1QCDA

Crystal structures of adenine phosphoribosyltransferase from leishmania donovani
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
236
Chain Sequence
PFKEVSPNSFLLDDSHALSQLLKKSYRWYSPVFSPRNVPRFADVSSITESPETLKAIRDFLVQRYRAMSPAPTHILGFDARGFLFGPMIAVELEIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGTALSGLQLVEASDAVVVEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLLSDDALTEENCGDSKNYTGPRVLSCGDVLAEHPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE
publication title Crystal structures of adenine phosphoribosyltransferase from Leishmania donovani.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Transferase
total genus 70
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 1999-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qcdA00
1QK4A 1VDMA 3H83A 4TWBA 1TC2A 3O7MA 5K51A 2FXVA 2XBUA 4PFQA 1U9YA 4P83A 4KN6A 4WN3A 1WD5A 5IPFA 4RHYA 1J7JA 1QK3A 4M0KA 1QCCA 1R3UA 1I14A 1JLSA 1YFZA 4P3KA 4P80A 4M0UA 5JSQA 1OREA 4RADA 1DQNA 1U9ZA 5BSKA 1GRVA 4PAWA 1G9TA 1JLRA 3OZGA 4S2UA 4RANA 4LZAA 1XTVA 5ESWA 1UPFA 1DBRA 4RAOA 2H06A 1TC1A 1D6NA 1G9SA 1NONA 3NAGA 1ZN9A 1QB8A 1HGXA 1I5EA 1ECFA 3OHPA 2E55A 3EFHA 2H07A 4F8EA 1I0IA 3QW4B 1A96A 3KB8A 4P82A 1A3CA 1HMPA 1OROA 3GGJA 2JI4A 5BQOA 1DKRA 1ECGA 3N2LA 1BD3A 3S5JA 5HIAA 1Y0BA 4LYYA 1A4XA 5BRNA 1A97A 1I13A 2GEBA 2YZKA 4RQBA 2C4KA 4Z1OA 4LZNA 4QYIA 5KAMA 1P17A 4RQAA 1PZMA 1OPRA 1L1QA 1XTTA 3MBIA 4RACA 4OHCA 1XTUA 1Z7GA 4RHUA 4LYGA 4RHXA 1VCHA 1CJBA 3LRTA 5JV5A 1IBSA 2P1ZA 2H08A 1GPH1 3MJDA 4ZFNA 5E38A 2VFAA 1W30A 4QYIB 5EUCA 1AO0A 3DMPA 4MB6A 1P4AA 2IGBA 4JITA 4RHTA 1O57A 3M3HA 1STOA 1LH0A 1G2PA 1V9SA 4RABA 1L1RA 1NULA 4WMLA 1BD4A 5IAOA 2PRZA 1P18A 4P84A 4JLSA 1DQPA 1QCDA 1BZYA 3DEZA 1ZN7A 4FYMA 2JKYA 3ACCA 1P19A 1UFRA 1I0LA 1ECBA 4QRIA 2AEEA 1FSGA 3LPNA 1A95A 1VSTA 1XZ8A 1DKUA 1QB7A 4X44A 1ZN8A 1QK5A 2WNSA 5KAPA 3HVUA 3ACBA 5HKLA 5ESXA 3OZFA 3GEPA 2JKZA 1ECJA 2PS1A 4X45A 2PRYA 1G2QA 1XZNA 5BQPA 1O5OA 2DY0A 4M0PA 4P81A 3DAHA 4P86A 4LZOA 4RAQA 1UPUA 3ACDA 1A98A 1MZVA 4RV4A 2HCRA 4IJQA 3G6WA 1ECCA 2EHJA 3GGCA 2JBHA
chains in the Genus database with same CATH superfamily
1TCVA 5T7BA 3O7MA 4YGXB 5DHPA 1RAHA 4A16A 1R4MA 4PSUA 1GLNA 1WHTA 1W85A 3IUYA 4L0DA 1OTXA 3JWJA 4RV9A 1RADA 1GNTA 3QYJA 5A0FA 3RIHA 4AN4A 4EHDA 3BKXA 4TMKA 3L9WA 1SXJB 5C18A 3SAJA 1IMJA 2XEDA 4L4RA 2GBCA 1Z0FA 4LRSB 3KQVA 1ZPDA 3RGGA 2BMWA 4RLQA 1TJPB 2V8OA 1JU4A 2O1XA 1MOSA 3CXUA 2OCBA 3CURA 3S2ZA 3VMMA 1EVEA 3EASA 4HQ6A 5E7IA 2G5PA 3FGNA 3K15A 3OHMA 3AI7A 3G1TA 4TYPA 4MKFA 2ZB2A 5ICMA 1BU5A 1P6XA 3AFGA 3W5BA 2AJLI 2QX6A 5ALOA 5JPDA 2V97A 1Q7CA 2JFNA 2PSDA 3AETA 3OQ6A 4BWYA 2Q3EA 5A3JA 1QYIA 2PWYA 3PCXA 2I6TA 4FDVA 4PF1A 5SICE 1QCZA 1R0RE 5GMOA 1R5JA 4N47A 4ZOLB 3WYCA 4DDUA 3SJ7A 3HCPA 2H85A 3T1QA 2WYOA 4EPTA 1BVHA 4LGYA 2E37A 2VZ8A 4KQ9A 2C5LA 1OZAA 1II8A 2P91A 1V8OA 1O95D 1AHNA 3H5IA 4U5QA 1FMFA 4IGKA 1CZOA 2QT9A 3FY4A 5T3YA 3JARA 5C1IA 3JD0A 3WGYA 2VQFB 3X1XA 4G9EA 1IY1A 3D8TA 3NHSA 4CGYA 1NFRA 3CF2A 4C4SA 1EK6A 3NOQA 1XD9A 2PX0A 1NI3A 1H65A 3QWBA 4I66A 1SRRA 4I3GA 3AU8A 3RWBA 3GMTA 5A9RA 3C1OA 4BJ3A 2O2YA 1VCHA 4P54A 3IQGX 1HPLA 1I7NA 1X7YA 1ZDMA 4AWBA 3D7KA 2ZRAA 3NAQA 4GOND 1UAAA 1JEAA 2YMQA 3GFOA 4HQLA 1WNFA 4D3ZA 3E7XA 3GN1A 1U2DA 3OZUA 5F1KA 4Z9BA 2IYQA 4CGZA 3VNVA 3O0DA 1C8BA 2B7CA 4RU1A 1BROA 4IOLA 3WP1B 1VYUA 2Z3VA 5A6SA 5JADA 1CBUA 4HC4A 1QYWA 1W5TA 4JKIA 1JW9B 2QW0X 1T26A 4BNDB 3MWEB 2WVGA 3K73O 1YCHA 2EZUA 4O4IB 4MLZA 4YO7A 2IU3A 1E3TA 4F6RB 4MA0A 2P7IA 1QGUB 4I9HA 5A04A 3E22A 3DTYA 3SC6A 1FTWA 1AGYA 3KR1A 5LA6F 4RGQA 5IAGA 2QSYA 3U9SA 3TQSA 3ZWVA 4DMCA 2GAIA 1J2YA 1G6KA 5I6DA 5K6AA 1H2WA 3GHYA 4PBRA 2RC5A 3R7WA 2PEYA 1RXEA 3IDAA 4AW9A 4LYAA 1E94E 4IG9A 2YTZA 1XCJA 5A1TA 1R6VA 5KX5A 2E4WA 1MB2A 2IDMA 3ORHA 2VYVA 5AVXA 3X1YA 1RZRA 4DRYA 4EGFA 1ADGA 1I2ZA 1NJ6A 4OU4A 1PU2A 4TLBA 3UAGA 4GOXA 4M6WA 3M0EA 2EJCA 3ZOZA 1MB3A 1OJ7A 1T9HA 3BEDA 4JC8A 2I4MA 3QLJA 4IY1A 5FRDA 2XGJA 4G5HA 1FVXA 2GF9A 2Q4EA 2YWBA 3M49A 3O3NB 6ADHA 2IYUA 3AESB 4YMIA 4NV1A 5C0OE 3FWZA 5E6SA 1W5SA 1D0VA 3H1GA 4X1KA 5AM0A 3BBLA 4Z5XA 4YRSA 1S2DA 5CVEA 1TAUA 2KB0A 3NM6B 1LI5A 5FBRB 2R6CA 3U0BA 2ZSUA 1TT5B 4YO8A 2B3TA 1KPIA 1DT5A 3AF4A 3L40A 3FBWA 3RQSA 3DH0A 3U7QA 1ZXBA 3FGPA 5ELMA 3W1WA 4BCDA 1HY3A 1RLOA 1HEUA 2DQSA 2DZDA 2LKCA 4LBWA 4LK2A 4MCAA 5KYVA 3HUTA 1BX0A 3EFOA 2V6IA 4KK3A 4CF4A 3WRYC 3H7IA 1EK2A 2Z95A 4GUAA 4HWRA 4JIMA 3TTSA 2CL6X 1MTZA 2XQJA 4XWAA 3OEEA 4PG8A 3VTAA 1D04A 3LL7A 5BN4A 4JYPA 4ETIA 1O8CA 2OL4A 4HLUC 5IUNC 1TQ8A 4W6ZA 2YY6A 3QJ5A 4UE6A 4EYKA 5CFPA 1IXKA 4LYDA 1DP4A 1I1OA 4UUQA 3IQEA 4I1OA 3AJEA 3I2JA 4POOA 5CYPA 5LQKA 3EPRA 2QK4A 3ENVA 5GAJA 4B3MB 2UVPA 1VSBA 3OICA 2II6A 2ZUUA 2AK3A 3LNCA 4F72A 3LWBA 2XUFA 3EZ6A 1E6WA 2Z5GA 3ABOB 3CH5A 3K5IA 4KH0A 5HOQA 1YS7A 5HZHA 2EXXA 1RJFA 2RSLA 4UMEA 2RGCA 4P6VF 3HI4A 2PD4A 5H3HA 5JIBA 4D9KA 4IHAA 1EWVA 4MB0A 5DWQA 3G9QA 3ABQB 1P7YA 3CVVA 4BGDA 4IICA 3GRKA 5C8ZA 4F1JA 4O2BB 2XRZA 4PRZA 3GAZA 4YTEA 4E88A 1RXWA 2ZU0C 3T41A 1HWYA 3R44A 5C8XA 121PA 4DMHA 4GXQA 2OEPA 2W8ZA 1PHPA 4GRIA 4B0PA 4QQKA 4ADSG 