2WKSA

Structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
b'MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Synthesis and biological evaluation of new nanomolar competitive inhibitors of Helicobacter pylori type II dehydroquinase. Structural details of the role of the aromatic moieties with essential residues.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 57
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2wksA00
2C57A 3N59A 3N7AA 3N8NA 4B6PA 4CIYA 4CIVA 2Y71A 3KIPA 3U80A 4B6SA 5WRFA 5B6PA 4CIXA 1H05A 4CL0A 1H0RA 1UQRA 1GU1A 2C4VA 2BT4A 1J2YA 4CKWB 3N86A 2WKSA 4RC9A 2Y76A 4B6OA 4V0SA 3N8KA 3N76A 2XD9A 4KIUA 2C4WA 2DHQA 4L8LA 4B6QA 3LWZA 4KIJA 1H0SA 2XB9A 4B6RA 4CIWA 1GQOA 4CKWA 3N87A 2Y77A 1GU0A 4RHCA 1V1JA 1D0IA 2UYGA 2XB8A 2XDAA 4KI7A 4ZC1A 1GTZA 4CKXA 4CKYA 2CJFA 4CKZA 4KIWA
chains in the Genus database with same CATH superfamily
3BKXA 2PGIA 3ZXIA 1PEDA 3A1NA 3IVMA 4GDMA 2IU0A 3BH6A 1NKVA 1Y98A 4FHFA 5CT6A 4BQNA 4JZKA 4D98A 5IZCC 1KI1A 2JCSA 1OE0A 3H99A 4RJIA 2Q7XA 1N8NA 4YAJA 1HZZC 5DBIA 3W05A 4OLBA 2BJWA 2ZUCA 3PXBA 4U9HS 1IATA 4A26A 2O3RA 3BRWA 4PN3A 3F6RA 3CQ9A 1AXEA 1FYXA 4A92A 4KAJA 1GKIA 1JJ7A 2WFMA 4LYAA 1YDHA 1ZCFA 2ZR8A 4O02B 4AXBA 1IU9A 2O8NA 4DUPA 1DQNA 3F7TA 1T4BA 3FOWA 3PC7A 5JWRA 2V59A 1LEHA 5DN6A 1C9KA 3IAS6 1I4TD 4RSHA 4RY0A 4EI2A 3ODPA 4LC9A 4FZRA 5HFAA 4BVEA 2IYAA 1RHKA 4JLJA 4YJDA 1CUSA 3TL6A 2R60A 2Y1KA 4BPBA 1P7VA 5KMGA 4CL2A 4MEBA 1S2OA 4V1CI 4AY6A 4ZAWA 1T3LA 3EOAI 3AF3A 3JQAA 4ED9A 1DV2A 1N6RA 4WLFA 3ZDDA 2XY4A 5KVVA 2W2TA 2ZPTX 4O4JF 2NUTB 1WHTA 1FX0B 2D4AA 2FA9A 2HZ7A 3GJ5A 2GXSA 3JV7A 2I2BA 3CVOA 4QT0A 4BE4A 4WNAA 3TW8A 4BX2A 3Q88A 4F5YA 2OT3B 5L3VA 5A6SB 5BSVA 2BC9A 5IPFA 3BAZA 2ZUDA 4FGLA 3ZCVA 4EPTA 2I55A 2PIAA 3GFQA 1Y4SA 4MR9B 5FFMA 5AKIA 1SD1A 1X7ZA 3H1AA 4DLXA 4AUKA 4MUEA 5FLXA 6YASA 1U2GA 3H6HA 1NLZA 4JBGA 1ZIXA 3FFWA 3DWEX 4Q47A 1LXCA 1HQKA 4GQAA 4FMCB 3VZQA 3UGKA 3GPLA 3BCSA 1SUBA 3RRXA 1N3IA 1X1TA 4CMGA 1NYTA 3IC5A 1GTVA 3NCTA 3QWFA 1WO8A 2ZI7A 3DEHA 2IUSA 4OMFG 4QU8A 1EVYA 1KI3A 2GDJA 4TQUS 2K2WA 1NOIA 3DV9A 1TJNA 3NP9A 3OZDA 4OJTA 5F33A 1J1UA 3V4LA 3WWEA 3TLMA 4ESVA 4RFVA 1RAIA 1MW9X 2EFEB 3DTYA 2FMIA 4P5DA 1PWEA 4EPVA 1KEUA 1IZ7A 3I23A 1I13A 3ONFA 3M2PA 3KR2A 1QIHA 4L57A 3CF6R 2FDRA 3FDZB 2GZ3A 3KZVA 4JEMA 3B1VA 3G68A 3OECA 1U2RA 4KQIA 4RENA 5ARDA 6REQB 2FPIA 4XIYA 4HL6A 2QL5A 1DTEA 4JYCA 4Q4AA 3A0UA 1D0SA 3QYAA 1UXJA 4B6OA 2WU1A 3UT5B 1XT6A 2QQEA 4QM7A 2D74A 4FNAA 5GJBA 2RHTA 1XZBA 2YJTD 3IT1A 5KYUA 2HU7A 2YJ6A 3DEZA 2Q3MA 2P79A 3LOPA 5JWHA 1XV5A 3I2HA 1Y9AA 3Q9UA 3S2IA 1TIPA 2WYIA 4Q0MA 4D4HA 4J2OA 3GEBA 4WQMA 1FF9A 1XZNA 1VC2A 2I6SA 4NCHA 4E2YA 1CDDA 4WA7A 1HLFA 1H4SA 4BFCA 3SU8A 1YBAA 3HKEA 4DYHA 1MC1A 4B9EA 3THYA 2BTQA 3FPFA 4UQLA 1Z75A 4R71A 1CJMA 5CLJA 4XD2A 3PE4A 3WDKA 1PR6A 4GYJA 4R1TA 4M0FA 5D85A 4DPKA 1M34E 1S7CA 1A95A 3D7SA 1A2KC 4MK4A 2OBNA 1RRKA 3HKBA 4QDJA 2AQIA 1BKSB 1TMOA 4TT3A 2PSFA 1JL3A 2WM2A 3TQHA 4ARZB 1NXXA 4E32A 3GO4A 4Y9TA 5D5QA 3GLFA 3GLIB 3A6PC 2FUEA 2QUAA 4UXIA 3ZI4A 4I5IA 3I9FA 2GCNA 2J32A 2M1XA 2XUGA 4WCFC 2FF7A 1MB3A 2OCBA 4R2LA 1GQQA 1JYFA 4PEVA 4DEXA 2PN1A 1L5HB 1PZGA 4XARA 4H2DA 4KEAA 3BXPA 5DRTA 5HF6A 3HJRA 5AHRA 5CXUA 1SXJC 2EBUA 2W6JA 3IQEA 5DM2A 1RLOA 1IXZA 5FWNA 2K6GA 4FCWA 3EEBA 2JB9A 2OWDA 2FE1A 2NZVG 2X1HA 3TQIA 2B5WA 1E0JA 4QLBA 4XIFA 5F3RA 3MQFA 3IEMA 4PICA 3WK5A 1F2UA 1DG3A 2RBEA 3SSMA 4U7GA 4X1YB 4UTXA 2DYKA 4HGRA 4BAZA 1REQA 4BGVA 3PD7A 3BUSA 2C96A 1C0EA 3RANA 3GLTA 4CI0B 2AG5A 3GVIA 5ICSA 3K2EA 5EZ5A 4LFBB 3M9XA 1GPYA 3AM3A 3M5DA 5G4LA 3JCZA 4K8RB 3GAFA 3NIWA 4NK4A 3GT7A 2ODWA 3I2KA 1Z6XA 5AXCA 3VOAA 4DSAA 5I4CA 3WLRA 5IJ0A 1FNCA 4Y9UA 4PX9A 5FOUA 4L4SA 4MP6A 4AJEA 3ZGZA 3G2NA 3MPUA 1L4UA 3JZFA 4CN8A 2H7CA 1RYNA 4X1IB 1WEKA 1ZD2P 5KNCA 3AEKA 2Q1WA 2GCGA 2NTYC 4S1VA 2CBGA 1B73A 1QG4A 2OORC 2F7SA 2VXCA 3MAAC 2OILA 3MF4A 3N86A 4W63A 5MF6A 3DVRX 5DK4A 3PD1A 2OXCA 2PJUA 3PGMA 4FD2A 4KNVA 5KYWB 2J08A 3FF4A 2ZK7A 2IIPA 4F6RA 1WULS 1SBTA 3O83A 4TRNA 1RI5A 1WF3A 2VL7A 3KUKA 4WEQA 4BNDA 4XYGA 3TSCA 1UMDB 5C1DA 4EATA 3MWGA 4M83A 2XOKD 5FBLB 2ETVA 2UUAB 1E3DA 1T0PA 4J07A 4RTSA 1XMIA 4YUZA 3LUFA 3GY0A 4IJ6A 3SC3A 2D1FA 3ZZMA 1DEKA 3WLPA 1W9HA 4ZICA 2J33A 3TD9A 3B1YA 4U2DA 4LA4A 1E6CA 2XCQA 1T9BA 5K0TA 4Y7DA 3CE6A 4IJUA 2ZJ3A 3GF4A 5FPPA 3GT4A 4YJGA 2BR5A 5I51A 3O8CA 3GLIE 2DWOA 1QSGA 3ZCPA 3EOBI 1E1CA 2JFGA 3WWPA 1MAHA 3MOIA 5FR1A 3E7WA 1B4DA 1X7YB 2QTTA 1GKYA 3WL3A 2FR8A 3HR8A 2XV1A 3ZLJA 1CEYA 3VKHA 3OHPA 1F6DA 3DP7A 3O2NA 3E18A 1VMAA 4UUBA 1S89A 2AVNA 3BBLA 3AR7A 4YHBA 4EHDA 8LDHA 1QFZA 3A9RA 4UNNA 3UXMA 4Y1EA 1SCQA 3QFFA 4LFAB 1OTHA 2A0YA 4XR4A 2P6MA 1N5KA 3B51X 4TLCA 4YAOA 1U11A 3SN6A 2HJRA 4MOWA 4MDYA 1VYUA 1BMTA 1W6UA 3PI7A 1ZG3A 3Q3JB 3R4VA 5TQ0A 1VSQA 3K8QA 1LBQA 2C2HA 1VJTA 4FB5A 5LDDC 2Q4DA 2H54A 3ESYA 5I8PA 1HMPA 1VIYA 2FUKA 1PGQA 2PSDA 4NFYA 3GNSA 3ZN2A 3DDCA 1OIVA 3R0XA 4P82A 3UK7A 3ZNOA 3VC7A 1IHUA 4PAQA 3EVDA 4Y2HA 1GAQA 5D2CA 5JASA 5K0JA 1UK7A 3U17A 5DW0A 1C1DA 1SZDA 1ISIA 1UXKA 3KYCA 2AN9A 