2ZLBA

Crystal structure of apo form of rat catechol-o-methyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
212
structure length
212
Chain Sequence
b'DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 72
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zlbA00
3C3PA 3DMGA 5K8VA 3LBYA 2QRVA 2GB4A 4YMGA 4FSDA 3R9XB 3G7UA 1X1CA 2H1RA 1RJGA 4E31A 2PXCA 3KHKA 5DX0A 4ISCA 5K09A 3CJQA 3TLJA 2ADMA 4MQ4A 4AZTA 3NDJA 1SUSA 3HA3A 5CVVA 2PX5A 3TMAA 2PX2A 3FUVA 4R8SA 1QAMA 1RI5A 4C07A 4F86A 3UJ6A 4AUKA 4V0QA 5LQAA 1ORIA 3CC8A 5DXAA 4K6MA 3PX3A 2AOXA 4YUWA 2XBMA 5IH3A 2I62A 4WVLA 1X1BA 2YX1A 3O31A 3TOSA 4RVGA 5HZMA 5LQKA 5CCXA 1JG2A 2PX8A 1IY9A 3TKYA 3ELWA 2OKCA 2NXCA 2ZLBA 4LG1A 3DLIA 2GPYA 3O4FA 4R8RA 3NJRA 5JUWA 5DM4A 3GU3A 5KS2A 3U81A 2ZULA 5K0CA 4Z2YA 5DM1A 3OU2A 1VL5A 4FSXA 4RSRA 4PYLA 2HMYB 2ZW9A 5E1DA 2YTZA 4DCGA 2VDWA 4FR0A 4PGGA 5ICEA 4OBXA 1NW8A 4P7GA 5CVEA 2G72A 3B7PA 4EK9A 3JWIA 3S68A 4RTKA 2VDVE 2VDUE 1JG3A 2PJDA 2Z6UA 1ZHFA 2IDJA 4M38A 4HGZA 3PT9A 5EIWA 3E7PA 3CKKA 1KHHA 3KPYA 3VC2A 1R00A 3BWCA 3MTEA 3V8VA 4B17A 4BLVA 3VSEA 2ERCA 3IYLW 2I6GA 5E1OA 5GINE 4R6XA 2PXAA 5BP7A 3SSMA 4KWCA 2OXTA 2OPBA 4ZTBA 3BXOA 1XDSA 4LWOA 5F2NA 9MHTA 3NMUF 2P7IA 2OBFA 3OFKA 5EOVA 3LDFA 3M4XA 5E1BA 5F2KA 3UJDA 2IFTA 1P1CA 4E2XA 5HOQA 2QM3A 3C3YA 1RI2A 3EPPA 3NTVA 3FUWA 3HP7A 4E30A 3DXYA 3UBTA 1KIAA 1G60A 4MTLA 3HCBA 2P1DA 4RV9A 2AOUA 3CGGA 3GDHA 1SG9A 5DTQA 5E9JA 4AX8A 3KQQA 1MJFA 3B3JA 3KQPA 2Z6AA 1RJFA 1AF7A 3FUXA 3NWEA 3PVCA 1SQFA 4LECA 2ESRA 5DX8A 4YUXA 2HR1A 5K01A 2R6ZA 4ER7A 1I9GA 2WA2A 3UFBA 3MHTA 3GNLA 2FK7A 1I4WA 1ORHA 5DM0A 5K0BA 1T43A 5EHIA 1NV8A 2ZCJA 3AXSA 4PINA 2JJQA 5P8WA 2CL5A 2PX4A 2ZIFA 3BWBA 1JSZA 4GUAA 3ERCA 1L1EA 2AVNA 3GCZA 3HNRA 2ZZKA 4C03A 4MHTA 3FYDA 2I7CA 2PKWA 4EMSA 3NVKI 5EQJB 3KR2A 3AJDA 3K0BA 1RJEA 4RVDA 2G1PA 4P7FA 1KPIA 2FRXA 2B2CA 2OY0A 2FYTA 4PYNA 2AOWA 2BZGA 4JXJA 4PIMA 5CUQA 3T7TA 5DRTA 3KPJA 3M6XA 3A4TA 4X61A 2FCAA 2HTEA 2AS0A 3QOXA 1XDZA 3P97A 3UJ7A 3PLAE 2PWYA 1RI1A 2A14A 1Y8CA 2NYUA 2JH8A 3KQYA 1NW5A 1P39A 2B9EA 1NBIA 3E05A 3EVDA 4RTLA 1Z3CA 5EEHA 2BM9A 2PLWA 3B3GA 3KPWA 5K03A 3UJ8A 1YZHA 2OYRA 4F84A 5ICGA 2P8JA 2PVCA 5GIOE 2O05A 3P71T 3T7RA 5LQNA 2H11A 1L3CA 3LDUA 5DT2A 3ELDA 3FPHA 2AR0A 2CKDA 1G6Q1 1R6AA 1XJ5A 2F8LA 3A27A 3I53A 3KQWA 5DM2A 4Y2HA 1TW3A 5FCDA 1L9KA 5EMKA 2B78A 4DA4A 4KW7A 3G8AA 3BT7A 5EKXA 3LGAA 1WS6A 1AQJA 1YFLA 3LCCA 4GOLD 2UYOA 1ZKDA 2PV0A 2Y1WA 3FPGA 3FYCA 3C6KA 4FP9A 3HM2A 1QAOA 2OO3A 1SQGA 1N2XA 2I9KA 3M6VA 5FUBA 4U7PB 3NVMB 5GM1A 2VZ9A 2IP2A 3LECA 3OU7A 5EKUA 4FT2A 3SXJA 4DCMA 4OX9Y 2NP6A 3P9NA 2ZVJA 5BW5A 4PNEA 1WZNA 5LQRA 3FRIA 4BY9E 3GGDA 3LCVB 2CWWA 1JQEA 3UA4A 4RTQA 5BW4A 1IM8A 3HCAA 4QQKA 3BZBA 2JH9A 5HIJA 4HC4A 2H00A 4AZVA 5ICCA 2PGXA 3FZGA 5FHQA 1WXWA 2DULA 3G2MA 3OFJA 3LX6A 2UYCA 3PX2A 3FTDA 5LQUA 4CXMA 3ORHA 4RX1A 5FA5A 10MHA 2CMHA 3OPNA 3MB5A 2AOTB 4YV2A 4PONA 3EEYA 5FQNA 3SMQA 4U7TB 4GC5A 2YVLA 3BWYA 3M70A 3GRRA 2C7RA 3OZTA 3SSNA 5DWQA 2IH2A 5BXYA 1B42A 4PYOA 1XXLA 4QQNA 3G2PA 4PCAA 4PYIA 3DUWA 2P35A 1L3BA 4RTSA 3DR5A 2FHPA 5EEGA 4PYMA 3THSA 2C7OA 2UYQA 1VPTA 2ZIEA 3I64A 1R8XA 4GEKA 2ZSUA 3DMHA 4Y30A 3TM5A 3GWZA 5B1SA 1X1AA 4DF3A 4HTFA 3HVJA 2DPMA 5FULA 4CKCA 4E32A 5CD1A 4X41A 5K0JA 1ZGAA 2E5WA 3KQTA 2YXLA 5EG5A 1VLMA 1BOOA 2QRVB 4IV8A 1R74A 4WXHA 2LD4A 3SX0A 3LKDA 1BKYA 3R3HA 4UOEA 3MTIA 3HCEA 4QDJA 5DRYA 3TKAA 1EAMA 5GM2A 1D2HA 5KQSA 2JG3A 1NT2A 3P2KA 1QANA 5KVAA 5E9QA 5D1NA 1KYZA 3PFGA 1NW7A 4X60A 3LHDA 5E8JA 4E33A 3EVCA 4PCLA 5C1IA 1WG8A 4DKJA 3MCZA 5EMJA 1F3LA 1QZZA 2K4MA 3BWMA 3FUTA 3M6UA 4YV0A 2UYHA 4BLUA 4YMHA 5K05A 1D2CA 2NP7A 3EMBA 2FPOA 4HG2A 2IBSA 3IV6A 4E70A 3KR9A 4OA8A 1H1DA 1XTPA 2P7HA 2YXEA 5FWAA 2P40A 4A6DA 3DP7A 4P7KA 3AXTA 1TW2A 2C7PA 5MHTA 3FTEA 3Q7EA 4PGHA 2VP3A 2YQZA 4GOOD 3HEMA 5CCBA 4IWNA 1UFKA 1BHJA 3B5IA 3KPVA 3B3FA 2N47A 3CBGA 3EGIA 3KQOA 3CJTA 4G56A 4QPNA 5EPEA 2EX4A 2IDKA 2ONYA 4KDRA 5FTWA 4R05A 3MGGA 3SSOA 1IXKA 4O29A 4PWYA 4XUCA 3UWPA 5K0GA 1ZGJA 3A7EA 3I58A 1NBHA 2PXXA 3AY0A 1JR4A 3REOA 3V97A 5E2BA 1KXZA 5M5BA 5DLYA 3A7DA 5K0FA 3SVZA 1X1DA 5FHRA 3TFWA 3G89A 3OE4A 4IV0A 2EFJA 3LBFA 5DTMA 4AZSA 4DQ0A 4RVHA 1R18A 2BM8A 4ATNA 3KQMA 1ZQ9A 3GJYA 4PYKA 4QDKA 4CTJA 5EMMA 2C7QA 2PT6A 2BR3A 3P2EA 1XCJA 5FADA 3F4KA 3CJRA 1BC5A 5K0LA 3X0DA 3DH0A 3G5TA 4YUYA 1VQ1A 1WY7A 5ERGB 2AOUB 2QYOA 3TRKA 1M6YA 4POOA 2XYVA 3P9KA 3P9IA 4V0RA 5GP1A 2ZZMA 4KIFA 2AOVA 3LKZA 3FPJA 3NWBA 3P9CA 2V74B 4RTPA 2P3QA 3BGVA 4NECA 1L3IA 2ZIGA 3KU1A 1QYRA 2R3SA 4ER6A 5E2AA 1O54A 3G5LA 4E2YA 1XDUA 4F85A 5U4XA 3KR1A 3FPFA 2O07A 3PB3A 4KIGA 3C0KA 5G02A 5HILA 2PY6A 3BKXA 3FUUA 3LL7A 3UA3A 1O9GA 3ID6C 2XYRA 2NXEA 3LDGA 5JR3A 4RYLA 4FS8A 2EJUA 4LWPA 3EGVA 3GRVA 4QTTB 4GQBA 3OE5A 3GRZA 3RW9A 3T7SA 4GC9A 4C05A 3R24A 2G70A 2XYQA 4X1OA 3P8ZA 3PS9A 3HVHA 2BR4A 1INLA 5EIFA 3MAGA 4FT4A 4FZVA 3PFHA 4EKGA 3FPEA 1UWVA 3EVEA 3SR4A 1PRYA 2G71A 2ONZA 3TM4A 3HA7A 4OA5A 3GO4A 1YB2A 4M7RA 1DL5A 4EKIA 4RTMA 3NDIA 2BH2A 1DCTA 1JG4A 1HMYA 4XCXA 4KDCA 3VYWA 1RJDA 