2ZLBA

Crystal structure of apo form of rat catechol-o-methyltransferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
212
structure length
212
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 72
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zlbA00
1JG4A 1P1BA 4OQEA 3TLJA 3DMHA 4H0NA 2ZCJA 3EVFA 3LBFA 2PT6A 3LECA 4E32A 5K0JA 3O4FA 5ICCA 1JQEA 3ER9A 2EG5A 2ZZMA 4MTLA 5DM2A 5P8WA 4YMHA 2VDWA 4PYMA 3KHKA 5FHRA 1YZ3A 4X61A 4HC4A 2B3TA 2F8LA 3MTEA 3BWBA 2AOWA 2FRXA 2IDKA 2AN3A 3MQ2A 3NWBA 4PYNA 5HIJA 2G1PA 3FYDA 4KDCA 2PGXA 5EIWA 1L3BA 5CCBA 5EHGA 3KPYA 1NV8A 2VDVE 2DULA 3OFJA 4R8SA 1KPHA 4B17A 3PX2A 2OB2A 3AXSA 3E7PA 4RVFA 2B78A 2CMGA 1G38A 2IBSA 2FK7A 1UWVA 1EJ0A 3BUSA 3HCFA 4M38A 4R05A 3EVEA 1Q0TA 3GRZA 4PIMA 1VQ1A 1X1CA 3LHDA 4RYLA 5LQKA 1BHJA 2QYOA 1ORIA 3HNRA 5F2OA 2FK8A 1SVUA 4RTKA 4PNEA 4BP1A 5JR3A 3PTAA 2HTEA 3CVOA 2BZGA 3SVZA 3WSTA 2QRVA 3UBTA 2BR3A 3EGVA 2ZBQA 2Y1WA 3NWEA 1RJEA 2C7PA 2ADMA 4DMGA 5LSAA 2ZWVA 3DLCA 1PRYA 3C6MA 2O57A 3HVJA 5EPEA 5GIOE 2GLUA 4CKEA 3P97A 5C9ZA 1G8AA 4PWYA 5EIFA 3E05A 1SG9A 3FTDA 3EPPA 3HVKA 4P58A 3EGIA 3IEIA 4FR0A 4OQDA 1DUSA 1NE2A 4XCXA 5EMMA 1PJZA 3M70A 4XUDA 1SKMA 4RSRA 3KR9A 5DPMA 3DMGA 1EG2A 3OZSA 4HRAA 5FQOA 5EC8A 1P91A 5EMLA 3FTEA 2B9EA 5DTRA 2O06A 4E2WA 4OBXA 4U7PB 5FWDA 4E2YA 5U4XA 1D2HA 1MJFA 5FTWA 3SMQA 2NXCA 4AZSA 1M6YA 2PWYA 3FYCA 1VLMA 4Z2YA 2AOUA 4MHTA 1VL5A 2P8JA 1KXZA 3DXYA 4FGZA 4Y2HA 3R3HA 3GRYA 1ZHFA 4X63A 3ME5A 2GPYA 5HIIA 5EG5A 3UJ7A 5LQUA 2ZLBA 3EGEA 3LGAA 3LSTA 5FWAA 4GOND 1KYZA 3G8AA 3BGVA 1AF7A 5K8VA 3H2BA 5EZSA 4HGZA 1NW5A 3EVZA 4KRGA 5G02A 3C0KA 5D1HA 4BLWA 5E9QA 3FRIA 2ZIGA 3G2MA 3M6XA 1BOOA 2AOTA 4RTNA 5EHIA 4RX1A 1YFLA 2P40A 5FADA 3ERCA 2NXNA 5T67A 3FZGA 5BXYA 1JQ3A 1X19A 1V39A 4GC9A 3C3PA 5EVJA 2O05A 3HCDA 5EMKA 4IV8A 4BLVA 4PGHA 4PGGA 2HWKA 1QYRA 1JG3A 1NKVA 1N2XA 2E5WA 2ZVJA 3JWJA 1WXXA 2Q41A 4FP9A 5DRTA 5HILA 1JG1A 4OX9Y 2PJDA 3ELDA 10MHA 1JSXA 4CWAA 2AR0A 4DA4A 3ELUA 1EIZA 2NXEA 2P7IA 5CVUA 2NP6A 3P2EA 4PYLA 4DF3A 3I9FA 1NW6A 1NBIA 3GU3A 1EQAA 2YX1A 3BXOA 2ZW9A 4KW7A 4L7VA 4QTUB 3OE5A 3SSNA 1R18A 1AQJA 3FTCA 3NTVA 3AJDA 3DXZA 3MGGA 2UZ4A 4ER0A 3FTFA 4EKIA 3KPVA 3B5IA 3FUUA 1RI2A 2HNKA 3UJ9A 2A14A 5KS2A 5LQCA 2IH4A 3UA3A 1UFKA 1EJ6A 4HSGA 3FUTA 3CC8A 3KQYA 4NECA 4HG2A 2JH9A 4DCMA 3NDIA 3PB3A 4DZRA 3SR4A 4YUXA 2HMYB 3OCJA 4EKGA 1G8SA 2BM8A 3RIEA 1M6EX 5BW4A 4JXJA 5LQAA 2EJUA 3DLIA 5EQJB 3B3GA 4X60A 1IY9A 2ZIEA 3KR0A 1L3IA 3LBYA 3UJ6A 1XXLA 1RI5A 4C04A 5EZQA 2PXXA 4HTFA 3OU2A 3P9KA 3ELYA 2AVNA 3P9NA 5FQNA 3AXTA 5DTQA 5DLYA 3P2IA 3GXOA 3HP7A 4MIKA 4E2XA 1UIRA 3MCTA 3BWCA 5K0FA 4HH4A 1NW3A 1SQFA 4OA8A 2ZULA 4BP3A 1RJDA 3M6VA 4V0RA 5KQSA 1RI1A 1R6AA 4P7FA 2PX8A 2AN4A 5DM4A 3M6WA 3BWMA 2GA9A 5GM1A 4YV1A 4UOEA 2CMHA 3DOUA 3E8SA 3X0DA 3FPJA 2G8NA 4GQBA 2P7HA 4F84A 1BC5A 1G6Q1 2ZIFA 1INLA 3TOSA 2CL5A 3SGLA 3A27A 3PFGA 3FUWA 2FHPA 3ER8A 1B42A 2JHAA 1VP9A 1F3LA 4GBED 4XUEA 3GDHA 1NW8A 3NW9A 5K0NA 4CTKA 2ESRA 1QAOA 3IYLW 5EGSA 2ZZKA 1O9HA 1O9GA 5EKXA 4C4AA 1RI4A 3KQPA 3OU6A 4YV2A 3HVHA 3UZUA 3PLAE 2JH8A 3MB5A 5LR6A 4FSDA 4AZVA 5EMJA 1JR4A 3HVIA 2ERCA 3G5TA 4LWPA 3LKDA 3OU7A 4PYOA 4QDJA 3EEOA 2BH2A 2FPOA 2OB1A 1BKYA 4F86A 1FP2A 3CGGA 4C05A 5FUBA 3B7PA 2XYRA 1TW3A 5F2KA 5IH3A 3C6KA 2PX5A 3I58A 1EAMA 4GF5A 5DM0A 3KQWA 4AX8A 1JTFA 3LDGA 3BGIA 4RTMA 2GH1A 4F85A 3TMAA 1MHTA 4LG1A 3M6UA 2P1DA 4DKJA 3KPJA 2AZTA 2H00A 4IKPA 2YXLA 4O29A 3GCZA 4K6MA 5T6BA 2I6GA 3UFBA 4C07A 5E8JA 2VDUE 3MERA 2P35A 4YUYA 2G70A 5K09A 1XVAA 3KU1A 5HFJA 4POOA 3NMUF 3GRVA 2PLWA 3LKZA 3NDJA 4QDKA 4YV0A 3OZRA 1XCLA 3TQSA 1WY7A 1L1EA 1HNNA 3SSOA 3F4KA 4GC5A 4ER3A 3P9IA 2OPBA 3PX3A 3R0QA 3A25A 5DRYA 4E2ZA 3CBGA 3ORHA 3VYWA 3I5UA 2I7CA 5DX0A 3I53A 2FYTA 3TM5A 1X1AA 2NXJA 1I1NA 3JWHA 5K0CA 1KPIA 2ZSUA 2NNWB 2UYOA 3DR5A 1JTEA 4CXMA 2UYCA 2B25A 3G2QA 4DQ0A 3THRA 3GIWA 3OZTA 5M5BA 1YZHA 4ER7A 1JSZA 4RVGA 2AVDA 3O7WA 5DT2A 5LQRA 2YR0A 5GP1A 3KPUA 1NW7A 4GUAA 1XTPA 1ZKDA 5DXJA 4KVZA 5FA5A 3QOXA 1AQIA 2ZTHA 5E1BA 5K05A 3UJBA 5FA8A 1T43A 5DWQA 1ZG3A 5C1IA 1JG2A 2GB4A 4FZVA 2P3LA 2YTZA 3HM2A 2OY0A 3UJCA 3GWZA 3GRRA 1O54A 4A6DA 3PS9A 4EQZA 4M37A 4ATNA 4RVDA 3BWYA 1NV9A 5CM2Z 3ID6C 5ERGB 4DM3A 2YVLA 3DUWA 4FSXA 3FPFA 1YFJA 3MHTA 3P9CA 3PVCA 8MHTA 4RWZA 3KKZA 1XDUA 4E31A 3DH0A 2KW5A 3M33A 3TPZA 3TRKA 4E70A 5CCXA 4RTSA 3HEMA 2B2CA 4YUZA 3LL7A 3BKXA 4KDRA 1N7IA 3SXJA 2OZVA 2YUIA 3SSMA 3TKAA 4C03A 2WA1A 2IH5A 3CJTA 3AWIA 4PYKA 1L3CA 3EVBA 4A6EA 2ONZA 5K0BA 1YF3A 1Y8CA 3JWGA 5H02A 3KQSA 1WXWA 2PSSA 4RV9A 4FT2A 1FP1D 4RVHA 4CKCA 3G8BA 3EEYA 5E1MA 2I62A 5HIMA 3HCEA 2OXTA 4RTRA 2VP3A 2XVAA 1G55A 1RI3A 2GAFA 1KIAA 2AOVA 2PX2A 3FPEA 4QPPA 2I9KA 5DM1A 5DSXA 2YXEA 2ZZNA 3UJAA 4PYJA 1KPGA 1WS6A 2AOXA 2QM3A 2XYVA 3L8DA 3HCCA 3LCCA 4C06A 3KR2A 4DCGA 5ICEA 3KQOA 2YXDA 2JG3A 2LD4A 5HIKA 5FULA 4M36A 1N7JA 3SX0A 4MWZA 2ZBRA 1Q0SA 3UA4A 2ZFUA 1VP3A 2JJQA 2WA2A 1FJXA 2P3OA 2PXCA 1DL5A 2VS1A 4ZTBA 3U81A 4OBWA 4GOLD 5E2BA 5K03A 5KQRA 1OR8A 3TKYA 3EMBA 1VE3A 5D1NA 2V7EA 2XYQA 3HTXA 1XDZA 1QAQA 