2ZLBA

Crystal structure of apo form of rat catechol-o-methyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
212
structure length
212
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 72
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zlbA00
3GRRA 4FGZA 4R8SA 1G8SA 4H0NA 5KQRA 1RI5A 3T0IA 1X1DA 1OR8A 2AN5A 2ESRA 2FCAA 3HA7A 3GRZA 4IWNA 2OBFA 3ANXA 4PIPA 5EZQA 3HA5A 1G60A 2AS0A 2WA2A 3KPVA 3UBTA 3H2BA 2EG5A 1FP2A 1L3CA 1BC5A 3ER8A 2VDWA 3UJ9A 3KR1A 2PVCA 3LKZA 1P91A 2ZWVA 5CM2Z 2IBTA 2H00A 3HCDA 3UWPA 1N2XA 2G70A 2QM3A 3V97A 3TLJA 1HNNA 3DH0A 3JWIA 4AX8A 2HV9A 2IP2A 2XYRA 4KIFA 2VDVE 5EOVA 5T64A 1RJGA 2AZTA 5DTRA 2A14A 5FADA 5GIOE 2O0LA 2AOTB 5D1HA 2IPXA 5GP1A 4JXJA 5T6BA 4RTKA 5FUBA 4P7KA 1AQIA 2GA9A 3HCFA 1JQDA 3DR5A 3O4FA 4PYOA 5LQRA 3EGVA 4GF5A 3ID6C 3QOXA 1JG2A 4K6MA 2G8NA 2OO3A 5K0FA 2HMYB 2PX8A 2HNKA 2YXDA 2BM8A 3THSA 2JH9A 3TPZA 3M70A 3MTEA 5ICCA 1I9GA 2P3OA 3BWYA 2P7IA 4PYKA 4CWAA 5K0CA 3EVEA 1QANA 4CKCA 2GPYA 1F38A 3EVGA 2C7QA 2PWYA 2O07A 1L3IA 4RWZA 2K4MA 5DX1A 5E1BA 2BR5A 4GOMD 5EC8A 5FWAA 2ZIFA 2WK1A 3EMDA 1BOOA 3P9KA 4QTUB 3TKYA 3G5LA 4BLVA 3GO4A 3BKWA 3HVKA 2UYOA 3KQWA 5HIIA 2PGXA 3PS9A 5E2BA 5LQAA 1NBHA 3BXOA 1KPHA 1KYWA 3FUVA 4XUDA 2JH8A 2ZBRA 1VLMA 3CJTA 4PYQA 5F2OA 4PYJA 3M6WA 5E2AA 3THRA 3E05A 3T7RA 4AZWA 3KQMA 5EIWA 4POOA 5GINE 2ZVJA 4PYMA 5HFJA 2NXCA 4R6WA 5B1SA 4B17A 3NJRA 3EGEA 1IM8A 2N47A 3GGDA 4P7JA 4PIMA 3G8BA 3UJ6A 3A27A 5JR3A 1P39A 2NXJA 4LWPA 1VBFA 3BKXA 1ORIA 4RTRA 4YV2A 2H11A 4OA5A 4E70A 1T43A 3MB5A 2OZVA 5E9WA 3FTEA 4QPPA 3FPGA 1EQAA 3FPHA 3OU2A 3TR6A 2ZLBA 3X0DA 4ZTBA 3KR0A 3HVIA 3GWZA 1YFJA 3LDFA 1NW7A 2P3QA 4PYLA 5DM0A 3RODA 2ZCJA 5GM2A 2AOXA 3RIEA 3LBFA 2NXEA 1VP9A 3UJ8A 3DLIA 1NBIA 3E7PA 2C7PA 4OBWA 4P7GA 4MHTA 1M0EA 1QAQA 4C05A 3LHDA 5FULA 5EHGA 4HTFA 3GRYA 3UFBA 2NP6A 3ELWA 5LQNA 2ZBPA 5KQSA 2V74B 4DZRA 1EJ0A 4XUCA 1WY7A 1JG1A 4YV0A 3K0BA 4PGHA 4ER6A 3HNRA 3OPNA 3R24A 4GOLD 2BZGA 3TMAA 1NW5A 2GS9A 4QQNA 3VSEA 4PNEA 1EAMA 2CMGA 4HH4A 3KQYA 1R8YA 4MIKA 5FA5A 5BW4A 5EKXA 1XXLA 2ONZA 1XDUA 1PRYA 3NVMB 3FUUA 2GLUA 2OKCA 1XDZA 3GRUA 5E8RA 3T7SA 2KW5A 4ER3A 5K0BA 4ATNA 4CTJA 4KDCA 4MTLA 2B2CA 2P1DA 3FUWA 3UZUA 2IDJA 1XTPA 4DQ0A 1VPTA 3B5IA 3HEMA 3PFHA 3SM3A 3HVJA 3UJ7A 5K8VA 3C0KA 1XCJA 1UWVA 1X19A 3KPJA 2PX4A 2AOWA 3T7TA 4RVDA 4BLWA 2O57A 4XCXA 2QRVB 3UJAA 2YUIA 2P35A 3LGAA 5U4XA 4KWCA 5G02A 3DXZA 3LCCA 4QDJA 1SG9A 3FYDA 4HGZA 1DL5A 5LQCA 3DUWA 3PB3A 4FS8A 5EIFA 2ZIGA 3B3JA 3KQVA 3KR9A 4E2XA 1X1CA 4X41A 4KVZA 4CKBA 2GH1A 3NW9A 5EZSA 1JG3A 4DCMA 2IH4A 1R8XA 3NMUF 5H02A 2CMHA 2WA1A 1O9HA 1ZG3A 3BWMA 3ME5A 1XDSA 2Z6AA 1H1DA 3ELYA 3KPWA 1RJDA 3BGVA 3JWJA 2ZW9A 1FJXA 3DTNA 1NV9A 4RYLA 5DXAA 1SVUA 2YTZA 2OB1A 4F85A 3AXSA 2DULA 5EG5A 4RTOA 3IEIA 5FWDA 3PX2A 4RTJA 4FZVA 1MJFA 4EQZA 10MHA 3HCBA 1FPQA 4X61A 3EGIA 5BXYA 3B3FA 4R05A 4BY9E 1ORHA 2Y1XA 1RI1A 3KKZA 5FA8A 4BP3A 7MHTA 1I4WA 3RW9A 4NECA 5F2NA 3AY0A 5K09A 1G55A 4RTNA 2UZ4A 2Z6UA 1VQ1A 5EKUA 3FTFA 2LD4A 4IKPA 2VDUE 4IV0A 5DX0A 5FHQA 3HCEA 2EX4A 3A7DA 5HILA 1YZHA 3TOSA 4E30A 5MHTA 5E1MA 3OFKA 4E31A 2ZZMA 3I9FA 5KYGA 1KIAA 3G2MA 4HTFB 4P58A 1AQJA 3FRIA 3G2OA 1RI4A 2FHPA 2NYUA 5LQJA 4U7PB 3FPFA 1IY9A 2XYQA 1KR5A 1R74A 2AR0A 4AZSA 5HZMA 1KHHA 1TW3A 3G2QA 4DCGA 5JUWA 2IH5A 1QYRA 3ORHA 5LR6A 4GC5A 5CD1A 1JG4A 2QRVA 3P2KA 4WXHA 3P9IA 1RJEA 1WZNA 4ISCA 5DX8A 3KPYA 5K0NA 2I6GA 2O06A 4C06A 4C04A 2JJQA 2OPBA 4F86A 4YUZA 5C1IA 5LSAA 3A26A 1ZQ9A 1YF3A 1WS6A 2AN4A 2JHAA 3OZRA 3ELDA 2UYQA 3LX6A 4RTSA 3G8AA 2IIPA 2PWPA 1M6YA 2BM9A 2ERCA 4QTTB 4LWOA 5DSXA 4ER0A 1JR4A 3KQQA 3UJBA 3R9XB 5C0OE 3M6VA 3KQTA 1KYZA 3R6TA 4GQBA 3SSMA 3TFWA 5DTMA 3UA4A 8MHTA 2P7HA 1FBNA 4PINA 2H1RA 3GXOA 3IHTA 4RVGA 1X1AA 3QOWA 4C4AA 1Y8CA 4M7RA 4EKIA 4ER7A 3MQ2A 3ELUA 3P97A 4HC4A 5CVJA 4YV1A 2HTEA 5CVUA 5CIYA 1YUBA 3EEOA 2EJTA 3OZSA 4R8RA 2P41A 4XUEA 1L9KA 3NVKI 2ZWAA 2Q41A 2FK7A 4A6DA 3CC8A 5HIJA 4EKGA 3HTXA 4Y2HA 2XVAA 2XVMA 4FP9A 3KU1A 1G8AA 2GAFA 2JHCA 3PLAE 2ZZKA 2IGTA 2I62A 1EG2A 3KQOA 3BWCA 1O54A 4PGGA 3C6MA 5EQJB 1RJFA 1XVAA 3FUTA 3HCAA 1JTEA 4GOOD 5E1OA 4A6EA 5P8WA 3B3GA 3FTDA 1N7IA 1NW6A 3TM5A 3EVDA 3LPMA 4O29A 4LECA 2IBSA 1JSZA 5CVDA 3KQPA 1G6Q1 1NW3A 4DF3A 2ZTHA 1VIDA 4OQDA 3SXJA 3DLCA 2G1PA 4Y30A 2R6ZA 3HVHA 5E1DA 2PY6A 5GIPE 3SSNA 1YFLA 4YMGA 2UYHA 5HIKA 2NP7A 3D2LA 3GDHA 3ER9A 4LG1A 1VL5A 1D2CA 4RTPA 2JG3A 3DP7A 5K0JA 3BWBA 3FUXA 4GUAA 2ZBQA 4PWYA 3GIWA 2GB4A 3OU6A 5K0LA 1SKMA 1AF7A 2IDKA 3I5UA 3SVZA 4PONA 3SX0A 3VC1A 3FRHA 5ERGB 4HSGA 2IH2A 1N7JA 4FSXA 4FT2A 4OX9Y 5E9QA 5CUQA 3C3YA 1M6EX 5DXJA 1P1CA 4DA4A 1DUSA 1P1BA 1TPYA 4IV8A 1JQEA 1WXWA 1X1BA 3SGLA 3OE5A 2PX5A 1I1NA 5E8JA 1ZKDA 4DKJA 1ZGJA 3TQSA 1DCTA 5C9ZA 1Z3CA 4V0QA 3OZTA 4RTLA 3EPPA 1WXXA 5DT2A 4GC9A 3A4TA 1L1EA 4R6XA 1VE3A 3UA3A 1UIRA 4PCAA 4X60A 3CCFA 3JWHA 3S68A 1HMYA 3DMFA 2I9KA 2JHPA 1R6AA 5F2KA 3LDUA 2AOVA 3NTVA 3LCUA 3EMBA 3EVBA 4X63A 2OB2A 5EMMA 3TM4A 4HRAA 2HWKA 3Q7EA 2ZSUA 4QVGA 5IH3A 5K05A 1PJZA 2XYVA 3LKDA 4EVIA 5K03A 2G72A 2B25A 4YUYA 4PYNA 5DTQA 4C08A 