2ZLBA

Crystal structure of apo form of rat catechol-o-methyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
212
structure length
212
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 72
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zlbA00
3BGIA 3OZSA 2P40A 4X63A 2IP2A 2AOWA 1X1BA 1JG4A 2PX4A 3Q87B 3IYLW 1AQIA 3BGDA 4LECA 2YUIA 3BZBA 2O07A 2ZZMA 1EJ0A 2XYRA 2AOTB 3LBFA 5FULA 3HVKA 4QDJA 5GOZA 1JQEA 4YV2A 1FPQA 1AQJA 3LECA 3HCAA 3DMGA 1VL5A 4ER6A 4YV0A 1R8YA 2ZWVA 5CM2Z 2QE6A 4RTSA 2I7CA 3GRVA 3K6RA 3P9CA 2NNWB 2O0LA 5HOQA 3A25A 2PXAA 4OQEA 1RI3A 3KPVA 3GDHA 4PIMA 3E7PA 2V74B 2HV9A 5GIOE 1L3IA 4YMHA 1YUBA 2ZLBA 5EEGA 3ERCA 5EIFA 1M6YA 2PWPA 5KS2A 3K0BA 3HCFA 4RWZA 4RTKA 2QM3A 2NXJA 3O4FA 3LKDA 2NYUA 2CKDA 1VLMA 4OBXA 5DSTA 5EMLA 5DM1A 3VC2A 5EZSA 4X60A 2OB1A 3EEYA 2B9EA 3B89A 4MQ4A 3KQQA 4CWAA 4PYKA 3LDGA 3JWIA 4DMGA 3HA3A 3IEIA 5D1HA 4EKIA 2O57A 2NXNA 3UA4A 1R8XA 2PX5A 4EQZA 1D2GA 4C4AA 3REOA 3KQMA 2AOUA 4GOOD 5KQSA 1AF7A 4DA4A 1VE3A 1XVAA 1MHTA 2G1PA 3SM3A 1VQ1A 1ZHFA 3BWMA 3LGAA 5FQOA 5EEHA 3PTAA 3TFWA 3LCCA 3SXJA 1XTPA 2OBFA 2ZFUA 4L7VA 1QYRA 5E1BA 1NW3A 2ZBRA 2YXLA 3MTEA 3KQVA 3GRRA 1M6EX 4KW7A 5EHIA 2IGTA 2B25A 3FPFA 5K0CA 4FP9A 3JWHA 3I9FA 1ORIA 2A14A 2I6GA 3OFKA 2HWKA 1YF3A 1T43A 4PIPA 4PYIA 3P2EA 4A6EA 5F2KA 5F2NA 5EC8A 4ZTBA 3FZGA 5C0OE 5T67A 1OR8A 2C7OA 4YUXA 2AVNA 2Y1WA 2VP3A 3C0KA 1G8AA 2OKCA 3EGVA 4CKCA 2XVAA 3E23A 3OZTA 1N2XA 2ZW9A 3KHKA 1ZQ9A 3FTCA 4ISCA 1RJDA 3R24A 1N7JA 3T7RA 2C7PA 3LX6A 2ORED 3OU6A 3GXOA 4M37A 3KQWA 1KXZA 3PLAE 1DUSA 1NV8A 4Y2HA 3SSOA 2G8NA 2Q41A 4GF5A 3UWPA 4RV9A 1TPYA 1XJ5A 1QAMA 2ONZA 3C3YA 3TM4A 3P9NA 3G2PA 3UJDA 4RSRA 2ZIFA 5DM0A 4A6DA 4EK9A 5BP7A 5LQUA 4HGZA 3UJAA 2EJUA 3HCCA 5E8RA 4ER3A 1ZGAA 3Q7EA 5E9JA 3HCBA 5EOVA 4HH4A 1PRYA 2PXXA 3TR6A 4U7TB 1EQAA 3IV6A 1G6Q1 2GA9A 3HVIA 2AOXA 2OYRA 1XDUA 1F38A 4KDRA 4BLWA 4F86A 4WXHA 5BW4A 5C9ZA 5DX0A 2BR5A 2ZBPA 3CCFA 4P7GA 2P8JA 2AN5A 4C08A 4E32A 4YUYA 5E1OA 1ZG3A 1RI2A 1ZKDA 3M6UA 5DTRA 4DCMA 1O54A 1XXLA 5HEKA 2PVCA 5DWQA 3G2OA 3KU1A 4HRAA 2EJTA 1SUIA 1VBFA 3DULA 3F4KA 2NP6A 4QVKA 3GIWA 3I64A 2QRVA 1B42A 3G2QA 3BWYA 1RJGA 4KDCA 2OO3A 4BY9E 2I9KA 2FPOA 4OA8A 4E2XA 4BLVA 1FBNA 4AZWA 3HA5A 2ZBQA 4IWNA 1WXWA 5M5BA 2GPYA 5K05A 1BHJA 5JR3A 4C07A 2H1RA 1NE2A 4V0QA 3VC1A 3FYCA 10MHA 4YMGA 3EVDA 3R3HA 3EEOA 3FUTA 3C3PA 1EG2A 5CVDA 1SQGA 3LPMA 3EGIA 3P2KA 5GP1A 9MHTA 1JG2A 3TLJA 1I9GA 3CKKA 4LWPA 3THRA 1MJFA 2AR0A 3O7WA 4BP1A 4YUWA 3ER9A 1SKMA 4RVHA 1DCTA 5FHRA 3LKZA 4FT4A 1FP1D 1VIDA 3OFJA 5FCDA 1FJXA 4CKBA 3UJCA 1P1CA 4F85A 3UJBA 3UZUA 1QZZA 5K0LA 3OU7A 5E1MA 5FA8A 3U81A 1R00A 3UA3A 4PGHA 3VSEA 2HR1A 2WA1A 3G88A 2PT9A 4KIGA 3CJTA 4MWZA 2AOUB 3GWZA 5CVEA 5EKUA 2P3LA 5E9WA 5K0EA 1Q0TA 4H0NA 5KQRA 4PINA 1WG8A 2GH1A 2ZSUA 1TW2A 1NBIA 1R6AA 2AVDA 3G8AA 5LQCA 1XDZA 2PX8A 4RVDA 1JQ3A 3M6WA 2Z6UA 3SMQA 2NXCA 3G5LA 2HTEA 2PKWA 2VDUE 5HZMA 3JWGA 4F84A 4HTFB 4M7RA 5LQNA 4KWCA 5P8WA 1NW7A 5K09A 2JHCA 4P7KA 5GM2A 1VP9A 4K6MA 4E31A 2ZULA 2EG5A 4GBED 3B3GA 2BR4A 3NWBA 5FUBA 4C05A 4QQKA 1KIAA 2R6ZA 5K0BA 1QANA 3GO4A 4MIKA 4KVZA 5EHGA 3E05A 1YB2A 3P2IA 5DXAA 5IKMA 2JJQA 4EVIA 2YX1A 2OPBA 2P35A 3ELYA 3HA7A 3CJQA 4PYOA 5LSAA 4GEKA 1XCJA 1PJZA 3FUVA 1N7IA 5EMKA 5BXYA 3EVBA 3ELDA 4NECA 3MTIA 3UJ6A 4FSDA 3NW9A 4PNEA 2JG3A 3PVCA 2WA2A 4P7FA 4HG2A 3A7DA 4FGZA 5DRYA 2OXTA 4DZRA 1EIZA 4HSGA 3GNLA 4PCLA 4PWYA 3MHTA 4FT2A 4XCXA 4ER5A 2ONYA 3DXYA 3TQSA 5HIMA 5DM4A 3NDJA 4PYLA 1L3CA 2P7HA 2AOTA 1JR4A 1X19A 2QYOA 3A4TA 2JH8A 4DM3A 3HTXA 2PWYA 1IM8A 3DH0A 3V8VA 3AWIA 5FWDA 3EVFA 3KPYA 4ATNA 3RW9A 2PT6A 1KHHA 4AZTA 5K0JA 3NJRA 4RTRA 1NKVA 3PS9A 4GC9A 4R8RA 4RTMA 3UJ8A 2G71A 3B3FA 4R6XA 2BZGA 3MB5A 3LHDA 3R0QA 2YXDA 5DRTA 4RTJA 2AN4A 2N47A 3HP7A 2AN3A 3C6MA 1NBHA 5K01A 3OE4A 3FTEA 3M70A 3ME5A 1WY7A 1WS6A 5T64A 4HC4A 4MHTA 3HNRA 1UFKA 3B3JA 2GB4A 2VZ9A 2B78A 2ERCA 2YTZA 5C1IA 2IIPA 5BW5A 4CXMA 5FHQA 1RI4A 3P8ZA 4E33A 4XUDA 1WXXA 3QOXA 1FP2A 2GAFA 2FRXA 5DT2A 2PV0A 4DKJA 2IH5A 1Q0SA 1ZGJA 3EVCA 5EGSA 4BP3A 2GLUA 2WK1A 2JHAA 1BOOA 3AXTA 4E30A 4O29A 3DMHA 2DPMA 3AJDA 4M36A 3QOWA 2UYOA 2BM9A 4HGYA 3HCDA 2JHPA 4QVGA 5EMJA 2P3OA 4LG1A 3BKXA 3T0IA 2XBMA 3FTDA 3SGLA 3SSNA 4QTUB 5DTMA 2F8LA 1SG9A 3LDUA 5HIKA 3HCEA 3HEMA 2EX4A 5DX8A 4CKEA 3KR2A 2B3TA 1AV6A 3ELWA 1VP3A 4POOA 1RI1A 3B7PA 2CL5A 4PYQA 1NW8A 3KR1A 1JQDA 3GU3A 2JH9A 4GQBA 1QAOA 5GM1A 5DM2A 2EFJA 5CVVA 3UFBA 2YR0A 3TKYA 3HM2A 5EPEA 5EVJA 3THSA 2ZTHA 3E8SA 3B5IA 4GC5A 3LBYA 1O9HA 4RTLA 2ZVJA 3QV2A 3CGGA 1H1DA 1EJ6A 3L8DA 4QTTB 5H02A 4C03A 2P3QA 4DCGA 3LCUA 4KIFA 3KQSA 3TM5A 5B1SA 5FWAA 4CTJA 5K0FA 1X1DA 3LDFA 4OA5A 4JXJA 2IBSA 4X61A 1JTFA 5JUWA 5CD1A 5CCXA 3NWEA 2OZVA 2HNKA 3DR5A 5GINE 2Y1XA 1UIRA 3TKAA 3ID6C 8MHTA 1KYZA 3KPJA 4YUVA 2IDKA 3DLIA 4X1OA 3GRYA 2HMYB 2E5WA 3X0DA 3JWJA 3NTVA 3DTNA 1HMYA 2PBFA 4E2WA 4EMSA 3SSMA 7MHTA 3NVKI 3G89A 2PX2A 2IH2A 4PCAA 5E9QA 2LD4A 2G72A 3OE5A 3BWBA 5E1DA 4RTPA 2G70A 3BGVA 3FPGA 3D2LA 4YUZA 4V0RA 5K0GA 3BUSA 5LQAA 3TPZA 2PSSA 2Z6QA 3VYWA 1D2HA 3EVAA 