5K0EA 4PYQA 2NNWB 1OR8A 3HVIA 3EMDA 1FP2A 2OB2A 4CKBA 3G2QA 4XUEA 2P41A 3IEIA 5EHGA 1NKVA 3KKZA 5E8RA 3E23A 4BP1A 2O0LA 1N7JA 3FRHA 2QY6A 1VBFA 5HIKA 3HTXA 2G8NA 1N7IA 5KQRA 2GA9A 2GS9A 2YR0A 3OZSA 1UIRA 2HV9A 4GBED 4XUDA 5HFJA 5T64A 3SGLA 4C4AA 3ER9A 2XVAA 1HNNA 5IKMA 3PTAA 1ZG3A 5GIPE 3GIWA 4RTOA 4QTUB 2O06A 4KRGA 3CVOA 3SM3A 3EEOA 2ZBQA 3A26A 1XVAA 7MHTA 3D2LA 2JHCA 4QVGA 3RIEA 2ZTHA 1PJZA 3ANXA 5DPMA 5EZQA 4OQEA 3TQSA 5T67A 3OCJA 4YV1A 4CWAA 3G88A 4HSGA 3M6WA 2ZBPA 4GOND 1KR5A 3AWIA 2KW5A 4DZRA 3MCTA 4OQDA 5DXJA 5LR6A 2ZWVA 3L8DA 3R0QA 3JWGA 4M37A 4OBWA 3EVGA 1O9HA 1KP9A 2O57A 4ER5A 5FWDA 3GRUA 1XCLA 1EG2A 3DXXA 2BR5A 2EJTA 3ME5A 3WSTA 1VIDA 4HGYA 3NW9A 3MQ2A 4GOMD 3TPZA 3JWHA 1P1BA 4MIKA 2JHPA 3UJ9A 3E8SA 5E9WA 3K6RA 1JTEA 5HIMA 5HEKA 4RTRA 2ZWAA 2Z6QA 4E2WA 5ICFA 4M36A 3H2BA 3QV2A 2HWKA 3DULA 5DTRA 5GOZA 2PSSA 5T6BA 3MERA 3R6TA 3UZUA 1YFJA 1EQAA 1V39A 3I9FA 4MWZA 1AQIA 4H0NA 5GWXA 5K0NA 1RI3A 1U2ZA 2OB1A 2FK8A 2HNKA 2WK1A 3BGIA 3G2OA 2GLUA 3DMFA 1FPQA 1RI4A 2PBFA 2QE6A 3DXZA 5EZSA 4RTJA 1YF3A 4PIPA 3GRYA 4HH4A 1JQDA 4HTFB 1SUIA 2IH4A 1G8AA 2AN3A 3EVBA 1KPHA 3EVZA 2NXJA 3Q87B 4QVKA 3B89A 3QOWA 2IH5A 2ZBRA 5FQOA 1KPGA 3KPUA 5C9ZA 1JG1A 1M0EA 3KQSA 4DM3A 2IGTA 3BKWA 4BLWA 3HA5A 3T0IA 1M6EX 3KR0A 1YZ3A 3JWJA 2OZVA 1JTFA 2WA1A 3EGEA 3DOUA 2UZ4A 1NV9A 2Y1XA 4KVZA 4FGZA 4R6WA 4L7VA 3A25A 3I5UA 1NW6A 3EVFA 3UJAA 4EVIA 1EJ0A 3KQVA 2IIPA 1JSXA 1MHTA 1JQ3A 2PWPA 3UJCA 3HCCA 4RTNA 1G38A 2ZZNA 1KYWA 4C08A 4DMGA 3BGDA 1FJXA 3C6MA 1F38A 2Q41A 1VP3A 4RWZA 2EG5A 4X63A 5LSAA 3G8BA 5DSXA 5DX1A 1SVUA 2GAFA 3ELYA 3THRA 3HVKA 4PYJA 5CVUA 5KYGA 3LCUA 2P3OA 3TR6A 5H02A 2NXNA 2AVDA 4P58A 1TPYA 5EC8A 3BUSA 1NE2A 2IPXA 5D1HA 4E2ZA 4A6EA 1FBNA 4GF5A 4ER0A 2P3LA 2YUIA 3FTCA 4P7JA 2AZTA 1EIZA 1AV6A 1VE3A 1WXXA 3DLCA 5EVJA 4C06A 1Q0TA 1Q0SA 3ER8A 4EQZA 3GXOA 4CTKA 5CVJA 1EJ6A 2YXDA 2B25A 3O7WA 2VS1A 4ER3A 2CMGA 1P91A 3HCDA 3OU6A 2AOTA 3IHTA 4RVFA 5EMLA 1DUSA 2JHAA 3P2IA 3VC1A 3HCFA 3DTNA 4YUZA 5LQJA 2ZFUA 3ELUA 3LSTA 1FP1D 2B3TA 5CIYA 2AN4A 1YUBA 3FTFA 4HRAA 4C04A 2AN5A 3UJBA 4CKEA 2V7EA 3M33A 4QPPA 4BP3A 1X19A 5C0OE 1D2GA 1G8SA 1VP9A 3CCFA 4YUVA 3EVAA 1G55A 8MHTA 3OZRA 2GH1A 5DSTA 1R8YA 2XVMA 5E1MA 1SKMA 5FA8A 5EGSA 2IBTA 2ORED 3LPMA 5HIIA 5LQCA 4AZWA 5F2OA 5CM2Z 3RODA 1QAQA 5CVDA 4IKPA 1I1NA 2PT9A 1NW3A
chains in the Genus database with same CATH superfamily
3DM9B 3FWPA 2FJPA 4TL6A 5JNRA 1MFZA 2W6JA 3D6AA 3IQXA 4YP1A 1Z45A 2HPZA 2PXCA 1I4TD 2R1UA 2O2HA 1P80A 3GHYA 1YJ5A 2IKQA 2HYIC 3HA3A 5CFMA 1FUIA 1MW9X 3TFQA 5IG2A 4DV0B 4DA6A 4I4TF 4EB6A 4M8KA 1NMQA 4NNOA 5AWFC 4HPWA 3JPWA 2P5YA 3BZUA 2I2XB 1RACA 3P9RA 4QRIA 3WYBA 2C9YA 4Q9JA 1RRCA 2XNCA 1XZNA 1IM2A 2FUG1 4D4JA 1N2GA 4L8FA 1R50A 3SEAA 1E2NA 4GOXA 1H0HA 3AP2A 2ZYDA 3NJRA 1MOPA 2YV1A 4BEVA 5JUWA 3HZOA 3PG5A 4P31A 4HO1X 3I3SR 1JILA 2BKUA 5A3SA 4EYOA 1K86A 1YCHA 1C2TA 2A7QA 3ZU6A 5IHXA 3VU9A 3GNSA 3FOCA 3E9EA 3DVLA 4IRUB 4BJHB 4PGGA 1PX2A 1YQWA 2AW3A 3F96A 2XZLA 1GTVA 4RXMA 4J6EA 4Q66C 4Y3UA 5JNLA 4NXNB 3GNQA 3OC0A 4CZ2A 4TMXA 5K0SA 1VPDA 4XOUA 4IIVA 4Z3DA 3RBAA 3GLQA 3ZDZB 1U1FA 2Z5GA 5IKMA 2O8CA 2GT1A 5FEMA 1ZQ1A 3KYJB 5LC1A 3AVQA 3F3SA 5DH9A 2PZBA 1KHHA 2NVUB 4KK4A 1TUIA 2Q3BA 2C3YA 3NKFA 4YRZA 3F5QA 3GCDA 4BO8A 1B14A 2WKWA 5MDHA 3U7GA 2I7TA 1NFQA 5JMWA 1WEKA 1T4CA 1ZD1A 2ZYSA 3VJLA 2XB4A 4PM4A 3V42A 1XDSA 5CT9A 5D7NA 5HF5A 4P5DA 1EHCA 4BXOB 2YCBA 3SC6A 1UKVY 3RRJA 3CKYA 1XZBA 3LO8A 3PJEA 4ISBA 5GJBA 1Y5LA 1VE7A 2QPOA 3KEMA 5EZYF 4ZYXA 1DAHA 1SURA 3IIMA 1E2KA 3OE7A 3T7IA 821PA 4ARVA 1XCPA 2GEJA 4BAGA 5KPJA 3IQIX 3K32A 1M72A 4B33A 1E9FA 1NJFA 1P2SA 2PVPA 4RF4A 2H1FA 2RI6A 2QROA 1NKTA 1FS5A 1DAEA 2HA5A 4W8GA 4LVCA 1RZUA 3HK2A 1M66A 3T3OA 2HBQA 2JI9A 5IJ9A 4YRAA 2JIDA 4IXDA 4BX8A 1HNWB 1XD9A 5F78A 2PX0A 4L2IB 5K4AA 2I99A 3WGQA 1QDEA 3RS0A 3BBPA 3T3GA 2WYWA 5IBPA 3TLXA 1T2FA 1ULZA 2P77A 2Z1MA 3DGEC 1I2ZA 2L69A 2ZIFA 4WXEA 3WOHA 2GZ1A 1ZRMA 3HUFA 3IO5A 5FXMA 2PLFA 4OOFA 2FXVA 2H0RA 3ZWDA 4ECAA 6ADHA 3HNRA 4C03A 2ZZKA 4IIGA 1VBKA 2X8WA 2IPNA 4OHCA 5DLEA 3EZ2A 3PUJA 3T3MB 3ZQ6A 1IE3A 4UNIA 1DOAA 4P7FA 1GQ2A 1H3FA 3AC0A 4FJ0A 1ND6A 4KYVA 2FOXA 3GMSA 3H2YA 4B34A 3IVAA 5KUTA 3CKMA 5C7YA 3B9QA 4LCEA 2IYAA 5CPFA 4XQ0A 2AI3A 2XGSA 3H1TA 1Y5RA 2FCAA 4ON9A 4X61A 2PBRA 3HJAA 4HUJA 4G5GA 1YI0A 5ALMA 4U7GA 2NYUA 1WCIB 2XCUA 2P27A 4RS3A 4YQEA 1P39A 2BFBB 1SUWA 1VXOA 3GL9A 4ZCPA 3W9YA 4CM7A 3Q2OA 5C5IA 3VNRA 5EEHA 3NALA 2QJFA 4FCWA 4RSGA 4B3MB 1KZ9A 3CLSD 1JLKA 2H2GA 2Z9CA 3PC4A 1MJNA 2NNLD 3IH5A 4CKZA 2UXCB 4D97A 3ER6A 4LHZA 4YJ3F 5HE9A 3IBFA 1C3OA 3FYUC 1XDWA 2ZRLA 1K7SN 2YS7A 4Y2YA 1G6Q1 1B6SA 1R6AA 2PMKA 2QY9A 1BQEA 2EP7A 2A5FA 4EVIA 4DA4A 2DXIA 5EMKA 4KIJA 3ANLA 1MKYA 1R8SA 3LGAA 1BHO1 3FDJA 4S0XA 3IILA 2ZYGA 2OO5C 2B8NA 4FBGA 4PHFA 4J2TA 2YWJA 5DBFA 1IY2A 1OFUX 5I47A 1HYGA 1QOPB 1PE0A 2VRCD 3T4XA 1OLXA 1JG7A 2JI6A 2OO3A 2V6BA 1ZW1A 2BD0A 4KEAA 5FTKA 4D3ZA 1HGXA 2IP2A 1EDOA 1ZCBA 5H0IA 4FT2A 5AJUA 2AJBA 1IBRA 2AQHA 3PRJA 2ZVJA 3WRYC 3REQB 3NBQA 2G08A 3VVCA 4QAJA 3S2GA 3QPVA 2HSWA 