2ZLBA

Crystal structure of apo form of rat catechol-o-methyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
212
structure length
212
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 72
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zlbA00
1INLA 2ZIGA 1RI3A 4LG1A 4PONA 3B89A 4DCMA 1ZG3A 2CMHA 3OU6A 3OZTA 3M6WA 3CBGA 3LDGA 3KPYA 4NECA 5DX8A 2JHAA 3B7PA 2CWWA 2BR4A 2PGXA 4E32A 2ZFUA 2YXLA 3OE5A 2KW5A 3KQPA 3R0QA 5K0GA 3HA5A 3R6TA 2QRVB 5GOZA 2P3OA 1JQDA 5ICCA 2PKWA 3G7UA 3EGVA 5IKMA 2AOXA 3HM2A 2C7PA 2QYOA 3TLJA 1FP1D 3PLAE 4GEKA 5FCDA 3UJ9A 3GCZA 5LQJA 1XCJA 1JTFA 4FSDA 4YUXA 3KPVA 5FUBA 1NT2A 1WY7A 1HNNA 3ELDA 2YR0A 2IDKA 5T6BA 5DM0A 3DH0A 3C3PA 2O0LA 4Y30A 3DMFA 3EGIA 5F2OA 3UJDA 3OPNA 1UWVA 5GP1A 1VE3A 2PWPA 3EVAA 2IBSA 2FCAA 4P58A 5KQSA 2ZBQA 4EVIA 4C04A 1QANA 5E2BA 3HVHA 4C07A 5K0FA 4AZSA 4BLWA 3LDUA 5HZMA 5K03A 5GIPE 1BOOA 1SQFA 3E05A 2P35A 5LQAA 1AQJA 2XYVA 2XYQA 5CM2Z 1SG9A 3GGDA 3S68A 2G72A 3A27A 2I62A 2Z6QA 2EFJA 3NWEA 4GOLD 4P7KA 3NMUF 3OE4A 4YV1A 4GOOD 5FWAA 2NXJA 3OCJA 3GJYA 5FHQA 5KVAA 3FYDA 2ESRA 4ATNA 3I64A 1G8SA 1IM8A 3Q7EA 3GWZA 4R6WA 5ICGA 4C06A 4MWZA 5F2NA 3RODA 5EC8A 5K0EA 3GO4A 3B3JA 4RTJA 1DCTA 3AWIA 5E8JA 1XXLA 3BXOA 5GIOE 2XVAA 4FR0A 3BGVA 2O05A 2IPXA 3KQVA 5K0NA 5BP7A 1ZKDA 3UA3A 1UFKA 3I53A 3DP7A 4C05A 5HIKA 2GH1A 4RX1A 2HV9A 2HWKA 3EEYA 5T64A 5EGSA 1ZGJA 3FPGA 2AOTB 3GIWA 4PYIA 2CMGA 3FYCA 1FJXA 4EQZA 1P1CA 3EPPA 1QYRA 3CJQA 2ONZA 5FQOA 5HOQA 3ID6C 4E31A 2LD4A 4OX9Y 3A4TA 3QOXA 4PIPA 2FYTA 3A25A 3PFGA 4X1OA 3NJRA 4LECA 5LQUA 3LCUA 1JG3A 3KKZA 1ZGAA 4QQNA 5CVDA 2WA1A 1L9KA 1DUSA 3GRYA 3OZSA 3UZUA 4EK9A 5CCXA 2VDUE 2Z6AA 3CJRA 2Q41A 3A7EA 3JWHA 4ER5A 3PT9A 4YMGA 4PYMA 4RTLA 1JQEA 3HVJA 3KR1A 5U4XA 1ZHFA 1YZHA 4WVLA 4PGGA 3EVCA 4GC5A 7MHTA 4PYQA 4A6EA 4IV0A 4C08A 2AOUB 1RI1A 2P7HA 1TW3A 3GRVA 4GOMD 4M36A 1QAQA 5CD1A 1F38A 2VDVE 3EMDA 3FTDA 4QQKA 5DSXA 5LQKA 1M6YA 3IYLW 4P7FA 4E33A 2NXNA 1KPGA 2PSSA 1KP9A 5EMMA 2ZZMA 3LPMA 3CJTA 3MB5A 5P8WA 3C6KA 3DXXA 4CKEA 2EX4A 5T67A 1NV9A 2UYOA 1MHTA 1VBFA 1BHJA 3UJ7A 1TW2A 3HP7A 3R24A 1RI4A 5DXJA 5EQJB 1VIDA 2BM8A 3FUWA 3G2MA 3LKZA 4BLVA 1VP3A 1AV6A 8MHTA 3FTEA 2IIPA 2ADMA 3G2QA 1PJZA 4O29A 3FUTA 2FK8A 2IBTA 3CCFA 3D2LA 2AOWA 3T0IA 4DM3A 5FA8A 4AUKA 2JH8A 1DL5A 5DX1A 3GRUA 5JUWA 4X60A 4QDKA 1RI2A 1L3IA 3G2OA 5FULA 2EJUA 1P91A 1YUBA 1X1AA 5F2KA 3P8ZA 3UA4A 3NVKI 2NP6A 4AZWA 3PB3A 1FP2A 3AXTA 2DULA 2PJDA 1M0EA 1NW3A 3KR2A 2PXXA 4XUCA 2ZZNA 2ZIFA 5FA5A 5C9ZA 1X1BA 3PVCA 3SSNA 4PYOA 1RJFA 3EVEA 3KQWA 3NDJA 2PT6A 1I9GA 5EHGA 2OB2A 4RVHA 3UWPA 4RTSA 3NVMB 1O9HA 2P40A 3DXYA 3MGGA 3FRHA 3LL7A 3PFHA 1MJFA 2NYUA 1KR5A 4FGZA 4KWCA 5EEHA 5GM1A 3T7SA 3UFBA 4XCXA 1XVAA 1R6AA 2GS9A 1VLMA 5LR6A 2UYCA 4CTJA 2V7EA 4ISCA 5K0BA 2AN5A 2PWYA 4DCGA 1RJGA 3KQYA 3P71T 2QM3A 3SR4A 1I1NA 5G02A 3NTVA 3HVIA 5DRYA 2ZW9A 2OO3A 5DM1A 1R8XA 3EVZA 5HILA 2A14A 5EPEA 1NBIA 2PXAA 3KPWA 4DMGA 5HEKA 5CVJA 5CCBA 3QV2A 4PCLA 5CVVA 3TKYA 3T7RA 1KHHA 4FT2A 1WS6A 1Q0TA 3FRIA 1QZZA 1G55A 1N2XA 3EVDA 4EKIA 4F84A 10MHA 3BKXA 3O4FA 1KYZA 3GRZA 1UIRA 3HA7A 3KR9A 2HTEA 2Y1XA 4PIMA 4CKBA 3FTFA 3LKDA 4WXHA 3HCEA 5LQRA 3P9KA 4YV0A 4F85A 3EVBA 3U81A 2PY6A 3LCCA 1JR4A 2P8JA 1EG2A 1NE2A 1YFJA 1WXWA 4C4AA 5EEGA 2B25A 1L3BA 5LQNA 4FZVA 2JG3A 5DX0A 4HGZA 5EMLA 4RTPA 2P3QA 4P7JA 5DM2A 1N7IA 4RTRA 4MIKA 3GU3A 4QTUB 1SVUA 3AJDA 2VS1A 4U7TB 5K0LA 5E1BA 1QAMA 4OA5A 4PGHA 2AOTA 3NW9A 3DLCA 3SX0A 4BP1A 4E2XA 1D2HA 5CIYA 3EMBA 2YUIA 1FPQA 2BR3A 4PYKA 5DLYA 3V8VA 1IY9A 3OFJA 3G88A 4GOND 2G71A 5LSAA 4RTKA 4P7GA 3I5UA 2B9EA 2CL5A 3KR0A 4IV8A 1JG2A 5ERGB 3G8AA 4GQBA 4E2ZA 4F86A 3I58A 2BZGA 4MTLA 3M70A 4QVKA 2IH4A 1NW6A 3M6XA 3G8BA 5EIWA 4HTFB 4YV2A 3K0BA 1L1EA 5E2AA 2EJTA 3P2EA 4X63A 5K8VA 5E1DA 4DA4A 2AN4A 1X1DA 3M6UA 4FS8A 3BGIA 3HCFA 1NW8A 4KDRA 5EKUA 2IDJA 2B3TA 1XJ5A 5FWDA 3DMHA 3TFWA 3FPJA 3HEMA 4AZVA 5DTRA 1XCLA 2I9KA 2ORED 1IXKA 1G8AA 4RVGA 2G1PA 4RSRA 3T7TA 1O54A 5D1NA 4E30A 1L3CA 4MHTA 2GA9A 3C3YA 5HFJA 3FUUA 4FSXA 3K6RA 3M6VA 3IV6A 4V0RA 3TM4A 3UJCA 2IP2A 4GF5A 2AOUA 1H1DA 2G70A 2NXCA 2ZBPA 2N47A 5C0OE 2XVMA 1KPHA 3BGDA 4M38A 3SSMA 3UJBA 3SXJA 4KDCA 4BY9E 1VP9A 5KS2A 1RJEA 1KXZA 2YVLA 1WZNA 2ZZKA 4HH4A 4ER7A 2OKCA 3BZBA 3DOUA 5DSTA 5HIMA 4ZTBA 1YFLA 3OZRA 3TPZA 2E5WA 5CVUA 5EG5A 4H0NA 5EZQA 3ANXA 1SUSA 2AZTA 1NBHA 4YUVA 3SGLA 4PNEA 2ZWVA 1KYWA 4RVFA 2AR0A 4E2WA 5C1IA 3OFKA 1D2CA 4A6DA 3TQSA 4LWOA 3VSEA 1JG1A 2B78A 3C0KA 4LWPA 2JHCA 2ZSUA 4AZTA 4RTNA 2B2CA 3CVOA 3ELWA 5FQNA 3A26A 2ONYA 3DTNA 3IHTA 3LDFA 4PYJA 3E8SA 2DPMA 3KQTA 5KYGA 3G5LA 2AVDA 3DULA 2P3LA 3P9IA 1YB2A 3LHDA 3SSOA 3R9XB 4POOA 5EMJA 2I7CA 1I4WA 3DR5A 3GDHA 4OBXA 5E9WA 1V39A 5H02A 2F8LA 2JH9A 3DUWA 5E9QA 3VC1A 4DZRA 1Q0SA 2AVNA 2YXEA 2FRXA 4U7PB 3IEIA 3KQOA 2PBFA 2V74B 2YTZA 3BWBA 2VDWA 3FUVA 3G5TA 2Y1WA 4RV9A 4EMSA 3RIEA 1JQ3A 5ICEA 3FPFA 3BUSA 2EG5A 4M7RA 3EEOA 4QTTB 2QE6A 2FPOA 2GAFA 3WSTA 2AS0A 2PLWA 3BWMA 3G2PA 5M5BA 5BW4A 5BW5A 3PX3A 3UJ8A 3DXZA 3SM3A 1G6Q1 1D2GA 3M33A 3DLIA 5EMKA 1HMYA 5DPMA 2C7QA 1KPIA 