4FZVA 2IFTA 3BWCA 3CC8A 3LSTA 4XUCA 5D1NA 2NP7A 4KRGA 2VDVE 3M6VA 2DULA 3RODA 3FRHA 2KW5A 2B2CA 2IPXA 1R18A 3P97A 4GUAA 2UYCA 3UJ9A 2I62A 5ERGB 3S68A 5U4XA 4GOMD 4RTNA 3EVEA 4P58A 4RYLA 4R05A 3V97A 4C06A 1M0EA 3KPWA 2YXEA 1DL5A 2BH2A 3PFGA 1TW3A 1X1CA 2C7QA 2FK8A 2H00A 3DOUA 5CVJA 5EQJB 5KYGA 2UYQA 3KQOA 3KPUA 1X1AA 1KP9A 1R74A 3FYDA 4FSXA 4G56A 1V39A 3O31A 3ER8A 5K8VA 5F2OA 4E2YA 4AZSA 3MQ2A 2P1DA 3GCZA 1KYWA 4IKPA 5EIWA 3WSTA 3ELUA 2AOVA 5ICCA 3I5UA 1IXKA 2QY6A 3LL7A 2O06A 1JG3A 1NW6A 3OZRA 1BC5A 5DSXA 5KVAA 3TOSA 5FTWA 2BM8A 2O05A 4RTOA 3TRKA 2UYHA 4AUKA 1JTEA 5E2AA 5IH3A 1L3BA 5DX1A 1JSXA 1NT2A 3A7EA 1Z3CA 3FRIA 1NW5A 5ICGA 4Z2YA 1YZ3A 5CCBA 1NV9A 5HIJA 3EGEA 1RJFA 2ZIEA 4XUEA 2H11A 5EZQA 3AXSA 3C6KA 3FPEA 2AS0A 4GOLD 4PGGA 5DPMA 4ER7A 4WVLA 1YFJA 2C7RA 1O9GA 2XVMA 3FUXA 4OQDA 2ZZKA 4FR0A 5ICFA 4E2ZA 1JSZA 3EVGA 3FTFA 3LCVB 3OPNA 1U2ZA 2R3SA 1UWVA 3I53A 3MERA 4P7JA 3SR4A 4QPNA 4HTFA 3A27A 5LQJA 3P9KA 5HIIA 4UOEA 3G5TA 3PX3A 3GRZA 3KQYA 1XDSA 2QRVB 2YVLA 3T7TA 4RTQA 5CIYA 3IHTA 3KR9A 3M4XA 3PT9A 5EMMA 4IV8A 4CTKA 2FHPA 2FK7A 3NMUF 2P41A 2Z6AA 2IDJA 3G7UA 4M38A 1SUSA 3DLCA 2IBTA 2ZWAA 2CWWA 3HVHA 5E8JA 2ADMA 2ESRA 5E2BA 3TMAA 5FADA 3MCZA 3CJRA 2FYTA 3KR0A 1YZHA 4AX8A 1KPGA 2V7EA 2AZTA 2CMHA 1XCLA 2XYQA 1KPHA 4YV1A 3PB3A 5GIPE 2NXEA 3SVZA 3NDIA 5FQNA 3A26A 1KPIA 3FUUA 4OBWA 2PY6A 3KQPA 5DTQA 3H2BA 5K0NA 5T6BA 1G55A 3T7SA 4IV0A 4QDKA 5LQRA 2UZ4A 2YQZA 3DMFA 3MAGA 1P1BA 2BR3A 3CBGA 3BXOA 3FUWA 3GJYA 4MTLA 2FCAA 2OY0A 1SQFA 1HNNA 3FPHA 3UJ7A 2PGXA 2PXCA 2PLWA 3ANXA 3R6TA 5DXJA 2VS1A 3EMBA 3PFHA 3MGGA 4QQNA 1WZNA 4DQ0A 5CUQA 1G38A 1P39A 4X41A 3GRUA 1INLA 2CMGA 2IH4A 2GS9A 2VDWA 1I4WA 1L1EA 3KKZA 1I1NA 3OCJA 1QAQA 5HILA 3G8BA 1SVUA 1P91A 3BKWA 3ORHA 1EAMA 3GGDA 1ORHA 3CVOA 5DLYA 1RI5A 3BT7A 5HFJA 3EVZA 1RJEA 2XYVA 3HVJA 4PYNA 5EG5A 4PYMA 4EKGA 1YFLA 5LQKA 1L9KA 3DP7A 1G60A 5CVUA 4ER0A 1VPTA 2PJDA 5ICEA 4OX9Y 4FS8A 1D2CA 5GWXA 3RIEA 2P7IA 5K03A 4GOND 3MCTA 4LWOA 4BLUA 1F3LA 4U7PB 1G8SA 3SX0A 5LR6A 3OU2A 3AY0A 3M33A 4E70A 4QPPA 5EKXA 4DF3A 3EPPA 4PONA 4C04A 5FA5A 3DUWA 4RVFA 1IY9A 1BKYA 3M6XA 4RX1A 4B17A 1JG1A 3G2MA 5G02A 4PYJA 3UBTA 4Y30A 2ZCJA 3DXZA 3P71T 2OB2A 3DXXA 4R6WA 3KQTA 2ZZNA 3R9XB 2K4MA 3NVMB 5MHTA 2ZIGA 1KR5A 3P9IA 4AZVA 3EMDA 4RVGA 3FPJA 3I58A 1Y8CA 3PX2A 4R8SA
chains in the Genus database with same CATH superfamily
4D9FA 2EC5A 2HJHA 2D7DA 3DYIA 3HVUA 1LC3A 1EA7A 1PL8A 1X1BA 1L5YA 2BFDA 3C5CA 3C8UA 3Q87B 3ZV5A 3N8HA 3NIWA 3WWDA 4BP9A 3STYA 4AZ0A 2BMEA 1CS0B 3BZBA 3PC8A 2BZSA 4CIYA 1CNEA 1ILWA 1UKAA 1UR5A 3GLSA 1GQRA 1JQEA 1JQKA 4OQYA 3HCAA 2PZAA 1W8IA 2YHIA 1ESNA 2WWFA 1R4NA 2ZANA 3DBHB 1OOEA 3OHSX 3PJGA 4FFBB 3WOHA 2I66A 3SAJA 4UTNA 1SCBA 1W9MA 2EBWA 2VYVD 4G23A 4EB3A 3IBSA 2O8EB 1XX6A 2PXAA 4PPNA 3VHLB 4O1IA 4V1CA 4PO9A 3H5IA 2H5LA 2VHJA 1L3IA 1RRFA 4AJHA 4YMHA 4ZGBA 3UCXA 3U4QB 2JGDB 4BE7B 1T9BA 1Z6ZA 4MW5A 1FSZA 4CM8B 3H87A 1GYQA 1SOAA 3LKDA 3N2KA 5JNRA 2AFHA 2ZUDA 3VZQA 1E4EB 2OB1A 4MQ4A 3OCVA 3OPQA 4KX3A 1RWOA 3W6PA 2PCJA 3HYLA 1EDOA 4J29A 4B6RA 4X24A 1DOZA 1MW8X 3CONA 1GCAA 3E7DA 3ML1A 2RAVA 2VAMA 3RRZA 1V7PC 2BP7A 3KQMA 1AF7A 3GJTA 5LB2A 4UXJA 3ZJ4A 2J9FB 1PJ2A 1ZZGA 4IQGA 2OXEA 4RPGA 4U7FA 1FFXB 4ZV9A 3WLEA 4B7AA 4LYDA 4R9NA 2EJWA 4GI3A 1NVAA 1VIMA 1F1BA 1ZICA 3Q5EA 3TLCA 1GVNB 4O4HF 4LY9A 1F17A 1ORWA 4YMTA 2I8CA 3THOA 4LMAA 2MOKA 4EUNA 1U5BA 3IMEA 4O6VA 1U0TA 4DUZB 1NY6A 4FYIA 1ORIA 3UM9A 1B3BA 5IAGA 4RVNA 1GARA 3SLGA 4E22A 3KKPA 1PBNA 2IXEA 2FAXA 3ZTWA 3X2SA 4EG7A 5T67A 2EDCA 4PG6A 2Y1WA 1ISSA 4YLYA 3AIOA 3C7AA 3OZCA 1KI9A 1JXMA 5AKEA 4DTIA 2XVAA 1DQPA 2PS3A 3FYUB 4KP7A 5J3JA 2E1RA 5DN9A 4QICA 1E9CA 3PIIA 2ORED 1C0KA 2H2AA 1EWKA 3KYIB 2W6QA 2O8DA 2WF9A 1GGVA 1DUSA 1NV8A 1N2SA 2RI6A 2G8NA 5E7MA 3PDJA 1BQ3A 1NJFA 5AHRA 2ONZA 5HM8A 5KYKA 2G0AA 3R3VA 2IU0A 3CIOA 4JLKA 5LQUA 4Y0NA 1ZD5A 3SIPA 5CD9A 2IWRA 3QTTA 3PNBA 1ZGAA 1FQJA 5AI6A 4B47A 4IMJB 3ROPA 1QXSA 2FMUA 1ULUA 3LBHA 3RC2A 1R6BX 2IYZA 1FNDA 2JI4A 3OZWA 2GA9A 2QL9A 3AR9A 1C0LA 1QP7A 3CV3A 4HAWA 2HLDD 2B2XA 1F38A 3EXFB 2VSQA 3TB6A 2RHGB 3EC1A 1Q5PA 2M6LA 2NUPA 1B8UA 4XVHA 5H4GA 2P2GA 2P9ZA 3RJMA 4OFXA 4ROTA 3NBZC 3WTBA 3EXIA 5EQDA 2CHFA 4IV5A 1K66A 1YO6A 4A91A 5M2QA 1B6TA 1W93A 2FZEA 2JGFA 3M6AA 3U0BA 1KYIA 3OESA 4WKOA 1GPKA 2RGNC 2KBEA 2DH6A 4QEDA 5EPOA 1M1NA 3OTHA 3WQQA 2QVZX 4BKMA 4IP0A 2GO1A 1L5FA 2CD7A 1J7JA 1USUA 2TS1A 5D3KA 4D99A 4FI3F 3AUTA 2RAUA 2F00A 1FQKA 2BELA 2PMEA 1VG8A 3WGVA 1KOGA 2XF2A 4EEXA 5JCOA 4V0QA 3HCWA 1DARA 1YZQA 4BWFB 3LCRA 1OAKA 2QMQA 3EVDA 4ZJUA 5CLFA 3EQ2A 3GHYA 3BULA 1CQIB 2OKGA 1GRQA 3NUGA 3AVUA 2ZUEA 4RIEA 1TMKA 2Q3JA 5D3MB 1YZUA 3STTA 3WWZA 5EJEA 5LMNB 2C92A 1GTRA 3HB5X 4N48A 3DCYA 2V7BA 3TAUA 1NF9A 1YS2X 1SM4A 3AIKA 5F76A 3OLVA 1MZVA 2YJ5A 4M88A 3JR3A 2YS7A 4YAOA 5IFKA 1OE0A 1HA3A 2J4CA 1UBCA 1Y89A 3H97A 2FCRA 4J6EA 4BZQA 1MVLA 2O20A 3AKCA 1YQEA 2QVLA 4BBAA 1V0JA 2C1EA 4PINA 1EFTA 3FNGA 4G0YA 5DTIA 3TQRA 3FN4A 3BMCA 3K1YA 5AIAA 1E0SA 3QIVA 3GCGA 4QPZA 5L3SB 1E7QA 1P4AA 4ZAWA 2D2IA 2FFHA 2H8GA 