2PX2A 2OY0A 3MHTA 4M37A 2IFTA 3HA3A 3I53A 4CTKA 3L8DA 2R3SA 4OQEA 1INLA 2AOUA 3OU7A 4MQ4A 3DULA 4MWZA 5HEKA 4EMSA 2XBMA 3KQSA 1QZZA 3PFGA 3A7EA 2B9EA 3HP7A 3KR2A 3SSOA 3C6KA 2PLWA 2PV0A 2I7CA 3NDIA 3PX3A 1SUIA 2V7EA 3IYLW 4KW7A 1V39A 3R0QA 2VZ9A 1SQGA 5KVAA 3ERCA 2C7RA 1KP9A 2PSSA 2FRXA 3GNLA 1NV8A 2AVNA 3HM2A 4CKEA 1RI3A 3P2IA 3UJCA 2NXNA 2QY6A 5D1NA 3MCTA 2UYCA 4Z2YA 2EFJA 4WVLA 1RI2A 1JQ3A 1ZGAA 2YXEA 3AXTA 3C3PA 3FZGA 3NDJA 4PCLA 5DSTA 4RTMA 4C07A 5FTWA 2BH2A 2ONYA 4QDKA 3MCZA 2YQZA 5HOQA 3PT9A 4QPNA 4FT4A 3M4XA 3NWBA 3P8ZA 2OXTA 3DMGA 1EJ6A 5CVEA 3TKAA 3CJQA 5K01A 5K0EA 9MHTA 4U7TB 4ER5A 4PYIA 2B78A 3AWIA 4KIGA 5ICGA 3CGGA 1VP3A 2PXCA 1O9GA 2NNWB 3MGGA 3BGDA 2Y1WA 1U2ZA 3U81A 1ZHFA 3O31A 4E2YA 2VS1A 2PKWA 3K6RA 3BUSA 2YX1A 5FQNA 5GM1A 3FPJA 1NW8A 4RX1A 3M6XA 3EVZA 4FSDA 1R00A 4GOND 4KRGA 4E2WA 3G89A 3GJYA 3WSTA 5EGSA 4BLUA 3MAGA 2AN3A 1YZ3A 5BP7A 4L7VA 3CBGA 1Q0TA 2PBFA 2EJUA 1KPIA 3LECA 4HG2A 4RVFA 4YUXA 3IV6A 3MERA 4RSRA 1UFKA 3G5TA 2ZZNA 1KPGA 2PT9A 3DOUA 2B3TA 5EHIA 5FCDA 3UJDA 3GU3A 4YMHA 5DM2A 4GBED 1R18A 1BKYA 4KDRA 4RVHA 1G38A 3EVFA 2YXLA 1XCLA 2PXAA 3CKKA 3B7PA 5DWQA 3SMQA 2FPOA 1QAOA 3FPEA 3OFJA 3E23A 1YB2A 3GRVA 4AZVA 3E8SA 3EVCA 3P2EA 2YR0A 4E2ZA 1WG8A 1NE2A 3B89A 2ADMA 4FR0A 4DMGA 4QVKA 3QV2A 4OBXA 2G71A 3KPUA 3V8VA 3PTAA 2O05A 2P8JA 3JWGA 2AOUB 5DLYA 2CKDA 5DRYA 5LQKA 3F4KA 3M6UA 5EEGA 3OE4A 3CVOA 4G56A 1D2GA 3KHKA 1NT2A 5GWXA 3LCVB 5IKMA 1EIZA 5DRTA 2ORED 2ZULA 2PT6A 2ZFUA 3TRKA 1XJ5A 4M36A 4RV9A 4AZTA 4F84A 3BZBA 1QAMA 3FTCA 3LBYA 5EVJA 4GEKA 5GOZA 2P40A 3A25A 2OYRA 4BP1A 4M38A 5ICFA 5CCBA 2FK8A 5DPMA 4AUKA 1IXKA 5CVVA 1B42A 2HR1A 4QQKA 5DM1A 2F8LA 1TW2A 2AOTA 3MTIA 3P9CA 3DXXA 4E33A 2QE6A 3EEYA 3NWEA 5EMJA 5E9JA 1MHTA 3P71T 1D2HA 4C03A 5EMLA 3LL7A 5BW5A 3CJRA 1SQFA 5EPEA 3SR4A 4YUWA 3Q87B 4HGYA 3BT7A 1FP1D 4X1OA 3M33A 3R3HA 4P7FA 5FHRA 1AV6A 3HCCA 2BR4A 3EVAA 2PXXA 1KXZA 4V0RA 3AJDA 2PJDA 5HIMA 4E32A 4UOEA 1Q0SA 1JSXA 3PVCA 3FYCA 3P9NA 2AVDA 2YVLA 3LDGA 1JTFA 2VP3A 2C7OA 3GCZA 4CXMA 4OA8A 1F3LA 3I58A 5K0GA 1BHJA 5DM4A 3VC2A 3VYWA 2BR3A 3LSTA 2QYOA 2CWWA 5EEHA 2DPMA 5EMKA 3OCJA 3G2PA 2E5WA 5T67A 1SUSA 5CCXA 1L3BA 1NKVA 3REOA 5KS2A 2FYTA 3DXYA 5ICEA 5M5BA 2Z6QA 4EK9A 2CL5A 4RTQA 4DM3A 3G7UA 3O7WA 4YUVA 3BGIA 3DMHA 3G88A 2P3LA 5FQOA 2ZIEA 5LQUA 3I64A
chains in the Genus database with same CATH superfamily
4WLUA 3G49A 3HMQA 1EUCB 5KVCA 1K5PA 3S2SA 4NEHB 1YBFA 1QYDA 1JAYA 3GRZA 3ZVMA 3ECAA 2HOQA 5EZQA 4LY0A 3R8XA 1DIOB 4KZKA 2HJWA 4AICA 2YJ6A 4ZWNA 1SWWA 1Z6AA 1ZZEA 2WSYB 3ER8A 2VDWA 2X0RA 1CD5A 2OGTA 4TSKA 1M83A 1G66A 4TT3A 2X7JA 4ZHSA 2G70A 2Q2QA 2RGCA 3QA3E 4QBIA 1RPNA 4DV1B 5KWEA 1E0AA 5LL6P 4HNQA 5EHXA 1MIOB 1L5RA 2PFGA 2ID7A 4ND2A 4Y0AA 2IP2A 3ZNNA 2C0CA 4KIFA 4DC0A 3OIYA 2E21A 1RJGA 2Y3IA 4IVRA 4MA4A 4O0MA 1EXMA 2OZLA 1YTLA 3E3OA 4S1PA 3ONFA 3PQ4A 1ZIXA 3WWPA 5I6DA 1TLTA 4QBTA 4Q3LA 1YMQA 2QORA 4PLGA 1G5TA 3H75A 3EH1A 3JARA 4E5YA 1OBCA 3OM9A 1H1TA 3B6JA 1ZR2A 4CM5A 2B4KA 1VKZA 3EFBA 4RZXA 1JG2A 2VT3A 4EY8A 4RJTA 5IWAB 3LLUA 1PZMA 2DBVO 1IXZA 3F6YA 4OQYA 2O7RA 4BLSA 6GPBA 2NV0A 3M70A 4Q34A 1KJ9A 2P3OA 1GRNA 1ISPA 1ID1A 2NQ2C 4NPCA 5FPSA 1B2RA 4TQUS 3VTFA 3VH4A 3L4EA 2NZXA 4AY5A 3W5HA 4I50F 1Q84A 5HRCA 1P62B 4GOMD 4FILA 4MULA 2ZJBA 4I66A 1V48A 4G24A 2CYAA 1JA0A 2C3MA 3W9YA 1U3UA 2GK6A 2B94A 4Z6KA 3GLGB 4LXGA 1SBTA 3VO2A 4RM3A 2HW8A 4RHTA 4BZQA 3PZRA 3C1AA 3H17A 3WWZA 421PA 1U5BB 2WZBA 4KG7A 4OXYA 1DTWB 1J07A 3KOMA 3QEMB 1YE8A 1TI7A 3UV6A 4DL9A 3NJRA 3ZU2A 3P7MA 4P7JA 4ARSA 1V26A 2C04A 2HDNB 4V2IA 3DVLA 5C46F 4BDSA 1NVDA 4KQFA 3KOYA 1L8LA 2WUFA 4D9FA 1CCWA 4ID3A 1J0BA 3RNOA 2VQEB 3IUSA 4O4JF 1VC2A 4BPRA 4OY3A 4JYBA 3IDOA 3NG1A 3NM5A 1GUYA 2FXVA 2WPDA 1IHUA 3FBWA 3U7QB 3JATA 3PICA 3A1SA 1GTSA 4F5DA 1JVSA 3ZVKA 3DGEC 4R5MA 2KMLA 3JPWA 3RU9A 3ZHOA 1NU6A 5JE8A 3ND9A 3FCUB 3PD1A 1GCGA 3PXXA 1SRRA 3I5AA 3S1AA 2QSJA 2PL3A 2QAJA 3JQGB 4P86A 1JL3A 3C8ZA 4KSCA 4DBLE 2G7MC 1NATA 2HSEA 3GJ0A 3GP3A 3TMAA 1DKOA 1XD2B 2XYHA 2OAEA 3BRSA 3UGQA 4F4JA 1NVMB 3FA2A 3AVTA 2NYAA 3EZ2A 5JJBA 2V9ZA 2YFHA 1I6LA 4JEHA 4OO3A 3G5AA 1WDTA 2QRHA 1JLSA 3BWVA 3VGPA 2V03A 2IY7A 4S3MA 2ADFA 2GLUA 3BD9A 3MM4A 1V35A 1Q7RA 4JZYA 1JHQA 4GM0A 3SMVA 3UMSA 7MHTA 3OPQA 3VO9A 3G2NA 3H9UA 4TMYA 3EG5A 3KYJB 3RYIA 1QP4A 4XOUA 1V16A 2XUIA 3EDRA 1QWSA 1OFTA 3ND5A 1U8ZA 2W6CX 2PGNA 3QFSA 4BLWA 1MFPA 4D9GA 3R9XA 4XCXA 3E03A 4QRIA 3VV3A 1O57A 1Y9ZA 2ZB8A 4A23A 2P35A 1I0IA 5IM4F 3C16C 1QLHA 2P5SA 3R7WB 3BMNA 2RH8A 3LCCA 4OKNA 2X3UA 4G0WA 4GYJA 5JSZB 2OR3A 4CM6A 2R1TB 2GZ3A 1OIXA 3KR9A 3M82A 2FHSA 1I3LA 1IM2A 1AO3A 1C8LA 1GRVA 1W75A 2JGDB 2RB5A 2AI2A 3GUYA 3QKSB 4MS4A 3R3WA 5G4KA 5BPHA 4CUZA 1G8PA 5AI4A 5JECA 3BK7A 4P5EA 2OC9A 5BPFA 2J3HA 2LWIA 2OFPA 4N6OA 4BVFA 1DCFA 3DTNA 4TMWA 3AIKA 4ZO9A 2YZNA 2BEWA 3MWFA 5EIAA 4G0OA 3AEYA 4N12A 2JD1A 4PV7A 3PGXA 4Q3BA 2NU9B 1CUDA 1LD3A 1B6TA 3FHJA 1ILEA 2QMQA 4U6QA 1B8UA 2DFPA 3WL3A 2HJGA 4DGSA 1CRQA 2I6FA 2IXFA 1D6NA 1T5BA 3EY9A 3SXUA 3FCCA 3A4MA 5MGNA 2FMFA 3DLTA 1MNQA 5K09A 1SC6A 1QYXA 