3AXSA 5K0JA 2O57A 1NV8A 3JWJA 1YF3A 2PT9A 2PX2A 3ORHA 5D1HA 2GPYA 5K09A 3MCTA 4HGYA 1SKMA 5EHIA 3FZGA 1KIAA 4IKPA 3O7WA 4IWNA 1XTPA 2ZBRA 3HVKA 2WA2A 4CWAA 1EAMA 1VL5A 4X41A 1WXXA 2OPBA 4UOEA 3JWIA 1SQGA 5B1SA 2YX1A 3KQMA 5DTQA 1NKVA 1RJDA 4QDJA 4RWZA 4X61A 5EKXA 3TR6A 3ERCA 1R74A 1ZQ9A 9MHTA 3P9CA 5E1MA 5DTMA 4BLUA 1OR8A 1BC5A 1G38A 1P1BA 3B3FA 3OU7A 3L8DA 1R00A 2IH2A 1X19A 2PXCA 4GUAA 1QAOA 1U2ZA 2P41A 3KQSA 1P39A 4CTKA 5FADA 1JSXA 5K05A 4ER3A 3ER8A 5BXYA 2YXDA 3KQQA 5DM4A 2ZTHA 4GC9A 3C6MA 3HCDA 1F3LA 4GBED 5EIFA 5FHRA 3TMAA 3EVGA 3NDIA 5HIJA 5CVEA 4DKJA 3O31A 4QPPA 3VC2A 3B5IA 1N7JA 3LX6A 3MAGA 4PWYA 4PYLA 3TM5A 4KVZA 5GINE 1Z3CA 5K01A 4RVDA 3MHTA 3FTCA 2JHPA 4DQ0A 1WG8A 3V97A 3MERA 3DMGA 3M4XA 2BR5A 3H2BA 4DF3A 4L7VA 1ORHA 5GWXA 2ZWAA 3OU2A 4R8SA 2ZULA 2GLUA 3LECA 2PX4A 1AQIA 4EKGA 2FHPA 2BM9A 5JR3A 4CXMA 3PX2A 2IH5A 2Z6UA 5FTWA 5ICFA 4ER0A 3LCVB 3R3HA 3PS9A 4HC4A 3TOSA 2P1DA 3EGEA 5DT2A 2R6ZA 2VP3A 5EVJA 2H11A 1VQ1A 1G60A 1TPYA 3ELUA 3KHKA 3SMQA 1XDSA 2O07A 3P97A 4KW7A 1JSZA 3LGAA 4OBWA 1X1CA 1YZ3A 2O06A 4HRAA 4RTMA 2YQZA 1O9GA 4K6MA 4QPNA 3NWBA 3P9NA 3KPUA 4KRGA 1EIZA 3E7PA 1EJ6A 4Y2HA 5EZSA 1JTEA 2H00A 2PV0A 4PCAA 4Z2YA 4RYLA 4YUZA 3AY0A 4OQEA 4C03A 3UJ6A 1R8YA 4E2YA 3UBTA 2UZ4A 2HMYB 3LBYA 3FPHA 3EVFA 2JJQA 2HR1A 4QVGA 4G56A 4B17A 5HIIA 1NW5A 3FPEA 5E9JA 1BKYA 5K0CA 3CGGA 1XDUA 3HCCA 2VZ9A 3MTEA 3BWCA 3X0DA 3G89A 2PVCA 3ME5A 4YMHA 3E23A 3TKAA 3GNLA 2I6GA 5KQRA 5MHTA 1M6EX 2IFTA 2IGTA 2OBFA 5E1OA 3MTIA 4BP3A 4YUYA 3HTXA 3BWYA 4XUEA 2OB1A 3ER9A 2WK1A 4FP9A 4XUDA 4E70A 3ELYA 3FUXA 2CKDA 3CC8A 5IH3A 4PINA 1XDZA 3THSA 5LQCA 2UYHA 4OA8A 1PRYA 3I9FA 1ORIA 5E8RA 4YUWA 1VPTA 2GB4A 4RTOA 3RW9A 2ERCA 2HNKA 1NW7A 2NNWB 3CKKA 3SVZA 1AF7A 2P7IA 2H1RA 3A7DA 4AX8A 2PX8A 4HTFA 4KIFA 3JWGA 4HG2A 3B3GA 4FT4A 5GM2A 3UJAA 2XYRA 4ER6A 4RTQA 2NP7A 2PX5A 1EJ0A 2AN3A 2FK7A 3BKWA 2OXTA 1B42A 3MCZA 3HNRA 1R18A 3F4KA 3KU1A 3BT7A 4CKCA 2OYRA 4PYNA 4HSGA 3P2IA 1JG4A 3Q87B 3TRKA 4V0QA 1T43A 2NXEA 4R8RA 2XBMA 5DRTA 1SUIA 2OY0A 5CUQA 1Y8CA 3LSTA 5DWQA 3GXOA 2K4MA 5DXAA 3QOWA 4OQDA 2BH2A 1RI5A 3HCBA 1FBNA 4KIGA 2C7RA 1EQAA 3THRA 3PTAA 3KPJA 2ZIEA 3VYWA 2ZLBA 4R6XA 2QRVA 3MQ2A 2C7OA 4M37A 4MQ4A 4R05A 2OZVA 3HCAA 2AOVA 3LBFA 3REOA 2QY6A 2ZVJA 3HA3A 2UYQA 2R3SA 3GRRA 4JXJA 2G8NA 5EOVA 2ZCJA 3P2KA
chains in the Genus database with same CATH superfamily
1O2DA 3O38A 4WBXC 2YINC 1GZ6A 3BVPA 4JLVA 5SY4A 2XIQA 3OZWA 2VRCA 5DXFA 4S1PA 2PKXA 3V8RA 1SOWA 3CW8X 1NIJA 1KTIA 4OFWA 1B0UA 4R51A 4UZEA 3UMCA 4F46A 3KG2A 1N36B 1YJBA 2O48X 2ZFUA 5F76A 1H3EA 3QUAA 5K0GA 3OM0A 2GHTA 3ODGA 4IPTA 2ZQZA 1VKOA 1L4LA 3CLRD 2HBYA 4LC9A 3G1UA 5KOJB 4OIFA 1AUXA 2VATA 4M7OA 2J7PA 1QJCA 3VAYA 3PQDA 4PBSA 1Z63A 5KVVA 1Z7BA 3GCZA 1C1DA 1HX7A 3KM0A 1KK1A 5BRNA 4S1NA 4NE7A 2BGTA 3ED1A 3Q5EA 4JKYA 4WY8A 1RYNA 3DH0A 4LXQA 3ZNPA 2C5HA 1DJLA 2QRJA 3EQ8A 5EIAA 2FY8A 3TLZA 3Q8XB 4M86A 2VA9A 3QVKA 4GLJA 4PSKA 3JV7A 1RQXA 4W8GA 3T4EA 1B8PA 1QP8A 3A1VA 3TQOA 4BX8A 2EERA 4K9PA 5K51A 3SSAA 3DPIA 1W47A 4FGJA 3OJOA 2QRLA 2XKBA 3ESCA 1UDAA 1Z5UA 1Y81A 2MSKA 3B1VA 3DP9A 1YBFA 1SBHA 4HDMB 2B8NA 3EC1A 2C2MA 4ITVA 1C2TA 4LJ9A 1R4ZA 3GFTA 4MKRA 1ODKA 3R6LA 4IUYA 3CHYA 3FWHA 5DVZA 1SUEA 4E14A 2P6UA 4V0ME 4TN1A 2CB0A 2I0FA 2J3EA 3FNGA 2PD3A 4WJZA 1JU4A 3MWGA 4HS9A 3WY9A 1AS0A 1ZR4A 4BV2A 4PX2A 4TWBA 1XNJA 2PZEA 3M7IA 2CXHA 2QT9A 1PS8A 3C3BA 1NUUA 3K30A 4EFMA 1Z2EA 1IVYA 1YR8A 5CFMA 1L4YA 4AT1A 2XGMA 3HDVA 4QTYA 4NLLA 1XQYA 2PRYA 4FBMA 3BGVA 3DO6A 3NS7A 5FBLB 3I53A 4N7RA 4TWAA 4DV6B 4AAYA 3NIFB 1E2FA 4Z9AA 4BNWA 1YC2A 4IQ8A 3L7DA 4ARAA 4BVLA 4LAFA 2H1LA 1XP8A 2CMGA 4OX9B 3ET5A 3UGQA 3CT4A 1ZNWA 1EVLA 5IDQA 1EK6A 2I3DA 4X62B 2HI0A 1ULZA 3QIAA 1JN0A 4CCYB 3OECA 2B4KA 2ASEA 3IPCA 4V0OA 3Q7PA 2WMDA 5FUQA 1POXA 3WB1A 4Z6KA 5KHLB 2GZ3A 2VDUE 3DE3X 3OT1B 2QZSA 3AF4A 2P78A 3A7EA 5HK8A 3L8FA 3QBDA 5FLXA 3HL4A 5A5GA 2BEVA 4UFNA 5U4XA 2CXTA 3QH4A 1Z38A 1JEOA 3HXPA 2ZSBA 3PQ8A 2YMQA 3A6FA 4MO2A 5D3KA 5DTJA 2ZJAA 4L3OA 1JFFA 2XB9A 2ZRQA 3ST7A 4KDEA 4D43A 3TQCA 4FN5A 4UZFA 1U63A 2QL7A 3A1UA 3U26A 3S2UA 5AOCA 4ITUA 2GD2A 1F12A 2IIVA 3D3NA 3I4CA 1C3VA 4R01A 1IAVA 5LZ8A 1V9LA 2BGUA 2GAIA 5EMMA 1MGPA 5DYTA 1P29A 1KJWA 3L8GA 4O2BA 5SYMA 3WX0A 4LXIA 3CJTA 5FBQB 1SC4A 3B6EA 4OSEA 1MJGA 3C6KA 4YQZA 2O2EA 3W77A 3ELBA 1MHTA 1EXWA 1K6MA 2HA2A 1CE8B 4BB0A 3X1JA 3O4VA 1EGAA 1MJ5A 4B3HA 1AK9A 3W8NA 3NRBA 2ZRPA 3PIIA 5JYCA 3G2MA 3TGPA 5EINA 3K70C 1CDZA 2KB0A 2P4UA 3LLSA 4S12A 1ZD2P 2IIPA 4EB6B 1PJZA 2VP6A 2O8BA 2VJCA 2JLRA 2AOWA 4LF8B 1NF2A 4DMRA 3PL1A 1UQRA 2C54A 1LKZA 2RJNA 3BILA 2V9PA 3IRUA 1XC7A 4Q48A 2PK3A 4ZO4A 1H2EA 2XTAA 4M0MA 2QTRA 3LTEA 2BGIA 4ZO7A 4WQMA 1N92A 4FFBB 1FOEB 3TQTA 2P5YA 2R84A 3PUZA 1ECJA 4RWEA 3UG7A 3BRWD 4OQFA 1YOBA 4RY2A 3H13A 4YN3A 4CKZA 1H2FA 4U1RA 1A9TA 1NW3A 3VI3B 3R5FA 5HFNA 4O3FA 5IT0A 3HLTA 4TWIA 1TTQB 4P7BA 4YBRA 1NGSA 4G5QA 1VPLA 1U1CA 1WMEA 2OB2A 1R4MB 2MMCA 2FW6A 1QDUA 3KIPA 4GLOA 4INPA 3ADKA 1S4MA 4QBFA 4TYPA 3C8UA 4Q1BA 4D9CA 4I6GA 4YYZA 4YNBA 5I9NA 5GM1A 1QGDA 3T7SA 