3JWIA 1VBFA 2IIPA 1KP9A 2BM9A 3IV6A 5CVEA 3ELWA 5DX8A 5GM2A 4LWOA 4EVIA 2PKWA 5K0GA 2QRVB 3O31A 1WG8A 3G2PA 1FPQA 3KQTA 1JQDA 4EMSA 2HR1A 3EVAA 4KIFA 1SQGA 3BKWA 3FPHA 2IPXA 3V8VA 5HZMA 2AN5A 3C3YA 3E23A 2XBMA 1YB2A 3HA7A 3OPNA 5HEKA 3AY0A 5FCDA 4E30A 3UJDA 3MCZA 4P7GA 5DXAA 1D2CA 2PX4A 5KVAA 5FHQA 4PCAA 4PONA 5ICFA 4AZWA 3MTIA 1QAMA 1AV6A 1XJ5A 2BR5A 4Y30A 4CTJA 3MAGA 4PCLA 2JHCA 2V74B 3HCAA 2PY6A 3Q87B 2NP7A 3SM3A 3GJYA 4YUWA 3KQMA 4C08A 3S68A 2NYUA 3R6TA 3Q7EA 3FRHA 2CWWA 4BLUA 4E33A 5DX1A 3BT7A 5EEGA 3P8ZA 4QPNA 2P3QA 3DP7A 9MHTA 2K4MA 4X1OA 2H11A 5CVJA 5EKUA 5GOZA 2AOUB 3TFWA 1WZNA 5CD1A 3G2OA 3UWPA 2OKCA 2PWPA 1X1DA 4PIPA 4WVLA 3VC1A 5CIYA 4IV0A 3EVDA 1KHHA 4R6WA 5CVVA 1NBHA 2JHPA 3OE4A 3R24A 3T7SA 5IKMA 1M0EA 5T64A 3GNLA 3CJRA 4QTTB 1P1CA 2AS0A 2R6ZA 3BGDA 3HA3A 4IWNA 4MQ4A 5DSTA 4FT4A 3ANXA 1SUIA 3D2LA 3P71T 2IDJA 1R8YA 4YMGA 5EEHA 5F2NA 2C7OA 3HA5A 1RJGA 2AOTB 3EVCA 3A4TA 1IM8A 1U2ZA 4V0QA 1H1DA 5E9JA 2CKDA 3CJQA 3M4XA 2N47A 4YUVA 3KR1A 4ER6A 4OA5A 3THSA 1R00A 5E8RA 4FS8A 5E9WA 2EJTA 2P41A 4LECA 4P7KA 3K6RA 5ICGA 2OO3A 2YQZA 2C7QA 5JUWA 3LCUA 3GO4A 3LDUA 1QZZA 4HGYA 3T0IA 1KYWA 3R9XB 5GWXA 4GOOD 5K01A 3HCBA 5B1SA 2HV9A 3A7DA 3LPMA 2ORED 1F38A 3UJ8A 3LCVB 3DTNA 2PV0A 7MHTA 2UYQA 3EVGA 1XDSA 2G72A 3CKKA 5CVDA 1P39A 4CKBA 3P2KA 2PXAA 3CCFA 3B89A 4QQKA 2C7RA 3G88A 2EX4A 2OBFA 3B3FA 1VIDA 2IFTA 3V97A 1KR5A 2EFJA 2ONYA 4RTQA 4R8RA 1ZQ9A 3LDFA 2Y1XA 3QV2A 3EMDA 4EK9A 3DXXA 2O0LA 3TM4A 5GIPE 1FBNA 5BW5A 4KIGA 1DCTA 1I9GA 3FPGA 5E1OA 4XUCA 1Z3CA 1G60A 3FUXA 2IBTA 1SUSA 2IGTA 4KWCA 1YUBA 3KQVA 5E2AA 3TR6A 3A7EA 4PYQA 3T7TA 5HOQA 3K0BA 5K0LA 5K0EA 2UYHA 2IH2A 3RODA 1L9KA 4QVGA 4QQNA 1X1BA 4ISCA 1I4WA 3REOA 5MHTA 3G7UA 1VPTA 3PT9A 3A26A 4P7JA 4QVKA 4RTLA 2WK1A 3FUVA 1HMYA 3NVMB 3T7RA 4ER5A 3B3JA 1RJFA 2PT9A 2ZBPA 4HTFB 3IHTA 2O07A 4PINA 5EOVA 3KQQA 4RTPA 5E1DA 3G89A 4AUKA 2IP2A 3VSEA 2G71A 4M7RA 2R3SA 3DMFA 4U7TB 2H1RA 3LX6A 3RW9A 3VC2A 5LQJA 4GOMD 4RTOA 1QANA 4G56A 2Z6UA 2VZ9A 2FCAA 3NVKI 3GRUA 2PBFA 5KYGA 5DTMA 2XVMA 3BZBA 3I64A 3NJRA 2QE6A 1ORHA 4GEKA 5LQNA 4R6XA 1XCJA 1TPYA 5C0OE 5GINE 2GS9A 2Z6QA 1R74A 1R8XA 1D2GA 2OYRA 1NT2A 1ZGJA 2DPMA 2BR4A 3DULA 3PFHA 2QY6A 4WXHA 1TW2A 2PVCA 5BP7A 3G5LA 1IXKA 3OFKA 5CUQA 4RTJA 4BY9E 4X41A 2Z6AA 1ZGAA 3KPWA 2ZWAA 3GGDA 4AZTA 4PYIA 3QOWA
chains in the Genus database with same CATH superfamily
3ZY5A 3UOAB 3BXFA 5L3QB 1WTCA 1WMBA 1L6RA 1SXPA 3R0ZA 4XQEA 4M1OA 1ZAYA 4D25A 3KLNA 4RCZA 1ZHOA 3NM6B 4MAFA 1C9EA 2QAGB 3RU7A 5DM2A 5DV9A 4PYMA 2Q3CA 1B0UA 4RWEA 5EUBA 3RHSA 4QVIA 4MRPA 1W52X 5KB3A 2NZYA 4MKZA 1O3YA 4DA0A 3B6KA 2WJVA 1EBFA 1NZFA 2P8SA 3I32A 1SM4A 2EHDA 3DBOB 3FCEA 4H7IA 4P3KA 4UE3S 3K1ZA 3WDMA 4HNQA 4XR4A 5EJ7A 5HRUA 3AESA 1G6HA 4KGDA 4RA9A 1UM9B 2GXAA 1E3IA 3NVAA 3JVIA 1TMYA 3PX2A 3TDKA 5FLXA 4N5MA 1SUDA 4RVFA 1W75A 3ZWKA 1PT9A 3GGSA 2DSNA 2JGDB 3BUSA 4R05A 3NJ4A 5E6RA 3LT5A 3HHPA 1BHJA 1Y4DE 3S1AB 1U3VA 1L5YA 2GO1A 3TL6A 1YA8A 2FPXA 5JR3A 3JYOA 4Z99A 2QTAA 3GLIE 3HC7A 3OUUA 1XLUA 2MINB 3GVIA 2Y1WA 3WIUA 1H94A 4DY6A 5J5VA 1RYHA 3GUVA 4G5FA 1R3UA 1T2AA 4BLOA 3GEGA 1N9GB 1PW5A 4IGAA 2F3QA 2GXUA 5AKJA 1OAOA 1UBMS 5EJ2A 2G5TA 4CMIB 4G8CA 1GN9A 1KTVA 1G8AA 2IF0A 2OSBA 3C1TA 1MXFA 5IKEA 4F97A 3BXZA 1VSQA 2D74A 2XMQA 2ZRAA 1KAGA 2FNAA 1VE6A 1J0XO 5TPWB 3STYA 3KB8A 3RVLA 2BV3A 4AT1A 1NE2A 2PD3A 1RXVA 1HE5A 3H6GA 1Y33E 1D3AA 3M70A 3MXTA 4M7PA 5ALXA 4ENQA 2YHIB 3W5DA 8LDHA 2AW3A 5EC8A 5JNWA 1YU9A 3H5LA 1OFUA 1Y9AA 1DOHA 2QZZA 4INOA 4LJ9A 1LFAA 2BI4A 3RKSA 4B2YA 4D56A 1N5DA 1SAYA 1SCQA 2H4ZA 4TSKA 5AVYA 5BUCA 4FXPA 2Z3VA 1TECE 3FFTA 5T8KC 5I7UA 2IEDA 5HIIA 1RYEA 1U7DA 1YKSA 4XWOA 5AQ1A 2GRUA 2ZLBA 3KSUA 4D0SA 5K8VA 5CLFA 1FNCA 1NQUA 1RRFA 1U65A 2DG2A 3EVZA 1OHHA 2O50A 2Q4DA 5L3RA 1XK7A 2ZTUA 3ZLUA 3HYCA 4RH0A 4TXMA 4ZXPA 2D3TA 2HJHA 3RAEC 5DT9A 5FPHA 1PD0A 4RTNA 1UT8A 3E2MA 4H2DA 4TL8A 1DEOA 5FL3A 5I4CA 3ERCA 2FUCA 4XUGB 4B9AA 5J58A 4J1QA 1P33A 4JC8A 3CKMA 2QTMA 3PJFA 4NPCA 3VZCA 1MBZA 5TVGA 4EHAA 3VQTA 3J81k 2BJHA 4HATA 1QU2A 2Y8EA 2VSXA 4W1PA 2AH5A 4NE2A 4C1BA 2V5VA 2V97A 1WEHA 2IPNA 3GT7A 3OY2A 4M98A 5FUVA 4EJMA 4YGXB 2ZVJA 5KPDA 1NKVA 2O52A 1CR6A 1GTL1 4EKEA 2OORA 3CUKA 3FTNA 4C6SA 2VP9A 1GM5A 3A31A 4YJDA 5K9ZA 1JSXA 2NUPB 2DECA 1G21E 1ECFA 5CAEB 3MNFA 3GN2A 4K86A 2AMJA 4O2AF 4XM2A 3H5TA 3V33A 4Q21A 4BKOA 4BMSA 3KSDO 1PGJA 2VJOA 3UXYA 2OGWA 3T54A 3W1VA 1L8AA 2YX1A 2I03A 5JMWA 3BXOA 1S02A 1IHYA 1YQQA 2OVFA 3PT5A 3ROEA 1IZZA 3SSNA 3C3DA 4I5GA 3WIEA 2CBXA 3AJDA 3DXZA 4OL9A 4J29A 3M34A 2ZANA 5IC4A 1PFKA 2QTVA 3CN7A 4R3WA 2UVPA 3PUKA 2J0EA 1ZNXA 2FZLA 2XEDA 2IIVA 1I8TA 3OESA 4HK4A 1H65A 5K8JB 1C4OA 1YDHA 1UAYA 2BM8A 3LF2A 3BSSA 1QRTA 1N5IA 1BKDR 1JU9A 3UJ6A 4KQXA 2OCAA 2XDQB 1J99A 1X15A 4BX3A 3M6LA 5ALRA 5A7FA 1BEUB 2GAOA 5E3IA 4UQOA 4F3NA 1VDZA 5DOVA 5DTQA 1VDMA 3PYXA 2R84A 1RXCA 2WJWA 5DLYA 4YXWA 4CMGA 2AKEA 2ZUSA 1X8XA 3CISA 3KKQA 4G37A 2QQFA 3NBMA 1WV0A 2V6GA 4EKNB 2NZJA 1GGNA 1RRGA 2Q8NA 3TECE 1AQUA 1R6AA 1SK9A 1XL1A 3EDRA 1EJ2A 2ZJBA 3NTQA 4IMRA 4KXUA 4P7FA 