2CWDA 1T3TA 3LG2A 3PCXA 4WD3A 5HSGA 1UJNA 1I4DD 4YRJA 4D4JA 1G5RA 4B7AA 1OGJA 4HXFB 4M6WA 4C3ZA 2BCJQ 4MQUA 2Y1CA 4TKLA 1Q0PA 4XVHA 1QK5A 1YZQA 3VAZA 1GSHA 2OHIA 3SJ7A 2YXLA 4D9IA 3P9NA 2W8BB 4DA4A 1ESCA 3OFVA 1U98A 5CXXA 5I47A 2B6HA 2IXTA 2YZNA 4YPVA 1O95A 3GRFA 3CO5A 3OM0A 1EGHA 1WCXA 3FAKA 5HRUA 2NTJA 4NJMB 3DZ8A 1T5OA 4GH5A 1BKYA 3D8NA 1GRVA 3WNBA 4EYSA 4ZT5A 5KSYA 1WB6A 5ITVA 2WP8J 1H8HA 3A2KA 1DIOB 1PR2A 2D2IA 4HWSA 5CYGA 1PR9A 1KEEB 1XYGA 1W0JA 1G4AE 4R1QA 4CV1A 5JZOA 4OLAA 2QDKA 3REQA 1WXGA 1RJFA 3Q0TA 3T7TA 3WKBA 1JEYA 5AI0A 2QRMA 3DE0X 4EHJA 2I76A 5SY4A 4U2CA 1A9OA 2B1GA 2GFHA 1D2GA 1E77A 5BSRA 3RYHA 2B3TA 3R0VA 4UNRA 2R8BA 5EQJB 3JPYA 3EFOA 4A16A 3RADC 3WAJA 1XMPA 2KBFA 4C0BA 4GOKA 3RABA 2Y6VA 3T1TA 5GOZA 3P45A 4FBGA 5FRDA 1SB9A 2R86A 4UOZA 3WLAA 1JB9A 1EYZA 3FZYA 4Y2UA 1P0MA 2P2NA 2FN3A 4QOHA 3VUEA 1I8TA 4FJ1A 1E3SA 4WJZA 4P4GA 2GBLC 1VHDA 4MYHA 3UGTA 4QICA 3DPUA 5LQNA 1DOAA 2B35A 4UTOA 1JIQA 3C6KA 2I67A 3CUUA 3I2YX 1SU7A 4HPJB 5CEFA 1L3IA 2DUJA 1TFUA 4N8DA 3OPMA 4ZT4A 4IWNA 2IVFA 3OURA 1WHSB 3BXGA 1RC8A 3U3MA 1JDUA 3R3XA 2Z58A 5BQOA 2C57A 5DCLA 5TMEA 4EOGA 2BWJA 2E4XA 2REQB 2FG7C 1DKUA 4YS6A 1P3Y1 2P9FA 5EKUA 1P18A 2D2XA 4F8EA 2ZWIA 2DAPA 4BO2A 2FSUA 5CYFA 4YVFA 4A0FA 2WU8A 2WSSA 1LRJA 2YIVX 2QN8A 1IONA 1TZ2A 3KHSA 2C9CA 2G07A 2H1RA 1DC7A 4N7BA 4W6QA 1Z2AA 3BHIA 4KNWA 4LISA 3ZDXB 3NNDA 4MVWA 4F9GA 4ZDKA 3KK0A 2PE5A 1V9LA 3AHGA 4P84A 1R6DA 2WJPA 5EYPA 1U8UA 5AVYA 2X4IA 3G2OA 3PXCX 5EKSA 1T1EA 3ILXA 1P5FA 4KJZA 4TV9B 2FDXA 1Y1TA 3ZWQA 2F43A 4OU4A 4D56A 2JVKA 4IM7A 2IYTA 4KWIA 1V1JA 4MWEA 3VR5D 3ZBQA 3B1FA 4RF4A 1FLVA 4ZAFA 4D44A 2CV1A 2IZ1A 2WVGA 3D64A 4CIBA 1G21A 3EZYA 5T8KA 1GTMA 2G67A 3IDAA 4UUPA 2MYNA 1HDCA 5K3SA 1C3OB 3RE1A 2A7QA 4C4SA 1JEQA 3AHEA 4V39A 5FDFA 4RV9A 1JR6A 1XTUA 1JDSA 1MORA 3A4LA 2VNKA 3BERA 1KSJA 4G4SO 4RC9A 1V7ZA 4BNJA 1Z35A 1O6FA 2BKXA 2OB1A 2V7UA 2BE9A 4L9WA 4JS0A 4JHXA 1Y37A 3IB3A 1ZM2A 4YH1A 2FWNA 1AS3A 2IW1A 2IY8A 2YNMC 3HDGA 3SHWA 4TWJA 1LX7A 1ADJA 3T3EA 5IDWA 2BIFA 4PX5A 1C8KA 3AF2A 1POXA 2AW3A 1D4FA 3FHOA 3A1TA 4JLPA 3W79A 4E1VA 3L93A 3QU7A 3GZNA 3M5PA 3X43A 1G5TA 2XJ9A 4RSGA 3K1AA 2W2OA 3Q3CA 1BDHA 4NAVA 4EGSA 1RM5A 3UAXA 1GZ6A 5EZYA 4E0BA 3ZVMA 4ZOEA 3OU7A 2GTHA 3ZTWA 2JZCA 4O2BB 2VTVA 3OE5A 1EK2A 1U8YA 4HGQA 4FS8A 1BHSA 5FBRB 3ZWOA 1N6IA 3IDFA 2J87A 3EPRA 4BQPA 1ONBA 2JW5A 3ILYA 3UKDA 4EUEA 2CXHA 4H1VA 3VNAA 3BG5A 4NH4A 3ERCA 1UC8A 1HORA 2TRSB 4JR0A 5E4TA 5B4UA 1Q16A 1R0KA 2HQRA 4RVGA 5CNIA 7MHTA 5G0WA 4XJSA 2WTUA 1LK0A 3INNA 1NLYA 3QW2A 4AMYA 2ZCUA 3L2OB 5LKRA 5BN5A 3L8ZA 2EZ9A 5I9BA 4DCUA 1CR1A 1KZ1A 4AULA 2A0XA 3VR6H 2ZYAA 121PA 1E3JA 2NZWA 2HA0A 2VJDA 3AESA 4EL5A 1QKKA 4OM8A 5JNTA 4JB3A 4I46A 1EK0A 3HB1A 2WV7A 2ZKIA 4TKUA 4K9MA 2XMBA 3N7UA 5AO9A 2EYUA 1S96A 3D8TA 4W5HA 3EA5A 4ZVNA 1XJQA 1UJMA 4XUGB 2UZ3A 3BGSA 2EHJA 1JU9A 1RWVA 2VRBA 3D0OA 3RC3A 3TUJC 3OOEA 1ACJA 1GDHA 2QRJA 1E8MA 1FDRA 4B6PA 4CCWA 2GRUA 4BJ3A 2Y0PA 721PA 4WK2B 3IAHA 1QWOA 4X94A 4MQ6A 3EH1A 3G6KA 3K0KA 3UHFA 3QF7A 4BN0A 3KT0A 2PYZA 4PC6A 1MX5A 4ER7A 4X97A 2QAGB 4CM4B 1X14A 2HWYA 4WJLA 1OXTA 2XTNA 4HN2A 2UVQA 3B89A 4IY1A 4YB8A 4FSXA 3STWA 4YLYA 5EJEA 2WR8A 5NULA 4ER5A 4HNVA 3A2NA 1A9XB 2QD2A 3UWSA 4S0ZA 3T1YB 3FCXA 4QAJA 3D2CA 5I9TA 5EP2A 1PT7A 3N58A 1R18A 3LWZA 4QJ5A 1J97A 1J5XA 4Y30A 2HRBA 2XNKA 3RQIA 2UXDB 2IS1A 1KRXA 2BMAA 4RVOA 3TCNA 2B8WA 1VPLA 2BHSA 2PKQO 1NVAA 5DHTA 4UAJA 4MB6A 3HYSA 4EHIA 3UHOA 1L9KA 1QWSA 4NE9A 2AQHA 3BSFA 1D4AA 3DQPA 3P5SA 3WMEA 5BVHB 3T54A 3QKWA 5C7IO 2WAOA 2CHQA 3BWDD 1CE8A 3V34A 1HFEL 4O0LA 1UK6A 2I1LA 3A2LA 1QIIA 1IBRA 3O4GA 4I9NA 1D09A 5THQA 4ASUA 1NJ8A 1P45A 5A04A 4RTMA 4DV5B 2PT7A 3LYHA 4L50A 3VRHA 3NYIA 4B85A 1N2BA 4CMIA 1ZD5A 3KLBA 1IZZA 4HN9A 4I8DA 1YUBA 3ROEA 2CXOA 2X0IA 1MU0A 1KR5A 2E1PA 5CX4A 3DKIA 4F11A 5HHTA 2SKCA 2FZ5A 2IYQA 3CV3A 5KJEA 4AJLA 3ENZA 3L0ZA 1IWOA 3PHJA 3O4VA 4IBOA 3LLMA 1QORA 1NP3A 2CL5A 2CNWD 2YXNA 3AWIA 4BZQA 4TN1A 1ZVKA 1G8PA 4OBBA 1JAZA 5DLYA 4YAWA 2AJ8A 2DFTA 4I9HA 5CIYA 1PRYA 1QS0A 1T8YA 3C3CA 4U7DA 1KYWA 4E5PA 2IOFK 3ZLVA 2LNDA 5EJ7A 4EHNA 4TTQA 1Q6ZA 3FYUA 3GLGA 1PW7A 1HWYA 3W6UA 4X44A 2XKKA 1SVWA 4RJLA 2EG9A 1CCWA 3X1XA 1Z6GA 5TPZA 4WASA 1Z16A 2AMVA 2MSLA 1JTFA 1K0FA 2YMQA 1YJCA 2G08A 1IZYA 1PAUA 4Q3AA 4PGHA 1X7HA 1JR3E 3N0RA 4GYWA 4Y9SA 1RIFA 2B1RA 5FL3A 3SF8A 4ARAA 4QYIB 2Q6OA 3QBVA 3V1NA 2QM7A 3QTTA 3OM8A 3OOWA 1KVSA 2CZCA 2HHLA 2C58A 3G17A 5DULA 4C0XA 2NAFA 5JYDA 3TSOA 3MLEA 4BNYA 2X0RA 4R0VA 3NC1C 4YDQA 2UZAA 4FI3C 4NHOA 3KO8A 2H7VA 3PK0A 4Q3OA 2JATA 4QBHA 3UJ7A 4EGCB 1KRWA 1TT5B 4KTVE 2JASA 3GFRA 1LSJA 2QIOA 1E6LA 1YR6A 1QNFA 1C4OA 2PG3A 3CB2A 3PWZA 1FW8A 2VNIA 4ZYXA 2XMGA 1S7GA 5EXPA 3NQ41 5KBYA 4GGPA 2UYQA 1SVLA 2I2AA 2FPSA 5KU7A 4F6LA 3UFBA 1JKXA 1P73A 4UVDA 3U61B 2VAXA 2R7KA 3LXXA 4GFDA 2ZULA 2FPUA 1A8IA 2ORED 2H92A 3JSAA 2VDWA 4HD8A 3PT9A 4ETIA 3U1BA 1SBYA 3BE6A 3IP8A 2UVPB 3TH5A 4I8IA 2QVBA 4MA0A 2GJ8A 5FWXA 3DW1X 3VPFA 1YJXA 1E4EB 1LH0A 3ELBA 4KN6A 3TNLA 3M1IA 5CYPA 1YZTA 3HJBA 1G8HA 1EE9A 5UKDA 1LPBB 4TV8F 3R7WB 1C1XA 1Y5NA 