1YVRA 2L18A 3H4MA 2GYVA 1S8AA 4P34A 5GM2A 1Q16A 2IUTA 1VMKA 5AJZA 5EWLB 4ESEA 1R0YA 3PUIA 3OM1A 3RYFB 2JCXA 4ZVKA 2GEJA 4ZCSA 1H2XA 1U0HC 2VZ8A 2VDMB 2X0KA 3EEQA 3RAPR 5JDCA 5CLGA 1EUZA 1FDVA 2TMYA 1NC1A 4MQEB 1TB4A 3GO4A 2DQSA 4IYJA 4IGFA 2C03A 2XJ9A 1SQSA 2MR6A 2Z3VA 1RYNA 5C1DA 1HG0A 1OT5A 3P2IA 1TECE 2ZSDA 1OLXA 4KPEC 3QMVA 3ZVLA 2P35A 1J8FA 1LS6A 3AB3A 3C3DA 3HA7A 2ZJ4A 3QPUA 1IMJA 1TK9A 4KAJA 3UH1A 4O08A 3ZUPA 1MOPA 1Y0BA 4JUCA 3U4DA 1CVRA 1CDEA 1GZHB 4ARBA 2F3QA 3DBOB 3QWHA 4V0KA 1J9EA 1JBKA 1U3WA 1YS1X 3K8ZA 4N3NA 1AKUA 1RXCA 3NATA 3HDHA 4EOGA 2JKVA 2HCRA 1EIZA 3FUCA 5FNVA 2Y0DA 4YFYA 3B8EA 3QBVA 5TNXA 4B0PA 5JVDF 1HDGO 1TO2E 1WHSB 2YRFA 4LZJA 1FOEB 1T8SA 4ZYWA 1N33B 1TQ2A 3EA4A 2JH8A 4L76A 3AX6A 4QOEA 4P4NA 4AJIA 3EVFA 4ATNA 3OURA 1AJEA 4NH0A 2E21A 2FHSA 2W6ZA 3DZGA 3L1JA 1YKSA 3DV9A 3PS9A 4K7JA 1DHRA 1E2KA 3K0EA 5DW3A 3UJ8A 4B32A 2X8LA 4D3FA 4X20A 3C6BA 4WSOA 1ZJWA 2AN4A 3DFFA 1WW3A 1XVUA 1DC5A 2VDJA 3QXXA 5KYNA 2ZCUA 4KYIB 1JDZA 4AYXA 2ID4A 2FGJA 5K9ZA 2I0FA 2OCDA 1JFSA 3IODA 1Z63A 1H4TA 4DKJA 4W63A 5E6RA 4QT0A 5JXJA 5EKDA 3EA0A 1Z25A 1ZGJA 1F1JA 3DHVA 5CM9C 3MQ4A 5IM5A 4LN1A 4MVCA 3F3SA 4JDUA 5SY4A 3N6VA 2G04A 3G2NA 3K0AA 2C5GA 1DIHA 4OO3A 5WRFA 1NXQA 1O8CA 2WSIA 3R5HA 2BHSA 1I6KA 3IO5A 4Y7CA 5LL6P 4KQKA 2DBVO 3SE7A 3EWAA 3SGLA 4BNWA 3O8DA 2EQ5A 1C1YA 1I80A 2VHVA 3EVNA 1YE3A 4O2AB 4RIGA 3Q4GA 1XFDA 1N1DA 2LZ0A 4JP3A 1X1EA 3ESQA 3HZZA 4PQYA 4Q9LA 2ON6A 3L2OB 3ELWA 1POWA 1XTJA 4DWVA 3S3TA 1Y3AA 3QQPA 3OCCA 4BXOA 5ELLA 5HDBB 5K1ZA 1VLLA 3JARB 3IUYA 3N9IA 3QUQA 4E13A 1W25A 1YQXA 2SCUB 1FU8A 5JSZB 2O8FB 3PX7A 2YOHA 3BRCA 5J2TF 2HIMA 4UXHA 4XQ9A 2H3EA 2BEKA 2EHDA 2X5JO 2ZR8A 3EY9A 3PQFA 3RPEA 1G2IA 1VBNA 2EKBA 4MS1B 4EATA 4DPLA 1LTKA 3RTCA 2KM1A 1PFQA 2DHRA 5ALMA 1TJ3A 3SN6A 4C4SA 1YJAA 5CNIA 2BM0A 4F60A 5THXA 1U2PA 3VM6A 1H3EA 1HE3A 3DG9A 4X61A 1E58A 3OFSA 3SHOA 2BY4A 2QHXA 2J6HA 3D4LA 2WOOA 2AUMA 3DWGA 3T3IA 2PVSA 1SCIA 3K35A 1UIRA 1LKZA 2COKA 1UBTS 3ZBPA 4BX3A 2XV1A 2ZI6A 1WB6A 2VNIA 1U2GA 4FOTA 5G3ZA 3VR4D 3STHA 4KBYA 4LDRA 3OFVA 4PHGA 3A36A 1HNXB 3SSMA 4OQMA 4BMSA 1YVPA 2OK7A 1B6RA 1MO6A 3EDCA 1NTRA 2F62A 2NM0A 1ZCBA 3FZNA 5E9QA 1WRBA 3T1OA 1RRCA 3PC2A 1M6VA 3BMOB 5E1DA 2NTVA 1G4AE 2RGEA 3T1QA 3RS9A 3KE9A 2Z3WA 5AW2A 4B6FA 1Z5ZA 2CLIB 4NABA 3KB6A 3C3KA 1UIMA 1Y9EA 4R8KA 4CEIB 4LZOA 1T5TA 2ZSFA 3TZKA 1E99A 2RCNA 3P27A 2OL4A 3E70C 5D1NA 2CFCA 1M0TA 1PEYA 5DBOA 2XMSA 3QG5A 3FRHA 4CIXA 1R18A 3U1VA 1QX4A 3AFIA 2XIQA 1F20A 2ZIWB 3MILA 3RRJA 4BQSA 1DRWA 2P0EA 1OASA 3KAJA 4TV8A 4D0SA 1TT5B 2WIGA 4X65B 1M0EA 4HRVA 1IK4A 3DEYX 1N9GA 2CVQA 4MZXA 1VYVA 5J9FA 2WF8A 3K32A 2QN8A 1XVVA 2XECA 3IVXA 1GGNA 1QG2A 3VZSA 2ZUSA 4H0FA 4ZALA 5EXXA 1T2VA 4ZT3A 3VVBA 3UBTA 4G8BA 4PZLA 1XZNA 1H2AS 3R5TA 4FSXA 1HE4A 4GBMA 4KPGA 1T8PA 4MW2A 3UCEA 1AU9A 4DJDC 2AJBA 2OGWA 1SOWA 1FXWA 3AIIA 3JYLA 5EI5A 2ZXUA 2OSBA 3KS9A 3GLFB 4GECA 4PR3A 1BXRB 4ZREA 4TXMA 2HK9A 2P6UA 2V59A 3Q40A 4G24A 4RA6A 4B7UA 3ZLJA 2QMOA 4JVSB 4KPFC 3T12A 4YQZA 2BFFB 4EENA 1LBEA 4L75A 3WB0A 3AP1A 2XAUA 2CFTA 4UW9A 1NLMA 3VSCA 2PDAA 3OOHA 3FFAA 3OSUA 4TYPA 5DBGA 3OTWA 1Q0PA 1ONBA 2OORA 3H6KA 2VTBA 4NCAA 4JI4B 5EZQA 3TR5A 4AP5A 4I4CA 1VCMA 2YDYA 4WUVA 5BSMA 3UK6A 3ZXSA 4CQMB 1WU8A 1YFJA 1H6DA 2B8JA 4OQDA 1P3Y1 1AQ6A 3EVGA 4CM6A 3ZHUA 2XBUA 1RXYA 3KB1A 2W2XA 1VIAA 1KORA 2R8EA 3PYXA 5A2QA 3MERA 5K8LA 2G77B 3H2KA 2PAFA 3PWSA 3VAYA 1HDYA 4ZANA 4PR0A 4YHHB 4EO4A 4G1CA 1XCGB 4UFPA 1L5SA 4NQZA 3QHAA 3TPCA 1UPAA 2C04A 3K9NA 5DNAA 3VTKA 1DT5A 2QRVB 5AUNB 4CLOA 1VI2A 1UBHS 1VKHA 5AK5A 5F23A 1QJ4A 2E6KA 3E0QA 2JRCA 3UC9A 1F7VA 3ZHVA 3MB8A 5A03A 2IBTA 2ZSEA 3EC7A 2O8VA 3ABQB 1COWD 1E7MA 1KFBB 1SBZA 3DVLA 4EW1A 4HAYA 3E6AA 4J07A 2I8AA 2ZRMA 1F14A 1ZOOA 3NUZA 5IYZB 5ESRA 1TK3A 3DTVB 2DYKA 1XYYA 1U2DC 3P2MA 1MC1A 2NUBA 3PB3A 4W82A 5FI1B 1DXYA 2SNIE 4BO4A 4CHTA 3K1AB 4DE5A 4BKPA 3AR4A 1NRIA 1TUBB 3MAJA 1JR3D 2ZM5A 3PIRA 2GLTA 1G55A 1NVTA 1DFHA 2AFIA 4DCVA 2XXAA 1A97A 1LVUA 4UASA 5F7XA 1W49A 3KZOA 4GEGA 3YASA 1S8FA 3GF4A 4U2DA 2V6BA 2XMDA 1ECCA 3L9XA 4ZXPA 5A9TA 3RT1A 5ERYA 4W5JA 1KU6A 5KPJA 5JSHA 3CW2A 5FI3A 4I4IA 1YNOA 2IH4A 3ASUA 2GN0A 3MSXA 2I9PA 2C2OA 4HK4A 1TEZA 3WGMA 4NAVA 1Y8RB 1YJXA 2DTXA 4IDCA 2WD9A 2Z4TA 3NKLA 1NPYA 1WUTA 2CLHB 4WECA 3OMLA 4G26A 3PFCA 4LA4A 4Q4JB 5F77A 3ZWMA 1OZAA 1CW2B 4B46A 3E7WA 4OK3A 4LWOA 2ODAA 3Q9UA 5BXQC 1V2HE 2JATA 2D5IA 2OAQ1 1KY2A 4JBNA 3AY0A 5CT9A 4E70A 1T0UA 4XIFA 3VPBA 4RF2A 4RVFA 4ZQBA 3TRHA 4P98A 1STOA 5AVSA 1UOQA 4P0TA 1MB4A 3OZVA 4KLZA 4KQ9A 4YRQA 1EUDB 1JIKA 4MQLA 4ECEA 5JNVA 3TK1A 4DIUA 1JDBB 4U4AA 1J42A 1E2HA 2HUNA 3GA5A 4IFIA 2KMLA 1C1HA 4G1FA 4HYQA 4NP6A 5MHTA 5CAEB 1JN0A 3C45A 1Q15A 3IP7A 4HSEA 4B3TB 4EYQA 3K7EA 3MW8A 2E5LB 2GN6A 4YT2A 2P40A 2Q7DA 5C8VA 4LRWA 1T6XA 1SUEA 4FCCA 4HB4A 3R7WB 2AF3C 1FL9A 3GLFE 2IEIA 1MC5A 3ZDCA 1E32A 1BAPA 1EJ0A 3FNEA 1SURA 4FNOA 1PYOA 2REBA 1P45A 2VQDA 2ZWMA 5AICA 3IPCA 4QDJA 3WFIA 2NO4A 3FKSA 3PA8A 2NAFA 4FGKA 1X7WA 3DMGA 4M1QA 1U9IC 3IAS6 1IVNA 1GUBA 1NYLA 2I6QA 2QE6A 3HUUA 3QUAA 