1QH8B 3WYAA 3DEIA 1R6TA 2J3HA 3U3XA 3HDYA 4KL8S 2JI7A 2AEMA 4H7PA 3Q3GE 4ZDJA 3DLBA 1KU0A 1RJGA 1UFVA 3PHJA 5DI3A 1UZNA 3UATA 4OJTA 2J6HA 1T2VA 4KR7A 3T3IA 4QG3A 3F49S 3PQ6A 3UWSA 3HO1A 1LC3A 3I0MA 1E1QD 4KO2S 3TCKA 4IMJB 2CSUA 2HK7A 4OJKA 3ZZ1A 3L0CA 3QPDA 3QVXA 1Z4LA 3K35A 4LMPA 4Q9KA 1GZSA 3FRIA 1J8DA 3FE2A 3GEHA 4LZPA 3K71B 1AB6A 1E2IA 3BKXA 4GEGA 5DT9A 2IW1A 2GF2A 2HTEA 1KQGA 1Z0AA 4NBSA 5KDOA 1B8VA 4FFWA 4U8GA 4DJFC 2FP3A 2IYAA 4GKVA 3INTA 3MCVA 1C9NA 1L8OA 3P9KA 3LP5A 4MI9A 3IAM1 3QUCA 1Q7GA 3CZ4A 3B13B 1E9VA 4GDMA 5ALMA 2GESA 1J5EB 3GQBA 5A6SB 4RKYA 3ROQA 3B1YA 3HN7A 1F4PA 4UBLA 5JI2E 2IS2A 4DMKA 5B3AA 5DEIA 5COQA 2E4YA 1V8DA 2H5IA 4P7JA 5DM2A 3MW8A 4HAIA 4NIMA 3UPTA 1X2BA 4KYUA 3H5WA 3G82C 5EKTA 2G0TA 3PDHA 1VBKA 4PO8A 3TAXA 1WJGA 4BKUA 1K4KA 4RJKA 3QEOA 2XB6A 3EMBA 4BJ5A 1ZJ5A 4HQRA 1AX9A 4ZXPA 3GUUA 3V7UA 3ADDA 4JNCA 5LSAA 3N07A 1JMKC 3PD1A 5JDIC 1G18A 1UAGA 2B9EA 2ANBA 2RHHA 1NAHA 3GVXA 3GYBA 3C43A 1BKDR 2ISQA 2JDID 3JZAA 4KK3A 4YP5A 3CONA 2HCTA 4Y9UA 4DLTA 3KXDA 3ZVKA 4E09A 3NEAA 3IO3A 5IVIA 3C14C 4HDRB 4OXRA 4UARA 5FUVA 4CMKA 4F8JA 5HUQA 4NOKA 3OM9A 2V45A 2I2WA 3Q6IA 4LSZA 1E7WA 4OHUA 4X63A 2AN4A 4Z54A 4V0MA 2OGWA 1A77A 4CYMA 3THXB 1QR6A 3WGQA 3TFWA 2EOAA 2IYUA 2XUDA 1E62A 5CK5A 5H80A 5I8PA 4YFVA 3PJFA 5D1NA 4CR6A 1IG0A 2GA9A 2QLFA 3WRYC 4KX5A 3EJ6A 2CY0A 1NNEA 1P2BA 2I2DA 3EIWA 1YR1A 4J76A 4TLEA 1SQ6A 4ZKEA 4EARA 2A9OA 1QNFA 1XHLA 2PBRA 2YN4A 2LGJA 3D1VA 3PK0A 3DOUA 1L9XA 3DCIA 2PJRA 2GNPA 1R50A 2X7HA 4R2LA 1NKTA 1I2CA 4KFCA 3WBKA 1KMMA 1KO8A 5EG5A 3VAAA 2C1XA 2QAGC 2Y0BA 3O8BA 2L2QA 2WVAA 3K8QA 1IEQA 4HFRA 2LP4Y 4Y98A 1BN6A 1GPBA 3K2IA 1SD5A 5BWOA 4P98A 1YJAA 5JPIA 3KD2A 4C5BA 5BN4B 3DFIA 5IWCA 4XGIA 2Y1GA 2IXDA 1LQTA 2XUJA 4YI5A 3KCNA 4TZKA 4AF8A 5FQNA 5LB4A 3MQ4A 3S29A 2W6ZA 2FE4A 2C7VA 1I3KA 2VK8A 1RHMA 1VRWA 4RC9A 4PANA 5KNBH 2CE7A 2PRKA 1C4OA 1Y4UA 4MQ6A 4D92A 5CBPB 3R9XB 1EKXA 4KPUB 3QKIA 1R9GA 4L2IB 4FQ5A 1V39A 4TKUA 3UCEA 1TK9A 1VHDA 2VPWA 3F74A 1PBTA 4EYEA 4LZAA 4WL0A 4IHJB 2AVNA 1I33A 4BASA 3NTOA 3DV2A 3JVIA 5IG2A 1E9CA 3RIEA 3VO1A 2BL4A 1DKPA 5EJMA 2Q46A 3FPFA 5G3ZA 3T5DA 1P3JA 2OFOA 2CFOA 1YRYE 2A3RA 3DL7A 5IW8A 4D9MA 4EM6A 1UBKS 3WSTA 4MWDA 3NM6B 5TT0A 3E0QA 4EITA 1UK7A 1NUQA 1SAYA 4F4CA 1S0UA 2V5AA 3T94A 3SM3A 4FGUA 3I37X 2GN1A 1IMJA 1UADA 4HLQB 2PS1A 1XU9A 3PHHA 1D8TA 3HG7A 4Y2PA 4C4ZA 4INAA 2E55A 5IMBA 3DZFA 1X7XA 4IKPA 4OXYA 2CNWD 3VZSA 2GCNA 2RHLA 1VL0A 2WA2A 4JJ4A 3P9QA 2V4ZA 4V38A 2H7XA 1W93A 1NNI1 1ZNXA 4UOEA 2NUAA 2WT4A 5FR1A 1IM2A 2XWSA 4W7HA 2FEMA 1EFTA 2RGXA 1GUDA 1RWOA 3K0CA 3RSHA 1PJ3A 2DKOA 2IHKA 1G1MA 3TZLA 4IIXA 3FN4A 2O8CA 3JD4A 4ZN6A 1FLVA 1DO0A 2HUPA 2R5NA 2XCQA 3P9CA 8LDHA 2Y0EA 4FGLA 4EHBA 3PUKA 2WY2D 1BC5A 4DJDC 1SCIA 2NIPA 3NHAA 3RM3A 5A4KA 3PXBA 2IEGA 6REQA 2CLOB 1C1XA 2W8BA 3JYLA 1CRWG 2P41A 5FYQA 4YJFA 4MUFA 4NCKA 1NI3A 2OHHA 2C8VA 4MPTA 5KOJA 3U44B 3I52A 2QQ5A 1DIOB 1JHUA 3DKKA 5B3KA 3W2TA 1H85A 1T9GR 2WSSD 4G07A 1M8FA 1YSCA 3HXLA 4GBED 4JZYA 4F5YA 5K6AA 3UEOA 2OAGA 4CQLA 4HN4B 3ZY6A 4GXTA 3RTCA 1YVUA 1H0RA 1A5AB 2PSFA 3B5IA 4XPIA 3L7LA 1A69A 4OQQA 3BXPA 1DTWA 2V7QA 1N4DA 4F4UA 1U8ZA 2WJWA 1PQWA 2ERXA 3I39X 3NBUA 3QVVA 4XSHA 3U80A 5M2QA 5TB5A 2JK0A 5LYJB 3KZCA 3RK4A 2NAFA 4J0IA 1C3JA 5EJ4A 3TPFA 5CPFA 1WMBA 3GLRA 2F3UA 1TVEA 4OK6A 2WZCA 4IQFA 3LW8A 2DETA 1KSGA 4M89A 3JATB 2YWJA 2Q2OA 1N0WA 3NRJA 5AK6A 3PS9A 2V5UA 5DEOA 4BP8A 3QELA 4A8JC 4Z7OB 3USES 1ESNA 6Q21A 4ZYZA 4UMFA 1VE6A 1NQ5A 5HKOA 4R2KA 1Q1AA 4K9DA 2V58A 1J70A 3LLVA 4KN9S 3ADPA 4HDOB 4MNTA 1WLYA 3U3MA 3ENZA 1D2AA 1QG0A 3WTCA 2C95A 4Q12A 4YRLA 1XEXA 4EGQA 4K2HA 3HJRA 3EIQA 3FCSB 3OPMA 4Y2HA 3VNBA 3T1TA 3H7AA 4JV5B 2BFDA 2H00A 3IR7A 5LOVB 1E2LA 4M0UA 5JXIA 1RKVA 2H1IA 3M5CA 4NJMA 2O2CA 2HZBA 3ENVA 3GLIA 4UXIA 2RAVA 2X9NA 4K9SA 3T0FA 1L5ZA 1P73A 1Z4NA 3H5TA 5DGIA 1QH1A 4URUR 1WIWA 5HGXA 2VCHA 4QUBA 3QRWA 2C94A 2IYXA 4OXXA 4Y1RB 1ESEA 2SKEA 2QQEA 4RHXA 4UDOA 4YMHA 3V4PB 3EZ9A 2VJOA 3FDIA 1M6EX 1XN4A 3R6GA 3ZWPA 5JC1A 1Q95A 4RQUA 5IT5A 1U8FO 3F71A 2E49A 2F3RA 2FH5B 4EQ6B 4W1SA 1DBVO 4MUMA 2D00A 1UKBA 2HQOA 1SBTA 5J5CA 3WWPA 1IN6A 4O2AF 4NYJQ 16PKA 1AT1A 4LQDA 3I01M 3FPBA 4ME6A 4MW1A 5IM5A 3WZLA 5KTYA 2ZXEA 2EJVA 3QE4A 3O83A 4TTVA 2VA8A 1CJCA 3EHDA 5IXJA 2IODA 1N6IA 3ISTA 5JAZA 1UT6A 3FDFA 3KLMX 3MUNA 2PKYX 1OXSC 3P7MA 2F55A 4RQBA 5C5CA 1GKUB 3W8DA 5KTNA 4EHNA 1YZLA 1ZNQO 4AX8A 4EH1A 2JLYA 4N7BA 1LC0A 3ZG6A 3ONNA 2RAFA 1NJGA 4CKEA 1L5KA 1P0PA 5CDFE 4BO7A 1K3TA 2A92A 2AN3A 2FOLA 2OCYC 2WYVA 4JA0A 3HFGA 2O20A 2O59A 4C0BA 3QM1A 2REOA 4MV0A 5B2EA 1ML3A 1SG6A 3BT7A 3R09A 1Y9JA 1U0EA 1L4EA 2GEBA 3ONEA 3FOBA 4A0HA 1NFRA 1RNLA 5AM0A 2GCGA 4B4DA 3QNMA 1NYTA 1AHIA 4N6NA 1I7NA 1FTQA 3M4ZA 2ZT6A 2AQKA 4Y6QA 4OM8A 2YUTA 5LL6P 1C30B 4D57A 1RI5A 3FMFA 1KBQA 4G89A 4M8LA 2RGCA 4HQ0A 1P5JA 1ARZA 3VR5H 2C7RA 1I4DD 2QN3A 1DKNA 4KSCA 2EJBA 1H4QA 1W6UA 2Y8EA 3L6OO 4O2AB 3RLFA 1LJUA 2GEVA 1ZY2A 3OTWA 5KJ6A 2PCLA 5A5VA 4GR9A 5MF6A 3ANLA 3V1LA 2GN6A 4XVCA 3IIIA 1MOPA 4GKAA 4RCYA 2QNBA 4XQCA 3LTNC 1KI6B 3K9NA 