3QGMA 3RASA 4DRYA 1YBHA 4MVJH 2W2KB 3T54A 1SKYE 5JEDA 4MQ5A 4BQEA 5M29A 2VT6A 2Z43A 1LH0A 3LZ6A 4N1AA 4D8XA 3OOJA 4UZSA 4DPMA 4JI0B 3BCRA 1X80B 3A6EA 2V6IA 3U09A 4QHYA 2PQ6A 1KIAA 3EGWA 1XEWX 5JD4A 1CY4A 2FHPA 2WB2A 1TJYA 4FYMA 2VP2A 3WLJA 1IY9A 4BO5A 4BMCA 5KYXA 1FYXA 1XELA 4JVNA 3G2QA 5IS2A 3N5KA 3O1JC 3I92A 3T4UA 5J4YA 4Q4AA 3TZHA 3EPLA 1B23P 2O23A 4QU5A 4WACA 1W6UA 1BRMA 1JG4A 2PYDA 2FLKA 3D8TA 3LY8A 5JYCA 2G76A 4C04A 1JNXX 1RYNA 1URPA 1QZXA 1QF9A 2A2ZA 1NXQA 2VNSA 4RFSB 2JCGA 4UEWA 4EI9A 5KMGB 3NAMA 3H8JA 2CXHA 1JDTA 3HS3A 5ULLA 3TJRA 3AUAA 1IK4A 1CULC 2JHAA 2GJSA 1PW7A 2V97A 4AVYA 1S4QA 1TCUA 1FUUA 2OKGA 4EG4A 3QE3A 7REQB 2FSVC 1OLUB 2OOKA 3B5EA 3MG9A 1DAOA 2FPXA 2VDQB 3O84A 4QXPA 4XX0B 3D1JA 4URHA 1FRNA 1SMKA 1VLZA 2VPIA 2I66A 3GXOA 1CG6A 3CZCA 4W9NA 5TMPA 1O6CA 2EKBA 1B15A 3WLIA 1M2EA 3ELUA 3H5RA 2AHRA 3P97A 3R5FA 2HTEA 4B6FA 2OLKA 5I7EA 2Y1EA 3ROMA 4V0NA 3OURA 1L9KA 2YWJA 4IWXA 4I4TB 4U2GA 3TXXA 1KJJA 2Z83A 2X8WA 1TRHA 5D6OA 2OV6A 3KU1A 5EKDA 5F33A 5BSMA 2Z1DA 3TVDA 4B85A 1T9HA 1C8BA 1EG2A 1G2QA 4RZUA 1XRPA 3ZV6A 3ESXA 3UAOA 4OB6A 4KWHA 5EQJB 5BVGA 3VHXB 4WY2A 4GOOD 1FDRA 1UT6A 3GA0A 2V45A 2F4NA 1FFDA 1RJ9B 2C4NA 4S12A 3TW8B 3U6KA 3N2GB 1BVRA 1O96B 3D8SA 2QDXA 2EWMA 3CN9A 2HLPA 4NV1A 3FCOA 1JSZA 3JD4A 1NW3A 2QG9A 3ZVLA 4OQDA 4LX8A 4X8MA 5BN4B 4K3VA 4G81A 3MCVA 1SXQA 4S05A 5E1DA 5L6LB 1JX6A 2PY6A 3T3PB 3THYA 1YFLA 2IUSA 5D5HA 3D54D 4M8NE 3GRPA 2IXDA 1EK1A 4RZHA 3DV0A 5BOSA 1D2CA 4LMRA 5JV5A 5LMUB 4MVCA 5K0JA 3K30A 1H0SA 3KKPA 1E3SA 2QR2A 4XWYA 4ACAA 3PDIA 3GCDA 3IUYA 3VSDA 1LJ8A 3ASZA 3ZXUB 4AF7A 2PIAA 3VC1A 5IM4A 2Q2VA 2H5IA 1ZONA 4JBGA 4LQDA 3OFSA 2JAUA 4B4WA 1G3IA 1VJCA 1MX9A 2PDAA 1IHXA 3LDHA 3F5QA 3FYTA 3VTKA 2Q0QA 1Y5LA 3SC6A 3E22A 1RTTA 1VZ3A 1XL1A 5CK5A 4DQUA 2G0NA 2CJPA 5BRAA 2G40A 3ZU5A 5K8IA 3V4OA 1DT5A 4R6XA 1J24A 2BUBA 1IN7A 1D8TA 2ZUSA 3RTEA 3R4CA 1Q1GA 1G21B 2I6SA 2X4GA 4PCAA 1OJLA 4HQKA 4LC1A 3OQMA 5HUHA 3BIFA 4HDNB 3D0OA 1F60A 3LDUA 2FPGB 5DOVA 5CDHA 1UKAA 4EQ6B 1PK7A 2DHDA 4IOJA 1TMGE 3QOYA 3WIEA 2IX3A 1THGA 2QNIA 1R5NA 3A3YA 3GLTA 1T2NA 2PGJA 2X14A 4GS5A 4V3BA 3AY3A 2G72A 3F49S 3TLGA 3TW4A 5JJIA 2H16A 3IAHA 3PUYA 3IOBA 2EW1A 5CX1B 2IYPA 3L8DA 1JHVA 3QYPA 2V7WA 3T12A 4EABA 5TE9A 3DULA 5FWYB 3HUEA 1ZAYA 2GK3A 2B1QA 4GR9A 1OFIA 2Z04A 2JHGA 5LZ4A 3VXKA 1GTL1 3KR2A 4DRXB 2RGXA 2WFZA 2PMWB 3C6KA 3G82C 4ZV4A 1L7RA 3ZHYA 1OTXA 3HRKA 5GZ1A 4DWVA 4CM4B 3RRMA 4YPVA 1COWD 1DIGA 4C5CA 4ZYXA 1WQ3A 2PRYA 3HJRA 1B76A 3PXAA 4RKWA 4QG7A 4G2TA 4BCDA 5KVAA 5H3HA 3WO1A 4ZI3A 1W5BA 4NEQA 1JEJA 1TECE 5JYEA 3A1CA 4KXVA 3GJTA 4XGIA 3L6CA 3N8DA 3IQHX 2H1SA 1I7SB 1OVGA 3C3PA 4NPAA 4YJKA 4RTMA 1Z2EA 5GZ3A 1QVAA 2V6FA 4LYEA 4QQRA 5HRUA 1CNMA 3C5CA 4PEVA 1MJNA 2JFPA 3KCQA 4CMIB 5J2UA 1UBMS 2K2WA 4HOYA 1JE0A 1NGSA 2ODNA 2QL6A 2QX6A 3A0RB 4RGYA 5BQPA 4EAAA 5A03A 1V9CA 4CLOB 4CLEA 4DTIA 5K01A 3N1UA 3K96A 4G5FA 4LI3X 3OE1A 2EF1A 1YB1A 2VWGA 1JFTA 3RRNA 1EWTA 5JYBA 1Y9EA 4B4VA 1T9BA 2AK3A 3HY3A 4FNAA 4A2PA 1Y48E 2VH1A 1O95C 3IHLA 1YNOA 1IRXA 5KJCA 2RI0A 1Q14A 4H77A 2ZDQA 2WIGA 3NFRA 4KRGA 4AT1A 4O4IB 3ER6A 3OPVA 4UD2A 3V8NA 1RVV1 3SBXA 4EHLA 4YRZA 1WCXA 3KKOA 4KYIB 4QLAA 2DBYA 2ZEJA 1VL1A 3FI9A 3I39X 1KMQA 3SNKA 3G2JA 4URXR 1SQ6A 1TUBB 1N2IA 1IUPA 1QHEA 5B5SA 3ZEIA 4O59O 2D0OB 1HC7A 4FKZA 1YR1A 2Q3BA 4O2BF 5L45A 1ORTA 4KDRA 3U61B 1JLLA 4FFDA 2OM6A 5BSGA 1HDZA 3V42A 2DKOA 3B7GA 4FYHA 1T4GA 3ADPA 2E4ZA 1GQSA 1YB2A 3ETEA 4IH1A 4AZVA 1RZUA 3SJBA 2BGMA 4XGNA 4B3JA 1CY1A 4FR0A 4QVKA 2BRUC 3I2HA 3R5XA 1KZ4A 1IPHA 2NYRA 3W9SA 1O95D 2QAIA 1R6UA 3JZMA 1YE3A 3R6GA 4FINA 3BL8A 3DCNA 5EEGA 5HZKA 2C7VA 3DL0A 4HAXA 1QORA 1NT2A 5JCPA 2WIJA 3LCVB 1NM5A 2OCGA 2V3WA 3K7EA 3OZFA 1XTTA 4K28A 2C4KA 1DBRA 3H6KA 4M36A 2Y1LA 3PCTA 4WDQA 3ZQUA 1GTVA 1J9GA 4COKA 3IPYA 5FPYA 1QJCA 3R76A 2ZIXB 2Y1DA 1BE1A 2P6PA 5EJIA 4MUXA 4GZ5A 4INZA 1AOXA 2JGEA 4D41A 2F62A 3CRVA 4FHEA 4PGFA 3RYHB 2ZXEA 1HYGA 2AV6A 1NR5A 3A37A 2GETA 3I12A 1SXJC 3A9TA 5C18A 5E7JA 2PH3A 1ZH8A 2BMDA 3O4HA 3HJBA 3N74A 4QFCA 4WNAB 4YROA 4D80A 1KI1A 1GFSA 3COWA 4X97A 1L4HA 2COUA 2GPBA 3PA6A 1AQUA 2JK1A 3RIYA 4HUTA 4W5RA 2J0QA 1ETUA 3TSWA 1J0AA 4WEOA 5DHUA 1G7RA 3GFTA 3BT7A 3CM0A 4UHFA 4ZVLA 1X2BA 4BO8A 4P7FA 1QLWA 4A8JC 1G9XA 4KDFA 1VLQA 3DQZA 3AKYA 3TQOA 4BZPA 3MPUA 4X6XA 1FX1A 1TYZA 2HA5A 2CFOA 1Z13A 3B36A 1CZNA 2PNFA 4Z4FA 1EM6A 3EOAI 2NU6A 3KYIB 2COKA 2EKPA 3EXEA 3LQQA 4RCYA 1H42A 1Z6PA 1EZZA 2WSSD 2O0HA 3HI6A 5E3HA 3RHTA 4ARUA 2VPXA 4R4JA 3GPBA 5TMBA 1F3LA 3TL6A 1Z5NA 1D6MA 2VYFA 1W5AA 4MKIA 4EM6A 4BYGA 3GJ4A 4IDGA 4OYLA 3SWWA 1S8AA 1ZK1A 2OORC 1XZHA 2DPMA 2WTAA 4U7JA 5CEEA 4I55A 2UUAB 2Q6IA 1EJ2A 5CCXA 3BS4A 3A0UA 3CKYA 1SXJD 1YVPA 3B85A 2QE7D 3HE3A 3KXDA 4Q02A 2HBRA 1U0FA 4G97A 4JJ7A 1I36A 4EHIA 1ZX1A 1ZU5A 2Z4TA 1DXOA 5A04A 5BV1A 2H4HA 3DMHA 1KEPA 2C2GA 1E2JA 1SEPA 2JASA 5GGXA 4KFSA 4NENA 3WYDA 5FQOA 2B1JA 2LPMA 3KQPA 4G5YA 1KFBB 5E4YA 3UC5A 4F8JA 3PEWA 4IIVA 5I47A 3PFNA 2NVWA 5I7FA 2QZ9A 3N05A 3X2FA 2FCAA 3L9WA 4M54A 1UPXA 2GAOA 2KB0A 4IWNA 4X8LA 1DCMA 3LC2O 