2VJPA 3I5MA 4LXXA 2Q2NA 4BZWA 3N8GA 3R6LA 4GNRA 4HQNA 5CDUA 2JIPA 5HIJA 5KTYA 2DPGA 3QVVA 4UBOA 3DDZX 1DUIA 1FP2A 2QLMA 5INTA 2PLFA 5B1SA 1AURA 1RPNA 4I5DA 4BASA 2WWYA 3MHTA 4WXEA 8LDHA 2VO1A 5AKEA 2WF8A 5D7BA 5JQWA 3R5KA 4Z0TA 3EG5A 2I8LA 3BTSA 4LTMA 2HF9A 3OMXA 2AEEA 4QBHA 2BKVA 3ZJYA 1AKWA 2C9YA 3RASA 1BQEA 1XZMA 3PC6A 4RA6B 4TRRA 4C3OB 3R7LA 3TUIC 2OAP1 4RD3A 2ZZKA 3WI7A 4JLNA 2FR1A 3M6VA 5KAPA 3SVTA 3MNFA 2H4XA 4G0VA 1ODIA 2VDNB 1RTKA 1VDZA 4CKXA 5KTNA 2H9YA 1XMQB 1VJ5A 3MGKA 1JE0A 1N92A 1O0SA 4HVTA 4X1IA 3K70C 2HM7A 1PK8A 4LQLA 2H2FA 1J23A 3D8UA 4IGAA 1U0GA 2VXYA 3LT0A 1FTNA 4IH1A 1THTA 2C0PA 1JAHA 3HLYA 3TQHA 3V9PA 3BE5A 2R47A 3DAGA 3THXB 1MOQA 1GPYA 2GRAA 1PLKA 5CXXA 4EYEA 2M1XA 1UC4B 5FBZA 5JFOA 4GMKA 2XNKA 4OJNA 5B3LA 1YIAA 3OBBA 1U3WA 1TVEA 3NRCA 5JMOA 4RGYA 3NV7A 4BLUA 1HOXA 4L7QA 2B4QA 2WSMA 3YASA 3FF4A 1T9BA 4UZFA 1Q7BA 3AX6A 2ZUTA 3TTYA 1YQGA 2IODA 2VPQA 4DSTA 2FZKA 2ZJ6A 1BC5A 2ESRA 4C43A 1X74A 2AT1A 2H65A 4JJ6A 1ITZA 5HYVA 2D2VA 4YXWD 4G07A 2PT6A 2Q5QA 2AFIA 4Q9LA 1EVZA 2F3SA 2G8NA 2ZZMA 1EVKA 2OLKA 2XOXA 1GG2A 5IBCA 2SNIE 4OA8A 1F0YA 3P1JA 2NOAA 2AL7A 3QPAA 4LJ9A 3JAKB 1NG9A 2Q2OA 4YMUA 3MJFA 4KPYA 4EB6A 2VHTA 3L2OB 3R3JA 2ZUWA 5FI3A 1UXIA 2BFEA 2VKQA 3PC8C 4LRTB 3DJYA 4FCTA 3BXPA 1QLWA 4B9AA 5HZMA 2XCOA 3LT4A 3ZXUB 4HBGA 5HILA 5F5NA 1Q77A 2VHZA 2PJUA 5DDIP 2N42A 4U9IS 3LVFO 5BQOA 5L3QA 3RYCA 2CNDA 5FOVA 5D1NA 4OHBA 4HWOA 4QUGA 3G2QA 5BW5A 3R24A 9LDTA 2JAHA 5CD9A 2QG9A 1R8YA 4ARCA 1GRCA 4CEIA 4DABA 1KO4A 1Z3CA 4CIAA 2XWQA 4NARA 1N9ZA 1LFAA 1Z82A 2ZBQA 3HB0A 5SZHB 2KJQA 5KNDA 2PYZA 2PCJA 3EGCA 2G1PA 1LF5A 3LHFA 5CD1A 1JR4A 2WWGA 4F97A 2F4VB 1GRRA 2YIJA 4F56A 2GEUA 1QTIA 1NW7A 3ZJVA 3TL3A 4DPLA 1Q6ZA 3BIJA 3DR5A 1W6UA 4CL2A 5MGBA 2RARA 2HLDD 2WR8A 4DIEA 1V48A 2IY9A 2MSCB 3COVA 2DKNA 3GXBA 4CM4A 2O8BB 4GLFA 1NY6A 2D5AA 1CQZA 4A0FA 3OQIA 1IULA 4UEKA 2F48A 2HRRA 4ZVUA 1SXJA 1T0JB 3VM6A 1E62A 2QRVB 2X13A 2DG2A 2ZIUB 4EEXA 6Q21A 4UEWA 5BRAA 1Y9DA 5EEHA 3TGWA 1JAZA 4J1TA 1GTMA 4IHQA 5FJIA 1BOFA 1JRLA 3FYUC 3K0CC 1ESEA 4FYJA 2D7CA 5E9QA 3PL5A 4A1FA 3K70B 1GP2A 2JKYA 4G63A 5HIIA 1GQ2A 5CVUA 3PGXA 1UDXA 1E0DA 1N3LA 1NXVA 1EDDA 3BFJA 4F7WA 1YA6A 5TB5A 2ZJ4A 2CE7A 3TDMA 5A4DA 2WKSA 3U9TA 2PN1A 4E70A 1YF3A 1NQUA 3AGPA 2IX9A 3UFXB 4YUZA 3A9VA 4GKAA 3GDWA 4P31A 5TC4A 2J8ZA 3CPHA 4W1RA 3RYHB 5IKPA 2NU7A 2Z1MA 4WZAB 2EZ9A 3DZJA 3FGOA 4NFLA 2PZKA 3FAKA 3UVEA 3EK2A 4ZOLA 4EYGA 4I8DA 1E6KA 1K9VF 1TZJA 2C3YA 3GLRA 1CY0A 3GI1A 3H2GA 4II7A 2XITA 4UM5A 1ZWKA 5DKFA 2DJIA 3PR1A 4MYHA 4KXNA 4KB5A 3ASYA 1M8GA 4MRSA 3NIBA 1V7ZA 4JNCA 1QU3A 1PG2A 4EJ2A 1OFVA 4XSGA 3EH1A 2R5WA 2C2WA 4XEHA 1UXKA 3R8CA 3UC5A 4ZICA 2XDWA 3DBHA 1E9AA 4GW3A 1WCYA 4MVJE 1ZOLA 5BR7A 2BGGA 1N0VC 1CVLA 1ZGBA 3QXHA 3C7CB 4EY5A 5TQVA 1VTKA 1GZ6A 1AQNA 1Z18A 4O8ZA 1EFKA 3ER8A 2JD2A 1UFQA 5HFNA 1XU4A 7ABPA 3BH6A 3RHTA 1L5MA 4UNSA 3O8LA 1QZTA 4PICA 3SNKA 2H4JA 3C3YA 4HAZA 1ZHHA 3SFZA 2XWBF 3GLSA 5F33A 3IE2A 1Z5OA 4BEJA 4DG5A 3ABRB 3PYMA 2O5VA 2CNOA 4US2R 5CH8A 4OA5A 3A4NA 4KBGA 4HUTA 3FLMA 4KPUB 2AN4A 4BL5A 6LDHA 1Z06A 4E2ZA 1F0KA 3KPYA 2PMWB 3ICVA 1IB6A 4NAUA 5BVHB 4C7MA 1A04A 2A5YB 2GM9A 3QW2A 1JAXA 4GX5A 4WQMA 1A9XB 4QUKA 5E6UA 1P62B 1QLHA 4RVDA 3GCGA 3DEKA 5EXDA 1XA3A 2YOFA 1M34A 3QQ5A 3WAKA 4OJYA 4TXMA 5LKRA 3UJ3X 2P4EA 2X8WA 3Q2IA 4B4UA 2Z83A 3AIMA 4G0PA 1CX9B 3TJRA 1AMNA 3KJFA 1OWNA 2BLLA 2FE1A 2JGFA 1RCUA 4WLUA 4ZPJA 4BTEA 2JFBA 4DCVA 4JHLA 5JJKA 4CL8A 3WLEA 4F3RA 2MINB 2WTAA 2YJ5A 4IQFA 5JHHB 2PAAA 3RAEC 4JDPA 3VYWA 3LCCA 3KJZA 3HKDB 5FLKA 2H17A 2CUTA 3I2IA 4JT8A 2HF2A 3PXXA 5A71A 3WK8A 2XIQA 2W22A 3IIIA 3KPUA 2GK6A 3DTVA 4MPPA 3FPAA 3IVAA 5HF5A 2X2PA 1AUVA 1IG0A 3C3JA 1M6YA 1YB5A 3HZZA 5ALDA 1W1UA 1F51E 3ET4A 3FYUB 4E5NA 2JGDA 4LF8B 2QL7A 2YJ4A 2ZATA 3TXXA 5A06A 2XA9A 3D6HA 3KETA 2JGNA 4UEOA 1U7DA 3M2TA 1XJWA 4RYLA 3SDBA 1WPQA 3DT9A 1JS1X 1KE2A 4IP0A 1YSCA 1K3TA 2WDPA 1WKBA 3V1NA 2JG3A 1QJCA 4Z1MA 3D2BA 3I9NA 1KEZA 1UZAA 1PBNA 2RHJA 3OZSA 4RTLA 1T9GR 2RHOA 3AUTA 4Q7KA 2B92A 5EKDA 2D1FA 5EFZA 3V34A 2I9KA 4PZ9A 1M0SA 1H8ED 5C5CA 4N5NA 2EZTA 1R18A 4G0ZA 4FMDF 4H4EA 1DV1A 3BK2A 1GYQA 1PL0A 1DCKA 4V39A 3HCEA 5EZQA 3O2JA 1HZZC 3CONA 1RCTE 2F43A 1PR4A 2GJ4A 2QNBA 4XM2A 2OESA 2YVLA 3VQTA 3WDMA 1NF3A 3OKFA 5AK5A 3N2NA 2X0DA 3V5NA 3VO2A 4PHHA 3KVNA 4ZARA 3AP3A 5LP6C 1LY1A 3C8UA 5DLPA 4CE6A 1A5ZA 3SJBA 5HNKA 4IIYA 1Z7EA 2OFPA 3C7DB 3AI3A 2ZDQA 1EM8B 1F8FA 1ZK2A 3KHUA 4B44A 4EHFA 5CAEA 4PPQA 4NOMA 1IFXA 2I6FA 2BBSA 4TYMA 2XW6A 4G01B 1RRFA 1P75A 2VXBA 5TSDA 4HAWA 5G53C 2I29A 2Y1EA 1VGQA 2QRZA 4NPCA 1Q2UA 2WVHA 4HFNA 4RAQA 4PU0A 4TL8A 2PR2A 3SXPA 3EEOA 4ZYZA 1FB5A 1SQ6A 2WEKA 4HDCA 4IH4A 4BQOA 1NMSA 1M67A 2QRGA 4G1CA 4AB1A 5CHEA 2PH1A 1Y8ZA 5KX5F 1KQPA 2A9OA 4R2LA 3QEMB 1II0A 2R97A 3ZV7A 3KSMA 4BFVA 1G18A 4LZZA 4XQ0A 1NJ5A 2YJ6A 2DKFA 3A2LA 3G5MA 5EHQA 4DIKA 5KCZA 1ST3A 3QX8A 4ZAFA 1E2DA 4L74A 2P68A 1GNRA 1X1EA 2IK8A 4M0KA 1ZWLA 1CEXA 3GFBA 4TWIA 3ZCVA 1NI5A 3QX7A 1VE1A 4D82A 2P3OA 3WKAA 3O3CA 1QDLB 1B15A 4OQMA 4FEGA 4K40A 1J0BA 5D2CA 1AH2A 3CLRD 3GLQA 1VBNA 1QIHA 4ZA2A 1BX1A 4JT2A 1G4UR 5LQRA 2EJUA 1YZHA 