1LPPA 3CW9A 3IAAA 4QHYA 4C7VA 4WERA 3ZPXA 1F3LA 3MYYA