2OM2A 3QF7A 4L3OA 2J9RA 3H2YA 4MPDA 1ESZA 1C0PA 3MLBA 4OHOA 3R20A 5F5LA 5I9LA 1HT2E 3LVRE 5L3QB 2IE8A 1YZLA 3QMPA 1MG0A 1RYMA 2I4NA 2VDPB 1GG9A 1O6FA 1VSTA 4ABYA 2JCXA 4ZT7A 4KI0A 5B4TA 4LVNA 5I8WA 4YDHB 1RWKA 1HQCA 2JAQA 3HCDA 2DECA 1CYEA 3PTLA 1JILA 3TLJA 3K09C 1AKRA 2OCLA 1DTEA 3C3EA 4IJ5A 5LDGA 1ZRNA 1HE3A 3JWIA 1O2DA 3JYNA 4MX8A 1B14A 4E4TA 2QGZA 1JSCA 3W78A 1KKUA 2ADOA 2AZTA 3TLKA 3WB9A 4AJIA 4D9KA 4EO4A 2AOTB 2OGZA 3D5TA 4IIHA 4IS2A 4OBEA 3WC4A 3FWHA 1UXOA 5IZCA 1XHFA 4ZDIA 3I04A 3RRZA 3S2FA 3SOZA 2OYSA 1QB7A 2VJMA 1WUKS 4JEUA 3MJCA 2CD9A 1X7YA 2PKQP 3F71A 4GI5A 1ADFA 3UKDA 4FMDB 2YXDA 4BGDA 3EAFA 3ZW7A 2NTJA 3RABA 1XKXA 2YJGA 5ALGA 5ALXA 1N3IA 2CNKA 3W7VA 5BWCA 3SVLA 2AQ8A 3EVGA 3U4GA 1JQBA 1MR3F 2C7QA 1W34A 3ZJ4A 4A8JB 3BB3A 2LDXA 4OFZA 3RLFA 5E1BA 3E9CA 5EC8A 3AF5A 2WK1A 4D8UA 1VZ2A 5IHPA 4Z9BA 2LIPA 1C2TA 3T3DA 2R7MA 2VO1A 1C0KA 2FPMA 3QU5A 2W98A 4P3NA 4EW1A 1BVUA 1U8UA 4JL5A 1VTKA 3BXGA 5B1HA 2VBFA 4UHEA 4WESA 3QEKA 4ZIRA 1D0SA 4PYQA 2O0JA 2H17A 3G2LA 2XDQA 5E2AA 3LKBA 2QQFA 4WKPA 4AZWA 5BV2P 3PHGA 1PGOA 5HJ5A 1KVTA 3FVVA 3OWHA 1UPAA 1EFTA 5DGIA 1HX7A 4B7CA 1TVKB 5HR5A 2EKQA 1EM8B 4LWPA 1TM5E 4NOLA 4OTZA 4UAGA 4Y1RA 1KK2A 4F12A 3ADBA 3MUNA 2H11A 2VF7A 5AO9A 4M0MA 1GA4A 3NIBA 4DG5A 1STOA 1WB9A 2A9RA 3I2KA 3G13A 4XQ9A 5F51A 4D4KA 3TFQA 1I4LD 1U2PA 4IXMA 4P4SA 4KO4S 4D5EA 5JIBA 3PEEA 1DG3A 3HVIA 3LUBA 4HI0E 3FDFA 2CLFB 5DM0A 4UU1A 3ETNA 2D7JA 4IZHA 2AN9A 4HUQA 1H9BA 3PD0A 5BNFA 3GFGA 4PZZA 2RGUA 2VAPA 4E03A 1HLFA 1NW4A 1UDBA 2R47A 2IGBA 5ALVA 1FXSA 3V8RA 2IUYA 1KOGA 3UW1A 4ENTA 3T1VA 3U4AA 3UFBA 9ATCA 1XU9A 1P0QA 1X15A 1NMYA 2VRWA 1Y1LA 4GICA 1ESDA 3VGJA 1JG1A 3R24A 3TTVA 1Z7EA 2CL0X 3ZE8A 2O8CB 3S2IA 1JJFA 1ZUHA 1EAMA 4X8HA 2NU8B 2OXCA 1KK0A 2DM6A 3V1UA 1N6KA 4JEMA 3PI7A 1V37A 1K6MA 4HTAA 1P45A 2WILA 1XDZA 3GRUA 3R23A 1BJRE 2HQSA 3HBJA 1QS0B 5CBPB 1GPJA 4G9GA 3AR7A 4TKVA 4NL4H 4UFOA 3USES 1NWCA 1IATA 3K2QA 1OXTA 1YQXA 3CURA 1UBOS 3ACDA 1K68A 2DPGA 1IPFA 1X19A 3KLOA 1FLVA 1ISHA 2AOWA 3OA2A 4G5RA 2IUEA 2J9ZB 3JQEA 1PE0A 1PKEA 3ZHZA 4MDEA 1V9LA 4Q1FA 4RY2A 2ZYIA 1I2CA 2G08A 1E5TA 1BXRB 4R2MA 4NS1A 1ULUA 3DZIA 1VE5A 1E9SA 3ESDA 2EC5A 4FHFA 2YXNA 4JVOA 3EOBI 2QW8A 2QLTA 1TJ3A 1CF9A 1QH1A 2P68A 4TTVA 4CKBA 2CNWA 2WWXA 2RI1A 2GD1O 3D0QA 3H2KA 4DQLA 5JS6A 5JY1A 1ZG3A 2GAAA 3BWMA 5FOSA 3TRHA 2O6LA 5KSWB 3IVRA 5LIRA 1RJDA 1YR7A 3GLHE 3MT9A 3HJCA 4L2IB 5KHOC 4MAAA 4DIEA 3BM5A 4OHYA 4M98A 3E81A 2KJQA 3PA8A 3WNQA 2R5FA 3ZTYA 2EERA 2X3YA 3N8GA 2GNOA 1OU4A 5JSYA 3GT7A 3K6JA 2H92A 4N3BA 2XXAA 4P54A 1RWVA 1NLMA 4NBLA 2PGAA 3TZEA 4KWEA 4FW9A 1ORHA 2ODAA 4BMOB 1N6HA 3LAWA 2IX9A 1XK7A 3R5JA 2JIPA 3NIDB 2FF7A 2J3DA 3Q98A 5C4IA 2X5JO 3HCEA 3PXCX 4CJXA 3K9FC 1QGED 2I2AA 1H5QA 3GFRA 2DRIA 5ILOA 4MRMB 1JJAA 3I9FA 4YRDA 2FMTA 1KTVA 2V7XA 4XWWA 1HOXA 2LUOA 4WRRA 5FNVB 3RFCA 5B3KA 1IG3A 4ROTA 3B8HA 4KQWA 4R81A 4TTSA 5I9SA 1T6NA 5HZMA 2XZPA 4FZ3A 4BN4A 4LS3A 3I4LA 3C15C 1RE1A 4P3XA 1DOZA 1I5RA 3ORHA 5IC5A 5B6IA 4X6YA 1OIWA 3FBGA 4BGIA 3A4LA 3KT3A 1Q50A 1N4AA 1J4AA 2I2DA 1FRZA 4IICA 1IFXA 5C1IA 5BQ5A 3U0BA 1O0SA 3V7YA 4PGAA 2PANA 3WGYA 3LX6A 3O9MA 2F43B 4C9BA 5ENDA 8ATCA 5JAHA 5FI1B 4A03A 4NCNA 5EFZA 3FMGA 4X90A 2VJYA 3F2IA 1GO2A 3IAM6 5LVAA 3H2IA 1AUOA 5EYPA 2PSJA 4RPLA 2EJVA 3A36A 1Z5ZA 4LV8B 4RVGA 4CHGA 1ENYA 1ZI8A 3FGNA 2EV9A 3CNQS 2GOYA 3EEOA 4UQLA 1PT9A 3OLWA 3T3HA 2RHCA 3M3HA 1A7UA 2HHCA 4WUVA 4LDZA 3U6BA 4EKGA 1U0LA 4Q3EA 3NFYA 2JK0A 4HXEB 3N70A 2MCFA 1KDVA 2GAFA 4CMHA 5IYZB 4PGGA 4H2DA 4J43A 4ZOQI 1O54A 3FI0A 1AQ6A 2WMOB 2ACVA 3QYJA 3B1ZA 3UYLA 1YVDA 3N53A 4A6EA 4E5MA 5P8WA 4OM8A 4P33A 5FV7A 3BJEA 4IDHA 3DTVD 4LKOA 4MUYA 3TOXA 4DMHA 4DSAA 3LIPA 3LPMA 4D4GA 3TW0A 3TUZC 5DLEA 3ZXXA 4BWFB 2ZUWA 3LHSA 3UG6A 4ZYYA 3KLMX 2ZTHA 4GLOA 2VXYA 4HD8A 3SXJA 1J2EA 3FWZA 3ADCA 2AK2A 3QFRA 3JVDA 1HFEL 1XVLA 1N75A 2RK3A 3GH3A 1I5OA 1ECGA 2DT8A 2GR9A 3A28A 3QXGA 1PX2A 4IJ6A 4L8LA 3KKMA 1YS2X 3U3XA 2PSHA 5LOVB 1NXXA 3RRJA 2HA0A 2Q6KA 4FCCA 3LT4A 3H3JA 3RS8A 3QKIA 2QT1A 3FVRA 3W04A 2AC4A 2JEZA 3DFFA 4HR7A 4WY8A 4XVQA 1KC3A 5AK6A 4I14A 2IDKA 4BIMA 2AEJA 1L5ZA 5G1OA 4PONA 4DTCA 3BA6A 2NXWA 3UJ3X 4FSXA 1TYCA 2W93A 3DR3A 3KVOA 2ZUDA 4DYDA 3AF0A 3CPSA 4OF4A 3GGPA 4QJBA 1KGSA 3DOJA 1XXHE 4QAQA 3QFHA 4NAHA 4R69A 5FUWA 5I9BA 1ZOLA 1AN9A 2PL1A 4ARVA 1DAIA 3O8OB 4TYMA 3U40A 1GU1A 4PLHA 3W9BA 4GMXA 5BSTA 4NY1A 1WLYA 1N2CB 3MUOA 5AXBA 3C7KA 3W4KA 3CF4G 2C2YA 4YQFA 3KAQA 1D0IA 1GPKA 2R5NA 2RC6A 1I7LA 4INOA 5CB6A 3BCUA 3GDGA 2XGMA 4X60A 2YYZA 3NBUA 2JRLA 5IBCA 3MTQA 4B47A 2AZXA 2H1OA 4PRYA 4M1MA 5J5CA 3SDSA 2QZPA 3EA4A 1BN6A 1SBHA 4ZEVA 4D3FA 2C1ZA 1WP9A 3L1JA 2WJIA 1AUVA 2QQGA 5A5VA 3ESZA 5KTSA 1ZR4A 1T9DA 4RHXA 4TTTS 2XB8A 1JKJB 2J6BA 4PC3A 4V2UA 3A1VA 5MFPA 4MAMA 2WKQA 1IL0A 3JD3A 3A3KA 4MKRA 1G0NA 1UM8A 4QUAA 1MNAA 5LC1A 5IVKA 1CUJA 2OOSA 3VYRB 4BKPA 3KUXA 1O58A 4KSBA 1CUGA 3F78A 1LLCA 3MTDA 4WZBE 3WFIA 4MUIA 3F47A 2SHKA 1U80A 1DZ3A 3KQSA 4LRUA 5L9AA 1ZQ1A 2ZJ7A 3IBTA 2WKRA 1U6KA 3L7MA 4H7IA 1ADJA 1ZLYA 4A5OA 2FZ4A 3TOZA 1LS6A 3RIGA 