3C6BA 4DUPA 2AJDA 3AHCA 2PX2A 2UU9B 1FL9A 3D0RA 1EWRA 5MFPA 4ZKEA 1M8KA 3A2KA 3DOUA 3F71A 1QB8A 4ND4A 3R3HA 1JEYB 4KW7A 2IYYA 3OHPA 3DDWA 3QEOA 5D3MA 1N5JA 2HNAA 1ZEJA 4DUGA 1Z35A 3PDCA 5I8WA 4J0EA 3ZE9A 2X14A 5J3JA 3K16A 3I6IA 5ICCA 3WLKX 4A36A 1LX7A 4C5CA 1U1FA 2ZTUA 4RF2A 3BD9A 5ALKA 1E64A 4Q4DA 3M8KA 4XIYA 2NM0A 3B60A 3I39X 2R6JA 4JXJA 3S81A 1XKXA 2YNMD 3DEYX 4MLCA 3AWIA 2NUTB 3C97A 3LP6A 4D4GA 2HSJA 1M2OB 1KJQA 3LX6A 2YUIA 1Q1NA 2ZYGA 4PWYA 4RZHA 1GQOA 1U28A 1YB2A 1O03A 1VLLA 2H00A 4RZSA 4BE9A 1K6JA 1W9MA 5IFLA 4KIJA 1EVQA 2RJOA 4NR0A 5FUWA 4C7BA 1N2CE 3SZ3A 2HF7A 2YX1A 4U9UA 2P9TA 1HYQA 1DRWA 5E1BA 4M2LA 3RFTA 5L3SA 1RYYA 2F64A 3PUZA 4IZOA 2RBEA 4KFUA 4UEQA 3TXAA 3DB2A 1O0BA 2YR0A 2QN6A 3NOOA 5FPQA 1RYMA 1DNPA 3M5PA 3JZIA 4TVBA 2BBOA 1OZGA 4WRRA 4F4HA 1ZOSA 2Z58A 1GYPA 3UAOA 5KNCA 2OWEA 3SEQA 2IUYA 1GU7A 3EZLA 3GFRA 3O3MB 3BB1A 1T4MA 3DLPX 4LMBA 5T41A 3S27A 3I4FA 5LP6B 4ALLA 1V9LA 4IPTA 5EPUA 3QBJA 3H8WA 3JWPA 3ZG6A 1BGWA 2XUKA 1RJ9B 1WEHA 3RGWS 2RGYA 3NV9A 2X0IA 4HQRA 1WMFA 1XX6A 4D96A 3PITA 4JKOA 2WU1A 3GY0A 4HNAA 3DS8A 4NZMA 4XPZA 1TRHA 1BS9A 2REQA 4C4ZA 5A5DA 4C4XA 5B4VA 1DAIA 1P3JA 1Z4OA 3TD2A 3DE5X 2WY2D 5I4KA 1V71A 2FHSA 3MTQA 1XWFA 3QV2A 2X5JO 3NCTA 3IVXA 4DSNA 2OBFA 1T4CA 1UDWA 2VUSA 3D81A 1XTIA 4WOJA 1B16A 2DHCA 5CCEA 5IUJC 1XO1A 1EFVA 1JSZA 1QV9A 2I3GA 2HREA 3WYFA 4PIPA 1UXHA 1Y3HA 3VPXA 5EJ6A 3RF7A 4KYTA 4WXHA 1LLQA 1M6VB 1KY5A 1QF9A 1XCMA 1LPBB 4I99A 4IWXA 5IN5A 2AF3C 2BISA 3EHEA 4DMRA 1LBEA 2YMLA 5JXIA 1CUVA 1ZL2A 5ADUS 3PPWA 2AW3A 1ZEMA 2DFTA 3Q3EA 1W75A 3VTZA 3IL2A 5JAZA 4R83A 4GLOA 4MAAA 3N8NA 4JENA 2JJ2D 1J90A 3ORSA 2JHFA 1UXGA 5ECGC 2A5LA 4ZI3A 4HNHA 5DBGA 3IOEA 4NF2A 1AT1A 3F6BX 3BYZA 1QG2A 5DX0A 3X1ZA 4B48A 3BWVA 1EFAA 3MJHA 2VRCA 4S05A 1J1ZA 4XIGS 4NBSA 2Q2VA 5B2FA 3W5SA 4GP9A 4KE6A 4KX3A 1P9RA 1YQ9A 2O2SA 3E7PA 2VF8A 3FW1A 1H2HA 3EMDA 1RT9A 3NVAA 4LAFA 5DM0A 3WB0A 4CG0A 4UMFA 4GE0A 2JGKA 4G5XA 4Z7JA 1IQUA 1LQ2A 4BDTA 4YBZA 1N25A 1HGXA 1DIGA 1T2NA 2M32A 3R77A 3W79A 1NP6A 3OJ0A 4DHWA 3TR6A 2AMVA 2I5PO 3NYRA 3HFRA 3UMGA 3VPCA 4B75A 1NMZA 2C2GA 4BZQA 1DC6A 5EKTA 5K03A 1JFRA 1V95A 1V3QE 1OGJA 1QGZA 3I32A 4Q5IA 2EP7A 4FUQA 4EAQA 1KARA 1T1IA 3NFYA 2EFDB 3JQ8A 4FW8A 5HRAA 2XHZA 4PZYA 5IVIA 5DIFA 2NADA 5FBQB 5DI9A 3W6OA 4EENA 3EZXA 4YAKA 4G4SO 1ZD9A 3D0KA 4M1WA 2V7PA 3OHSX 5HJ2A 1S01A 4CCAA 4BX0A 3A1CA 3KQOA 3ZKWA 1M2GA 3Q9SA 5A6VA 1F60A 3GJ5A 3H87A 3N3BC 4B17A 3B3QA 4MOWA 1OPRA 1W4CA 3LUCA 3A8TA 4FQ7A 2EVWX 3HXQA 4DMFA 4KG7A 1JXQA 1HT2E 1QIDA 3BD7A 3E9EA 4UQOA 4AJHA 3TR5A 2IP1A 2YYSA 3ISVA 3EXHA 1SIUA 1HFWA 1HF3A 1W4ZA 1WMDA 2VNJA 3K3PA 4IIEA 5P8WA 4M86A 3W3AA 3TFWA 2Q3BA 3FRJA 3Q88A 4KJZA 2ZIWB 2O7NA 4CHTA 4YMWA 2IDKA 3KQMA 4MW7A 2JRLA 3A6HA 1KKLA 4FGUA 2JFVA 2PUJA 3RS0A 5FTWA 1EFLA 4CN9A 3MRSA 3NKFA 4YDSA 4W7IA 5AJZA 4CMEC 3NEPX 3UUWA 2JHGA 3M1LA 4JGIA 4X3OA 3PHBE 4L57A 4UM7A 4EELA 3GDOA 5C81A 5IK2A 1BD4A 2QBYB 1CJCA 2VDVE 2RHBA 1ZYUA 4Y2TA 3PE6A 4IV0A 2HQ1A 1HORA 5J1TB 1XN4A 4QDXA 1FFXB 4XGKA 2CFSA 2OKCA 3VZSA 2VP2A 3ZJUA 1PZGA 5DXJA 2NSYA 2JBAB 4IUCS 3ZHSA 1T6NA 2P67A 4E0BA 4KI7A 1F8GA 2C5SA 4IJ6A 4QPNA 4XARA 4QGSA 3A4VA 3KAJA 4HXGA 2Z04A 4Q7LA 1Z26A 3HDVA 3HNPA 2GX6A 3M6XA 3WGOA 1KMQA 4WUTA 1EXMA 1Y98A 2EJWA 4G1FA 5AW4A 1ZQ9A 3ILHA 2QM8A 2XZDA 2X2FA 4R3NA 1LX6A 5CDGA 1XD2B 1YOVB 3W5DA 3WK6A 1NM5C 5J58A 2NYUA 1NY5A 4NHOA 4Y9UA 1BX3A 1WCIB 2QD1A 1AO3A 5BQPA 3T7CA 1EJ6A 3H5LA 4J0KA 2GDJA 3KZ1E 4D9EA 5JS7A 3GJQA 2Q7XA 4C89A 4S3MA 1F4PA 3LFTA 1OZFA 3QE4A 4DN6A 3ZWDA 4BCCA 3IUEA 4GZ6A 2OXCA 4ER6A 1SVWA 2ENWA 3L6DA 2Y9PB 5CB4B 3FH0A 5CB8A 5GTDA 3C3BA 3CRW1 3JQAB 1XMPA 2LCQA 3W9YA 3QY0A 4Z7OB 1PQUA 3C85A 4PR0A 4MAMA 3LQYA 4BFXA 4AECA 4WVLA 1Q17A 4LJRA 4P80A 3WNBA 1E1QD 1ZUWA 4ALMA 4AP6A 3ZC3A 3PJRA 1XYVA 3U3RA 5D6NA 3A6EA 1GG8A 2FOLA 3VYTB 4LA4A 2XZTA 4RANA 1PR1A 4L0QA 4WCDA 2QY9A 1VLZA 2DH5A 2H06A 3QXJA 4AURA 3RYIB 3K1JA 2GN8A 4LNUB 1EWYA 1T1JA 5FYQA 5KSPA 3PGLA 3JQEA 4M0CA 2Z6AA 5EJMA 4D79A 2E7ZA 5CTJA 5A4FS 1QH1A 3EODA 1BHO1 1BRTA 3ROGA 1JIKA 1HMPA 2QSUA 3RODA 4YCLA 3MD0A 4DSOA 3UENA 5LDDC 2H59A 4GO1A 1JVNA 3TFQA 2IE0A 1WUHS 2V7QD 1J0CA 3X1JA 2I4TA 1T0HB 3ZWNA 1LNZA 1P44A 1AS2A 1P1FA 2X0JA 4U3JB 5DBEX 4N0EA 2BF4A 4RQBA 5IU6A 4NCKA 1B6TA 4CLXA 3WFIA 2H7XA 1E92A 1EM8A 4X8LA 1V8BA 4CTMA 3RUHA 5J2TB 4CLRB 5LC1A 3P2EA 3KO8A 1GNPA 3BSFA 5JJ5A 1Q0HA 3L0ZA 3EIOA 4KWTA 1L7AA 5AW5A 1KFBB 4CTOA 4M99A 2QRNA 1T4DA 2HX1A 2G9QA 1OUMA 2BM1A 2NUBA 4K5QA 1ZH4A 3HFSA 4KVAA 5CNJA 3OQMA 3F5FA 1ZO8A 2VLBA 3IVGA 1MA3A 4RE6A 4A5OA 5BNIA 1VJDA 2O0MA 3LGAA 3QEMA 5GONA 1AOXA 4GS5A 1D2EA 3PENA 2YINC 3STTA 2X9GA 5LQJA 1NQWA 3CLSC 5JAUA 5JXWA 2ACKA 2FZ4A 1SQ0A 3GGOA 3CUYA 2CCGA 3NI2A 4O25A 5D01A 2NN3C 5DM2A 2XE8A 3TW8A 4MUEA 1OAOA 3UWOA 2XF2A 2PS9A 4TV9A 1NPDA 1VZ2A 1Y6ZA 5EN4A 3AEYA 2J33A 3HB5X 3NO4A 3SX2A 2ECPA 1E2IA 1S02A 3HY4A 4AMBA 4B35A 5THQA 3V2UA 3WIEA 3D7NA 1LVGA 3WHKA 4D97A 1GL9B 3FBGA 2D2IA 2PBFA 3EMBA 4S1WA 4KXYA 3WGUA 4AF6A 4X62B 1C2YA 4UQLA 1PI3A 2YWCA 2XTAA 4BN4A 2VYQA 1BN7A 3DSRA 4NQRA 1XCBA 5K4AA 1WB5A 3LTNC 1GUYA 1KFJB 3K0HA 1WW2A 4C0JA 2GXAA 1DIRA 