1NXVA 4KQWA 4ZT6A 4HFJA 4DLKA 3MA0A 5M04A 1L4LA 5ALUA 1ZMOA 2HMWA 2LUOA 4IQ0A 5HOQA 2H4HA 1FRZA 1KO5A 1XVTA 4P9NA 2RGRA 1MNQA 2H06A 4MA5A 4W99A 3LYLA 3N07A 16PKA 4G84A 4ASUD 3E03A 3UHPA 1MW9X 4WCFB 5JI2E 4K8RB 4JX9A 2Y1CA 2YZGA 1FRFS 2WF5A 4JLBA 2P62A 4MI1A 3TSZA 1D7OA 3BB3A 5DSTA 3WGJA 4Z0HO 1MT0A 5EZSA 2UZ1A 3G1UA 3FCXA 3CRZA 3D6HA 5I8WA 3DVSX 3JWIA 2W71A 1TCVA 2H3HA 2YXPX 4J16A 3C85A 4UKDA 4HXYA 4EKIA 4GVXA 1NYQA 3MTAA 2JFZA 1OWOA 4G9GA 1L7QA 4ND3A 4RHXA 1ZN2A 4DA4A 4JYAB 3BL5A 4CF6A 3KT3A 3WO1A 1YDWA 3K9BA 1GYPA 1SBNE 2QRMA 1L9XA 3M5CA 3OJXA 1XA4A 2HXSA 4MW9A 4V0OA 4B3DA 3FZYA 3NFRA 3JSXA 2RJ3A 1CNMA 1KI6A 3K4PA 5BO5A 3AGPA 4XR9A 2PEZA 2W2NA 1UFQA 1O5IA 2YXLA 5DHPA 4A16A 2R7AA 1A8UA 2MYTA 2QVCA 2RFLA 4LNUB 5DXFA 4QPDA 3L6BA 4YJKA 2XH8A 3WRWA 1OZ0A 3HXMA 2J9ZB 3B2QA 3FAKA 1E2EA 1WCIB 4U2GA 1V7ZA 1NVVR 3Q10A 1XWIA 2YC4C 4G0WA 1KI1A 2YW2A 2QP4A 1Q7GA 3D81A 3JTMA 1OBOA 4XD7D 4V0ME 1G7RA 2BFPA 3LOQA 5ALHA 4Z49A 3KXLA 3ZQJA 3PBKA 1ODTC 1JP7A 5GVRA 4DADA 1IUPA 3QPDA 2HIHA 5KIAA 3QJGA 4QAJA 2ZE5A 3OZBA 3B38A 1NF2A 1YR7A 4X1IB 4GZ6A 4DMUB 3DDCA 1RFLA 1XAGA 4PFQA 1RPAA 5EQFA 2Z4RA 2WHRA 2A86A 2VPYA 1XDDA 2PL5A 3OT1B 1BMQA 4JGIA 3ZJ5A 4EK9A 5BP7A 4HGZA 1MA0A 2Z8ZA 4ND7A 3UBMA 2FE1A 3VR6H 1J0DA 3K70B 3AF0A 5EKSA 3IJ5A 1D1SA 2FPLA 4ZQEA 1II8A 2A5DA 3CLRC 1YMQA 3MGAA 3PPWA 1V5GA 5IBPA 2AOXA 1ZCAA 3V7FA 4KDRA 4PGFA 1A9ZA 3Q6IA 3U49A 1E94E 1QHFA 3H9EO 4O33A 5CTJA 3UVEA 5KDDA 4ZOCA 4C08A 3V9PA 3U56A 5LOVA 1X7GA 1VHLA 4XA8A 4LF5B 4U2FA 2QSYA 5AMXA 3ER6A 2JAPA 1E98A 1ZD4A 3I6YA 3I92A 4KMSA 1V96A 1YBHA 1L6RA 5H83A 3Q0IA 1CJUC 4HUJA 5HGJA 4J2TA 3EAGA 3RS8A 1ULSA 2DOKA 5CDSA 4X7BA 1OXMA 3CLUC 4Q9AA 5D5HA 5IYZA 2I9KA 1SBYA 2EFYA 1KJ8A 3DS8A 4RK0A 4WT7A 3A9UA 3GMSA 3R5XA 4PNHA 5AT1A 3TTVA 3IAM1 4AW9A 2BFMA 1Y48E 1FBNA 2IP1A 3EQZA 1LLDA 2C9OA 4GNKA 1BX1A 4U39A 1FJHA 1I0LA 3WL6A 3BM5A 2PZ8A 4UD2A 4NEGA 2H1RA 1CUJA 5C8XA 1XF9A 4P3YA 1KS9A 3I4FA 4WZZA 4NZZA 4KSYA 3PLRA 1KH3A 2HF9A 4IIXA 4EKEA 4GZLA 2ECFA 1LSSA 4HWGA 2JCVA 5TT0A 2Q29A 3EGIA 3PC6A 5FWNA 5JXIA 3RVMA 1WD7A 3OOJA 3A9TA 3EGWA 3THRA 2WC1A 3RJZA 3TW8A 1XU4A 3DFKA 5D7BA 1DCMA 5H8WA 5BR7A 3P0RA 4NZNA 4PRZA 3VH4A 1PW5A 2UVPA 5K0LA 3KZMA 4DCSA 4JB3A 4YCBA 2J0QA 4PGHA 1HE5A 3GFPA 4IJMA 1D2NA 3GCDA 2WU3A 3NUQA 2IE0A 3H1BA 3MOIA 1GITA 3CJTA 5L3ZA 3GWZA 3UXEA 4LPKA 4B85A 1RM5A 2OCXA 4IEEA 1G59A 3KL2A 1K5GA 3SCZA 4ILKA 2R8OA 3G8AA 4FYWA 1AKYA 4H2DA 3W8EA 4U7DA 1SUPA 3CX4A 3OF3A 3SMQA 1W4LA 1TYDE 5EJ8A 2XGOA 4L8VA 4F84A 1HEUA 1VKJA 4LF8B 2JHCA 1C4XA 1K75A 1U7ZA 1Z0ZA 2G4VA 2PYIA 2ZIUB 2ZRGA 4FVTA 2C8KA 1SKAA 4R0NA 2ZB8A 2BUCA 1MENA 4LZAA 2V55B 3HHPA 2RHMA 3TOVA 4X91A 3JYHA 4M8LA 5CIWA 4ERXA 2IXAA 1SMKA 1G2QA 2HRDA 1LTQA 4JQZA 3RUPA 5I7VA 4OHVA 1KZ4A 2GKSA 3IE1A 1WF3A 1ZD2P 2PS9A 2GWHA 3RREA 1TQ8A 2LP4Y 1S89A 1NUQA 5HQJA 5LSAA 5F12A 2HRZA 3JX9A 3FUVA 1FK8A 2G9UA 1IQPA 1UZMA 4HDSA 2ASVA 1VJ0A 2HLDA 3BRSA 4L07A 3B48A 3HJFA 4G4SO 4NOMA 2VOEA 2XTMA 3TR0A 1BQ4A 1LC0A 3UJ6A 3NW9A 4LY3A 1U0BB 4BQEA 2I54A 4LQCA 4Y2JA 5DRYA 2E82A 1E5VA 1NBME 1OI2A 3C14C 4L1KA 3AY7A 4DZRA 2IX3A 3SDZA 2HMSA 2OMEA 5BSVA 1IOVA 5KYWA 4FFPA 4KE7A 2B1QA 4HWKA 4IIUA 3P52A 5J1SB 3H6GA 1VSTA 1YE8A 2P7HA 5EIBD 5LQSA 1Y80A 3PSAA 2QYOA 3IBYA 4RA9A 3NYWA 5NLLA 3HTXA 1Y1LA 1HUQA 2H4JA 3K9WA 3LO5A 4YHBA 4YS6A 4Z51A 1E5XA 5I8ZA 2OYSA 4G5QA 2EKDA 4LTNA 1JVSA 1PBTA 3SDSA 4LVUA 3AQ4A 3OQIA 1BXGB 1IY8A 4FMPA 2XAAA 3GRKA 3SVLA 1IRXA 2ZRNA 5BWLA 1JZSA 2X8JB 1U0NA 2YMQA 4DYHA 1Y8QA 3NTQA 5DRTA 4L2IA 1A0OA 4KRYA 4O4IA 3PL1A 2WIDA 3QKRB 1BMDA 2FUKA 3ETJA 4MRVA 1MQ8B 1OKKD 1TIKA 2D7CA 2R84A 4CV0A 1RBYA 2EJVA 3KEOA 3R44A 4XYEA 2ZUVA 2GB4A 2HWWA 2WJPA 4WOCA 4BTVA 1M1YB 1O2DA 4AY4A 5KNBH 2PKRA 4S1OA 3H8SA 1NRWA 4LJKA 3ZVNA 3AETA 1OY1A 4DLXA 3F6PA 1PJTA 3OM0A 3Q9SA 1R9MA 1RLIA 1LPAB 1Z6GA 2WE7A 4K6KA 4X97A 4XEUA 2M6RA 2C2WA 5IXJA 3R74A 1EBBA 1LLQA 2GBGA 3A4VA 4KI0A 3PE6A 4M1ZA 1JDNA 2GCOA 1SXJD 3TVDA 3E61A 4BWYA 2AG8A 1AHIA 2GPWA 1LLFA 1C1DA 2P3OA 1R1DA 1VLQA 4WGGA 1GTVA 4HWPA 1B0AA 1TYEB 2E4WA 3OE1A 5AKZA 3RV3A 3SZOA 2G80A 1K9SA 1IU9A 1VDMA 2FR8A 2P79A 4KGXA 3WK4A 1WB9A 2GM4A 3K6KA 3M83A 2IZ5A 3W5VA 4BMPB 4BKQA 3EQ6A 1IMOA 1FFHA 5BW6B 2H7CA 4BJHB 3SQMA 3CWQA 3JPYA 4XWTA 1XCMA 2JC3A 3KNZA 4HX2A 4B80A 4F71A 2A2ZA 2ZAMA 3OLZA 4NBWA 1Z29A 2I1WA 5LDGA 2R96A 4DXHA 3GJ0A 4F4HA 2DXIA 1D5WA 2JIZA 1J2TA 4PQRA 2H7YA 4BKRA 2JLWA 3TOCA 2VSOA 1DAGA 1NQUA 3CRRA 3IT0A 2RHOA 5H02A 1R0WA 2CF5A 1P0PA 3K5WA 2EFCB 3B5JA 1G8GA 2ZT5A 5EJ2A 2VSXA 1QYCA 3URMA 3I3OA 1X1DA 2CVZA 2YZMA 1VE7A 5J63A 5IWAB 1FVXA 1L5ZA 2D5BA 3A1EA 4DDHA 5JUWA 4K9DA 4HNAB 2OQRA 2Y1XA 3TKAA 4NPHA 2XUJA 1KERA 4JENA 1ZJ6A 2PX6A 3KPJA 4KXWA 1QWOA 2WAOA 2YASA 5IC4A 2XGGA 4ZV4A 1AMOA 1G19A 3EIUA 4FYKA 4O4IF 5KNCA 3JVIA 2C5EA 1I2ZA 3M82A 1KZHA 1ZN9A 3PC8C 3I28A 3MF4A 3BGVA 4MV6A 1LPSA 4BN5A 5EHQA 1V4VA 3RLIA 1JDSA 1YSCA 1J5PA 1JDJA 5K3CA 3BXHA 3P9YA 4HQNA 4ZFNA 4HNSA 4RPJA 1J9ZA 3U61B 2B30A 2J5XA 4NFHA 3GROA 1NAIA 2IFTA 3H65A 3BWCA 1Q44A 4QQFA 4V2IA 1UXKA 1Z5NA 1LV8A 1MFPA 3M6VA 