3G8CA 4IINA 4OAOA 1X42A 4YR9A 2CXQA 2B34A 1C9JA 3L4EA 4KXQA 4FNGA 1YD7A 2XVAA 3CUEF 2FAXA 4GZ5A 3WIDA 5CLFA 2ZT6A 1S3IA 2WJ6A 1H2HA 3G0BA 5DHFA 1MO2A 1RD4A 3NYQA 5FR2A 1XPJA 1Q7EA 4JGGA 3CPEA 3EZ7A 3KWJA 4FEAA 4FB4A 2GZSA 3UICA 1CUFA 1UM9A 4M1KA 3HJNA 1FDTA 4CMBA 3MWEA 3A25A 3HJHA 3JQBC 1TD9A 4D3SA 1ZK4A 1P2DA 3D0KA 3GJ8A 4MVJH 1KPGA 3SHQA 4TL6A 4B6SA 4E70A 5FBVB 4HRYA 1H69A 3KQKA 3C87A 4XDZA 2JGFA 4D41A 3D8UA 2GUGA 1WUHS 2VHQA 3WG9A 3UUFA 1B23P 3SKVA 3C8MA 3N6XA 2D5CA 1JH8A 1QNLA 2BCGY 3FCSB 1L7BA 1MO3A 2XYGA 2BGLA 2ZFUA 5F9MA 3HCCA 4YPFA 4OTZA 3R3VA 4FYHA 4TTVA 4Z4CA 3TKYA 2D5LA 3OH8A 3SHOA 1U3CA 4MW7A 2M32A 3VKVA 4D4GA 1GZ7A 3AIOA 2WP0A 3T9FA 1VYTA 3NHYA 4XW2A 4Q1DA 2C0CA 4P8RA 4MYTA 4UHBA 4HDNA 1VECA 5H4GA 5AQ1A 3H9JA 2DU8A 2BGGA 5JVDB 4ARSA 4C88A 2V0GA 3CGWA 4GP9A 2WA1A 1BC5A 2WK1A 4LYGA 4UEKA 1W36B 4JXXA 1MV8A 3PJDA 4H6XA 3TLBA 4PR0A 1F12A 3ZYZA 2V7VA 3QVGA 4BV2A 2QLLA 1PUJA 3QX8A 2NO0A 4JI4B 4LY6A 2FCRA 5TPWA 4MV3A 2FY8A 3AILA 1YB5A 5CH5A 1VG1A 4ZGGA 3MT9A 5DHQA 5FPHA 5L40A 3MGAA 3UG7A 1B8OA 3QXGA 2R751 3EVCA 4QEKA 1AXRA 1K08A 2H1WA 2HX1A 3L8EA 1OAKA 2DF8A 3B1KA 3VJRA 5BRAA 2A5YB 2QG6A 3Q6MA 1MNQA 3N8NA 2CL7X 1AURA 5ALKA 3RK0A 5EIEA 1N2OA 3GLRA 3F7MA 4EL0A 1QCYA 4RKFA 4IIHA 1A27A 5LZ5A 3BCUA 4MV6A 3TR0A 2H1HA 1J2JA 3HKDA 2WHPA 1DX6A 1V1RB 4J0IA 1CQJA 1J4AA 1U2SA 4PC2A 1JPJA 4NFHA 4ZZIA 2AI2A 1EP3B 3ASYA 1TO2E 3E35A 4MP3A 3PR3A 3V2UA 4N5DA 4OGKA 1CS0A 4B4WA 1Y7PA 4MDHA 5DGCA 3DSRA 1H9BA 3H18A 3FKJA 4FHDA 4BLRA 2LPMA 4D74A 3P20A 2V0NA 3VI4B 1JQJC 1P1RA 2FETA 2WD7B 5CAEB 2BMVA 3JWIA 2H0RA 3PL5A 4EGQA 3JQFA 2FWPA 1OPRA 3D59A 2O2EA 5ESWA 3M83A 3TSWA 1E7YA 5AUPB 1HX7A 3VVLA 1WB9A 1QHIA 2V54A 3IMFA 4RCZA 2J8ZA 2O0LA 2VBGA 4ZVPA 3BGVA 4TZ6A 2M98A 1XZEA 1J24A 1ZRSA 2CMGA 4OQ4A 3H5IA 3DXXA 1U3GA 1P81A 1QGYA 5DBHX 5L51A 4AYTA 1YH3A 1Z7BA 2X1VA 4R1SA 4PF1A 2JVIA 2BSAA 4URWR 4Z9YA 4YROA 4WHMA 5A4FS 3V2HA 1DBSA 1OLXA 2C61A 2HL6A 2HK8A 3WBJA 5KWJA 3LNCA 3S2FA 1ZNQO 1NVXQ 3HO8A 4ZVQA 4A91A 4C3VA 2O06A 5DWQA 3LNTA 4Y9RA 3ZZ1A 3TXXA 5CVDA 4FN5A 5JAQA 3T5MA 1JFFA 4IAOA 3ZWAA 1OA1A 4FX5A 5LQJA 1MGOA 4KQMA 1JKJB 1UP4A 2FHSA 2KW5A 3AHFA 3BWEA 4NK5A 4TWIA 4XYMA 3ESZA 2A67A 1HQDA 3VPAA 5E3IA 1M8KA 2VF5X 3V4PB 1X7WA 1TU4A 2F2TA 4ZHSA 1LPSA 3L7IA 3K0SA 4DQKA 4Y2GA 4DUGD 5FUMA 3F9IA 3R6TA 4BEBA 3D6VA 4QBGB 4X8MA 1BH6A 1ZY2A 2OV4A 1Q77A 1J07A 3SG0A 5BNWA 3R7DA 1OX4A 1PJRA 5KWEA 4P3PA 4XVCA 2YQ5A 4D9BA 1N4AA 2VPXA 3ZTTA 3PHIA 2VQEB 1L7NA 1V1MB 2DJ5A 1P44A 2W8ZA 3KD2A 5G1OA 3LYUA 4YWJA 5IC6A 5IH3A 2L82A 3ROQA 5E8RA 2OV3A 2XODA 1I7LA 3UMSA 4UBKA 5J23A 4O4HF 1XQ6A 3ES9A 3KS9A 1ZICA 3QNWA 4JBIA 2WJVA 3QF4A 4UZFA 2B21A 1PG5A 3DAFA 3ABQB 4AK9A 1U0FA 4HGZA 3JQ9A 4L73A 4EECA 1FNNA 1ZMXA 4LCBA 1X1QA 2X3FA 4H7EA 1TU3A 1VRWA 4BB6A 2BM1A 3GJZA 3DZHA 4XSHA 4GMGA 1XZ8A 1C7EA 2P9YA 3CUVA 4RHUA 4ZAVA 2CUTA 2JANA 4S3MA 1OZAA 2QAJA 2W2QA 1TZMA 3V7YA 5IF3A 1QDLB 2R47A 1SNYA 3AEYA 5AJWA 4C9BA 4DC9A 3VUFA 2W6CX 5J2UB 4EUKA 2PTGA 5A5VA 5B6PA 5JQWA 3SJUA 2VK4A 3M5WA 2Y1XA 1TCUA 4AYXA 1A4XA 1C4XA 3I2GA 2LZ0A 4JLSA 2II6A 3CX6A 2EAUA 3AMVA 1XK6A 4L8GA 2OEPA 2XD9A 4RZXA 4M9RA 5BMVA 4LK3A 4URFA 3JQ7A 3ETJA 2NYUA 5KTOA 4BRWA 1QGUA 1RQLA 4B3CA 1U9ZA 1Y34E 4IR7A 5IP5A 1DIAA 3PGVA 2VJPA 2V1XA 4GRIA 2E6UX 1QV7A 3BB3A 4HADA 5JPDA 4I55F 3TZKA 1MC8A 4JIGA 4AZ0B 5KYXA 3U7JA 4YACA 1W5TA 3CHYA 4MKZA 4P0QB 4ZV7A 1T0HB 4DM4A 1XTTA 1K0UA 3CW2A 3P9CA 5T7BA 3JR3A 3F4LA 3KAJA 1H2AS 4EO9A 4PSAA 2JFOA 3AETA 3D3JA 2QUKA 4HS9A 3V32A 3WSTA 4CEIB 3H5RA 3D8SA 2BBTA 4HX9A 5BW4A 3NP7A 1E0AA 4DOMA 2C5HA 4HBZA 4RYLA 1NMZA 4CHTA 4R0MA 4LOIA 2NMVA 2P4UA 2A92A 3DT6A 3S7TA 3VYUB 1SO8A 1Q0SA 4KHZA 4B6QA 1FTYA 3M6AA 3PC2A 5U1PA 3IP3A 3MJDA 4MI1A 1QHHA 4A82A 1HURA 1RRVA 3H2ZA 3OCYA 4PZDA 2XA1A 1MUUA 3T7SA 3TFOA 3R40A 2Q3CA 1V8DA 4RL6A 4CQMD 2RAPA 1T2UA 3M6UA 4CEJA 2QTZA 1U7TA 1R0BA 5J4HA 2CDBA 2I71A 1SOWA 4OI4A 4XSGA 3FYSA 3G8AA 4F8YA 4RK6A 4DPLA 1N5JA 3KELA 1JLRA 3EXIA 4JNKA 5HNKA 2OMKA 4IXTA 1OH8A 3EOZA 4XM2A 1KPIA 3LC7O 3O1IC 5HKKA 2O8CB 4G8JA 1NAHA 1V47A 3ZDBA 3NT2A 3SC2B 2Z8YA 1VGRA 2BEUB 1CT9A 3DDHA 1JDBB 4K9DA 4N5LA 3VR0A 3DZDA 4RE5A 3ZHBA 1OU0A 4CIVA 1ZR4A 3Q72A 2P3QA 5JZMA 4QGSA 1BX3A 4U3JA 3CH7A 4EI7A 3DXZA 2Y0DA 1KQNA 3UXEA 1Z0IA 1MOZA 2BHTA 2UVDA 3GJRA 3H11A 3QVTA 4LRSB 3RS5A 3RC9A 4WNYA 4LOJA 2AUNA 4I5DA 2PZAA 2ONKA 4R05A 4EJ0A 1TE2A 1GUYA 4OBWA 2OV6A 4FEGA 2XLBA 1YZVA 5HQ3B 5K2OA 2ECKA 4OBEA 3KOOA 2RI1A 4P7BA 1FSFA 1FPMA 2AJDA 3IQDB 3QBTA 4KUEA 2ZJ4A 1TJPB 5GVRA 2QA5A 3C8UA 5KYVA 2Z8ZA 3ADDA 1FP7A 2OQ2A 3PDHA 5E0KB 1Z5OA 3LCRA 5T4FA 1DKOA 3KQPA 3P9KA 3PQ2A 2I66A 4WMLA 4CHGA 1J21A 2XIJA 3E4DA 3O8NA 5H68A 1W0KD 3VKUA 6ADHA 3HXMA 1Y6JA 3T9EA 1V71A 5AW4A 2CMDA 3FDJA 4PZUA 2VUSA 2WDZA 2WMNB 4LRUA 1U63A 5CW1A 4F84A 3S81A 1IB6A 1CR4A 3KYBA 2CXRA 3IPRA 3O4HA 3OEED 3WLFA 3MA0A 4NCKA 1DXOA 1S8AA 2FW8A 2WWXA 1UM8A 1DUIA 3GGSA 2B3DA 1NV8A 1QCZA 1S4QA 2VJYA 4G4IA 2Q5CA 2I9KA 2CL0X 1LK5A 1IDN1 1BE8A 1M83A 4NARA 4XH9B 3L8HA 3V42A 4NRDA 1AKNA 1TM7E 1TQHA 3QXSA 4WN9B 1RJ9B 1QPBA 1CSEE 4L7VA 4LRXA 