2WKSA

Structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Synthesis and biological evaluation of new nanomolar competitive inhibitors of Helicobacter pylori type II dehydroquinase. Structural details of the role of the aromatic moieties with essential residues.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 57
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2wksA00
1GQOA 3N8NA 4CIVA 2Y76A 1GTZA 2XB8A 4KIWA 1GU0A 3N86A 4KI7A 4B6RA 4CKXA 1UQRA 2XB9A 2XDAA 3N76A 5B6PA 2WKSA 3LWZA 4CIWA 4B6QA 3N8KA 4CL0A 4B6PA 2XD9A 4CKWA 2BT4A 4L8LA 1H0RA 4ZC1A 2C4WA 4CIXA 4KIJA 3KIPA 4B6OA 2DHQA 3N87A 2C57A 4B6SA 4CIYA 2Y77A 4KIUA 4RHCA 5WRFA 4CKWB 2UYGA 4V0SA 1H05A 1V1JA 1GU1A 4RC9A 3U80A 2Y71A 2C4VA 1H0SA 4CKZA 2CJFA 1D0IA 3N7AA 4CKYA 3N59A 1J2YA
chains in the Genus database with same CATH superfamily
2HR1A 1B74A 1MC8A 3QFCA 1DCFA 2BF7A 4EAQA 1XZMA 1YE8A 1P1KA 3KAKA 3E7XA 3QXSA 4MYRA 4NF2A 2JVJA 4ZAVA 2LVBA 4P93A 5GM1A 3VHXA 3ZVLA 2Z98A 2KBFA 3GCDA 3KJGA 4LJYA 5JJCA 1TO1E 2YBDA 4G37A 2F1OA 3NORA 4TYPA 2V7XA 4B84A 5K0EA 3KFLA 3LFHA 4E13A 4LI3X 1CZLA 3GBPA 2IHKA 5DSTA 5DYWA 2GO7A 5C7OO 5LYJF 3DZ8A 3U60B 1IN6A 3G17A 1S2NA 4DABA 4AS2A 1QLWA 4A15A 2HIMA 2AWOA 1XTVA 3VISA 4RIHA 3LH5A 5CCDA 2C92A 3FKQA 4F4IA 4YC7A 4JLNA 2R87A 2ZVJA 1JZSA 2P67A 4U7PB 2K87A 3RS0A 3WGUA 2QMOA 4YIHA 1X7GA 3P97A 1T43A 1FEZA 2X0IA 4KQCA 3UMSA 4BBAA 4L75A 3UANA 3P4UA 1D07A 3BN3A 2KE5A 1U0TA 2J9YB 3OZTA 4LWZA 4ZGGA 1KI6B 1Q2UA 2EJVA 3DE3X 4R3WA 3JSAA 3DFKA 1WMSA 3CTPA 4J9UE 4NU0A 5EJMA 1IL0A 4G5HA 3EUWA 4R2XA 1DSSG 3EBOA 3VYUB 2JIOA 2PUGA 2FPIB 3I37X 5J2TA 1POWA 4A2WA 2Q7XA 5JECA 3CZRA 1KI7A 2R5NA 4M83A 3TQRA 2HFKA 5IXJA 2IU3A 3E1GA 1F0YA 3ITNA 4NDAA 5G0UA 3PLNA 3ZU2A 4HXEB 1OX6A 4RHTA 1LDBA 5K9ZA 1IZ7A 1RCTE 3GGCA 1KVQA 1K3UB 3CH7A 3C6MA 2G0NA 2QZZA 4LTMA 4R3UC 1RPNA 2QRNA 3FOFC 4Z0HO 4Z99A 1V39A 2Q1WA 3BB1A 4FX5A 3TNDA 5DNYB 4ARCA 2IS1A 9MHTA 1K6JA 4HWOA 4IZ6A 5CT5A 1N9GB 4GI7A 4F5YA 1VL5A 1FFEA 2IYRA 2V7WA 4G1UC 1DAGA 4C03A 1TF2A 2AEFA 2P5TB 2PBFA 3UICA 4RJJA 4YRQA 4F2PA 4PZ9A 4A6PA 1KHHA 2M6RA 3HB5X 4G63A 3OM0A 4P54A 5TV2A 1IN1A 5EKUA 2G4VA 1ORDA 3T3GA 3V2HA 1U1CA 1W25A 1DEHA 1COWA 4BKMA 1QFSA 1KO5A 4RFSA 4PYOA 4PM4A 4I5EA 3GPIA 4JI1B 2ZUTA 1XQVA 3AY0A 3EEYA 5ETJA 3RYIA 4BV9A 4DMCA 1JWLA 2JGLA 3QXJA 4BP8A 3ZBQA 3GEPA 2ZP1A 1OR8A 5CA0A 4H7EA 5HQTA 1LLFA 4B9AA 4BKPA 4B40A 2DETA 4P5EA 3PA8A 4WZAE 3B3QA 4KE7A 3UK6A 2FWIA 5EXPA 4WY2A 3SJZA 3O91A 1QYXA 2WIBA 5TQJA 5JHGB 3Q5GA 2NQ8A 3GN1A 2PH3A 3OTIA 1G5TA 5KX5F 4GGPA 1AQNA 2FPWA 2I67A 2J0SA 5E9JA 2YCLA 3LDUA 5G1OA 1FLDA 1NBWB 1PBTA 4W1SA 1QE0A 2QTFA 3EXAA 4WW0A 4CQMD 2JLRA 1Z28A 4EVQA 2H16A 3ENVA 5I7RA 4WFIA 4AWXA 4P53A 3AP1A 1OW3B 3OIWA 4GC9A 1BW9A 4XFDA 1LXCA 4XDYA 1AV6A 1YS6A 4KLZA 3KZCA 1AQJA 4A1FA 1I3MA 3WB2A 4CMCA 4R0MA 2ZB4A 5C8YF 4W8GA 2CHEA 1NMEA 3GPBA 4MULA 4MQEB 1FFYA 2EU8A 1HRKA 1H93A 1P19A 3GBSA 3RSZA 3F3MA 1IHUA 1EK0A 1M54A 5HIAA 2JG3A 3G85A 3VJRA 5FEUA 5EGNA 4M0KA 1G3IA 5COQA 1DEAA 2EDAA 3KWJA 3PDCA 3ENKA 1QF9A 5JXHA 3B3FA 3WBKA 1MT0A 4ER7A 4PFKA 1NUSA 1X86B 3VH3A 5A3JA 5JEDA 3VAZA 4DCUA 2XYRA 2EL7A 2WQ7A 2NYUA 3FPBA 2C83A 1NF3A 3KKMA 3CUKA 3LY9A 4UEOA 1ZRMA 4DPMA 1OAKA 3WVNA 4H3VA 4QM6A 3AR9A 3CUWA 3ODGA 2HLDA 2VYCA 3TJRA 1TK3A 2C2YA 3FPCA 5A1TA 1KYZA 2YFYA 3VDXA 3G0CA 3KKPA 3I9KA 2QUHA 4DBLC 5E6RA 4KQXA 3SOPA 3WB9A 1X1AA 1U3FA 2YL2A 3KSRA 4EGFA 3UPTA 3L6CA 3INRA 3F6BX 1DVRA 2ZIXB 4OHMA 2IPAB 4KO4S 1E1QD 5CFPA 2JCXA 4LK2A 2PH1A 1XTBA 2DAPA 2ZVQX 4HADA 2LR0A 3MB8A 3PJDA 1YNOA 5ICGA 2CLSA 5KO2A 5JNTA 4HBZA 5GMOA 2WVJA 3JR3A 2BLNA 4QO8A 4BZXA 1X8KA 1TPZA 2Y2UA 2Y9MB 1A50B 2FI1A 2O7SA 3GRUA 4HFMA 2OSVA 1MGOA 2VLBA 2ZDHA 2P2DA 2VIIA 3O3MB 1JHXA 3U1TA 3ONDA 3PXCX 3IP7A 4N5NA 2AE1A 3D6MA 4N5IX 4QYXA 5SZKB 5A5GA 5DSXA 3ZQ6A 3OUUA 4PBRA 2VDNB 1DAHA 2Q07A 4QEDA 3BMNB 2EFEB 2WJ6A 3SYTA 3R9IA 3O1JC 2CF5A 2HCBA 4UUAA 5C4IA 3AF3A 1CNFA 2BZ1A 1GSIA 2GZDA 3NXKA 1FDRA 4FQ8A 4QJ4A 5BPHA 5JYBA 4P58A 4DUZB 1O9BA 1U11A 2Z2XA 1BQ4A 1X19A 3KPUA 4LXHA 5FA6A 4HBGA 3FLAA 1Q7EA 1JS1X 2DE0X 4AF8A 1FUYB 1KP2A 1VGQA 3H0CA 4PPNA 4CU5A 5GM2A 4G84A 4O08A 1NXWA 5CCXA 3PUKA 4BEBA 1FS4A 3MGKA 5EHXA 1L7XA 1T9ZA 1XFDA 1AQ6A 1M2OA 1XDBA 2BCGY 2Z5GA 1K88A 3GVCA 4O4HB 4ABYA 2KW5A 4R1LA 4M7RA 1XYGA 3M9XA 3NX4A 1RI2A 3SIPA 1T1GA 4F1WA 3OCWA 3A4NA 4PLCA 2VO1A 5B1SA 2IXBA 4DNPA 2M6LA 3D3WA 1E92A 1OKKA 2YHAA 3QFSA 1U3WA 4EUFA 4F1KA 2FEKA 2CV1A 3L18A 2PUFA 5JAHA 1X8JA 4AMZA 3ZWXA 2H11A 3ILHA 3VHQA 3MOSA 3Q8WA 3H9GA 4PLVA 4P4SB 4EMBA 2AVNA 2OQVA 3WWPA 4CM4A 4EUNA 4MKZA 3W3ZB 2ACEA 2PYZA 3CZCA 2QJFA 3NHJA 1KE2A 2Q7OE 4WBNA 1HK7A 3RM3A 5LZ4A 2CLDX 2GZHA 1ETHA 5FULA 5LL6P 3HCWA 4GLBA 1D09A 1P2GA 1K27A 3OU2A 4PLPA 4BVLA 3E5RA 4U00A 3RR2A 3K6JA 1A82A 1QNFA 3DBRB 2F1HA 3RJMA 1A9ZA 2HQOA 2Q2VA 3LOQA 1HE2A 5E6UB 3QVUA 4FJ1A 3VKWA 1FRNA 5A7FA 2ZATA 4IGEA 3IUBA 3SM9A 2D7CA 1U7ZA 3K0CA 3S2FA 4I1SA 4XQEA 5BR1A 2VDMB 3IKMB 5HG0A 1JMVA 5KQGA 4ZO6A 2I8CA 3NNNA 4B2IA 3FWYA 3GRKA 2CNWD 3K30A 3SHTA 3NM4A 3TXAA 3VR5H 3A27A 4ZEXA 5LB2A 5CYPA 