2H31A 5J5AA 1YR1A 1AHPA 3M6WA 5H83A 2GPJA 4CLRB 1CEEA 1C3OB 2XMCA 2JFWA 2ZRBA 4WZAA 1P6XA 1J2JA 1P7ZA 5EJIA 4LYFA 5ARBA 1YMVA 1XZ8A 3D1VA 2FGKA 2QN3A 4G0NA 3UMVA 2YHUA 2G17A 2FHPA 1V71A 4RYDA 3I01A 1ZPDA 2IEYA 5BNWA 1GQ2A 2PTHA 3NG1A 4DCUA 4RE6A 1HQCA 1QIGA 2J8ZA 5BNFA 1QTNA 1C1DB 2J6HA 3BCRA 4NJMB 1SB8A 2KM1A 3G5UA 5IK2D 4QXAA 3Q8WA 5DGHA 3K9QO 3QIAA 4LPSA 5DF1A 1WHSA 4HDNA 4A27A 4JBNA 4KPYA 1KDRA 3ZU4A 3AFHA 4KL8S 1G5HA 3OU7A 4LF6B 1TEZA 1X8LA 2I4IA 4DLWA 3RE1A 3CSUA 5SYNA 2IQ5A 1FDVA 1PR6A 4MVJH 3RS7A 1TAUA 3I58A 2WJ4A 4J0EA 3HKDA 2XMBA 3TXYA 2VNAA 2ZQYA 4P36A 1GN8A 4LXQA 2J5XA 4DRZA 4P35A 3E9MA 4OUDA 4C89A 1TLFA 3DW1X 2OWEA 4PPFA 1FNSA 2HLDD 1PFVA 3OQHA 2D62A 4M9UA 2JLZA 4C07A 4EX7A 3VKFA 2OAP1 2EBUA 3H2HA 2O19A 1UFOA 1MO3A 5IWCA 3CZMA 1QCYA 1MW9X 2P35A 4YUYA 2AWOA 4MH0R 3E0XA 4BCDA 3K1JA 3QWIA 4OMDA 1XRLA 3HDQA 5BWMA 4IDGA 1U98A 1PZNA 4IQ8A 4MUXA 4ZIRB 5YASA 3P45A 4NCAA 2REQA 5JI3E 5JNUA 2PJZA 4UCFA 3R9IA 4ZO4A 3PNBA 4MRSA 4W5TA 1NLYA 5IEJA 2L0XA 1DG3A 1GPLA 1I14A 2HA3A 1BMFD 1T2EA 5HW0A 4E5VA 3GNQA 1HDIA 4RE5A 5F3RA 4NQRA 4P3OA 1FA9A 3K8ZA 1KJNA 2Z43A 3ETNA 3BA1A 4IKOA 1IAQA 1JIJA 5JS1A 1FMTA 3OTOB 4GL2A 1A5ZA 5D3MA 4EFDA 3WOVA 1GA6A 3IQDB 3PWSA 1J7JA 1SCIA 4NARA 3AHJA 1P1IA 3E9RA 4BMDA 4G5OA 3GLFE 1R0ZA 4AICA 3QPBA 3EBLA 1MB9A 4RDXA 2YR0A 2AJBA 2QUJA 1N2HA 3IC5A 3ZY4A 1KETA 3HQ4O 4IIBA 1HNWB 2W2KB 1D2AA 1BH2A 1QYIA 3ONNA 4H6WA 4NYJQ 5C8DA 1D4OA 3GOHA 4UFPA 1APBA 2VK2A 4YIKA 4PLPA 3GH3A 5HQ3B 1ZM2A 3RIXA 3ZIAD 1U1DA 2E0IA 2J3QA 4EGCB 2ZJ7A 3IESA 5IZCC 2VYFA 1N2CA 2J5QA 4P83A 5BMVA 4ITRC 3DDCA 3ORQA 5EXXA 2ZUBA 1U7PA 2QMOA 3WGYA 1XEXA 4P98A 2RJOA 3KUKA 4JS0A 4MRAA 1VPLA 1DDIA 3QXJA 4DM3A 4U9HS 4AROA 2Y67A 1HLDA 1XR3A 1P74A 3A6EA 5J5CA 5C31A 4HZGA 2BEVA 4BATA 1AZWA 4HOYA 2IXTA 1GL7A 3TPZA 5GONB 3OLVA 3HACA 5M04A 1HUQA 2B83A 1SIUA 2L2QA 2C04A 1IXSB 3KYCA 2Y1GA 4KDRA 1V7ZA 1LPPA 1KZ1A 1TZKA 2QTTA 1KEVA 2YUIA 3ICVA 3ED1A 2VRCD 3NHFA 5F51A 3RS8A 3UCXA 1SVLA 3EIWA 1GZ4A 2V9PA 3F5QA 3KHTA 4GYKA 2JW5A 1LI4A 2P6MA 5BW6B 4A4DA 4OAQA 2FSFA 4GD3Q 1TF7A 1E2BA 3S44A 4RESA 1EZ4A 2C54A 2FQ1A 1YRHA 3R0XA 2RAPA 3HCEA 2HGSA 3E22A 1N1MA 1HDXA 3LLUA 3DEYX 4MW1A 1KI4A 2BELA 4GI3A 3BSWA 4U2CA 3KKEA 1A7JA 2HFKA 2QNRA 4ESHA 1KPGA 3C41J 1WIWA 2F00A 3KR2A 4JUDX 4LRWA 3PDWA 3IS3A 2V0GA 4Q6WA 3NB0A 3RV4A 4WJLA 1EUYA 4HQNA 4A03A 1PZEA 4PN3A 1NXOA 2Q5EA 4B34A 4GOJA 2YCBA 4ENPA 1VLQA 5K3SA 2JJQA 4EWLA 3KJIA 4YBRA 1IRXA 2B4RO 3PKZA 4K9SA 3AUSA 5A6VA 3IPXA 5KYKA 2AX4A 2IY8A 1RCTE 4Q4LA 3DMYA 3WYBA 1SC6A 2YC4C 5DP2A 3DDSA 4G1VA 2IS2A 1L5WA 1PV2A 3TW0A 3D4LA 5CVEA 1X9GA 5ALUA 4NMHA 3E82A 4JUCA 2Q6IA 4O2BB 5ES3A 4EVIA 4PE5B 3L5KA 4Q82A 1IVYA 3KQTA 3O47A 3G2JA 3VFDA 4MPTA 3QMPA 2IPXA 3GLIA 3E9EA 1B3BA 1YB2A 3UOGA 4FYMA 1CHDA 1XTSA 2GX6A 3O84A 1TZ2A 4WMLA 3CRNA 1XTRA 2JNWA 3Q1KA 1S1MA 3EZGA 1SCAA 3K73O 1Y8ZA 2W83A 3ER6A 4GI2A 4L74A 5DU2A 2UUOA 4JY7A 5I4IA 2ZPUA 4Q0MA 3TQRA 1EHYA 2UZ1B 2GBFA 2Q46A 3D6VA 4LSMA 5DJ5A 4WFKA 5AOBA 3AJ8A 3NIBA 4X8OA 3GGOA 4CQNA 1LLCA 3R5XA 3WI7A 3UANA 5EGNA 1QGDA 2H2HA 3HKCA 4YUWA 4LXTA 1E4EB 3FRHA 2AQIA 2H2AA 4AG5A 1U7UA 2GAAA 4M4SA 3NJ8A 2QT9A 3A2KA 1HTBA 1P8JA 2FAXA 1NNSA 2ZBDA 1LH0A 1U8FO 2LR0A 2AOUB 2RHRA 3OEYA 3UUFA 1G1MA 2R48A 3LSYA 2D0OB 2PWPA 1L5KA 3WB1A 1D04A 4A73A 4CL2A 2ZE8A 4L08A 4R6WA 1UQTA 1YHZA 2UZ3A 5CB4F 5C5CA 4X66B 5CBKA 1SHZA 2YNMD 4J7CA 5HJ5A 3NEPX 1EWQA 1NVWQ 3HFJA 4HMPA 1K98A 3HJCA 1JJVA 3RVRA 4C5AA 4QTYA 1FNBA 4L2IA 3GJ4A 3ZHSA 2JGJA 1UK6A 2JJMA 2ON6A 4FT4A 1H93A 4D9BA 3OPMA 5CTJA 2IDJA 2C7OA 4FYKA 1RPTA 1VPEA 1RJGA 3DZFA 4MVYA 1JIIA 4NCJA 1PEYA 2AEJA 3SJ7A 1H05A 1MOPA 4JOBA 2PKQO 4WY5A 3TTXA 3LM8A 1YTUA 4KFRA 4UHEA 2IV2X 1EK2A 2G06A 1U3GA 1H4QA 4YRBA 2C7QA 1RLOA 1TVEA 2GM9A 3LQFA 4H59A 4TLAA 1ABBA 4S24A 5DBEX 3ONEA 2HHHB 2Y93A 4Z9AA 2V1UA 1UZMA 2WQ6A 2NZXA 3MT8A 2OZLB 4R1SA 4EKYA 2VNIA 3DVAB 4LHYA 3HRKA 4DRXB 3F6YA 4UARA 1VIYA 3OQNA 1N36B 1TMGE 3G9UA 5LDGA 4AL4A 4NPHA 5FBKA 2COUA 9LDTA 4L8LA 4DPKA 2IOFA 3RG8A 5AVOA 1FU4A 3VVLA 1G21A 1M2VB 2GCOA 1DIBA 4LRQA 3FKJA 3LDHA 1SHJA 4QQKA 2WOJA 3FLMA 2OBFA 5MN5A 4D9IA 3JCZA 4L5YA 2P4UA 1EGVB 3CVUA 4ZQCB 1JDTA 2EFJA 2ANBA 6NULA 1E1YA 1E0DA 4JVLA 4JLVA 2GKSA 2O14A 4E1AA 3EMDA 2WKQA 3OM8A 4JODA 4Q3AA 1OE0A 4CCYB 3IELA 1XRJA 5KAMA 1PK8A 3GJRA 4MV7A 3BC1A 4ZYLA 2IBTA 1RKQA 2XUFA 5EPUA 4X93A 2EFYA 1GOTA 2FPKA 3CZCA 3PFKA 4G97A 2UYHA 1YS6A 3ZDBA 2H3HA 4QQNA 5JZVA 4ISCA 3K9GA 4ENTA 1YDWA 4TLDA 5CK5A 3NO4A 1R9GA 2P9CA 5GOTA 4P7JA 2HO4A 3REFA 4RTLA 3E3NA 2OFXA 2WK1A 4MV3A 2PT7A 3I9V6 4RV4A 3UG7A 2WR8A 3B3JA 1Q1GA 1Y89A 3PR1A 5IYZB 1KO4A 3PR2B 3HO6A 1FB5A 1OWLA 3HNOA 3EQ6A 1C9NA 2BJVA 2R3SA 3M1AA 1SCBA 3Q0EA 4CIDA 4W6ZA 4CKXA 2VUIB 4IXTA 4Y9UA 4REOA 1SQ5A 1FS6A 2VATA 1AGRA 4LC1A 3CNNA 3II6X 3ONVA 4PTLA 5DTMA 5TQ0A 5KYGA 1UBJS 2NV6A 3DAYA 4PR0A 1PGQA 4FQ5A 1DUIA 4IJ5A 3BQNB 2VJYA 3DZHA 3FBWA 3GJ6A 1RYNA 4CG2A 1ZGJA 1LLUA 1Z8HA 4WXHA 5G53C 3RSOA 4BFVA 3U5ZB 2ZKIA 4P9NA 5CUQA 1DRWA 4RTJA 2QVCA 3VHQA 4OVKA 4JOSA 4A2WA 1SKQA 4KFSA 5J2UA 1DKMA 1QVWA 