1PG0A 3TLAA 3FYDA 4WL0A 3MTBA 5ADVA 3CSDA 4O4IB 4ZDWA 3T52A 4XSVA 3QQ5A 4ALKA 4EUFA 1O0CA 1G4HA 3MNFA 1ZYUA 4LDAA 4FGKA 2CNDA 1GPUA 1N5MA 3A3PA 4H7PA 1JJAA 3AKDA 1RYMA 5FV4A 5SY6A 3D3QA 2C99A 2V8OA 3W4IA 4RH3A 4IZIA 4EBFA 4NC9A 4Z3KA 1FC0A 1IM5A 3CLUC 3NGLA 5GINE 1G7RA 3CPSA 1CLUA 5K8JB 4RJJA 1M5RA 1UT8A 1YJBA 3EAQA 3OOYA 5D6NA 5FBQB 1O94A 4KREA 1XA3A 2ZI3A 5GY7A 5BSTA 5JS8A 2AOTB 4RORA 3EXFA 4WXEA 5FTWA 1N2HA 4F8JA 4R7ZA 1AJEA 3A9VA 4DUYB 5JQGB 1ZRMA 3WLHA 4E2XA 4L08A 5G0VA 1OREA 1Z0FA 2PMCA 5LA6F 2X13A 221PA 4HDSA 3ZWDA 4A0RA 2MINB 3KAPA 3ETEA 1K3TA 5LBTA 4ON9A 2QTFA 3HSSA 5GONA 1R50A 4F92B 2R6CA 2GSWA 2AI1A 3WGVA 7REQB 1KFKB 1K6IA 4MHOA 5IFKA 2PJRA 4O5AA 3TE6A 2A35A 2XCRB 1H94A 2XPCA 2R6ZA 1IY8A 1JIIA 3ZCRA 4X95A 2J5RA 3W6ZA 5CM8B 4GD3Q 4K87A 4P4TA 1FP4B 1HDXA 1SOVA 4YT4A 1J00A 4X6UA 2Z2IA 4HLCA 4JC5A 4M7RA 2EZ4A 2O5CA 3NBMA 3GDOA 5IXYA 1M67A 1Z2PX 4JYBA 4ZIRB 4G5XA 1Z7YA 4YQYA 1E3WB 4ZK2A 1J33A 4L8LA 1EK6A 1ZI8A 3GJ7A 4XX0B 5CTJA 3LS2A 4LJ9A 3UHPA 2QYTA 3GIDA 4MKIA 1MH9A 5PGMA 1ESDA 3DMPA 3EG9A 3N0XA 1KMCA 5JNUA 5HDBB 4V0OA 5AVRA 1KY5A 1T8RA 4FDUA 1EFDN 1JJIA 2OENG 3GFBA 3MN1A 4N9WA 4F46A 3PEYA 5FWYA 2P6OA 4MGEA 4G07A 4BP9A 1XP8A 1AKQA 2I22A 2YVLA 4PZYA 2ID7A 5C3MA 1N78A 4NOJA 4IDEA 4J0DA 3L8CA 4UUOA 1J1ZA 1D07A 2N75A 3MTIA 4NBTA 5D00A 4S05A 1VPDA 2GLTA 2R1TA 4I3GA 4YYZA 1E2HA 2WIAA 2WU0A 1YB7A 1ECFA 3VR2A 4BNVA 2PDAA 3A6EA 3MCWA 3DL7A 4I2NA 4XYBA 2D7JA 2VYQA 3GI1A 5TMDA 1UC4B 2C88A 2DBZA 4GPD1 3ZHSA 2OO3A 4ILEA 2IITA 3WGMA 1VJDA 4IFIA 3M33A 2YWFA 2FSPA 3O2SB 3P8ZA 1GU7A 4I66A 1COZA 4Q39A 3TOSA 2FG6C 4PXSA 1FUKA 1Q22A 4IP0A 2ZAIA 3AHIA 1F38A 2Z9BA 5A9TA 4FOLA 1M73E 1OW3B 1MABA 3SJZA 1ZCZA 2FVXA 5C8YA 3U7QA 2R7MA 3LC1O 1W8DA 3OT1A 1GKKA 5B58C 2QJTA 5K0FA 3DB2A 1INLA 2I4IA 3HI6A 3ICPA 1T35A 2HNBA 3LPMA 1RWWA 2SHKA 4G1FA 1P62B 1QUFA 3K9QO 1HLDA 4S1TA 1VJ1A 1BQ4A 3HRIA 4CLOB 1LTQA 2Z2JA 3NW9A 4DWWA 1YO6A 3CVVA 1EUCA 2AVDA 1W4BA 2V3WA 3QGMA 4KX5A 4YECA 2I8AA 3JYOA 3COJA 2P6UA 1UPCA 2Y67A 1ZRHA 3RC2A 4OXQA 1ISJA 2BDEA 1C1HA 1NFRA 1FQOA 2A33A 2EFHB 2ZYIA 2YXBA 3GCGA 1Z83A 3KVNA 4B34A 1EM8B 3I9LA 4M0MA 1O2DA 2R6R1 3ZGVA 4OATA 1P29A 3IQXA 4CF5A 3JYHA 1QH8A 2K5UA 1AM4D 2Z2YA 3JD0A 2W4MA 4CCYA 3P0JA 2RDMA 5FL7D 3EVBA 4NU5A 4C0LA 4C4XA 2WI8A 3OZWA 2HLNA 4C7BA 3WA7A 1EWQA 1SULA 5IJAA 1VSVA 1DPFA 2R25B 4Y2QA 4NBKA 3FGPA 1ZNZA 2FQYA 4GVPA 3VM6A 1RC0A 2CJYA 2CVPA 3TLGA 3R09A 4S2UA 5DLPA 2M9MA 4CT0A 2KSQA 4O1IA 2NPFA 4FEEA 1EZ1A 4U9UA 1S9DA 3VOSA 2G0TA 3BZUA 2RI6A 1NJ6A 1U94A 3OEHD 1W5EA 4W5RA 1RU3A 4HO1X 3DGEC 4JOBA 2WJ3A 3ANMA 2QAIA 4CLHA 1FQJA 1XWIA 2VK1A 1PI3A 3A4TA 3E5RA 2W4IA 3Q3EA 4ITUA 2IK8A 3L7KA 4WZAA 4RD4A 2C4WA 6Q21A 5KPDA 5JCJD 2PUEA 4EFDA 1EGVB 3L40A 5DHSA 2FMUA 1WV1A 3ER9A 1M6VA 4YUVA 1IN7A 1Y7TA 4YJ2F 4CG3A 1I10A 3MGGA 1XXLA 3IQZA 4F9FA 4QOIA 4EFKA 1MGPA 1QR6A 1I7SB 2GZHA 3G2MA 3CTPA 4MGHA 1VDMA 3RRJA 4YAIA 2ODAA 4WY5A 3TTYA 1HG1A 3LCVB 3DZGA 4ND1A 4BKQA 2DBVO 3JD2A 3O3OB 3OQVA 2ZRPA 2Z5VA 4NVRA 5JDIC 1R8SA 4DV6B 2B5OA 4CV3A 4OAPA 3ZI7A 1XKTA 1RAFA 2R8YA 1JFTA 1QE0A 5K6AC 2D59A 3IALA 4XGRA 3OZAA 5TQVA 1I3CA 1V4BA 8GPBA 1BEUB 1X9IA 1Z63A 4LGYA 2ZUTA 4WLNA 3DHYA 2O2GA 3MGBA 3PQ8A 4JQCA 4YCJA 4CQLB 3BN3A 1TEHA 3WO1A 4P38A 3FSRA 3NAMA 1ZKMA 4FFSA 4BIIA 4ZDJA 4G0WA 4PLVA 1IAQA 2CJFA 3N6VA 5DZSA 1O87A 3FZEA 3I1IA 3NTRA 2KB0A 4ROTA 1LDEA 4AVYA 3NBFA 3URMA 1V6CA 3WQRA 2C2MA 1JNXX 3PGA1 2YYSA 1QC5A 5CM9C 1C3JA 1ZWKA 1VJ5A 1PR0A 2B30A 4ZT7A 5AESA 5BV2P 3HHPA 4OXKA 2ZM6B 2EKZA 2F55A 1ZVMA 3R5XA 3CW8X 4G6ZA 1E62A 4H15A 3J81A 1JIKA 3E7XA 2FUG1 3A11A 3QE4A 4Q16A 5GGYA 2RG1A 1NOKA 3A3OA 2H31A 5JJ5A 1CQPA 3EUEA 2XI4A 2P9CA 2XYRA 4OUDA 2D54A 4UZSA 2J09A 4GLLA 4X20B 3DQQA 2JK1A 4CM8A 2KLBA 1GPNA 2B4AA 3V8MA 2X14A 4JKOA 1VBFA 3RI3A 3Q9SA 3VOTA 2QMUA 1JJVA 4PSVA 1VI2A 1JUDA 2FPIB 1C7FA 3SICE 1MB4A 3IRUA 4KWTA 1M0SA 4Q4AB 3VZPA 2VJLA 4JZYA 3GRCA 2QY6A 4UCWA 1B00A 3TR6A 1KVTA 2AMJA 3NFRA 4HFMA 4ARCA 2XSZA 4LN1A 4S24A 1J56A 5KYUB 1RACA 4K86A 2SBTA 1II8A 1P1KA 3P7MA 3SX4A 2D7CA 2A5DA 2AFIB 2VYVD 1NVUQ 1RZUA 5I3ZA 4RYDA 1MXHA 4MVJF 3C5HA 4MQFA 4IDOA 2E1RA 2A4MA 2PUDA 2QX8A 2J3LA 3N2GA 1PK8A 3L7OA 3W2GA 1KI9A 2HHHB 2FEWB 2FN7A 2P4QA 1G6KA 1K7SN 4O4JA 2OL4A 3LWBA 1UCFA 3K70D 2EWVA 3HKBB 1DZIA 1ZMTA 3CLSC 5EWJB 4C7VA 4MIOA 2X6RA 4MRRA 5FJIA 4GNRA 1PD0A 3M9WA 3U4CA 4OHMA 2X5NA 1QVWA 3PWSA 2WU4A 3EDQA 3RJ9A 2CLKB 5BUCA 3DFUA 5KVCA 1E64A 3G1TA 5EP3A 2H5LA 2PU5A 2YOGA 1FFWA 3QW4B 4LHZA 1A9TA 4O1HA 4A8HA 2AX3A 4B6EA 5CCBA 1Y1KE 3FSJX 1S8OA 4FFBA 4TMZA 1N2ZA 1XQVA 1RQGA 5JW6A 3DG9A 1N5DA 3VFDA 3C70A 2G1AA 3D7NA 1G20A 2A5JA 2VJBA 3BIOA 1KBZA 1R74A 4C7JA 5A02A 4BATA 2Z1NA 3UEOA 1YRYE 4ZHQB 1CU1A 3GLUA 4KMSA 4LWZA 1NR5A 2BZSA 2OD7A 2WMOB 4H1HA 4MO2A 5LZ7A 4RD3A 1TUIA 2PIDA 2G4LA 1F2UB 5COAA 3PX7A 3ER8A 3C3JA 4X24A 2GO7A 1CUEA 1HEYA 1RYBA 2VDRB 4J9UE 3N0TA 4I2VA 1JIVA 4A10A 5HJEA 1U7OA 1YE3A 4RMIA 4HNGA 5LQUA 2G04A 1SBIA 3DLIA 4ZI5A 2HFJA 1S3GA 5K7SA 4PE5B 2JBHA 4FYKA 4PLZA 5KOYA 3T5DA 3COWA 1EVEA 4M1EA 1OFUA 2KMLA 3KR0A 4DMLA 5IJ0B 3Q12A 2JFFA 4YDSA 