2QUZA 3KALA 3W90A 2MYTA 5EWMA 2YNMD 3V1KA 5IJXA 1CR6A 1WEKA 4TMVA 4RTSA 1I5EA 4JQCA 1O08A 2IZ0A 2ZJ5A 5IT0A 4J2OA 1C8BA 4ETMA 1FRQA 2CL0X 2F62A 1NW6A 3AEUB 5IVHA 6AT1A 3DZBA 2P4QA 2ERXA 3T7DA 2F4NA 2V54A 5EMJA 4AJPA 3B7WA 2NUTB 1OLXB 3I5UA 5J5CA 3EXHA 4AT1A 3MD9A 3CR3C 4YY3B 3OAAD 1FVFA 2H31A 1LBQA 3BSSA 4QXPA 1YR7A 2DFDA 4LXXA 1PT7A 4U2CA 4B87A 1VSBA 1VYUA 1PN3A 3GK3A 5FD8A 1P6UA 3A1TA 1UC8A 2ZTHA 3TBFA 3BMOA 3LCVB 4B2YA 4H9GA 3RTCA 1A72A 1Y5NA 4D0GA 3CRMA 3P9RA 1JR6A 3ABIA 5HA5A 3VYWA 4BQRA 2PX8A 3LIPA 2ZQZA 3HSYA 1ACMA 2TS1A 3NO4A 5EL0A 5FL7D 1L5YA 1E3IA 4TV8B 5E2AA 4BNUA 4MAMA 3DMPA 4M0EA 4MA0A 1XXHB 2AHOA 5IEJA 3SP1A 4HYEA 1E2EA 3KTOA 5EXEA 2C31A 5K3BA 1HYQA 1RRKA 3VNQA 5AVXA 1BTOA 1SQGA 2AUMA 3TTVA 3KBOA 4NFYA 1X6VA 2AUNA 3A6FA 4PPYA 4W9NA 4MQLA 2FYTA 1RJGA 4S04A 1DAKA 3OQPA 3PHIA 2DP4E 4OQNA 2X7JA 1N32B 3WK4A 1E5VA 4HB3A 5MF6A 1SB9A 3T5MA 2Y0EA 1AK2A 2ZM5A 2H2FA 1ZU4A 1QGOA 2OM6A 1BXKA 5HZKA 1V7ZA 4AWBA 2YZKA 2BMEA 3C16C 4GMXA 1W88A 3EVZA 4AMVA 4BKOA 2YWXA 5LD2C 3FPFA 4IDAA 4NULA 1XVAA 2V1XA 1ZUWA 4DMRA 3QXGA 1GV1A 3ACBA 5BRNA 3V5NA 3ZXXA 3FR8A 4E5VA 4IIEA 1R4MB 3DTVD 4INAA 5D3ZA 5TF4A 3F3SA 2VSFA 3KEQA 2OD9A 4FSHA 1U5AA 3LNCA 3TD9A 1GSAA 3VDMA 3VPCA 1QRUA 1ISJA 4HGPA 1CUCA 1NMZA 3KR1A 3VPXA 2H29A 3Q7QA 3E2IA 1W2HA 3MWKA 4N01A 4NZNA 5HUHA 3UMJA 1GXSB 4MMYB 4LGCA 2OXFA 2PXXA 3V8NA 2PR7A 3JWHA 1TUGA 3EEIA 3K31A 3AUXA 2ZANA 4V38A 2DSTA 3UB4A 3BHNA 2O1XA 4G1VA 1YRAA 2G5PA 3DLCA 3NAMA 2QBYB 1VXOA 3HUTA 3UMBA 1P0IA 1OF1A 2JDID 2UXCB 1XEXB 5ALYA 1DPFA 1YZYA 2HAEA 4EL0A 4YUAA 5DHUA 1Z8NA 3PFIA 3GMTA 2DERA 2EFGA 2GBLA 1DC8A 2YHIA 5M5BA 4X3OA 3VZRA 2WC1A 4C4AA 2F4VB 3EG9A 1P91A 3PUXA 4BO0A 3DKIA 1M10A 1VKOA 3PR1A 2I65A 3RU2A 621PA 2NPOA 2REQA 2V4UA 3M1IA 4E1BA 3C4VA 3CT4A 4YS6A 1CCWA 1TVEA 4JXJA 1P2FA 4FE4A 1JLSA 2IDZA 3N05A 1CE8A 2B94A 2IIVA 1GM5A 2ZSEA 2AQ8A 2I8LA 2NU7A 2DBRA 2QQ0A 3MUOA 3PQFA 4PZ0A 4ZVUA 3WRWA 4YMWA 3WMFA 1TTHA 4U7DA 5K01A 1I3KA 3BQMB 4XWOA 3RVSA 4FGZA 2NZYA 4X6XA 3REQB 1JIXA 1UCFA 2DR3A 1JDBC 2ES4A 3B6JA 2HEIA 3DBOB 3V1UA 1KQ3A 1ECGA 2HDNB 1MA0A 1PG0A 3AVQA 1D3AA 2QRVB 4CKEB 3HG7A 1USWA 3NPAA 1K6IA 4AX4A 5IVIA 1BMTA 4M60A 3ZWOA 5L3SB 4WLFA 3AETA 3WMWA 4K9RA 2XODA 4DLKA 2E4XA 5BR8B 1TO6A 4HQOA 3W79A 5IKPA 5TQ2A 2FSUA 5HF8A 4HH1A 3DW1X 4BN4A 1LF0A 3L7CA 3AVWA 4LJLA 1WP9A 5A2QA 5L45A 2VBIA 4D9BA 3RRZA 3ICOA 3R0IA 2YY7A 3I64A 3ZR4B 4J1TC 2ISSD 1FP6A 1T2FA 2X7HA 4JSYA 3RUDA 4D9CA 1XFAA 3R3WA 2BH9A 3KCNA 4JLKA 5G4LA 3PKZA 2ZIAA 1MB0A 3KSDO 4KVGA 1U02A 3UV6A 5COBA 2VR1A 3PE6A 3IBYA 2YRXA 3H87A 4K46A 1LRJA 2HJSA 3R3ZA 5FOSA 3W78A 4HOYA 4FLEA 2WRZA 2QVXX 3MA0A 3IAM6 1BX3A 3IHLA 4YJHA 1C7EA 3B1VA 2SKEA 4A5SA 2YXDA 2AV6A 4OH1A 3ZJ5A 1WDLA 2YYAA 3FNBA 3WKEA 1VBNA 1SU7A 3DDNA 3GX1A 2GH1A 4IILA 3N6XA 2A7QA 4JLJA 3OPYI 2YRWA 3LP6A 1E7MA 5J4KA 5M3BA 1R8SA 3FMPB 1SU4A 1YK0A 3OFKA 3F7MA 4WWHA 3VI4B 3VR1A 5JSHA 2OSBA 3LLUA 5DO9A 1FDUA 2XWQA 5AMXA 3AVPA 5ITZA 3RPEA 1O89A 2C94A 2OO5C 4EX7A 4MGHA 3DYVA 4XD7D 3L7OA 1T0IA 4OUDB 3NT5A 2X4IA 5EWLB 3M4JA 4JC0A 3S2GA 1QZXA 2H4ZA 2V65A 1MG5A 4FHDA 5TGTA 4OLAA 3EGEA 3MUFA 3PUHA 1KBQA 4Q37A 1T3SA 2GOYA 5CX1B 2QEQA 4HTAA 4CEHA 1NF9A 2GZSA 2QUIA 4HUTA 5A5VA 4JJ7A 4IJKA 3HVKA 2XWJI 4TXHA 3BKXA 5JI3E 4Z4EA 1JIJA 4WFKA 3NDBB 1S7GA 3O75A 4M8KA 2FMFA 5C37A 4CEJB 2PZEA 1GRQA 1NP7A 2AG5A 2JVKA 3DOHA 1A1SA 4Q4HA 4X1KA 1A2OA 3F6PA 2FRVA 4GQBA 3PZRA 4WK4B 1KF0A 3BHMA 1O03A 5TEWA 4AJHA 1MO4A 2FK8A 4OPMA 4D97A 4HRVA 5AVWA 2M1ZA 3ICQB 1A98A 1G4UR 1Y7TA 3JWPA 2UZ1B 4IHQA 2CE7A 3FTCA 4M36A 4LWQA 4UHHA 3ZZMA 4E6EA 3GJ4A 1QP8A 3ND9A 1RC8A 5CHEA 5DBGA 3BHIA 4FIZA 3CVOA 2HCRA 4B1FA 5ITVA 3P45A 4RDIA 1TECE 1Y7IA 4Z7JA 4YMSA 4WCFC 5H9VA 3MFQA 2GZ3A 2PWYA 4G0ZA 1DC6A 3EAFA 3UK0A 5HOEA 1FFGA 3O31A 2IX9A 4Y0VA 1H69A 3HB9A 3RHFA 4EJSB 3C5WP 3G3EA 2OP0A 2ZRLA 4O4JA 3GLIB 4BV8A 4P3NA 1VIAA 1WTCA 5JBQA 5IBRA 3UJPA 3U7IA 1C81A 1ZG3A 3WB0A 4HC4A 1NOKA 2JATA 5LA6B 2PO7A 5HF6A 4ZCIA 2GHTA 2GPWA 2FQYA 2Q5EA 6YASA 5B5SA 1Y4UA 4TGLA 5DFAA 2AN4A 2E1PA 4GOKA 3MINA 1SZCA 4IH1A 4KFCA 1JI0A 1OXXK 2CNDA 3PQCA 3T54A 2AX3A 1D8AA 1EUYA 4PS1A 4TLDA 3H11B 4FPXA 4PBTA 4RH1A 4M49A 4AZVA 3PYXA 1RWKA 1YTLA 4GRDA 1P0FA 4L0CA 1GKIA 3UJDA 3ADPA 4FZ3A 2B2XA 1TIKA 4HLNA 2I2CA 2JHAA 1QTIA 3K9QO 5BQOA 5CNIA 2AMFA 3B12A 2WFZA 4G01B 4MGEA 4EA9A 2RC6A 1WMEA 3TBHA 4ZFNA 3O8DA 3TR0A 4DCTA 1YHNA 1XRRA 2PSHA 2IA5A 3DE5X 2M2IA 3AERA 4Q48A 4EQZA 3QV1A 2XXAA 4KI7A 2WYHA 3HK2A 3GEGA 1H3NA 1P1HA 2R6FA 3EVBA 3QENA 3MTQA 4N0EA 2QVCA 4CN9A 1QYCA 2OKCA 4V39A 1KWGA 4CM9D 1QF6A 1XRMA 1YUNA 3M7IA 1E3JA 2IHVA 2QHXA 4HDOB 4C7XA 5KU7A 1RYDA 2FPUA 1W35A 3T12A 4KXLA 2XMQA 2Z4SA 2C61A 2YMMA 3NWPA 4F2HA 4S1TA 3F6EX 5EHNA 1JGTA 4RSGA 4UBJA 5FNVB 1S6YA 2FXVA 3EEQA 3VM6A 4PLWA 1E2QA 3F0TA 2C04A 1P4SA 3Q1KA 1EGVB 1SXJA 2VT6A 1JMKC 3F3YA 1T34A 3GAMA 4XVQA 1DINA 5EXSA 4QUAA 4S12A 2N3ZA 3O2NA 3RI3A 1CQIA 1YQEA 1FNDA 5FPHA 5I01A 4AQYB 3D2AA 4OHFA 3REOA 1CV2A 4GBGA 4YCBA 2O5EA 3NBQA 1CZOA 4L3VA 1YQXA 1IK6A 3FHCB 4G0NA 5JPCA 2E82A 3L1KA 2BMWA 2VTVA 3OZAA 5AM3A 