2D1YA 4L4RA 5DCUA 2V7EA 1N5OX 1CS0B 3DE2X 5FPPA 3DE6X 4OP1A 1I3KA 2V7GA 3QPDA 1EWVA 2ODEA 3A9WA 3WMFA 1OBVA 2E82A 2PGDA 1P4JA 2XMCA 3CUSA 1JHYA 2CB0A 3GNLA 3JQBC 3KEQA 4TLDA 3AEUA 3UJCA 1ZMTA 5AK5A 1ZN9A 2QY6A 4CG0A 1YI1A 1EFVA 5HKLA 3AZPA 1WW3A 1I80A 4IIBA 2D1FA 2ODQA 3U7EB 2FEWB 4DSZA 2AW3A 1II8B 1MJHA 2GYUA 4LTMA 5DGXA 4MYHA 5INTA 4QGFA 1FNDA 5T8KC 3BXXA 4QPNA 1WSAA 1V8BA 4ALJA 3LTNC 3H05A 1CR0A 5TVGA 3COPA 3UWSA 2YJ5A 2JGMA 2IEDA 3E8MA 2AMYA 2J7PD 1WDKA 1LJUA 3DMGA 3TKAA 2Y4NA 1IY1A 1XRJA 2IL1A 2WT9A 4C78A 4DRZA 5JH7A 1W0KD 2HXSA 3PWTA 1NXTA 2V7TA 2O8DA 4BNUA 3GQBA 2PZMA 3UQZA 4YAEA 4O4HF 4EG6A 2JJ2A 5DGDA 3K6RA 4OOFA 2YIJA 3FPJA 4OHVA 3S8MA 5J58A 1HGXA 1H9AA 5E7MA 3EVZA 5C8YB 4ESHA 2BFDA 3HJFA 4KREA 3GJYA 3E3LA 3I52A 3LQ4A 5GV8A 2ZQZA 1A9XB 1VJDA 3ZWYA 4FOTA 2QQ0A 3GH1A 3PXEA 2XZOA 2EJUA 3CWCA 1XOIA 3EZNA 1WMBA 3OWOA 2QRZA 1EB8A 3EVTA 5DLQC 1Q21A 2AHOA 1BE0A 1P72A 1UFKA 3ANTA 3QG5A 2PT9A 4TWJA 1D4OA 4IIYA 5HJ7A 1QX3A 1WQ4A 2X40A 1VL8A 2IS2A 2JHFA 2YYAA 1OCEA 2V6JA 1H3EA 1EVJA 4GYWA 1SCQA 3WADA 3PUVA 5A3SA 4XQCA 3F2VA 3CU5A 3IA7A 2QROA 3NKLA 3DVQX 4R2HA 5EERA 4HVAA 5DSZA 3N2KA 3RSFA 1WG8A 1C1YA 4QXOA 4BP9A 3GD5A 1QCYA 4HMOA 1E7QA 2JKZA 1DPFA 2OTCA 1NW9B 1UBEA 3E9NA 2FSGA 2O05A 3R1IA 4C6SA 4F93B 1DKUA 2FG5A 4QAJA 3SYLA 4DJEC 3WKBA 1XYYA 2JBWA 2PV7A 1IHDA 3IUEA 4QFMA 3L7YA 3KM0A 1T15A 2M9MA 3Q4GA 3C45A 5EINA 1XFAA 3S55A 2BBOA 4FZ5A 2PT6A 4BGUA 4AZTA 4DR3B 1MKYA 3BZBA 1VHWA 3CIOA 3C8UA 2I8LA 3R7NA 3M1IA 2SKEA 2QDKA 2HEGA 3EBPA 5LDDC 2DQSA 5ICFA 2VQ6A 3M81A 2YHBA 3UICA 2CCGA 4CM1A 3VU9A 5C7LO 1ZCZA 1GPBA 1J39A 1PT6A 2GF9A 3ES9A 4UMFA 5DDIP 3KQKA 1P5RA 1U3CA 1Z39A 1FSZA 4DSUA 1KEEB 1XYVA 1YQQA 4YXFA 1UL1X 2IP1A 3GDWA 2GHRA 4JVLA 3HL0A 1B2LA 2E0IA 3INYA 3SI7A 2HJHA 3GJRA 2AF4C 4H7EA 2ECFA 3EF0A 4IMRA 3A2MA 4YUWA 4NTZA 3L93A 1FP1D 3ZGNA 5B1DA 3R3HA 3UMMA 4MLDA 2R7KA 4UE6A 1QGZA 1Z29A 3GFOA 4PVCA 1RWWA 1J97A 1VECA 4I46A 4G0MA 4L4XA 1U6JA 4CM3A 4BAZA 4F1KA 4YPFA 4F5YA 1QONA 1W29A 1L5OA 2R97A 3VRHA 3JTMA 4M0DA 5B2EA 3H6HA 1YULA 4D6XA 5JHHB 4P3YA 1RIIA 3PLNA 5CH8A 4WIAA 5LUBA 3A9RA 4TLAA 3T94A 4IXTA 3QNMA 4Y2YA 1DNPA 2ATVA 2EQBA 4KGDA 4EW2A 1U0TA 3DDWA 3HYSA 2B7CA 1VB5A 2Q0HA 2BZ1A 3GMSA 4ND6A 5E7IA 4E4RA 5LNK6 3N0WA 4DLSA 4A2QA 5KS2A 1L6IA 2AEEA 1BJKA 3AFMA 3QJGA 4BNHA 2CL5A 1NQ5A 1JKXA 2WICA 1NP7A 4D79A 4IHJB 5AUPB 1J9EA 2D2FA 1JU9A 3DT6A 4WOCA 5F4BA 2ZSBA 5KJEA 1MX5A 2PMDA 4N03A 3QLUA 2EL7A 4OUDA 3L46A 5EE5B 5CT4A 1HNXB 2E89A 5FI3A 2Q45A 4XFJA 5SY6A 1M7HA 3QKWA 1VRVA 3DLAA 3W5BA 3ANXA 4LJ7A 4H7HA 2YS6A 3ISJA 3LF2A 2E7ZA 4H3VA 3ZH9B 4N9WA 4ZTUB 5EXSA 2CV1A 2Z3VA 4YN3A 3Q3GE 1GQ2A 4O0LA 3SR3A 2Z8YM 3KR1A 4OGGA 2ZWVA 3ICEA 2OXRA 1KYQA 3NHRA 3IHWA 2A5YB 3Q7SA 4MZDA 4U3JA 3UWPA 3CVJA 3F8SA 3UEOA 1FNCA 5KAMA 2OCDA 5J2TF 4BLQA 1V95A 3IIIA 2CXQA 4XAQA 4QBHA 4F91B 1GZ5A 1R6DA 3LW8A 2D1TA 3QE2A 4DYHA 1A2BA 1JU3A 1ZWKA 3CUVA 3EGCA 3IOEA 5KTRA 3LLVA 2VDVE 5T64A 3OCUA 4DANA 1T8TA 4D9IA 4DIDA 221PA 3ADOA 3WL6A 4DA7A 2C3PA 4OLBA 3PEYA 4KHPB 2ODTX 3HCFA 1JQDA 3KZNA 3PL1A 5K51A 1SFRA 3M2PA 4I08A 4LDPA 1EEHA 3N6VA 4IQ4A 3GROA 3RYFB 4A16A 3M83A 1VKJA 1XZBA 2HNKA 1X7GA 2WF9A 1OF1A 3PDCA 2BCGY 2J0UB 3QHAA 4RD3A 3WBJA 4U2DA 5L3RA 4A9AA 1KO1A 3EXG1 4F38A 3EVEA 4IDNA 1KIMA 1EFHA 2H63A 3KSMA 4IRUB 1XPOA 5DEOA 3S5UA 3OZIA 2X8JA 1LW6E 1OROA 3F8WA 4J03A 3FKSA 1VE6A 2HZBA 3WWCA 1JXQA 3HN6A 1E1LA 4PRKA 4FMPA 5FWAA 2A4MA 5TPZA 3SX2A 3N8NA 4JL8A 2A92A 2VAXA 1OA0A 4HAUA 2CVQA 4MEJA 2D7DA 4DNQA 5HE9A 1I4DD 4LZLA 4ZAVA 5CM9C 2A88A 1XKQA 4EJFA 2XB2A 4JOCA 1W73A 3HV2A 1T3TA 3IT3A 4JITA 4UNPA 1MO3A 1KYWA 4XUDA 4EB3A 3OFND 6REQB 2IYRA 1X7DA 4EATA 2YY5A 3ROPA 4OP3A 3N6RA 4XH9B 3U13A 1T25A 4JKYA 4DREA 3RR2A 5A4FS 3NGXA 2V0CA 5GINE 5A6SB 4ZGBA 3M6IA 2D2XA 1IC6A 3LHKA 3F90A 3TK1A 1NN5A 1V1RA 3A27A 1PR3A 3AFOA 4HDSB 2OLEA 3ORSA 2BKXA 3VYSB 5KJFA 2D4HA 4R8KA 2C9MA 1I2AA 4RA9A 4UTOA 3U3JA 1GQYA 4OGLA 3WGHA 5REQA 4NESA 4JUDX 1TA4A 4GZ6A 4Y9TA 4YQZA 4CU5A 2JS7A 2ZLBA 2J1LA 1XRSB 4KO1S 4BB6A 3LOPA 2HGZA 3RODA 4EPWA 5EXXA 1GN9A 2FEPA 2WWWA 2ZCJA 3ZGZA 3D8UA 2Q4RA 3AOEC 4NNPA 4DMUB 3IJ5A 3QLEA 3KVRA 3ZE6A 3HDTA 2VCEA 4R9UC 1LKZA 1NUQA 4JI8B 4YCJA 3DBRA 2DBZA 1HSZA 2POCA 3K15A 4TZKA 4D81A 1Q74A 1V5WA 2PBLA 4NHOA 4DCJA 5AXAA 4D45A 2RHHA 2OWEA 4O2AB 4PGHA 3IP8A 3CLHA 3WMWA 3L0DA 4LC0A 3CIFA 2Y1KA 5FA5A 3KZOA 1CBUA 4IQ0A 4XPIA 3HXOA 5F9HA 1CEYA 5DHTA 2EYUA 1WSWA 1ODFA 3BB4A 3N86A 3ZZTA 1ULBA 4QATA 3U0VA 2ZIWB 2KW5A 3I2YX 4XD7D 4MGHA 1GY8A 3H9BA 2C5SA 1G6OA 2PR2A 4CTJA 3AX6A 4NXNB 3EXAA 1CNFA 1YS6A 2QD1A 2H4XA 1SPBS 3C3CA 2CFCA 2C9YA 3MZ0A 4V39A 3UN1A 4Q7LA 3I5XA 1TJ4A 1NUSA 4IHQA 3T7TA 4BKQA 1NJFA 2PUHA 3TQFA 3RQIA 3AV3A 1JDPA 4YECA 3HY6A 1GVNB 3THWA 2HF8A 1ZJ4A 1J7JA 1J8QA 1JJBA 2IITA 3RTGA 4FDUA 4DCSA 2D0PB 4WY5A 1N25A 2HUNA 3WA6A 2HZ7A 3OY7A 4NAUA 5TPWA 4FB5A 2A35A 3C85A 4A1OA 2GH1A 5LZ5A 3RT9A 5J2TA 5FUQA 2CHQA 3VU3A 3QTTA 4LWZA 3ZHSA 2R8YA 2ZG6A 3QY9A 3PWZA 2IE0A 1F06A 4DMLA 3RVSA 1OWNA 4FXOA 2ZWPA 4LE0A 5L7YA 2IS6A 2BJHA 2VKTA 1NZJA 1UZMA 1HQYE 3BMQB 