1C1DB 1NDUA 3LA8A 5JSUA 4JYAB 5G1OA 1CUWA 3K2EA 1MA3A 1ZG3A 4DCMA 4X84A 4KTVE 1EM8A 4F1JA 1X8KA 2FV8A 4FYKA 5EERA 5ALTA 1VI6A 3KV3O 3V7NA 3KPYA 3CMCO 2P30A 1HDRA 2AUTA 2M9MA 2NU7A 2X14A 3C5CA 3LIPA 3MRVA 2ZTMA 4WKNA 1A98A 1T4CA 1ZC3A 4OAPA 5HCUA 5AW1A 4EZEA 3CVJA 1Y6JA 3KJZA 1JEQA 1AXRA 1W8IA 2ISSD 1AKVA 3IQIX 4PSAA 1W6RA 3C1TA 3C6ZA 3ZLUA 1NVUQ 3GV0A 2YV4A 5I7SA 1TX4B 1Y5LA 5FCDA 1AK2A 2HF7A 1JQ5A 2W8BB 4IIJB 3UOAB 4DDTA 4ZOQI 5CDSA 3R3XA 2WHQA 1OT5A 3G68A 3OEED 1BE6A 1DV1A 5EGNA 1Z4KA 2HH9A 1IONA 3U31A 1WXQA 2PIAA 3UW1A 1OFGA 4KN8A 3VSDA 1VYHA 3FCUB 3A05A 4PPGA 1FMJA 1J5PA 3IVCA 2PUAA 2Q7OE 2FZ4A 2O5VA 4GWGA 2NTEA 3B78A 2B7CA 5KTRA 5EJAA 4P33A 4XPZA 4DYDA 4M6WB 3WIUA 5LQAA 1AKNA 5FFFA 2EL7A 1PVDA 4AJ1A 4RE6A 4OOEA 2XYQA 3LLCA 4XR9A 4TTAA 1J90A 1U8UA 2XITA 2FKAA 1E9RA 2A5JA 3A27A 2XZDA 3G0CA 5DB4A 2C42A 2H8KA 4HQNA 3F67A 1J20A 4P7KA 3GJ4A 3EC7A 2VHZA 4F7DA 4BQPA 2ZQ5A 2FWPA 3IURA 1XWFA 1NQUA 3O9MA 3OZBA 4HD8A 4GMFA 4RZSA 1NVTA 5HM6A 3U61B 2R97A 2COEA 3ZDXB 5T3UA 3IC5A 4WK2B 3V48A 4AS1A 1A9XB 4L57A 3GQBB 3EXEA 5D2CA 3RRXA 4BWGA 4RTJA 2KX7A 1K6XA 1Y3DE 5CH3A 3VBCA 3K1AB 5KYUA 1OAOA 1R5NA 1S9HA 2P90A 4NBVA 4QT0A 4N0DA 3DPUA 4NBWA 3IMGA 1GZUA 2Q3LA 5EP4A 4BC0A 1BJKA 1RRFA 2VP4A 3IT0A 4KEAA 1JDTA 1PFQA 2HV9A 2I29A 1M76A 3M89A 5CK4A 4DCSA 8ATCA 1FF9A 4J0HA 2JIZA 4IKOA 5ALKA 1IHYA 1OUMA 1OPRA 5LQSA 4XQEA 4QPJC 4GKKB 1C9KA 2SCUA 4CV0A 1B76A 1N8SA 1TAQA 2DRIA 5IVPA 1LBSA 1TYAE 1WW2A 3NJRA 3QU5A 4LECA 5LQUA 3LCUA 2WE7A 1PR0A 3I2FA 3KEMA 1BZYA 2GT1A 2FUKA 2JJYA 3H5IA 1M9NA 2Y67A 1DUSA 1VCOA 4I9GA 4ZT5A 5JJBA 1FLNA 3MTAA 4CMAA 4HMOA 2M6KA 3JWHA 3PNYA 5CYFA 2A9FA 4BGVA 2R4TA 4X7RA 3R3ZA 1YS9A 4DVGA 4RTLA 4UW9A 3K09A 3TR0A 3TUZC 3WDSA 1OWMA 2EIXA 2J9RA 3CWQA 3P19A 4BVJA 4UEOA 2AWOA 4NDZA 3NOOA 1MX5A 2FXIA 2WB2A 3LV8A 3K6SA 2CL7X 1YOVA 1YJXA 1JWAB 1ORVA 5HF6A 1EB8A 1QE5A 2C9OA 4H18A 1ZICA 2CUZA 1ZN2A 4UU0A 1PTJC 2CK3A 3LC2O 1USUA 2DU8A 3T38A 4P7FA 3SLGA 5D8DA 1ZONA 1C9MA 4LHXA 5AM5A 3O8DA 5H59A 3FNQA 3N39C 1DKOA 1SXJC 1Z0KA 2PZMA 1YKSA 2VOJA 3NPMA 4RV4A 4JHLA 5C34B 4ARZB 5B5SA 2QTGA 4IVPA 4KXYA 1IBKB 1QP7A 4OG2A 1QCYA 1AO0A 1G16A 1E2NA 5E3IA 1VLZA 2IYWA 1T24A 4KQ9A 3ZBTA 3WWZA 1NOIA 1FA9A 4BNXA 1BTOA 1FFSA 1GG5A 1E1RA 1H6DA 4FMCB 4N40A 4UCWA 3QEMB 3U4GA 4BMVA 4P8RA 3LQQA 4BNJA 1SKUA 4JJKA 4ZEWA 1KVRA 2EJUA 3BIWA 2PL5A 3OH8A 4S2UA 4KXLA 4OAOA 3T5GA 1QFJA 4R8VA 1K5DA 1MV5A 2KM1A 2J7KA 1B4DA 3GP5A 4X0EA 4F3YA 2YKGA 2H4ZA 4L0DA 3RSCA 1N6RA 3IV7A 2ZZNA 3JQDA 5C9ZA 4K5QA 2HRRA 1PP4A 1SCBA 4I5DA 3E7DA 2QDKA 3D6TB 2NG1A 3DCNA 5J4KA 2WLSA 5JBIA 2P9TA 4NHOA 4AM8A 1NVKA 3ZV6A 3NVMB 4F3KA 3R3VA 3GZ4A 3W5HA 2XWJI 2UAGA 2JRCA 3MGGA 3PFHA 5F98A 3RU3A 3N28A 5LZ5A 4UUNA 1NMSA 3U60B 4E4TA 2XDWA 3CW9A 2RK3A 5FX2A 2ZSFA 2AN5A 3QEBZ 3ZDQA 2BCEA 5AVRA 1E7QA 3QFSA 1KO1A 2IEDA 3PEEA 1WF3A 2CXRA 1OZFA 3AR3A 3Q9UA 2FDXA 1XOIA 4NP6A 4DHWA 4CLDA 1Z8FA 2V6MA 4FBGA 1BX1A 4YJKA 5KAPA 1GTSA 5CVJA 4YS6A 1ENYA 1GUFA 8AT1A 5CVVA 3RT7A 3VQTA 1R9MA 5FI1B 1K5GA 1M1UA 2VTDA 4KQHA 2O2GA 3BFKA 1TC2A 1EJ2A 4FYHA 2D4AA 1KS9A 2YV3A 1NXVA 3DZGA 3GRZA 2WG1A 2FEKA 4LVCA 4EFDA 3JD1A 5JSZA 3HO6A 3QKSB 5JYDA 4QPDA 3C4QA 5LQRA 4G26A 3IELA 4JLJA 1U4OA 2OZKA 2XE4A 5KDDA 4EHLA 1NE2A 1XRRA 5D3MA 3EDYA 4RDXA 2VUSA 5IJ9B 3C85A 3OE7A 5H16A 1JB1A 2V6GA 5I7RA 2WPDD 2H4WA 3PXXA 4GG1A 1V2HE 4OQPA 3BHIA 4ES6A 2PX6A 2IV2X 5GZ3A 1DO8A 3PCXA 4UXJA 4WASA 1K5PA 4L5BA 3KSBC 1IVSA 3G9TA 5NULA 2VS1A 5K0LA 3EFBA 4LA4A 1Z5OA 1V1MA 3T3DA 4R1PA 4EKNB 3DJFA 3LUAA 1K8YB 1EX6A 3Q9LA 4GUDA 2X8JB 4K9MA 4MVJD 3WGGA 3ICEA 5EESA 1CV2A 4F5WA 1T29A 2DUNA 3DVAB 5I4CA 2SKDA 4BN4A 3L8ZA 3I58A 3R2JA 1J8MF 1VLVA 2IZOA 3ZU3A 5EIWA 4WZZA 4GM1A 3GLGA 1IPFA 2KBFA 3EXHC 3KUCA 1LPMA 4LE2A 4UFOA 5B37A 2R8YA 3R8CA 2PMFA 4KPYA 4FS8A 3ZCPA 4BZXA 2QVBA 4C6TB 3VPFA 4NFYA 3UMMA 2QPOA 1WXHA 1RU3A 4L9SA 3HEMA 3SIRA 5DF1A 4KR3A 1LI7A 3VPBA 3LUBA 1YNOA 4RVGA 2BN4A 4WOKA 2WV7A 4H7KA 1Z7GA 4Y6PA 1V6CA 4WOCA 2ZJOA 5HFJA 3VR4D 3QHPA 2FJ0A 2V96A 1U8EA 3L4JA 3K9QO 2C20A 4JC5A 3PNLA 2ZEJA 1R0SA 1TKRA 2X0NA 3DJYA 2GKOA 2LV8A 3MLEA 5DULA 2AR7A 3WQSB 4AZ3B 4NC9A 1MPXA 5HPYB 1O8BA 1OIVA 2WB4A 2Z8YM 2QMHA 3BGOS 3IDOA 5JE8A 4ENSA 4IJUA 2AZTA 2JCVA 3EXIB 4FR5A 1HM5A 2HRZA 1PTKA 2IT1A 2WWXA 4RGYA 1FSPA 4DJ5X 1H1LA 4NS1A 4RVFA 2CNWA 2JASA 2P62A 2QMEA 2QROA 3BCHA 3K6JA 1G8HA 4K2AA 1NBMA 5FPQA 2RC5A 3WRWA 5L53A 3C0KA 1NR1A 3PRHA 4H7HA 3DO8A 3N74A 3WGLA 4ABTA 1ODSA 3EH1A 2R9VA 1IL0A 2RARA 2W6JD 3PV0A 4CIVA 1CYEA 1N7HA 4OFXA 4RK5A 3RFFA 3DF7A 1DADA 4DLLA 1PR6A 5AKGA 4E5MA 4UD2A 1Y8AA 3LDHA 1ETUA 5WRFA 4POOA 5EMJA 3VVLA 4HJXA 5FDFA 3RG8A 3UHOA 5E9WA 4DA7A 3ETHA 3AB7A 4LXXA 1Q7CA 2NO1A 2P3SA 3JSXA 1ZITA 4BO4A 2WYIA 2X4IA 2YWFA 2O1SA 4PLGA 3RI3A 4G0VA 1UAAA 2PBFA 3H0KA 5KCMA 3I83A 1DJMA 1QLJA 4FUTA 4FINA 3M82A 1S2DA 2PH1A 3AW8A 3Q3VA 4B73A 3E70C 4X45A 3U3ZA 3ZZNA 1P9WA 4QTTB 5FBWB 2JLWA 2GAFA 2W11A 2DR3A 1F4LA 2I2FA 3KB1A 4XKJA 1HWYA 2N3ZA 1E5LA 2WOJA 3GBSA 3P9YA 3TQHA 3TLKA 4XRGA 3IBCA 3E18A 3FNRA 5EXSA 2UXBB 3GRAA 3R5SA 2XOEA 4FMDB 