1E2NA 1KHTA 2ZU6A 4IDQA 3ONEA 1B7GO 4ENRA 1LI7A 5HX7A 1U8YA 2QYTA 3K72B 3E70C 4LY0A 1XZGA 5ILQA 3ETDA 1EGHA 4OQYA 3KQLA 2QNIA 1WRBA 2VA8A 5E0KB 3UHJA 5IAKA 4Q4JA 5JG7A 3HGMA 1EVYA 4E3WA 3LF1A 4DDTA 5FTLA 1NWHA 2FSHA 3QVMA 1I4OA 4Z2YA 1C7RA 5AOAA 4JQYA 1W5SA 4LF9B 1UJ4A 3I42A 4F11A 4ZK6A 1C3JA 3T4XA 4Q4CA 1TT5A 3IDOA 4ZJUA 3ZOZA 4A8JB 4CCWA 4YQZA 1ZC4A 1SUBA 2Q4EA 3QG5A 3A4IA 3E8SA 5J4YA 2O8BB 3HDGA 3S7TA 3N1UA 4AICA 2H65A 2RHMA 4OIMA 4MZDA 1NXXA 4KUHA 5EYPA 4EJMA 2CMGA 3QLJA 4F5DA 2G5TA 4BGEA 3RF7A 1JG7A 5ALZA 4TKVA 2FV8A 1MOSA 4RDXA 2IHUA 3SZOA 3BXGA 2R60A 2VF5X 4KGXA 3GW8A 5HGXA 2O8EA 4UKDA 3G82C 4IYRA 3QX9A 3FYUC 3KXPA 1HQKA 5F5NA 3R9WA 3K70D 4QRIA 4GW3A 1KZ6A 3LDGA 2HCFA 5JH7B 2DHRA 1GR0A 2XNCA 4KYUA 3JQCA 2QUKA 3Q8XB 5FUXA 5CITA 5K4HA 1LTKA 1SCNE 4J1SA 4FBLA 2DQSA 4LRUA 4NEGA 4RZSA 4EZBA 4IOMA 2WKSA 1DQYA 2AC4A 1EVJA 2Y1LA 3PX3A 1AS2A 1QKJA 2A92A 2PLAA 3HACA 3VBCA 1PR2A 3CT6A 4Y9TA 4MRPA 2O14A 5KJ1A 1GJRA 1HKUA 1MB3A 1Q95A 2X8JB 4GX0A 1UFQA 3HYRA 4OJQA 2J4FA 3Q7RA 4NPHA 4G1FA 1EX9A 2O0LA 3TQFA 5JD3A 2D0IA 4KP7A 3QEMB 1B8NA 3WI7A 3O4VA 3B5JA 4KGVA 3O2QB 1ZJZA 1NT2A 2FB9A 2NOAA 2QS9A 4MS3B 4B3CA 5CH5A 5CJJA 3MN1A 1OBVA 1Y1LA 1N5DA 1PSZA 1Q0RA 1YIAA 2C84A 1AUOA 5A6SB 2SBTA 4PG5A 5CM2Z 4BP3A 2JCSA 2KPOA 4LNAA 3A2MA 2IWRA 1ZWKA 1G0OA 1OASA 2B4KA 1GZSA 4D79A 1Q0HA 1ZJ5A 1Y8QB 2HSGA 5AVYA 1XZLA 2J4DA 2BSAA 2R62A 3EEBA 4Q9IA 3DLTA 2HHCA 2FDCA 4RXTA 4YJKA 3JZFA 5FO1A 3WHIA 3ICCA 4EHJA 5CAEB 1UDAA 3MMZA 3QSGA 2AOVA 4AY5A 3V3TA 5J2UF 3D4NA 1KDVA 1A9RA 1BGXT 4Y2RA 4EIWA 6NULA 4L73A 1MZVA 1I7SB 3JY6A 3IEVA 3B52X 4OL9A 1RQ7A 4XLZA 1USVA 4XRRA 5J1SB 1SXQA 1JHAA 3OIYA 4RHEA 1S01A 5EXTA 3UAGA 1XT6A 2G80A 3FNEA 4HDSB 3VU3A 3OU6A 4X20B 4YP6A 1OH6A 3G5TA 2KLBA 3IP9A 4AJJA 4BGVA 1EVZA 1NZFA 1BN7A 1FK8A 3TEJA 4UARA 2E4AA 2BJWA 3QLVA 1JJ7A 2NZ8A 4Y2JA 3SEFA 1XZQA 4GYYA 4C08A 4JU9A 1GDDA 4R54A 2V8BA 4MV4A 2NM0A 4AUKA 1JDNA 4UEKA 5CBKA 4TYWA 2O7VA 4DZTA 1OAAA 2CVZA 2HCJB 2QSZA 3DPSA 3GY0A 3A0UA 3NOXA 3ODPA 4KK3A 4LKOA 4NCJA 5T4FA 2OV8A 1YRLA 1S2DA 2Y1GA 5CXSA 1SXJE 3DNFA 3NZEA 3WXBA 4J0KA 2Q62A 2VH2A 4OJYA 2GNPA 1M0WA 4JT4A 3E81A 4YQFA 4JL6A 1E5TA 4V0MA 4A6XA 3K05A 1P6QA 2YXPX 1IVYA 4IXTA 4WBSA 5K99A 1FZTA 1I4LD 3Q1LA 5F2OA 1B16A 1PFUA 3BSWA 1FYFA 2FMXA 4HSEA 3GCXA 3HJUA 3ZU5A 3GLFE 2HF9A 3O6VA 1BDBA 3E9NA 4YBZA 5H80A 3AXTA 3LVRE 3ZHZA 1YBHA 4PRKA 1QS0A 3DKVA 5IM4A 2NZVG 1DWUA 5C8XA 1DWOA 1A4RA 2V03A 3GT4A 1CB7A 1F20A 1G3MA 1LK7A 2FEOA 4BNVA 4K1XA 4DA9A 1T15A 4RTOA 2GAFA 3BXPA 3M49A 3NUQA 4P84A 5AHXA 4OK3A 3CH5A 3ZCRA 4E5NA 4G5YA 1NL3A 5KVSA 4TLMB 2G06A 3W9BA 2O5VA 3MEQA 1V1MB 1DMRA 4I9HA 4NBLA 4G0PA 3BRWA 2VKTA 4XH9B 4FFWA 4Z4GA 3AYZB 3E9DA 4IP0A 1QORA 2Q0XA 4BO2A 1NMSA 4BFTA 6REQA 1XRSB 2QR5A 5DWVA 5EIOA 3Q3HA 3C7TA 1W49A 5FOTA 1R6XA 2YN4A 1Y1QA 2G9UA 4C0AC 2GZ2A 5EVCA 2VNJA 2QGNA 3I32A 3IVMA 4NWIA 1ULAA 3FWPA 3A58B 4M54A 1XA4A 3OZIA 3A6DA 4JGIA 3F8TA 2QZSA 3WLKX 2WJGA 2VNIA 4MW5A 4LVCA 3I12A 4RIIA 4KIJA 2GHIA 4BKUA 3KDPA 4DLTA 2J3QA 2J0UB 5K0TA 4CM8B 1CWUA 1G8JA 3KQYA 4JBWA 1LDNA 3NIGB 4MVJA 3UZUA 5AW1A 3PDUA 5FF9A 1QIMA 2GF9A 3NP7A 3REFA 1FP2A 4ZO7A 2ZTMA 3NRBA 4AECA 1E2HA 3ZDAA 3FBWA 3L0YA 3EZFA 1U1EA 1EWTA 2CXQA 2M6SA 2WAOA 3LXXA 3Q11A 2HI0A 5EGSA 1B8OA 4B2LA 1YVRA 1QTRA 3HQ4O 2YIVX 2EW1A 3NUGA 3OX4A 3QX7A 4GPZA 4BU0A 1GFZA 1E4OA 2QZ4A 3NHRA 2HGZA 2N1MA 4XVCA 4N9WA 4PZAA 3F9CA 1T2CA 1IQPA 1HY3A 1ODJA 1KQOA 1E77A 1P29A 1TFRA 3ENNA 2B0CA 4H17A 4MUYA 5D85A 3SOZA 3MQ4A 3VYTB 2FZVA 2MINA 1KC1A 5GPBA 5KNDD 1JFTA 3TLCA 3MB5A 2GXUA 3UG7A 4OP1A 4OX9B 1D6SA 1BCSB 5E7JA 3EGIA 1WL8A 4AJIA 4AQ7A 1X7WB 5DLPA 1NAHA 1RI3A 3COVA 3IXLA 4UTNA 5AVKA 4B6EA 3I1YA 5JAPA 4C20A 4W63A 2VH1A 4YT4A 2QY6A 2N0SA 1X7XB 1Q3TA 4UEJA 1WDWB 4NYJR 3MS7A 2IP2A 4NFHA 4HX9A 5EKSA 4W9MC 3IP8A 4K8RB 1PZEA 2OCDA 2F8TA 4DSTA 1B1AA 3DLAA 2RBKA 3BCSA 1PS0A 3JD4A 1VSVA 2L0XA 3EPJA 4R1TA 1N2IA 3MGBA 3URKA 3WK9A 1CDDA 2Q50A 1I01A 5CHYA 4URZR 1FSSA 4KQ9A 2NTVA 1XRJA 1UADA 2VP4A 4QL3A 2O2GA 4LXUA 1C9JA 1G21E 4CL8A 1F06A 3DKRA 5CDYA 4I4TB 4JBLA 4PAOA 3V7NA 2ZAYA 3LC0A 4TT3A 4C05A 4DMFA 3RB8A 2IH5A 2F8SA 2ZR7A 4P6VF 1H8EA 3F6YA 1CIPA 3HPRA 4Y98A 1G7TA 1IE3A 3STXA 3WMEA 1YZVA 2PWPA 2AA3A 4V0ME 2OXRA 1NBIA 4W5OA 5IABA 4GBJA 5MN6A 2B5OA 3DCYA 2G7MC 4DQUA 4K26A 3T0GA 2XV1A 1PGOA 1VJ5A 1YOVB 3ZWCA 4BWFB 4OHYA 4TRNA 1F3LA 2OV2A 3EMVA 4GMFA 2ADFA 3V33A 3RSHA 4QYMA 4I08A 2EJTA 3C8ZA 5JOQA 1AS0A 4N5LA 1VIVA 3VPBA 1EE2A 3BC1A 4DCPA 1NXSA 3A9VA 3VSCA 4UZEA 4NJEA 2PUTA 2IV3A 4U2FA 1OTXA 2OZVA 2Z6AA 3L01A 4BLUA 4QXAA 3WADA 1EX6A 2P40A 2AMYA 5M34A 2W2KB 3QXHA 3U37A 4DHEA 4EFLA 5KPDA 4GDMA 2I1WA 1XUOA 1O77A 2IXFA 4GOND 4AC9A 1MC5A 5KYNA 3K0CC 2H17A 2R6R1 2XITA 4PYRA 1ZJJA 3D0OA 4Z9AA 2Z58A 1PJ3A 3NH6A 4R98A 3LHSA 3M89A 4C0JA 3HMKA 1FFWA 1BVRA 3KV1A 3CC8A 4AIRA 1I8TA 1D4ZA 1K06A 1DRKA 2J6IA 1AB6A 1EFRD 3LZ6A 4AZSA 2GFQA 3BAFA 3PGLA 3X2EA 3PNLA 2FLVA 1LI5A 2XQFA 3CVWA 2J1LA 2GPNA 3FDFA 4H7HA 5DCUA 1P62B 2QSYA 4LN1A 3BJRA 1TVKB 2IZZA 2F1IA 3CCCA 4ZCRA 1CDZA 4IDOA 4Q9AA 1KDYA 3N75A 3TJMA 