3ABIA 5I5GA 4YRTA 4Q18A 3PX2A 5C5IA 3USZA 2HSZA 3BXPA 3FNEA 4UHJA 3TRIA 3T06B 5AW4A 1OXBB 2WD9A 3PG5A 3R7AA 5D7NA 4RAQA 4K26A 4P3PA 1QRDA 4OV6B 4X61A 3C4JA 3TL3A 3F9IA 2VHJA 3I9KA 1PNTA 2A5FA 2NV6A 2W2QA 4G1MB 4ESOA 2W6IA 1N8TA 2RARA 4DLUA 4C0AC 2DX7A 3K32A 4U39A 1WBJB 2HMVA 2MTBA 3OZAA 3H1AA 2BE9A 2HX1A 3WDKA 4E3WA 1ZM4A 4KR9A 2ZZMA 2PT7A 1PR6A 2AZ4A 2QVCA 4C43A 4H6VA 4TLBA 2MYTA 4J2HA 5HQTA 1EQ2A 1JYEA 1ZH6A 1TT5A 1HE8B 4JI5B 5J5AA 2XNJA 3BSYA 1DHTA 3L1HA 2HSGA 2O1XA 3PR2B 4KUGA 1RYHA 3LUAA 4OSPA 4BQFA 3GFQA 4ARAA 2C42A 2W6ZA 3BULA 3P2KA 1R0CA 1XDWA 1H1LA 1RJEA 2OCAA 4MLZA 4WXHA 4BZZA 4EX7A 1MZPA 2OPBA 1P7ZA 3CX8A 3MTGA 4WECA 1TQ2A 1GILA 1YR9A 5DP2A 3ZHBA 3ZCPA 2XMDA 3KQNA 2ZIUB 5YASA 2JGLA 3GUHA 2M98A 1XRNA 1LNQA 2PK3A 3DDNA 2DKNA 1M7BA 3N8KA 3RT1A 5JD5A 3KKNA 4PIVA 1QC5A 1NJSA 5EP2A 1A1VA 3KOXA 4ZRDA 3SSMA 1N77A 3Q8WA 5JEEA 2A9JA 2OO5C 3VR5D 3URKA 4PINA 1IJBA 5DNUA 4RPGA 2DR3A 1T1GA 1QYWA 5JQGB 3EIWA 4Y2UA 2WQ6A 3DOCA 5C1OA 2Y1CA 2XF8A 3OZSA 2J85A 4R8RA 3QX3A 2GYVA 1YZTA 3IKMB 4XUEA 2KHZA 3TRFA 1TA9A 1NDHA 4E6EA 4DMRA 5ICMA 1SUEA 4ZRMA 2RGWA 3KAPA 5A5DA 2XYGA 3T3NA 2AE1A 2OAP1 2IGTA 1S7CA 2FPIB 3PKZA 2ZT8A 4C1BA 2UZ3A 4MR8B 1XVAA 3FOAA 4B3DA 1YK1A 4BO0A 3DFKA 5I01A 2RFLA 4GE0A 4BP8A 5BWMA 2PLAA 2CDNA 2OV4A 4O29A 1THZA 1P1JA 3AFNA 2SECE 4M0UA 4R83A 3U4QB 2XMGA 1EVKA 1K8YB 2RCNA 4RL4A 1UODA 3BAFA 1P74A 5T4HA 3HVHA 2OEPA 4LSGA 1O6BA 2YHSA 4WXMA 2G17A 3TR5A 4KOAA 5IMSA 4URUR 1RQ2A 2W2NA 2OP0A 4ALNA 3LBIA 1LPPA 3D4IA 1OILA 1OT3A 3H5LA 2FUG6 2R6JA 2PH1A 4F9GA 3F1KA 2AX4A 4U5XA 3QPBA 3RSGA 1Z4NA 3IESA 2J67A 5K0LA 1TZMA 4B5KA 1SCIA 3RVLA 2HDHA 3SF8A 2NPFA 2MOKA 3LQRA 4OX9Y 1AH2A 1L4KA 1MB3A 3UENA 2BUAA 2B1GA 2CXRA 1RQXA 3DPSA 3P20A 3Q1KA 4HN4B 4NU5A 2ZCVA 5ALFA 3U7RA 5JNUA 1WUJS 1BCRB 5ALIA 3DVRX 3BAZA 2B98A 3AO0B 4IOMA 2WJGA 4I8DA 5FEMA 5KHAA 3TRDA 1M6HA 1O08A 4TXNA 4HVCA 1FPMA 4XYMA 5C5CA 2WUGA 3W2FA 3DCYA 4DY6A 4WLNA 1EG7A 3SQDA 1GGVA 3TJZA 3BX1A 4JI1B 1KH3A 2RGYA 2AFIE 3AF2A 4IWYA 1P6UA 2IWHA 3WGLA 1HNWB 1EVZA 2H3EA 3NBMA 4IS3A 3BE4A 1FFAA 3TG2A 1B00A 3DDCA 3H1TA 4YJHA 5TQ0A 5AVQA 2AOVA 4L27A 5PGMA 1G8FA 2EEPA 4MV8A 1QU3A 4RK0A 3U3MA 2CLDX 1NJ6A 1RM3A 3LWDA 5TGTA 1SY7A 1G19A 1RMYA 1QGAA 3T5CA 1KAEA 1UOEA 2IIBA 1JXAA 1R0BA 2CFTA 4X9XA 4ZJUA 4YT8A 1PNVA 2XQKA 5LWHA 4IZ6A 2MMGA 3HB4X 4OLFA 4WNIA 2OZKA 4X00A 1PJ2A 1XXHA 4DQKA 3MCAA 4NARA 2QP3A 4TTPA 4ZEWA 1Z6GA 2BTEA 4MWZA 4EMSA 1UEIA 4CEIB 2WZDA 3N2YA 2FEOA 4XX1A 1LQTA 3TAHA 4L7QA 3GLSA 4L5JA 4C4RA 2I2BA 5ALRA 3RGGA 2ZP1A 2EIXA 4UEOA 4HDRB 1QP0A 2FXIA 1NBEA 2XMRA 2HK9A 3R0QA 5AJXA 2PS0A 1NV8A 2ZJFA 3B70A 1P3DA 3PC8A 2W6JD 4RK5A 4Z0HO 3A6ZA 1ZIDA 3FFTA 2EFJA 4QX6A 1XK6A 3F5SA 2FZEA 2YCBA 3MB8A 3I9JA 3PT5A 4PCLA 4PG4A 1Z0DA 1ZI9A 5AVWA 2ONJA 2V1UA 1WRBA 3SYRA 3A4NA 1MDBA 5FLEX 2JIQA 3WGVA 2BEUA 2YWXA 3TD6A 3DP9A 2WVJA 2G80A 4MQEA 1CF2O 1NPTO 4WZBA 2YJTD 4ZEOA 1DQRA 5CLQA 1VHJA 1K8RA 2H85A 1X14A 2IU0A 3NKVA 2RBEA 3R0ZA 2FMHA 1FC0A 1NBMD 2FX2A 4XPZA 3GF4A 4RORA 5AW9A 1GA1A 1U2ZA 1HFKA 3R8CA 1ODSA 1DDGA 1XZMA 2YX1A 3P9ZA 4LJ9A 2SCUA 3DVAB 1V47A 1X8KA 3EQ7A 3Q11A 4GOND 2I80A 4WMLA 3EUAA 3ZW8A 1K6IA 1MA3A 1TMYA 3KXPA 1P75A 4LBYA 4HMQA 5TY0A 4E2WA 4ARZA 1GITA 4L08A 1CUAA 2YBEA 1P9WA 2WP0A 1FA9A 2QR5A 4LTDA 3UVEA 2FW6A 2VCHA 2ZRKA 4HWTA 1Y82A 2FDXA 1HDIA 2BFCB 5JSKA 1N6LA 3EDOA 2WKWA 5JDCC 3CKKA 4ODIA 3CVUA 3RUHA 1Y42X 4N6NA 1DI0A 1T3GA 4Y3UA 4OL9A 1F51E 3E23A 3GEEA 1ZC3A 3H3XA 3SU8A 3T1OA 5FUMA 4RLQA 1W4BA 4F3RA 1J8FA 2AYYA 3LXRA 2WHPA 3MD0A 1CUFA 4QJ4A 3CQ9A 1GNRA 3OH8A 2B4TO 2G71A 1CJUC 2OD9A 1AQLA 3FAKA 1T3ZA 2G83A 2VJAA 3KSRA 2TMDA 4KE9A 2OBYA 3WIUA 1CZLA 1XMOB 2R4UA 3Q2OA 1L6RA 1D2GA 1E6UA 3I42A 3NP9A 5EIXA 3UJHA 4QULA 2CUTA 4MVJE 2P11A 4MYSA 4IGFA 2AFHA 3VR5H 3L6DA 5A06A 2QPLA 4EUFA 2GNAA 2JCYA 2O8NA 2OSBA 3VJLA 4BATA 1G7TA 3MWGA 5CLIA 4KN8A 3U9TA 3UHOA 2WJ6A 3F6PA 2I8CA 4W1QA 2ZSJA 3N5CA 3UMBA 4B3XA 1NFFA 4CDRA 1GAXA 1Z25A 3RTDA 4FLMA 3GLGE 2J6CA 3GOHA 3AB8A 4LVCA 4B76A 4JBWA 4JP2A 4E33A 4YRAA 2JW5A 1DKPA 4ECAA 4JU8A 3U3KA 2PTHA 3AVUA 3GVHA 3Q3CA 5BQFA 5AVRA 4BO9A 3RG8A 2P6OA 2P9EA 4HPWA 1MB9A 1GAWA 1V25A 4U9UA 1PL8A 4BV8A 3QITA 2FNAA 2H4JA 3B1VA 4AL4A 3L2OB 4K9KA 5K05A 1UFQA 3O38A 1I2DA 4Q1EA 2FFRA 1A8UA 3AUFA 4DEYA 4OLAA 2ZBEA 3HB0A 4RU1A 1RCUA 2BH9A 4F3KA 1FSPA 2OZLB 1X86B 3OKAA 4LZZA 1C3OB 3PX7A 4P3OA 5J4LA 1GFZA 1XN1A 4D1YA 3UK0A 2QTWB 3WSVA 5CEFA 2G7ZA 3BTUA 3B8EA 3DWGA 3S5JA 3SJAA 1LPNA 4EEZA 4YR7A 5C3MA 1E5QA 4MUHA 2I3ZA 3STYA 5DM4A 5LU9A 2FZCA 4NYIR 4PZYA 4IZIA 4B3MB 3ESAA 4CMEC 3R6DA 4QKQA 2XUOA 3V7FA 3O47A 1BE8A 5CJPA 2QM7A 3DXYA 4OLHA 2ODPA 3NZEA 4G09A 1MA0A 1FP4A 2TMYA 3HDGA 4A8HA 5KSOA 4KNVA 4YP0A 1U0GA 3I09A 2RGRA 1CQJA 4YUVA 4AROA 2P2YA 1Y3DE 1NI4A 3PWSA 3VH1A 2ZIEA 2YNMA 3NT5A 1WXFA 1Y4DE 1G8SA 2FMKA 4UKDA 3UF0A 3KOZA 1UKZA 1CQZA 3EFOA 1C9EA 4LHZA 5G53C 2AN5A 1PUJA 1G41A 4R9RA 3IPCA 1Z5WA 5C51B 2WI8A 4KQGA 2F3RA 2PA0A 1OBFO 1NP6A 2IIVA 2NZYA 2B8TA 3KEFA 3SAJA 2QUHA 5IN5A 1BC5A 2IYWA 3OLYA 2C88A 3E9EA 1RE0A 1Y7LA 3O2JA 2H00A 5D3MB 