1OBHA 3IVMA 3V2HA 1WUIS 4X3CA 4X95A 1RVDA 4I1PA 1SUAA 4UCXA 2PT9A 1EBFA 13PKA 1S3GA 3OPYB 2AFHE 3QVGA 4HNGA 1NBWB 4E11A 2O0HA 1KIAA 3I9JA 1Y8RB 3JALA 1LBTA 1Y4DE 2ATVA 3HVKA 2HLDD 3QKRA 4GBGA 4IWNA 1VJGA 4P6VF 3L49A 1VL5A 2B37A 2IEBA 5HKKD 2A86A 4QOSA 3OEYA 3TG2A 1EX9A 2BBSA 2AMYA 2GA8A 2JFPA 4JR1A 4ENWA 1SIUA 4QDJA 3CW2A 1YZNA 1GG2A 4M8NE 1P72A 5CNIA 4DT1B 1ZQ9A 4KXMA 2PGOA 4KXQA 1XPJA 2E2WA 2YJGA 2E3JA 3OD1A 2F6RA 4BLUA 4C0WA 3AV3A 3USZA 3ICQB 4D25A 4HX5A 3CRQA 3K2BA 1UZUA 1ULUA 2RK6A 2OMEA 3OU7A 4G9GA 4OB7A 4ZWNA 3ILXA 3TD9A 3T5AA 1XFDA 4J6EA 2P2ZA 2ZYVX 1YRAA 3WKDA 4B81A 3T8YA 4AY5A 3KLNA 4COKA 1Q1NA 3A9SA 3K1ZA 1KE2A 3ER8A 4YGYA 2IHTA 1EE1A 2HBQA 2RG7A 1UINA 1EHIA 1X80B 2X5JO 4JB3A 2HHHB 3FKQA 2WQZA 3GVCA 3L7KA 3NDIA 1T6NA 2VQSA 1NJ1A 4CT4B 4DDHA 1EH5A 1SXGA 2AX3A 4QOFA 1NJ8A 1R66A 4YP6A 1L5GB 2IRWA 3ZD7A 1A96A 3SHWA 5FUXA 2JHPA 1HKUA 2PPLA 2BR5A 3H2BA 1DLJA 3R6DA 1ORHA 2OCBA 2ZWAA 3M1AA 4ZC1A 5KTTA 1S1CA 1TYCA 2BGRA 3MGBA 4TVOA 5F7XA 1JKJA 1JFVA 4LVOA 3QQ5A 3DBLA 2Z6UA 3RT1A 3AOEC 1IUOA 2CHVA 2G9NA 1WNFA 1XCOA 3VNQA 1ZHHA 1LLUA 4JXXA 2X5KO 3F6EX 5AJTA 3SBEA 2HAEA 3KC2A 5DZSA 3ELUA 3WC4A 3SMQA 4RIGA 4CIYA 3AVYA 3SYTA 4ND6A 3A6ZA 1O0SA 3FDZA 4YRRA 3RU2A 3CKYA 2CBZA 3K20A 3MTGA 2B4YA 3P9NA 4O08A 1V5WA 5THKA 3WQHA 4BE7B 1EJ6A 3TGWA 1T4CB 1T1SA 3LDAA 2Y1OA 3IBFA 4YO8A 3HO8A 3ZCTA 4TXHA 3L04A 5A3JA 1U02A 5AQ1A 4NCBA 1IY0A 1KC3A 3VZDA 4RXTA 4F96A 1ZNZA 2BHLA 1VZ2A 1AA6A 3GL9A 2ZCVA 3LQRA 3QU4A 1DE0A 2B9VA 5CG2A 4M0LA 3GMDA 4FEAA 2B5WA 1PJAA 1H0SA 4BFSA 1Z33A 4ZJZA 4ZT3A 1XMIA 2W2KB 1P44A 3ZWNA 1GKIA 2YICA 5CEEA 5KQRA 3GNLA 5T3YA 3GLFB 3LVRE 4FKBA 5A3VA 1M2FA 2VSOA 1ZK0A 1ACJA 3H16A 3SG0A 5KYWB 1CP3A 1LJ8A 5CMLA 4MR8B 5A3QA 1ABBA 4Z8YA 3IP1A 2O8EA 1QONA 1NONA 3OT5A 4ZT4A 1G2PA 2UUCB 1W2WB 1UPCA 4QT4A 1R5OA 3BCRA 2QW1A 4F93B 1JP7A 6REQB 1TA4A 1DUVG 1M2OB 4RVSA 3HKCB 5J4VA 2X4DA 1NR5A 1P1JA 1PNTA 1W85A 1B6RA 3HI6A 2P2CA 2D2FA 1F51E 1C3XA 1HDOA 3B2EA 3KCQA 4LJ5A 4B5KA 2P7IA 1Z75A 3MJEA 4UATA 2M6LA 5JAPA 4MJ7A 1KZGB 3EZFA 3C2QA 3FSJX 3JWGA 2WIDA 3FBGA 2W6NA 4UVEA 4LMBA 3TS1A 2Y0DA 5C51B 4RTQA 1U81A 5A3RA 1A1VA 1UKZA 4MRPA 5FRDA 5BY2A 3BKWA 1IUNA 4JMLA 3ZD9A 4TX1A 4MWGA 1PYGA 4EG4A 2GUWA 1P31A 2AUMA 1RWNA 2XY4A 3QKTA 4TKUB 5I9BA 3SLKA 4EO9A 5AW7A 4U0JA 1JG4A 4H4CA 5ESWA 3QKWA 3FFBA 1X7YB 2F8SA 5FPYA 1YK1A 2DBRA 1PK7A 1UWLA 2GRUA 2ZB4A 3HCOA 1Q1QA 2CFTA 2O8FA 3NH6A 4JB0A 2YN2A 1GDHA 4AW9A 4WXMA 4P2GA 4HY3A 5GVSA 1YQDA 2XW6A 2ZLBA 3QUBA 3QFTA 4CF5A 2XZOA 2QRVA 4UC0A 3I32A 3REOA 2ODNA 4KBYA 3JQGA 1OBCA 5AI9A 4AUEA 5JO0A 2MINA 1YZQA 3AZOA 1EBBA 4JXJA 5EOVA 2ZB7A 1I0LA 3OX4A 5I4BA 2QYTA 4PONA 4N0EA 3KEFA 4P22A 3MJFA 1FFCA 4XYMA 5TQVA 5C1OA 4MI1A 2LR0A 4GRIA 2IPOA 4S0ZA 3JR7A 4C4PA 4JK3A 3IOYA 3M6WA 4QE3A 3DE6X 4KX3A 4NECA 2IUEA 3NHRA 3EXHA 1WM1A 2DHDA 6YASA 3CPSA 1U0HC 2NPOA 2JCXA 2OTCA 4X24A 4AWAA 4K26A 1PFYA 2KW5A 5DGTA 2A5DA 2QY9A 2WWGA 5GOZA 2NUTB 1XZHA 3ZI4A 2C8KA 2RHGB 3G79A 2ODEA 4Q16A 3FM9A 2Q9CA 2WT9A 4LYEA 4B5LA 1K3FA 4WZBA 2P4EA 4ZCLA 2ATEA 2HJVA 1K92A 2I7TA 3GNSA 3ILVA 3TINA 3UMVA 3LO5A 3UHFA 3O91A 3IPLA 3ZCRA 5IHXA 2AKEA 1WY7A 3BRCA 4I99A 4KXWA 1M66A 1ORWA 1P4JA 4CKEB 5IYZB 2A33A 2NTNA 4KJXA 2WMNB 3NFYA 2JAUA 3TK1A 5EWJB 4EHJA 4LN1A 2HHLA 3S5UA 4EEXA 4EVIA 3P4XA 1UDCA 5AKIA 3W04A 5ITVA 1M1ZA 2A9JA 2F48A 3LFTA 4K9OA 4XGQA 3LFUA 3DBOB 3BM5A 1CRQA 2JVJA 2QLMA 4X3OA 4Q3EA 1DP4A 2REQB 3PUYA 4QBHA 3VOTA 5EJ9A 1WHTA 1DMSA 2YZ7A 5AVQA 5GJCA 4DMUB 3MRSA 1J42A 3V4VB 5TF0A 1BHSA 1OXVA 1J09A 2OZPA 2NXJA 4QWWA 3S6JA 4IDDA 3VU9B 3H19A 1F9EA 1IPEA 2PDAA 4B8WA 1IM8A 4G0XA 4FLEA 1A8IA 3B6IA 4CKCB 1OX6A 1T2NA 4QYIB 3DL2A 2BKEA 2C4VA 4IJKA 5M29A 3GO4A 1I3OA 4JYZA 2HREA 4J7XA 1BVHA 3T34A 4M9SA 4DLBA 4S0XA 2M98A 3DEAA 1SGWA 4JJ7A 3AUAA 1SK9A 3HE3A 4D8VA 5K7SA 4Q93A 4HYTA 5SYAA 1QK3A 4TQGA 3W3AD 2AN9A 4O2AA 4FYXA 1E69A 1QV9A 4M98A 4N4AA 2O2IA 1T0PA 4RZUA 4F3NA 3A4NA 4EQZA 1P1CA 5KYKA 3WADA 4KMSA 4QYTA 5HOQA 1P4GA 2FQYA 4HH3C 1E1KA 3B9BA 4RD2A 4A7PA 2HDNB 2AC7A 1EFKA 5CJJA 3RYTC 3RVPA 3WFIA 4QM7A 3DYBA 4P4GA 5K6TA 3R9IA 5FEUA 5HUHA 4IJQA 4HVCA 1UDRA 3M1IA 4FU0A 4B82A 2ZIWB 2QVGA 2NU7B 3ROMA 3N2EA 2Q29A 1WCIB 1MP0A 4ZIRB 3SJAA 4EWLA 5BN5A 2EV9A 4PYMA 1V26A 1Z5NA 4X8OA 4Y2GA 4A8PA 1BX0A 2VXOA 1R8SA 3BWVA 2CD9A 1C3OA 4KMOA 3UFXB 2AZMA 3MMNA 4NENB 1TJNA 2WI8A 1WD7A 3GLKA 2O50A 4ZQIA 1DJNA 1DDGA 4W5HA 2NM0A 1L4FA 2BJVA 1RI1A 2DGDA 3MXTA 1C0KA 5CD1A 1Q6ZA 2NZJA 3EMDA 2DERA 2FQXA 4QQKA 3M6LA 4QUAA 1HNXB 5TPWB 2VG8A 2XV1A 3KTAA 3F6BX 3E58A 3IUEA 3W5SA 1KP9A 1MAUA 3VKHA 3F8TA 2UU9B 1PW5A 4LPKA 1EFRA 2MIIA 1E2PA 2ZIUB 5T67A 2DLDA 1HL3A 1CY0A 3CFYA 2H2GA 3PNVA 4Q4HA 2FEXA 4LF9B 3CVUA 1YTUA 2XAAA 3DEYX 5EMNA 1T9HA 4WBNF 5JZVA 3K8YA 3BWDD 3OF5A 2BUCA 4U4AA 2BC9A 4IQGA 1APBA 4ZCTA 8MHTA 3OCVA 4PFJA 1KETA 5JRZA 1IDOA 3L7YA 3DC2A 3G2QA 1LXCA 1X7GA 3ZK8A 4RK0A 4DCOA 1AOXA 4GRDA 3QLVC 5FA8A 3W3AA 4C04A 5DKFA 3QPCA 5DHFA 1X94A 1DWUA 3Q12A 4LMRA 4D41A 3G2OA 1T1JA 4QGBA 4XWWA 4X6LA 1SHJA 5EHZA 3OTOB 5ALFA 3D6AA 4GPAA 1XJWA 4OLJA 3KR2A 2PXXA 