1FDOA 4LBVA 1VJGA 3EXHC 1NXVA 5IAGA 3IT2A 2A1TR 3W6ZA 4YAIA 5K6RA 1LLDA 2DLCX 4MEBA 1PR6A 4QOJA 3BQNB 4YRKA 1K3TA 2HF8A 2ZE5A 4KG7A 3RVPA 3DG9A 3HHEA 4C4TA 1S9HA 1Y8RA 1JJVA 3PB3A 5DGXA 4E5YA 4MVJE 1J6UA 5A06A 1Y9ZA 2Q6LA 3H5VA 4N6GA 2CE2X 5FFMA 3UJ3X 4NJOA 3P9CA 1GR1A 2DUUA 3AHDA 4GZ6A 1DTEA 4KFUA 5ELMA 5AK6A 2ECQA 1OQAA 2WVGA 4OHOA 3UHOA 3U4HA 5EHQA 4NXMB 3FCEA 4TRMA 1A04A 1P0MA 3AFIA 1G3RA 4XYEA 1SU8A 2QTRA 1JBEA 1IQUA 5GGXA 1E5QA 4WLNA 2YHBA 4OYHA 1CUHA 3STUA 1KQGA 4ZVTA 4DA6A 1DBRA 1ZA1A 3CFYA 3H19A 3NGMA 5E95A 4KX3A 3I61A 1GGHA 2H8KA 4BVFA 2AFIA 3PFKA 3L4BC 1C1XA 3FYTA 4K9PA 2NQ2C 1T2AA 3QVLA 1U5BA 2VZ8A 2WUEA 3ZGNA 3BIJA 2GPTA 4HWKA 4E3ZA 1FFDA 3LTEA 4LE2A 3AJEA 5DN9A 1U4SA 3RBVA 2B69A 3IVXA 1E5LA 3K5PA 3AI2A 1B43A 3DBVO 1BD3A 2R1ZA 4RMNA 4XARA 3EPKA 2NO0A 1A7JA 4D74A 1NXQA 1OMOA 1YU9A 1EAMA 1C1DA 1K75A 2R8EA 4LYGA 3QU4A 4C29A 2CC2A 3TE7A 4CN8A 2G9NA 1RSZA 1XG5A 4KH0A 5FUBA 1EUCA 2DWPA 1NBMA 5GIPE 3FRHA 3HHPA 5BXYA 3OTOB 1JW9B 1USKA 2X7XA 2HTEA 1QRSA 2R7AA 4BLRA 4N39A 4ONEA 5TXGA 4M1QA 5L3VA 4M8NE 4KI0A 3V8MA 3O2JA 2HLNA 2AGVA 1VA5A 3GJ8A 3DR3A 4WADA 3AF4A 2JAWA 5PGMA 4RBNA 1MAUA 4NFLA 1LQ2A 1XD2A 5D84A 5CFRA 4AF7A 5KHLB 4PQRA 5K0LA 1U1DA 1EWKA 5DP2A 3ZHQA 3D8HA 4HXYA 3O4JA 4JR0A 4J6EA 4RCZA 1XE3A 3L0BA 5KDDA 3L3BA 3AEYA 2C9MA 1BXGB 3GJTA 2P2ZA 4CV0A 1MU0A 2Q3JA 5TVGA 2PSEA 3I0MA 4BQOA 1EJ2A 1J0DA 4XJTA 4U7HA 2AD1A 3IBSA 3KQSA 4YQYA 5AI9A 5FA8A 5B30A 4NZMA 1DZIA 3QKIA 4GGOA 3NEAA 5IT4A 1NLFA 4DMUB 2HLHA 2CLCX 1NRIA 2HUNA 1PR3A 3EJWA 1JJBA 4NIMA 2FMTA 2CLLB 4E5SA 2WUVA 4DV1B 2WWHA 2LDBA 4QULA 2XZDA 2OAQ1 4ZYLA 1VHWA 3KG2A 4BE7B 2DB3A 1RHUA 1G2PA 2WABA 3QLUC 1JJIA 4GYKA 1J07A 3O92A 3PCRB 5HQJA 1SVMA 4QDKA 2CUTA 2YVLA 1X94A 2Q2WA 4JXXA 2QN6A 3QJYA 3QPVA 4YNBA 2BSQA 4H3HB 4KMOA 4OQXA 3O1IC 1DJMA 2VDVE 2HMVA 1M83A 1JDTA 2J9RA 2R97A 3ASZA 3PXEA 4QBTA 3UT0A 2NAPA 2IODA 4AROA 4JI8B 3C14C 4FHGA 3RRFA 4YJ2F 5HRUA 4UXJA 2ILTA 2NWQA 1GCOA 3I5AA 4NAVA 1RWPA 5EN4A 5JZMA 2AOTB 1PQPA 3GRRA 4OM8A 3KLNA 1ISSA 1RXSA 1ZIXA 4JELA 4S0XA 3VC7A 2CMKA 2IDMA 1M2HA 2VHWA 4F8EA 1KQNA 1D6NA 2J6CA 4H0NA 1S2LA 4JJ4A 2NP7A 3VMMA 5KTTA 1M9NA 4ZEMA 1H0KA 1L1EA 1OYVA 1SC6A 2AZ4A 2VDWA 1E89A 2VK2A 2YV3A 3CWQA 2W93A 3JQ6A 3KKLA 4KSCA 4EB3A 5J58A 5LYJB 4Z4FA 4YRDA 3IUNA 2RG1A 1M34B 3MYRA 1QG0A 1T6YA 2VBCA 4NE9A 3L9WA 4Y7CA 4BLWA 2ZYAA 1XEAA 5LZ9A 4R68A 1CJSA 2QVGA 3IMFA 3WWEA 4DJEC 1I1NA 1MB9A 4ZHQA 3E7WA 1F2TB 3WZLA 4MI1A 4GG1A 1PJQA 2G4LA 1ATZA 3N70A 5CFZA 4BNDA 3ABQB 1KYTA 3CR8A 2X5NA 3I9NA 1UMCA 2W0MA 2YJNA 1AO3A 2H06A 5I4BA 2XF2A 1JFVA 1J9EA 3VR3D 4WN9A 3ZJ4A 2ZLBA 2E4YA 4FNOA 4IHJA 4URFA 4A10A 3DVAB 4MR7B 4E88A 1JG4A 4TLBA 4KXQA 2O0HA 1W9HA 1CZKA 3C3JA 5FPQA 3UC9A 3LLVA 4BNJA 1XPRA 3SJAA 2GF2A 4XJVA 1XJ5A 2R6GA 2PQ0A 3BGIA 3PVZA 4TRRA 5JR3A 3PT5A 1HPLA 3RAGA 5L9AA 4EHAA 2I6GA 4XGKA 2PL3A 4KWCA 1BDJA 1JALA 5AKJA 3MBKA 5LKAA 1PS8A 1I6MA 4N8DA 1C41A 3A28A 1P73A 3O8BA 4H31A 2IEAA 1T9CA 3IQWA 3R5KA 3SS9X 1JN0A 4A36A 4LZNA 1U6IA 4J7AA 4FHCA 1U3VA 3PK0A 1PG5A 2BFDB 1XMPA 1UKZA 3SQXA 2OECA 2YV4A 4AQDA 3LXMA 1L5ZA 3IE1A 2H1SA 5B6JA 1NBME 3HYCA 2HHJA 3MUNA 1BKYA 3IUQA 3LPNA 2HREA 2UAGA 3AF6A 1X14A 2Q5OA 2YN0A 1SWWA 2R7MA 5TMDA 4L8GA 4RF5A 3ZCUA 2HW8A 1U7PA 1L4FA 5JY1A 2CBZA 5KNCH 4DB2A 1N6OA 1VSQA 3UFXB 2XMGA 4BFZA 4LS3A 2K5UA 2Y1WA 3OFSA 3ANYB 3WQBA 2I4OA 1Y48E 5F2KA 2FOLA 4F5EA 2VPTA 1H4QA 4QUKA 4KQMA 2ZWVA 4LDJA 3ZDCA 3EMBA 2C0PA 1U0JA 5KX5B 3I9FA 1TJYA 4NLLA 1PZGA 4HDNB 4WL0A 1SVWA 4D9JA 4ZOCA 1G6Q1 4DUGD 3HGTA 5HKKD 3K1TA 3VI3B 2NVUA 3MAGA 1KDZA 4DT1B 2BMAA 3SC2A 1Z12A 2FDRA 2QP9X 1DUSA 1JIQA 1X1CA 1L4MA 3HKDB 4YXFA 4JA2A 2R6DA 2C4KA 1TUEA 2YMQA 3BDVA 3AHJA 3MOGA 4RVDA 4DSOA 1ZYUA 2C3UA 4ME6A 3LPLA 3VTFA 1XQXA 2B36A 5BUSA 2RGYA 1YHYA 1AQIA 3GRAA 1NUPA 3GRZA 2ZRKA 5DXFA 5JAZA 4TN1A 3RH0A 2PA0A 4NJMA 4D5EA 4KBGA 3AKYA 4OLFA 3RIGA 3Q87B 2OZLA 5DM70 5KNBD 1B6GA 3TLAA 1QO7A 2QSUA 5DBHX 5SYMA 1F5SA 2ICAA 3FWKA 4L4SA 2PZBA 2ZRBA 3EF1A 3DTYA 4PAMA 5IC6A 1HZZA 4X1YB 2WG1A 3OO1A 4IIFA 1RU3A 3NHUA 3RWBA 3OHSX 4A23A 5I6DA 1T5IA 1VP3A 3GLUA 4TLCA 5D3KA 3AUKA 1QRAA 1ZNXA 2DPHA 2NT3A 5JQGA 2IH4A 2EKZA 3CEAA 3CLTD 1EWVA 1Z16A 4NG4A 3S2EA 3THYA 1D1TA 2RJNA 2WJZB 4HGZA 1KFBB 2PGOA 2ZYVX 1YQTA 1EG7A 1ZNYA 1KFJB 1SXJC 3H17A 4KJXA 4AS3A 3OOHA 4ZI5A 1V37A 3AKZA 3DNMA 5TJ9A 5E4FA 5CXXA 2C82A 2C07A 2IH2A 4NYMQ 1RYEA 2WUGA 1EK6A 1XMQB 3BE4A 4V3CA 1U2EA 3V4RA 1QOQB 4HEA1 1TAHA 2YHUA 3K09A 3OZSA 1HE8B 1Z4KA 1Q1AA 2X2EA 3K4QA 4R83A 3IUMA 4KC0A 1NJ8A 4CLOB 3NDJA 2C1ZA 2WTMA 2IUYA 1CLUA 2FKAA 3CNEA 3DEYX 3L7NA 2JLZA 3JQAA 4DAEA 2VRCA 3QU7A 3DEHA 2CEKA 2D5AA 3THXB 1R4NA 1I3OA 3TOCA 4F3KA 2DR2A 1U2GA 3U44A 4GZ5A 3Q15C 3RBZA 1JQKA 3HC7A 1U2ZA 3I3OA 2CB0A 4QOIA 4E5PA 2W7TA 3Q6NA 1CRWG 1FNMA 4MQMA 2ZBFA 3E0XA 3R5SA 3LPCA 3OC6A 2CDCA 2AF4C 3FYDA 1KJQA 4NVRA 1TCVA 2BISA 3DHYA 4D4HA 3LKZA 1E9DA 1TEVA 2R68A 3G2HA 2VP9A 5I9BA 1L3BA 4AB1A 1E9FA 4YRLA 3AM4A 2HU5A 3DMDA 2Q3EA 1UWLA 5H70A 1RT9A 2WF5A 1DX6A 2L42A 1SUAA 4INZA 1NOJA 2NTEA 4RXMA 1T2EA 1V48A 3D3NA 4ND5A 4PQGA 3V4FA 3GFOA 