1LDBA 1QSGA 2RONA 5HA5A 1RRVA 1WDWB 2C9OA 3WGZA 4EMTA 1U9CA 1J42A 3KLPX 2OFWA 1ZD3A 4XWKA 4PPYA 3COSA 3K70C 2Q62A 1GYPA 1ZIYA 1QZUA 1KKLA 1WPRA 2XCIA 3HFJA 3WGTA 5HGXA 1IM5A 1SUBA 1Y6JA 1UC5B 5DBGA 4X62B 4EB6A 4FDMA 3E61A 3EG9B 2E37A 1B41A 4R8VA 3FETA 4ALMA 3F1LA 5IJ0A 1OLOA 1GNLA 1GNSA 3KP1A 4R2IA 4X91A 3WLRA 4BNDB 2Q1TA 3VISA 1DQSA 1OBOA 3GHHA 1KZ1A 1YOBA 3PHIA 4R40A 3QE4A 3E9QA 4BVAA 3S2ZA 1W4CA 1XD8A 2XODA 1BVHA 1CEXA 4D0GA 3OEYA 5K0CA 2WAAA 5MGBA 2PUCA 1UAYA 1VFPA 2XLCA 1CNEA 3IXLA 4PBTA 2Z2YA 5DHRA 2K4MA 1R0KA 3UHPA 1SU7A 4LZNA 2BR5A 2X2PA 5B2ZA 3EMDA 2VNJA 4QTUB 3BRQA 4ROSA 2ASEA 2H4WA 4DV0B 1QQAA 1B74A 2QKYA 3IKLA 1N3LA 5K7SA 1LU9A 3RYIB 2VH5R 3C98A 3OUUA 3K70D 4MS1A 5H81A 1S9DA 1P1FA 3B1WA 3IMFA 2OGUA 4LQ4A 4RJJA 5MN4A 2VK1A 4RD2A 1USVA 1QVZA 1C9KA 2O0KA 4PYJA 2B3DA 3COJA 3THRA 3WYCA 2J45A 5KNLA 3E7FA 2H59A 2GJ8A 4B2YA 2GM9A 3BMNB 1IM8A 3DOFA 4MIOA 1WMSA 4D0RA 1EWQA 1J2UA 1GSAA 1LDYA 2NX2A 3N7UA 3VU0A 4YAFA 1ISRA 3V7WA 1AGRA 1G5IA 1SC3A 2EX1A 1G0OA 3AGPA 4GYKA 3VDQA 5BSUA 4OQNA 5E9WA 2HLDD 3ZDXB 4ANFA 3OSUA 3ZCTA 3NTOA 4GXNA 1Z36A 3MT8A 1S2MA 3GJQA 2Z2XA 2CLIB 3X0DA 1A7KA 1P29A 4X3CA 5A9SB 4RPKA 4TWZA 3B1KA 5AM1A 5F35A 3KAKA 1UMBA 2K6GA 5GM2A 5EE9A 2BEWB 1EGQA 1MV5A 4AMGA 3EGXA 1M10A 3JD0A 5I3ZA 2EQAA 4HWKA 2GXSA 1J1UA 3A9SA 1QGDA 1UK6A 2CFRA 2AUNA 2P2DA 2QJRA 3HACA 3O3MB 4MV5A 3JALB 1FFEA 4HTFA 4RW0A 4Q4JB 5EHGA 4BQPA 3U1BA 2C03A 3PHJA 2BEKA 2YXPX 4QELA 4ZXPA 5BRNA 4Y9DA 4EGFA 1Z06A 2NTYC 2IYOA 1H8EA 2OQRA 4NQRA 3IVAA 4G65A 5BMVF 5KHLB 4QVIA 4L4ZA 5GVRA 3K70B 3UMVA 1PX0A 3W6PA 4KE7A 1NA5A 1OHHD 4I50B 4YAWA 1CS4C 4E5PA 1A9QA 2GN9A 4H59A 3T7SA 2Q7XA 3C74A 4RXUA 1JALA 4C88A 4TVSA 4MRAA 4BQRA 5JSFA 4A6XA 4MO2A 3GI1A 1OH6A 3E58A 4QHTA 3TTWA 4B71A 2EBWA 3MCWA 1ATIA 2A9VA 4UHHA 2JI8A 2J5BA 4JLAA 4NU6A 3ACBA 2O57A 1W36B 1L4NA 2Y92A 2ZPTX 2IDZA 5B12A 5M34A 2C84A 1X13A 1ESNA 1FLDA 3AR6A 5CPBA 5EUCA 2CK3D 3C48A 1C1XA 1Q17A 1N7HA 3B2NA 3QW2A 1Q2XA 4G0YA 1ZEJA 2C54A 4HX2A 2DUJA 1K1EA 3ED1A 4S1OA 2EFCB 4H1HA 3A6PC 2PRJA 2YWHA 2Z57A 3QFTA 2CXUA 3PB3A 1EP2B 3Q7QA 3RS0A 3VUEA 4UU7A 4NXMB 3AK4A 2X5NA 1H2EA 5JWHA 3SFTA 1PJCA 1KSGA 3KOUA 1ZNWA 4O4JB 4HX9A 1XTBA 3K8OE 4GPZA 3J81k 3SJUA 4D97A 2WIFA 1QH8B 2BFFB 3ME5A 3H2JA 2FE4A 5DBOA 5AYVA 3STVA 2PCLA 1E92A 4IFBA 4OOEA 2EKDA 4BVHA 5K8UA 3JWJA 4WCFA 4EARA 3DNMA 4BQSA 2OB1A 3IQZA 3DA8A 5C7YA 3ICCA 3PJGA 3WZMA 5AM3A 2ZT5A 3L79A 4PG7A 1MCZA 5KTOA 3N75A 3T7JA 2CL7X 2W8BA 3A04A 2XB6A 5DN6A 5BXYA 5BVGB 1FTNA 2BPOA 4O1IA 1RI1A 3OLXA 3I8SA 4G0UA 4A8TA 2IHJA 5EKUA 4BRZA 2LD4A 3E2MA 1XZKA 2UZIR 3NEJA 3PC7A 3EFEA 3L0IB 3G85A 1BDJA 3OQIA 3QELA 3A7DA 4FSHA 1Z2PX 2IYXA 3HG7A 1OTHA 1EP3B 5CYPA 4PQFA 2OYCA 3ZUPA 121PA 5KYYA 4YHHB 2DHQA 1WVMA 4MUEA 4TQGA 5AHWA 3T99A 1HDEA 2NYUA 1FJHA 4HEQA 4PLVA 5FYDA 5K4HA 3LOQA 3FPFA 1JA1A 3RUDA 1KHHA 1H4VB 2B34A 1W2WB 5JZOA 2UUBB 2XF2A 2FI1A 3SHOA 3W3AA 4LYAA 1N6NA 5E0KB 3T7KA 4EBBA 4D0LB 1KQ3A 1N5JA 3OE7A 2WQ7A 4KVAA 1DEHA 4XWGA 2YDXA 4GX5A 2W00A 4NQZA 5H59A 3VR3A 2I6GA 1Q0HA 2QX7A 1O5OA 1QIHA 3CUEF 3EODA 3ND7A 1NUTA 4MW9A 1O89A 1SPXA 3W5CA 2V55B 3INNA 4Y1FA 4PS1A 5BW8A 3DFMA 4FN5A 3QXJA 2JARA 4C30A 5HM8A 3M4NA 2Q46A 1FW6A 4TTAA 1MTOA 3ETHA 1EP1B 3HO8A 2IHTA 4QTTB 4YPOA 3FTNA 1DMSA 1UPBA 4L51A 4WA8A 3FYUA 4Y2JA 4CKXA 4EEXA 1QHFA 4HWSA 3CA8A 4JD5A 4PPGA 3QLVA 2DLNA 2QYSA 4HC4A 2GUWA 2PWZA 5CVJA 2FN7A 1QIFA 2ZWIA 2D06A 1E32A 5A7GA 3JZDA 4JR0A 4M53A 4DMCA 5KNDA 3CC8A 2FFAA 2GN0A 3HTXA 2C20A 3VA7A 1KETA 5D3KA 1PJBA 1XLWA 4ARIA 3R0JA 1K5HA 4KIWA 1G8AA 5HF8A 4PZCA 4TMKA 2C8KA 2QTVA 2SBTA 5ALWA 4K87A 3UAGA 5LDHA 3CVVA 3GJ6A 2W6QA 3U26A 2XGSA 5K3AA 4RCVA 4D9HA 1A2KC 3SM9A 3W8DA 5K6AA 5E1OA 3VMMA 4QREA 4ZN6A 2GXQA 5BMVA 5FLKA 3L04A 3I4FA 1OU0A 4B79A 2XWBF 4BLOA 3J81A 1CFJA 4GVPA 5L53A 2Z1MA 1W6RA 4RVOA 1J21A 1IWOA 3MJVA 4MW4A 1JLMA 3LT1A 1R9MA 1AB5A 1E2IA 1ZH2A 3LT5A 4MNTA 4NCHA 3SSNA 2HRDA 1A5TA 1C9NA 1K7CA 3B6ZA 4RSMA 1GG5A 1Q7CA 4L76A 4JSRA 2QZJA 3BWBA 1BDMA 5H9WA 1KS2A 1YOVB 5I9IA 3OU6A 4LHEA 4M7WA 1UT8A 4TX1A 2R6DA 4K6KA 5HK8A 3HRIA 4NJMB 2C98A 3HKEB 5ERGB 1AUPA 4AX4A 1N7JA 1AGXA 1I30A 3FSGD 3ETJA 5K8TA 1P1CA 1PG0A 4LYHA 3SGLA 1AK9A 2I7TA 2PRZA 2PX5A 3OEHD 2ZUBA 3L7LA 4R3UC 4XW2A 1N9KA 1P4SA 1ZGJA 3GUVA 2VEDA 5C9ZA 1TO6A 4DWJA 1VHDA 3L8MA 3CTMA 4R8MA 2D1RA 3BD8A 3GELA 4M9ZA 3C1UA 1EX9A 4UAVA 3ZZNA 4RC9A 1E61A 3MRXA 4BB0A 2OV2A 2QUBA 4I4NA 4C0BA 2GEVA 2G5TA 2CLCX 2GKOA 3NOXA 4FTWA 5AJHA 4GXQA 4HEJA 4CFZA 2F90A 1AKWA 1EDEA 2VDOB 2EBUA 1TJPB 5F21A 4B3BA 5T3YA 3Q7EA 4RIFA 1P8AA 2W6NA 2XQIA 1BFKA 1JAHA 4ZYLA 1SC1A 4KLAA 5LYJF 1BMFD 4YUYA 1RQRA 4MVJF 1LVGA 3PTZA 4AZ0B 3C5HA 1U2QA 5DTQA 3IRVA 4K9RA 4BBPA 4N9QA 2MINA 2QW0X 3NRBA 1TYEB 1E3DA 1INLA 2PG3A 3G1WA 5AKLA 5ALDA 4QPDA 2X77A 5A3QA 3H9EO 4X1KA 3Q3VA 5CIQA 4C2TA 3HP7A 4OHUA 2P6RA 3U62A 1X92A 3EF3A 3TR0A 2J9FA 4B84A 1DLIA 2HCRA 2OD2A 4NABA 2HSJA 3PNOA 3R7SA 4TZTA 2BUCA 2F1KA 4AURA 3SYNA 3ZQ6A 2WFLA 2VZ9A 2AFIA 3KDAA 4WLOA 4LF6B 3ERCA 3RNLA 1JVBA 1P7YA 5LM3A 4G67A 3OICA 2GCOB 5AXCA 1GSOA 2I7XA 