4OI4A 2BEKA 5KYXA 1JG4A 5IJ9A 5K7SA 3WA7A 5G3YA 5ICCA 1SVSA 4WCFC 1E7WA 4FFBA 4JSRA 5CNIA 1GCGA 2PRSA 1IJKA 3KWLA 3R7NA 4YWJA 3O8QB 1ARZA 1G3UA 4M2LA 5FD8A 4Q9KA 3C97A 3C48A 2YY7A 5T3YA 4ZDKA 1SNYA 2ODPA 3W1WA 4YP5A 1NKSA 3ZTTA 4IR7A 5IHXA 1L1QA 5IX8A 4Q9JA 1J1UA 1RQRA 2LIPA 1D09A 5CCBA 3R3ZA 2W7TA 4GMHA 1H66A 3N6VA 1MPTA 5HE8A 4YT2A 2JA1A 2CMGA 3OQMA 3OCXA 3E8XA 1HDOA 4O4JA 4PANA 3IUYA 3VPBA 1IJEA 1X1CA 4UUMA 1GPMA 5FO1A 1MJNA 4JH0A 3HNRA 2NTJA 1NJSA 4PM4A 1BROA 4JBIA 4LYDA 1RHQA 2BISA 3PHIA 1YRYE 2Y0PA 2AT1A 4XLTA 3IMKA 3B1FA 5IZCA 5F7JA 3UBTA 2ZIXA 2EP5A 4KPUA 4ZT3A 1PR1A 4X7MA 4Q9AA 2ARKA 1WPQA 1A82A 4IH1A 4OB6A 4HNSA 1J90A 3MWDB 4WECA 3SF8B 1YI0A 2ORIA 1V9SA 2B5VA 1CLUA 3F6EX 3P0FA 4F4FA 2V0CA 4MCJA 3AVTA 1JYEA 5EQTA 5GPBA 5B12A 4YR9A 3FNGA 3A3YA 3AI2A 4LS3A 4XYBA 1JNYA 2IU0A 3WP0A 2O8CB 5F76A 3S2GA 3RHZA 1G19A 1XQ9A 2X40A 3E3AA 1N6RA 3CSDA 1BIFA 3I5AA 4Z9FA 1RM3A 5T6MA 1V7PC 1YI1A 3KJEA 1E7YA 2ZB8A 3CM0A 4BGDA 1B2LA 1PHPA 2I5PO 3IT1A 1M0TA 1P91A 2HZBA 2YFQA 1ZI6A 3KZOA 4B87A 1P61B 5FLYA 2ZXUA 4OBXA 4KTTE 2VTDA 2DAPA 3GLFA 2O8EA 1NI3A 4XKJA 5DIFA 2Z9CA 4C76A 4CU5A 2J7PA 1P72A 1QCDA 2P77A 3U4MA 1L4GA 4RFSB 1K7EB 4ZDIA 1AKYA 1XD9A 3HB1A 5CX1B 1Z06A 2W6JD 3KT3A 1P2DA 3EGEA 3QUSA 3LYUA 1LEHA 4EQ6B 2OZEA 3P5BA 3T9BA 1TF2A 1WF3A 4JB2A 3D2AA 1CUYA 2ZE5A 3MBIA 4WA7A 3K5WA 1C9MA 1ZZGA 1ZVKA 4YQEA 4AAYA 1J25A 3N76A 3BFPA 4MINA 1YCHA 1FRZA 3B38A 5E9QA 1JKIA 5LYJF 1BOOA 3KSMA 2Y27A 4OGLA 2VWQA 4INZA 2FWBA 3O6VA 4JDPA 5AKLA 4JITA 3IKVA 3F4LA 5CA1A 4EGAA 2O2CA 2DX7A 4C7MA 2IYNA 4HDAA 1ZH8A 2PZGA 3SN6A 1II9A 1B3RA 2Q7OE 3A1DA 4JZKA 3MWEA 1TE2A 5L6MB 2B61A 3SQDA 1UODA 2F9LA 3DZDA 2HPHA 3IUSA 4JUIA 4RGVA 4TV9A 5D8DA 1CYDA 2KPOA 4CHTA 2IIQA 1JQLB 4P0PB 3KG2A 3C8UA 4OJKA 1H6DA 1X42A 5EWLA 3TZQA 1IIBA 3EARA 1JXOA 4XGRA 3TDNA 1EX9A 4JP3A 5KYYA 4PO8A 4OYHA 3PD0A 3C6XA 1PTJC 2CLKB 4INAA 4CM4A 3GU3A 1K08A 2O1SA 1NI4B 1DPFA 1FSSA 2CFCA 4XDYA 5CM8B 1JVBA 4F4JA 3F73A 4KVGA 4NRDA 5FJIA 3CBQA 4JXKA 4EI9A 4OXIA 2QN8A 1T5DX 1PZXA 3VPGA 3WDSA 3OLXA 3OWXA 5EIAA 4NNOA 2YZKA 2R8XA 2I9PA 1TYCA 3OC0A 4XQ9A 4UDOA 1OUMA 1VGVA 4ZVUA 1ZS9A 4K6CA 3SZMA 2PLAA 2WLSA 1PX2A 4HWOA 3OCJA 5EJAA 1Y4SA 1G2QA 1SZPA 1V16B 1C4KA 1X1RA 2V0NA 2M6LA 4KRFA 1H22A 1SCJA 1U0EA 3G23A 2R47A 1EP3B 1Z0IA 5EQJB 4QUIA 4B80A 1D4ZA 1RQPA 3FSGA 4QUKA 4C04A 4MQ5A 4J0KA 3RDPA 5CNKA 2BP7B 4JI8B 3OU2A 2I67A 1B74A 3ELYA 1T0HB 2I65A 4YIHA 1IOVA 1E8MA 4E88A 1E98A 3BWCA 1U7HA 5DN9A 1KO7A 1ZXXA 1DMSA 1JHRA 3PQ3A 3K4PA 4MJXA 1J56A 1GAEO 2C3PA 3JY6A 1V2HE 1E6MA 2P9EA 2WV9A 3MJHA 4TTVA 5CLHA 3Q2IA 1MZVA 3QQPA 5LWHA 3RAFC 2XNJA 2Q4RA 3LCJA 1IG3A 1O0BA 5KEIA 5HMMA 5J4HA 4QHYA 4EPWA 2EDAA 4CV0A 1G9SA 2P7HA 2JANA 1G6Q1 2GJ9A 4QLBA 1NR7A 3OPYB 4QXMA 2H54A 4C0WA 3TDMA 3G13A 4Q9HA 5BSMA 3RS3A 1PHRA 5AK3A 3S7ZA 1R9NA 1YKGA 1JJIA 3FLEA 1F3LA 6YASA 2XNSA 4DMHA 3GDHA 5JLJA 1IWPB 3IYLW 5EGSA 3K0AA 4URFA 2VAPA 4LOIA 1AKRA 1P75A 2ACVA 4HDMB 2XXBA 4BNNA 2JHFA 1EPUA 1NMXA 2HIGA 5GJCA 2O3SA 2E6UX 3BQ9A 3PQFA 5IKXA 3SBEA 1CVLA 2DJIA 3F6RA 4JX8A 2H85A 4DCOA 1ZICA 3IUNA 4K6HA 4LMRA 4W8GA 4OTZA 4M9CA 1MX3A 1E77A 2PL3A 1O03A 3E3MA 3WSWA 2RGXA 3PTLA 4GE3A 1JTFA 1OAAA 1RWKA 1T36B 1UBOS 2XUKA 4UATA 3O8OA 2FMKA 1CZHA 3M6AA 4UMDA 4J91A 2WWFA 4EA9A 4NATA 2FW1A 3FSJX 4H7FA 2R6HA 4V39A 3HPRA 4FM9A 2R6JA 1UMCB 3ZE7A 2JEOA 2PSDA 3I09A 4W63A 3EBPA 1T5BA 3ODPA 3SICE 2DFPA 2FRDC 3JAKB 2DUUA 3QXSA 2W42A 2X19A 5L7TA 2PLWA 1I2ZA 2B4YA 4EX6A 3U49A 3LKZA 3UV3A 2FUNB 3KVNA 1MQSA 4EFKA 2QN2A 4BE7B 3KJHA 2ZYGA 5JROA 1HQKA 3C3MA 4GOKA 1QUFA 3GELA 1XN4A 4KTVE 4WJKB 5E3HA 3KYDB 3VA7A 2IYEA 3D7MA 3SXPA 3ZWDA 3WAJA 3CBGA 1EZ1A 1X2EA 5A9SA 4Y6RA 3UBMA 2BMEA 3BE5A 4ZZ2A 3HCNA 4F5WA 2O5EA 1YU6A 3FXAA 2PKEA 3FN4A 2V4ZA 1Z29A 2ZSUA 3AO0B 3PXBA 3SYKA 3ZWBA 5FFMA 5H8WA 3NHUA 4WCFA 5BWBA 4E51A 1Z63A 3O7WA 1H8HD 1YSCA 4BXOA 3KPUA 1ZWKA 4KV7A 2GNOA 3TKLA 1LGYA 1P9LA 4G5XA 1U2GC 3PDHA 3U44A 2WSYB 2O7RA 4BQNA 2ASEA 1JV2B 1O6BA 2EZ8A 2ZAGA 1D4AA 3Q2KA 2FUG1 3AR4A 2WSIA 4EDFA 4CIXA 2JD1A 3G8YA 4G5GA 4OKIA 3QEAZ 4I14A 3SR0A 3PNPA 5DNYB 2GWHA 3SQOA 2P3LA 2YTZA 2VSNA 1Y3BE 1YC5A 2CVFA 4HXYA 1XWIA 5B7PA 1KMCA 4O02B 1QIJA 4F6CA 2VKQA 3MPUA 3QFTA 4CLDA 5KYUB 4ENRA 1LPBB 2XGJA 1MW8X 2P0AA 4I9GA 4WFIA 3RSLA 2PQ2A 1V3VA 1OA0A 1WZUA 3GEEA 3KWJA 3DH0A 4TMZA 3U3XA 3GGJA 3T0GA 1ZBQA 5DHFA 4I1UA 5JXGA 3HL4A 1NX6A 3R3JA 4BMCA 4G09A 1QF9A 2Q9CA 1JGTA 3INNA 3TZ6A 2AKYA 2CYCA 3UTCA 4O4HF 1C7QA 3JWGA 3HJBA 1BMQA 4BZWA 3T7DA 4FT2A 1FP1D 4DEXA 1HE4A 2CCKA 4DIMA 4E22A 1FMLA 1GGVA 2VQFB 4W9RA 4A92A 4ALIA 3L0YA 1JPJA 1CQIA 1BWSA 2V7GA 4D81A 5DSXA 4RGQA 3KYBA 3JV7A 1YCGA 1EUDA 1KGDA 3UJAA 4PYJA 2ZZNA 1DARA 1U2PA 1UBRS 2FE4A 3COPA 4LWZA 5IFLA 2D1FA 1EDDA 5A2QA 3LPLA 3V32A 5MGBA 3I72A 4XA8A 4DVJA 3RIYA 2I6QA 2VNJA 1HK7A 1YR6A 2D1QA 2YJZA 1MAVA 2BLLA 2O2HA 4E5PA 5B1EA 1H2FA 1P7YA 3H05A 1VRVA 4OBWA 3TKYA 1KQPA 4EPTA 3MBOA 1TJ4A 3AUKA 5BYBA 4NCKA 2ZJ6A 3LP5A 2NX2A 2ZUFA 3HTXA 3FMPB 4I4TF 4OXKA 4NQZA 3PUHA 3CKYA 3TOXA 2XKAA 4CL8A 4JA2A 4C0HA 3N2ZB 4FGKA 1K66A 3O31A 