4PX3A 2X6QA 1A8UA 1KBZA 1NY5A 4I14A 1MQ9A 1KYWA 4O2BA 1JIKA 1ZRHA 2DU8A 1PV1A 4ARZA 4E5UA 3IEMA 1FFHA 5DHQA 3GRPA 4HN2A 3P32A 2XTNA 1BG6A 4B5LA 2I7TA 3CLUD 3FDXA 4PRZA 2BZSA 1LUAA 4GVLA 1V6CA 2QTVB 2JCYA 3AR5A 4G0QA 4JZYA 3ZS9A 4EHIA 5HR5A 1GA6A 2ZITA 3AUAA 4EYOA 3IT1A 3PDHA 3G0HA 4JUDX 3KT0A 4D02A 5GVSA 2Y27A 4JOCA 2EERA 1I6WA 4LY6A 2GS9A 3AEZA 2JVIA 4Y6SA 1CDOA 1V4NA 2D2FA 2WILA 2ALJA 3OEYA 3CLVA 3D8BA 5F4BA 2J30A 2VK1A 5FOQA 3EJ6A 3P9PA 5HKOA 3LKBA 3LPDA 3PE3A 4G4SP 5GONA 4N7MA 4DC1A 1UBNA 2D3TA 5BUZA 5K4AA 1H0SA 2A9VA 1DXYA 5AKKA 1TM7E 4JBXA 3G8DA 4L2IA 1JSLA 3F49S 4F85A 4WY8A 1KWKA 1XMOB 1JHZA 4HB0A 2Q99A 1T1SA 1Y82A 1PT6A 4RM2A 1BEZA 3DHVA 2WF8A 1T6BY 4P4NA 4P83A 1O97C 4XVHA 2W2NA 1RLTA 2OVFA 3VO8A 4AURA 3N2GB 1XMVA 3NW9A 1CF9A 4MB0A 3ITDA 1QH0A 1YR9A 3KPWA 1PGNA 1F8FA 5IK2D 4DKXA 1F7VA 3M1LA 4ZYUA 3SF8A 2DFNA 5ES4B 2NN3C 1PRYA 4NYMR 3OIFA 4WKPA 3DT8A 5BP7A 4AUEA 1NF8A 1QYIA 1EH5A 4BMYA 3GU3A 4CVNA 1ZAKA 1R74A 3NM5A 3G7UA 4IL5A 1MFPA 2PMKA 3HU2A 4QBIA 1T4CB 3QLVC 3QOXA 2FY8A 5FRDA 1J2EA 3UXMA 3SC3A 2K7FA 1K4MA 1Z8FA 4KPUA 2FRDA 1TM1E 3RASA 1VRWA 1UXKA 3FR7A 4Y1RA 3AR7A 3EWIA 3T5BA 2IS4A 2X1HA 2HMUA 3AILA 1WCIA 1GRVA 1KEUA 3LXRA 3CO5A 4JJGA 3RHZA 1IEVA 3NT2A 2AWNA 3P2IA 3CB2A 2C7GA 3F6CA 4M76B 4FD2A 2VN8A 5AH0A 2JASA 3KB1A 3R41A 3V8PA 2HSEA 4GPD1 4V2IA 4IMRA 5DGDA 3TN7A 5B2FA 2V6JA 3KT6A 4PTZA 2AOUB 2IIBA 3CIOA 4UVGA 4EW1A 3LOPA 3T1OA 3RVMA 1DIOB 2ZPAA 5EVJA 4IPTA 4F38A 3AQ4A 4D3FA 4M8IA 2H9IA 4BVKA 4X60A 1EE9A 1GTVA 1U8TA 3OQ6A 4D25A 2IS6A 4YV1A 1EUDA 2V7GA 1N2GA 2V6MA 2X41A 3IB3A 4BJ3A 4JCOA 2WJYA 1OV6A 2JK0A 1FBNA 1X7YA 3QIAA 4Q7EA 1W5FA 1PLKA 1NP6A 3PFBA 4DILA 5SY6A 3KSAC 2P7IA 2UXBB 3ED5A 4MIKA 2VCYA 4P2BA 4RD2A 4TMFA 4CDGA 3HB7A 1XQ1A 3TIFA 2VATA 2JIMA 3M6LA 2FA9A 3CVUA 3RT1A 4HEQA 5B3LA 4WESA 2Q8QA 2YJ4A 3DB2A 3FTPA 5K3FB 1ND5A 4RL6A 2XKBA 2ZOSA 4HRAA 3MJSA 5K0BA 4HQKA 3V4LA 5CDHA 2BM9A 3MT8A 4BFCA 4F8YA 3JAKA 4F04A 4PU0A 4ER5A 2O20A 1XHEA 2R8BA 4EW2A 1UBRS 5IH7A 1O8CA 1PDOA 2GA8A 4JX9A 4D92A 2BFCB 1B3BA 1LDEA 3T9FA 3UOWA 1AHIA 1Y33E 2OYRA 4GM0A 1SY7A 1ADCA 4U3JB 1DL5A 2I71A 4GWLA 4WE3A 1PL6A 4CG2A 2DQ4A 2HUPA 2ZCJA 1KRWA 1L0BA 4G0XA 4BE9A 1OUMA 2VWHA 1YB2A 2J3IA 3I4CA 4Q1AA 2X3FA 4R3NA 3GB9A 1DP4A 2GERA 5DHRA 3S99A 2IEBA 2X19A 2R79A 3B82A 1G6KA 1SGWA 4OSPA 4DPKA 5TIIA 1KSFX 1ONNA 2DYKA 2JBAB 2GN6A 3A1CA 3BULA 2GN2A 3B8EA 3GLTA 1QAOA 2BDEA 3GZNA 4OXNA 5E7IA 3FTQA 3UJCA 3QKRA 1KO8A 2AKAB 3VO1A 2OBXA 1IPEA 1HE1C 1AF7A 5KTNA 2ID9A 4RF4A 2BHTA 4DDWA 4YB8A 2A4MA 2GCPA 2YJZA 3GRYA 3JWIA 3KELA 5T41A 4EITA 3TF5A 4AU1A 4DLZA 2FN3A 2OMKA 2Q49A 3A1EA 5IFLA 3AJ8A 3H18A 1E7RA 4K87A 3DZIA 3D3EA 3LBYA 2PUEA 1GD1O 1WUHS 4H2DA 3B9PA 4HNUA 1L9XA 4BNFA 1YIOA 4DM4A 1ESMA 3MTAA 2HWWA 1G0NA 3U1VA 4TYNA 2LW7A 7MHTA 4OQDA 4LJ5A 3G2QA 4CM5A 4O4LF 2QTZA 4BRZA 5KOIA 3LUGA 5K4GA 4BNGA 4AI6A 4IUYA 1IPFA 2CYBA 1DLJA 1FS5A 3FYUA 2BHRA 1DKLA 3PXAA 5CLGA 3UA3A 4JT9A 3E2PA 3EOZA 4S1WA 3ZV4A 1C9KA 1IPHA 1Y89A 5G4KA 3HXMA 2H4FA 4FWIB 1PEKE 2W8BB 2IF0A 2WWTA 2GYVA 1IM8A 3LCRA 2LRHA 3BF7A 4UDYX 3H8JA 2NT4A 5IYZB 1DTSA 4UNSA 2ZJ4A 5JCZA 1S4MA 4FDMA 4RQTA 4TQGA 2VEDA 2B1IA 4EARA 5LD2B 1KY3A 4OI2A 1C2TA 5J5VA 3AHIA 2UYHA 3CZMA 4B5KA 3ORHA 1PNQA 2WJ4A 16PKA 2ECPA 5JAQA 1SD5A 3HKEA 3IC5A 4C7MA 4B7AA 3EQ6A 2ZUEA 1EWQA 5K3SA 3I9V6 4OQ4A 4YPFA 2HBYA 4EHBA 1WY7A 1B41A 2BR4A 1X42A 3AZPA 4HDMB 3BMCB 2BN4A 5CW2A 3JPYA 4B45A 1E7QA 1C7IA 1RKQA 3RUPA 1Q11A 4TV9F 4UFNA 4Y67A 3WFIA 3X1XA 1E9SA 4MQ6A 1Q83A 5FL3A 2WAAA 5EIEA 3ORSA 4JLVA 1FRZA 1QR6A 3D1LA 1RLOA 4LRWA 1I10A 3PJEA 4UU8A 1UMKA 4OK6A 3DAGA 3HZOA 4XM2A 4HX5A 2LCFA 4Y3UA 2Y1XA 1TA9A 2Q3CA 3GC6A 4OA5A 2I55A 4RJLA 3EFEA 3I2KA 3IVCA 4PTYA 3HR8A 4DZZA 2FCRA 1AUPA 1KY2A 4H7JA 1VPWA 3PQ6A 1J1ZA 4BTVA 5DGCA 2E87A 2WFLA 3OMXA 2V6GA 3UJ7A 1P2UA 2YY6A 3VSAA 2B7BA 2EG9A 3BREA 4DREA 1QIJA 1CB0A 1NVTA 5FTKA 1AUXA 3T34A 1B8VA 2FR0A 2NLOA 1VC2A 4CQMA 3TOVA 2FUEA 3GJ3A 4NOKA 4NXNB 4FMCB 1T0PA 4OGLA 1V4VA 1K6MA 5KTKA 2MYNA 3JATA 4D5GA 4EEZA 2VZEA 2WUDA 3UO8B 3QYJA 4OV6B 4EHNA 3H8WA 1WXWA 5D1HA 1IBLB 1VG9B 2CBXA 5HYVA 4MUMA 3JPWA 4JITA 3M1YA 4EPTA 1ZR4A 3F7TA 1A3CA 1GGMA 2GO1A 2IP1A 2W00A 4HEJA 1T10A 3DCJA 3AHEA 1EFLA 2IZOA 2G67A 3AI7A 4FOSA 1BE6A 2C8JA 4QX6A 3OFJA 4PS0A 4DDKA 3PYLA 1JDBB 3C8DA 4C6RA 1XAJA 4HKTA 2M98A 4HH4A 4URYR 4MVJI 4EG5A 2HMWA 2XMRA 2XOEA 4ZU1X 4BMZA 5DVZA 1NNLA 1D5WA 1TU0A 1NRXA 4WIAA 3H0KA 5C34B 2OWEA 2MSKA 5AW4A 1CYDA 1XSEA 4H60A 2LZ0A 2OD2A 1F1JA 3HYSA 4Q3EA 1R8JA 1Z5PA 4CLEA 5T4EA 4WVFA 4KN8A 4TTTS 2W6ID 3ZU6A 5C31A 1M1NB 1NG1A 5LM3A 1KZ9A 1UEIA 4M9CA 3T9CA 1G8HA 4EMTA 1P61B 4Y2TA 1KSHA 1MLDA 1N5JA 2RGUA 4GNKA 1JDSA 4ALNA 2YYSA 1R9NA 3TBKA 3PC2A 5CJPA 3DBHB 1E1QA 2GAIA 3DP9A 3E8MA 3SSAA 2YS6A 3G2MA 5KQPA 2FPPA 3O0DA 2PQ2A 3I6QA 4OQZA 2IIQA 1PP4A 4C1BA 2A0XA 1A9XB 2VPZA 2WYUA 1I4TD 4HB4A 1KQFA 5DM1A 2OFXA 1W6RA 2POQX 3CM0A 3RIYA 1IZZA 1BWSA 1XMIA 3TX2A 1KDPA 4B7CA 3S3TA 1RCFA 3CZQA 4MUAA 1KR2A 5CLIA 1QK5A 5HS4A 2JFOA 3C8UA 1I94B 3UWPA 1VE6A 5UKDA 2OQRA 3M6AA 3ISTA 1JE1A 2IOYA 1JHUA 