1F38A 4QA9A 3AVWA 1G8PA 3BJZA 5JCZA 3P96A 4Z6KA 2VAVA 2WTBA 3V48A 3Q8LA 5HM8A 4R05A 2GNOA 2OXRA 1X1TA 1X0VA 3PWSA 5EC8A 2NUTA 3O3OB 4NBNA 3ELYA 4EQ6B 1AMOA 5DTRA 1MV5A 4IIJB 1HL7A 3KUUA 4DR6B 1DKMA 1VE7A 4HKTA 2B94A 4BNFA 1R2QA 1GXSB 1MC4A 1UDRA 5GM1A 4QBGB 1CIPA 3LIIA 1KO5A 1NI4A 1TA4A 2GK7A 3I0NA 3MIIA 3OA0A 2LPMA 1CF4A 2XGOA 1WZEA 3OOEA 4ZQCB 3NAZA 4XQEA 3WYEA 4PGFA 4FXPA 2I55A 4P7KA 4QDJA 2WHYA 1WMAA 2YCLA 4YRQA 4COKA 3UPUA 3Q7QA 4GQAA 2V3WA 2Z2ZA 3ZQJA 1OBOA 4IQGA 1V1MB 4NICA 2ZFUA 4RAOA 1G1MA 5JMPA 2HA4A 4BO3A 3AB7A 3TRKA 1MRNA 4G65A 1PSDA 2P79A 1ND5A 2VK8A 2ZANA 2ZEJA 3ORFA 4REMA 4WK4B 2GXQA 4NP6A 1Y33E 4MUJA 1I0IA 1OV6A 1TEXA 3SMQA 4ZOQI 2Z1NA 4FN5A 3PEFA 3HU1A 4B3SB 3GUUA 4ZRMA 2F6RA 1XTQA 2G1AA 3KKLA 4QPJC 4Y9RA 3V4ZA 3WWCA 1I2CA 5K8VA 3SZGA 1UJCA 1XRQA 2OV4A 2MYPA 1CJSA 2WG1A 5JCJD 3U5TA 1AIPA 2ZKLA 3HB1A 5C5EA 1HXHA 1MTOA 4L9SA 4Y1GA 2GJ9A 3MM4A 1MAHA 2YYAA 4M8LA 1TW3A 1PGQA 1Z0SA 1FYVA 1P39A 3X1MA 3WWZA 3UJPA 2CZCA 2GBLC 2QAJA 3HB9A 4GECA 3AEZA 2CLDX 1G3IA 1W0CA 2EG5A 4FZ5A 1EWKA 1NW8A 3AQIA 4Z4GA 2ZWOA 2EHDA 2W4MA 3BRWD 1A7JA 2GPWA 3OU2A 2XB4A 1M6VA 3D5TA 1G2IA 4ZQIA 4Y2SA 3PFKA 4Y2PA 3S0JA 4B2LA 2ZI6A 4OXRA 3WMGA 2ZSHA 4RJ2A 2W6NA 3GQBB 5LIPA 1HZJA 2VDKB 5FBWB 1PIWA 2DUWA 2D4HA 1G20E 1Q20A 2GHRA 2ZJ8A 3AJDA 3DE7X 2XNHA 2IGBA 3AKEA 3IGFA 1O57A 3NNDA 4GP6A 3WRXC 4BNHA 4F96A 4ENRA 2H1HA 4HDRA 1VJ1A 1XF9A 1Y6JA 3V8RA 3ZQ4A 2MJLA 3OTQA 1R0CA 3AKCA 2ZJOA 2G17A 3PFIA 2H7CA 2VYNA 3JQ9C 5DF1A 5ED0A 5IF9A 1NTRA 3PD1A 3QEBZ 3RVDA 1QO0D 3DNPA 3LRXA 1KETA 2AFRA 2XSZD 3CLVA 3GA5A 3VR2D 5KBYA 1EFHA 4U8HA 4HD8A 4RPGA 5DHRA 2FOIA 3A4MA 3M4ZA 3P20A 5CH5A 4GQBA 3U4AA 5IYZB 3GAFA 2PUFA 1NUAA 1DAOA 1YZLA 2WM2A 4YWJA 1UFRA 5IJXA 3BC1A 4A15A 1T8TA 4UHFA 3E1SA 2XMRA 3IS3A 3DJFA 3CW9A 3ZU3A 1DJQA 3E2IA 1WUYA 3U2QA 2ZXUA 4C03A 4WKBA 2IVZA 4O0LA 4OOFA 3WGNA 1VXRA 3A1VA 5DYYA 2WYUA 4IKEA 4PX5A 3V1KA 4Z86A 2O07A 3UMYA 1ZR2A 4CEJB 3I73A 2HU2A 3GGSA 3HA7A 4NMLA 4JI7B 2Y68A 1UZUA 1XMSA 3HBNA 3H05A 1S7CA 4PCVA 2Y0CA 5A9SB 5AUNB 5CH3A 4D9BA 4KAAA 3C2QA 3UWKA 3C5VA 4ERXA 1W94A 5I7AA 2OKGA 5J4HA 4MEAA 3JSAA 1GM5A 4C7XA 3A4LA 1KQNA 2OFXA 4RXUA 1SAYA 3MB5A 4WCFA 3FDZB 3UKOA 2AJ8A 2I3BA 4RY2A 4Q03A 4WY8A 1ZG3A 3UJNA 1RWVA 5KOYA 2GNPA 3BXFA 1O97C 3WB1A 3BGSA 3DL0A 4MW4A 3HM9A 2LCFA 4OHPA 1LGYA 1KYWA 1JDTA 1SY7A 3T5GA 2JW5A 5TF4A 1J22A 1NMEA 1NRJB 1RHJA 1VA4A 1H22A 2HRQA 4B3HA 2VA9A 4BJ6A 4ZYUA 1Z8HA 3DLCA 2Z8YM 4M9QA 2I6XA 2J0UA 1UPTA 2GZSA 1HTBA 1M1YB 5CBPA 1SEVA 5KINB 5IJ0B 4F71A 1ZNYA 1N36B 2RGBA 3I30X 1HG0A 5LIRA 5KDLA 1ISFA 4PTZA 3IPXA 4UU0A 4RSHA 5HF6A 3CR3C 4J03A 4DQVA 1OAAA 5EIAA 2EWVA 3OBIA 3G0OA 2VHWA 3C6ZA 3VR4A 4RK6A 1KJYA 1XUOA 4P82A 2QLFA 3K6JA 4MIEA 1HYBA 4WK6A 3BFKA 4E15A 1D6JA 2W4IA 3A36A 1UKBA 1GKYA 3GLVA 3K9HA 4QDKA 4Q3NA 4F4CA 3GNTA 1XAHA 5DWDA 2WYIA 5HIAA 1L4HA 2CNWD 3V2IA 5CBKA 1AY0A 1QRUA 1U3UA 2GEBA 5TX7A 5IVPA 4H35A 4XI9A 2IUTA 5JXGA 3EZFA 3L77A 4MQ6A 3FWNA 4X61A 5F52A 4ZVQA 3RIGA 3OX3A 1RRPA 2I7DA 3RH0A 6REQA 2I4RA 3LBAA 3NVDA 4DR2B 1YOVA 2DHDA 4J07A 4RHUA 5JEEA 2QTLA 5FA8A 3ZBTA 5JQGB 4B3RB 4RNCA 2OV2A 4H7IA 3PGJA 4DWWA 4E46A 3KB2A 1ORIA 1P0MA 1JB9A 1XYYA 1DIHA 2FPSA 2WRZA 3F8WA 1KY4A 4MA5A 4Q3BA 5ECDA 5A3QA 2BGIA 1GARA 4TN5A 5J4YA 1KDYA 4LHZA 3S99A 2RGGA 3BF8A 3CH7A 3H2BA 1Z2PX 5D8DA 4F5EA 1QTRA 3U4QB 3SZMA 3ZZMA 3A14A 4EARA 1BE8A 4JZYA 4RK5A 1J06A 4LJYA 3PS9A 1EDEA 4U4AA 2QHXA 2RIRA 4MQLA 3B9BA 1K5HA 3Q11A 2GWHA 1ZBDA 3FVVA 1PJLA 2C99A 1GDTA 1ZNZA 2CNNA 3FETA 2HCJB 4AJ2A 3LM8A 5TXGA 1A88A 1C5KA 2QVZX 4BXOB 4B3XA 5KJFA 1HG1A 2V5VA 4H3SA 4CQLB 3FOBA 4I08A 2IV7A 3VC3A 2XADA 3BVPA 3PNYA 2HSDA 4FDLA 1R15A 5FR2A 3VR5D 3P9CA 4NH4A 2AUTA 4UW9A 1UF9A 4N18A 2P7HA 1AQYA 1X15A 1BJKA 3RYIA 3LUDA 5HEKA 1Z6YA 2WP8J 3DF7A 1B7GO 1FYFA 3D4PA 4GUDA 4IV8A 2O0JA 1NNI1 2ZYVX 4FXOA 1IZ7A 3K5PA 2O2ZA 2K7FA 4H9GA 3E61A 3D2AA 2DFLA 3A6JA 4JR1A 4CCSA 5LQUA 3LPMA 5BNWA 2AR0A 1G2QA 4BGEA 1R9NA 4F0JA 2KLBA 2PUEA 1QZXA 1HKUA 3F9CA 3HDQA 1UPUA 1H8HD 2FUEA 3R9WA 4QJ4A 2FPXA 3HUDA 2EOAA 2JIQA 4L4XA 4PLHA 3ZH2A 1E32A 1Y1KE 2P6PA 1WPRA 4MVXA 2KQUA 3QMPA 2C4UA 4Y0NA 1XQXA 5FTNA 4DCGA 4ZJUA 3IP1A 2IBSA 3LPAA 1MV8A 2PGJA 2BUCA 1KI6A 4KPGA 5AM5A 5F7XA 5JNSA 3MUOA 2ZIZA 3NBAA 2HRBA 1RYDA 3KPJA 4H08A 2CSUA 2G71A 4WNAA 5IUKC 2BKLA 2GM4A 4YYEA 2XNCA 3OETA 4C1BA 4D0SA 3U56A 1TM1E 3ZWBA 5JD4A 1I51A 2NYRA 1RKXA 3F47A 4GGMX 4F92B 4A2PA 2ECKA 2XF8A 1YVRA 2CMFA 4TPKA 3UWSA 4BBZA 2EJVA 3CWQA 1X9HA 4Q9DA 3DYVA 4ZRDA 3CZAA 4IV5A 4GVLA 2Q5IA 3TMYA 3WICA 1L7NA 3OZEA 4UDYX 1XTBA 3UH1A 1FRZA 2G28A 1MX5A 4XTCS 4TLDA 2Q6VA 4S1OA 2BEWB 4NU8X 2B7BA 3FNEA 2DR3A 2OV1A 1EGQA 2G67A 2HOQA 3O74A 4ZU6X 4EEZA 1IN6A 5CA1A 4ND8B 3CG0A 1CPYA 4NU0A 3N86A 2R4TA 4HH1A 1PQ4A 1Y37A 2EQ5A 1XFAA 4M3NA 3R74A 3E5NA 5DLYA 5JAPA 2I34A 3ROXA 4EGJA 4QKQA 4N5IX 1CRLA 1L4MA 1RWKA 3SZLA 1I13A 2DE0X 1NMQA 3CCCA 4F4FA 1PGJA 1XJCA 3HVJA 4YA6A 3VYVA 3TUZC 2BF7A 2PX5A 4BNKA 1TUEA 4DS3A 4H7DA 3G2JA 4BLQA 4RS4A 2POCA 3LLSA 5EE1A 3EISA 1TXGA 3ZUPA 3K2BA 1FTSA 1WVGA 1DOAA 1Y9ZA 3AG6A 4K7JA 4LYGA 3STVA 3VI3B 2A7QA 1GNQA 4RS3A 4TLEA 4RH0A 1PFKA 4PHGA 