9GPBA 3U4IA 1E9BA 1KNQA 3TZCA 1BS2A 1E2IA 2W2OA 3AM4A 4L07A 3ZWPA 1ILEA 4OBBA 2HO5A 1DC7A 3AW8A 3AGPA 3MINA 5EHNA 1Y5MA 4ERNA 1P77A 3NHPA 1QNLA 3BAFA 1FFCA 2HF2A 3JQ8B 4UOQA 4X7PA 1TD1A 1HDCA 2HMVA 1ZH2A 5IDYA 1Q7BA 1SU6A 4KGXA 3A58B 4LDQA 1T24A 4LXGA 4MVJD 5ICFA 5TPZD 4ZI7A 2D7DA 4DPLA 5B55A 2ADFA 2DWUA 4UUQA 1CQJA 2DHRA 5GJVC 1KRHA 1MNQA 2PYZA 4E0BA 3AKYA 1KI6B 1NAIA 1Q15A 4C08A 2W8BB 4EYEA 1UEXC 1C30A 4UVDA 2H4FA 3D7LA 4ARSA 2L69A 5JCOA 1DPGA 3QF4A 3P8ZA 1PGPA 3TTSA 1NMEA 3U09A 3N2GB 2VYQA 3N3BC 2IS4A 3P9YA 4MV0A 1D5CA 1M2KA 1FSPA 4F9TA 1MEEA 3ADCA 2HQOA 2DWPA 2AUTA 5EE5B 1HEUA 4HNRA 1M0EA 4OHUA 4DWWA 3DOIA 4YDRA 3CJRA 4QTTB 4D7AA 4DM7A 1AHHA 1ZL2A 3NWPA 2ACWA 1LDMA 5LIPA 3H4TA 1KRXA 4XDGA 1Q17A 2ZB3A 1KS2A 2I76A 3U7RA 4KQIA 2V9CA 3F7MA 1CE8B 2X8JA 1QDEA 4OO3A 1A7UA 2I3GA 3FWZA 1ZMBA 1XTKA 3T3PB 5AR1A 3QVOA 1P4RA 5IU6A 3GPLA 4GE0A 2BEUB 2B99A 3O1HB 4PXSA 3TAXA 5TQ2A 3W04A 2O3QA 4RVNA 5IJ0A 1FQJA 1N0HA 1T13A 2ZU0C 5HKOA 3ITEA 3HY6A 1YZVA 2W4IA 2GEBA 2OCIA 1SXGA 4MULA 3LUPA 5FV4A 2CDAA 1H6CA 4KXXA 4DMFA 3EVGA 5AVJA 4JLKA 1G8FA 1PG0A 2ORVA 4K0RA 4ZI2A 1KVSA 3KETA 1Y37A 2PXAA 5EWJA 1R8QA 4DA7A 4D9MA 2GXQA 1ADBA 3V97A 4BASA 4QEZA 4JR0A 4D42A 4H6PA 1JR2A 2XE4A 3LDFA 5DCWA 4PPGA 5AI6A 4ZMRA 3EIUA 5JRZA 3ZX4A 1G5FA 5L7WA 1XZIA 1IM2A 1CR4A 1Q19A 2JB9A 3FNIA 4JHXA 1MIOB 4WD3A 5AVVA 3ZJ5A 1XB2A 3QFRA 4WN3A 4EAQA 3AR7A 1T6XA 5JNTA 1E9DA 2IH2A 3AQ4A 4NYIR 1R4NA 2H1WA 4REQB 2WJGA 1NVEA 3HYLA 5BSUA 2I7XA 4LZPA 2X9QA 1I4WA 1VCHA 1E58A 3TG2A 3G7UA 3H8VA 3N8KA 2NN3C 1W73A 3CWQA 3U16A 1HMYA 5ECWA 2WIGA 3T7RA 1W7AA 2XBLA 1TUIA 2H48A 2FF5A 2IYFA 3ZUPA 1QP0A 3BOSA 1K7SN 2O0JA 3D4PA 4L4UA 4C4PA 1F7VA 2VC2B 1P2GA 5LQJA 3L8FA 4ZO6A 3EXFB 2BFMA 2QPTA 1YDMA 2QPLA 2PBFA 1E61A 1SKBA 5BRAA 4I5IA 5JDCA 4OHWA 2BGJA 5K3CA 1SOMA 5DEOA 3K0CC 2X22A 2FB9A 4P08A 2P9FA 2Y66A 3H9BA 3GRCA 3N5CA 2JBHA 1DJOA 1HE2A 2ECOA 2PVCA 1T1JA 4U7WA 4U02A 2JRCA 5DE3A 4U8HA 4UBKA 3WX0A 1ZINA 2QAJA 1KVQA 3U7EB 1TQDA 5BPFA 2BGGA 4AZTA 5AD1A 4MX8A 4KAAA 3ZX5A 1LV8A 1S89A 3MFYA 3PLRA 2I29A 3DNMA 3AYZB 3VHXA 4BZQA 3LECA 4E32A 4D9EA 3Q3CA 3B1ZA 1VE9A 1X92A 4MIEA 3ZXXA 3KQNA 4AJKA 3FVQA 2NU8B 4I1YA 2WUDA 3FDJA 1JFFB 3R1IA 5B3LA 4U39A 3V7NA 3NEJA 4C6TA 4TMTA 1KEZA 3K20A 5JWOA 3QWHA 1LPMA 5CYFA 1ZM9A 5BR7A 2FRXA 1QO0D 4N39A 1E79D 3IAUA 2DTDA 1JR6A 4K9NA 1BMTA 2ZTLA 4C6HA 4FFPA 3PNQA 4B7ZA 1K8RA 1MC8A 2PS9A 1NV8A 3NBKA 3D64A 5HKBA 1XVTA 3WKBA 5JTTA 1V4VA 2XTAA 4BNDA 1QKJA 1T3HA 4X20A 4CU2A 1G38A 2CN1A 3IUEA 1P5RA 4K6GA 1Y3CE 3WE7A 3NP9A 1U2GA 1PKEA 1AKWA 1Z22A 3A1FA 2ZR9A 3VH2A 3ITKA 4LNUA 1JLMA 1IBKB 1MQ8B 5J47A 1C1XB 2QRVA 3AIOA 1QO7A 4JUFA 1TJNA 4D2IA 1JLHA 1T0PA 4LHVA 1N0WA 2FOIA 2VF4X 1ZOLA 4PWZA 3HVJA 4PVCA 2GBIA 3O03A 3I2KA 2JLYA 4QA9A 3I2GA 4QOIA 3THOA 4EW2A 1XD2B 2VSFA 1CW2B 4BMXA 2Z0MA 2NNLD 3UHJA 3AHGA 3HVKA 5LP1A 3HRIA 2H2GA 4U1RA 3S0JA 4XRGA 1CEXA 1SR8A 3I3OA 4B76A 3BICA 2QPAA 4FR0A 3UHAA 2YKGA 4P7BA 2P9ZA 1CUBA 3R7FA 2JGDA 2CZQA 2VPQA 3TJZA 2BTEA 3DTVB 1ZA1A 4KJZA 3URKA 1SKMA 3OOEA 1ATIA 2C0CA 4FOLA 4GGOA 4O08A 4MEAA 5D5PA 5DPMA 5T4BA 3S1AA 5K3BA 2ZGVA 4IIEA 2MYNA 3TEMA 1E5TA 4L73A 1D2HA 4AZSA 4PLGA 1O6GA 4P4LA 3RFFA 1NJFA 2MINA 3OTWA 2EF1A 4WAUA 2Y0EA 4PEVA 4IYRA 4OQQA 2G0NA 2M1ZA 1NQTA 4Y2HA 4ZMSA 3GMIA 4GX1A 1USVA 4RA6A 4CMIA 5LQUA 1Z0KA 3N8DA 5GAJA 4INPA 4XWTA 3WWEA 4QGSA 1EBBA 2W90A 4Q7KA 1DQNA 1JQJC 1HQDA 3A1UA 1O8CA 3ZPXA 4D9KA 3H9GA 4BNMA 3QELA 4QBGB 3K2QA 4LY3A 3L0DA 5ED0A 3FRIA 3LJKA 3A2NA 4FI3F 2Y9PB 5IWAB 1P0QA 3TIXB 2JCSA 2DOKA 3AZPA 2QYTA 5A5EA 1CY6A 1JFLA 1YDFA 2GTIA 2Z83A 3WWCA 3VAZA 1LPOA 4HFMA 5T4HA 1HI9A 4G2NA 4LE1A 3U17A 4QOSA 4KQ9A 4L15A 2X58A 3DBRB 4WUVA 3WFIA 3OMWA 4MEBA 1XVVA 1ADYA 1OXVA 3L05A 3UGQA 1ZUNB 3T7AA 2C77A 2MSLA 4YAOA 1I4DD 1YOVB 1V3QE 1WXXA 1E0AA 2BFCB 4RKYA 1QIFA 2WM2A 1AO0A 1WQ1R 3DJFA 4P3YA 10MHA 3CPSA 1E6LA 1QP4A 1QGOA 2GJ4A 3D81A 2P7IA 4F6RA 2JFNA 1X7YB 2JI8A 3MC1A 5CVUA 5BORA 1U3UA 1G20B 4J76A 2MSWA 1C9DB 4GZLA 3WMWA 1Z6QA 5LMZA 4QE3A 4CLHA 1GQYA 1N1EA 2WZDA 3CLRC 3EY9A 2I1VB 3OE5A 3I3SR 1R7RA 1GG8A 2Z4TA 4I5DA 1L4HA 1L5LA 1PNRA 4L8VA 3GFQA 3FMFA 1CNFA 1E8NA 5CXUA 4JFAA 1CZLA 1LX7A 2HNKA 2GHQA 4A26A 2QPOA 5KS2A 2XCSB 1R0RE 1BVRA 3R3VA 2FEAA 4P34A 4U4AA 3KQYA 2WPDA 4ROTA 3LYLA 3REGA 3CZQA 3WK8A 1KSJA 2VEOA 1USUA 2OMKA 2X15A 4K1LA 2D06A 4YPFA 2NUPA 3U1TA 1XXLA 3A0UA 2F3SA 1KOLA 2QU7A 2NT3A 4NICA 3JD1A 2LCQA 4ES6A 5BMVF 5CYGA 3ZJUA 3WL7A 5KSYA 3NTUA 4QX6A 3G0BA 4UHFA 1DBIA 2Q07A 2FSHA 2VH1A 3MCTA 3MFQA 4A10A 2O0HA 2V96A 1RJDA 3O8BA 5BSHA 3TR0A 3PRJA 4DJ5X 2CDCA 1KFBB 2PIDA 5AMXA 2G7MC 3FHCB 1HH4A 1MRNA 2Y71A 5ILGA 2XQKA 4YV1A 3W5JA 5IDWA 1YE3A 2EV9A 5HCIA 3QSYA 1Z4OA 2NLOA 4DLRA 3CV3A 4AJ1A 1WBJB 2Z95A 4IAOA 1D1QA 3F1KA 4LKOA 5T5QA 3SEQA 5B3KA 4ND5A 3Q7QA 4FOPA 4B45A 2PA0A 2ZVDA 1L1FA 1FP6A 2VRCA 1B42A 2PO5A 4EATA 1JT2A 5BQOA 1UAAA 2W6QA 2GZSA 4TL9A 1FYXA 3WLSA 1MG0A 2XDQA 2F17A 2GARA 2WIFA 2DH6A 4FWIB 4CTKA 2F9MA 2QRUA 5KYWB 3SXUB 3TRIA 3M2TA 4RFLA 3SZLA 3BMXA 2GD2A 2FPUA 1NG9A 3JQFC 3LYHA 1SBQA 4G89A 