3T1NA 5DNCA 2ZRDA 1F2UA 2D5CA 3IO3A 1ZGAA 3VBEA 4DY4A 1R3DA 3G8YA 5TQVA 3TMYA 1KHTA 1GXSA 1HZZC 2DU8A 2Y27A 4BPBA 5FOVA 4AWBA 4GDMA 2G9RA 2FWIA 4J4BA 3RSQA 1YONA 1L5YA 1KAOA 2PRKA 4GGMX 3WA7A 3ST7A 4NDZA 5FXMA 3M8KA 3BG5A 2I4OA 4FDTA 3MJRA 1E2QA 3RK0A 1R8QA 2B83A 4EG0A 4C4YA 4TSRA 5KTPA 3CGGA 4U00A 3ZBTA 5AWFC 2JGIA 3BGDA 3E8XA 1GGMA 1FFXA 3GGJA 2J5XA 3NH9A 2RHRA 1ONSA 1NW8A 1ZUD1 2AD5A 3WQQA 4YP7A 3ANSA 1VCHA 5JMOA 1K3TA 1CJKC 2VP6A 1OZ0A 5D84A 1TD9A 5C4MA 2ON6A 3GHYA 2PBFA 4MWEA 4RK1A 3QU7A 1XJ0A 3LECA 4CG3A 5CU7A 3LQKA 5J23A 1G2PA 4HATA 1CUEA 2JL1A 4FEEA 3PJEA 3RK1A 5FCDA 3FCXA 1Y63A 1TOAA 1Z6YA 1RLTA 4YMHA 1C4OA 4CUKA 5CTAA 4MEBA 3WICA 2EWVA 2P91A 2C78A 3TSZA 3WOHA 4CEJA 1M2VA 5CDSA 2NU6B 3JR7A 2QIOA 2REXB 4YMLA 4ZVMA 1BYUA 3RAFC 4NV0A 1KOFA 1CVLA 4NVRA 1ORWA 3KJIA 3FWYA 3P2EA 4V3CA 2QGFA 3C3MA 1Z0FA 5D51S 5IAGA 4LOAA 1M76A 1OGYA 3FFAA 1U1EA 4JLUA 4Z8YA 3EA5A 3BN3A 1Z0JA 1E98A 4OBXA 3LD9A 2QY9A 4DA0A 3RKUA 1P19A 1BFDA 1ZUWA 2QF7A 4XA8A 3VDXA 1GTJ1 1RYBA 1SXJE 2P2LA 5DRYA 2ES4A 4RSGA 3SLRA 1SD5A 2G5GX 5BV8A 2YWRA 4JYMA 5J63A 3DEFA 1UBHS 1Q7EA 1QV7A 3EZLA 3FNHA 3I1FA 3UMFA 3V2UA 3I3SR 4FUQA 3SBOA 4YIHA 3VNVA 2UZAA 4LKRA 5A9TA 3ZCUA 3W4IA 3UUGA 1TPZA 2NWQA 3K0CC 4NENB 2VF2A 5E6SB 4AU1A 3FLMA 2WU4A 3FTCA 2RKBA 1JP7A 1I7QB 4MA0A 3TQTA 4COOA 1UMKA 2NV2B 3HU1A 1XZLA 4B73A 4D57A 1G6HA 2FK8A 3DQPA 3IQDB 2YIDA 3L7DA 1W93A 4P4NA 2JVJA 1GUBA 4I0WB 1UPUA 1HLGA 3VV2A 3CVWA 5DM1A 1WA5A 4QYTA 3FVQA 2BJWA 2HF2A 3CEHA 2WF6A 3AH8A 3MTIA 3EEYA 2HK8A 3NHAA 4OU4A 5HUJA 2INGX 1OGIA 2FW8A 4FM9A 5KOIA 1JXMA 2ZJ3A 1M1YB 3QNWA 5GJVC 2W22A 3H4MA 5EMLA 4H17A 4KR0A 2VWQA 4OGWA 2J31A 5I7HA 4QT4A 1PP4A 3PGVA 1HA3A 3M6MD 3ZY3A 4YMUA 1V5FA 4OIMA 5E38A 4OSOA 4MVJA 4GKBA 4Q66C 4X1OA 4TKUA 1UBCA 4NBSA 4B75A 3ABOB 4XCVA 4P31A 2X0FA 3ZZ1A 3U17A 4DUGD 4M7PA 4O2BB 1M2HA 4D6PA 3IMEA 2CDBA 1YIOA 1ZISA 3PEVA 3QVJA 4V0RA 2OHHA 2AW5A 4YRNA 3P9QA 4L3WA 4YT5A 1G9SA 3LDGA 3MTBA 3AUJB 4KN6A 2QLLA 2ZSDA 3SK0A 1JU4A 4BJHB 3GLGA 1GUDA 3I45A 4IGIA 1XEFA 3WGGA 3OJEA 4WOPA 2XPCA 3HSSA 2H65A 1ZXXA 4NBTA 4ENRA 2W71A 5KOHB 2GM3A 1G6KA 1R0RE 2JJ1D 2WBLC 4PRZA 2CXPA 4Y6RA 4W1RA 4YP9A 3REOA 4CMCA 4DBLC 4AYTA 3I01A 4ACBA 4RQAA 2X2OA 4PX5A 4U7FA 4JLWA 4KK4A 3A10A 1V1MA 1J7KA 1OV6A 3G7UA 1RS0A 4XASA 4CCSA 4CQLB 4Z1MD 1H4QA 2C61A 5EJ7A 1TGYA 4IF6A 3KHUA 2I91A 1ZP6A 5CYGA 2O2SA 1FFGA 4JL6A 3RFUA 1Y89A 3WTBA 2ESRA 4CCAA 2R6FA 4LJ8A 4ZIRB 3W4JA 2C0PA 3EXFA 3GWGA 3NOQA 4BECA 2DAPA 3U7QA 1TFRA 4ND3A 3SS7X 4F2HA 4IDQA 3TBKA 2G28A 3NAZA 4CT4B 1NASA 1WU7A 1B4DA 1NNLA 3OCXA 1D2MA 1W5TA 4ML3A 2BFBB 1ETHA 1S7GA 4FEAA 2J0SA 1R9JA 3OBBA 3KSAC 1GPWB 1N2XA 1QHGA 2QM3A 3V97A 4E4YA 4EGSA 4PG8A 3JQGA 5TGDA 2I1QA 4PHCA 1VLLA 3AHJA 4BC1A 2PVSA 3U4DA 2GZHA 4NONA 2FPLA 2GRAA 2I76A 1BS2A 4PZ0A 4M76B 1CUZA 1CR6A 1XD2A 3KU4A 4LMPA 1OAKA 3TQIA 4C76A 1IB6A 2QA5A 1O94C 5KDLA 3VR2D 2GA9A 4UE3S 3ZG6A 5EKTA 3WYFA 3H1FA 2UZ1B 3E5RA 3K8YA 1MQSA 1SC9A 2RB4A 3DV2A 3ZYZA 4TV9F 4NBVA 4CYMA 1C30A 3ZTWA 3D4LA 3L0CA 1JBKA 2P9QA 3N2NA 3GOQA 4ADSG 4QJ3A 3ZI0A 4BRSA 2IDMA 3QG1A 4AFNA 3BWYA 3JCZA 5L7WA 1P1KA 3C70A 4OKSA 4JOQA 3G9UA 3EY4A 1U0JA 2JDID 3JPYA 3NCTA 3AVOA 1KY4A 1OFHA 2AB0A 2YW2A 3W8FA 4DLNA 1QRTA 1XYGA 2J3LA 3LNCA 1DAFA 3COVA 3L06A 4A8PA 4EKNB 5FTKA 3C6YA 4Z9XA 2RD2A 3UGKA 2LKDA 4LRQA 4I1OA 4BMSA 1HEYA 4ZP1A 4Q7JB 1ENOA 5G0UA 5JBIA 2R1TA 3BSFA 5SICE 3JVIA 5JAOA 5K2OA 3LA6A 3QKSA 1N33B 4D9MA 3VOTA 4G1FA 4Z0TA 1KPHA 4Q12A 1O94D 5J1TB 3ITKA 4NIMA 1FY2A 3L7JA 1KFCB 3I5YA 3RIMA 5H16A 1A7JA 5FBRB 4LOJA 4POOA 2XCRB 3MGCA 5FPQA 3DHWC 3C6QA 3UJ6A 4BFWA 1PK8A 3F7OA 3WQRA 1KEKA 1NSYA 1HLDA 2NXJA 3IP5A 4GH5A 4AF6A 1ORIA 4Q93A 3FDJA 4KLZA 4UASA 4P9NA 3NBXX 3A9CA 4BMDA 4I4LA 2O8VA 3TZLA 1QH0A 2HYIC 2VPTA 1WUYA 4G3XA 1E9CA 3QKTA 4X24A 1NG9A 4ZOCA 1GKUB 3FPGA 4OD0A 4NV3A 1IYZA 3A1DA 4Z7NB 3NNDA 3G9TA 3GWZA 4RS3A 1AKQA 2TSYB 3EB9A 3EYAA 4RKQA 1YL6A 3U3OA 2PXHA 2QV7A 3H7IA 4II2A 3LBFA 3JU3A 4NJOA 1MHPA 1DWUA 2W2KA 3D4PA 3GA7A 4FQ7A 4AMBA 3SHFA 3HVUA 3EJ6A 4R1NA 3QMVA 1X80A 1Q3KA 1XU4A 3CZAA 3N2LA 2PUFA 1LEHA 2WM9B 3QU2A 3V3KA 2IF0A 2X6TA 1AKVA 4INJA 2Y0BA 5HOEA 2L18A 5IRCD 3GLIE 1SCUB 3G6KA 1Z15A 2QTBA 2IPAB 3WMXA 4B6PA 4DR1B 3HI4A 3ISTA 4N49A 1E2HA 1F0KA 1JN0A 1RNLA 1H2AS 2AFVA 3BICA 4JB8A 1XDUA 3E35A 4QUDA 2E6UX 4NSNA 2QTZA 4Z2AA 4RFSA 2XMSA 4EL0A 2IHVA 5EP3A 1SG0A 5KMGA 3S8YA 2BDUA 1JPNA 1RPJA 3EHDA 4G5OA 2QPTA 4PLFA 3PRHA 3FDIA 1J90A 1ZVMA 2PKCA 1LI7A 1YHNA 2X0NA 1Z22A 2BFOA 3GEPA 7REQA 3HCNA 1OLUA 4Q5IA 3IXMA 1V4VA 4RVDA 2HIAA 4R1UA 2R60A 1KVRA 3BPSA 1Q1BA 1Y3CE 2D0IA 4IG4A 3D1LA 5U4XA 1DJLA 4OEHA 4DCUA 2J41A 3DXZA 3KEMA 3OPYA 4QDJA 4EHJA 1VB3A 3T3IA 2JRCA 4TTJA 1MABB 4I4TA 1BGWA 3AIIA 2JAPA 2HBYA 3WK7A 5C53B 4BNWA 3F73A 5CB8A 4I6JA 3NUGA 1SKYB 3ZIDA 2F3PA 2O9JA 4S04A 1Z8HA 3VHXA 5A0VA 3E3NA 2ZBUA 3ILXA 3AYXB 3TW8A 4HLCA 1UJ5A 3N2GA 3QXCA 1O96A 1C4WA 3SE0A 3P26A 4IX9A 4ZVRA 5B55A 5JDIC 3NDRA 3EZFA 3A2KA 2C4HA 3AJAA 3KJNA 1N6IA 2Q3EA 3JASA 1MJFA 2PMBA 3L8EA 4Q1AA 1M1NA 4BFZA 4ZCRA 4HNVA 1Z63A 3VJRA