1W0CA 2GZSA 1YZYA 4MW7A 2DULA 4BNZA 4JC8A 2VRCD 2Q6VA 2IZ0A 3QVSA 1CUIA 3PNPA 1UT8A 3AF4A 1T9KA 3ZPXA 5ERGB 2XE4A 1N5MA 3ZJYA 2AIRA 2CDAA 5KWEA 1ID8A 3AH8A 3ETCA 4IDBA 4R05A 4CM4B 5IXYA 5KKNB 4M9XA 1DL5A 5AXCA 1NXSA 1V4BA 1SK9A 4PFSA 2BGLA 1C9NA 1GZ6A 1V45E 3JU3A 3RVPA 4BGDA 1VL8A 1R74A 4DREA 2PD6A 1V39A 3KLNA 3PL5A 4DUGA 1JVBA 1W8DA 4MMZB 1JG6A 5C37A 5DE3A 3MT7A 3C8MA 2VO1A 3DDWA 4GD3Q 5CDTA 4N03A 4EA6A 4OK5A 4Y2GA 2A3NA 4MZDA 4AWBA 1K3TA 1FVOA 1EP1B 5B36A 1WMDA 1Y37A 3GARA 1EPUA 1QRTA 5LP6A 1Z4JA 2GZAA 4GSYA 1M83A 1E1YA 1ODCA 2B34A 4PGAA 1L3BA 4C22A 4LX8A 5GY7A 3ZH9B 4C0JA 5LM3A 3C6ZA 4G0XA 4JROA 1M1YE 3IJPA 2GK4A 4M9SA 4N5LA 1DEHA 1O9GA 1GY8A 1UAYA 5DW0A 2XE7A 3KFVA 3OFNA 4PSAA 3BF7A 3L7IA 2ZJ5A 3JQBA 2P5TB 1ODKA 2DR0A 2E55A 2POQX 1UWVA 4OUDB 4P3PA 2OGZA 2WJWA 3HYRA 2Y27A 3QBTA 4NS1A 4R1MA 3GUVA 3WISA 1IZZA 3H3FA 2CMFA 2H1CA 1KVTA 2WFZA 1E20A 1TMOA 3PXBA 4ZQIA 1YWGO 3ZTYA 3GBVA 1KKLA 4CL0A 4UOEA 1SC9A 1YOBA 2QUHA 2V7GA 3A8TA 3DB2A 5DYTA 3SJ7A 2EZ8A 3CTMA 3C6YA 3IHTA 3LHFA 1F5NA 1FDTA 3SEQA 1S7GA 1GA4A 1KAOA 2KWIA 1EM8B 3DT9A 3VR4A 4UUNA 1QCDA 1FEZA 3ESYA 3IE2A 1YMUA 5D87A 3U3ZA 3SQXA 1PIWA 3MJ4A 1QYWA 4PZ0A 4DCTA 5K3FB 1MZPA 1DTSA 2VPQA 3CJRA 3S5JA 4KR9A 2ISSD 2GAAA 3DEKA 3LC0A 1JNXX 1GWNA 4LXHA 2G36A 1TTPB 1I7DA 3DDHA 1PQ4A 1Y4ZA 1K6MA 3P9SA 1LBIA 4KXYA 3FAZA 4PPQA 4D9CA 2P0YA 2CV1A 1TE2A 3FUUA 1KPIA 5FQNA 1PL0A 4C6HA 1P5JA 1FUUA 2ODBA 4M46A 4WEOA 2NV6A 3SYKA 5CDUA 3E4DA 5DBIA 4ND8A 3UJ7A 5KKCA 4GWLA 2Y0CA 1VHWA 2QORA 1HEYA 3Q3GE 3ADBA 2GMWA 3BEOA 1ELOA 4MYHA 1DKQA 5F98A 2P9EA 5TSDA 1UDBA 3QX3A 2OCAA 3L6DA 4M49A 2GS9A 2VDWA 3RTDA 1D2RA 4CETA 4HUQB 1ECFA 1NFQA 1IN6A 3U7RA 5JXHA 1T2DA 2QXUA 3EBPA 4UREA 5FWYB 5HBRA 3TGLA 4OEHA 5DP2A 1KKUA 1M8JA 3ROZA 1W36C 2XYHA 3E2PA 4EA9A 5ICEA 2V7QD 5HNKA 3LT1A 4UUAA 2NO0A 4MX8A 1C29B 2V9ZA 1HFEL 2W0MA 2XQJA 3IEUA 3IQXA 4IYRA 5E38A 5E9AA 3GLIA 1JH9A 3RVOA 2GF9A 3OU2A 1A5ZA 2AMYA 2C5AA 3M33A 4HQRA 1E3JA 3EIEA 3SBEA 5EERA 3DAOA 4XPIA 4DF3A 1EFKA 1FFCA 2GN4A 3SZUA 4Z5XA 2GM9A 4ZPXA 4MUYA 1BJRE 1EGVB 4KPUB 1U6KA 3M6XA 1XHLA 3TL2A 1N7GA 2ZYSA 1UPXA 4BIMA 1GRNA 4JL5A 4MHOA 4PC3A 3GZ4A 3LT4A 5HMLA 5HYVA 1QGOA 1VCOA 2IUSA 1UM9B 1W4CA 3P71T 3V4LA 2HM7A 3T7KA 4O63O 4URWR 1NSFA 3LW7A 4OSOA 2Y0EA 3WA6A 1Z0FA 1R66A 3B9RA 8AT1A 5E4JA 1VPDA 4OTZA 3DDNA 3I1YA 2EJCA 3V1MA 2G09A 3BSSA 1FDOA 1I2MA 1OFHA 1N1EA 3SS7X 1EA5A 1CEEA 1X7DA 3QLTA 5GZ3A 2E5FA 1A2QA 2OBYA 3L6CA 4LE1A 4LY6A 2D0DA 4NIMA 3UMBA 1L7AA 4TLDA 2XB2A 4MRMB 4QRHA 5BMOA 4R41A 4RD3A 1FX1A 4EGJA 1TZ2A 4QJ4A 3NIFB 2I6UA 1KK0A 3Q9NA 4TTVA 5GOZA 2H63A 4YH1A 3IURA 5CA0A 2Y9MB 4LDPA 2YNMC 5JASA 2IYVA 2ZWVA 2L42A 3EFHA 4JZKA 3N76A 5EUQB 2FLWA 1OV6A 2X13A 3NASA 3VZCA 2QLLA 2CMDA 1AQNA 1UBSB 1ITZA 1RYBA 3KPVA 4C6SA 1GXSB 4IIFA 4QEZA 1FYXA 3DOHA 4JC0A 2WTNA 1C3OA 4CN8A 3A32A 5IZ4A 1SHZA 2GNPA 2XUFA 4W8GA 4ED9A 3ZWCA 5IABA 4MGIR 1EI9A 1F6WA 2ZXEA 2V9CA 1JEDA 1RCUA 1PG0A 1QYIA 1VLMA 2CKDA 3WNVA 1AUPA 5HTOA 4D4LA 1M7GA 4LZWA 3AEYA 1ST2A 3FWNA 4BE4A 4HVLA 3NI2A 4MXDA 3FPAA 3DF9A 1JHXA 4AJLA 1UBKS 4R40A 2NXNA 5ARCA 3UAOA 1YI1A 4JJZA 1J9GA 4IZ6A 3IKJA 3BCRA 3GLRA 3CR3C 4JJIA 2ANCA 4AJ4A 5B3JA 1GT6A 4GHWA 3SM3A 2J3MA 1AN9A 1UBNA 4HDRA 2XMRA 1XEAA 3GG2A 5CBPB 2R6FA 3WZ2A 2QIOA 2AJCA 2QRHA 1RIIA 2IZOA 1Q11A 1Z88A 5C3UA 1V3VA 3MTEA 2J3QA 2ZITA 4FYMA 1M6EX 4S1WA 4JOQA 4Q3BA 4UM8B 2GZ2A 2OAP1 5TMBA 5CXUA 5KX5F 4D98A 2AJLI 2A14A 4M9UA 1YF3A 3R7BA 4ZQCB 4D8VA 3ONWA 4A6EA 5FOQA 1D1QA 2GTHA 4OGGA 3TNFA 4C3OB 4D92A 4DCPA 1XTTA 2Q4DA 3NLLA 2RHTA 4FNAA 4AS1A 4IOMA 4HAIA 1CVIA 3OCWA 1SQ6A 4RDXA 5INTA 1IHUA 1NP6A 4CMGA 4YPVA 5KYYA 1CJSA 1C3XA 1FU7A 3AEUB 3TTXA 2YVAA 4D9HA 2C94A 3BZUA 4E5MA 2WYWA 5HF5A 4ZO7A 5ADVA 1QONA 1C7EA 3LUFA 5CA0F 3ISTA 1E2PA 1X15A 2REOA 3X1JA 1ZA1A 2I6FA 3JQGA 1U28A 4ZU1X 4ERNA 2FW1A 1P5HA 1X3SA 2FZGA 4FHDA 1ZNWA 3PHGA 3CU5A 3UJDA 3UMVA 4MJ7A 3SC4A 5IUJC 3FTPA 3HCCA 1U2QA 1W88A 4MYUA 3UT5B 4ZJZA 1P9WA 1ECPA 5JPCA 3ZZNA 2PRJA 3PLNA 2R44A 3LKVA 3GB9A 1JEOA 2R1UA 3S1AB 4AX4A 1L7NA 3SYRA 1BVHA 4R1NA 1SRQA 1WVIA 4FFMA 1Z68A 2EWWA 4HPJB 1DAMA 4ALIA 4YUYA 4BGEA 2KSQA 1RWMA 3K8OE 3MRVA 1NYRA 1JPVA 3LPNA 2YDXA 1AKMA 4FBGA 3ZU5A 4BGUA 4FCVA 4EZBA 5C8ZA 2QRUA 3OZIA 3ZBQA 2GETA 5DNWA 4TMVA 3RQIA 4C5AA 1Q2XA 2PAAA 2LCIA 2CXHA 2P2NA 4R5MA 3E2MA 3G9QA 1XLWA 4MVJA 1JMYA 2FPOA 3G8CA 2FSFA 1EVKA 2HJGA 4Q3KA 1LF0A 4G65A 2JPDA 4KHPB 1N2HA 1T6YA 1PQYA 2BCJQ 2OD7A 1M72A 4NMWA 2OFFA 1ECGA 4HDCA 4JIGA 4NU0A 1T3HA 1O6BA 2FWRA 2X0RA 1C4KA 3PNSA 3MHPA 2X4DA 5DHAA 2CNWD 4FONA 1XL1A 10MHA 1E4VA 2H9AA 3OC6A 4A0QA 2UYGA 4WLFA 4EPYA 4TZ6A 3NTUA 2RD2A 5AVXA 4LRUA 1BE8A 1PT9A 1SOVA 1DQNA 4ZAFA 1LA2A 2F1JA 2P2SA 1MJFA 1PFVA 3V9AA 1K27A 1RQRA 4CKBA 4DQDA 2OD2A 3UJBA 5G1PA 4JLAA 3W05A 3WXBA 5L53A 1I3CA 3VSEA 4B81A 4ZVUA 2VZLA 1ZVVA 3OO0A 1G18A 2H0QA 3A3PA 4A27A 4EI7A 1Q0QA 1TZBA 4CIAA 2J8ZA 5E9WA 3U16A 2RHHA 3FYSA 2R6JA 4LBVA 5E95A 1JL3A 2ZS9A 3LYHA 1Y8ZA 4TZ0A 1G1MA 2YFKA 1BROA 4LY0A 5B37A 4LWZA 1U7TA 4YPFA 2BUBA 3OJ0A 1UP7A 1K0FA 2JAWA 3ETHA 3HWX1 1KEPA 2Z1DA 