4MCHA 5DTEA 2AEMA 2ZS7A 4RTQA 3GFPA 4LK3A 4WGGA 1Z13A 1ZNYA 1C1DB 3BM5A 2J3QA 3OKFA 2YMLA 1WSDA 3HYTA 1Q0HA 3PE6A 5ALTA 4AZVA 4IX1A 2PGXA 5EI5A 4IQGA 3JQPA 5DNWA 5C80A 5B57C 2E4XA 5B1EA 2WUDA 3COWA 3OKCA 3LT5A 5EERA 4BLPA 1JEQA 1W36C 1P72A 4QVIA 1THGA 2UYYA 4JI4B 1M34A 2BTEA 1KEWA 5FWYB 4Z7JA 3H1BA 3QHQA 3SMQA 1LDEA 1ECGA 2VWHA 3JVIA 4IIUA 5AO9A 4CHGA 5L7WA 1URPA 4JJKA 1XQ6A 3OZTA 2D13A 1FDWA 1QS0A 3KSZO 3TD6A 2KSQA 1NC1A 3HB4X 1TB4A 1F12A 5REQB 2VPYA 3O2SB 2B82A 3DB2A 1OAOC 4FYKA 4R2JA 5A6VA 4TX1A 4AP6A 1WMSA 5KX5F 3GLFE 3H2IA 2PL5A 3N3AC 4JDUA 4OMFG 2OGUA 1R8XA 3OQ1A 4AF7A 4EUSA 1MO6A 1A9ZA 1ZONA 1GUZA 4HDRB 4UVEA 1G8JA 5CT8A 4EA9A 2ZJBA 3AERB 2DPMA 4II3A 3NCTA 2EF1A 2IWHA 5CD1A 1QR2A 2M9MA 3E22B 1NDHA 5D3QA 5WRFA 3AP1A 1K2VN 1U4NA 4IKOA 3DE0X 3OHMA 3IEXA 4RJKA 5DE3A 1T6ZA 2JEYA 5AW6A 5L7TA 2AUTA 5HTKA 1DE0A 1EZZA 2QUZA 1UZNA 1L7EA 1QE3A 3B9RA 4D45A 1YL6A 4TYYA 2XXBA 3R40A 1OUMA 4A0QA 1JA0A 3BMOA 1U2PA 4PPQA 5E6SB 2AJCA 1RXEA 4LXUA 2C2KA 2V7BA 1RQ7A 2PV7A 4AKSA 4BIIA 1GSOA 4MUYA 2UUBB 5KU1A 5SY4A 3Q0EA 4BNZA 4JI7B 3S6JA 2DPHA 2QMZA 3CLUD 3OWOA 3QEKA 3UBMA 1DZIA 2PO5A 4OHUA 2XWPA 2OD9A 2AFIB 2XKJE 3ICVA 4PV7A 3AF5A 5M34A 3PGVA 4JODA 2ATIA 4HG2A 1HURA 1TVCA 3GPCA 2QPLA 2HDNB 2GD1O 3MRXA 3TKLA 1IY0A 4OQPA 2YXEA 1KVRA 2R6CA 1ZCJA 2Z2YA 1FP6A 3QQPA 2VDWB 4XFKA 3WC4A 1LRKA 1KU0A 3O84A 1CY4A 2P9YA 1UJ2A 4L76A 5K3EA 3R74A 1T2AA 3FPAA 1HRKA 3HEMA 3LZCA 3LUHA 4DR5B 1QH9A 3FPLA 4G56A 5EPEA 5A3JA 5LKRA 1NVAA 5A03A 4HGQA 1GFIA 1M74A 1EXMA 1Z73A 1PLKA 2WHQA 4JLPA 2RKBA 3IIJA 5K0GA 1HDRA 2YC4C 4ND6A 5BWMA 1MMFB 3ZDCA 3EH1A 3JQ6A 1RS0A 3FPSA 4RD1A 3PC7A 4RMHA 2OC9A 3B9BA 1S2NA 2VJOA 2D5AA 3TFWA 4B2LA 2FN9A 2QJTA 3WGMA 4CE6A 2XKKA 4W1SA 2BFPA 1V95A 2PBZA 1JE1A 2OPHA 2A0UA 4PNZA 2GXQA 5TQ2A 4TKVA 5TGDA 4F8JA 2V58A 5EMMA 3ZW9A 1G20E 3RNLA 1VFNA 2WJ3A 2MMCA 3P2EA 4MV4A 5AUQA 4BAUA 1VG9B 5D7BA 1OU4A 3LQ2A 3KJEA 2J3DA 3JZFA 3MM4A 4B80A 1M6YA 3AY3A 1PNOA 2HYDA 4JLUA 1TTTA 4B76A 3PQCA 4GLOA 5AHRA 1BHSA 2XPCA 1HDOA 3H1EA 4M46A 4MKXA 1LBIA 5I9TA 1QO9A 2B36A 4CQMB 2XNDD 3OM9A 1LLFA 3E4DA 1VOTA 4Y6OA 4AURA 4CLRB 1YZQA 1O5OA 3PFCA 4LSZA 1TLFA 5EXTA 2XEDA 3ETCA 1NOKA 5FTLA 3PUHA 1LEHA 4BJ6A 1TA4A 2GBCA 3E3NA 5EHZA 2B5OA 1CP3A 1ENOA 2M1XA 3NHAA 1KFEB 1YZFA 1MX1A 3QMMA 2J3IA 1KHTA 1GAXA 1JDUA 4GQBA 2X0FA 3DVRX 3VR5A 5AKGA 5C32A 1GQOA 1N3BA 1PYGA 4PSUA 4ZYTA 4MNTA 4G4JA 5JS6A 3K1YA 1YCGA 3P8ZA 3HVHA 1EZ4A 2JFBA 3VHRA 4EMTA 4RETA 5A4JA 3ZVNA 3O8BA 4F5ZA 1Z35A 1EFVA 2IGBA 1OY1A 1KZHA 5M29A 1X7XA 5EZSA 3ZCQA 2KE5A 3TGLA 4C6HA 2WSMA 5FFNA 3LA8A 4M7RA 2GJSA 1AKVA 1ZC3A 4IHJB 4EHAA 1V4VA 1UIMA 1Y37A 3VPBA 4ARCA 1H05A 1HMYA 3K7EA 1O6BA 1WL8A 4C5BA 1YS4A 3PC2A 2DY0A 5I7AA 3RBZA 1EH5A 3HSSA 2ZYAA 1IHOA 3IBYA 3V4SA 3KKZA 2AG1A 3KSMA 4NOMA 4RULA 3FRHA 1YVDA 3HPQA 3IEPA 1XMOB 5KQRA 4B6GA 2QYHA 4MGEA 1G8PA 1U4OA 2JJMA 1LS6A 4XUDA 4AN1A 1W5BA 1T4GA 1CKEA 2IZ7A 2QX7A 3PXAA 2D5IA 4WLFA 5AOBA 3VOAA 3PGJA 3QKSA 4JYCA 4GSYA 5M2QA 3KVOA 4ZA2A 1RM0A 4QVGA 3RIEA 2PLAA 4DMKA 2I6XA 3MJDA 3H5NA 3QLVA 2ZTHA 4L15A 4PF1A 4II7A 4S1OA 3DVAB 1RMTA 3NCHA 4YR9A 4N48A 3UC9A 4TMWA 3K15A 2ZWIA 4LGCA 4ZEOA 3G5UA 3L8DA 3N1UA 4M0MA 3SZMA 4CF5A 3N75A 1U3GA 9GPBA 2QTVB 1U3TA 4FHFA 5FWDA 3RUIA 4L9AA 2H1SA 1V2GA 1K06A 2Z9BA 2GCOB 4NZZA 4X20A 3RFCA 1D9XA 4OREX 3TTWA 4OGWA 3DZKA 3ZG6A 1U3FA 1XRLA 3QVUA 1KP3A 3CRVA 1GRQA 4I5GA 3TX6A 4DWVA 4OU5A 4XYGA 1E2JA 3OPXA 3QJGA 4WHMA 4HB0A 1KL7A 4X94A 4CL0A 5BUZA 3B6KA 2IRWA 1KIFA 1MJGM 1OPRA 4HNSA 2YY6A 2DUNA 1LVHA 3MERA 1KRXA 3D7RA 3SHFA 1AQIA 1LXCA 4IGFA 1ZI8A 1U9JA 1U2ZA 4TLAA 4LNUA 4NMHA 5K1ZA 4LYAA 3DOJA 3K1AB 3TZBA 2XMPA 1FPQA 3GDOA 2ZKLA 1S01A 1II8A 2GEVA 3DFFA 4IS3A 5JDCC 2EIXA 1JFRA 2Q21A 2XDWA 3C98A 5JNUA 1A1VA 2WICA 1EIWA 2C5BA 4FSHA 1YQUA 2WIKA 3DDSA 4BAZA 2JBAB 1E9BA 4EUFA 2PGNA 3IL2A 4CQMD 1UKEA 3MD0A 5FQOA 3SD7A 1N5OX 4YMIA 1FS6A 2JFVA 1LC3A 1VE1A 1Z4JA 4XDZA 4DEYA 2QAGA 1LV8A 3SYTA 2G8LA 2P1ZA 4P4UA 2G1KA 2ZXFA 2W70A 4FZ3A 2FSVA 1RC8A 4WACA 4AUNA 1OH6A 3NBFA 5EVCA 4M55A 1U0JA 1YDGA 2IXBA 2WA1A 4MUMA 4TSKA 4XDGA 5DWDA 1NV9A 2C57A 5EJGA 5GAJA 1X1TA 2B7LA 4U2FA 1NOIA 4BRSA 1JDVA 3I5UA 2WUGA 2PWBA 4P08A 2QNIA 2IIPA 3LYLA 3SLKA 3H8JA 3LDAA 3JYQA 1EU1A 3R7WA 5KJ6A 1E3IA 2JANA 1ZBQA 2RGBA 5CA1A 4XEHA 1UJMA 1ZS9A 1QV6A 2C9CA 1AKEA 1NSTA 2CLEB 3O83A 3QTLA 1YB6A 3ESCA 4RGYA 1E79A 1SUPA 3C85A 1JGTA 2WUWE 4FR5A 1LI7A 3CNBA 5AHOA 5CVUA 2QL5A 2DU8A 4EKNB 4L9SA 3RIMA 4ASUD 3TIVA 3OJWA 5CT6A 1USVA 1NE2A 1G8HA 4C7OA 5MF6A 5KNLA 4UATA 1YS7A 5LDGA 1KJNA 1YOVA 3EJ6A 1FUUA 4W4TA 4DJAA 1NDQA 1RYMA 5EVJA 3BZWA 3VNBA 4Q3CA 3HH8A 1N5KA 2XMBA 2XYHA 4KJXA 1P2UA 1M2VB 3O4HA 3PWTA 2YQ4A 2UKDA 1CTQA 3KTAA 4MULA 5ELMA 3I30X 1U31A 5BOSA 2NMVA 3S40A 1THZA 4PTLA 4UAGA 4HBZA 4KQ9A 3D81A 4TMZA 1TC1A 3DTNA 4ZI2A 1XTJA 4XGNA 4J0HA 4UMEA 1GN8A 3AETA 3RABA 5ADUS 4TYNA 1TJYA 2F8SA 1T0HB 1FL9A 3QKRB 3JQCA 3OHSX 2YNMA 5BR8B 2IVZA 5C0OE 3NHSA 2REQB 2GJ4A 4EPWA 3QH4A 3VSAA 2OBMA 1K4MA 1BJKA 1YC5A 3H18A 3IQWA 3LKVA 3QYPA 4RFLA 5A4DA 3U09A 2F00A 2Q3FA 3UMBA 