2A4KA 2PANA 5EEGA 1OU0A 2BJVA 2JA2A 5FI1B 1VHTA 3GP8A 4LE0A 1JXAA 1SPBS 2NO1A 3KQHA 3PUIA 3I4LA 4YJ2A 3MJTA 2OKGA 2WSMA 4PNEA 3IVAA 3H2YA 3AB7A 3PRKE 4J7CA 4WSOA 4JSRA 3L8HA 3EVFA 1JHDA 2L17A 4RZIA 1PT9A 1XZIA 2QG4A 3EZLA 4CQLA 1B3RA 3I2GA 3MWFA 4N48A 3VGPA 2V5UA 1K86A 2ZE8A 4DANA 3TG2A 4C43A 1I6LA 3ABOB 2ODEA 1QPGA 2RGBA 3K96A 2GRUA 3LOUA 3KJHA 1YDFA 4J6FA 4QUEA 2F9MA 4U7TB 4LXIA 4WN3A 3SJBA 1Z35A 1J5XA 4JJIA 4BGDA 1ZY2A 3TE6A 4FKBA 2QN9A 3D6VA 2OAP1 4B6RA 4GMKA 1QU3A 1AF4A 3PD1A 4YPVA 2PQMA 2JFHA 2ODAA 3L40A 5FUVA 2E2WA 4W5QA 2BGMA 1RAEA 3CRW1 2EFYA 4D56A 4K05A 4KQGA 3AF2A 1CUXA 4FFDA 3GR6A 3NEPX 5J23A 3Q40A 1HG1A 3K1YA 3FW1A 1WDTA 2C98A 4DBZA 2HA2A 3FWNA 3CF6R 4F72A 8AT1A 2PUCA 4GLFA 4U8HA 1R4ZA 2W43A 2LXNA 1MW8X 4HQ0A 1JV2B 1JG1A 1O0BA 3K92A 3HLTA 3NJ4A 5F35A 2DM6A 3B70A 1DTWA 1VHLA 2IYFA 1GTRA 1E3QA 2DFTA 1SVNA 3AUTA 3BPSA 4XQ0A 4F4FA 4QPZA 2F43A 4WCFB 3EFBA 4PQYA 5DEOA 1CJUC 1UMDA 5BSGA 1OI3A 4OXYA 4GD3Q 3RYHA 3LPMA 1RKXA 3FHOA 4OOFA 1EB9A 1RP7A 2XLCA 5EJAA 3ZWDA 1ES9A 1PR0A 3WAKA 4OJMX 3DUFB 3FETA 4WDRA 3ROKA 2HJWA 4P92A 3WY9A 5CGZA 3HYNA 4WKNA 2QTHA 3C85A 2YKGA 2ECKA 2QD5A 4V1CB 2F64A 3KUKA 4UU7A 1YB5A 3KL2A 3TW6A 3DCIA 4JR1A 4A3SA 2XD4A 3ZHYA 1M1YA 1CUBA 2YNMA 3L0DA 2GBCA 1XRLA 5K51A 1P17A 5HMMA 4UDXX 3TTTA 3P26A 2PMBA 2GILA 4NMXB 4R2MA 2H4HA 3OVMA 1A9TA 3NRCA 3ESBA 4LNHA 1V2HE 2LE0A 4WXYB 1QQ5A 1MUUA 2XMDA 1ZUD1 2DQKA 2HMTA 4I66A 4MGZR 1XCOA 2X9GA 3S4YA 4GBED 4L3OA 4V02A 2ETVA 3NB0A 4R8VA 3LT0A 2C8KA 3W3AH 4G89A 1CUEA 3QI7A 1GG9A 4U2EA 4Z86A 3ERCA 2FWMX 1DT3A 4R69A 3WLSA 2BZGA 2YY5A 4GI5A 1MAHA 3H13A 3W7VA 1QIDA 4URHA 5DNWA 2JAOA 4YX9A 2QG6A 1B2LA 3DR5A 4H7DA 2A30A 4GO1A 3SIRA 5JT1A 4E33A 3TK1A 1G9TA 3ZV5A 2AYXA 3FUTA 4QPDA 5FWXA 4TXNA 5AKGA 3B8HA 1DFHA 5CDTA 1FLVA 5FL7A 3ACCA 3E3NA 3WHKA 5K0ZA 2PRKA 1BH2A 4DKJA 1U7WA 3TIGA 3VVLA 1RJ9B 2Q5FA 5HP4A 2B1JA 4CJXA 2C5SA 4I50A 2V9PA 1IEQA 5JMOA 1ZR2A 1W34A 2DHEA 1UJCA 1PJ2A 1ZJ6A 2ZZKA 3JQPA 3JTEA 3TLBA 4D81A 4W5NA 1KA9H 1AY0A 4BNNA 3GJQA 1ZJYA 3BA1A 1FB5A 1WR8A 4GUDA 5KOYA 1RNLA 3MTJA 1RHRA 4Y8VA 5J2UB 3E9QA 3ADCA 1GY8A 4FHZA 4MI3A 1U3DA 1EGMB 4JLPA 2YQ5A 2FU5C 2W0SA 3K2IA 1XROA 4F9TA 5BN5A 1ISIA 1OV4A 4QEKA 3UKOA 4WZAB 2VNKA 4QE3A 4AJOA 3DTVA 2AJDA 2BKVA 5F73A 2WA1A 2UVPB 3KVOA 2E6KA 4IJUA 4UXIA 2O8FA 1XU7A 2NYRA 1GFWA 2E5FA 3CNBA 3JVEA 4JNCA 2P9YA 1IXSB 1VMEA 3BFXA 3E5HA 5FI0B 1CSEE 3A1UA 3IMGA 3OOJA 4P98A 4RVFA 2ZB8A 3OT4A 3AIKA 4B0PA 2BI7A 4FFOA 4OKIA 4D44A 4I1VA 1JSXA 1G55A 4IVQA 4ZU3A 1Z13A 4M9ZA 1KR5A 2HXYA 3OEED 3Q2OA 4MVJM 4ZD6A 4EZIA 3NMUF 4C78A 1LFAA 1YI1A 2YWGA 4ZQGA 2O3SA 2YWDA 1II8A 1P2TA 1GPLA 4PX5A 1XVTA 5DPMA 2JDIA 4FHEA 4N54A 3NHYA 1KMCA 1BHQ1 2GYUA 2D7JA 1M8PA 1BXRA 2XVMA 3QE4A 1NQAO 2WU4A 4QYIB 4UTRA 1ADYA 1IXZA 4GMGA 4QOFA 2WUWE 3FYUB 3GCWA 3MT9A 3WZMA 4IF4A 2SICE 5TPZD 5DB4A 1QGYA 1U04A 1UUFA 1W93A 4RJ2A 4NZYA 3KZKA 1ULTA 3TLJA 1XX6A 1XCJA 2DWUA 1XWWA 4GP6A 2XI4A 4L50A 1YDMA 2R96A 3VHXB 2A86A 1I2BA 4BXOA 4JYAB 5BUCA 1NNEA 2IGBA 3HE3A 2R2GA 4DXAA 5TNXA 2JFQA 3UKJA 1C0KA 1V7CA 1G7SA 1C9DB 5E6SA 3V34A 8ADHA 4X7RA 1VKNA 4PEVA 2KWIA 4KPGA 1LQTA 4MA4A 4V3BA 3U4CA 1MNAA 4YDQA 5IKEA 5LPNA 3BWDD 3HVIA 3TSCA 3ETLA 2ZTVA 1NI5A 4TWRA 3TG8A 2G83A 1F38A 2VNHA 3L1IA 3K6KA 3OA0A 4FE3A 4KWIA 4MRRA 3ZU3A 3U3XA 4BLSA 3NV7A 3T1VA 1U9ZA 3PQ8A 3QKSA 1TYDE 3GJ7A 3WLAA 1IWBB 1N0HA 3LC2O 3VX4A 1UKAA 1M1YE 2BHSA 2E3JA 2GKOA 4LEIA 1QCZA 1RYZA 3IKLA 1T1IA 4E21A 5AD1A 5EQJB 3H9UA 3IOMA 1GZ6A 2HNAA 4PRLA 3ENWA 4DRXA 4AZTA 3X43A 3DDOA 4HZIA 3NVKI 2CLFB 1E8DA 4RHFA 5I9LA 3GMIA 1HZZC 1M2GA 1ZD9A 2B98A 2GCOA 2QN1A 1KS2A 3DAPA 3NBYC 1WKVA 1IONA 4K6KA 4OY3A 4I8XA 3L0CA 2EGHA 4ROTA 1SHUX 3H2JA 3M4NA 1C50A 1Y9DA 1L4YA 4ZCPA 4YVFA 1RRPA 3S1AA 1G8GA 4AKEA 4IUBS 4CHGA 4COKA 2R48A 5LQNA 2ZM6B 2HEGA 4F21A 1K68A 2YVAA 1W2WB 4PV7A 3KJNA 3WDMA 1BHO1 3AF0A 1LFDB 2HOQA 1P33A 4H7IA 4LYFA 3NHFA 3SE0A 4QWWA 4URUR 1Z06A 4MROA 1QAQA 1GAXA 1DUVG 2D4AA 4JWTA 3GVIA 5AW2A 1YZKA 3NDIA 3ZXUB 2J8ZA 4PICA 4CKBB 2PZKA 4LK3A 3UJ8A 3QHPA 4OMCA 3P0JA 1AQYA 2CLHB 2AVDA 3B36A 5AP9A 3K09C 1Y80A 4DJ5X 2NU9A 1J4AA 3C3EA 5KTRA 1KAMA 1RC0A 3C87A 4QXQA 3ZD8A 1FL9A 1FJXA 3OF3A 2WU3A 1OXKB 1CY6A 1KIFA 3TS1A 2IU4A 1TYEB 4RFSB 3IAUA 4R2WA 4MK4A 4AKHA 1R12A 2HPHA 2ZSKA 4WJZA 4PPFA 2VBFA 4ML3A 8LDHA 4MS4B 5HK9A 3RYIB 4L6CA 5THQA 2W42A 3HJBA 2ODNA 4JQZA 4ASUA 1U2GC 1QP0A 1SPXA 4X85A 5CA0B 2UUOA 4EVIA 1DGQA 4F06A 2WZCA 1UXOA 1Z47A 3RROA 1KE1A 1EBUA 3ZVMA 1ML4A 1CX9B 3FHJA 4O8CA 3V3KA 3DCNA 4WAUA 3W5CA 2G08A 5EJ7A 1M2VA 1ZXBA 1J7KA 2V4ZA 3AUUA 4J0EA 4JOSA 1TAUA 3LLCA 2XE8A 3QZUA 4FFBB 4CMBA 1GPYA 1D2MA 1XPOA 1AZTA 1XKLA 3VRHA 4EG3A 4E30A 3KPVA 5C35A 3KQKA 4AP9A 1LNQA 2QVLA 3MJCA 3OHMA 1YDGA 5LOVF 4NENA 3HWX1 1ACJA 2CXTA 4HAOA 2YS7A 4OAOA 2QAGA 1BYUA 3P2OA 2GBFA 1V7QA 2YOHA 3I04A 4DARA 3VR4H 2HV9A 2D74A 4XW2A 4QARA 3WV5A 2D7DA 1W7AA 4XYBA 3S2SA 1DOAA 3JQBA 1JE0A 3RARA 1G66A 2F67A 4LNUB 2ONJA 1CNMA 2JJQA 2V5AA 3FFXA 3WIDA 1YR2A 3RRMA 4L72A 1RXCA 5AVUA 1XTQA 2CLOB 1SUFA 4YJGA 4MHOA 4D8VA 3P2EA 1RWNA 1T2DA 3P20A 4GXRA 