1IBRA 3QBTA 1NSFA 3NWOA 2Q0HA 3ASUA 5F1YA 4C9BA 4PYOA 2PUHA 2R6FA 2QSJA 2IKQA 3V4SA 2QBYA 4GPBA 3RSLA 4QOJA 5F9HA 3FRHA 2PWAA 2BT4A 1LDBA 2D2IA 2FN8A 4NFHA 1P60A 4EHHA 5DN6D 3K0CC 1GPKA 4GZ3A 3K8OE 4IDFA 1KZ4A 2CZQA 5ESXA 1CTQA 1PX0A 3PITA 3WLSA 5LR6A 1P17A 3HB9A 1M1YA 1S9DA 2CLFB 4JSYA 2Q49A 4MIOA 2Z5LA 3GCWA 3PDIB 1DEXA 5B7PA 1K7EB 3E2MA 3EBLA 3GF4A 1EXNA 5BSTA 1G6HA 2OD9A 3TBKA 3V46A 4B2PA 4ZVVA 3THWA 2P9BA 2NNLD 2OGZA 4FYWA 4WEOA 3RBVA 2ORYA 3SOPA 4ARCA 4ML3A 4JJ8A 3T5BA 5J3JA 1KHHA 1HH4A 2KS6A 3DEJA 3HGQA 3O4RA 5TX7A 3FPLA 2YHUA 1B15A 3TDNA 2VWGA 4IP0A 4DGQA 1SUDA 4B4WA 3STHA 3LHFA 5K0ZA 1WB5A 1CQJB 1JHYA 2CYAA 1XVIA 2GBIA 3GA0A 4OKNA 4HB2A 4PRKA 5B1DA 2GZ2A 3D31A 4JI5B 1C7EA 3SKVA 4F9TA 1FYVA 3NBKA 1BCRB 4FDMA 2X0DA 1QIFA 2HLNA 3RREA 3PXUA 3ZK7A 3JWPA 5CYPA 5LQNA 1G5PA 2JDIA 4FZVA 4OQNA 2ZT8A 5AHKA 2WJHA 2ZM5A 3WYGA 1FP4A 1SCDA 3IT3A 4IOJA 1G2IA 4RIHA 4ENUA 1W59A 1N7IA 3F1KA 4MIKA 4DLSA 3GEBA 2FSVC 2RKBA 4GE0A 1EFPA 4IHJA 1D7AA 2C5LA 1HDEA 1KP2A 1P1HA 2B21A 2Q2QA 2XB4A 4A0RA 3H8JA 5JALA 4N76A 3Q11A 4BP1A 5BUZA 4ZQHA 4E2XA 5IS2A 1WX1A 5D01A 1KY2A 2WWVD 4EI9A 5ALEA 3E9ZA 3EF0A 3INGA 1VGRA 2ONCA 3OFJA 3PGA1 3D8HA 3ND5A 3UV3A 1QIEA 4HEA6 1RBMA 3EQ6A 4PHGA 2XA1A 1QFSA 1IN8A 1BRTA 1DC7A 1QDLB 3CT6A 1UR5A 4J91A 5FTNA 1IMOA 4MGEA 2NPIA 2QAGA 3KEOA 3S2GA 5PNTA 3WLHA 5AM1A 1DIBA 4KNWA 1RQ2A 3A9UA 4CEHA 3TJMA 2A57A 3ZTYA 4A8TA 1SB9A 2HO5A 2Q6TA 1WZEA 3DGEC 4EBBA 1IFXA 3JTEA 1DNPA 3LUJA 4YJ3F 4AZVA 4EJ0A 5BUCA 2NSLA 1F4VA 1A5ZA 1DXQA 2ORED 3BB4A 4BFTA 5K3BA 2H2IA 1O9BA 4G4SO 4UEKA 1ES9A 5L7TA 3AM4A 2BMWA 3CM0A 3HLKA 2ZBPA 1DX4A 1ESCA 3BGDA 3L1UA 3UJHA 3C7KA 3ICWA 2OCGA 3ZJ4A 1CR0A 2W6MA 5K8UA 1DWOA 2Z56A 4MZDA 1WZNA 4RPKA 1JQJC 3G2NA 5CT4A 2E5FA 2H63A 1W52X 2DSTA 1KH3A 2WVGA 3EXG2 5TDHA 3EOAI 3V4FA 2FUEA 4TUYB 5BV0A 5KWSA 1BVUA 3OZRA 3TPZA 2W2KA 1EUZA 4YROA 2AFIB 2NUBA 2ZWIA 2ST1A 4W1RA 5J4LA 4RDHA 2D7DA 1ZFNA 3MRTA 1E92A 2RB4A 1MZVA 1DKMA 1JMVA 1ZUWA 2AR0A 2Q8QA 4M1YA 3NAGA 3LP8A 3TQSA 2H59A 1W96A 1T4MA 4KI0A 2WWFA 2FB9A 4AZTA 2GK3A 1HMPA 3E81A 1DTWB 1LWNA 1X9GA 2RHBA 4M4SA 4QYXA 3LDFA 3MWEA 3N8NA 4XGRA 3UAXA 2WJAA 4JL6A 2FPRA 4P0QB 4HZGA 4MARA 2J3IA 3O2NA 4V03A 2EBFX 5BSGA 1OZ0A 5JPCA 4KNYA 2D4HA 1K4YA 2EKQA 4AROA 4CU5A 2AZXA 2FEPA 3LXXA 2BMDA 5B3JA 1HG0A 3GPDG 4FHCA 1DX6A 1TQHA 2A0XA 3LD9A 4AP5A 1GTL1 4RV9A 3BWBA 4AYWA 1Z6TA 1JT2A 2V6BA 2C3MA 2XRMA 1MVOA 4P4TA 1JHMA 4Z86A 3FJYA 4QPCA 4TS4A 1KDYA 3S2ZA 1XNGA 3OZEA 3U3DA 4BLOA 4O1IA 4WESB 2EGGA 5AT1A 3HU2A 3MGKA 2YJ5A 2XXBA 3WWEA 5F1PA 1LFAA 2IXEA 2FOIA 5IM4A 3Q2IA 4LJLA 1F7VA 1XRPA 2HHJA 2Y3IA 5B1EA 2IGBA 3R8FA 2FWBA 2WF6A 3QNUA 3WYDA 421PA 1I3MA 2O57A 1P18A 4CKXA 1E8NA 3D8RA 5F52A 2H16A 4RQAA 3ICCA 5EHIA 1ISFA 2HQ1A 3FZGA 3GJ0A 4BIMA 1DBQA 1RM3A 2BTQA 3ZLVA 3EY4A 4YP0A 9LDBA 2RH9B 5EP3A 1CF4A 2WVJA 4B4UA 2CBGA 2G77B 4FDTA 3TDKA 3VOAA 5CNMA 1CHNA 1TNDA 2GN2A 2I87A 2IJGX 2YMPA 4O59O 5EKXA 3AVWA 5BQOA 4G5OA 1MBZA 2H4JA 1PYDA 1GSHA 4KFUA 2JZCA 4TPKA 4A10A 2G9UA 1MTOA 3B3FA 3E22A 2QSUA 2DLCX 3B5EA 3NHUA 5D6OA 3OE7D 1QV6A 4QD3A 1GPWB 4TKLA 2O9JA 4F1WA 4M0CA 1K9VF 3SZMA 1KSFX 2PU7A 5JZOA 2V7XA 2P2SA 2W6PA 3OZUA 3OQIB 2Q4EA 3HSYA 1KSHA 4G81A 4TM7A 3GAZA 3WMEA 3G49A 3TZ6A 5JEEA 2H3HA 3MLAA 1CC1S 1L4GA 1WCWA 3T3EA 1PJ4A 3B3QA 3HSSA 4LRXA 1EWTA 4JC4A 3VC2A 1J1ZA 2Z4RA 4ERNA 3ZDZB 2P2YA 3JQAD 1Y1QA 4BXOB 4IJVA 5IHPA 1DOZA 2C8LA 4TMVA 3EGOA 2X76A 2CNKA 3M4XA 5JWHA 5AW5A 4L7VA 5JO9A 2CXXA 1XEWY 2GBLC 3RUCA 2JPDA 5JR3A 1SK8A 4JBXA 2FUG1 3HVUA 4U6SA 3IVAA 4JU8A 3LCVB 1E9AA 1BXRA 4YRZA 1A3CA 1BX3A 3CINA 2ZT7A 1QH9A 1A7AA 4BN0A 5KKCA 3MMSA 4L50A 1OTYA 3JAKB 1Z25A 1POWA 3D5EA 5IKEA 5ED0A 2KHZA 1MJHA 2R6DA 2WTBA 4O4LF 3I62A 3QVWA 3T35A 1U94A 1O9GA 1U4NA 4IQ0A 5C8YA 2QB5A 4X6XA 1EFVA 1S01A 3WLRA 1L8QA 4FNMA 4OIMA 5GADl 1AO3A 1EIZA 2WMYA 3SQMA 1Y8QA 1DAFA 1HYQA 1A0OA 1WEKA 1C4WA 3DCYA 1CRZA 1GWNA 4O02B 2PSDA 5KBYA 1BYIA 1B73A 1T9AA 4KYVA 4OQEA 3OQNA 4JI8B 3U7HB 3IOMA 3FPHA 3NATA 4B09A 4QM6A 4KQIA 3PC3A 2HR1A 1BG6A 3ZTWA 1U3UA 1WU7A 1M5UA 4I1UA 4UM5A 3HCCA 3UMRA 3G89A 2BLLA 2C82A 4ARUA 5A9SA 1FMFA 5EZYB 5EIBC 3DMTA 1X8JA 2DUWA 2IGTA 1MC4A 3AJRA 3M2PA 3WBBA 3PGKA 5LD2B 1II0A 4MDFA 4GXNA 3GH3A 1L5FA 4CDGA 3H2ZA 1IOWA 4FOPA 2ET6A 2FLKA 4NI5A 3TTUA 3C3JA 4XXHA 1KWKA 2IHVA 3PF9A 4I55A 4WV3A 1XR3A 2OKGA 5BYKA 1ODTC 3CLVA 3X1ZA 3F8SA 1IHUA 2EYUA 1JVSA 3ESQA 1WLSA 3AY7A 3HUDA 1LRJA 1X2EA 2NZ8A 4NESA 4IIFA 1JIJA 1QK5A 2AXPA 2DBQA 2BP7B 1GG9A 3C1AA 3PJEA 4KODA 4OREX 4PEVA 5FYDA 3VTAA 2Y71A 3WLQA 1IZ0A 2B36A 3QE2A 3RB8A 2A78A 3IULA 4Q21A 1G0OA 4URFA 4ZVMA 1EJ0A 3JZDA 5JAMA 4NBUA 1J0CA 3A6DA 2QL9A 3DSRA 3MCZA 5IKPA 3KU1A 4BBAA 4QX6A 5I51A 4RMGA 2YIMA 3WB9A 1GUZA 1KVTA 3JZMA 3T9DA 1NIPA 1KORA 4TLAA 2D1YA 2OY0A 2QQ0A 4XLLA 2EZUA 5J2TF 2R1VA 4OK3A 1X92A 3K70B 3I6IA 1JMYA 4P2BA 3THYB 2BH2A 3HP1A 3JYHA 3L4EA 5EHXA 5HIAA 1DWPA 2YMMA 1Q15A 2B4RO 5MGBA 5D84A 3Q7QA 4P4SB 2EQBA 2JI4A 4RF3A 3A6HA 1JDPA 2E18A 2C4UA 2O2SA 1BD3A 4BXOA 4KREA 2ZVJA 3CXRA 1TVKA 3OHMA 1ENOA 1SCAA 1XZKA 1VE1A 3DKRA 