3VO2A 3AFNA 3WDKA 1XRRA 2X9GA 3ITNA 5IJXA 5LQCA 3JYNA 5LJLA 1U0OC 3ZWBA 5A5VA 3ROKA 3IVCA 4RHYA 1CIVA 1I32A 1BIFA 3P20A 4J1SA 2VJCA 2YHIA 2Z2ZA 2VWPA 2QX4A 3C3BA 4FNAA 4DLRA 4FNGA 4LMAA 3AUXA 3U7IA 3ZXYA 3T5PA 4WOPA 5I01A 3KTOA 4U2CA 5CT5A 3IBCA 4EY8A 3D0OA 4GMHA 4H3KB 2XMCA 3ZHSA 2W71A 2AXPA 1RI5A 3PXUA 2NV0A 3L49A 4G5OA 5TPWA 1XAGA 4EGAA 3CVWA 2GPNA 4DHWA 4W8HA 3O91A 3DHYA 2RK3A 1WZEA 4K6MA 4BKQA 4I9NA 4KE6A 3C1TA 1SK8A 3DHNA 2ZR8A 3EQ9A 4ETMA 3IBSA 1JJ7A 1CD5A 3HDTA 2QRGA 1KQOA 1J9EA 3ELWA 4PW0A 3LHSA 5CHEA 4Z1MD 2I4TA 5BMOA 3PRHA 3G9TA 3QLTA 1KMNA 2WKQA 1SMKA 2WT9A 4QU8A 3Q3CA 4QZVA 3HEAA 3PX7A 3FCUB 3L8HA 4FSXA 4KBYA 3RUAA 1XTIA 4XX0A 2GMWA 1SQ0A 2HXSA 1CQIA 1E4VA 1I2BA 1XBTA 5HQTA 4RPHA 5CVEA 4EK9A 3QI2A 3V8PA 4PLGA 4B7AA 2IELA 4JXKA 3WJ1A 2X2PA 2IDJA 5HFNA 1KOJA 2GFHA 3FCEA 4OFBA 4FDUA 3QNMA 4YGXB 5DV9A 3GYBA 1N0HA 5E1OA 5BP7A 4E3WA 2V03A 8ABPA 5TARA 1GIAA 1SHTX 2WF5A 5FP0A 2WFZA 1O7JA 3OM8A 3UC5A 1PW5A 3FF4A 1N5RA 2ZSEA 3WRXC 1NFFA 1W9MA 3MC1A 4WADA 2H6EA 4YJ2A 4UUAA 5FPSA 2FV8A 3MQFA 3C3KA 3UPTA 2P3SA 3FUWA 3EUAA 5BMVB 2BPOA 2C00A 5DHQA 2OHJA 2X1VA 2R6FA 5D6OA 1DC7A 3RSQA 1J09A 1KEVA 2VPPA 3M9WA 2IEZA 3Q8KA 5DTQA 3MINA 4OO3A 3ONNA 3JV7A 5CURA 3TTYA 3UOGA 2I76A 1QDLB 4KXMA 1H42A 2QGFA 4XCQA 4FGWA 5L3SA 1A9YA 1OC2A 3H2KA 3TW6A 2HA6A 1IOZA 4BOYA 1OQAA 2ODEA 4UKDA 3T5TA 3DGFC 1Z7EA 1CZNA 3Q2IA 2FK7A 2BE9A 1DBSA 2V59A 2Q4EA 1CVIA 1LVGA 1JR2A 1MA3A 4WK6A 1S2MA 4DMUB 5EY5B 4HXFB 3D7SA 5JU6A 3T95A 5GADl 4NARA 4N7JA 1EBFA 2I5PO 3CFYA 3NTXA 3DW3X 4MRRA 4QBKA 4RGQA 3LY9A 1JIXA 1VPWA 3KQNA 3LM8A 1F2TB 2PD6A 1YB1A 2EW8A 3AEQA 1S02A 3AJDA 3K0BA 4RVDA 4DWOA 2XGJA 2FNAA 4HUTA 4NKRA 1I80A 1QX3A 4DJDC 2NZ8A 2B2CA 3P19A 5TPZA 3OZEA 2PGLA 3M6XA 1CJBA 2HV8A 8OHMA 3KKKA 1RE1A 4JYAB 4AKGA 1SD1A 3P97A 2IYTA 2A14A 3T0GA 1NYLA 2B4YA 2WYOA 2WVGA 3T94A 4OXXA 3WTCA 2HT6A 3LY8A 3IUNA 4IHAA 4BJ5A 1H1LB 3AK4A 2GASA 5AHXA 4RZ2A 3PQEA 1JKJA 3AESB 1H85A 2B1GA 4NCHA 3BHIA 3Q8XB 1B0PA 3R44A 4GMKA 4Q7MB 4U2BA 4C5AA 2PVSA 2A9JA 3T7RA 2OCPA 2OILA 3R7FA 4CM8B 1GPDG 2QJRA 1FMCA 5BVGB 1QQ7A 1YKGA 1UMKA 1VIYA 3B6JA 5SZJA 3MSCA 1JDPA 1L9KA 3F78A 4AN4A 3HXOA 2JHGA 1KDRA 2B5VA 4IKEA 4HMPA 1PSZA 3PHJA 3ROGA 2BHNA 1WOYA 4H4EA 4EFLA 4ZEWA 2WAXA 4B2YA 2R2AA 3CB4A 4PR3A 4FP9A 4BN4A 3DT6A 1FEZA 1N2XA 3K4QA 3IALA 2JA1A 3NOQA 4BKPA 1RLUA 4OJNA 1HQDA 3RSCA 1CQZA 4IV5A 4G0VA 5FBQB 4Q01A 2JFZA 3WLTA 2MSEB 3ZNQA 3AF2A 4OJMX 1GJRA 3L84A 4EHJA 4QFBA 4I55F 3WV5A 1DCKA 4YJDA 3U48A 4BB9A 4HEJA 4FUTA 3FYSA 1AIPA 1UXHA 3NAQA 1G5IA 4I4NA 4U6QA 4YMHA 1C4KA 2FN4A 2BHLA 5A4FS 2XT0A 5BW4A 3K9BA 1ONPA 2CCGA 1N2CA 4HNQA 4ZQIA 1BE1A 1HEYA 2YXBA 4BN0A 2CXTA 3N6VA 3ZHZA 1DT5A 1KJYA 2C58A 4WV3A 4KCGA 4KNYA 4H1TA 4U2KA 3ZQKA 1U1EA 3LQ1A 3PX2A 5HQ3A 3RU3A 2QD1A 4DLPA 4PLVA 10MHA 1CULC 2HA3A 5GVRA 3I37X 4OYRA 1THMA 3GJ8A 4ZOLA 2CLSA 5F2EA 1A8SA 1F2UA 1ES9A 2QMEA 2QTRA 3N8GA 4RK1A 2D1FA 4AP9A 5A5EA 1ENZA 3SOZA 5LZ9A 3KQKA 1V1MB 3WL5A 5JT1A 1RD4A 1NW4A 2RHCA 5DWQA 2A1TS 1FXWA 3ADDA 4IOLA 1B42A 2GK6A 3FHLA 4OI4A 4MARA 2OC4A 4K9LA 4LX8A 1U8TA 4QGAA 2WKPA 4ZC1A 3ON5A 2QJWA 4G01B 4PYMA 5IJ0A 1VLLA 2DPYA 1E61A 3HCWA 5LA6F 4I3HA 3T1NA 1UQTA 1IUPA 2ST1A 3W2FA 3DMHA 3TM5A 1SIWA 4NBTA 4NH0A 4RW0A 5IF3A 1G20B 4ZAVA 2O8DB 3HVJA 2A1TR 3IB6A 4OHXA 4CKCA 4HOYA 3HJFA 3ZDDA 1FA9A 4AZ0B 3NT5A 2QRVB 1Z6YA 3COYA 4JYPA 1FFXB 3CTPA 3U1TA 4MVJF 4DCCA 3KT0A 2IHNA 2GERA 3ZKAA 4ENWA 1LK7A 1XT6A 4YAGA 1ZM2A 3WYFA 1H94A 3LK6A 4B6SA 4LGVA 1ZNQO 4OQNA 1SY7A 3HPRA 2JG3A 5A6SA 2FZVA 2OBXA 4H18A 1G1AA 1UDAA 3TLAA 1LDYA 5E9QA 4G0PA 4D56A 1KYZA 2PT7A 4E33A 2PANA 2WQ7A 4LSMA 4URHA 2Y77A 1XKQA 3HUEA 4EB3A 5I9IA 2JLSA 4DKJA 2YVAA 2ALJA 1SRQA 2HF9A 4HDKB 2OCLA 2UYHA 3PTLA 1D2CA 3EQ7A 2GYVA 3DOEA 4RDCA 2GD2A 1GA4A 5KTTA 3TUJC 2YZKA 1C7EA 4Q4HA 4I50A 1P0FA 2VQSA 1A8QA 4N3CA 2IYFA 4BNHA 1JDBC 1RWXA 5HTOA 1U0BB 1SCAA 3I9KA 5ARCA 4KE9A 3W9UA 1XJWA 5HZKA 4N3BA 2C7PA 5MHTA 3Q7EA 3X1YA 4X8HA 5F1PA 5LBUA 4I99A 4AL4A 3P7MA 4UTVA 1Z74A 2HU5A 2DWOA 3R3WA 4NBWA 5KS2A 1HXHA 1CNFA 1AQUA 3G82C 4J16C 2GJ9A 4MVJE 4KOAA 2FR1A 4M83A 1XZ8A 4MKIA 4EHNA 3KSRA 1C7QA 1SKAA 1JR4A 1LU9A 4MYSA 1KOFA 3E9RA 2NUPA 2BSQA 2EL9A 2QZ9A 1F2DA 5DLYA 3ASZA 4RFSA 3OJCA 1PS0A 2AK3A 1YR9A 3KG2A 4I9HA 4R1PA 4LFBB 4PAMA 1XZJA 1V5IA 2A3NA 5THQA 1SVWA 5CM9C 3O38A 1Z0ZA 2F55A 2XUJA 4RIEA 4BKRA 2NM0A 2BGGA 2G63A 2G0TA 1SAYA 4UBOA 1OSNA 2GO1A 3SFVA 1D1SA 3ZS9A 1IIRA 4ESVA 1IVSA 1KMHA 3CVXA 2AOUB 5LNK6 1CDZA 4MB6A 1W4AA 3GVHA 3N8HA 3FJYA 3LPAA 4KH1A 3SIXA 3WO0A 2X0EA 4KIFA 4HLNA 4MWBA 4PWZA 4RQUA 5IT5A 3BGVA 2ZIGA 1EWTA 2G9UA 5AW8A 1J5XA 4RHFA 5COQA 2FEXA 2DUMA 1DV1A 1NA5A 4P0QB 5T3YA 4B46A 5HILA 1LK5A 4RAOA 3KZNA 3GP5A 4D1YA 2NYRA 4EI9A 1KE2A 2C78A 1X2BA 1L5LA 2PMDA 4ABYA 4WZAA 1HBJA 2ZYHA 1NX6A 2ZP1A 2EFHB 3BK1A 3DOCA 4FS8A 1D1QA 4RYLA 3UYLA 2J5QA 1W25A 3DTVD 1Y7PA 2B83A 3U9TA 1AKRA 3CNHA 3AI7A 3H4VA 1XVTA 4QUAA 4HDOB 1UPCA 2XCQA 2DVMA 1S7CA 2C3PA 1HFWA 1WNFA 2YV2A 3UWOA 3THWB 3MMPA 4D4IA 1UKAA 3MS4A 2ZGVA 1AZWA 3FNIA 4FU0A 4RLQA 1JHUA 2K7FA 2I22A 3CSSA 