4XD7A 5FO1A 5A6SA 5LWQA 2QX6A 2DERA 3AFHA 3KSRA 3N8DA 3PG5A 3ORSA 4H6WA 1OYWA 5IMBA 4RKFA 3AEQB 4Q66C 3LBAA 3FRJA 5DF1A 1VLZA 3B3GA 4Q4HB 4PZZA 3PWTA 4QQKA 1JLLA 3O3OB 3NT2A 3WWCA 5HCIA 3DL7A 3ZNQA 4WXRA 1QB7A 2GHIA 3AHDA 2VR1A 1ENYA 2PRZA 4Q01A 3NV7A 3UGKA 1QLJA 2WJZB 5AI0A 1IUNA 3ICPA 1E3IA 4BV8A 4ZI7A 1E7SA 1PJZA 1A8HA 4QO7A 5ELXA 3G8YA 1Z4NA 3UGQA 1XF1A 3EH1A 1U0GA 1RKBA 1WO8A 2OORC 1IXZA 4I1VA 4P80A 1TADA 4DIBA 3D64A 1IULA 1UK6A 1XD2A 2MTBA 2R1VB 3VSDA 2FUEA 1P0CA 1LDBA 4EUKA 2PUDA 4HWOA 3MHTA 1T1EA 4K05A 2E2WA 3CNQS 3MS2A 1KOJA 4XCXA 4L8WB 2EX1A 1NURA 1X9HA 2R1TA 3IELA 1CEYA 3W3AA 4KN5A 3BRWD 3SBXA 1GL7A 3OZUA 4B5KA 2VP5A 1XCOA 2JRLA 2P8SA 3HFJA 1SHLA 4LXYA 2GHRA 4WI1A 2P77A 5CBKA 1RZRD 3QM1A 4RTRA 2PE5A 1AN0A 1YCDA 3KTFA 4R8RA 2D06A 4HZUA 4R6XA 2GEVA 2WM3A 1BEUB 3E9YA 2RGGA 3FZEA 3IS3A 2D62A 2SKCA 1PP4A 3MB5A 3O95A 3WGOA 4RTJA 1U0FA 2WIAA 1RQGA 2R8XA 1PHPA 4EPTA 3ZDDA 5BN3B 2QNIA 4FEYA 2QYHA 3AKEA 4NICA 2AGVA 3ME5A 3TPFA 1RD4A 3A37A 4O2BA 4MHTA 3LNCA 4Q1EA 2BD0A 1F4VA 1L4YA 2B78A 2R86A 1O6CA 4B34A 1NATA 2G1AA 1MRSA 4JEIA 4P5EA 5J23A 3ROXA 5DGHA 4JI5B 4GP6A 1NVEA 5CFZA 2YC2C 1Q0SA 3FDZA 1BOOA 1E6UA 4HDNB 1CQWA 4GPBA 5LZ7A 4KDEA 3U3DA 3UOWA 4ZHQB 5CYGA 4YAGA 4ZIRB 1FFDA 3K9FC 3U2QA 2VDPB 1C7RA 1JV2B 3PJDA 4QOGA 5HP4A 2H1LA 1GDHA 1XVLA 3ZNNA 2QTNA 4JYBA 5BOSB 1TJ4A 4B44A 4NCXA 1SHTX 3GD7A 3V8EA 5IU6A 4RZ3A 2ZTLA 4LHXA 1J5EB 1JA9A 2HX1A 4QULA 2H0AA 3EH2A 2EZ4A 4A36A 2CL5A 4ZI7F 4LJSA 2WTXA 3H3XA 3OX3A 3JAKA 3Q11A 3KR1A 4A23A 1SBQA 4IO1A 4P4GA 1YL7A 5AO9A 4UDXX 2X5NA 5CVVA 4BVGA 4OH1A 5EJGA 5H4HA 1GO2A 1ML3A 3B5IA 1Y3CE 3HU2A 2YWGA 3A4MA 121PA 3MJSA 5AP9A 4B3HA 4PC6A 1EJ6A 3FOAA 1UZNA 3RR2A 4M1WA 1NPDA 2QDKA 4ZK2A 4WXYB 3E3OA 3BQMB 4HB2A 2VWPA 2OFWA 1FZQA 2JD1A 2PMCA 1KDZA 2XCRB 3IL2A 3PGA1 3DR5A 2HNKA 4R2JA 4JKYA 4M0LA 4CZ2A 2IOFA 5F52A 4CMIB 1PVVA 3GRYA 3MMPA 1JX6A 4PX3A 3ZHOA 4BNDB 1XPUA 1FDIA 3GDFA 1XTRA 3JWJA 4NBTA 1NUAA 4S0ZA 1KFKB 1E2FA 2JCSA 2VNKA 3LRPA 5C5CA 2V8OA 3SOZA 5JAOA 4XFJA 1U4OA 1PCXA 1EVYA 4KIWA 5B1EA 2FWBA 2WZBA 1CTQA 2ZIZA 3C7TA 2JFXA 3D3NA 3D6MA 4PG4A 4YALA 5G1OA 5JWHA 3KTAA 3BWBA 1MN6A 221PA 2BFEB 3V8RA 4BEBA 4EG3A 5IAOA 2G70A 2QZPA 5MN4A 4F4DA 2ZJBA 1PLJA 4JI1B 1BVYF 2X6QA 4QBIA 1T4BA 5KNDD 4LXUA 1W85B 3BSYA 1X7HA 2AG5A 3ORYA 3PI6A 3RS4A 4AVYA 2IOFK 5JNWA 1ZIOA 3V4SA 2Z6QA 4MAAA 1OD6A 4I4TA 4FZVA 3PXEA 4NBNA 2QMEA 1U99A 3DZDA 3G1TA 1IHPA 3QYJA 4PTYA 4G4IA 4QBFA 4XGIA 4Z8XA 1YUNA 2O0KA 3PXCX 1EFUA 1FP7A 3RODA 3RWMB 3MD9A 1HRDA 4GUAA 4OQPA 4Q18A 5BSRA 4DIEA 1G8YA 2A88A 2P3SA 3EBOA 2XLBA 1NSYA 3A1CA 3NQ41 1SPXA 3SEAA 3I2JA 4RSGA 1FSGA 4E5VA 1XKXA 3FFTA 3DD5A 4K26A 3TN7A 4CKCB 3E9ZA 4ZN6A 3WGIA 3BL8A 3EE6A 2UYQA 4HVTA 3F71A 1LVHA 2ZRHA 2VBCA 5BMVB 1F2UB 2C9CA 1JQJC 3IQZA 4G4JA 3MQ2A 2OC9A 4Y1EA 5EIWA 3GK3A 1PLKA 1N8KA 1MABA 1QLWA 4KKXB 4UU8A 2E1PA 5EIAA 4DR5B 1EWQA 1PTKA 2H1SA 3AK4A 3GT0A 1RBQA 2WG0A 3D6UA 1LGYA 4H1VA 3RU3A 1DC8A 2BKEA 2CNNA 1BDBA 4PCUA 5FIUA 2WRZA 4EWLA 5JNTA 1WCYA 2IPLA 1Z33A 3JQ9A 3O9ZA 2F1OA 2NTNA 4Q7MB 3EFOB 5ICGA 2XWPA 5CCBA 4OHRA 1AURA 4M0KA 1CUWA 1GSIA 2IEBA 2MSDB 2IODA 2OV8A 4FPXA 4GLLA 5AW8A 2FPGB 1PGQA 2BFNA 3VC7A 2XVMA 5ADWA 4GPTA 3L4JA 3OTGA 1UC5B 5GMOA 2IYNA 2ZK7A 9LDBA 3I6ZA 4YT5A 4RKWA 3OPNA 1VXOA 1YH3A 1Z06A 2A4KA 4GXQA 4P7JA 5CNJA 2PRYA 3L8HA 4QUIA 2BCEA 1GG5A 2HSDA 4UZEA 4R1LA 3C3BA 3HG7A 1KEWA 2ANBA 3EYAA 3P9KA 4G5XA 3SIWA 3WWEA 1I4LD 3B1VA 3G5TA 4C20A 1D2AA 2CL7X 5JS6A 1GPDG 2C1ZA 2DFNA 1GQOA 3FR8A 1VZ3A 3NBQA 5K51A 1RXWA 2BI8A 2OMKA 5LUAA 2OXIA 3AESB 2DVMA 2PMKA 4RVUA 2XUZA 5B7QA 2PPVA 1E7WA 2NZVG 1P18A 1MJGA 2PO5A 3RAEC 4MRNA 3ZXYA 2MYUA 3JQAA 4O4JB 4Y0VA 1US8A 2ESRA 1I6LA 1T15A 4K8OA 3I8OA 1FLDA 3ONEA 4L50A 1X7ZA 1Y5RA 5PGMA 3IH5A 1HLFA 3NOQA 2Y05A 1HDZA 1WAMA 1VHDA 4PG7A 5FADA 1YZHA 2V7EA 3LX5A 2J6BA 4A8JA 2C9MA 2H07A 4K6GA 3EXHB 5JDIA 3MGKA 1W76A 3HB7A 5EJFA 4NENB 4J4HA 5KTPA 1P0QA 3NHPA 3PRYA 4XIIA 3D3EA 3EZYA 5DTQA 1V5IA 4YTEA 3EFBA 2O1SA 3H2BA 2GBIA 3T7SA 1T36B 5FYDA 3NH9A 4BMVA 1N9KA 3E48A 5HRCA 3RK0A 3H8WA 4H7HA 1GAEO 2WT9A 4URXR 1NDQA 1TOAA 2JVJA 3QU4A 5JXGA 2IY7A 3AKZA 2VRCA 4KXLA 1YCGA 3O1LA 1ISPA 1G291 1E4YA 4C7KA 1EWVA 1EWTA 3IPLA 5CB4B 3LYAA 3AW9A 1UDCA 1OH7A 4KFRA 2WD7A 3EVZA 2QTBA 2RHJA 4PQFA 5FR1A 5KQPA 1JALA 3GEBA 4L27A 5JFTA 3TTTA 2FSVA 1GPLA 3FVQA 2DY0A 4GOND 5I9SA 4BLUA 1EFLA 3THWB 2Y8EA 4RDIA 3K05A 1CUYA 2WF7A 3BJMA 5IAKA 4NEHB 4JB8A 4TMXA 3EPPA 1QO7A 3BRQA 5DI3B 4B33A 3TQFA 3AMVA 1HOTA 1LW7A 1JR2A 2ZJFA 3G0IA 4B17A 1J99A 2I8LA 4OGWA 2RKBA 3X1XA 1T3SA 4RAOA 2RMKA 4BO7A 4BQRA 5K6AC 1T3TA 5H80A 2P6MA 1WPGA 3E82A 5KTNA 3R9XB 1XN1A 1WKBA 2XB9A 1OB5A 3R3ZA 2DCMA 4LBZA 4RJJA 1F8FA 3GEDA 4GO1A 4B6GA 4C5CA 4PSUA 4BX8A 4KK4A 5J2UB 4BMXA 2PXHA 1L5LA 1Z5UA 3GDGA 4I7EA 3T4UA 3VNSA 2BGJA 4BNVA 4WBNB 1TC1A 3EDYA 4OAPA 3II6X 3T3MB 3BGDA 4G6ZA 1ZNQO 3JTEA 2GASA 2HW8A 1DUVG 2YUIA 1JI3A 4G0OA 4XDYA 1U6IA 5CYPA 4A92A 4C0LA 1K88A 4YRCA 4Y9UA 4YGYA 2P0AA 2GPJA 3PKIA 2H31A 4D41A 2HT1A 1WOYA 1I32A 2FV8A 2W6IA 5C31A 2DHQA 1N0WA 4BJ1A 