3DAFA 5G1NA 1JHVA 2H5LA 5B6PA 2X76A 2OV4A 4QPJC 1T91A 4EBBA 5KC9A 2P68A 3MWEA 4I4NA 1PAUA 5AKEA 4BRWA 4N40A 2VJKA 4J0CA 4R7GA 5FBZA 2D0PB 3TW0A 2IHZA 4ZV4A 1E3EA 4KMSA 5EJGA 2A5LA 2C5BA 4PO8A 1PFQA 5FTNA 1JAXA 5DX1A 3T7TA 3PJGA 3IV9A 3OKFA 5E6RB 3V8RA 4C88A 1UFOA 2QLMA 4W1QA 5A05A 1P4GA 3K0SA 1ISPA 4PAQA 3RC1A 3UUEA 4EGJA 3NAQA 3FCAA 4GYJA 4JKOA 4GWKA 3L1UA 2X8AA 3WS7A 3FNRA 1U8UA 4TL8A 4KBFA 2P2GA 4TMZA 1LGYA 1E4VA 2ZRMA 4XX1A 1N4AA 1TAGA 4UUOA 2P5YA 2ZTSA 4NKRA 3B3AA 4QU0A 5JFTA 3U6KA 4B3TB 4TLLB 4FE7A 1RYHA 3DTTA 4H27A 3T7EA 3G5UA 1W8IA 3K8YA 5EP4A 2EJUA 1HNZB 4CM9A 3ZIDA 1BFKA 1VKJA 5TMEA 5JFGA 3T0IA 1FP7A 2DC1A 3K0AB 4LJ8A 3HKCA 4KWEA 4LJSA 5D8DA 3H9JA 1J09A 5CK5A 1XZAA 1SCKA 1CULC 2ZBQA 3QMPA 1AD2A 3QX8A 4HN4B 3T4EA 4EY5A 4YRBA 721PA 1RM3A 5HIMA 3DXXA 3GBVA 3UMCA 3UAZA 3PQ3A 4IGAA 4O3MA 1FSFA 1S9DA 1YRHA 3A6LA 1ZCJA 4PZYA 2CFRA 2H5EA 1NJ2A 2FRDC 1R0XA 3INNA 3NTRA 5FXMA 4NRDA 1WW2A 3VBEA 5A5FA 2MSNA 4FSXA 4RENA 1CG6A 4X95A 2NO6A 3COZA 3I8SA 3KO8A 1A5TA 3DZKA 2RHGB 1LNZA 1ZL0A 2R47A 2UUPA 3ENZA 1U94A 3OQIB 3KWFA 1NMQA 3CUSA 4RVHA 4XDHA 4MPTA 4DZRA 5LJIA 1E1LA 1AXEA 1FXSA 4D0SA 5KI6A 4MXDA 4ZIRB 5KYTA 1Z7YA 2JS7A 2IPOA 4HFRA 1P3DA 3PCTA 4D0NA 3PHLA 1EHYA 3LG2A 1MN6A 3SXUA 1OXUA 3WSTA 1AHHA 5FADA 1P45A 3FOAA 1C5KA 1SEVA 1JEQA 1LRKA 3D3WB 3N28A 5G3ZA 1I7PA 4PYMA 4HS4A 1PR5A 1BX0A 5CTJA 2F1JA 1TEXA 3PE4A 3SPXA 3OY2A 3SSOA 2ZBUA 4IAOA 4W9RA 5A4JA 4OCZA 4DPLA 2HLDD 1GVHA 1TGVA 4EPVA 3TTYA 1R0KA 3OIDA 1NN3A 1YUBA 3GQBB 1CQWA 4OLJA 3U39A 4CM4B 5JXGA 5EJ6A 4WBNB 5C5EA 4IIUA 2H9YA 3IEIA 3A11A 1EM8A 4L15A 3WK7A 3BD8A 2MR6A 5KQSA 5F98A 5EP2A 1DQNA 4OU4A 2UVQA 4REMA 2XZTA 1I1HA 5DM0A 5JO9A 1TXGA 2Q5HA 2RGCA 4CNQA 3VC1A 4MPJA 4DA0A 3VC3A 1Q14A 1WG8A 2ACWA 4C87A 4DCGA 5IMSA 1PFKA 1SKBA 3QUAA 1MJ5A 4CF5A 4E1AA 3ZHRA 2B1RA 1U0RA 2NZXA 1HI9A 1QGDA 3A9WA 1E1CA 2Q0QA 3MS2A 1G42A 4HY3A 2AKYA 4G1MB 5C1IA 2QQGA 1I0ZA 3AFGA 3UMRA 3GFRA 3TSZA 4EUKA 1U2DA 1SBYA 4Q6BA 4C0QC 3GNTA 1IRIA 4M9UA 3CGWA 1DRUA 1Y0BA 1AKUA 5EWMB 3LZCA 1Q0LA 1RHQA 3FBGA 4ARSA 4IFEA 3RTEA 4LKRA 4B79A 4B6QA 3TQCA 2ZXUA 1WBDA 3VNRA 3HJFA 4FOLA 5BR7A 1RWMA 1IZYA 2LIPA 4A82A 1OI7A 2NO7A 3WLMA 4DBVO 1PJ4A 4JKIA 3EXHB 4FDVA 3PQDA 3L7IA 4WFJA 4Z0NA 3C5CA 4G9BA 4YP1A 5B53A 2O2EA 4UDOA 3ZVNA 1OVGA 1RLIA 4HNSA 4C0LA 2PUJA 1J0BA 2LD4A 3EODA 3O47A 3QVTA 4Q02A 4LBZA 1N2OA 1OLSB 3BMOB 1EVIA 3PGKA 4JYPA 3PI6A 4R8SA 4TQUS 5FBLB 1XNGA 5A04A 4JY7A 2J0QA 3A9TA 3DL7A 4LG1A 4X65B 4RQUA 1E8NA 1UBTS 2YUTA 3MRSA 1YKFA 3FOWA 3OZGA 2EYUA 4L9AA 4R9NA 1OAOA 4WLUA 5EMHA 2V59A 3QBJA 3VX3A 5IVKA 2QXTA 3CRVA 2HIHA 4JHLA 3I62A 4K6FA 1N9KA 2IBTA 1AB5A 1VBKA 2AEMA 4PAGA 4CKWA 3DOEA 2XNHA 1CUSA 1M7GA 1ORTA 2C0QA 1A8IA 2JLYA 2QW0X 3GPCA 3PBKA 1Q84A 2J87A 3UNXA 2CHUA 3PWZA 1RM5A 1OX5A 4DIOA 3W05A 1R50A 1UAGA 1JQ5A 2JIDA 2CXUA 4R84A 4OQPA 5ALUA 3BB3A 1ULSA 4LOAA 1QHGA 5GV7A 2OD7A 4JYMA 3WGKA 3BJEA 2FG5A 4HGOA 5DISB 3SY8A 3T94A 2AXPA 3CVVA 2R66A 1XQ9A 4ZCQA 4DRYA 1ZI9A 4CEIA 4NZPA 5DTEA 4RF2A 3TM4A 3R3UA 3SMQA 1ZEJA 2EJBA 2X2FA 3ZK8A 1W88B 1ZJWA 4LX0A 1SC3A 2LNDA 3F96A 4XIFA 1WLYA 1Y5IA 4K9NA 4EG8A 5BV0A 2C99A 4RGBA 2ZJ2A 4L74A 1PE0A 1Z2EA 4GL4A 4OBEA 4BNXA 1WZ2A 2A5DA 2IC5A 1PL7A 2G04A 2XUKA 3TR5A 2ZJOA 4UD2A 2HJRA 3VPSA 2HIGA 1R8YA 1EZZA 1Z7BA 1GITA 4JD5A 4BRSA 1M2EA 5KYXA 3GDFA 1F5NA 1EXNA 2AYYA 3G9UA 4H1HA 3RTDA 5ISMA 2PRIA 4UHDA 3F5MA 1SFRA 2DPYA 4G1BA 4KO1S 3T3IA 1XLTA 3KUXA 3D59A 5AOBA 4FFPA 1PYGA 2VI5A 2QTGA 1UMBA 5F3WB 2P4SA 3C3WA 2MT9A 4FIDA 4QWMA 5JXWA 4JOBA 4E31A 2NUBA 2E21A 1XQ6A 3EZ7A 4FT4A 4QIHA 1W1IA 1CR0A 3TFOA 2JHGA 1NRJB 2AI2A 2KBEA 3IQZA 5U9CA 2Z8ZA 4LRSB 2YHIB 3LV8A 4JJAA 5IARA 4CF6A 3EG9B 5AI4A 1BZYA 1H2ZA 3CONA 4E94A 1T0JB 3N39C 4A0HA 1ZHHA 2R8ZA 2REQB 1NQTA 2ZYSA 3DFZA 3DZCA 1YO6A 1CS0A 3M5WA 4A16A 4IIJA 2ACKA 1XJWA 1CE8B 5EZYA 3I9MA 4X3PA 1P72A 4W7IA 4C6SA 3KT8A 1A71A 4O63O 1IOVA 3STTA 1XTJA 3WTCA 4H59A 3SBEA 1F0NA 1NYQA 1TW2A 1WXXA 5FT9A 2C9DA 4LDZA 1SEPA 1NVFA 2BI4A 3K8QA 5EPEA 3SYNA 5I7OA 1JEAA 1A2KC 4S0ZA 5DHTA 4O0MA 5E1OA 2XGMA 3FTDA 2XBUA 1FRVA 4J0QA 1UH5A 1NSYA 1PWYE 4P4TA 4V0SA 3NHMA 1U8EA 5IASA 2OESA 1Z4PX 1H2BA 3AETB 3G6KA 1T8RA 4CR8A 2GUWA 4EDFA 4RK6A 3PGVA 3MJHA 5TQ2B 3DLIA 3N2NA 5LNK1 2H2HA 1W0JD 1DI0A 1M8KA 4P1ZA 2DECA 3QX3A 4K5QA 4B75A 1YC5A 2ONYA 3GLGA 3E53A 2WF6A 2P1ZA 4J07A 3EBLA 3PUZA 4D43A 2DFPA 1JNYA 4FXPA 4DV7B 1XCBA 5F7OA 3M2PA 5B57C 1QR2A 4EA7A 4L0MA 1XL0A 4CF4A 4EENA 1V8OA 4E2WA 3UBTA 2Y77A 3ROMA 3FRIA 1CNEA 3TINA 2PBZA 3LDFA 1FF9A 2YWJA 2WIFA 4YJHB 5FWYA 2SKCA 4MWZA 2CY0A 2CYAA 3OCYA 4GU5A 2CXNA 4FZRA 4TMXA 4CI9A 3NEJA 5AICA 3JSXA 1UXJA 4B35A 5C5CA 1U63A 1S2MA 1JSZA 4DM3A 1SKMA 2QP3A 4XJSA 4RUKA 4YUWA 1MCZA 3WLFA 1ML3A 1MG0A 2I7CA 2H7CA 1FYDA 1YJ8A 3AL2A 1GPMA 3PF9A 4G8CA 3SYLA 3WLPA 3W7BA 4NARA 2PX0A 2WHPB 5GQSA 4CE6A 3HPQA 2JZNA 1IBKB 3BH7A 5ITZB 1EX1A 2ORED 2C7QA 2ZAMA 3RS3A 1D0SA 1CRPA 3AR4A 2ENWA 3IAS6 3GN2A 4MV8A 4Q4DA 3TVTA 1L8AA 1SR8A 1BS9A 4X7PA 1P4HA 3WBFA 2E7ZA 4HVTA 4LFAB 1E6EA 2ATCA 1P5HA 2CWDA 1KK0A 4CETA 1GRNA 1L5VA 5EKXA 4CEHB 