4TV9F 5AVRA 3LUPA 1TQ8A 4L16A 1FOEB 1MPTA 2W4QA 3F5FA 3PFHA 3R6DA 2A0WA 1NMXA 5E3HA 1PRYA 2WWXA 4W5RA 1KRWA 4PN7A 2CNNA 4RQAA 5BQPA 4GXNA 2PM8A 3UWMA 3KOMA 3QEOA 1WLSA 3BL6A 4YY3B 1RBZA 4LTNA 1U1DA 1HC7A 1WY5A 5LB4A 4DLXA 5HYVA 4XGQA 2HRQA 2HY7A 3F6BX 1Y4UA 4N01A 1AKYA 2IUTA 3KJHA 2H4YA 2ES4A 3IEIA 4AXBA 4EPXA 3MELA 4NEGA 4D9FA 2BEWB 4CKEB 1Y9EA 3GPLA 3VZSA 4JKYA 2FOIA 4PICA 4DDMA 3HP1A 3VSDA 3VR0A 1EP3B 2IXEA 5HS4A 1IBLB 1E7MA 3GBVA 1X92A 3AINA 3PEUA 1W6UA 1E1RD 3D4LA 3KFXA 1XCGB 1ZG3A 2HUPA 1M8FA 1FSPA 4PG4A 3D6MA 1PT8A 4BNGA 5KYUB 4PO1A 1U2DA 1YD7A 1HEIA 4YLEA 3LPCA 4JN6B 4OQEA 4MJXA 1M2KA 3RS4A 2ACVA 3TXXA 3ZUGA 5I3CA 3W5IA 1TIPA 3SMVA 5JXGA 2ZBPA 4LV8B 4DZRA 1FYXA 4MWGA 2ZROA 2WHRA 2ZJOA 3INRA 1GAQA 2Z04A 3WHKA 1P7WA 5I8WA 2VA9A 2GZ3A 3CRNA 3D7LA 2A0YA 4W5WA 3E84A 1L8QA 2Y76A 3BDAA 3DYIA 3KVYA 4FZRA 4YXWD 4KX3A 3PNKA 2XRYA 3G8YA 4D79A 1KI6B 1IHPA 2ZIWB 4S1TA 4I1PA 4IYJA 1TLLA 3JYHA 4NE9A 2GK3A 1F9AA 5DTRA 5IXSA 1GFSA 2R9VA 5DNEA 3UZUA 4FFBA 4UDYX 4MVJG 4YRTA 1PNRA 1QRRA 3S2ZA 1FYVA 5DHAA 2OORC 2A9RA 4YO8A 3RSGA 4OUDA 3E6AA 4BQEA 5K3FA 5CDYA 1AKQA 2GN0A 3EIOA 3HFGA 3K8YA 1KEPA 1XZMA 3QBEA 4AROA 3PUKA 4B7UA 4C0JA 1HDYA 1BX3A 5FJJA 4CIAA 2O2ZA 2O2DA 3EN0A 4WFQA 3URMA 4DT1A 1SUIA 1R5NA 4FIDA 1J23A 5AKHA 1E1QD 1JYFA 1F48A 1ZOSA 4GM0A 4RO0A 4NCAA 5C9ZA 4ZCQA 2WIDA 2AXQA 4L9RA 4W9NC 5DOZA 5T57A 4NDNE 3TOXA 4DM3A 4F1KA 4KJZA 4XSHA 3NHMA 2HJVA 3T0IA 4Z4HA 1YL7A 4MQFB 4Q3AA 3DAOA 2I8LA 3BFXA 4JT2A 2R6R1 3PDCA 3EGEA 4CFYA 1O94A 4TVKA 1E3WA 2Y1XA 5COAA 1SC6A 2FOLA 3DFUA 4L6CA 1L5HA 3RC7A 4AT1A 1UMCB 4U5QA 1Q7EA 2AKEA 2Q5QA 1JKFA 2XD4A 4EI2A 3JZAA 3KD3A 5ADVA 2OCBA 3UV6A 3L46A 5TB5A 4QO8A 3V2IA 2HIMA 1H69A 5JO0A 2GTPA 4H27A 5FNVB 4DPLA 4RMNA 2J30A 3AY7A 2GEUA 4EHFA 3RR2A 4X63A 2AN9A 1EX7A 2HUNA 5DX1A 2C2WA 2OESA 2ZRFA 3RTGA 2QWXA 1Y4SA 1TYEB 3PXCX 5DBHX 1US8B 2VH1A 3TW8B 2WEKA 1CETA 3B70A 5JJKA 5AP9A 2DHQA 5CA0F 4E12A 2QTHA 4CV1A 4IJQA 4ZZ0A 3D4IA 4KKXB 1P2FA 4BV2A 1FBNA 2LVBA 3QVXA 4FYIA 5B55A 1XK6A 1Q6YA 2MHCA 4J3FA 5D5PA 3L7BA 3ZJ5A 4M1KA 2MSWA 4MKFA 1ZN2A 3F3MA 3TAXA 1UZUA 3BIWA 3E7DA 5IYZA 4TMFA 1H8ED 2M6RA 3L9XA 2DBVO 4QPCA 4CTKA 3INGA 2YN0A 1A9RA 4PFKA 3NNSA 4NONA 1C3LA 4Y1GA 2R1VB 4BHTA 1JWBB 2Q6IA 3EF1A 1NQWA 1DQYA 1BCSA 4QUJA 4EKDA 1XHLA 2QDXA 4FX5A 1AXEA 1GRNA 2Q07A 3ECSA 3ZXUB 1P18A 1UQRA 4JLVA 4DRXB 3DSRA 1HETA 3UATA 2M6LA 3UNXA 1E6WA 1RPZA 4CG3A 6REQA 4BP3A 2ORIA 4PFSA 1EXNA 4LWZA 2DBZA 5IVIA 4IDAA 4YUVA 3NIGB 8MHTA 4XQCA 4CL2A 3QLEA 2WTBA 2VAMA 1AURA 2AA3A 2ORED 2WJVA 4HEA1 3DVSX 5F4ZA 1H23A 2W2MA 4EW3A 4TVSA 3EULA 4QOJA 1W36D 2O23A 3K0HA 4IKPA 1XQVA 3OAAA 4WECA 3U0VA 4TSFA 2HOQA 1XTUA 4CLEA 3LW7A 2GJ8A 3NOOA 2EQAA 5K09A 1SO8A 3PGKA 4FX2A 1YRAA 1ZM7A 2C5HA 2Q4DA 2WJ6A 2EX1A 3KALA 3GZTB 3I2YX 4YMWA 5JZVA 3SK0A 1XTSA 1NPYA 3OHPA 1LKZA 2A67A 4FFLA 2A5JA 3RG8A 2VDOB 1N6PA 2BN4A 5DXAA 1BRTA 2WE7A 1M8JA 2V55B 4AS3A 5LQAA 1N5MA 5BXQC 3QVVA 4WY2A 3MWEA 1FUEA 2PGJA 4CDRA 2Z2IA 1VJTA 1G9TA 3FETA 3FKSA 2WKRA 5K3SA 2D1YA 1CQJB 4U0JA 5IC4A 2WV9A 3OWXA 3SHTA 3PI6A 3LBIA 4GXTA 5DM4A 1GADO 2O20A 1GVNB 3BYZA 2AK2A 3C7TA 5ALLA 4G0MA 4WPGA 4Z0HO 4K9OA 1NZFA 1KYQA 4IDCA 4JQCA 2ZW9A 2FMHA 5CJJA 4DV4B 1V0JA 1ZEMA 1KTVA 1SJ9A 1AB6A 2EF0A 3AUUA 1DI0A 1T8SA 4KSCA 5A3RA 2P75A 3MUFA 4HDMA 1D07A 1Q1EA 2I8AA 1R00A 3BXGA 3PNVA 3EUEA 3ST7A 4O02B 1K66A 2QD5A 1Z0JA 3LPDA 1OIWA 2JEZA 2LRHA 4OEHA 4L50A 5CW2A 5A3QA 1GCAA 2PX3A 2PXAA 4LRSB 1TVKA 5E3JA 3WLNA 1LK0A 2AMLA 1C8KA 4NG4A 4E4YA 3F98A 3A1TA 2I4OA 4ZKEA 1E0DA 3BE6A 1ISMA 3E27A 3C3EA 4MPRA 4WZZA 5ALHA 1VYVA 3V8RA 1VE6A 4C76A 1AGXA 2YJ3A 4G9GA 4X7RA 4QO7A 1NM5A 1JHRA 4DLNA 2DE0X 4WBXC 3EZ6A 3N74A 1MB3A 1Z2NX 1VHDA 4OQFA 1TZMA 3U1VA 3F7NA 3F2VA 3N76A 1KIAA 3HKDB 3IKTA 1N32B 2PH7A 2D3WA 2FUG6 3PPXA 4NOKA 4DSAA 5HNKA 3H0EA 3WLMA 4N18A 1HO3A 1RXUA 2VPIA 4N5HX 2R7KA 3QEMA 5BSRA 4A26A 1K2WA 2R6ZA 1VJRA 1VRWA 2C7BA 3B78A 4RCVA 1ZM4A 4EHLA 3MHTA 3GNLA 3EZNA 4O4LF 3RQSA 3ZWMA 2FE1A 3C6BA 1MT3A 3MJSA 3KXDA 4F3TA 4ZZ2A 2EZ9A 4JBGA 1K3UB 4BZPA 3K70D 2G1JA 3GT0A 5A62A 4JYZA 2AYZA 1ORDA 1XSEA 4DREA 3C14C 3EBOA 3FYDA 5IZCA 2C2HA 1Q57A 3VMMA 1VL1A 3HZRA 4CV0A 2F2TA 3FWYA 4WKNA 1ZUIA 1RBYA 4QBTA 2IXAA 2C31A 1VE5A 3S1LA 1L7AA 2RGYA 2FYTA 3JTEA 1VMDA 5FLXA 1A69A 2BL4A 3OOEA 2G80A 1QV9A 1U65A 3HHPA 4IZIA 3QX8A 1UKYA 1XPUA 1CUBA 2B1QA 2Z83A 1QX4A 1WIWA 4KXLA 4ZDJA 2W8BB 3CZQA 3PICA 1XDZA 2KJQA 1MTOA 3ROTA 3K6SA 1VL0A 2JH8A 3LC7O 4R7ZA 4YECA 3GX1A 2C5SA 4C0BA 2P2GA 2UUCB 1KO7A 3TOVA 3BHJA 4ZJPA 4RH0A 2FQ1A 3CO5A 4RK6A 1K88A 4TWBA 2ZVDA 3Q12A 4PO9A 3DB1A 4N5LA 4NCXA 5JECA 1N2EA 1KDOA 2G4CA 3KJXA 2E4AA 1X39A 3A4YA 3WGTA 1NL3A 4D3XA 4JBNA 3EIUA 4FYWA 4HAUA 2O3JA 2KHZA 2JFFA 4F4DA 4B32A 2R2GA 1GRRA 3CUTA 1W4BA 3DMRA 4OXQA 2G0AA 2X1HA 2ZSKA 2B30A 3PQ2A 3C6KA 5LFAA 5I45A 5LWHA 3L1HA 4BE4A 2AV6A 2EKLA 1A9TA 3GH1A 1TZCA 4LAFA 1YIAA 3QUSA 2B8TA 1HT3A 2NZYA 4AICA 2XOEA 3MGKA 1E2FA 3N8KA 4ZAXA 3RK4A 3DE3X 3N07A 1ODFA 2RK6A 4HPJB 3N59A 3BIJA 4PNEA 3C3WA 1KRHA 1K6IA 1NR7A 3O4IA 4BECA 3WLSA 1M5RA 4QFMA 