1FFGA 2ALJA 2R1TB 2IXFA 4W5RA 3N28A 3IFSA 3RTDA 4Q4AA 4D4KA 5FUBA 4YRLA 2KSQA 4CLRA 1FDWA 1XDDA 3KLBA 2N9UA 1C3OA 3MTBA 3REQB 5ALJA 3I28A 1CETA 4KVAA 2W2LD 2CY0A 2V3CC 3B1JA 4B0PA 4P38A 2O8NA 1CUAA 1QGUB 1V5WA 3BMOB 3QX8A 3DDHA 3SLGA 5BQPA 1L1RA 2P1DA 1ZMXA 2XE8A 3KPJA 4K28A 4M0FA 2GKGA 2XBUA 3VO1A 3CO0S 4R0NA 1E1CA 4ALNA 2QD4A 2C94A 1BU8A 1C1DA 3EIQA 4G36A 3RGGA 2AZMA 3F6PA 3ICPA 4K9OA 1QFSA 4J8PA 4X71A 1UEIA 4FFDA 3TQCA 4LJSA 2HCTA 3WJ7A 1OH7A 2ZUTA 2V3VA 2QRKA 1RZRD 1SELA 4HXFB 2EC5A 4CUKA 1YKFA 3H19A 5LM3A 2ZJ2A 1D4FA 1H0SA 3GEIA 1SC3A 4XD7A 4UW9A 1X7GA 1TJYA 3HS3A 3PX3A 3R0QA 2CLSA 4CI0B 1UZNA 4E2ZA 1D2NA 4N5HX 4FHCA 4EGFA 3A1NA 2HCBA 1J9EA 2ISCA 1IPHA 1NT4A 3VDNB 2IK8A 1W76A 1CIJA 1QJCA 4OYRA 1KVRA 5AJZA 5DBHX 2ZUVA 3OKFA 4C2TA 4XWAA 2H1OA 3ABQB 4BNYA 1NJ6A 3TRHA 4D4MA 2P0YA 3VX3A 5M5BA 1YZHA 1VECA 4JP2A 4I36A 1B26A 1GV0A 4MWEA 5DT2A 1I7QB 3H99A 2HV8A 4GP6A 4Y2PA 3ROGA 4URYR 1DJLA 3I2JA 3JS5A 1X38A 5KHAA 4ZIRA 3A6KA 2HQBA 2FR1A 2CJYA 4G26A 2I2FA 1EWKA 4YT4A 4TMFA 3OIDA 3EDOA 2VNKA 1JDBB 1F7UA 3RSGA 2MYPA 3S2YA 1NJ5A 7AT1A 2W8ZA 2WM8A 4QGBA 2RH4A 3KUXA 2H7CA 3A1CA 3GDOA 1T4BA 1GGJA 2WUEA 2GN9A 2JGEA 1E32A 3PS9A 3WK7A 4ATNA 2P90A 4TRMA 4MPPA 2IPLA 5EE9A 5IFKA 1B8OA 3W6OA 8MHTA 2BTOA 1XA3A 4EDHA 1CWUA 4WNAB 1ZJ6A 4YCCA 3M33A 3KDSE 4DE5A 4E70A 2Z2KA 3HBFA 1OTHA 3KZXA 1DAPA 4EHJA 1DX4A 2G25A 3TKAA 3ORSA 2WA1A 3R8XA 1WZ2A 3FPCA 3SQLA 2W2KA 2WU3A 3K1AA 2HUNA 3M5WA 2HJRA 1Y8CA 2LE0A 1IDOA 2Q5OA 2WUVA 2XWSA 3NOOA 4WLVA 2ECFA 4C7BA 1W0KA 5DGTA 1MQAA 1XCPA 1XTBA 3CX4A 4G6ZA 3KXLA 3EB9A 4GLLA 4Q03A 3UY4A 5I7WA 1U4OA 2QROA 2FMUA 1G55A 1E3LA 2ZBEA 1BXRA 1PFUA 2NVOA 3EWIA 1T2NA 3IB3A 2IELA 3CRMA 5JNLA 8ATCA 1CF9A 3LCCA 4BFWA 4XPZA 2OFFA 1ZNWA 1Q1BA 3EBOA 3TQIA 2XQFA 2H5IA 3FVVA 2X23A 2WFZA 1R16A 3DHWC 3RK4A 1HT1E 2FN9A 2FJUA 4L72A 1A72A 4I8IA 2YIDA 1MX5A 2RAVA 2H59A 5I7VA 3RU3A 3OLQA 1J23A 1U90A 1VB3A 4K2HA 1OB2A 4LOAA 4OHYA 2NUTB 4EL0A 1RRCA 2F8SA 3BE8A 4PHGA 3RTGA 3PJRA 1ZW1A 4J49A 4QGHA 3QVWA 1RADA 1U8YA 3MUNA 1T2CA 4CFSA 1V8OA 3C3EA 4LJ5A 1KARA 1TCCA 5K99A 1R6XA 2XD9A 4AO8A 2Z2IA 4RMJA 4G0QA 3DFKA 5CURA 1W46A 1GR0A 1LLFA 1TKAA 4MWDA 3S2EA 4RELA 4Y6QA 3WZMA 4KDFA 2RFLA 2I2XB 2QAIA 5K2OA 1YVEI 5SV2A 1HL3A 1UBSB 2PX4A 1V11A 2ZTSA 3N2KB 3GLGE 1KHTA 4HFRA 1EFUA 1QONA 1ISIA 3E1SA 4FD2A 4PQRA 1EUQA 3FF4A 3NORA 1TCUA 1J5PA 1I3LA 3MJDA 4N9QA 4ZDWA 2C9DA 4PY2A 4H7PA 1N7GA 1MOQA 4KO1S 3DONA 3K0SA 5J2UF 3G8CA 2J0VA 4E33A 3MUEA 1JQ5A 1T3ZA 3OX1A 4O2BA 5FAKA 4I3FA 3H9EO 3HM9A 1GPJA 5DM60 9MHTA 2K4MA 1TLLA 3HHEA 4FE3A 3BL8A 2YMLA 4LDAA 4RL4A 4UBOA 1CDEA 3FG9A 1SUEA 2FEWB 4GNRA 3RC7A 1K8ZB 4GSLA 3HU3A 5CTAA 3O83A 1PJCA 1UC4B 5GVRA 2IBMA 5KSPA 4QAQA 5I7OA 4ZVNA 4NMMA 5TS3A 1LW7A 4MAAA 3UT0A 2VXOA 1ISGA 2FZ5A 2BW0A 4IVPA 3HNPA 2LKCA 4JJZA 2VUHB 2ZIAA 4FBGA 4ZAFA 5B58T 4EI7A 3KQKA 1PVVA 4QIHA 1ZGGA 3TRDA 4DZZA 1G5QA 1O58A 2UZ1A 4DJFC 3FNBA 4B5KA 2B92A 1SA0B 2D4HA 3J7TA 2AOTB 4DADA 5C81A 2ZYHA 1PV4A 2QGNA 3M4XA 2HBZA 1VMKA 4Y2GA 1ZN9A 1E4EA 5E9WA 3TFOA 2FX2A 4LECA 3QJGA 3AM5A 5CR9A 3RUPA 3EWSA 3G2KA 1CNEA 1TYAE 4EH1A 3NBQA 4HN9A 3GX1A 2MSDB 4OPMA 4UTOA 4C0AC 4MB6A 1NX9A 4DNPA 4EJ6A 4EYQA 5IF9A 4MIOA 1N5KA 2M32A 4RPIA 3ZY3A 1K4YA 1H6AA 1X0VA 2XTNA 4M0EA 3ASUA 1XQYA 4YBZA 3JYPA 5D3QA 3EQ2A 2PSFA 1SXJE 3LKVA 3NIGB 2O5CA 2WQZA 3OP4A 3UKJA 1Z6GA 2CCGA 4LE2A 4RZXA 1IUOA 1DG1G 3JSXA 2D2XA 1GVHA 3HDHA 1CERA 1RLMA 4MYRA 4UBJA 3AUYA 4QJIA 5SZKB 4W9MC 4WX2B 2FDXA 3UAXA 1KKUA 4MVWA 1XN1A 5FH9A 1O08A 5DTIA 4EPYA 3OJWA 1V1RA 2TMKA 4EK9A 3CO5A 2WW8A 4KIGA 5PNTA 4G8BA 1MTZA 5E7JA 4P3XA 4R2LA 3MYYA 2WD7A 3EDQA 4IDEA 3UVEA 4QJ3A 3KQVA 2ADOA 3GWGA 1DAFA 5EJ4A 2PH1A 3EZXA 3M4ZA 5ALNA 5DNDA 4ZWNA 3RBVA 4LWQA 4YRAA 3AL0C 3GUHA 1AKTA 1TTPB 1PFQA 4KQJA 3VR6H 3IDFA 4DRXA 3ABSB 5F7OA 2ZJ0A 5CDYA 1U5BA 2QYHA 3FUVA 4YMTA 2OUIA 4FGSA 4IDCA 5KYNA 1DHTA 1EP9A 1KK0A 4CG3A 4PINA 1M2VA 4L7QA 4E3ZA 2W6ZA 2QZSA 2VVTA 5FI0B 1IRIA 2YJ5A 3RW9A 2YXPX 2B4TO 4GUDA 1AKQA 2GF0A 1SXJC 2WKSA 3NBFA 4RW0A 3NVKI 3GRKA 5DCYA 4G0YA 3I64A 1XMVA 5TQJA 3SHFA 5E4TA 1ORHA 1QKKA 4DLPA 2X9LA 1PGNA 3AZQA 1VHQA 1ZU4A 2YN4A 3N8IA 2GS9A 5FTJA 5C0OE 1R8XA 1D2GA 1P0PA 5H82A 3WC4A 1KIMA 5CA1F 3OEWA 4E2FA 4UM9B 2NSDA 2QY6A 1YT5A 2JJ1D 3OA2A 4J2OA 4Q1CA 4BY9E 1YACA 2CFSA 2XXAA 2J45A 4K9QA 1K63A 2ODWA 3W2TA 4F38A 4TV9F 4CKZA 4L6IA 2AMYA 3UW3A 4EEZA 5AVZA 3EVFA 4HWRA 2PT6A 4LV5B 2ZCJA 1DAIA 1P2TA 5JEEA 2OCPA 1NBME 3HWSA 4CNQA 6ADHA 1UMBB 3ZGVA 3WV5A 5LA6B 4KITB 3TSYA 1N3BA 5A9TA 3R8FA 1SUAA 2CNOA 4LGVA 5KNCA 4X61A 1QV9A 4ESOA 4N3BA 1T26A 5T7BA 2JGMA 1BS1A 3PEVA 5M29A 1BNCA 1QK5A 3ZV4A 2LKDA 4FYVA 5F33A 4CI9A 2Z98A 3I12A 2ICAA 4KN9S 4EGQA 1Y3IA 3BK1A 3ECCA 1QFYA 2XUOA 1YB7A 2Q1WA 1ETHA 4GWGA 5AKEA 4B17A 2F62A 5CHYA 2WKPA 2R1VB 1DOAA 1U2TA 3CSSA 3DOHA 2PK3A 1YCFA 3A0RB 2W6NA 1NXTA 3H5RA 4HDOB 1N6NA 3C7AA 4HLUA 4Q3BA 5K0LA 4A5SA 1SVMA 2AXQA 3EXIB 3ZGOA 4E07A 3MUFA 2Z57A 3BGSA 1TQHA 3NT5A 1ORIA 2H1CA 5AK6A 5I7SA 2IU6A 1LVUA 3SBDA 3ZE2B 2QG6A 3UN1A 3BS4A 3SVZA 4Z4GA 3CVXA 5BRNA 3ZW7A 2A30A 