2XUZA 4DEYA 1KK3A 1O94D 4BQIA 4AFNA 4NNOA 2HCTA 2E48A 1HYHA 1NWHA 4MTLA 3F3SA 4LF6B 3SS7X 4DT1B 5FI0B 5E1MA 3EA0A 1QCYA 2QAIA 1C1DB 4NYIQ 1FRVA 1K6XA 4X8MA 3PEUA 4OLBA 3AHIA 3PQCA 3R6GA 2D13A 3KEMA 5GONF 2XV1A 2FN9A 5EQFA 1LJLA 1OJLA 3AT1A 2SKEA 3I1JA 4H7JA 3EEIA 4L8FA 3W1VA 2FZEA 4PFJA 3SYTA 5JHGB 4QO8A 4J0DA 4X91A 1X77A 2QMQA 1GPLA 2V3VA 1NBOA 1I4OA 3GC6A 5F78A 2JS7A 4XDGA 5DRTA 4BO8A 2ZAGA 4EUKA 1IBKB 3K05A 3RRFA 1CQPA 4W4TA 2ZTHA 1LC3A 4WSOA 3ZTYA 1WDKA 1FOEB 4NE9A 4P32A 4QRIA 4TV9F 3R7DA 4BNTA 1PNOA 2SKDA 4WJZA 3ROZA 4B8WA 1A8SA 4HK4A 3EXIA 3JCZA 2XGSA 3DVSX 3CF4G 4E5VA 2XH8A 1PNVA 2FPRA 3KXLA 2ZTMA 4KC0A 4U00A 3PSAA 3IUSA 4FM9A 3PE4A 3IKJA 3E84A 4TTPA 5CFLA 8ADHA 5I7EA 1FSSA 2HIAA 4J0QA 4BKUA 2F00A 5A5FA 3V3TA 3TLAA 2EAUA 4X3PA 2D5LA 3HA3A 3T7EA 3HYRA 3LRPA 4W7HA 1K0UA 4YJFB 3UMRA 5FTKA 3ZW7A 3GZ4A 2BTQB 2FPPB 4YRFA 1HEIA 4KV7A 4UPDA 4BLSA 4OMFG 3WWPA 1JR2A 3H9QA 3QVUA 2YXPX 4NZYA 1SOUA 4KXFB 5AYVA 5LQSA 5FT9A 4Q18A 5BNFA 4IINA 1HLDA 2GEDA 4WDQA 2Y0DA 1GIAA 2EGGA 5JS8A 4A7PA 1XRJA 5KJEA 2H5LA 1EE2A 2ZI3A 4HWSA 4RJJA 3RU7A 4DV7B 4N8DA 3NG1A 4WN9B 1IDN1 3M6AA 4AYWA 4CMBA 4CT0A 3K9GA 3OQ1A 1SXQA 2GM3A 4IJ5A 5HKOA 5ENVA 4Q9AA 4MS4B 4PZCA 2RHCA 3UMJA 3WY9A 4CT4B 9LDBA 1Q1QA 4NHEA 5BUCA 2GR9A 3V4PB 3ZCPA 2BFOA 1DVRA 3PVSA 4X5OA 3UB3A 2L0XA 5IXYA 1ZK1A 2HSGA 2ZYDA 1UT8A 2DWOA 1WTCA 3COZA 5FLYA 5TJ9A 1WZNA 5HFJA 2O54A 4MRPA 1Z29A 1QOQB 3OESA 4FYPA 4ZCMA 4J1SA 1PR0A 5NULA 1X1DA 1Z37A 2JVJA 4RA9B 2WWFA 3MCVA 2Z43A 1DC8A 3H11A 2IIBA 3DKVA 3LS2A 3OQJA 4QUHA 3JWGA 2VCEA 2CHFA 2HLNA 1RU3A 2BP7B 4OP2A 1KTIA 3D59A 3UUEA 3F90A 3F8TA 4LF5B 2FWBA 2B4YA 1NOIA 4X6UA 3V2GA 4ARIA 1L7OA 3IAHA 5BSMA 3OTGA 4CFSA 2IGTA 1H2FA 2VK2A 3NALA 5LLDA 1AZSC 1ZRHA 3OCWA 4L8WB 1C1XA 2YW2A 3UK0A 3LDAA 4PC3A 3H7AA 1NA5A 1QZ3A 3GEHA 2GKGA 3HACA 2MR5A 1WXQA 3ET5A 3N39C 1YZNA 1ABEA 3QOXA 1YDMA 4UUBA 5JI3E 5LP1A 3KR0A 5EA2A 1OKKA 3AM5A 4RJLA 4J0JA 3A28A 1R74A 3DFIA 1O89A 3FZYA 4L08A 1G5FA 3RDPA 1FNBA 4PWZA 1GKKA 4NYJR 2QN9A 2FPKA 2IXBA 4IVNA 1NW9B 2CB9A 1VECA 3UCFA 1Z0ZA 1Z4LA 1V6SA 1JECA 2FEPA 4IIUA 4LRUA 4XGIA 1S8OA 4BVJA 1Z2DA 3RABA 1ZD3A 4ZMSA 1EDOA 2A4MA 1W88B 1XE3A 4G9BA 1K7XB 4HGYA 2QRJA 1U3VA 1BRMA 2ZRIA 5AIBA 5JZ9A 3COYA 2Q9BA 2IPOA 2P5SA 3CNLA 4NC9A 1QO9A 3IOYA 4IXWA 1IUNA 1QX3A 2I2CA 1S6YA 3N0XA 4REOA 4M9UA 3ZZTA 4BO4A 3LJKA 2QDKA 2J3DA 2FMKA 4B7AA 3ZLVA 3ONEA 3UXEA 1B14A 2I1VB 2C00A 3D7RA 3OCYA 4BN0A 1JHVA 2XRMA 3QXGA 4P5PA 2ZIVB 2V6FA 2B8EA 1B8NA 3OQPA 3W4IA 5IJ0A 4EUHA 1AX9A 3NWPA 1VMEA 2BE7A 2ADFA 1TAHA 1CJUC 4N7JA 1P2GA 4R9UC 3PK0A 5AK6A 1RE1A 4EUFA 2O3TA 3COJA 1ZK3A 1G21B 4AI6A 3SIRA 1OIVA 1RM4A 4P0TA 1XCGB 3H0EA 1RAFA 1GZSA 3L0SA 1A7KA 3TOVA 2AS0A 5B30A 4F9FA 5EJ2A 2SKCA 4KR7A 1OX6A 3EDOA 5AVOA 2ZITA 2W2XA 5DWVA 1QP4A 2J6BA 2KBFA 3EEBA 3ZI0A 4E5PA 2AQKA 1XAJA 1B8PA 1XAGA 4LZOA 4PPFA 1WWKA 2JFXA 2Z4RA 3CX7A 3BL8A 3QVKA 3W9UA 1CR2A 1JHXA 3DD5A 1QP8A 3OE7D 1EHYA 2YCBA 1P73A 3EZGA 3OJFA 4WASA 5D51S 5T6MA 3SFVA 3WE7A 1ZD4A 4HSGA 1VE6A 1TZ2A 1USUA 3EAGA 3V8PA 2JJ1A 5EWMA 1E3IA 4F5YA 4EY7A 1P1KA 1T2CA 2QT0A 4RHYA 1VL1A 2V9CA 1UC5B 1EFTA 1TEVA 3L7OA 4F86A 1RMYA 4OM8A 4ZCPA 4UNQA 5AW9A 3AVTA 4O4HB 4OXKA 4BB9A 2WU8A 1OLSA 4RD4A 3WYBA 1QQ7A 4Y1RA 1Z5UA 2W8BB 3IAM6 1QNFA 2O8CB 1UAGA 4YDHB 4BP8A 1GITA 4S04A 5K3OA 1U1DA 4E2WA 2XLCA 3DFUA 4R0MA 3I2FA 3F0TA 3N0VA 1QVZA 1IH8A 2Z6UA 3EIFA 4FSHA 3UGTA 1PZXA 1R66A 4QHSA 2J08A 4HMOA 3QELA 1L4NA 4MDEA 1K92A 3PUHA 2RBKA 1FVFA 2ONZA 2VPIA 3W8DA 5K1ZA 4TZTA 4QPZA 1Y3IA 4QARA 4DCMA 4I8IA 2P40A 4NK5A 4FB5A 1BCRA 3DAFA 4D02A 2XMZA 1LLCA 1ABFA 2L2QA 4WJKB 2B37A 1ZJYA 5H8WA 1G59A 5KS2A 1EXVA 4GSLA 2A1IA 4HP8A 2X5KO 1M83A 4LOAA 3WNDA 4A10A 2AYYA 4BQFA 4R7ZA 1SJ9A 5BW4A 3Q10A 5FQOA 4PFKA 4JEUA 2O5RA 4TXNA 3EZ9A 2BE9A 3KR2A 3MS7A 3NOVA 3EZNA 3WQBA 4BB6A 3VBEA 2FW0A 2Z9BA 3WLMA 2F1HA 3GMSA 2OILA 1NUSA 3GROA 3KLNA 3OM8A 3IKMB 5FEUA 1OWPA 2G63A 1WXWA 3DFFA 4G5FA 5BQXA 3K2EA 3PNQA 4EG5A 3VFDA 5F21A 4OGFA 3OOJA 1G3MA 3HMKA 4PLFA 5FUVA 4QXPA 1XPUA 5AW8A 2BI4A 4G5GA 1AM4D 1P9LA 3P9QA 3RREA 3D02A 3DCJA 2BFMA 3IFSA 1ML4A 1WF6A 2R1TA 2CWDA 1N1EA 1LS6A 2DBZA 1WDMA 2ZYTX 3DLBA 1XLTC 1CEEA 1J6UA 1A2OA 2GSWA 2NTJA 5I7WA 1TO2E 5H3LA 1CY8A 1VM6A 1CB0A 3M3HA 1FRQA 1VSVA 1WP9A 3HKCA 4QL3A 1A9ZA 4PS0A 1B8UA 5DLEA 1UK7A 3EN0A 1UK6A 1I3NA 1AN9A 3LY5A 1DIBA 2D8MA 1MEOA 2ORWA 4MKRA 5DM4A 3TDKA 2UZ4A 3KQKA 1V5EA 2DTDA 3PDIB 4XFDA 3BHNA 3KRTA 3L3BA 2JI6A 1H69A 4IRUB 3Q3CA 1KWKA 3G2MA 4YXWA 3BIWA 2BY4A 2PGDA 4YMSA 4RMHA 3RVJA 3WLFA 4E12A 3MCAA 2R96A 1YL6A 5DSXA 2JAQA 3DQQA 4TXLA 1WCV1 4IIVA 1PZHA 5BMOA 1QTNA 3A7EA 3QVGB 1JSCA 3EARA 1TO6A 4B82A 1YQDA 2IHKA 3DYBA 3JRWA 4L85A 2PH7A 1NUHA 1ZNQO 2BN4A 3QNMA 3BWCA 4B32A 1J0XO 1XZIA 2AXQA 5KC8A 1VCNA 5KNBD 2I66A 1RJWA 2IEYA 4YJDA 5I4BA 1T2VA 4L8VA 1KJ9A 1NDQA 4B8YA 2JATA 1ZRSA 2FPGB 2HWKA 2G70A 3SKXA 4X7BA 1UEIA 3BWMA 5CT5A 5DGCA 1YFJA 4Z2YA 3IBCA 4B3CA 2VIIA 1A2BA 1D4OA 1KAHA 2V55B 4RPLA 3KE8A 3QFFA 1CS4C 2WE8A 4JJFA 3VPHA 2HJ9A 2ZJ0A 1A8IA 4GG1A 1YRWA 4NBUA 4B85A 3W3ZB 1U4NA 2PBLA 3A26A 4BLRA 2NQ2C 5HUQA 3ZK7A 3QPWA 3PKJA 5BW6B 1TVMA 3FRIA 