1W47A 2FW6A 3GDFA 1C7IA 4XOUA 3UUEA 3I5XA 2DFDA 4CG0A 3HGTA 3CEMA 3IRVA 4QDZA 3AEKB 2DJIA 3LFUA 2C4KA 2RJNA 4RV5A 3ZLBA 3T7JA 1A98A 3P4YA 4WXMA 1MH1A 1TYEB 2I54A 3EXEA 4FDAA 3KQHA 2D0DA 2AFIE 1NMEA 3FLBA 4OK6A 4Y1RA 4P7GA 4ZCSA 3RDPA 4BQOA 1AQUA 2HMUA 2WZQA 4YDHB 1ZI9A 3CJTA 3UJ9A 5T6BA 2MCFA 3F67A 3PYLA 4FI3F 5B3LA 3P96A 3I83A 3F71A 4G0ZA 1RAGA 4KUGA 3KX2A 1PZMA 4ZK6A 2O52A 4A23A 3DMRA 4O6VA 1SXGA 4A0HA 2GETA 2IYPA 2YVAA 3FRHA 3EXHC 3H97A 5JYCA 1F20A 3HVIA 1CJUC 4OQMA 1P3JA 3BXXA 4WZZA 4H7DA 1JFSA 3QH4A 4WRRA 2PUFA 2JI8A 4ADSG 1XTIA 5ICEA 2I4NA 2O3TA 3LBNA 2RHDA 2BHRA 1NY6A 2IODA 2NV6A 2EL9A 3M2TA 4G5GA 3ZHUA 3GXOA 4AZTA 4V0LA 4KO3S 4LDPA 1PT5A 3R7BA 2H17A 1PNRA 1YDFA 4YV2A 3AFGA 3S7ZA 2FQXA 3GJ6A 4PFQA 5FYQA 3WGLA 1C5KA 1XHEA 2YY5A 2ORIA 2VH5R 1FOEB 2WSMA 1C0LA 1VMIA 5IXSA 5A4MS 3KVVA 1ZIYA 2GFIA 4OHRA 2YIMA 9LDBA 4JROA 5EXXA 1LI5A 3SEZA 1MQ8B 5CA1A 1O54A 4TZKA 1ODFA 3E8MA 4Y2TA 2DY1A 1EA5A 5DTJA 5HBRA 2C5BA 3KEGA 1AKUA 3AY6A 1ZM7A 2XOEA 5ALDA 3O95A 5LCXA 4Z51A 5G40A 1QGDA 2XMSA 2O3UA 2IP1A 1C2TA 3R77A 5HMMA 1E6EA 1S6YA 2VTBB 1A8SA 1D5CA 3FPAA 5CVCA 3TSZA 4RD2A 4BASA 3DXYA 1EFHA 3LT1A 1C1DB 1YQGA 2JH3A 2OHHA 3KYCB 4M54A 1GZVA 3G89A 4PGGA 2YJZA 4MZXA 5FH9A 4HNSA 3ROTA 1WUYA 4CWAA 2AGVA 3Q9LA 2XBUA 4M6WB 4DXDA 2P9JA 4MRAA 1JW9B 1NNEA 2RGGA 1JXAA 5GOTA 4AROA 1QRAA 1C29B 2XE6A 3CLRC 4HXEB 4U7TB 5ALGA 3F6YA 1HSOA 2R5NA 1HTWA 3JR7A 4NMHA 2BFCB 1EWVA 1KERA 3TBHA 1X39A 1RYZA 4FS3A 4IF6A 4XPZA 1GQSA 2CDNA 1T5TA 4KR7A 4C5BA 2ECQA 3DZCA 3NJ4A 3HLKA 1U1FA 2KJQA 3O8OA 4G41A 4RVHA 3UC5A 2DPLA 4YQFA 1A1SA 3TN7A 2W11A 2JAHA 1PNTA 1AV7A 5CGZA 4XPIB 1R88A 3RQSA 3KL4A 2M6SA 1Y3HA 1HC7A 1T13A 4OI2A 2A7XA 3SQOA 1I14A 1U0EA 1Q12A 2VQFB 1BWSA 1T5IA 5B2FA 1S1MA 1JEYB 1H0HA 1G2QA 2ZUBA 3RYTC 4US0R 5CM2Z 1KZHA 3RRBA 3DULA 4NYJQ 4UFOA 1DU4A 5DYGA 2I1QA 3T41A 4KO4S 1IBMB 1QQBA 4IJQA 4A2PA 4MUYA 3CEPB 3Q87B 4D1YA 3EFOB 2HXSA 5DYIA 1ND6A 1PTJA 1TCBA 1HETA 1TQ8A 2JIZA 1JT2A 3G5TA 2B98A 2D0IA 2AE1A 4JU8A 4LY9A 4Q4DA 3CG4A 4XJTA 3U7FB 1KFCB 2H4HA 1YSCA 2X0KA 1MXFA 3DV0A 4JDUA 2QR3A 4HVAA 4MMXB 4YJ3F 2KLHA 3ZD8A 4DCJA 3FIUA 4EA7A 2ACWA 4I50B 5EIHA 2AKEA 3RKUA 5JH7B 1EM6A 3W3AD 3EMKA 4RKYA 5BWLA 4B3TB 4OHXA 3D2BA 4K6MA 1NHGA 4G86A 4J0CA 3UH1A 3EEFA 2WSBA 1HKHA 1DC5A 3E6AA 5LQKA 4P08A 3VPDA 2IS2A 5B6IA 2HHAA 1UKAA 1LF5A 4GBGA 4BVJA 4BZZA 2ECFA 3NTQA 3H6GA 3NHBA 4HDMA 2IH4A 5CCDA 5K09A 2BRUC 4BKMA 4IEEA 1NMXA 4I6JA 3KUDA 4CZ2A 3STTA 1TEVA 5E7MA 4IPTA 3TOVA 1MO4A 2CJPA 3ZE9A 4ZCQA 1NVTA 5FUQA 1XCJA 1AKVA 2NQTA 5IAOA 3CZAA 4MQEB 4YAKA 2ZBGA 4ALIA 1NC3A 4B80A 4IDCA 5IAJA 4JN6B 3RH0A 5EIBD 3LTNC 3OZCA 5AM2A 3U3OA 2CHEA 4UC0A 1UOPA 1NI5A 2B4TO 2J5BA 4IG9A 5EYPB 2ZT5A 4NS1A 3IT0A 3IUMA 4MV1A 4L9AA 4QXRA 2YWJA 2F43B 3MK31 2RONA 4M0UA 4Q4JA 1GPKA 1X1CA 5KYNA 3KQSA 1QCCA 5IUJC 4EJ6A 1CUBA 1XMVA 4HAWA 4IMJB 2NX2A 3LY9A 2E85A 5F12A 3WK7A 3GPBA 4D96A 1NU6A 1Q1GA 5JNRA 2JBWA 1J39A 1JEQB 2R85A 4NZYA 5IK2D 3G5LA 3H9EO 1T2EA 4RE6A 5B37A 4CKYA 3UOGA 3DLAA 3EBPA 3OLYA 3QA3E 4I5FA 3SXUB 2NT3A 1U9IC 3W9SA 7YASA 3JQDA 2OCYC 5FAKA 4UUQA 3FR8A 2GGSA 1TYCA 4ITVA 4QUHA 3OQ6A 5IYZF 1AKEA 4BN4A 2WQ7A 5AKEA 4DRXA 3O3CA 1OAOA 1RQXA 2Z83A 5JMOA 4N48A 2BT4A 3D2AA 3PI6A 2QPAA 5HA5A 2JFUA 4J6FA 2R6HA 3WIBA 3AJDA 3SDZA 1J8QA 2PO7A 4BVFA 5LDHA 4N82A 1JMYA 3ITKA 5CFNA 3GZNB 1I2BA 2XE4A 3W06A 4BJHB 4GOOD 1S3SA 2VDKB 2AN1A 4XASA 4IIJF 5AIAA 4YP7A 5BQPA 4L75A 3L1HA 1A77A 4KXYA 1LGYA 2GPWA 2WICA 3CF4A 3LA6A 4YALA 3W7AA 3EIUA 4BEJA 1HNZB 4BTEA 5HMLA 3TQFA 1FYWA 2FK7A 5ITSA 2HDWA 3DMTC 2F6RA 3AFOA 3THXB 2CYAA 1M8JA 2TS1A 3PUZA 3H16A 4MX8A 3R75A 3L0IB 1UP7A 3KETA 4CKBA 3D6FA 3IMKA 1WDTA 4S04A 4XQGA 4DV2B 1N5OX 2FFQA 4NZOA 5A2QA 1U04A 4XOIA 4C4RA 1PV1A 2I3AA 5DHAA 1XG5A 4OCZA 3WRYA 1EIZA 1PWXA 1SOMA 2OCDA 5E7IA 4EBBA 4GWKA 1QXSA 2AXEA 4XJVA 3PPYA 4UUNA 1F9EA 1TC2A 1VIAA 3NIDB 2NUPB 4QOSA 2C94A 2QLFA 1Y1RA 3D5QA 1ADCA 2F48A 1IXRC 3HL0A 4J03A 4NYJR 3F47A 2AKYA 1MG5A 2D5BA 2H2GA 5C3UA 4ND5A 3U3DA 2BFEA 3BTUA 2R6GA 2DH5A 1RWBA 1EVZA 3E2PA 1PWHA 2R7NA 4JJEA 4Z7NB 2IYFA 1OT3A 2Q6LA 3AESB 4LVUA 4D0LB 5EHZA 1IHPA 4MYRA 3LD9A 1OTXA 1DRKA 2QTAA 2I87A 2WF7A 3P19A 5EJ4A 4KQKA 2VSFA 1ORIA 3IS3A 1PR4A 4FDVA 1A9ZA 3G0DA 2AOXA 2XLCA 4AZVA 2OLKA 3EGDB 4WERA 4ZAYA 1XTJA 4XQEA 3S1LA 1JV2B 3U49A 4F4DA 4NV3A 4D8TA 4K2HA 2VDOB 1BA2A 3GFVA 3D6JA 3K16A 4I1RA 1W4ZA 3SEFA 1KZYC 1SVKA 4A6DA 1Z5NA 5JISA 4B0PA 1IY0A 3AUFA 3G82C 1D2MA 3DAHA 2ZRLA 2ZVQX 1P39A 3PNLA 4NOMA 3MZ0A 4K1XA 5KDOA 1P4JA 2HCBA 1K89A 2XWSA 3GHYA 1KL7A 2X76A 4LG1A 4MRMA 4K6OA 1QB8A 5I7EA 1MJNA 2R62A 3EYAA 3Q3VA 5ALRA 1B2LA 5DMXA 1A82A 3N2ZB 2IHJA 3P32A 2Q4EA 2Q2WA 3BRCA 2OKCA 1P9LA 4M98A 3WK4A 4HY3A 4FHCA 1Z17A 2BMFA 1YQTA 4KQXA 4Y0VA 4LZAA 1UMBB 4QYWA 3ET4A 1P2VA 2QSJA 2PUGA 3PGLA 4R81A 1ACLA 2J5XA 2I03A 2Z0MA 1II0A 3LQKA 4X7RA 4DSOA 3H0KA 3B9RA 4C0KA 3CY6A 3U7RA 2AN3A 1UXOA 3C14C 4MYUA 3F78A 5HZMA 4CM7A 1TUEA 2MYPA 2GEFA 1N3LA 1KJNA 2P7IA 2QRUA 1N9ZA 4LE1A 4YRPA 2IW3A 1HRKA 1IN6A 4MWBA 4HATA 4BNWA 3SWWA 4J94A 1N5LA 3K35A 4MUFA 2QJFA 3QVLA 1A9YA 