2B7BA 1EXDA 3U4GA 4W6QA 1HEYA 1HRKA 1YQWA 2EQAA 4XOIA 3UOWA 3CLHA 4QD3A 4PHCA 4CLOA 2BZSA 2DWCA 1OYOA 4O4IA 3GROA 5IZ4A 1U2QA 5H9VA 1TKCA 3FGOA 1WZCA 2R8RA 4TS3A 3ZI4A 4O2AB 2UYYA 3AF5A 1JTVA 2WZCA 1AS0A 3W6PA 1UP4A 3OCYA 4DJDC 3P94A 1QOPB 3M0EA 2F4NA 3A1TA 2R1UA 3EPPA 3VAYA 4EENA 1SVKA 1TK2A 1T8WA 4Q02A 3M83A 4IEFB 5EMMA 2CE7A 3C3BA 4FINA 1GG2A 2FP3A 4CEIB 4QULA 2AF3C 4MYTA 5CW1A 1PKXA 4HRAA 3BD8A 3MMPA 1G7SA 3OQ1A 3QW4B 4KX3A 2YWXA 1UC5B 2VQ3A 3HLTA 4FIDA 1M6YA 1P1KA 3NEAA 5MF6A 1PX0A 2RH9B 2C8VA 3GJ3A 4JLUA 1E1QD 3Q85A 2WWTA 4LZAA 5FI3A 1IOWA 2OHGA 2FSVC 5SZHB 3WRYA 2WNIA 3GARA 4IBOA 3SF8A 4FGUA 2CFTA 3IMGA 2J5BA 3OZWA 5C35A 3V00A 2WAXA 1QB7A 1SUPA 3Q10A 3CRQA 5KOJB 4M8NE 2QJFA 3LBNA 2MDTA 3QPVA 2RK4A 2IV7A 4FKBA 2O8CA 5EZSA 1WQ4A 1Z6PA 4FNMA 4Z4HA 2IYYA 1F2VA 1FK8A 1XZQA 1X1QA 1CY4A 3L4JA 1DV2A 5EJ5A 1ODLA 4LRUA 4NTZA 3LLMA 2KS6A 2YY5A 4IZOA 4PAWA 2FUKA 2HQ1A 4LYJA 3ZLVA 2CNNA 3C5VA 1GGFA 1CNMA 1FNMA 3GB9A 3T3NA 2EBFX 1YB1A 5HF6A 5BPHA 2R7AA 1FTNA 1H1LA 1HXHA 3JARB 2VQSA 4BLVA 4II3A 3HV2A 2D2EA 3JWJA 5FPKA 1VPWA 5E2IA 1GNPA 2NPIA 4RFSA 3UT6A 2HIAA 4LK3A 2CT8A 4B82A 4IGIA 1K7XB 2WOOA 4ZT7A 2V7TA 3PU6A 2ZJAA 1X94A 4RZUA 3WLHA 4MPRA 1YJ8A 4XFJA 1RQLA 4WK6A 5BN4A 4DF3A 5CFZA 1IVSA 4N48A 3KD3A 4C7JA 4MUGA 4KH0A 1UUFA 1WUJS 5FWXB 1Y1SA 2EARA 2G07A 3Q7IA 5THKA 3U37A 4BECA 1PEDA 4Q4DA 3T5CA 4W1QA 3K9FC 2P0EA 3GK3A 3H2JA 4ER0A 5J4KA 1FTGA 4LCEA 3B5JA 4UM9D 2BHRA 1IY1A 4NDAA 3I9V1 1Y6ZA 5LQCA 4MSUA 4M83A 4PZDA 1C9YA 3CC8A 4QGAA 1PL7A 2Q45A 5AVXA 3ESZA 3AJAA 2YJ6A 3PB3A 2DQ4A 4NNJA 5C7OO 5FWNA 1TL7C 5DGXA 1VJ0A 2D0PB 2W2NA 1PLJA 3QUAA 4ZO7A 2X77A 4XWYA 4YROA 3W5IA 3LA6A 1SN7A 3LHKA 4KR0A 1WBDA 4CF6A 2ZIEA 2JFUA 5AWFC 2FW0A 2QRPA 2YVAA 4W1RA 3C70A 3BGWA 2VWPA 4DSUA 1YHNA 3LI2A 4OFZA 4X95A 2RGAA 5K4HA 2VHQA 4KC0A 1BXKA 2QE7D 3EZFA 4RH3A 1NLMA 2J31A 4ABTA 3H2ZA 5CXQA 4UASA 1Y48E 1JXMA 2Q3LA 1YIAA 3IULA 2IV3A 3TS1A 3UF0A 4OJNA 1ZK4A 4QPZA 4ASUD 3IQWA 4CBVA 4KBFA 5KQSA 2PX8A 1SG0A 1P0MA 1NBWB 2PAAA 4ZVMA 4RHYA 2ET6A 3DZKA 3GLGA 3PICA 4GPEA 4H4EA 1VJCA 3WMEA 2F8TA 2XIQA 2ZBGA 1PEAA 3U0VA 1NQOA 3K4HA 5F5XA 5BUSA 3RVOA 1N6HA 1J07A 2MU1A 5LLSA 3E35A 1E0SA 2QZJA 3HCPA 3H75A 4GH5A 2WP0A 3CUUA 2HK7A 3U6KA 3VZSA 3F8WA 2QUZA 1SUBA 2J1LA 2IWHA 2IYWA 2HJVA 1L7XA 1YL5A 3AUTA 2YFKA 3NHWA 4HP8A 3AU8A 1GFWA 4OLFA 5EKXA 3SYRA 5AIAA 3S81A 2OHVA 4A2QA 4TKZA 2XKBA 5DIZA 1JN0A 3TVTA 4AP5A 3Q7TA 1RAEA 3LP6A 3E15A 3M4JA 3MS2A 3BTUA 4MQ6A 4Q3LA 3CB4A 3TCNA 3V1UA 3WNVA 1VSBA 2W6ID 3HR4A 4HDCA 3PDIA 1ULSA 2B2NA 2FRVA 1PWZA 1L5GB 3SJUA 3PPIA 5JI2E 4IIDA 4ONEA 4HBGA 1BOFA 2CHVA 4H6XA 1XMIA 3NYQA 3AFIA 3HN7A 5ALZA 1U3WA 1EAMA 2P68A 1ODFA 4PZ0A 3C1UA 4QUBA 1ZLYA 4ZT6A 2FDCA 4GWKA 3EA4A 2MSEB 3QZUA 3S2UA 4KUHA 1W36B 4NBKA 2V7BA 4UU7A 3RSCA 2Q29A 3TWOA 5JW6A 1VKZA 3CPJB 2WVGA 3PHHA 3G2LA 1DOZA 4IKPA 3D0QA 4JLMA 2QEQA 3OLCX 3PA8A 4MIYA 4BLRA 1MJGA 2RBKA 3V48A 2X8LA 1UXKA 1GA1A 2XD4A 3TX2A 5EUCA 1SOUA 4R7GA 2X2OA 3DC7A 4UC0A 1J8QA 2PUVA 3OTQA 4KOAA 5CFQA 1KTIA 2COKA 3IURA 2J9FA 1SXJA 1P9WA 3QPWA 1H9AA 1RXIA 3RLFA 3W2HA 5HF8A 2JLSA 3EH2A 1TM1E 2HJ9A 2AXPA 2XB9A 5BOVA 5CDFA 4CM8B 4EY3A 3BAZA 2K2WA 1QRSA 4ZI7F 3BE4A 5AW5A 1C7FA 1Q95A 2I6FA 1F5SA 1A9YA 2VJNA 5DRYA 5LBUA 3TZKA 3VH4A 1USIA 3W3AH 5ICSA 1TO1E 1T36A 2ZB2A 4FMDF 4KXMA 2XWJI 1L5HB 4IP0A 1WABA 1UPXA 4LVOA 3RRYA 4KE8A 4YT8A 1X1AA 3A3NA 2AL7A 2Y68A 3AHHA 2VA9A 4K0KB 1K86A 4P1ZA 1B16A 3UJPA 3P2YA 2R60A 3UWMA 4M9SA 4MDEA 2J3EA 3G2QA 1IN4A 2A58A 2R96A 3THRA 1O6ZA 1YL7A 2QRNA 3GT0A 3TTTA 3T1TA 4PRZA 2FOLA 3ZK8A 2VCHA 4LJ7A 1RWNA 3UV6A 1Y4AE 1GTVA 2DPYA 4TWZA 1ZJ5A 5E38A 5JAHA 3THWB 3R74A 3TPFA 4W5JA 3LH5A 4AWBA 2QRGA 4CQLB 4HXGA 1AN9A 1ZMOA 2CYAA 4KO3S 4BVLA 5A2GA 5B4VA 3IL2A 2W6CX 1M2OB 2BFAA 1QFMA 1TTTA 5JXIA 4I5EA 2J3IA 1ICIA 1FEZA 4QFBA 4MYHA 1RZVA 2A9JA 5CXSA 3IP6A 4DIEA 5AW2A 1J5XA 2QWXA 5BN3B 1G98A 2FFAA 2VJLA 1NV9A 2CHFA 2E82A 3D54D 1TCVA 4XPIA 1I1QB 3SC2B 2HPAA 1RR6A 3KKZA 3M82A 1NA5A 3WHIA 1J22A 4IJVA 1S2OA 4PX5A 4TS4A 5F1KA 1Q12A 4MQEA 2ZM5A 1NPYA 1EXWA 2L42A 3L0BA 4JGGA 5J4VA 1TI7A 2B6HA 3PC7A 5A6SB 1Z45A 5F9HA 5FUWA 3VR0A 3DOJA 2P11A 2BHLA 1W34A 4OL0A 2I1QA 4QGGA 5BRJA 3E27A 1K75A 2HDWA 5U4QA 3UMMA 3H42B 1W88A 4F1WA 5E1MA 1T9GR 1VE1A 3QX3A 4YACA 1IULA 1C7ZA 1PJBA 1NBMA 3KLOA 1LPNA 1PQYA 2HSWA 4CQMB 1Q7TA 4G4SP 1VL2A 5IXYA 1OA1A 4B6PA 3QEMA 1KMIY 1U7WA 1E5XA 3F96A 3WBFA 2A9QA 2JLCA 3IBFA 3O26A 1YBMA 3TQOA 3GVXA 1V9LA 1SBCA 4JV5B 3KQOA 2YXDA 3BH0A 1RYYA 5CM9C 4O3FA 5DBGA 4S0XA 3X1WA 1Q7EA 1M1UA 3WWYA 5AM3A 2C2WA 1VKNA 4B6RA 5KZMB 5HRCA 4R3NA 1ONOA 1S7GA 3L7DA 2Q7DA 3S4YA 3TW8A 1I1OA 3IBCA 3KWFA 2NU6B 3GLKA 1WOYA 5TLSA 4LI0A 4F7DA 3OF5A 4MGZR 5PGMA 4F1KA 3ITDA 1P44A 3QFCA 2PZJA 3WGHA 4ZJZA 4A82A 5K05A 5L40A 1RVDA 1SZCA 3MJTA 3PRKE 5DULA 4DBLE 4DA8A 1OY1A 5HM6A 2V6JA 5IUKC 1G20E 4F11A 4DR5B 4F4HA 4M87A 1QQ5A 3HA7A 1XRRA 2X6RA 2XMSA 1U8UA 4FR5A 5HEKA 3VMMA 1U1GA 3GZNA 3FHTA 2R4QA 3DVLA 5DBOA 3L6RA 1E2QA 3IUJA 4G67A 2X6QA 4WBSA 7REQB 4MRMB 3G2NA 4PQYA 2GEKA 4LXYA 4JCOA 5REQB 3TSOA 4BJHB 