3K6RA 1RLOA 2FOXA 5TMDA 4EJSA 1QS0B 2PTHA 2XWQA 1TZKA 1YB5A 2ZG6A 1BYUA 4QWMA 1N3LA 2PL9A 4JLWA 1C8VB 4KSBA 5ED0A 1K08A 4PIVA 1H9BA 2PM8A 1C81A 4R3UC 1Z0JA 3VRHA 2EDAA 4ETWA 1MXFA 1QRRA 5F3WB 2WT4A 1BMFD 3HCFA 3O84A 1I5EA 3R76A 3TRIA 1XXHB 1R0BA 4GSLA 2IOYA 4EG0A 4PLTA 1FCJA 1RC1A 3T3EA 2DBZA 3QLUA 1WQ1R 4NOJA 2IS6A 2WQ6A 4J4BA 1M7HA 1SNYA 1Z6AA 3DBLB 3LDGA 4XFDA 3ETLA 1ESDA 1JUDA 1JQBA 1SU7A 3UA4A 1CUVA 5EP4A 1QKIA 2CZCA 4HLQB 1AS3A 2QRJA 3EG9B 3F6SA 1SN7A 2VHYA 3K53A 5CJ2A 4A1FA 5DN6D 1RPZA 4RY8A 5DNCA 4EG5A 5HKOA 1YT5A 3AKDA 4A2QA 2VJLA 3I9OA 3QWBA 1TX4B 1HT1E 3HB1A 5REQB 2JVKA 2ZFUA 3I2KA 1AKVA 3L0YA 2D2EA 2ZBRA 2XKKA 4NBKA 4EGSA 3GRRA 2OQ2A 3L40A 3NETA 1QHNA 3MWEB 2IU4A 4F92B 3LC7O 1YS7A 2VWHA 2O1EA 2WHPB 3CXUA 3NHAA 3PRHA 5C8YB 2OYCA 4BVFA 4UCFA 4NSNA 4JBXA 2QI9F 3KEQA 1HYHA 4GMDA 1DU4A 2VP3A 4LJ7A 3L1UA 3Q0EA 2QVYX 4OBEA 4DDMA 5DNVA 3I52A 2XX3A 2VWGA 3TDKA 4IDGA 1K7FB 4JVLA 1ZQ9A 4HO1X 4AU1A 3QY0A 4GM0A 4IGKA 1QOPB 3TYXA 3B8HA 4F9FA 1N0VC 2GBFA 1OXBB 4JR0A 4HADA 1Q0LA 5HF8A 2PGDA 1GAXA 5TEWA 4XX0B 3NIDB 3TM4A 4Y2VA 3ZCUA 1GZ7A 1P3JA 1DAKA 4CLXA 3HGQA 4N40A 4ND4A 2FR8C 3LH5A 3ACDA 5HQ3A 4HD8A 3MINB 2YY5A 3ZW7A 3TR6A 1K4MA 3OZEA 5UKDA 4LC0A 5I4BA 2GHQA 4I5EA 4ZVTA 1F8YA 2WIKA 3P5SA 2ZCJA 1R0ZA 2QM0A 5AOBA 2QTCA 4LMRA 3LPAA 1KQPA 4NH4A 4DCMA 1O54A 1DC7A 4MV5A 2OAEA 3L8CA 3M9WA 3QUBA 5HEKA 5BSHA 1LI5A 4IMIB 3NOXA 2ILTA 1OX6A 5DTEA 3X44A 3OF2A 2YVKA 4DANA 5IZCA 2H6EA 1UUFA 4B31A 2ZE8A 1TLTA 4XVUA 5JARA 3QI2A 4LJYA 1C9KA 4NR0A 5FOSA 2J5KA 4N7BA 1IEVA 2NV0A 1PV4A 1Y6GA 2I87A 4LBYA 1PGOA 5LA6B 4CFZA 4MA4A 1FFAA 3GLHA 3V1NA 4B6SA 1OHHA 1K7XB 3LWDA 1QNFA 4DG8A 3VH3A 2JGKA 3ONDA 3IQIX 4N3GA 3H2YA 1XCPA 4A1OA 1PHRA 2O7VA 3KDPA 1YZFA 4DMKA 3OWHA 1E1CB 1VHQA 2CCGA 5K05A 1ZHOA 2FW8A 1NUHA 3QPAA 3QI7A 1O87A 4QPCA 3BK1A 4EX7A 1LPOA 4RLHA 3RRYA 2D5CA 4PTLA 1PGJA 1TI7A 4PAGA 1KDPA 3R6GA 4H7PA 2VJQA 4LZZA 1KDVA 3F5DA 4OJNA 1FNMA 4E15A 1CLUA 1J0XO 2CWDA 1E64A 2AN9A 2EW8A 3LPMA 4IAOA 4KAFA 1HL7A 4L9WA 3VOBA 2DJIA 2DQKA 1MO3A 5F9MA 5I9TA 1HFKA 4RLSA 5JI3E 3UGJA 1SKMA 2FN7A 5DSZA 2XZLA 1EE9A 1YIAA 3G79A 2EQBA 5IN5A 1C9MA 1RABA 3DOIA 3DAHA 4WD3A 1MHPA 5IRCD 2I6SA 2CLLB 1J22A 1XXHE 2E7ZA 3OBBA 3R0XA 1SH7A 4RDHA 4Y9DA 5GJBA 3DFZA 1YZNA 4WACA 4CQMD 2PRSA 1MUUA 1F0NA 1NVVQ 1R4AA 1E0KA 1V8PA 4KX5A 4B3IA 5B5SA 3ABSB 4A73A 5LQCA 2XCOA 3KJNA 1DAPA 4LS3A 4N01A 5LYJA 2QOEA 3V42A 1C9JA 4AWXA 3AERA 2HTEA 4LI0A 7ABPA 4Z1MA 4AFNA 5CDFE 5E3HA 5LQNA 1I01A 1EFRD 4LSWA 5P8WA 1EX1A 5LWHA 5KI6A 4PU0A 1VP9A 3KKKA 2PKXA 4YP7A 2JNWA 4F2PA 5U1PA 2Q5QA 3BFPA 1E2BA 1G21A 4Y3UA 1OFIA 2BR4A 2CSUA 3JVVA 2XCTB 4C05A 3HUFA 2OEPA 1UAGA 2IU3A 3JZMA 4U8HA 2ZVDA 4O5OA 2ZVQX 5D7NA 4D5EA 4EAAA 3ZXIA 1HI9A 3E05A 4XIGS 5HHTA 1TA4A 4TZTA 1E9RA 1V6AA 2UVDA 3FSRA 3UAGA 4TQUS 4EZEA 1FYDA 1USKA 1O96B 2P9TA 3KSBC 1XCJA 5J5AA 2J9XB 4OHMA 4DSZA 1E6KA 1SCDA 2H54A 3DTVD 3MXOA 5A3RA 4GKVA 4EARA 2OM6A 4X93A 1MG0A 3MWDB 2EJBA 3X3HA 2X3YA 1KSHA 5FXMA 2VJMB 3OT4A 2WA2A 1CUSA 4HG2A 3SXPA 3TLGB 3KWFA 3F3KA 5CFLA 2Q5HA 3HJTA 1E2GA 2WHQA 3C7CB 1PG5A 1BX0A 1Q6ZA 3GJ7A 4LGVA 4YLGA 2UZIR 1J2RA 3PXDA 1CRLA 5FV4A 4HWTA 1EDBA 4IHAA 4MUFA 4E94A 3HLYA 1KOLA 2BZ0A 2KYRA 3A6JA 3DVRX 4FSHA 1XFAA 5EJ9A 1MB0A 1GFWA 1MRNA 3DH0A 3L43A 1EK1A 3V8VA 4N1AA 4Q3NA 2OWDA 2FMHA 3E58A 1A76A 3FMIA 3AI2A 3AW8A 1D2MA 2DLDA 4CV3A 2BZGA 4UXIA 4LXQA 4PO1A 5DP1A 3UKOA 1BD4A 2R5NA 3IIMA 3UYLA 4S2UA 5LLSA 1NULA 4I8IA 2DWQA 1Z7GA 4BMDA 2J0EA 3FTEA 2QBYB 2QTWB 4QHTA 5GJVC 2D1SA 3NPMA 2PX0A 1DB3A 4CR8A 1IUKA 1XK6A 5FL7D 2IIPA 4CMEA 3FX2A 3QFRA 5JC1A 3GLUA 1MR3F 4LXTA 4GMXA 1FMCA 1VDZA 3FLAA 5TGTA 2FSGA 2GLUA 3LG2A 3GFTA 3BCSA 1LK5A 1PGNA 3CSDA 3HO8A 3MCAA 3AJDA 1XNJA 4UHHA 4CLHA 5FJIA 1AG9A 1M1ZA 1Q92A 1V95A 1MIOA 1ULHA 1V7QA 4LG1A 1K97A 3RK4A 2ECKA 4G5SA 2R8YA 2CJPA 1BS2A 2F8LA 4IZOA 2UUCB 4FFWA 5ENZA 5KREA 2CY0A 1L1FA 4BB5A 3GEPA 4RK7A 2JBWA 5T7BA 1K86A 5JTTA 3T9CA 1L4KA 2H5JA 1PR5A 3CNOA 3NR2A 1X14A 1DOHA 3B7PA 4A26A 1QPBA 2J3HA 1RHJA 3JR7A 3TIIA 1QH9A 4F6CA 3EPJA 3NO4A 1M1UA 4JXZA 2QL5A 5DM2A 1Y3FE 1PE0A 5DHUA 2B21A 1YC5A 1X92A 1Y82A 3KALA 5F7ZA 4OHKA 2JCGA 3AI1A 4BX0A 4FMCB 1AXEA 1T8YA 3EK2A 3LCUA 2BSQA 3C1UA 3CNEA 2ALJA 4YI5A 2A5YB 1IRIA 5E3JA 3OT5A 1LSOA 1UEXC 2AYXA 3HY4A 3L1IA 4PEVA 1C9YA 1D6MA 4XIJA 2IF0A 4EHBA 1U90A 5J43A 4B2PA 4ZOAA 3A1VA 3KXKA 1XRNA 2IS4A 4RF3A 1X77A 3IIKA 1I4TD 1VE5A 2BKUA 1II0A 3O2SB 4JI0B 1Z35A 4X1OA 5SZJA 4BJ3A 2F1KA 6LDHA 3LPCA 4I2VA 2B6HA 3VR0A 2P2DA 1DV2A 1W73A 2PBFA 2C96A 2HK6A 4K1LA 1LB1B 3TXYA 4EPRA 3AVVA 1BZYA 1E3TA 4POAA 4UBJA 3BRWA 3IGFA 3MSCA 2D3TA 5JQWA 2J87A 3CSSA 4HDQB 1P1RA 2LD4A 3JQFC 3N1UA 2Q0XA 1U7OA 2QRZA 1RR6A 1M2OA 3KD2A 1ZWLA 3PFBA 3Q7RA 4IHJA 4IR7A 4RH0A 4RZXA 4NZ9A 5AHOA 3T4EA 3C3CA 5A9SB 2F4VB 5KZMB 1DWPA 1OLUB 1RAFA 3WYAA 3DBIA 3M4YA 3RVJA 4L4UA 3U1BA 2QW1A 4X90A 4OLAA 3CKYA 5THKA 4AIIA 2RSLA 1GPUA 1R9JA 1BX3A 1X42A 2EX0A 4QASA 3WRXA 5LNK1 2H2FA 4BVEA 1LX7A 4D45A 1Y1RA 4Q03A 3RS3A 4CV1A 2XUGA 3OPVA 4NDNE 3UJ9A 3V7UA 2JGIA 4R2MA 4YP1A 1Z8FA 2BTQA 