2Q4OA 4DDWA 5B7NA 1ICEA 2P2DA 4C0JA 4D99A 4DJFC 4FJ2A 1UT6A 3LUBA 5ALLA 3RRYA 5P8WA 2NO6A 4Q9HA 1GKLA 1NUPA 2BKLA 2F17A 4OHWA 3L4JA 2EL7A 2XXBA 1T5BA 5HX7A 4DV3B 5HZGA 3ZH9B 3U5TA 3WOHA 4ZP1A 3PQ6A 1QTRA 4H31A 4J7UA 3TNFA 3KR9A 1KJWA 2JIQA 3K30A 1N6PA 4JYAB 3AI3A 4XTRA 3UOWA 2AZXA 4KTTE 3GLGB 1DQPA 1SUDA 2VHTA 2I6UA 1UKZA 4F1JA 2D6FA 3SKYA 3HCFA 2R0QC 2EFYA 2J6IA 5BORA 1OGIA 3L4BA 4QJIA 2Q1SA 5C8DA 3L7NA 3MB5A 5JO9A 4D0GA 3AK4A 3HM2A 3VC1A 4M1SA 2K2QB 4INAA 4KQGA 3DMNA 1TVKA 1P61B 5COQA 5EA2A 3ER6A 1PT6A 5L3SB 4IWYA 1UWVA 3UBTA 1JG4A 3L7LA 4MB0A 2B61A 2I8CA 1WXQA 4KL8S 3ZX4A 1ZC4A 4BO4A 3RVJA 2UYYA 3K05A 3STVA 2H5EA 2MYUA 4WXYB 4Z8XA 4EUSA 1XR3A 2AYXA 2LR0A 2BEJA 4RY8A 5GPBA 4DCPA 1KFEB 3UT0A 2E4YA 2BKUA 2F67A 4QPPA 1EPUA 4LNUA 2ISQA 3VKFA 3WP0A 1PNVA 1U0OC 3UAOA 1VPEA 1V3QE 4OFBA 4EY4A 4OK5A 4PW0A 1ADFA 1M1XB 3HDHA 1VKOA 1CY7A 2OCLA 3IQFA 3ZOZA 2WT9A 1Z5VA 4WTOA 3O2JA 2HLPA 1VCMA 3W2HA 4F86A 4OV6B 1HYGA 1XOIA 5CFRA 1DI0A 5ADWA 2HQSA 4AT1A 4YMLA 4Q3LA 1YR1A 2WHXA 1IK4A 3KT3A 2IHNA 1DCFA 2WFLB 3FBWA 2ERYA 3FUXA 3UJCA 3AUKA 2R8RA 2VDWB 3KBBA 6ABPA 4AKIA 2UDPA 3KAQA 2QTHA 3D6MA 5A03A 1Y9JA 3LPCA 4MQLA 5MFPA 2QGFA 2HRCA 4GYYA 1MA0A 5HF5A 3UMVA 1V3UA 5EERA 3ICQB 1YJQA 2WDPA 4QPJC 1NJ2A 1C1XB 2X2FA 3ULKA 4JAVC 4OJMX 2AQKA 5REQB 3VBEA 2PA3A 2RK6A 5CVTA 2HA2A 3H2GA 4BCBA 4ZI7A 1Y9ZA 5JHGB 1GOTA 3IE1A 3NFYA 1NVMB 1NKTA 3FPGA 3HA2A 2CHFA 3MJTA 2A14A 4NEHB 4JWTA 4WNCA 5JD4A 3AVXA 4ZEWA 4CMEA 1VA4A 3DTVD 4YMGA 2WG1A 2O1SA 4QWWA 1T8PA 4HPXB 4QHYA 5AW9A 4GLOA 5HFJA 3VMMA 4C2BA 5ILQA 5L7TA 1SA0A 3E27A 5KPJA 1D03A 2XA9A 3HPRA 3QV1A 2O50A 1AVTA 2PBLA 4G84A 5KNCH 3ISVA 2HYIC 1WXDA 1UBKS 1UBSB 1XLTC 3MT8A 5L9AA 2PJDA 1JPUA 1ZOLA 4KR6A 3BXOA 1WCV1 1DBRA 2XB9A 4AX4A 6LDHA 4RA9B 2W2KA 2FWJA 4NCIA 2GXUA 2HREA 3ID6C 1TECE 2XDAA 3LJKA 1VKJA 1DIRA 1ZKDA 3W04A 2XADA 4MTCA 2C8JA 3LPDA 1QJ4A 4I4IA 1GQYA 1RZRD 3KVOA 1E66A 4EKYA 1G42A 1K27A 2CK3D 1K63A 4OY3A 2Z08A 5F1KA 3H1PA 4IZ6A 5JAZA 4DLNA 1U0TA 4KFCA 2P1DA 3MB8A 1XTQA 1IQ0A 2YINC 2ZSDA 3QUQA 4W1RA 1UJCA 5KS2A 1HT3A 2VXOA 1UFKA 2QU8A 3EA4A 3HR4A 1XI2A 4LJYA 4PYMA 4D9GA 2HIHA 4M9XA 3AC0A 4R8MA 5KJ6A 2HSJA 3BTOA 4ZANA 3E3LA 3A6JA 2CDAA 2IVZA 1ZXXA 1KWKA 2BH2A 4PXAA 1L5MA 2ZXUA 1RLTA 5ARCA 1ZIPA 5CH8A 4LSWA 2YY6A 5KTPA 1OIWA 2FWMX 4OFZA 2O14A 2GD0A 3L05A 4LHXA 2GTIA 1L1QA 2YFQA 4MQBA 4EVQA 1DV1A 2BONA 2FZKA 3AZPA 3X1JA 2XZOA 3E84A 3ZU2A 4EYKA 3WISA 8ADHA 2Q99A 1FTWA 4EX6A 1YCGA 3JZAA 3OWOA 5I6DA 3ODGA 4X5OA 2J7PD 4C4OA 3WZMA 1ZNYA 4JJ7A 2NADA 1RRFA 5B5SA 5F2EA 1NXQA 5LIPA 4TV8A 5EC8A 1JSRA 3AV3A 2BEVA 5JE8A 5KYKA 1VI5A 4AJJA 2UYCA 1KK0A 4L5AA 1ORTA 1XEXB 2RH4A 4GM0A 3LL4A 2ZSHA 3KDAA 3QX9A 3VR3A 1W1UA 4B2PA 4TTAA 2F3PA 1W4RA 5ICGA 4EF6A 2F1IA 1TQ6A 4MIYA 3QTLA 3EIXA 5JI2E 4OXRA 2BFBA 1RYYA 2NLOA 1FFXA 2VYCA 4QU0A 1LZKA 3UFXA 3GLHA 1B16A 3KB2A 4XWYA 1IEQA 4ZQFA 4BWYA 1FBTA 4IGIA 2C4UA 4IS2A 1CS0B 4MHSA 3FTEA 3N2EA 2GEDA 2J0UB 1EWKA 5E8JA 2XF2A 2LWIA 2PNJA 3RRZA 1WB5A 2VT3A 3LQYA 4GEGA 3JAKB 4B3SB 5KWSA 3FOZA 4J1SA 5TARA 5M7EA 2XUKA 1E79D 2HMVA 1J2RA 4GS5A 4NHEA 4KW7A 3UB4A 4ECAA 3DEAA 2EZUA 3M4YA 3HTXA 3UNXA 5E6UA 2DUNA 2R84A 3WGOA 5IT9A 3MRXA 3DKRA 4F06A 4LDRA 2O23A 2JAQA 2IYYA 2RJOA 1D9ZA 2JGRA 1YAHA 1RWQA 2ZIFA 2IY7A 3LGSA 4P31A 5BRNA 4L51A 4LSMA 4D8XA 1IQRA 1K8YB 2PQMA 4DGQA 4EYOA 3QX3A 4I4NA 3HDTA 1D2CA 2DFKB 2GOYA 2V65A 2QRLA 3L6EA 3R7FA 1U02A 3F5FA 1TJ4A 1GV1A 2CGEA 2Z5FA 4N01A 4BMNA 2OV8A 4EKDA 2G9RA 3Q11A 2G36A 2G5PA 3AF4A 3OLZA 3W78A 4DG8A 1XAJA 1PLLA 4ZOBA 2VPPA 2B1JA 3T9AA 1KFBB 1YR8A 4S12A 2VRCA 1AK9A 3IA2A 1T6NA 2JIPA 1FUIA 3QVWA 4NEQA 3VHRA 1JVSA 4AM8A 5GM1A 3BMCB 1Z3IX 1G8FA 3AP3A 3SZMA 3EZFA 3S8MA 4EZIA 5EJ9A 1XDSA 1YBHA 1JFFB 3D6NB 1EG2A 4R9NA 1M5UA 1U0LA 2JPDA 2VZ8A 2ET6A 1P33A 2OGTA 2GM3A 1N3YA 1P6XA 3N7TA 3OSUA 3I6ZA 4Y18A 3ZXYA 5KQLA 1WOYA 3R3JA 3AEZA 4F5EA 2C7PA 1UBLS 1SUCA 2H57A 3VVBA 2FPKA 4B75A 4CDRA 1V5IA 1WMSA 1XRSB 3CB4A 2X2EA 3C3KA 4JBNA 3KQYA 3DUFA 2WKPA 2WIBA 4H4DA 2XE7A 1BZYA 4ZD6A 1CIVA 1WZCA 2XNDA 3TPCA 1SUIA 3CRMA 4IRMA 5EIXA 1DC8A 2QL6A 3M81A 3S40A 3BBPA 3K0CA 3KSDO 9MHTA 4MVXA 5FOSA 2R1VB 3KC2A 1T91A 3E8SA 2XMPA 5AWFC 3JAMA 1ZM3A 2ZAMA 3KLOA 4M49A 2GHQA 4DR2B 1ZM4A 1KFJB 3EGVA 1W8IA 4XFKA 3PFHA 4AL4A 2DSTA 2G63A 1ZGZA 4V0ME 4A15A 2R79A 1SJ9A 4AW9A 1GRQA 1EBBA 2FPWA 1AUQA 3R8XA 3O2QB 5EZSA 2Q9UA 4I5GA 4RKWA 4C6TB 4H18A 4DTIA 2G28A 1VM6A 1Q7CA 2QX6A 1J0AA 1EE1A 1RKUA 3S55A 1VGQA 3QKUA 3OC0A 2NUBA 4ID9A 2PPLA 3C4JA 4ZTUB 1G5HA 2YWGA 1FVFA 4FOOA 2PZFA 1USGA 1VKHA 2FSFA 2O05A 4OQEA 1SPXA 4RAOA 3GVXA 3K9CA 3UC9A 2LGJA 3PNSA 2G76A 3KYIB 3A8TA 1T1JA 4KQJA 3X1DA 4J4HA 4ALMA 1VKZA 4F3KA 2DLDA 4KIWA 2XDQA 3GP3A 2WZBA 4G0OA 2BFMA 3AY3A 3AQIA 1LSSA 1XD9A 2ORWA 2QLNA 4OGFA 4U7FA 3RIGA 4RK7A 1E2NA 3FPBA 4GXQA 4G5YA 1PGNA 3ZUPA 2WUFA 1ESMA 1QGUB 3EODA 4MAFA 2E89A 3G7UA 1JVNA 3TDNA 3WHLA 1ANKA 3QELA 1W29A 4QNMA 3RJZA 3ZE0B 5JYBA 4YI3A 4FFDA 2ZBDA 4M8NE 5IZCA 1GA1A 2DPHA 5KTMA 2FLWA 3L8DA 4JCCA 3S8EA 2W0SA 2WYVA 1WSWA 1HZZA 2XTMA 2QE7D 1YNSA 3BFPA 4CIWA 1PZFA 3T5BA 3SR0A 4D8VA 