5AW0A 4QO7A 1KDVA 5JATA 1GUDA 4PG8A 1HC7A 1VBKA 2XQJA 2HSDA 3NNSA 3MTIA 4E1VA 4ROSA 2ZQZA 1W36D 5A4MS 4FFSA 1WW2A 2GFQA 4WXEA 3EISA 3GJYA 3LHFA 1U7OA 2ODAA 2M6SA 1M10A 2I80A 3A04A 3S68A 1DWOA 3R0VA 4MR7A 3Q7EA 4E09A 1T9KA 1PWYE 5DX1A 4R1OA 3EXAA 1OJLA 2MYUA 5B4UA 2C2HA 2P3QA 3DP7A 2DLNA 2WWXA 3QKWA 4KH1A 5DWDA 2H08A 1EFRD 4MI9A 4KI7A 2NV0A 1ZMRA 4BX0A 4IICA 3EZNA 3RT7A 4PIPA 3IDAA 2H92A 1JFTA 4G01B 1HURA 1ZRHA 4J0JA 2CLFB 1BAPA 2F48A 2GZAA 4IOJA 4OHXA 5EI5A 5NLLA 3RF7A 5KVCA 1P17A 1Z8NA 1VMIA 3GPIA 4EZBA 4GSKA 3C7KA 4DBLC 2X5KO 4Y0VA 2AS0A 3RRFA 3DHYA 1D6JA 5DKFA 1YRBA 1SGWA 4R0MA 1OIWA 2VTVA 3PLNA 2A59A 3KLPX 4GQAA 4P33A 1C4XA 3KOYA 4MRNA 3QVGA 5AI8A 4LXXA 4BWGA 4CM9A 3L8CA 2PWAA 3CJQA 3TXAA 5B58C 2ZYRA 3MTJA 1PQWA 4EHNA 3LPAA 4PHHA 5C8YA 4FS8A 3OZDA 2Q1SA 1CY1A 1O97C 1YC2A 4N5NA 5AKXA 3U7GA 3RIMA 1UADA 4DLZA 2R7LA 2ODTX 3GVCA 2RSLA 3RU2A 3FLAA 3N2GA 1T9GS 2AZXA 1TTHA 2B6NA 4UNIA 1WUTA 2DKNA 2O2DA 3U7IA 2FXIA 2ORED 3DMTC 3KFLA 4C0BA 1T5TA 2JI6A 3P0JA 4S05A 3NOQA 2RHHA 2OQ2A 4G07A 4IKEA 1HNZB 2R00C 3N0TA 1U4NA 1ZL0A 2UYQA 3AETB 1NXVA 3G1WA 3V1YA 5CFMA 5DNUA 5LMUB 2Y6UA 5CVDA 2PUCA 1R6UA 1UEJA 3GLUA 1BD3A 1YJ5A 1GRCA 2BSXA 1NQVA 3A3PA 1VIDA 2IYQA 2SBTA 3CRRA 1KR5A 3H0KA 2HL6A 2LNDA 1FDIA 1LC3A 1Z4NA 1MRSA 1ZQ9A 2W2PA 3D4NA 1NVAA 4FB4A 2GZRA 2FPPB 3LUCA 2BM1A 5AHXA 3FPGA 3T7KA 2GZ3A 4IH4A 2PSJA 3FUXA 4M8KA 1SUSA 2E87A 4I81A 1ENOA 2IY9A 3RKRA 3I0NA 2ID9A 3SFTA 3UEOA 4RF4A 2IWRA 4MQUA 1QQTA 3P1JA 4N5LA 1KERA 1BG6A 2REXB 4HMOA 4X44A 5KAPA 1A88A 4NZNA 1DEXA 2GKOA 2JVIA 4WLNA 3NI2A 3DKIA 3C4JA 5KDLA 1JHMA 1RRVA 1JDSA 3VPHA 4CQMD 4G1BA 1ZRNA 4LDRA 2NVBA 4Y67A 3KQQA 5EOVA 3JASA 1XV5A 4D45A 4YX9A 1KZ6A 5D87A 1PFWA 1POWA 3ILHA 1E5DA 3ZZ0A 1OXSC 1HKHA 2CWDA 4CFYA 2FCAA 3B1VA 3K15A 3M3DA 4M76B 1B6SA 4QU5A 2HBYA 4AMVA 1EFDN 2GBGA 4EEKA 1QQ7A 4EMUA 3ZXUB 5JC1A 5HUHA 1GZDA 1MORA 5HOEA 3SNHA 2BF7A 3TLBA 1WQ3A 1CULC 4JQZA 1DKRA 3DC2A 3MIIA 3V8PA 4DXDA 2J07A 1JI3A 1D6NA 3M5CA 4UVIA 4BTVA 5B36A 1I10A 3CLUD 5COAA 4XWKA 1H0RA 4EB6A 1FFBA 1CUDA 3FYTA 4N3AA 3S28A 2C5LA 4IMPA 2XUDA 4IF4A 2V7XA 3HJAA 2JD2A 4QECA 4XGKA 5ALLA 4PC1A 4B7XA 5KVSA 3DMHA 5IHPA 1BDHA 4BKRA 3E2PA 1EDOA 1NVKA 4KR3A 1LQ2A 2OV1A 1D7AA 1T2FA 1ODKA 2AJLI 2JIPA 3DE4X 2HH9A 1NZDA 1RFGE 2C3MA 2QT0A 3PYMA 4V1CI 1IUPA 5DYNA 2CLCX 2Q9AA 2JI4A 5FI5A 5DISB 2WHYA 3QUCA 1KJIA 1YFKA 2IDKA 4M6WB 2J48A 3OKPA 4LDJA 5B3JC 1UDBA 2CVHA 5FTKA 1D2EA 2WTNA 3JQQA 3S8YA 4QJBA 3HCOA 1ZISA 1L3BA 4IO0A 5KCZA 3DV2A 3IPYA 2YC2C 2NPFA 3UV7A 2DULA 2XDAA 5LYJB 3SEFA 2BFPA 2A3NA 2B35A 2JIZD 3AXSA 3E7PA 3ZWYA 1IJBA 3R2JA 2D5IA 2HQSA 3HCFA 1ZUWA 3CY6A 3ENWA 1CJTC 4L0CA 4YRGA 1VGRA 4OB8A 1GFZA 4Q18A 1C2TA 1GPKA 3IUMA 3QTLA 3O82A 3SHTA 1KDYA 4RANA 3H8SA 4RTKA 1QP8A 2BFEA 2V6FA 4NX2A 4JJEA 1M6VB 2BZGA 3BM5A 3IBYA 5EP3A 2XQGA 4CM6A 2BR3A 3FDXA 1EU1A 2NU8A 3EF3A 4DV3B 4TGLA 3BIOA 1JFFA 2WJ6A 3PFBA 5FF9A 5JPIA 3ZGYA 4AZ0A 5SY6A 1KJYA 3WLPA 2ZWVA 3ZTWA 4E94A 4ZOQI 2NZ8A 4DVGA 4RPCA 5GIOE 2HADA 3TBKA 4OHVA 3R75A 4IUCS 1BTOA 2FZCA 1SIBE 4AP9A 1W87A 4Q4CA 5LUBA 4FDMA 1K6MA 1RLUA 5TQVA 1Z8DA 2EYQA 4FLFA 1N2IA 1KBQA 4R9VA 1GZ3A 1YQEA 3EVTA 3OSZA 5BR1A 5LB4A 3WK6A 2IXDA 2V3WA 2Z09A 4AYTA 1E99A 3N6RA 3L43A 4UM5A 1SZDA 3HYTA 4M1YA 3EZ2A 2CNWD 5TF4A 2PJUA 3FR8A 4OATA 5FQOA 2O3RA 1OI3A 1VTKA 3ECSA 3SDSA 3QOYA 3IT3A 4LY6A 1JDZA 4C0QC 2FQQA 2J46A 1C1XA 2WD8A 2WWGA 1HYEA 2A9KA 1BD4A 3H1PA 3NQ41 5U4XA 1FVOA 1GPDG 2XPCA 5HDQA 1WDTA 1T34A 5JRDS 1HE1C 1CJSA 2A9PA 4BRZA 1P6QA 4FGZA 1RPAA 4JYCA 4ZEWA 2X5OA 1JA0A 3WGQA 1IN8A 3BCUA 1XD2A 2G6TA 2J5KA 2W70A 2WIAA 4TLMB 2DM6A 1YRWA 3H9QA 3D3KA 4M9QA 3RWBA 4G25A 4GOND 2I34A 4GLFA 5KNBA 3QA9A 3V9AA 3WLMA 1A9XA 5IXJA 4AC9A 2L17A 4TMKA 2Z8ZA 5JSZA 5CNMA 4ZTZB 1Y1LA 4BLWA 3OH8A 3PFIA 4OCZA 1DAMA 1TCBA 3R6DA 3RYHB 2IZ5A 2GNAA 3DKRA 3DTVA 1A0OA 1MV8A 4RX1A 1Q1NA 1YFLA 1NBEA 1CJUC 1W5AA 1K9VF 2YWJA 1QMGA 4XZ3A 1ZIPA 3JRWA 5JAPA 3B9PA 4PICA 5BXYA 1U6IA 2HLHA 2CXOA 4U9IS 3LS2A 1F0PA 4UHHA 4EFMA 4HT3B 2XB4A 2QVLA 5JOQA 1DXOA 3KV1A 3OCUA 3COVA 1JG3A 3MTQA 3OE7D 4TWIA 3VR6D 5FKJA 2QXUA 1VXOA 3WQRA 5KKNB 3H5OA 4DUGD 1YS4A 5E4FA 3D8TA 4PW0A 1ZCBA 3MZ0A 4EECA 4IILA 1RQNA 3GCGA 4R83A 2SKEA 3E3LA 5CFRA 4GI1A 1OLUB 1T1RA 4H17A 3P2EA 4RKRA 4URVR 1Z0AA 2BKAA 5LN1A 2GZDA 2IYRA 1KI7A 1NBIA 1EQAA 1S8FA 3PC6A 4S1OA 5HE9A 4C43A 2R11A 4C0SA 4HQ0A 1R18A 1VL1A 2C07A 2H16A 3EE6A 3ZI7A 4NCIA 1L8LA 1B7GO 1IWOA 2H1SA 1BWQA 2AR7A 2VT3A 3QE4A 5CDGA 1C0IA 4LMPA 4YFVA 4NG4A 3AEUB 1AB5A 2CE2X 4YJFB 2PMKA 4UZSA 5JS8A 2UUBB 1G63A 1S3IA 4RBNA 2ZP1A 4UXJA 1ZUNA 1PU2A 3CPHA 3U3JA 5C2JB 1WB9A 4KQGA 1NP3A 1YCDA 1ZD3A 3I9JA 1A98A 2NUAA 2FPRA 3F78A 4L78A 1CUWA 1FX0B 4NYMQ 1PNVA 1XZJA 3KR0A 1L3IA 4Q4JB 1OROA 3FHLA 2QG9A 4ENUA 2FSIA 2JK1A 4IHJF 1G20A 3P9KA 4KBGA 4ZFNA 3NPAA 4US2R 1GRRA 3PI7A 4E6PA 3JZMA 4D9FA 1W35A 4JI2B 2CF6A 3GUZA 3LT0A 3GQVA 3OZCA 4X8HA 3EG9A 1IMJA 3RUDA 4IJKA 4XARA 5HBGA 4M0PA 3DVSX 1GHTA 1MA0A 2ZE6A 4LTNA 1S2LA 3V2UA 7GPBA 1UH5A 1VZ2A 3Q2OA 5GM1A 1JQKA 1VL8A 1CRZA 2VF5X 2Q4BA 3FA2A 4GFDA