3OZXA 3P9ZA 1NKSA 4OAQA 4G8CA 2IHZA 4YRPA 5KSWB 5COQA 3H75A 3MK31 3ONVA 3TWOA 4DRZA 4E21A 2LR0A 4YHHB 1EUQA 4YASA 2CL7X 1EIZA 1KQFA 2GWRA 2PGLA 3NEJA 4G8JA 3GL9A 5DEOA 5FBHA 3K2IA 4PYNA 4WY2A 4BBAA 3QIVA 4PLVA 5A7FA 3UXMA 4Q1FA 2NSJA 2AK2A 3WGQA 3LY8A 3UFBA 1I8TA 4RTJA 1JSRA 3RFFA 4PE5B 3TRFA 2QTZA 4UFOA 3UJHA 4G56A 2GFIA 1Y4ZA 1TOAA 4HYEA 3DEHA 1ZM2A 4RXMA 5TR9A 4JFRA 3KTAB 4ZQBA 5CJPA 3G89A 4ETMA 4H3VA 1Z5PA 3R41A 3U26A 5CA1F 1YZQA 3C15C 3LC2O 4EM6A 1UBKS 1QWOA 2Q1YA 4BVGA 4CI9A 5CVTA 1KFEB 3B6ZA 3PUKA 5BR8B 2DP4E 2QN2A 2XKKA 4A8JA 1KYQA 2M98A 3IUBA 4Z49A 2P4SA 3NS7A 2QTAA 5JYDA 3GLGA 2Q1XA 5L6LB 3EDYA 1GOTA 1WOYA 2XUHA 1QONA 3K1AA 5A5EA 1DAPA 3EDQA 3S2UA 4QM6A 3WLHA 2PA3A 2Y1FA 3T54A 1Y9EA 1VE9A 1SHUX 2EKBA 5DNYB 2VRNA 3DG9A 3M7IA 5FO1A 4C08A 4Z7QB 4L73A 2OYSA 4A3SA 4AZ3B 4BV3A 4KIWA 1ACMA 4XCVA 5IULC 1DQYA 2J3LA 5KU7A 2C94A 1IY2A 2C7RA 1UKEA 3LK7A 4ROTA 4XKJA 4BY9E 2EBFX 3JTEA 4P08A 2Q6TA 2Q2QA 3NHAA 3QE0A 4AZ0A 3FI9A 1GAEO 3K71B 2FF7A 3RVBA 3OPNA 3ETHA 4MDFA 4GDMA 3K9CA 2VUTA 2PT5A 1V45E 1UDCA 2WDZA 1Y3AA 3VDMA 4BNWA 3AHHA 3FIJA 5JMWA 5ICSA 1R0KA 3U7GA 1H1LA 1IXSB 1XDGA 1C3VA 4G3XA 2XMQA 2ISQA 3OZ7A 4I6GA 5K3BA 4JP5A 1SEPA 4E2XA 1IOLA 1W5BA 1PFUA 5L4SA 4J8PA 2ZSDA 3KT3A 3GCWA 1SOAA 1PHRA 1W36D 3UA3A 3WYGA 5G3YA 1I80A 2H4YA 3G9ZA 2HIGA 2ZXEA 1M8FA 3DEIA 4JYCA 3O73A 3JAWB 1TU4A 1P60A 3Q1KA 2PZAA 4CKEB 1JAIA 2XCIA 4LNHA 1EFDN 4RESA 3VKGA 3IKVA 1QR6A 5H4HA 1XHLA 2BI7A 3BXEA 4D98A 1ICIA 3S44A 1JTVA 2WHQA 1QH0A 5FEMA 3Q7TA 4BFWA 1MJHA 4LDRA 4DLZA 4DA4A 3LG2A 3BIXA 4N49A 3T4PA 4PSCA 1RHUA 3A0RB 4J7XA 5BOVA 3GT4A 3SC2B 5KJCA 2AE2A 2VUHB 3TYXA 3UHAA 3IQXA 2H57A 5LYJB 4X65B 2QP3A 2DM6A 2VPPA 2IYZA 5B3AA 4IX9A 3QLUA 1TU3A 4CMHA 2AZXA 1JEJA 1N6LA 1W5AA 3HQ4O 4E14A 3UOAB 1NL3A 1T6ZA 4WX2B 5D86A 3U80A 3WNCA 1JHYA 3VR3D 1W2HA 2OORC 2A1UA 3CZPA 2AN3A 1NVGA 1Y5RA 3EFEA 1Q50A 1BA3A 2R7LA 3IODA 3RIXA 4ZHQB 5T64A 2RK4A 4X66B 4U8GA 4PINA 3P9RA 3ZX5A 3T3MB 2PJDA 1VYTA 2WQ7A 2C98A 2FV8A 3SS9X 4S2EA 1VA5A 3DP9A 5BQ5A 1PNRA 2A9VA 4JQCA 3KT6A 1LUAA 1PW5A 1YIOA 2PX8A 2OFOA 4ZOAA 3ONFA 2FN4A 4KO1S 1Z28A 1H8EA 1PX0A 1V16A 1M7HA 2MU1A 3BWYA 1YMVA 2HJWA 4C0LA 1RBMA 1X80A 3QVLA 3UGKA 4B2YA 1OC2A 1FNNA 3G59A 5SYNA 1Q1BA 1M10A 4H6PA 1DBVO 3O7WA 4X8HA 4MWOA 2Q62A 3W8FA 5KSYA 2GN0A 3IIEA 3KUDA 1G9XA 2VJQA 5SZJA 3P8ZA 1GUDA 3VO1A 1ACLA 1IU9A 1TYAE 1WQ3A 5KOJB 5KAMA 3KPVA 4OHFA 4OH7A 3T3DA 3RYFA 3PDUA 3G8DA 4CF6A 4PTLA 1TPZA 4FHZA 4GGOA 4KLNA 1E2EA 3IT2A 1AK1A 3CZQA 3PG5A 3HJUA 3PPYA 4U7HA 1E7YA 2ET6A 3WZMA 4B09A 4ILEA 4PX9A 4BX8A 1BCSA 4IGEA 4WUVA 1GGNA 2B78A 3KYIB 3R3XA 4KE8A 4RVGA 5G0TA 3SLKA 4F85A 5L7TA 1F12A 3FKQA 2QRPA 3ME5A 4MB6A 4XUDA 3ZWWA 4QOFA 4QRHA 3WLQA 1N2XA 1YXMA 2PS3A 3A4YA 4LE0A 3WGZA 3BGIA 3R6TA 2ID9A 3NASA 2G04A 5DEIA 4B6PA 4CODB 1QR2A 2DSTA 1CFJA 2O7RA 2YVQA 4H7EA 5JE8A 1ZD8A 5FHRA 5A3RA 5F9HA 2VJOA 1OFUX 1L5WA 3BIOA 2HPZA 4K3VA 4FOOA 4AG3A 2I8AA 1A9QA 4TT3A 2ARKA 4R68A 4HOYA 4N1AA 1ZM4A 5LQDA 1L4GA 3QXXA 4QPPA 4LRWA 2H4WA 1BG6A 2D2FA 1B3RA 2Q07A 3VOTA 2CYAA 3VPFA 4RJKA 2BEKA 1A9RA 3UHFA 4CKBA 2Q3HA 2VP0A 4QICA 3RPEA 3VYUB 1LTQA 2IVFA 4MJXA 4OQFA 2AN9A 2ZI7A 3H84A 3ZHVA 5IAAA 3OLVA 2VLIA 1NQVA 2WD8A 2HK8A 4KXMA 3CPSA 3GUHA 3QJGA 1C9KA 1NC3A 1IWPB 4HQ0A 1O5OA 1PJ8A 2YNMA 3KWFA 1QC5B 4GH5A 4MQUA 1EBUA 1NC1A 2E49A 4Q24A 2EDCA 4MP8A 4WBSA 3WFZA 5GJBA 1JIVA 4B0OA 1QPGA 3K4HA 5LVAA 2D7DA 1Y6FA 2PXCA 2JI7A 1R8QA 1QK4A 2W2MA 1VLVA 1Z6TA 3CG4A 1KI3A 1P2BA 1R6DA 3AJ8A 5KJ1A 3L0IB 1DTWB 3AZOA 4J1QA 3GMIA 2MCFA 3PKIA 2XNDD 3PHHA 1F8UA 2VDMB 2V0GA 3DVAA 3MZ0A 4K8RB 1TGYA 1VOTA 3VU9A 4B6JA 2FCRA 3DO8A 3FSEA 2HA6A 5M7EA 4U2GA 3HXMA 1CHNA 2R6GA 1BHJA 3L7AA 1EAMA 5JAQA 2EKDA 5K3FA 1LK0A 5MN5A 2ACVA 5FAKA 4LVUA 1L7EA 1ZJJA 4ZVVA 3PQ3A 1Y4SA 3ZCSA 2ZBGA 2A0XA 3FF1A 4HADA 3RT1A 3P9SA 4FFDA 5JT1A 3IAFA 3SC3A 1TMYA 1KIAA 2WHPB 1IHOA 1MAWA 2CDAA 1BW9A 5D3QA 1VG8A 4YCNA 4NSNA 1J5PA 1DPFA 2ZYRA 4PQFA 1L6RA 2AWNA 4BU0A 2HD4A 1N9KA 2HQSA 3HCFA 3DCIA 5IVDA 5KI6A 1E5TA 3O1JC 4M9SA 1DWUA 4RH1A 1G41A 2HHCA 3N07A 3OO0A 3WTCA 1N0HA 1P8JA 2ZUBA 2V7GA 5K8UA 2AFIE 3IR5A 1US8A 3DUFA 1DC7A 3TLJA 2V4ZA 4PGGA 4FCVA 1KP2A 1E3MA 1O6CA 1JPJA 4NCXA 4D1YA 3IJRA 5JCOC 3U31A 3MG9A 2X6QA 3ZDYB 3QVGA 1B0AA 4CM8B 2PGAA 1C9EA 1Z5VA 2B69A 4FDTA 4DIMA 4JBHA 3OWOA 2HR1A 2C7BA 1D2HA 2GCPA 1GWNA 3A0UA 3FUUA 3GNQA 3X2EA 1JDZA 1XU7A 2IYTA 1ZUD1 3DEAA 1JXOA 2Q9UA 2JLSA 3GIDA 3EBLA 3WS7A 3RS4A 4EH1A 1JFSA 1W7AA 1UMCA 1MKYA 1SBTA 4IO0A 4GSYA 3O92A 3QTTA 4LX0A 4DG8A 221PA 1YBFA 3PGKA 2WF9A 3R7FA 5K3EA 4KPEC 4MVJH 4QGGA 3I9JA 3BMNB 5CA0B 5FX2A 1UOPA 1P4AA 3CRVA 3MTDA 2JJ2A 4AZTA 2Q3FA 3GLUA 4D6XA 1TK2A 2ANCA 1Y81A 3RM3A 5BN5A 2Q3DA 3DDHA 1NF2A 1NXXA 2V54A 1VE5A 2J9RA 2FUG1 5L45A 4S1VA 1GPBA 1XZLA 1ZJ4A 3WKCA 3WLIA 3B6EA 2AN5A 3OQHA 3U37A 4ATNA 2WF5A 3M6LA 1VPEA 3LD9A 3NCHA 3E3NA 6GPBA 2CT8A 1YCGA 3G5UA 3NOXA 4EA6A 2Q3LA 3H5VA 1BZYA 1TUGA 3VGPA 1Y8AA 4U6SA 2F55A 3WKDA 2JD1A 1VCOA 2WG0A 4MYRA 1A2KC 4J91A 3MT9A 3QLTA 4TOIA 4XJVA 2B21A 3V4OA 5C1BA 1SXJE 5CITA 3VX3A 4DJFC 4OD0A 2FP4A 2HMVA 1Z2CA 1Q44A 1C3OB 3ZKAA 4DLYA 2QI9C 2P2CA 3L7KA 