1KSJA 1M0SA 1JI0A 1JQEA 2XBLA 3C5HA 3N2EA 1T15A 1QGUB 4YFYA 3HCAA 1PNQA 4B44A 4I5IA 5LA6B 1GRVA 5LB2A 3JQAA 4Y7DA 5IDXA 2CNOA 1Y48E 1OH8A 3NS7A 3G8CA 2WWFA 1Z2AA 3HADA 4Y2JA 5LXTA 3FNRA 1ZAYA 4F04A 1XTKA 5BSUA 1B73A 1PJLA 2P4EA 1KI2A 4L8YA 2VQDA 4X6YA 3K0EA 4UTRA 1WUKS 2D0DA 2W83A 1RCFA 3E2PA 4TUYA 4LXQA 4WCFA 3PDJA 1FUYB 4F06A 2CLHB 2X1LA 2IIBA 2JCGA 2VOEA 4UEOA 3QE9Y 4IY1A 1KYXA 4PY2A 4RA9A 2GEFA 3X1KA 3BWDD 2PKRA 1ZRSA 3KB6A 1P74A 2XBUA 3AFMA 3P4XA 3GMDA 4QQNA 4IIFA 3IAM1 4GT1A 1XJ0A 3VR4D 3R5XA 3VGPA 1X8KA 1VIAA 3QP9A 5KCZA 2DH5A 1VECA 4J29A 4A6XA 2WUEA 3G1WA 2QMQA 4HSEA 2VN8A 4MV5A 4ZVLA 4GMXA 1E9RA 1QIMA 1CPYA 4ZV4A 3H5RA 2VQEB 3BTUA 3MPOA 3H13A 2ET6A 2QTCA 3K2QA 5IBCA 4QEZA 4TWIA 3FB4A 1V3UA 2LD4A 3WMFA 4DA0A 2IEAA 1BDJA 4QDJA 1RP1A 1Z25A 4N3NA 3LQYA 1N2BA 4TTAA 3FMGA 3WWPA 4ETIA 2AN1A 1NG1A 1L1QA 1H2RS 3ZEAA 4WZBE 3HXPA 4LTDA 3HGTA 4R5MA 5EWLB 4ZMBA 1GARA 4BGUA 2C99A 2IWRA 2PJZA 2J5XA 4CNBA 1WG8A 4PLPA 2F3TA 3F6RA 2D1SA 1CLUA 1E2HA 2HO4A 4YMSA 4HAOA 3ROZA 4EJ0A 3V2HA 3OJOA 3RVLA 4BLUA 1SHLA 2XTAA 3AHHA 5K3CA 1I3NA 2DYKA 1FW8A 1PP4A 3FKJA 1OFHA 3P0IA 4AJLA 1LSSA 2A1IA 2VYND 3IV6A 1X3SA 3KR9A 1LNQA 2XUAA 3PGXA 4P32A 4FFOA 1H1DA 4YJGB 5DK4A 2JF0A 3U4CA 1QXSA 3QNWA 3HMKA 1TW2A 3OUTA 4PZZA 4FM9A 4F7WA 1CERA 4E5MA 2J6IA 3AONB 1N9ZA 3OJEA 4IWNA 4B9AA 2ENWA 2DT5A 2N47A 1UK8A 2R6JA 4FJ2A 3CJTA 4HAWA 4IOMA 3WGOA 4CUJA 4EHHA 3DPUA 2CXQA 3RVRA 4R05A 5C3MA 4XVRA 4YDQA 3ROMA 3L18A 3UWPA 4ZQHA 3NTOA 3I58A 2RAVA 5JH7A 4D92A 3MJHA 3W8RA 2H9IA 4DLUA 2J0VA 4CDGA 3KJNA 1VRVA 5INTA 3HYSA 1YU9A 7YASA 2GBIA 2JAQA 3I9NA 4UMFA 4DYDA 2GLXA 1XTTA 1AUVA 3EZYA 3NU1A 2IITA 4KO8A 4Q9NA 3F6EX 5JBNA 5F64A 2WU8A 3F2IA 1JZTA 3PNQA 1IN8A 4AXXA 3CEPB 2QD2A 3FLBA 5TS2A 3MUOA 3U3ZA 1WD5A 3BIXA 4IG4A 4NQRA 5HZHA 3PFWO 2C1EA 3BJEA 1QONA 1BKDR 3F4KA 4L57A 4ENRA 2CFOA 1DTWB 5A3VA 2F17A 3VPCA 3RS3A 4Z9FA 3UMSA 3IUSA 3P9KA 3F5SA 4UPVA 4RD3A 1DX6A 3LBNA 1MO3A 2HA7A 3R3XA 2EZ8A 2ZJ4A 3PFNA 1KGSA 3VR3D 1PO7A 4P6VF 4O2BF 4WWHA 3VC3A 1AN0A 2QL9A 1VKJA 1KBZA 1XV5A 1JLLB 5H9VA 3R7NA 1F4LA 3D5EA 4LCBA 4Y9SA 2D8MA 4DDVA 2GF0A 2J41A 2RHOA 2E18A 2YHAA 3AOEC 3P2OA 4MVJD 4N0QA 4DMHA 2VF8A 1O9GA 1DDGA 4WTOA 3IE2A 2G7ZA 3MFQA 4E94A 3RNOA 4J03A 5DTIA 1OYYA 3W6PA 3BE4A 4X8MA 4EZIA 5KNDA 2JIRA 1TEVA 2EJUA 4LJ7A 4LWPA 4FN4A 3BWVA 3L7CA 4HYQA 4MB2A 5CDSA 5BW8A 5H4HA 4XGKA 3OE5A 2WMDA 3GRZA 1VPLA 2ZTVA 4C05A 1I01A 4M98A 3V00A 1JEYB 3N2ZB 4YRCA 3PQ5A 4LDPA 5LMNB 4EA8A 1V7PC 4D41A 4D0RA 1F8FA 2G9RA 1V16A 3DAYA 3WGVA 3LVRE 3DPSA 1Z4OA 3EDYA 2FN3A 4CEJA 3B51X 1Z5NA 1B7GO 2N3ZA 5CLFA 1YB2A 5IMSA 1JRLA 1VCMA 2C97A 4MIYA 5KTMA 2UAGA 4INPA 1LBEA 3RKUA 4TYMA 3WWZA 4CIXA 3PFKA 4DCPA 3K1ZA 4Q4LA 3KQHA 2GILA 1LZKA 5ALIA 2I4NA 4KTTE 5KHLB 1ULSA 3JRXA 4QBHA 4UXHA 1ZUNB 2TS1A 1BYUA 3MRTA 1ZVVA 1TZ2A 1DEAA 3T34A 1AU9A 3ZHUA 5TVKA 1RIIA 4R8LA 2IA5A 4ZYUA 1X13A 2QTZA 5CJPA 2O2CA 3L8CA 1AZSC 1P0MA 1T3LA 2D00A 2J0UB 2CD9A 2QW0X 2BJVA 3IPXA 3PTAA 3D1JA 1QTNA 2AW5A 4KRGA 4AS2A 4TXHA 5AICA 2ONCA 3R4VA 4CQLA 4IAOA 1NBMD 3W2TA 5A4IS 2PH5A 3GMTA 2WVAA 1E8DA 3L8FA 1ONOA 1SWVA 1QRDA 3QXXA 4WXRA 2XV1A 3SOPA 5F12A 4D44A 3E9YA 1KVQA 2ZAOA 2B3DA 3MQ4A 3QLVC 4MINA 5IDWA 4GFDA 4UZFA 4LISA 2PS0A 4BNDB 3D4OA 2X0DA 3C5WP 2Q5OA 3KZOA 3PNOA 2QXYA 1JBQA 1OX5A 2WD7A 2O57A 5LMCA 1KAOA 1XCLA 1YZNA 1EG2A 1EFRD 4HFRA 1ZLXA 4S12A 3T9BA 4B71A 4MR9B 2JGFA 3I9MA 4HGYA 1MH9A 1A4XA 2YN4A 3U13A 2XUPA 1A8PA 4RVCA 2BMDA 5JLAA 3D0QA 1IDOA 2CVHA 2V54A 4TQUS 2GF2A 2XUZA 5CP8A 3Q5EA 1VCHA 2XF2A 3Q3EA 4YRQA 5FYDA 3SI7A 5LDDC 4LDQA 2ZUEA 2LIVA 2VXOA 1E0AA 2QE7D 4DDTA 3M6IA 3NRJA 3DEAA 4PC7A 1PVDA 4PE5B 1GZ6A 1SKUA 2OB1A 1A3CA 2HEGA 3U26A 2W8ZA 2XZPA 2PBFA 4ZDWA 3TTXA 1NX9A 1OXMA 5ESDA 3X2FA 5AI4A 5K2OA 1WQ1R 3GRYA 1JYSA 3TAHA 2Q0XA 3G79A 4YP7A 2ZRJA 1EUZA 2CDRA 3AP3A 4LJ5A 4LHVA 1N3YA 3QYJA 4E3ZA 4DJTA 3Q87B 2IS2A 2GK4A 2ZE8A 3E2IA 3O8OA 4UFNA 3DL2A 4AM8A 1KPGA 2QP3A 4WOKA 5IJZA 3EXAA 4IDGA 3B3AA 5ESWA 3IIKA 1M6EX 2QTWB 2QLJA 1CJUC 2ZUDA 2QTNA 3GVIA 3N58A 5GY7A 1CZOA 4DMRA 4C6TB 2V7QA 3U3RA 1N9KA 2NZ2A 2PH1A 1W0JA 2FSVC 5KQPA 1WETA 5JMPA 4X7BA 1TZBA 4B0PA 2YMPA 3PXDA 2IYYA 3KQVA 2C4MA 4RF5A 5IDQA 5KQMA 1PR0A 4M3NA 3TS1A 2CXOA 3N7TA 1JQJC 3O75A 4H08A 1GTSA 4LRQA 5DTJA 4JUBA 1PFGA 2EQBA 1AA9A 4FC7A 3H8VA 3W7VA 2HPVA 4LYDA 1VC2A 2VP2A 1SOWA 3L4KA 1ILWA 3HV0A 2VXBA 4UPEA 4EYSA 3K9QO 1QDUA 2D4HA 3AEYA 4HRXA 1J6UA 4MV3A 4MW9A 2NACA 1DUVG 1NR1A 3CR3C 3TBFA 4KWTA 5J1TB 1BE6A 4WEOA 4U3JA 5D1HA 5DYTA 3KXKA 4WNYA 4DPMA 5LP6A 4H6XA 4O33A 3CNNA 4UE3S 2OCDA 3W06A 2ZI6A 3ZDQA 1QIGA 4C21A 1G2PA 2AHOA 2JNWA 1EQ2A 1YK0A 4WMLA 4F3KA 2P2YA 4PSCA 1XD8A 2B25A 2YXDA 1U7OA 2YRWA 3GUUA 2IU6A 5IAKA 4AMUA 3AT1A 2IPAB 1CW2B 4BNTA 5HQJA 3S28A 3GQBB 1A2OA 1RDFA 1JI3A 1SQSA 2VQ3A 3E2MA 2R6GA 3ELUA 3NRBA 5ECGC 5I5EA 5LQJA 1EWVA 1ZIXA 1ZJ5A 2W37A 2QRMA 4R1TA 3WMEA 5CW1A 4QECA 1UAGA 1X7ZA 1AMOA 2BDEA 2CLKB 3B12A 1RM3A 3VZRA 3B7GA 4JXZA 3NHYA 3HB5X 3HRHA 3EVAA 1G55A 2NU6A 2VBIA 3DUFA 2NV2B 3VI4B 2LKDA 4EABA 2YNMC 4OGKA 5FA8A 3U16A 3VRHA 1OYOA 2V9ZA 