4DCSA 3S5UA 3L7JA 3AETB 4XD7A 1TKAA 4IZOA 1ISSA 3T0FA 4L28A 5JSUA 2CLOB 3WZLA 1Y6FA 1RM4A 4CFZA 2QZZA 5K8TA 3TVYA 1QX4A 5K6TA 3MTDA 5E7QA 5CBKA 1E2BA 2FN8A 3K92A 4JP8A 3MXOA 4IV8A 4YEDA 2DCUA 1JEJA 2GSDA 2PHZA 1OROA 4NXMB 3B1ZA 1WNFA 1CVLA 1I9GA 3B1XA 1FS5A 1TIBA 3L6CA 3LZDA 1FNMA 1XD2A 3NH6A 4IG4A 1QHHB 1ZK2A 4KAAA 1GZ4A 2JIDA 1QH0A 2JGJA 3LKDA 3KB6A 1PSZA 3PR2B 3WLOA 4O4HA 4DJDC 2BGTA 4V02A 2IV3A 2G88A 1FDSA 3W3ZB 5AUQA 2QS9A 1MHPA 1ZM9A 3K0FA 3PKJA 4B7XA 4RA6A 5CB4B 1L0BA 3GLQA 1NVDA 1QPZA 1K3FA 2WTAA 1TAUA 4Q4HA 2ZAGA 1BMFD 3VPSA 3X1ZA 3ZV3A 4PVCA 4ZTBA 1D0IA 2OCAA 5F7JA 3K9WA 3TLYA 3QSYA 2CCJA 1K6XA 3A4YA 2MOKA 1FJ2A 3PC4A 4TN5A 1VP3A 3DYIA 3ZI0A 2VAVA 5EWMB 2IYRA 3D6AA 3FNGA 3X1WA 3QK7A 1L7RA 1M2FA 2GPAA 1HTBA 5HZKA 1EFVA 4KO8A 2FOLA 4RGQA 3VGPA 1H0KA 3VDXA 3FROA 1KZGB 2CKDA 1LD3A 2JRCA 4HAXA 1LA2A 3UKJA 3WWCA 2J41A 2WUWE 4YMHA 1E1NA 1E2LA 1RLIA 3H42B 1N6OA 1UC9A 4BNXA 3H5VA 4QYTA 5HUQA 4K8OA 3Q85A 3ZD9A 2GFQA 1SRRA 3QVJA 3USCS 2R5FA 5K8IA 2GKGA 1I2CA 1HDIA 1O03A 3C5WP 5KU1A 2UYOA 1MQ9A 3TOXA 5ABPA 4Z4HA 3H6KA 1O8CA 2B94A 3G0CA 1WV0A 2C29D 1SEPA 2X9QA 4X45A 5HCUA 3T8YA 4YIHA 5K8UA 1T1IA 1UWCA 4I55A 4ZRDA 1PGJA 1YB4A 2WTBA 1RABA 1LBHA 4M7PA 4R3NA 2H11A 2R00C 3LQ2A 3P9SA 4PG4A 2QXYA 4B3IA 3U44B 3QU9A 4G0QA 1Z4NA 4DLTA 4JR1A 1YR2A 1WUKS 2IV2X 4V1CB 5LQAA 4GI2A 2P8JA 3B5IA 3MJVA 1Z6YA 3OUUA 2WW8A 1WETA 3L46A 4RDIA 3I34X 2QRVA 4N7RA 3QA9A 3THWA 4RVDA 3J7AC 3G9TA 4HOYA 5CUQA 3E9MA 4L85A 3I9MA 3FTDA 3H2YA 3N87A 3CZQA 1U1DA 5B53A 4OK3A 3DVLA 4JMLA 5IKEA 1M8FA 1KF0A 4C6RA 5JZ9A 3PFIA 3D7KA 3EW9A 3BF8A 2POCA 4WBNB 3QKRA 2E3JA 3VC2A 4DWVA 4XWWA 2P4SA 3ROZA 3DKPA 4G4JA 4AURA 1KU6A 3F9RA 2A6PA 4CM9A 1VKNA 2GCOA 4DIMA 2P9TA 4Z0HO 5FBZA 1HFWA 2GYVA 3H5OA 3PGXA 3PZBA 4NJEA 4TLBA 1P80A 2A5FA 3MQ2A 4AP9A 1ODCA 3WWZA 4NFSA 4F5ZA 1IB0A 2P7HA 3GVHA 4W5QA 3RT9A 5DP1A 3KT6A 2NSDA 1BOFA 1IY2A 1V7CA 2ZRBA 4RCVA 3KSZO 4GPIB 3E7DA 3N0VA 5K0ZA 2ZRGA 3GFFA 3GYGA 3MRTA 4WESA 4BUJA 5HKOA 5L4LA 2HJVA 3PKIA 4QKQA 3CVWA 4WLOA 2PANA 2YH2A 2Q3BA 2OHVA 3PCTA 2QTWB 3RHZA 2EZTA 3QX7A 4G0MA 1V7PC 3EXFB 4HGYA 3VSDA 2P9ZA 1GUFA 6PFKA 1L5RA 1E9FA 1Z2OX 2A9VA 4WCFA 1SN7A 1UJ5A 3PJEA 1AQNA 3OI7A 4AP6A 2YJ5A 2P0EA 3JQ6A 4KQ6A 2QT0A 1MQSA 4V0RA 1SXJA 2RBGA 1MV5A 1SELA 3IOCA 1K8RA 5GONB 4AWAA 2JHFA 3KJXA 1P9OA 5D51S 5HRAA 4MUNA 1D2AA 4KBGA 5B1HA 2W6IA 2GEJA 1U90A 1Y9EA 5AHXA 3OPYI 2ZPUA 1E1RD 4I08A 1JQKA 4WFIA 3MAGA 2XT9A 3Q6IA 3NGMA 4DCTA 4YT5A 3NWJA 4TXHA 3LH5A 4CM5A 4CF3A 1QOQB 2WFAA 2ZJOA 4EG3A 1P77A 2F90A 2QLBA 3EQ6A 3OLXA 2JLZA 3JVEA 1N7HA 3KZKA 1P75A 2EGHA 1OZFA 2O0HA 3VTKA 1WNTA 4BP8A 2QG9A 1Y4ZA 3B2NA 4ENWA 2V7XA 3U39A 3EG9B 1BEEA 1MBZA 4ILKA 5IBCA 3NEPX 4IFEA 1SM4A 2ZBUA 4MMYB 4DS3A 4MGIR 4N39A 3ZQ4A 3H9CA 2I7CA 3JQGA 3QMVA 4DR3B 2FFJA 3KFVA 2OORA 2O8DA 2YXEA 2AK2A 5FOWA 3JXEA 5DTRA 1OBOA 2UYGA 4OHFA 4J3JA 3C1TA 5E9QA 4E14A 4UFPA 4EJSB 1SFRA 1KGSA 4BNZA 2YV1A 1ZEMA 3EAFA 4LRYA 4GRDA 3IR7A 4IIGA 1CJKC 5DT2A 2CFIA 5IF9A 2FEAA 3BWBA 3PITA 3RLFA 2R1TB 1AIPA 3A06A 1F2TA 3JATB 4K0KB 1TQDA 1U0JA 4QFBA 1XAIA 1HQYE 1NW7A 2VP5A 1L5VA 3H2KA 5HKLA 2Z3WA 3RVBA 1PLJA 1WUJS 3F8TA 4N6OA 3FSGD 3ZK9A 4ZVUA 2JIMA 1YFLA 4RS3A 3TMYA 3WQSB 4PYKA 1Q11A 3NKLA 2KI5A 2ZAOA 1IG3A 4URYR 2OBMA 1FDOA 3OQHA 4Y67A 4AI6A 5GM2A 2J1LA 5G02A 2GPSA 3V7NA 3GBPA 5D1NA 4LTDA 2GJAA 3V4SA 2BGMA 1C50A 5LA6A 3A2MA 4BNKA 2DERA 1T9HA 2O3QA 3B1WA 3PVSA 2PFKA 3U7QB 5D01A 1NZDA 1ISFA 2WE8A 2EQAA 2WWTA 1M1NB 3OT1B 2GZRA 3E15A 3FVQA 5A71A 1PSWA 2FDCA 2YN0A 1UQRA 3Q4GA 1KNQA 2LRHA 5K51A 4RXUA 3Q2OA 4WI1A 4L15A 4EQ6B 3BJEA 3PX3A 2FPPB 4GPTA 1TJYA 3GNTA 1M1YA 3BREA 5ILOA 4Z5XA 2WD9A 1NT2A 2NNLD 4CKCB 4JKIA 3TDKA 3UVEA 1K86A 2XGGA 1T36B 1GNPA 3CM0A 2QX9A 4HQ6A 4MKHA 7ADHA 5JEEA 1M2WA 5GJVC 4MDFA 1AKRA 3TLEA 4AJIA 3PBKA 1ZZGA 5H0IA 2WAYA 3FLAA 3JYLA 3QXXA 4QQ8A 2Z2KA 2WB4A 1UDXA 4GR9A 2V8BA 3WRXC 2VVTA 5C5EA 4NYIR 2L2QA 4R8SA 1ZVJA 1QH8B 1IH8A 1Q91A 1J5PA 2C3YA 3WP1B 3HDYA 2VPQA 3T5AA 1R4NA 4W82A 1NJFA 1OYOA 4PU0A 1LW6E 3OIYA 5CJJA 4CCYB 2CT8A 5AVOA 3C5VA 4TM7A 5T64A 4QECA 1CNFA 3EQZA 3PHLA 1PE0A 2A78A 3PPXA 4FFMA 4EYGA 1NBWB 1FA9A 1AU9A 4QFCA 3ELDA 4Y8VA 3ZE6A 3IOEA 1V16A 2Z09A 2ZANA 4DMMA 4DSUA 3T61A 1S9HA 3DW3X 4KE7A 2JBAA 1JQDA 4QQKA 4L27A 3PUJA 2UZ4A 2QRPA 4Q48A 1A9RA 2CMKA 4ZGBA 1B1AA 2P75A 3QEOA 4J4BA 5E2IA 4NU8X 4TYNA 1PGPA 3VR6A 1KSFX 1D6NA 1OOEA 3FNQA 3R41A 5T67A 2E48A 2WZDA 3G2PA 3K5IA 4MAMA 5B1DA 4EG7A 3N7AA 3HV0A 5CDUA 1E61A 3NRCA 3ZKWA 3RT7A 3JU3A 4Q7QA 3W77A 1U2QA 2EYQA 4C7KA 2J3MA 1AH2A 1WY5A 5C81A 1W36C 5CR9A 3B9BA 5KYYA 2G71A 5G41A 2OXTA 1W96A 1XALA 4MS4A 1M6VB 3OE7D 1KE1A 1VG8A 1F8YA 5DSZA 3LXRA 1BX0A 1R9NA 1NTRA 2VP0A 4IH4A 3R8FA 1ODLA 4Q19A 3T7CA 3ZQ6A 3RK1A 5IWCA 2L69A 3RTAA 4P3KA 3I9JA 4HPWA 4JLDA 1DJLA 4IYJA 1UH5A 2IX9A 4MWDA 3ENNA 4DLRA 1N32B 3BS4A 3T35A 3CSUA 1W2GA 3HN6A 1AS0A 2QQFA 3MYRA 2UYHA 2H2AA 3E2MA 4PZLA 4JP2A 5ALJA 2P35A 3NC4A 4ZMRA 1LWNA 2GBLA 5TNXA 1Q0TA 1JHUA 4YRIA 5EEGA 4PLPA 4ALLA 5D3MA 4B3RB 1KJIA 1OXVA 4G5SA 1BJKA 2XZTA 2V7GA 3B6JA 3FUCA 3H2HA 4HYTA 5CNKA 