4MJ3A 1L4FA 1OIXA 4L5JA 4YAJA 1J20A 1S5PA 1OFGA 4LWPA 5LU9A 1WJGA 3NDRA 4DIBA 3IAUA 1X7HA 1L7DA 1QYRA 1UIMA 5ALXA 3SLGA 4A1OA 3H2KA 5FKJA 3K9NA 2P78A 2IV2X 1HNWB 4D8YA 2FWIA 4H60A 4D8VA 4Z3OA 4GMDA 2IYSA 3KC2A 4BPRA 1E9DA 3SSAA 3NM4A 3TAXA 4MQFB 3RI3A 1QH9A 2BTEA 4FYXA 3UT5A 3S55A 4CDRA 1D2AA 3LUPA 3MLBA 4HDKA 1Z33A 4XLTA 3UBMA 1KGSA 5CPBA 3RJMA 3RD5A 4NAHA 1SUCA 3HZRA 4I1VA 2FR8C 1GKUB 4DC9A 1B2RA 1U8AA 5BV8A 3MQ2A 1PLJA 2KW5A 1GZ5A 4XYEA 5C7LO 1YRYE 1F8XA 2NG1A 5D1HA 1W8IA 4FI3C 2J3EA 4OI1A 3F4LA 1PS8A 3ETNA 4YCBA 5KYTA 4BMVA 2YHIA 3RBVA 2J30A 3ZY6A 1QE3A 2AMYA 1W46A 4RD2A 4BWFB 2I65A 3VH4A 4ZVRA 3Q3JB 2C20A 3N8DA 1KYXA 2ANBA 4GWLA 2BRUA 5LYYA 2AH5A 2FJUA 1KU6A 1MO3A 3HE3A 1W73A 3FUCA 3K9QO 2PUWA 3U81A 5AW3A 4P4NA 4QG3A 5K01A 3LO5A 4CT5A 2ZTVA 1WOMA 5EP1A 2XGGA 4GMHA 3O8CA 3VMFA 1UMBB 1UWLA 2EBUA 3L0OA 3ORQA 3D3WB 1XD8A 5TS3A 1V2GA 4REQB 3TEFA 1PSZA 3N2LA 3TG2A 4FEEA 3KZXA 4MV8A 1I3MA 1IEWA 3RS9A 5EIFA 4CU5A 3VDXA 1QGOA 2P4HX 2QUBA 4Z1OA 1V3UA 1PJ3A 1T2AA 3GFSA 2O9JA 1JZTA 2QRQA 1M1NB 2WVJA 1Q95A 4DJTA 2EX1A 3DOOA 1GSAA 1WHSB 2IOHA 1Z25A 2J07A 2CDRA 3UV7A 3V1MA 2EX4A 1IBLB 4LVNA 2VS1A 1V25A 4DQKA 1V5GA 3IHTA 4MKHA 1VP9A 1O77A 2Y93A 3Q8KA 1M34E 2ZE7A 4Y18A 4UD2A 3RIMA 1U0LA 4K86A 5FWXA 1PD1A 3R3YA 1IZYA 1I01A 3ZBPA 1WF3A 1T91A 3R3VA 3RVPA 4UM9B 2PVCA 1SHKA 1UM8A 5E9AA 2C8JA 1CDDA 1F17A 1N77A 2XT9A 5LJLA 4LDQA 5B57C 5AVQA 1WMSA 3ZV4A 2RGEA 4QYMA 5B4TA 4ZYTA 5TT1A 1QE5A 1Y3DE 2OFWA 2PZMA 5EMHA 5EMMA 1OZ0A 4BMCA 3T0FA 4WJLA 2AXNA 2CXNA 3ES9A 4PPNA 2H63A 2CUNA 2HA7A 1Y34E 1E3WB 1E1QA 2O4UX 2JEZA 5IKMA 1EFPA 4UTXA 5TMDA 1BYUA 4JLJA 1T8PA 1SVLA 2I22A 5EJGA 2OP1A 4OQYA 1LPNA 3ESCA 4JX8A 1XRRA 4RZXA 3U44A 2FMFA 1CF2O 2FZVA 3EWNA 2D1SA 4FZ3A 4O1MA 5KKAA 3ZGNA 2OVFA 4L2IA 4BRUA 1KZ9A 2JZCA 3EQ7A 1C0IA 1I6KA 3QITA 2R86A 4OHVA 4ZEMA 5A4IS 5FV4A 1XTPA 1DG9A 3UCXA 4X44A 3L4EA 2AEFA 1CUGA 2C0CA 3IEPA 3SJZA 2C97A 3KKPA 2FH5B 3OPYB 4Q4AA 2BBTA 1C1HA 3TOSA 1SUPA 1X86B 3TG8A 4DXAA 3V42A 1ULSA 5KO2A 1Y7TA 1PWHA 4BB5A 4ZGBA 2KLHA 2IS6A 3D3QA 5BT8A 1Y4DE 4BWVA 2YWXA 3OY7A 4LK3A 2FUG6 1FFGA 2V7QA 4KE7A 4E1BA 5HBRA 1LW6E 4X20B 1GTL1 1IN4A 1FY2A 1C9DB 1N2ZA 2AG6A 3B82A 2VQEB 2R7MA 2DSNA 2ZIEA 2W6IA 2CVZA 2I6GA 3H83A 1Q57A 3ITEA 1K27A 5J23A 1U8EA 4QHYA 4KN6A 1MQAA 4Y6RA 2WUVA 4EJSC 3JXEA 3OLXA 1MT0A 4H31A 4F4JA 1KI2A 3FR8A 1KPGA 3IVMA 4AJ1A 2GZ3A 4EYSA 5AXAA 3LOUA 5HR5A 3U3JA 3C6MA 2R5NA 3O9VA 2C7QA 1DT3A 4G86A 2WC1A 1F2UA 3G2IA 5JEDA 4UMDA 1L7PA 5I8ZA 2QL6A 2Y1GA 3QM1A 1LSSA 3DKKA 1T8WA 1YR2A 4JGBA 2HN9A 2VNSA 5JDCC 5C7IO 4KQGA 2QGNA 3F6EX 1N9GA 5TMPA 2JLXA 1ZCJA 3VVLA 1XNGA 2D1RA 4LY3A 2HL6A 3LBYA 4XVHA 4YFYA 4DA7A 1TKCA 5TMBA 2ECFA 2O1SA 1O4VA 2H07A 3LVQE 4LCEA 1X19A 4HDMB 4B76A 1ZIDA 3B20A 5FPKA 3F6YA 2F1IA 1IJBA 3DZFA 1H4TA 3WX0A 5JNTA 3KYJB 4PAQA 2AR9A 3W7VA 1E96A 2RE8A 3CN9A 1CY2A 4C7KA 2NX2A 5AK0A 1VKRA 4EFLA 5BSGA 5B3JC 1TPYA 3O95A 1A77A 4ZMRA 4EO9A 5C1PA 3KU4A 4JUDX 4F60A 4QQNA 2Z5LA 3DXYA 1A27A 1FX0B 2A58A 3KZVA 4DCSA 3SYKA 1W48A 3D6NB 2VSOA 2AOUB 2YASA 1EX6A 3CEJA 3V7UA 3GRRA 4IEIA 1XELA 2WJGA 4J76A 3FCCA 2WIAA 3L0YA 2R8EA 4V03A 5HK8A 3RTBA 4O3MA 1THGA 2I80A 1N2CB 4AJJA 1DMRA 4C9BA 1Y4UA 2JARA 1F0PA 1GSIA 1UPAA 2Q5EA 3CY6A 3KTFA 5BSRA 2OCXA 2OORA 1MO2A 1QC5A 4H2DA 2QX8A 1X39A 3ZXIA 4D4MA 2AF4C 3H2SA 1OYWA 5T6BA 3PA6A 2DUUA 3IBYA 3O1LA 5E0OA 4I1PA 3BQNB 2YRWA 5JTUA 3BGDA 1UWKA 2P9FA 2J4CA 4JMLA 3LFUA 3ZI4A 4DR7B 3FSGD 4X63A 1RTTA 1L8AA 2FQWA 2PRKA 4Z3DA 5CEJA 2QG6A 3TJZA 3WO0A 3CNHA 3NT2A 5C8YA 2R85A 3VDRA 3DBIA 3K6RA 3GRYA 4DBVO 3LW8A 1EBBA 3O9ZA 3QNWA 1MGPA 4OYHA 4Q01A 5M29A 4ND5A 3H19A 1Z75A 2ZUFA 3M6FA 2W2VA 1Y6RA 3HHEA 4G37A 3VNRA 4AMYA 1V3VA 2YIVX 4BU1A 4NMXB 5H1YA 2ZCJA 2QL9A 4NECA 2HSZA 3C14C 4I19A 5JDIA 5J2UA 3HKBA 3QPDA 1P8AA 2YVUA 1T4GA 2KS6A 2ODBA 1T13A 1Y8RA 2VSNA 2X9QA 5DP2A 1D4FA 3CF6R 3HVUA 1P31A 3ENZA 4IWYA 4EJSB 2CFRA 4IAOA 4F3CA 2IY8A 3ON5A 2EF1A 2CXOA 5A62A 1XWIA 4YR9A 2O8DA 5E4JA 3LCMA 1EFRD 5BSUA 1TYZA 3F7MA 4BE7B 3IBSA 4L75A 5DHFA 5JWRA 1FPMA 1UMDB 2V1XA 2QMZA 3C5CA 2IW1A 1AXGA 3L6UA 5KDDA 4MVWA 1VPLA 1GGJA 2B98A 1NYTA 4IJQA 2CD7A 5BWBA 3N87A 1ZISA 4RTPA 5DISB 1Z5GA 3PCRB 4LRYA 1OXTA 1VLMA 2B5VA 2BEUB 1CG6A 2DBRA 4NBTA 4UCWA 3WBKA 4DSUA 1B73A 3QV1A 4TLMB 1DADA 1LJ8A 1SBQA 2PWBA 3ENQA 4JJEA 4UHBA 1EPUA 3BRWA 1T0IA 3Q15C 4BMXA 4E7PA 4ENVA 1QFXA 1LS1A 4N3CA 1Y6QA 4HAUA 1K66A 4KK4A 3TXYA 1T5BA 4QSMA 2YHAA 2QPTA 2QTVA 4DL9A 5AVWA 2NO0A 4KDCA 2BLNA 1NTOA 3BMNA 2ACWA 3Q72A 5K8JB 1C8KA 1QRSA 5LMUB 1PGNA 2OSBA 4U7FA 3ZVKA 3DDSA 4QUBA 1I4DD 1GUZA 2F59A 1Z16A 3T35A 5ILOA 2C5GA 3M9LA 3DYIA 3DE4X 4Q4CA 4MQ5A 5AJWA 4H4DA 2CNBA 5AI6A 2CXHA 3IALA 3PRKE 1RZVA 2XCRB 1BXGA 1TCBA 4LV5B 4II2A 1GZDA 4QASA 4BNLA 4PCUA 3OJEA 3DMGA 5HG0A 4CUZA 2GPNA 1QO0A 4CV0A 3FTCA 1M0TA 3GAAA 2XSZA 3VR2A 4RTOA 3TKAA 4KITB 3RS2A 1GY8A 5TEWA 4ZMBA 1PV4A 2I03A 2JCGA 1HL3A 2GLUA 5G0SA 3SS8A 3G8BA 2NUPB 3NC1C 4UARA 2B36A 2V7XA 1JA1A 5B12A 3VYRB 4C05A 5KQRA 2GN1A 2P11A 3I6YA 3GD7A 4RSMA 4Z9FA 4DHEA 4FJ1A 2WWRA 4EO4A 1C3OA 1B23P 1S2MA 2VJMA 5DHSA 4FHGA 3M34A 5EL0A 5TF0A 4KTTE 4H4CA 1G5IA 1X14A 