3GRRA 3Q98A 4LDQA 4ZODA 1TMGE 1TUBA 4MUKA 4RJTA 1S2GA 3OLCX 3HADA 3OJWA 4LG1A 4JI1B 3U4CA 1GXSB 3EYAA 1CU1A 3RDPA 2C99A 1T3LA 1V47A 3OZTA 4UTNA 1DCFA 1MENA 2QAJA 1G42A 4C3ZA 4R3NA 5DX8A 1W1UA 4UTXA 3BJZA 1JDUA 2HC9A 1NN0A 2PGIA 1SN7A 1PBNA 3HA5A 5A06A 8ADHA 3EQ9A 2EW1A 1HG1A 1Y7IA 3QK7A 3G7UA 3PQEA 3U0VA 4EF5A 2QBYB 2V1UA 1Y6ZA 1R88A 3JXEA 1H5QA 2XDAA 1J0BA 3L6CA 3ICPA 4R7ZA 5DHAA 1T3SA 3R8XA 4AECA 4B2IA 4J9VA 2HA0A 4JT8A 4MUAA 5CDFA 1AURA 5I7WA 2Q3BA 5KTPA 4G8BA 1PL8A 4BO1A 2IDKA 2NV6A 2OVFA 3DR3A 4QSMA 1VRCA 2O0LA 4FX5A 4EO7A 3T95A 721PA 4QIHA 4BQFA 3LI2A 3WISA 4GVLA 1GL9B 2I3GA 1G20E 3JX9A 2BI7A 3L7CA 4YJ2A 1OLUA 1FNSA 2CN1A 4WA7A 4CL8A 2EX1A 4DWVA 4Y9DA 5K03A 1K7SN 3U56A 1AQJA 4QUJA 4DYVA 1J7KA 3VOSA 3TGLA 1QGUB 1SD1A 3GGDA 4NWIA 3OEEA 4IGAA 2J31A 3RSQA 3KD3A 4MSUA 3NMUF 4TKVA 3QMWA 2ZT5A 1FPMA 1X3LA 2ID4A 1SBQA 5JNLA 1G8SA 1J2YA 1KK3A 3A58B 4GX2A 1TFRA 4I5GA 1ATZA 1OHHA 4DJEC 2PUCA 5TEWA 1E63A 1Z2OX 4Q34A 1DAIA 3SF8A 3TO5A 4NZ9A 2LE0A 5E8JA 1X1TA 3RTDA 1DDOA 1T3HA 4FR0A 3Q40A 5BWCA 1E7YA 3N2GB 1B0AA 4IJWA 4LUCA 4QULA 2VTEA 5FBRB 4BLRA 1X15A 4D4HA 3QEKA 1W36C 1ZVKA 5FNVB 1QLHA 3X1KA 5JAIA 3D8NA 1IXRC 3LYLA 4ZYTA 2DQZA 1JHAA 3FYCA 3ZYCA 3CJQA 1U2RA 4IH1A 4NENA 5T4BA 4DZZA 4Q37A 2OCPA 4OX9Y 2OFWA 4PIPA 3LOUA 4KV7A 3KAQA 3SZGA 2CXUA 4WFJA 2Q5EA 4ZVLA 4DDVA 2ZUUA 2MU1A 2QAGB 4EEZA 2QG9A 4Y6LA 5DHSA 3ZKAA 1L9KA 4BBPA 3M6FA 4CMIB 1EFAA 4MVXA 4FMDF 4JVLA 5KYWA 3EYWA 4ZI5A 4IEEA 5EPUA 1BAPA 1D03A 2PGLA 2PH5A 2QTWB 4LTDA 3MLBA 4MQEA 5L3RA 3TZCA 4YMGA 3PQ7A 1ZI9A 1VFNA 4MDYA 4N65A 1J8VA 3L07A 2C5BA 4HDNA 1DKUA 2DX7A 4QRIA 5KNDH 2YWDA 1PNQA 5F9FA 4G6ZA 3W5JA 3TXYA 2OFPA 4MCJA 4O1HA 3BBLA 3A6PC 3ROEA 3BSSA 3DOJA 3C7AA 2ZRLA 4M36A 4UE3S 2OHGA 1FQJA 4Q4CA 4FOSA 3FYUA 4BPBA 3I42A 2H4XA 3LZ6A 2GNAA 3FHLA 1JJFA 4Y2QA 3UAZA 1UBUS 2P9YA 4TUYA 1Q19A 2PL3A 4W5OA 4GU5A 2AT1A 3RS8A 1C30A 1D3AA 3LFHA 4RXMA 4Q4LA 5EQJB 3FAZA 2CDAA 2VP0A 2XQJA 3B51X 1LVUA 4MR7A 4CQNA 3ZQJA 1JR6A 1SZPA 1SCUB 3AIOA 1Y89A 3V6LA 2ADMA 1A27A 4MOWA 5HR5A 4Z1MA 2IL1A 2HRCA 1SEVA 1Q44A 2IF0A 3TMKA 1U0FA 2ATIA 3ANSA 3HHPA 4QDKA 4XQ9A 5JUWA 3U6KA 1FFEA 2ECFA 4OVKA 1UAYA 3GPBA 3NB0A 4NARA 3P8ZA 5K5EA 2W6CX 1YK0A 5E7QA 1K6EA 1J2RA 1UC4B 1ZGBA 3I28A 3PZBA 5DISB 4J7UA 3Q3JB 4BLSA 4ESVA 3PUVA 4EQ6A 2QN6A 4H17A 1C5KA 2XF2A 1MB0A 2H1VA 4AKSA 3DFKA 3PGJA 4MEBA 1VHJA 2A5GA 1ZCJA 3Q85A 2Z5GA 3TTVA 1E4OA 1FK8A 4H31A 1VJCA 2YXPX 3FWYA 4GXQA 3LL7A 4JEMA 1AKTA 3G02A 3TSOA 5EEHA 4FCVA 1J1IA 5E7MA 1T0IA 4Z4CA 5IDXA 2DM6A 3KVNA 3LUFA 1SBZA 1W7AA 1Y1PA 4CLOB 2IVZA 2PWYA 1HC7A 4MRRA 4XWOA 5JNSA 4PTLA 3BXFA 1E6EA 4PZYA 1YQEA 2ZR9A 2GD0A 2Y1KA 5EPEA 4GKJB 2N46A 1E2BA 2PA3A 2D0DA 1Z39A 3KHTA 4E6EA 4E07A 1LDMA 1IZYA 2GCOA 1KJZA 1R5JA 1Q0QA 2AA3A 5AOBA 5AM4A 1FYFA 4TL6A 1NPYA 3BK7A 5CAEA 2Q5OA 3TIVA 1RYFA 3VJRA 3FTFA 4DRXB 1JNXX 1WO8A 2HA5A 4UQOA 4YK7A 2VHEA 4MCHA 4H7FA 5FL7A 3NIBA 3COWA 1U7XA 1SHLA 2H7CA 3U62A 2ZETA 5TEVA 1XG5A 1P2UA 1IOLA 1U3FA 2B61A 2ISCA 2PKEA 4Z1MD 1EVYA 3RWMB 2ADOA 1WB6A 3FCEA 3VNVA 4Y7DA 4B44A 1VM6A 4CF7A 2QUKA 4US1R 4Y67A 5AJWA 2P3QA 3L8HA 5DP1A 3WMGA 3JD0A 5AFSA 3A2KA 3EAQA 2CJXA 3M6MD 1SUFA 1FUIA 1GGHA 4RA6B 3G5MA 4U7TB 3G0BA 1L1QA 1Q3KA 2GN4A 4C87A 2RGRA 1U5CA 2QG4A 3LQ4A 3MS2A 4LJRA 1W76A 2IP1A 4K1LA 1TAHA 4IH9A 4R8KA 3KNZA 5DCUA 2CLIB 1V45E 1N8NA 2KMLA 5ENVA 1M2EA 3VR0A 5FI3A 2KJQA 3BFJA 4Q47A 5IC6A 1TEXA 1QX4A 4N8EA 4LQCA 5KWVA 3EGXA 4FXPA 3EFOB 2EJTA 5DNUA 4UBOA 2ZRJA 5E1DA 2CW5A 5EKUA 3M6UA 3BGIA 4ZV9A 1M6HA 1TGVA 2WP8J 2IYOA 4E0BA 5FWDA 1R1DA 2P9ZA 4AWBA 5AM3A 2B1QA 3PFIA 3HN2A 4V1CB 4L28A 2J9GA 4Q24A 4DY6A 4WJLA 2BWJA 3DEFA 3NGLA 1MO3A 4HAYA 3V8MA 5KTSA 4B2YA 1MIOB 2I8CA 4TKZA 2I8LA 1RM0A 3ES9A 3O4JA 1TM3E 3UOWA 1U80A 4BB5A 1WW8A 1H1DA 1AKQA 1NBMD 2XRFA 1J22A 4X92A 2Z0MA 1FJ2A 1JSLA 4NJEB 1KXZA 1YU9A 5JYEA 4W5TA 1IN4A 4KCGA 4U0KA 1SHZA 3DZKA 3ZHSA 1EFRD 4NBKA 4U39A 5HA5A 2FGKA 4NAUA 4QGHA 1C29B 1TIKA 3EOZA 4WOBA 3SGLA 4AJHA 4KYIB 4YMLA 2VHWA 1DAPA 4HNSA 3HBAA 1O95C 3AETA 3TF5A 4B3IA 3TD2A 3OFKA 3RIGA 1PVOA 3VSEA 1PGQA 2B8EA 4PLTA 4TTRA 1J2TA 2QYSA 1DKRA 5BPHA 3LWBA 2QWXA 5J1TB 5CYGA 3TECE 2HDHA 1D8AA 1ECPA 4U5QA 4U6NA 3SX4A 3QZUA 4CV2A 4N54A 2GDJA 5LLTA 2ZSAA 1ODFA 4EATA 1VE5A 2YXNA 3UGTA 1N2CB 2ODAA 1KRWA 3EFHA 4F7WA 1RM4A 4DLKA 1I30A 2QK4A 3QF4A 1TU3A 3OC0A 3KTFA 2QORA 4OHVA 4UM7A 4M0EA 3AY6A 1EE9A 3I3OA 1H69A 3OLYA 1CUXA 4UEJA 4AKIA 4QODA 3H2HA 2ZDHA 1R0RE 4NX2A 2BTQB 3WFJA 5ADVA 1TU4A 5I7FA 1FQKA 2Y1WA 3WKAA 5JADA 2ODQA 3CNBA 3VO8A 3IPRA 3K96A 3O3OB 4MA4A 4RHTA 3UQZA 4OQYA 5AKXA 4PSDA 1ZVMA 2W37A 3FG9A 4INJA 2FWRA 1W4BA 1FY2A 1QB7A 1KBZA 3DL4A 5CB8A 2ZBFA 4M0PA 2E0IA 2BHRA 2IF2A 1NM5A 2J5RA 2IITA 2Q6OA 1G6Q1 1ICIA 2QQGA 1U7DA 3JQ8A 1J4AA 2FWJA 2H31A 3M33A 5KTKA 5K0JA 2Q9BA 5C7IO 2HU5A 2QD5A 1ISRA 4UDYX 3LP6A 1AKUA 2GPJA 1VRVA 4TMFA 5D1HA 3FVWA 1GKYA 4B3JA 1HR0B 2P9GA 5ALRA 3UYLA 1CUHA 4NBTA 3MUFA 1S1MA 3IMEA 4KWTA 4MR8A 4X41A 3CPEA 3TL3A 2OPBA 2V54A 4FFVA 1GA6A 3GP8A 1RLOA 2WUWE 4M7WA 5BWMA 4HSEA 1UDBA 1QGAA 3K9LA 3IV9A 5CM9C 