3ABSB 4BJ5A 5CRIA 3SF0A 4FPXA 3PFGA 1PBNA 2ZJ5A 3RVDA 3GIWA 1U5CA 2QRNA 1FTSA 1ORVA 3EQ2A 3LBAA 1Y8AA 3RFXA 3RAFC 3TRKA 3M6LA 3O8BA 2ZTMA 3I04A 5F73A 4C4ZA 4QYSA 5HM8A 2WF5A 2XAUA 4B6FA 1E2FA 3W1WA 1QC5B 4GP7A 4BV9A 4M0CA 2IX3A 4BC1A 1KYZA 3A4NA 3NTVA 1T6BY 1CFJA 2XGJA 3EY9A 2G80A 2G77B 2GEVA 4I5EA 3UYKA 2W37A 2X4LA 4EGJA 1VE1A 4PX2A 4EMUA 2J0SA 4NEGA 1JA1A 4BS9A 1RHUA 1P1JA 2PGOA 2IT1A 3B6EA 3UYLA 1N2CA 1T9DA 1G64A 1OXBB 2AT1A 1VE7A 2QI9F 3LL7A 1BS1A 4RZSA 4L8WB 2C5EA 4OUDB 1OPXA 4U02A 2FSHA 5ANRB 4BVBA 4RTRA 5MN4A 3NOXA 2P77A 3AI2A 4E11A 3EHDA 2I65A 3FNHA 1O7JA 2EKPA 5IXJA 1OKKD 3NM5A 1UBNA 2JJ1D 1MENA 2VK8A 3DM5A 4ZVKA 1HLPA 1CZUA 2C54A 3L7YA 4MA5A 4ENRA 1FRZA 1ZEJA 4TS4A 4JUDX 1IXYA 5KOHB 5C7LO 1DL5A 3HKCA 3TI9A 1B14A 3DLCA 4G09A 4QFMA 4A7PA 4EY7A 1JBQA 4BLTA 2VJQA 1MZPA 4FWBA 3WOVA 4O2LA 3KOZA 1Z6PA 4B3JA 2ZI9A 2RHMA 2EX4A 2IHYA 3OU6A 5EP1A 2YHUA 3ROKA 4L8YA 4JVMA 5AD1A 1NF2A 1CHNA 1SKQA 1P9WA 2MSCB 2YNMA 1X80A 5IDYA 3IEPA 4F4HA 2XT6A 5E7JA 4YJ2A 3ENQA 1RJEA 3TQSA 3B20A 2XVMA 1E6KA 1D6MA 3N2GB 3U4DA 1L4YA 4BKUA 3GNLA 4BNHA 2V4ZA 3CFYA 5LMUB 1HT0A 2WKSA 2F4NA 3DDUA 5BUZA 4TL7A 2AC4A 4G01B 4TQ9A 5FF9A 3R9IA 4Z4GA 1MRNA 1FJGB 1JQBA 4H1TA 4HVTA 4YQZA 1I3KA 3AM4A 3TTXA 1JILA 5G0UA 3LXMA 3BDAA 5C1IA 2IS6A 2CHGA 4QUJA 4CEHB 4M88A 3QIVA 2KPOA 1XP5A 3ITEA 4G37A 1Z39A 2EX1A 5CG2A 1TYBE 4IFTA 4UVIA 1U5BB 4WZBB 2QVLA 4CDMA 1PVDA 2VHEA 2XIQA 3Q0IA 1CD5A 2Z04A 4H3HB 2GN1A 3CR8A 5IUKC 1XZKA 2AV6A 3WO0A 4DN6A 1CR2A 3HFJA 4R01A 1WXFA 4DMGA 3PNQA 5BWMA 1NOJA 2IBSA 2RGAA 3ROPA 1NJGA 1GV0A 5AKJA 4MI6A 2PYDA 3EIFA 2EZ8A 3BQMB 2ZZMA 1JA0A 2WMDA 1I32A 1TQ4A 5DYWA 1BXRB 3O8QB 5H4HA 4GZMA 2B2NA 1EDZA 1GUDA 3OICA 3DOEA 3OAAA 2VI5A 2CNKA 2X6QA 1GSIA 2J46A 5CA0A 1Z8HA 4C29A 2C2GA 4ZAGA 4RJTA 4O2AF 1W88A 1ZN9A 3AU9A 2CHVA 3E4CA 3HCEA 2WKRA 4ZXPA 3GJ0A 3LIPA 3DO5A 2V6FA 4GX2A 1XJ0A 5ADHA 2HF7A 2LP4Y 5CT5A 2PRYA 2XCSB 3BVPA 2X8JB 2QT9A 4A8TA 4G56A 5EJ6A 1D4OA 3LKBA 2YDYA 2CLHB 5ALPA 5KSOA 3OQNA 13PKA 2EFGA 4KO2S 2GAOA 2PM8A 3AW9A 2NYAA 3C97A 1SUPA 2WABA 2O2SA 3Q2IA 2JNWA 5I48A 1H4VB 2MWMA 3L04A 1N2EA 4B0OA 1GJRA 3KUXA 3EARA 3EVFA 3LUAA 2WU3A 4Q9LA 3H4VA 1KDPA 1YK1A 1W2WB 1C9YA 3K4QA 3NHLA 3AGPA 2WJYA 3Q3HA 4ZC8A 2A1TR 3OOJA 3REFA 2AFHB 5AJZA 4L5JA 4Y3UA 4P6VF 5FP0A 4QU9A 2C9DA 3ZJ4A 2AYZA 4MVJA 4PBTA 4E21A 4DGSA 3N2YA 5AHOA 5D6OA 3SKXA 2G4VA 3CZMA 3TRIA 3E1KA 1ZGHA 1U2DC 1OXMA 3GLVA 2KE5A 1CUXA 4WKPA 4MW2A 5DNAA 4KPFC 4DIUA 2I2FA 2B82A 3LWNA 1UPXA 2NM0A 5CX1B 4R1LA 2JJ2A 1A7KA 3NJRA 5L3QA 1CZKA 2F3RA 3QPDA 3HS3A 5T57A 4Z3OA 2C9OA 2JDID 1ADGA 5EESA 5FI1B 3G13A 1HYHA 5GP1A 2RKWA 3PUHA 1KY2A 2PX3A 4WOPA 5FWAA 2ZVJA 3F3YA 10MHA 4CMKA 4QDXA 3L1KA 4X71A 1TEZA 4HDRA 1RWOA 3REOA 1SURA 1Z37A 2OXRA 4QUBA 4WZBE 3R7AA 3E82A 1W6RA 3RS7A 3NHPA 4GMFA 3PQCA 4KB5A 5CDYA 3K4HA 1EUYA 4XWKA 3ZWPA 4O29A 2LVBA 5H02A 2FMTA 1L7DA 1RWXA 4NECA 3ANTA 4DIOA 5AVQA 4U2GA 2FSGA 2QJRA 1PIWA 1DCTA 2VJAA 3WLNA 4NNJA 4CDGA 3GN2A 4K9NA 5AI4A 5ENZA 5J5VA 4HZGA 2HTEA 4MQ4A 4EUNA 2ZRCA 4POOA 3R5JA 4HAVA 3ZV7A 3SC6A 2RGRA 4XYEA 1GYRA 5LWQA 2F1HA 4C0WA 2RHWA 4HGPA 3A9SA 3E9EA 1U1IA 3ZGXA 3SS9X 4BNIA 3BXEA 3QKIA 3EA0A 3GDGA 4L3OA 2XUOA 4K9OA 3AJRA 4WY8A 5JY6A 2BP7A 3I52A 3A70A 5EI5A 4OGGA 1NNLA 3X1YA 1V3VA 3RD5A 2XVZA 4R2HA 1VG9B 3V33A 2CD7A 4OP3A 4C5CA 4EFLA 2EJTA 2HCTA 3OLWA 2WM9B 3VH1A 4OB8A 1ZK0A 2C8KA 1B42A 4LF7B 3DMFA 4GKKB 1SR8A 2X8WA 1B26A 3D1VA 1P5ZB 3MJRA 3FYHA 4DHWA 2HDOA 1POWA 2ZEJA 4PHCA 2A8YA 5A1TA 2GKSA 4M53A 4MCJA 2BFAA 2I7TA 3TQQA 1Q44A 3EGEA 3F6EX 3QBEA 4HMPA 1B8UA 1GZHB 2AFHE 2Q5IA 5E9WA 3NHKA 2C9BA 2FKNA 2Q5FA 2OO5C 3T6KA 3U81A 4J43A 1B15A 3WIOA 3VU9A 2QZSA 3VV2A 3UJDA 1DJPA 5LM3A 3RUAA 1D8TA 2HA7A 1PZEA 1ZCJA 2ZTSA 3GH3A 5LQDA 3U4HA 4PFSA 3ZC3A 4CQMB 1H1DA 3R3ZA 1YKGA 3WKDA 1SVMA 3ZOKA 5EAIA 4AG3A 3PXEA 2VYFA 1UBEA 3E81A 3VHXA 4D43A 5LD2B 3GUCA 4DBLE 5KREA 2H18A 3O1LA 1KDZA 1QQ5A 1NPYA 1I3LA 4JJAA 2ZBFA 1SOUA 2O3JA 2OGZA 3LK6A 4FXOA 2H08A 5FNVB 2Q3FA 5KSPA 4HWTA 1B1CA 1YULA 3VTFA 2QVYX 3EPPA 3QE2A 5ETJA 1EK5A 4I81A 3E61A 5GGXA 1DTSA 1J5EB 4KYUA 3S28A 4UHKA 3LOQA 1NUQA 5ISMA 2AWNA 1L5GB 4FU0A 3TGLA 4RGVA 2A30A 3S29A 3BMNB 4BVHA 5HP4A 1SBHA 3F6BX 3WDLA 1V26A 3DA8A 1R5OA 1KI6B 4N3CA 5AKHA 2OD2A 3TD2A 4R1MA 4EENA 3CSSA 2A1TS 3DO6A 2XQFA 3IOMA 4LTNA 5D8DA 2NO1A 1NX6A 1W4LA 2NUAB 3I6QA 2ZATA 5EP4A 3RUPA 1NRWA 4I9UA 1TI7A 4PHHA 4UOQA 5TS2A 3WWDA 5D7BA 1XZIA 5A7FA 5KINB 1BOOA 1X19A 2C4HA 3C48A 3BIWA 1CJVC 3L0SA 1FW6A 2IS4A 2HYDA 4DMCA 4DC1A 2P41A 4Y1FA 4KXLA 2YYAA 2NU6A 2G5CA 1NXPA 3LTEA 3AX6A 2VHYA 2ZR0A 1NLFA 3ADOA 1QYCA 2JFPA 3EZ6A 2PU7A 3LAWA 3A0RB 1N8TA 2VDVE 2WWIA 3JAWA 5AW8A 1UKEA 1MEOA 3JQBA 4IMPA 5EOVA 3WGGA 2CJWA 4NV1A 1P2FA 5JAHA 5ALUA 2PR2A 1KQOA 4JCOA 2ROQA 4KQ1A 4CF7A 3DL2A 3HH8A 1KP2A 1RKXA 1WAMA 2HSWA 5B57C 3IVGA 1P0CA 5BY2A 5I4KA 4V0QA 2XVXA 5AW2A 4DR6B 1Z47A 1YDWA 2EERA 3DEKA 1GPMA 4G26A 3V7WA 2YXDA 1NQVA 1QKIA 2GN4A 4LGMA 5IDQA 1R5BA 3HDVA 5HIMA 4JH0A 2RIPA 4HH4A 3TSAA 1BFDA 5LLSA 1F17A 4YXWD 4DREA 1YOBA 3UJNA 3FJYA 5LZ9A 1K7YA 1VRVA 5K01A 4D42A 2H5IA