4DLXA 1JHAA 2XMDA 3MJEA 5BPHA 4L3OA 1FSPA 4C5AA 2BPOA 3AYXB 4BV8A 2ROQA 4NZPA 1FDVA 4K2AA 3M4JA 1NZFA 2F2TA 2FHPA 1LRJA 1SKQA 1VFNA 2ACEA 2P62A 3LK6A 3QF4B 3LECA 4MQFA 4JXXA 3SMVA 2DWUA 2PWZA 2IYLD 3KQWA 4DIUA 2FE4A 4E3ZA 3QTLA 5LFAA 1P3DA 4UTOA 2QVYX 2Y27A 2PSHA 4M7RA 4BX2A 5D3ZA 1V6AA 2HIHA 3KLPX 2NAFA 4CM6A 3HNOA 1U9IA 4Z54A 2N46A 3B9QA 1VSQA 1Z6XA 2B2NA 3OIDA 4G67A 1KFCB 5T8KA 5IT9A 1ZN7A 2B6HA 2F4NA 3V7YA 2OAGA 1ZOOA 2MHCA 2VPYA 1REQA 2GEJA 1NUPA 4EW3A 1SHZA 3KYCB 2FJPA 1KZ6A 1U5AA 2NYAA 2DULA 4NFYA 3WDSA 2PKYX 2NZVG 2X42A 3PHIA 3KEOA 3PNSA 1Q83A 4QQ8A 3WNQA 3VSCA 4OY3A 4OSEA 4B3JA 1F4VA 3I5UA 3BEOA 2F3QA 4ZO7A 4JVSB 2W37A 1JEQB 3L1HA 1WA5A 5AVRA 1OHHD 3VSDA 4LJ7A 3ZGOA 4CEHB 3BXOA 4FT2A 5CG1A 3GB9A 1SCJA 3L84A 1WS6A 2CNWA 2HF8A 4TMVA 3RSZA 1K1EA 2BMFA 2IXAA 1U9JA 1PP4A 2JBHA 2HJRA 1S4QA 2GJSA 2DQYA 2JGLA 4DZRA 5LZ4A 2FG5A 3WZ2A 5DZSA 1U8FO 4QOEA 3T5MA 2IZZA 1HK7A 1NW3A 2GK4A 3QUQA 1JQLB 2XCTB 3GLHA 1QIGA 2GZHA 3L46A 5EXPA 4ESVA 1D07A 4U39A 4UZEA 2IXTA 2D0IA 4K26A 1ZK0A 1J24A 4JGGA 2J41A 4RZUA 5EXTA 3PP8A 1Y5NA 4MVJI 3U62A 2C7PA 1QQ5A 4Q12A 5SYMA 3TBKA 2BGLA 3P71T 3RE1A 4F12A 1O58A 1MD9A 2TMGA 1HI9A 3E4CA 5BXQC 2JGAA 1RC8A 2JCBA 4LG1A 1JQEA 3DOCA 3V00A 2WA1A 4XYMA 1J2JA 1QBGA 2GPJA 2R7KA 4AMUA 5FWAA 3FNIA 1W0KD 1W0JD 2KX7A 4MR8A 3T1TA 1DDGA 3VDNB 3VJRA 1E3WA 3PI6A 1RWPA 4BUCA 5LWQA 1RMQA 3QE3A 1ZH2A 3VHXA 2RJ3A 3QVSA 2HGZA 3T3EA 5IN4A 1Y6GA 4I4IA 4PX3A 1LBHA 1EUDA 1SMKA 5IARA 3VR5A 1N57A 1XXHB 2Z2IA 5A3SA 4ESHA 5E3IA 3EY4A 5E2BA 3NJ4A 1L5VA 4YRJA 4ARVA 1FTQA 1BEZA 1JLLA 3M1AA 3QU2A 4DBLE 3SSMA 2WTNA 2OR3A 3PZBA 3V32A 5DCUA 1LF0A 3OLQA 3KWLA 1A9SA 4EY3A 1QHNA 3SYRA 5LDHA 3MSXA 1DJPA 3OPYA 1K89A 1P2VA 1PJ4A 3R5XA 2K2QB 3D3JA 5B55A 3EIEA 2JGMA 2EL9A 5J5AA 2FR8A 2WA2A 2FVYA 4JR2A 3GARA 4MVJD 4YV1A 1R9JA 1ZK4A 2C4WA 2FOXA 3QOYA 5FB3A 3SNHA 4BC0A 4Z0HO 1H8HA 3EWIA 3KLMX 4ES6A 4EW6A 5BQ3A 4GPAA 3W2TA 1GTVA 1MEEA 3ZNOA 1J8DA 1YR7A 2PEZA 4YP9A 4FR2A 1IONA 3T7TA 4DSZA 1EQ2A 5I4CA 1QYCA 4RPCA 4RJIA 5ALPA 4W5JA 1IVYA 1WD7A 4EDFA 5IDQA 4C07A 2I2WA 3FFXA 4GX2A 5FWDA 2EJTA 5L53A 1MG5A 1XL0A 2A8YA 3R5JA 3G0BA 2R60A 3SXUA 3Q8MA 1QYXA 4P84A 1QGAA 3H5RA 4ARBA 5EHGA 1HURA 3CT6A 4GT1A 4MICA 4HGOA 3STUA 1V1RB 2ZI9A 3W7BA 3RUAA 5KYKA 4GYWA 3AVXA 2ZRJA 4AIRA 3EUEA 1HH4A 1M2KA 2I7CA 2KPOA 3OCUA 1ZW1A 2P9GA 2R6ZA 3CGGA 4JCOA 2VSYA 4RZ2A 5LMCA 2GA9A 4HDNB 4J2TA 4DMMA 2VYFA 3GZNA 4L0MA 4QFBA 1UK8A 2A9PA 3KXPA 3R8XA 3UMVA 1OGYA 2IYPA 4MP6A 4D0GA 5EGNA 1X2EA 4D8WA 4DM7A 3L8YA 4RY8A 1MW9X 4A73A 2PRJA 1ILEA 1DLJA 4YUVA 4GNKA 1TD9A 3LVRE 4BZXA 8OHMA 4EYQA 2YZMA 4LXQA 3G79A 5BWOA 2PRYA 2WT9A 1GRNA 3EGIA 3HJBA 3UW1A 1XAIA 1MG0A 4LDZA 2WJAA 3PHLA 3DV0A 1MC1A 3QIAA 4GZ3A 4RKEA 3W8NA 2OM6A 1X1CA 2G4CA 2WJ6A 2DFPA 2QRKA 5BMVB 2OOSA 1JU9A 1J8FA 2QSJA 3A70A 3DONA 4MI1A 4E5MA 1JR3E 3IESA 2AIRA 2ERYA 2HU5A 4DCJA 5K0CA 2VH5R 4MS3A 4NDNE 3TTUA 3ELUA 3HR7A 6ABPA 1YBHA 1FBNA 4TS4A 3NETA 3ZDXB 1U4SA 1YHNA 1E20A 4FMBB 5AKGA 4G25A 1RP7A 3AJAA 3WGLA 3MUNA 3NIFB 3L06A 2WVAA 3Q9UA 1ISGA 1SN7A 1LFDB 3PR3A 3OIWA 1HTTA 2XVZA 1UR5A 1YBAA 4ITUA 4JB8A 4DR1B 3A6KA 1YVPA 1YCDA 3I64A 5EHIA 1DJNA 1W4LA 1RKVA 1CE8A 1KMMA 1U2EA 4LCJA 4P35A 4YUYA 2Q3JA 2LKDA 3TLGA 4EKNB 1ZP6A 3EQ6A 4LHXA 4XJSA 5BNTA 2HMUA 4PNZA 3T3GA 4YP6A 4Q66C 4LV6A 2I1WA 3HBMA 5DGDA 5JH7B 1AMUA 1W49A 4PZUA 3EIUA 4HWPA 2J7KA 5ENDA 1BEUB 4P4SA 4IFEA 4W8OA 4ZP1A 1N6PA 2EQBA 3P4XA 1PYOA 3ZZUA 5TVKA 3RRMA 2AZMA 1GVHA 1PUJA 1CD5A 2X86A 4WERA 4OQQA 1G5RA 3SBOA 1PDVA 2EC5A 2WF7A 5K3AA 4R6XA 3A9TA 2JGEA 2PR7A 3BILA 3DDOA 4CBVA 4K03A 3THYA 3RT9A 1M1ZA 1X0XA 4JLDA 2FX3A 2BZ1A 2CLEB 3RKSA 3D6MA 1P45A 3C48A 1UJNA 4LY9A 2EGUA 3CZ4A 3RJZA 3U3XA 2YY5A 2H2AA 4Y0AA 3R0XA 1EUYA 1ID1A 4IF6A 3KWJA 1K68A 4EYOA 1Z7YA 2B1IA 2HBZA 1FUIA 2W2PA 4PCLA 4OLJA 1KS9A 1OU4A 1GPH1 2C0QA 2PHZA 3B3FA 3IELA 3O8NA 4Q1CA 3V1LA 5IVKA 2GXUA 2R4QA 4RFSA 2V7UA 3ELWA 3F5DA 3FUXA 4FE7A 1JHOA 1XVUA 4QJ5A 3RG8A 4IIXA 3ZBUA 2D0PB 3FR7A 2PLNA 3ZNPA 2NPFA 3CLUD 2DBVO 3FHOA 4NMMA 4AVYA 5KYYB 3H9CA 1Y8QB 5EE3A 1ISPA 1NN5A 4N8EA 2C88A 1K3UB 2F8LA 4A0SA 1SG0A 4C01A 2ZBFA 3EDMA 4BO2A 5C4MA 3DO5A 1CR1A 1FS6A 2NO4A 4FT4A 2FEMA 3FTNA 4PHCA 3UUFA 4AKGA 1QHYA 3Q98A 5CT9A 5C8YF 1QQ6A 4RDHA 4Q6BA 3TLXA 1YS1X 3K8OE 4K6FA 5B3JA 1PTKA 4C78A 2N3ZA 2CDNA 1AKVA 3ANTA 3TB6A 3U0VA 4A23A 5FOUA 1C7EA 3L0DA 3NZEA 2GCEA 2VF5X 3JX9A 2CCKA 3BHJA 3E7FA 4FWBA 1X3SA 4J16A 4LYEA 5CFMA 4CIDA 3HK2A 1YV9A 1K8RA 1HDOA 3F9RA 3HEBA 5J2UF 4CLHA 5HQ3B 2A5DA 1KMHA 4D9JA 3E8MA 3H8SA 1RMTA 2OXEA 3KD3A 2H1RA 4YROA 1R4NA 2FFBA 3TS1A 1TI7A 1E7QA 4DBLC 4AKIA 4KN9S 1UANA 4H1UA 3MRXA 4F38A 3H42B 2XCLA 5IHPA 1RP1A 2JVIA 4BNNA 3GFFA 5KUTA 3OOHA 2NUPA 4DA0A 4N03A 3TW0A 1RSZA 2QOEA 2G0TA 5D6OA 1XMJA 4CFYA 1RNLA 1QANA 2QUAA 3DLTA 5FOTA 3A3PA 4PFQA 2YWJA 4WAUA 2ZYHA 4WI1A 4WN3A 4Y6GB 4ZDIA 3JD4A 4KRGA 2I1LA 2IH4A 2PQ2A 2OZLA 5AJVB 1CQIB 4LMPA 3RSLA 3K72B 4IF4A 4OUDB 3ZNNA 4ND6A 1U3FA 4B81A 1ULZA 2CK3D 5J43A 1O3YA 3TEJA 4P9NA 1J2RA 2D8AA 2ZW9A 3KVVA 4P3KA 4PLGA 1BWQA 1RFLA 1GFSA 2PUTA 3JD2A 4PYMA 4ZZ2A 5JNWA 1JL3A 3K8YA 1JQKA 1XEXB 3S1LA 1T0PA 4QDZA