3LHKA 4WBSA 5CFPA 3IBSA 1IJKA 2C4HA 1W1WA 3KKOA 3H7IA 3HPRA 2E85A 5E1MA 1TXGA 4NKRA 4RD4A 2QM0A 2HEIA 3MMZA 5CPBA 2BM1A 4OL0A 4KSYA 2MYPA 1PL6A 2BOVA 4HMPA 4MYUA 3B9RA 2OBNA 4JBWA 1GQRA 1ISJA 3RIXA 3REQA 3KQSA 1P39A 3CLUD 2LIPA 3GLHA 1NQXA 4YCAA 1L5LA 2OK7A 3CO5A 4ER3A 2XE8A 2ZTHA 4FZ5A 3C6MA 5U9CA 2RGBA 3A6JA 3D6HA 5B30A 2WWRA 5J58A 5IJ0B 1TK2A 1F48A 1KKMA 5CVEA 3O8OA 1T1IA 3SHTA 3TLAA 4LQLA 4WDRA 1FX0B 3DHEA 3GROA 3MAGA 4ZRDA 4BECA 2J4DA 4E5UA 5KREA 1P7ZA 1V1MB 5GINE 1U6IA 4RACA 1AXGA 4EFKA 2QI9F 3FTCA 3OO0A 1YVPA 4BNGA 1OGIA 4DVJA 4BQNA 1W73A 3HFJA 5F12A 4Q5IA 4Y2JA 2YHSA 5COAA 2VI5A 2YASA 5EXEA 5HDQA 4DHEA 4B2LA 2RAPA 4TV9B 1BGVA 5FTWA 5ICFA 3W8RA 1W5BA 3V3TA 3WGHA 3BFXA 2P1DA 4GZ5A 1P8AA 1USIA 3PRJA 1OLOA 1SIBE 3NYQA 3PNKA 2CJYA 2HBZA 1JAHA 4KKVA 3HJAA 1E79D 1A9XA 2GCIA 2GEUA 2NW6A 3KHKA 4E4YA 2GILA 4Q3KA 5FR2A 3HCPA 3LGAA 4OGKA 3VDRA 2WTXA 4ZT7A 2J3KA 3BTVA 4B6SA 1GPAA 4RTMA 4R0NA 2X9LA 5KSPA 4K6MA 3ZN2A 1KH2A 4CEHB 2JBAA 3DONA 3GMSA 4M1QA 1C1HA 2IOFK 3L0DA 3SDZA 4JMPA 5HMMA 4B6OA 4ZTZB 4KN6A 1NUTA 2QKYA 3RBAA 4QHYA 2PFKA 3B8EA 5SICE 1IJBA 1JLLB 1TZJA 1NF8A 1EFUA 5FWNA 3ZD6A 1KQPA 2ORVA 2Y1FA 3CRW1 4G5GA 1Y48E 1PNVA 4O63O 4PFKA 3UK0A 3W7VA 3KETA 3B1ZA 3UKOA 1N0VC 1XEWX 2ZOSA 3H8VA 4KQCA 4R3UC 5C53B 1FFXA 2VYND 3WLOA 1XDBA 2IFTA 4FMPA 1R6DA 3ED5A 2PJZA 2JCSA 5T4FA 4E94A 5TJ9A 2GUGA 1JDNA 2CNOA 2C9DA 2VXCA 3HR7A 1PR9A 5TS2A 3SC2A 4Y1FA 5ALUA 4XLZA 1MO5A 2BY4A 4JYMA 4CV1A 3R4CA 4HQKA 2GWHA 3OJFA 4R1LA 4C4SA 4D8XA 4Q7MB 5A5FA 4CM8B 1ULTA 4A27A 4BATA 4NFSA 4UMVA 5E8RA 4E1VA 3C6XA 4DFDA 1NW7A 4X3PA 1L1FA 4DB2A 4U2FA 1CERA 4UOZA 5H9WA 3B1KA 4YLGA 5LA6B 5KEIA 3JD3A 2REQA 3PYXA 2GKSA 3L7BA 3A2NA 5D5HA 4ARBA 1UCFA 2ZBEA 3Q0EA 4TS3A 1IHPA 2ACKA 2CCKA 5CA0B 1VMKA 4XWTA 5AYVA 4I19A 5FH9A 4ZZIA 2Q1UA 2XYGA 4OLAA 5TS3A 3BB1A 4QICA 4OFBA 1U2TA 2YJNA 3ESAA 1UWCA 1YKGA 3DVRX 1HORA 4L8YA 1WSAA 2PX3A 2W6OA 2P77A 1T43A 3EUFA 1PT9A 4H16A 1T8UA 3EPHA 1SUIA 1SURA 4EGSA 2Q1XA 5AKYA 1P19A 2K4MA 3JCZA 1M3SA 4E1AA 5I45A 1NI5A 1PDWA 5CXQA 1Z5GA 5JQWA 1W36B 3T4PA 2OAEA 3KJHA 3AF6A 5K3OA 2YZMA 2ZIEA 1L4NA 1Z74A 3RU7A 3VYWA 2GTHA 3DE1X 2W2VA 4O4IF 4GWLA 1XSEA 1KYQA 1QZTA 2F59A 2GZRA 2QY6A 2ZANA 1VIMA 1A1SA 2QUJA 2X0RA 2Y99A 3KOYA 4FKZA 4ZOAA 4DSUA 3CH6A 2QDXA 4K0RA 1MU0A 3ANMA 3RS0A 4BMOB 4DG5A 4XB1A 3PE3A 1Z2DA 5E2IA 2IY7A 4J7AA 4MCAA 2ZUEA 2HXSA 2O8CB 1IJEA 4P83A 3EUAA 1OVGA 3ZVMA 1QR2A 2LDBA 3UFXA 3Q7RA 4KSBA 4QJ5A 2DHEA 3KFVA 4NYMQ 3ZZ0A 1ISHA 1HZZC 1XZLA 4BMPB 1Q74A 2QTHA 3CSUA 2FAXA 4Y1GA 4YJDA 3T52A 3R6TA 1QVRA 3ZU6A 3OMXA 2WD8A 3EEFA 3EGVA 4NOMA 5DNAA 3O9VA 1H2BA 3N70A 4U3JB 1D4OA 1YHZA 2HXGA 3RRMA 1Y1KE 4LMAA 3UK2A 1M2HA 2QX7A 1QP0A 4KH0A 2FN7A 1NT2A 3USCS 4AQ7A 1HQDA 2HSDA 2XSZA 4QYSA 4UNQA 2O23A 4Y0VA 5CLFA 5FAKA 1QYWA 2D5LA 3DMFA 1OIWA 2BTOA 3OP1A 3OPNA 2WOOA 4D44A 4U9HS 4XSVA 4E7OA 4D9NA 2JI8A 3HZHA 3P9RA 1I1HA 4UQPA 4BO0A 3P2OA 1OC2A 1CNFA 2X3YA 3ZNQA 3KB6A 3PP8A 4FK8A 4PFSA 2OECA 1YR2A 1ECBA 4ZD6A 4KO8A 2G72A 3AUJB 3MAJA 3B12A 3S70A 3HU1A 1H2AS 1ESZA 2C2HA 3AVQA 2VPTA 4GOLD 4GOOD 3RVBA 1Q0LA 2OO7A 1E2EA 2IU6A 4MW0A 3AMVA 1GNPA 4HWGA 4DUYB 3GJSA 5C5IA 2PR2A 4HGQA 3SCZA 3QLUA 4LHWA 4P80A 3SEAA 4QBGB 1UXIA 2IKSA 1EK2A 3OZIA 4MV1A 3TSAA 1FC0A 4OQXA 2C88A 4S24A 4URXR 1JFTA 3FNHA 3BH6A 1E5XA 1TK3A 4KHZA 1P0FA 3K94A 4EO4A 4JOCA 4CHGA 4GYKA 2QTFA 1I1OA 4EY7A 2P9CA 1VLQA 1FYXA 1FFHA 1R0YA 4CLXA 5LXTB 3FNEA 5AKZA 2GK7A 1ZGJA 1X0VA 4NH4A 2FZ5A 3H3XA 4NYMR 4Y1RA 2W70A 2Y2VA 1XDWA 4J0QA 4FEYA 3TE7A 3U16A 3Q3EA 1NP7A 2HHAA 4ENQA 1H8EA 3DHWC 4E31A 4N7JA 1QGED 3DZ8A 4C05A 1TCCA 4G5XA 3H1PA 3I2JA 4UOQA 2GKGA 4DAEA 4LHZA 3FF4A 4DE5A 4JR2A 4Q18A 3JQGB 4LGVA 4LY9A 1N5OX 2GVDC 3BIFA 3EGXB 3KKZA 4URZR 3ER6A 4CFZA 3OZSA 1C81A 5J2UA 2Z6AA 3ZU4A 3L93A 5ALYA 3V1MA 3BE5A 4DQVA 1FS4A 1CEQA 1PGJA 2O6HA 3SBOA 2J30A 2KSQA 3WGJA 4I1YA 5HYVA 3WGUA 5BORA 2WFLA 1M34A 4CUJA 5LP6F 5JAOA 4NU0A 3T4UA 4V3CA 1KL7A 4MS1B 4KU4A 1NWHA 4Q3AA 2W83A 2JJ1A 1G8JA 5KHAA 2GZ1A 1XRQA 1IU9A 1RQ7A 1F38A 1P0CA 2QI9C 1WMFA 3PQFA 1YVDA 2AG8A 1FP4B 2MYNA 1L8LA 4H59A 2ARKA 3IYLW 5BSMA 3A6EA 3IXMA 3FPCA 3LPMA 4EHKA 3TBHA 5IF3A 1C3LA 5CDYA 1N3YA 1J6UA 4KAXA 2PTGA 1CBUA 1PE0A 2E6KA 3ZIDA 1NV9A 4AF7A 2GM9A 1VBFA 4B71A 1BHJA 1UDWA 3KZMA 5TT1A 3TQFA 1U2DA 1MOSA 3C3KA 5K45A 5KWJA 1MC8A 1SKYB 1E9SA 2PTHA 1EMDA 4CU2A 6CHYA 3I5XA 1ZIOA 4G0YA 4X5OA 1I7PA 1P74A 2BFOA 4ND8B 3IUYA 2AD5A 5BOSA 5CJ2A 1ZH8A 2BGLA 4KZPA 2WTNA 1U6JA 4Y7CA 3SR3A 1E4VA 1E3LA 3FOZA 1EP2B 4MVJP 4O4JF 3U40A 3VX4A 1YUBA 3DQQA 4GI3A 5LP1A 1H8ED 2HK9A 4G1MB 3V6MA 2K5UA 1N9GA 2ZJ3A 4AZWA 1J2EA 2DULA 2AFIE 4PBTA 3Q4GA 2ZIFA 1X1BA 1BXKA 5BUQA 4QGSA 1QO7A 3ADOA 5L7YA 1CKEA 3E0XA 1SC1A 3PJRA 1JKMA 2INGX 5DCWA 3ZXIA 1IQUA 1UXHA 3AG5A 5FV4A 4BNYA 1TF5A 4M1KA 2DH5A 5IH7A 2K2WA 1P2SA 4MQMA 1DG1G 4I1RA 4Q4AA 4LC1A 3NHBA 2C2WA 1K1EA 2UZ3A 3H9UA 1FVHA 2OL4A 3GFFA 9ABPA 4I08A 2HSGA 1US8A 3SVLA 5DBFA 1CY2A 4RZXA 4IS3A 2VT3A 1RBYA 2NSDA 1L7VC 3KTDA 1VIVA 1Z12A 2X8LA 3LT2A 2HPHA 3EXIA 4KUGA 4ZGBA 3GLGE 1HYHA 3T7RA 4RKWA