4M3NA 4N0QA 3R3XA 3SF8B 3FF4A 3TNJA 3H1GA 4EI2A 4C06A 1X87A 4C43A 4F96A 4DEXA 2W8ZA 5KKAA 1JFTA 1NBMD 5EHZA 3TIGA 1SY7A 2HK7A 2NO7A 3GVCA 3GYBA 3NP9A 4MW6A 4W8OA 4OHWA 4G56A 5CVJA 1DBQA 2IPNA 2X76A 3DMDA 4W9MC 3WDMA 5E6UA 1ZGCA 4Y98A 1NM5A 1TTTA 1A82A 2HGZA 3FNIA 1P62B 1Z9BA 2ECPA 2WZCA 3I5UA 1XWFA 3H0EA 4L5CA 3UKJA 4C4ZA 4Z9YA 6REQA 2ZR9A 3P20A 2NU7B 3DTTA 4NJOA 3P1JA 4MIEA 4Q9NA 4K0RA 4S1TA 4YRRA 3VFDA 1H0SA 4BDSA 1FYEA 4F9GA 4V39A 4ALKA 3K8YA 1DAFA 3NM6B 1J23A 4FILA 1ISHA 2DR3A 5IH3A 5LU9A 5E7JA 1GL3A 2D74A 1FBTA 1NLFA 1ZGZA 3A7EA 4I9HA 1XAJA 2JLYA 2C07A 2FZCA 3I6IA 3OO1A 4QDUA 3C6KA 4MRSA 1V1RA 4CV2A 3C1OA 4UULA 2EZTA 3E27A 2D0OB 3O2QB 3VKVA 4D4HA 4E2ZA 1YR9A 3W5AA 3VKUA 2SICE 3SKXA 3KBOA 1KJNA 1GV0A 2RBKA 4QUBA 1IK6A 3KIPA 5BUCA 2Z95A 4QJ5A 1FSPA 1NJ6A 1OYOA 4J3NA 3I5YA 3AU9A 4LTMA 2IUFA 3ZHZA 5E7QA 3O2NA 3PQCA 4AC9A 3FHJA 4QRDA 4UM7A 2HRQA 1N4DA 2HN9A 1MBZA 4P93A 1MAWA 2PEYA 4CTKA 3ZYZA 1F6BA 1YQTA 3H04A 2EERA 1P4RA 1PNTA 1TGVA 5NULA 2YJ3A 4QPJC 4PLPA 3M3DA 4B87A 2F64A 1F2DA 1NLZA 3U31A 4D56A 4YMVA 3LVBA 5ITVA 4DYDA 4MKFA 3UTCA 2ZM6B 2IHUA 2XNJA 4LRTB 1Y1QA 1EFPB 3LV8A 4WZBA 1RPTA 2H8KA 1GZ3A 1E5TA 2XTJA 5KVQA 4H3SA 4ZYTA 1O6FA 7REQA 4I0WB 2I4OA 1Z2OX 3S6JA 2C58A 4D2IA 4IFTA 4B2IA 4M83A 1E66A 3IAXA 4DBLE 2FCAA 1WCWA 2G6BA 2PZFA 3VR1A 4BFTA 3D8UA 2JFFA 1U65A 3HCOA 4GFDA 4JVMA 4F5ZA 4LF9B 4B3JA 2XVYA 5A5VA 1WE2A 3H9QA 3QLJA 3HDJA 4XWGA 4C14A 4LGYA 4G89A 2ORWA 3EPKA 1QE0A 3OCJA 3B1WA 4BU1A 3O5AA 4NG5A 1GRRA 4OV6B 5DLYA 1ZK1A 2ZIXB 1ORHA 4PLWA 3BT7A 3B20A 3F5QA 3FYUA 4TKVA 3KEMA 1Z37A 3T4XA 4RM3A 4HI0E 3VNBA 2GWRA 1EZZA 1DIBA 2PJDA 3PEEA 5ITSA 3KD3A 3V46A 1JG7A 3BE4A 5KSWB 2H1VA 1JRLA 1ISGA 2JFYA 2R65A 1PDVA 2J1LA 2F17A 5CFPA 3TEMA 2YIMA 3RKUA 4PONA 4ER7A 4IVQA 1DQRA 1S7CA 4MSUA 3MC1A 3F97A 3BXGA 4U3JB 3REGA 1FE8A 4FE4A 1E1RA 4NESA 4EF5A 1UWLA 2W6JD 3H1FA 4YXWD 5KYXA 5C53B 2ZJ2A 1NKTA 1XJQA 3A6FA 5EZ5A 1N2ZA 4PNZA 2ZRBA 2GPNA 3L8EA 2W2QA 5JANA 2PD4A 4WESB 3RT7A 4FC7A 3VR3D 3VVMA 5KTMA 1JEAA 2ZSJA 2AKYA 4IX9A 3LZDA 3KQKA 3DT6A 1ENOA 1Q7CA 4PHHA 3ODGA 5LDHA 1N32B 1IG0A 1Y8CA 3DMRA 4X45A 3R8XA 4TUYB 2GUWA 2Y71A 4WCVA 4C0XA 2Y92A 1QHSA 4G0VA 1Z0KA 3JD0A 4XJXA 3EODA 3A4NA 3NCTA 4N5DA 3T94A 3E9MA 4F5YA 4FXPA 1JJAA 4DLWA 3LBFA 4HVAA 1J2JA 2PKYX 3EGDB 4CQLB 1APBA 4W5RA 3EOBI 4KWTA 4YDHB 4KO3S 1HX7A 2GAOA 5CM2Z 1BWPA 2EGUA 2KHZA 3GRVA 4H0CA 3P9CA 3TQHA 1FLAA 2F43A 1OXVA 1TYBE 2H51A 2O0LA 2PKQP 3FPBA 3L82B 4YB8A 4OQEA 1IVYA 3PDIB 4MWOA 5CLIA 4DCUA 4IGEA 5B2EA 4AULA 3DHEA 4W6QA 2O2SA 4XJTA 3RRMA 4KZPA 3ZVRA 1THGA 3HU5A 3I4LA 3H8JA 4D9MA 1OJLA 3KXDA 3TCKA 3DE1X 3WV5A 5DM1A 1Q2UA 3TJMA 5LP1A 4ND2A 2VHWA 1I33A 3G2HA 3L6UA 3H4IA 1GZ4A 3ND7A 4JJ8A 4YAWA 3T5BA 2B4AA 3N8IA 3BK7A 5TQ0A 2NYVA 2VNAA 3ROEA 3KAKA 3KJGA 3AVWA 3HABA 4JSRA 4K9RA 3VISA 4BO9A 3IXLA 4MEAA 1SHUX 4RSHA 4CCYB 1HDIA 5B64A 4YUAA 1DDIA 3HYTA 2DSNA 1EFHA 3SBDA 3TFWA 2Y1EA 1HZJA 1XTPA 2OBFA 3MOGA 3W77A 4EJ0A 4ARCA 3BXFA 5T3YA 3GFGA 5G4LA 4KR6A 2BKLA 2RBGA 3TAHA 1THMA 3KQVA 1D5CA 2G88A 4P3XA 1GR1A 3ZDEA 3RC3A 5HKLA 4D0RA 1XZEA 4CIWA 1XVIA 2LRHA 4I55A 4AO8A 3QEOA 1A9PA 2EWVA 5F2KA 4J7AA 4HYYA 4AJKA 4MQEA 1OR8A 1N1MA 1XQXA 2AVNA 3OIGA 2QT9A 1V11B 1VSVA 2B4YA 3L4EA 4KJXA 3TZBA 4DCCA 5JSUA 2IEGA 1H05A 1UK8A 4JXXA 5HIAA 3ILSA 2JIOA 5HF6A 1DS6A 4DIKA 1XZGA 3GLGA 5IUNC 4RE5A 4Q1VA 1Z6QA 3GXOA 4W5WA 1UZLA 2PUHA 2PV7A 4INPA 4XGKA 5DEIA 2H1FA 5H16A 3TX6A 2C3YA 4RJIA 1TJ5A 2A1TR 2Q41A 4MUAA 3BMNA 5I7AA 3IR7A 3H5TA 1V2GA 3WAGA 3IV9A 1W52X 3OIVA 3TLZA 3DR3A 4ZDIA 3TD6A 2JLUA 2JGMA 4YQEA 2JLSA 2ASEA 3KJQA 3LQRA 5DLQC 4QG3A 4KQCA 1DJLA 2J4FA 3O3MB 2PXXA 1A69A 4JV5B 4N9WA 1K2VN 1XRRA 3MRSA 1CZKA 2NTYC 3OJLA 3ZWOA 4ZDJA 2B6NA 4OHFA 5L7TA 3HJHA 1N5IA 4X1YA 3PPVA 3F3MA 2X2OA 3C39A 2P8JA 4LYHA 4LVCA 2XZPA 5DYWA 4ZARA 3T35A 1F8XA 3U39A 1UAAA 1QIEA 2OCKA 3IEXA 3VR2D 1PT8A 5FOWA 4BKUA 3KP1A 1WZEA 1DAOA 3MUEA 3Q5DA 1NR5A 2W4IA 3DYBA 1IZYA 1E9DA 4WJKB 3RIXA 3ZS9A 4D6YA 3STUA 1KDTA 4MYCA 1VCHA 1IUOA 3GI1A 1NNSA 3SHWA 4KR2A 3QF4B 3I64A 2PR2A 4RZQA 1JDTA 3INYA 4JCCA 4B6EA 1BMFA 3HGTA 2P2LA 2QTAA 5JWOA 3F1LA 4ZJPA 1A7UA 1RAAA 3EAFA 5FTJA 2BTEA 1PR1A 2IJGX 2HSWA 3COJA 3RBVA 4AZWA 2C31A 1Q0UA 1W5SA 4RCZA 4RD2A 2HO5A 3LUPA 2PA3A 3VNVA 1QVVA 1DSSG 3ADKA 2X1VA 5JR3A 1H8HD 1G8HA 4NV1A 2QX7A 3ABOB 3LFTA 3BJZA 3DAYA 1UJCA 1EP3B 3FD8A 2EL7A 3WBKA 5DN6A 2WQZA 5ILQA 5EIBC 3RKSA 4NCIA 4ARZB 1GSHA 5D86A 3I8SA 2AH5A 3B1FA 3HJUA 1VB5A 4OHCA 5JMPA 3LUKA 1X70A 1YRWA 2Z2YA 4YUWA 4NS4A 1FSSA 1SEPA 3WYGA 5FHRA 3LKZA 4BVAA 3EMVA 4ROSA 1POXA 2VTBB 2JLCA 4L8GA 1RYYA 1PFKA 3OPMA 1B73A 5FB3A 5BN4B 4B3CA 1Z0SA 4OFWA 3HKEB 3I83A 1RXUA 2QR3A 3W2TA 2WU0A 2XDQA 5D84A 1QTRA 4EUHA 5AFSA 4AIRA 2PLFA 2A0XA 5EKUA 1BGVA 2OXCA 1Q0TA 1QH8A 4KK3A 1H94A 1YXMA 2AVDA 4DMMA 5IM4F 1LPBB 2VRWA 3KLBA 3QSYA 2NZ8A 1H2HA 1BWQA 1NI4A 1ZUD1 4XCVA 1JEEA 5G40A 3JRXA 2JJ2D 2VDUE 4OI0A 3DC2A 2B7CA 3Q6NA 3G2IA 1SBCA 1GCOA 3KEGA 2FGKA 4J7XA 2ISQA 1OX4B 3UJPA 2Z30A 3VV3A 5ISMA 4JLJA 3DZBA 3KYBA 3L0PA 2PA0A 4K6MA 3SQLA 5CURA 4E31A