1T5BA 1WD7A 2FB9A 1YQ9A 4AQYB 1T9KA 3OX3A 2NSHA 4GICA 1G59A 2PGOA 4F4UA 4BVHA 3O1IC 1B4DA 1VL2A 1AKUA 4NESA 5CVDA 5F9MA 2XJ9A 3WQHA 5C5DA 1TTQB 4YJHB 1FRVA 3V9PA 1ZVMA 1CJCA 1BAPA 4QEKA 4TRJA 4CMBA 2VSYA 5AR1A 2A1UB 3HDGA 2WBLC 1PD1A 2FQQA 5AM5A 3V46A 4RACA 3NDJA 3TMAA 4EX7A 4QOSA 3O5AA 2FWMX 4D9HA 4DIBA 1EDDA 1M6VB 1RWBA 2ADOA 2IHJA 1AHHA 4HNHA 1SBNE 4ZI7B 3L7KA 1HR0B 1CR1A 2Q8PA 3BG5A 3PD7A 2AOXA 1DC3A 3R0XA 1YQXA 4PR0A 4ED9A 2P0YA 2R25B 5E0OA 1ZNWA 3GPDG 5ELLA 4ENUA 4HDNB 5E6UA 3NC1C 3TG2A 4EDFA 2P9BA 2XTJA 5LCXA 4C4AA 4ZHQB 2HHCA 1HYQA 1QFSA 3CF4A 4R8RA 3ENZA 5BPFA 2DERA 3LUKA 4HWSA 2YZNA 1NVTA 1HL3A 1U11A 3IJEB 4TS3A 2BGKA 1JU4A 4BNNA 5HW0A 5K0CA 3QVGA 1RTKA 3EXIB 5TSDA 3KEOA 1B2LA 1V9SA 4OG2A 4K87A 1PV4A 2EAUA 1GDDA 4P92A 2BHTA 3HFRA 1DC8A 4P34A 4X90A 5LYJA 4RD6A 4QXPA 2EARA 4CI0B 4DARA 5CVCA 2YV4A 3IT3A 5F7XA 1I1QB 2ZTSA 2B20A 1LJLA 4PZYA 1RKVA 4KITB 1ND5A 1UPFA 2BGNA 1I14A 1AKMA 3MAAC 2EYUA 4BWYA 4W63A 4D81A 1QJCA 4EX6A 2VNKA 2HLDD 2NO9A 2B4KA 3UJPA 2CKMA 2OZLB 2Q5CA 4BQQA 1SIBE 3I83A 4FOLA 3AGQA 3CSUA 2GRJA 4M1OA 1G6HA 3ROFA 4FHDA 3KOZA 2JAXA 3P5SA 1GV0A 3Q3IA 1PL8A 5F2KA 3ZGXA 1L4LA 4OJYA 4F0JA 1P7PA 2RGEA 3QFCA 4FOPA 3D8UA 3ZXXA 3UT0A 3C7CB 5FL7A 1CR0A 1E5XA 2HREA 1KGDA 3ZCVA 4RZQA 3PSAA 3H1PA 4RC9A 4CEHB 3LHFA 4KR9A 1SZJG 3VV2A 1J5PA 3MMSA 4EYKA 3A9TA 5TNXA 1JKMA 1PZGA 3KB2A 1XEXA 5B53A 4NV1A 2Z6AA 3FUXA 4BLRA 2YVQA 1P0PA 3PVCA 4LECA 3KYIB 4D96A 4MA4A 4QJIA 2OQIA 1SZDA 3LQ4A 4HWOA 3THYA 1UEIA 2J85A 3FTNA 1WJGA 4I6JA 3TCKA 2YIDA 3AXSA 3B82A 4LF8B 2VQ6A 3RTDA 3MB8A 1P1HA 2HFKA 4KR3A 3J7AC 2PX4A 3KUCA 4YQFA 4P84A 5DN9A 4NZOA 4OK5A 4OAOA 2A0FA 4P54A 4AF8A 4OGLA 3MCAA 2I7CA 1WSBA 3SZRA 2Q0HA 4TL8A 3H84A 3HU5A 1ISSA 3GJ7A 2PQMA 3MTGA 1TAUA 2EL7A 4H77A 1SCJA 1NJ5A 1DXHA 5BWCA 2Z8XA 2QI9C 5EP1A 1DKLA 1C50A 3IRUA 2PWYA 1RCUA 4AMVA 2Y99A 3LBAA 4JD5A 3KM0A 3U7JA 4DB4A 3EJWA 2F9MA 4W7HA 2ZT7A 3JATA 2VNHA 2NUAA 4YQZA 4YAJA 5JCXA 1K8ZB 2FZWA 4NI5A 3ROXA 1YZHA 4TQAA 1MO2A 1NW9B 2PVCA 1S2GA 1VHLA 3WDLA 1ZWKA 3ELDA 3MYRA 5ALFA 5A5FA 3EF0A 3C6QA 4GSKA 4P80A 4Y2HA 3AQ4A 2B78A 2H16A 3NBKA 1JMKC 5AI0A 1HEUA 2XCIA 1YR8A 2XDAA 5EKDA 3KWMA 3RSZA 3LUAA 1UH5A 2GDZA 2REBA 1NF8A 3D59A 2Q99A 4FWBA 2W2NA 2QB5A 2ZM6B 3TJZA 5TF0A 1EPUA 1E2UA 2CHVA 4UTZA 3DV2A 4HAIA 2C7VA 3NM4A 5CLGA 2Y27A 3F6SA 3LWDA 1M83A 2EKBA 5LOVA 1PLJA 1ZOPA 3MT0A 1VPEA 4WJZA 5EE5B 1WZNA 2BFDB 1ORWA 2Q4OA 4IH1A 2IZ1A 3EX7C 4ALLA 4BY9E 2IUUA 5C53B 2B7BA 3HE3A 1PX0A 4KQ6A 1NXOA 1F2VA 4JHXA 5AJZA 3SC2A 3W8DA 4IEIA 3H2HA 4X66B 4JP3A 2Y1CA 1E94E 5HIJA 5KWEA 1LPBB 1NN3A 3L01A 3OA0A 5BQ5A 3S2SA 1WB6A 2PO7A 3PE3A 4DV7B 1C81A 1YA4A 2JI8A 4ME6A 4K03A 1OXVA 4Q05A 3NETA 4HDSA 4JX9A 1BN6A 1DAKA 4I14A 4MS1A 3W9BA 5CB6A 3BWEA 5KB3A 1R0LA 1QP4A 3IMEA 1OV6A 1G3QA 2QSYA 5AIAA 4KR7A 4INZA 4EY6A 3EGWA 1G2QA 3RUEA 2W98A 3RYIB 5KPDA 3AO0B 3TTSA 5ADWA 1JZSA 1Y63A 2VF2A 2VEOA 1V43A 4XE5A 2QX6A 1XXLA 1MIOA 2JIMA 2SCUA 3TRHA 4DLVA 4LK2A 3PIIA 3VOTA 1F8XA 1W49A 3OETA 1H3NA 1E3QA 1NFRA 3ZJTA 2W2OA 3E1GA 2CLMB 3DBHA 5IAAA 4WLEA 1Z7GA 1O8BA 2FPLA 3C16C 5DGXA 5BR4A 2X4IA 4O5OA 2D2FA 1F7VA 1ZGAA 3KXLA 1J0CA 3L7JA 4A1OA 1M8PA 4FJ1A 4QWWA 4RGVA 2TMDA 1FQKA 3E8XA 1N0IA 1RHQA 3BD7A 4JL5A 4O4HA 1EAMA 5GM2A 2XIQA 3MIZA 3RSLA 2RCYA 4B6JA 4BWGA 1A72A 4WSOA 1O03A 2ZUVA 5FOXA 4EB6B 1ODSA 1AG9A 2AQ8A 2I65A 3CNQS 3OP4A 5EGNA 3FCXA 1KYYA 2H1CA 5C1IA 1IULA 3WDMA 4C3OB 2WT8A 1FNMA 3CUEF 1PYOA 1VZ2A 1XJCA 2QM8A 1XZHA 1NWHA 4NBSA 4RWEA 3O8QA 4CUZA 5ADHA 2BFOA 1CVLA 2J08A 2C9MA 1YI1A 4CCAA 5IARA 4XZ3A 1SC9A 3HWSA 1Y7LA 4GR4A 3NYWA 3EFOA 5AOAA 4A6DA 3T35A 2FPMA 3VU9B 4CMEA 1TVMA 4L5YA 4CQNA 4JJGA 1XRJA 1YS6A 2HJHA 4NJEA 5BN5A 2I33A 3H2JA 2ZTLA 4OP3A 3ZHRA 2V45A 4IO1A 2O8CB 2DQYA 1Q22A 2X19A 5FTWA 1R3UA 4ZPXA 4OHZA 4O29A 1VLJA 2AE1A 1C9JA 5IU6A 4L72A 3A7EA 2GN8A 2DWQA 1BW9A 1HSZA 5E2BA 4GX0A 3DAPA 1T4CB 3GUHA 3T1HB 1TX4B 3IE0A 3HKCB 4G1UC 1M73E 4JR1A 2ZS8A 4WX2B 4X7MA 1YC2A 3VU0A 1JIQA 5EXSA 1R18A 1OT3A 3F3KA 3GJSA 4FOOA 4XB1A 3R2JA 5EE1A 3OSZA 4RIIA 2WWTA 2ZBEA 5LKAA 2OA0A 3G0HA 3BS4A 3Q15C 2C7QA 1XZPA 4DTCA 3I6ZA 1W581 4UMDA 1QBGA 1N5DA 3UJNA 4PS0A 1EUQA 3B1YA 3G5TA 2H17A 3HWRA 5FF9A 5KJFA 4RF2A 4AKHA 2VK4A 1O96A 1NQAO 4LQ4A 1ZUD1 3I32A 5IJ9B 3S1SA 1Z15A 1M67A 1VJCA 4NBLA 2HQRA 4ZAFA 3AM5A 5HR5A 5DBGA 4E5YA 2XIJA 4BGVA 2HC9A 3LY7A 1NJGA 1ULBA 3KR1A 1M10A 3AJ9A 3SHVA 1Z6PA 3IP3A 4KAJA 2OSVA 2VHXA 3BKXA 2YYYA 2VYVD 4U8GA 2ZJZA 2XB8A 3UMGA 4X7PA 4EG4A 5I9NA 3RHTA 1R9NA 3GN2A 1Z06A 2QT1A 2XYRA 1N57A 1TK2A 2DG2A 4WDRA 4DY4A 2O2XA 5TMDA 3B9PA 2OFPA 1MOSA 4WERA 4EW2A 2X2EA 3M1LA 1XO1A 2H63A 4U9UA 3NKLA 3TBKA 1P73A 4X5OA 3RLIA 4MSUA 1FBTA 3RS2A 1T1GA 2GM3A 4ZVOA 1NUPA 3DC2A 3D4PA 3ZWOA 3BH7A 1Z5WA 3I01M 5BOVA 4EJ2A 2BONA 3BRWD 3R1IA 3IJPA 4M8SA 1J9GA 3NPMA 3R3YA 1W1WA 4R1LA 5LZ7A 3RVPA 1OBVA 1EFTA 2PWAA 3EARA 2QTFA 3BN3A 3TEJA 3TM4A 1E2DA 5AXBA 4JUCA 4GDMA 4UASA 1DL5A 2MSKA 5AKYA 1LTQA 1YXMA 1RYDA 2RMKA 1YK1A 1NUTA 1BEUB 4KN6A 1UWLA 3VYWA 1SEVA 2HFJA 3JAKA 1SN7A 1PQYA 2Q29A 1LNZA 1C3OB 3H5TA 3HJNA 