4PG4A 1VA4A 2GJSA 1SG9A 4HGRA 3WGMA 1GUYA 3ZWMA 1U6KA 3KU4A 2O8DA 3X1ZA 4UFOA 4ARBA 4Y2XA 3L05A 1A9YA 3K1AA 5FLXA 5J9FA 3GD5A 1K0FA 4Q4HB 3WYAA 2VWQA 3O8LA 5ELLA 3VYVA 1GZVA 1GAWA 2X6TA 4OSEA 1VL6A 1K7XB 2Z43A 4HCJA 1KVUA 1D0VA 1KYQA 1TEZA 1I24A 4U2DA 4IICA 2IYZA 3G2PA 4H4DA 1DBPA 3G2LA 5EC8A 5J4HA 3UBMA 4ZDIA 2X5XA 2PD6A 2Q6IA 1JG2A 4RV5A 3R7NA 3WC4A 1J9GA 1NU8A 2DLDA 4QVGA 1QRDA 3N53A 4LMBA 3BS4A 4ZVVA 4HVCA 2EV9A 2P65A 3DJFA 1E64A 3CRZA 5JVDB 4BAGA 4YJFA 4MYTA 4QKQA 4ZALA 1K2WA 3DUWA 3UV3A 2L69A 1PNOA 3C48A 4HWGA 4O4JB 4TTRA 2JH9A 5KJEA 1UKYA 3SE7A 4AMGA 1GSHA 1AV7A 3CBGA 5KCMA 4MRAA 3ZK9A 4F12A 3QPUA 2QPLA 2DUJA 3HBMA 4PLYA 2HA5A 3VKGA 2JJ8A 4DA4A 1DU4A 1W85A 4OHKA 1ULHA 1XZPA 5JATA 4DG9A 3K9FC 4DIBA 1GIAA 2I1LA 2J3DA 2QW1A 3MINB 5IX8A 2YNMC 1EFRA 3MHPA 1E1DA 3QVVA 4L1KA 4U7JA 4KB5A 2A5JA 3RVDA 1ZIOA 5K2OA 2INGX 3G89A 10MHA 2CL6X 3PEVA 2A9KA 1EVKA 1LDMA 4G36A 1E60A 4H16A 4XQGA 5IBQA 1EFAA 1FZQA 2PEYA 4DQXA 4RABA 1YL6A 2GM4A 2LV8A 4KFTA 3DE0X 3W5BA 2HDHA 3CMMA 2HDOA 3GFFA 2G1PA 2PJRA 1G8MA 4AG3A 5CG1A 1FJGB 4EGAA 1I6KA 1Q6YA 2FN7A 3PQ4A 4XAQA 4W7HA 4YMVA 4ESVA 3UWMA 1UBUS 3AERB 2HTFA 4AMUA 1SK9A 2VYVD 1I9GA 2J9GA 1B2RA 2ZRAA 4IEEA 4IJWA 1ETUA 3E9MA 1MVNA 1IY0A 1V41E 3WWZA 4BO6A 4YMTA 2H6EA 4CLDA 4UVEA 1G9SA 1JXQA 3K9WA 4TKMA 5F7ZA 5TJHA 1EP9A 1CETA 1YJBA 1VMKA 2BGLA 2XZPA 3D5TA 3AI3A 3GLGE 3USZA 1A4UA 3F67A 1F2UA 3CUYA 3UUWA 3ZBTA 4LTDA 3A9SA 4RPJA 3PEWA 4RACA 2FMUA 2QSJA 4TMKA 4D99A 3HRHA 1SXJB 3CWCA 2CN1A 1KMQA 3ZGOA 1I14A 2ORYA 3P19A 3G2NA 2GJ8A 1J8QA 2BUBA 5CCBA 1IMJA 3NHAA 1X74A 1CQIB 1UP4A 2GD1O 4UMDA 1QGAA 2OP1A 2UUBB 1TLTA 1LRLA 2Q3LA 4IVPA 5JZBA 4ZT2A 2OLJA 4QICA 3R9KA 3TOXA 1WXIA 1EFVB 2D8MA 3EDYA 4NL4H 1YZNA 2GUGA 2ZI9A 1H2WA 3AF5A 2JPDA 5J40A 4RYDA 3TCNA 1Q1QA 4BB0A 3ETEA 1YI8A 3FG9A 2E4ZA 3LS2A 4KACA 5TT0A 1W30A 1XV5A 4XDGA 4ZVLA 3OWOA 3DVQX 4YTEA 4Q4JB 4BQSA 4RTNA 5TT1A 3M70A 1C4OA 4RMJA 3ZUPA 4LF5B 3KKOA 4RCYA 1WCV1 4CDRA 1D1SA 1NN1A 5GWXA 4FYHA 4MCJA 4BVEA 4MSUA 4PVDA 5IJWA 3RYFA 4TZTA 5E1DA 3I2FA 2PXHA 2BM1A 1VLHA 2ATVA 3QFHA 4H4CA 3G9ZA 3USCS 1OFIA 4FDAA 1OD6A 1XF9A 1RABA 4UAVA 1IOZA 5EYPB 2PU7A 2QD1A 1GWNA 2JIBA 4HPXB 4BRUA 3BIFA 1N34B 3HCCA 4D7AA 2VQFB 2WWYA 1FYEA 4J2HA 3R5JA 2GTPA 2CK3A 4IQ4A 1AA9A 3AUFA 2VS1A 2ZDQA 4FNAA 2JZOA 2IITA 1WB4A 4N0QA 4GDFA 1YDWA 3U4IA 1JA0A 4YR9A 2NVOA 3LRPA 4FYJA 1AGNA 1JEDA 4MB2A 3VZDA 3MXOA 1B76A 5D6OA 3GH1A 3LI2A 3KJQA 5BSHA 3FOEC 4ZGBA 4HAXA 4LCJA 1M0TA 4O4IF 2OZPA 4YRTA 4A27A 1ZNWA 3EIEA 3HXLA 2J3JA 3JTMA 1J2UA 3KOOA 4BYGA 4CMKA 1EG2A 3U0VA 1Y7LA 2EW2A 2JJ2D 4PNZA 4FZJA 3B1WA 4BMCA 1ZVJA 1SXJD 4AWAA 4O4HF 2VPXA 2YW9A 2JFXA 4J90A 2P35A 4E51A 3PT9A 1Z7WA 3WLOA 2O2SA 1MV5A 2B37A 2QNBA 2H7XA 2MU1A 5FAXA 4B3DA 4ERXA 3KQMA 5T67A 1ECCA 2VJMA 2DSNA 5E4JA 5G0TA 4JP5A 5LC1A 1BD4A 4MO9A 5CRIA 1U8FO 4CMEA 1FTSA 5KS2A 3ZYCA 4QBFA 3GA0A 3NTVA 3U4DA 3THSA 2QZ9A 2BTQA 3QJ5A 4DV3B 4OYRA 4BFWA 3NIFB 3ZDFA 3U13A 1YVEI 2ZR0A 5L6LB 3CISA 4L22A 3A1NA 2HWYA 2Q6VA 4L5JA 5LSAA 4UVDA 1HYGA 1N7GA 2WG2A 2BKXA 4C0WA 2HQSA 1W36C 1MAAA 1QM5A 4L16A 4TUYA 5M04A 1RMQA 4FEYA 4YALA 5FLKA 3R7FA 5A9SA 5C2JB 3TVDA 1MABA 1BHSA 2Q4RA 2DHCA 3TNJA 4U2BA 3SVTA 3I2IA 4RADA 1WD5A 1HYEA 2FMHA 3D8UA 3KD2A 4J0DA 5TS2A 4P2GA 5EQDA 2X0FA 1UWKA 2Z0MA 1GZ3A 1JLLB 2UZAA 4I36A 4EGSA 4DR7B 1ADBA 2V7UA 3BK2A 1AO0A 3ISVA 3WZ2A 2A5FA 3O2SB 4P0QB 1E9BA 4JODA 3HJTA 1GQ2A 2YXNA 3IKVA 5FI5A 4JJKA 5AVQA 2FW1A 2GBIA 4KLCA 2GEVA 1Z5ZA 1EFTA 3GROA 3SEAA 1HTWA 4A4DA 4ERNA 2WHXA 2YXBA 2B82A 4G24A 4IJVA 5JDIA 3OQJA 3LNTA 4DSAA 1EEXB 2CUZA 3VR3A 1OOEA 1SD1A 2P5UA 4CNBA 3VUEA 4JL8A 3U9LA 1HGXA 1IXRC 1BO6A 1G7RA 3LMKA 5BOSA 4QELA 4P80A 1PUIA 1WZEA 1WMFA 2JFGA 4HDRB 3E8XA 1M7HA 2ZB2A 1T5OA 4ENQA 5KYGA 4U0KA 1T5SA 4Z4CA 4YAOA 2WE8A 4Q1FA 1KEPA 4MRMA 1US8B 2OCXA 4UW9A 4FGUA 4AZ0A 1DJLA 2HT1A 2GX6A 5LZ8A 5IDQA 2HX1A 3CNQS 3GP5A 1VG0B 3NU1A 2Q5QA 5G3YA 4F8JA 1LDGA 4Y2YA 1V3TA 1O6CA 4Q47A 3WBJA 4WLVA 3FCOA 4RA6B 3T3HA 1QS0B 1ZD3A 4Q1DA 4R1UA 3WDSA 1KTVA 3ECAA 5DU2A 4DNOA 4F93B 2QU7A 3FE2A 1SCBA 1E62A 1XI2A 1K5HA 2RAFA 1SXGA 2JJYA 3G5AA 2X0RA 3H6HA 2Q4BA 3QU2A 4TV8F 2VTDA 4GOXA 5JMPA 2FNAA 3CX4A 4REQA 4P4UA 2AQIA 3H5RA 2H1RA 1W581 3VMFA 1EP2B 5IW8A 1CC1S 2KM1A 4A92A 1XEWX 5B12A 3B13B 6REQB 1NW9B 2R8XA 3IT3A 2QAGC 4ARIA 1EESA 2ZUCA 1IEXA 1X80A 3TIVA 1OXTA 2JFUA 4MNTA 3SQDA 2NVBA 1U8AA 4MV5A 4DEVA 3T6KA 1WXGA 2XXJA 2REOA 2PGLA 3D1VA 3IRVA 4QRDA 5DIZA 3VHRA 1TK2A 2PIDA 1IY1A 3JQBC 1TFUA 5ARDA 3FOZA 2ZJFA 1UR5A 4URWR 5B4TA 3AHHA 4CL3A 1RKVA 5JUWA 4R6WA 4ZMRA 4G56A 2G1JA 1ZUIA 1WP4A 3BTVA 4RK4A 1FDSA 3OFVA 4DUGA 2PUVA 5HKKA 5SYNA 1W73A 1V11A 4NV3A 4RKWA 4IX9A 3CH4B 3H7AA 2FZWA 1Y3HA 5LXTB 4H3KB 4DW8A 4OM7A 5G0WA 4MQFA 1CJTC 4CQJA 3JRNA 1Q0UA 1STOA 1GNVA 3DONA 4CUKA 2AXQA 1Z3IX 4A9AA 1JHPA 4N3NA 5LYYA 5BRJA 5IJ0A 5K0JA 2XCSB 2UXDB 3H5WA 1N8KA 3O4FA 1YVUA 4L4XA 1BFUA 3DL2A 4I4IA 1MX1A 2I76A 3GUUA 3PKJA 4IJQA 2NPFA 4QQ8A 3A06A 1GNLA 3CEHA 3HVJA 1UQUA 3KLMX 4BDSA 1UAAA 5A02A 1BYIA 2RK6A 1BN6A 3PJFA 2GWHA 2Q46A 1UZLA 3ONWA 5IBPA 1QV6A 3ZP