4UHKA 1XGKA 4BJ1A 4DCVA 2OB2A 4G6ZA 4CKBA 2C5AA 1VZ3A 4N65A 2HRDA 2QI9F 2O1XA 3DEHA 3P0EA 3LCJA 3SBEA 5ALJA 4BP1A 3PGLA 2SKDA 3L5OA 2NO5A 1A7JA 3E8MA 2C0PA 2QTBA 5FNVF 5U1PA 5JDIA 4HH0A 3V3TA 2CNBA 4GZ3A 1PR5A 1XA0A 3FMVA 4TKZA 2X8JA 1OLXB 3AB8A 4HWKA 3OIDA 3ZDFA 1AUXA 3BJZA 5CDTA 4HPXB 621PA 5GIPE 2ZSBA 5J40A 1J5EB 4ZQGA 5BSEA 4IGAA 1XEWX 3P2YA 3T5BA 3UMYA 2XHEA 3OOYA 3NGLA 5DZSA 2QW8A 2FTKE 4FLFA 1QPZA 2QUAA 4YV1A 3FIJA 1T34A 3M6WA 2W11A 4WDQA 2V9PA 4UTPA 1ZJ4A 3VBEA 1Y4AE 1EM6A 2QVXX 3D5QA 3OTQA 4HAZA 2OAP1 3PDHA 4B3CA 1DQRA 4PX5A 1BJRE 4D9BA 2P1RA 1Y3CE 4IW3B 3L6DA 1UM8A 1JEQB 3IDSA 3LKBA 4MGYR 1T8TA 4F45A 5I6DA 3RUDA 3P27A 3PWZA 4XFDA 5KAPA 1TC2A 1M34B 1Z22A 2XVYA 4GHWA 5HKBA 1NNUA 1W75A 2GHTA 2JHPA 1DBPA 2PRIA 2AWNA 2YIJA 3VSBA 4IGEA 2YYZA 4F5DA 1NJSA 1Q95A 1QFZA 3H83A 2PUVA 3UB2A 1RWMA 4MP8A 1QS0B 4X6XA 3HR4A 1NXPA 1SD2A 3OTHA 3CWZA 3U49A 5GWXA 4BVEA 3R9KA 5IKOA 2OHGA 2YWFA 2GLUA 3PHBE 2V5UA 5TDHA 5JJBA 4AU1A 3H8SA 3AEUA 4IBOA 3FJ1A 1GFWA 4LOKA 4KVGA 3C8HA 4LJLA 4Q3NA 3DBOB 1NNSA 1Y9DA 2PKEA 5D01A 5SY9A 3L8GA 3JQDA 4PC1A 1SFRA 2BZ0A 1JLMA 3GLSA 4BLSA 4L4RA 3ZZNA 3AU8A 1K5HA 1H6DA 2XRMA 2QXUA 2G5CA 1X8JA 4R1SA 4ECEA 1M7BA 4F97A 2FRDC 1VGVA 2ZJ3A 3W3ZB 3I73A 4TMTA 1Z12A 1IRXA 4ZD6A 1VRCA 3UENA 4Y2SA 1H2BA 1H6CA 1NIPA 3RGGA 3GG9A 3BMOB 2RH8A 3EFHA 4QODA 3R0ZA 4XJSA 5IN4A 3LP8A 1FXWF 5ALWA 1QUEA 4W82A 4P3KA 4M7PA 2WMYA 3KXIA 2WWGA 1O9BA 5AVVA 1ZH4A 2OXRA 1QTRA 2H2FA 1YS1X 3ZD7A 1XZEA 2XUIA 3W1WA 2YINC 2PSEA 1KJWA 4AD8A 4F6LA 3FGOA 2ZJFA 4MWTA 2H1WA 3L7YA 4JQSA 4QOEA 5D6NA 4DB2A 3U7EB 1RW4A 4L8LA 2MMGA 2JKVA 5DSXA 1SVUA 5J5CA 3F73A 1G42A 3ELYA 3AL3A 3WK9A 1NUAA 3G7NA 4NE7A 5IHPA 5KSYA 1N2CE 4BEWA 3Q3JB 5HUJA 3VYSB 1X1QA 5JTUA 3FY4A 3PWKA 1QGDA 3NOVA 3LVFO 2BY4A 2FVXA 4H16A 4P7JA 4W5JA 4CIVA 1CK4A 3VU1A 5DP1A 3IE1A 3A9VA 3L7IA 4MO9A 1IYZA 2AB0A 3S70A 3K9WA 4QYMA 1R4NA 2VS1A 1OFVA 3HL0A 1PDOA 2CHUA 4EG3A 1T4MA 2AOTA 3FVWA 4AZ0A 5D85A 3AR3A 3WNCA 1S9HA 3OJXA 2HPAA 4LBZA 4GO1A 4XYEA 2X14A 4A2QA 3CZ9A 4I50F 1U3UA 4K7JA 4TKVB 5TQ2B 2IL1A 1UBKS 4R8MA 3F46A 3FHTA 2V7EA 1Q0PA 4Z1OA 1X19A 2CVFA 2FG7C 3KUXA 1D2GA 4HHEA 2I29A 1JQLB 4OQXA 2SKEA 1T2DA 1EB8A 3H4IA 1VLQA 3IAXA 1YCFA 4BYMA 4P4TA 3Q8MA 4NDZA 4AZWA 3QUBA 5K9ZA 5J4LA 1FMFA 1A88A 3C7DB 2X42A 1E3DA 2POCA 4OCZA 1U2RA 3ZJYA 3L1JA 4DEVA 2LCIA 4JBYA 1O3YA 4TXMA 1X1CA 2H1RA 3R77A 5DX0A 3ONWA 1EVQA 3T7JA 1PUXA 4H7HA 2ADMA 3KL2A 4R69A 3RHZA 1P5FA 1Y3DE 5HF9A 2HH9A 4KXXA 2KBFA 4EI8A 3ACBA 3F0TA 4MI9A 3PNSA 4ILKA 3WWYA 4V0QA 2AI1A 2UV8A 4B4DA 1HI9A 2X2FA 3TSAA 2IU3A 4LJRA 2ERYA 4U7JA 3BGWA 4QELA 5A4MS 1RTTA 1AXGA 2XECA 3UCXA 4DS3A 1IY9A 4Z4GA 2QQFA 4ZVKA 1HL7A 4ITUA 3O4FA 4ZKDA 3KEQA 3MTDA 1EFVB 4Y2VA 3U81A 1X7XB 1OX4A 4ENQA 4KLNA 4G84A 3RK1A 2GXUA 1SU7A 2ZYIA 1CEYA 3M6AA 4DJJA 5LDHA 1W44A 1WMEA 3D1LA 3ESQA 3OCCA 3OEYA 4PAOA 4HGNA 4RZSA 2IPOA 2PSDA 3WHLA 4F21A 5A2QA 2GFQA 1DO8A 3FBWA 4HEA6 1V26A 1XELA 3PU6A 1T91A 3OT1A 3FFBA 4N5NA 4EVRA 3JZIA 1LI4A 2RGNA 2OHIA 2VNSA 2XE4A 2Q0QA 4QNMA 2WTNA 1OFTA 4KRFA 1QWOA 4KPUA 1DTEA 3UY4A 3ZX4A 1XLTA 4M9QA 1MO5A 1JV2B 4ZTBA 2O7RA 5BUSA 3B48A 9MHTA 3ZNNA 1V4BA 3FZNA 3RTEA 3EGDA 2A59A 3OFKA 5EOVA 5F77A 3V4VB 5TF4A 3UJDA 3TVDA 4B7CA 3QKSB 2RKOA 1T8RA 4QXAA 4TZKA 5AVKA 1RHMA 4ICIA 3NGXA 4GP6A 3FMIA 4RM2A 5DT9A 3SX2A 3CF2A 3HI4A 4MW7A 1N36B 4O4IF 2GWRA 3NTVA 4OQQA 1XYYA 4ARIA 5CNJA 4BLOA 2RGUA 2HJGA 5JD4A 3LQQA 4DCNA 1HTWA 1NM5C 4MTLA 2BSAA 2JCVA 2X6RA 3GOQA 4O63O 1Z56C 1AY0A 4FVTA 3LT0A 2Y2UA 3RTCA 4I4LA 3NR2A 4UW9A 4E07A 3F7TA 3AKEA 4BO1A 1PJ2A 4DIFA 1KK2A 4ZJZA 4EYQA 1FZTA 1LW6E 1IJKA 3UFBA 2XOXA 4X20B 4WZAE 2VSQA 4K9QA 1Q6ZA 1T43A 2NU7A 3IUEA 2BCJQ 3K2BA 5JS8A 5K3OA 4PZDA 1ZL0A 3JU3A 4CMJA 1G8GA 5J4YA 3JD0A 1VB5A 2F3QA 2HLPA 4OIFA 3BWBA 4A8TA 4XPIA 1C7ZA 1W73A 3IX7A 2EFEB 4UHBA 4BRWA 1L1EA 3VH4A 4YMUA 3PHLA 1KBQA 5A0FA 1OWLA 2E82A 3UG6A 3WAKA 4A5SA 1JUDA 1V8PA 5EQJB 2AJDA 2XDQA 3KR2A 1JX6A 2X9NA 1X2EA 2E5LB 1E2MA 1NTRA 2YVUA 3O0DA 3Q85A 4LNUB 4WINA 2FN7A 4C88A 4KQFA 5IZCC 4YRBA 3QKUA 2BZGA 1II8B 2ATCA 4FXPA 4BNUA 4LF5B 4V0NA 3NIFB 3S8EA 1P9NA 5JW6A 2IXTA 1E66A 1Z8DA 2QSZA 2VEDA 1TYCA 3W5CA 2G25A 2FW6A 2JDIA 4GPIB 4L51A 4I46A 3WISA 5K45A 4L95C 2BGWA 2QAGB 4BB0A 3UPDA 1XTVA 1XKLA 3V8MA 3NIWA 6LDHA 5GIOE 2JIQA 3FSRA 3P71T 1N6HA 3L8YA 2WAYA 5I7VA 1KYIA 1C4OA 2X4LA 4LC0A 4TT8A 3MJEA 2WJZB 5FCDA 1RYHA 1C0PA 1ZNXA 2H08A 3D2BA 4Q1FA 4IIBA 2HK6A 4W5HA 3SZGA 3R7WB 4RQBA 4EG0A 3WR5A 4ZYZA 4ZOQI 3ZCSA 2UYOA 1Q74A 1Y6QA 1EDEA 1ZKDA 2VA8A 4MQLA 4PX9A 5CA1B 3NORA 4W6ZA 3VAAA 2F43A 4N1AA 2ENUA 5ITWA 3CLTD 3L0YA 1Z5UA 1QAOA 1W76A 4I1UA 1L5YA 2XVZA 1BEZA 3E35A 4IGKA 4TZTA 5ALUA 4YPVA 1E6MA 1ZRNA 2HPHA 2MYUA 1EJBA 2PTHA 2V4MA 4YDSA 4B6PA 3PHCA 1ULUA 1W0KD 2R96A 5LZ8A 2BMJA 1BO6A 2XNHA 4DR1B 3KUKA 5I4CA 5ALGA 2G17A 2Y68A 3AVXA 5AK5A 1H93A 1RLIA 2OCXA 3W5BA 5HM6A 1E0KA 4C7OB 1E64A 2PD4A 1YOVB 2YW9A 3C3MA 1GA6A 1LBHA 2FA9A 2HB6A 3MLAA 1NT4A 4G4SP 7REQA 4V1CA 3ZYCA 3LHKA 2ZYWX 1AA6A 2H00A 1KY3A 2Q5EA 4UCWA 4UHFA 5DHSA 3T5MA 3E81A 1RWQA 2BFFA 4PC6A