1QCDA

Crystal structures of adenine phosphoribosyltransferase from leishmania donovani
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
236
Chain Sequence
b'PFKEVSPNSFLLDDSHALSQLLKKSYRWYSPVFSPRNVPRFADVSSITESPETLKAIRDFLVQRYRAMSPAPTHILGFDARGFLFGPMIAVELEIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGTALSGLQLVEASDAVVVEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLLSDDALTEENCGDSKNYTGPRVLSCGDVLAEHPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE
molecule tags Transferase
source organism Leishmania donovani
publication title Crystal structures of adenine phosphoribosyltransferase from Leishmania donovani.
pubmed doi rcsb
total genus 70
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 1999-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qcdA00
1ZN9A 1OROA 5EUCA 1ECGA 1U9YA 3N2LA 2E55A 2YZKA 1G2PA 5HIAA 3ACDA 2HCRA 1VCHA 1OPRA 2WNSA 3LRTA 1AO0A 4X44A 4P81A 3MBIA 4PAWA 1A3CA 1HGXA 4X45A 4RAOA 1P18A 3ACCA 4P3KA 1XTUA 2H08A 1HMPA 4RQAA 1QCCA 5KAPA 3DAHA 4M0KA 2GEBA 4LYYA 4LZNA 4P83A 5K51A 1ZN7A 2DY0A 2P1ZA 3NAGA 1I14A 1Y0BA 4QYIB 1QK3A 4P80A 4WMLA 3DMPA 1A98A 1ECCA 4Z1OA 1GRVA 1D6NA 3MJDA 4P86A 1MZVA 3GEPA 4WN3A 5ESXA 1DQPA 2PRZA 1WD5A 1O5OA 5IAOA 2EHJA 4KN6A 4LZOA 2JKYA 1G2QA 5BQPA 1O57A 1QCDA 1XTTA 1UPUA 3QW4B 5HKLA 1G9TA 2JKZA 1A4XA 5JV5A 1QB7A 4P82A 4MB6A 2IGBA 1XTVA 4QRIA 1QK5A 1VSTA 4PFQA 1YFZA 5BQOA 4RHXA 1BD3A 1I5EA 1NONA 1ECJA 1XZNA 1P4AA 3LPNA 1FSGA 3DEZA 3OZFA 1V9SA 1PZMA 1BD4A 1VDMA 4RACA 4M0PA 2JBHA 3OHPA 4RHUA 1DKUA 1P17A 1QK4A 2PS1A 5IPFA 1IBSA 2AEEA 2XBUA 5JSQA 1J7JA 1L1QA 1CJBA 1UFRA 1Z7GA 2PRYA 1L1RA 4F8EA 4ZFNA 4LYGA 1ECFA 1R3UA 1I0LA 1UPFA 5BRNA 2C4KA 1JLRA 1A95A 1G9SA 3OZGA 1DQNA 1A97A 4RHTA 3KB8A 2FXVA 5ESWA 1A96A 2JI4A 5BSKA 2H06A 1OREA 4M0UA 1ECBA 3EFHA 4RADA 4P84A 1I13A 1JLSA 4JITA 1TC2A 3M3HA 3GGJA 1LH0A 3G6WA 1XZ8A 4JLSA 3S5JA 4QYIA 4LZAA 1GPH1 3H83A 1P19A 1W30A 4RQBA 1DBRA 5KAMA 3O7MA 4RANA 4RABA 2VFAA 4IJQA 1STOA 1QB8A 3HVUA 1I0IA 4RAQA 1DKRA 5E38A 2H07A 1TC1A 1ZN8A 3GGCA 4S2UA 4OHCA 1BZYA 1U9ZA 4RV4A 3ACBA 4FYMA 1NULA 4TWBA 4RHYA
chains in the Genus database with same CATH superfamily
5IKOA 1RM5A 2C7RA 4Z4HA 3IDSA 4NY1A 5KJ6A 1FPQA 1U81A 5J58A 5KDOA 3E82A 1QLWA 1GZ6A 3OY2A 5CX4A 1XPOA 1OXTA 3U7JA 1J2TA 1V8PA 5GONB 5AESA 3G5MA 1KK1A 1ZHHA 4IOLA 1U2EA 4JLAA 3K70C 4W5NA 1P7ZA 2PL5A 5DIZA 3VKGA 1PBTA 3BREA 4UEQA 2JGFA 2PGXA 5EJFA 4YYZA 1HMPA 4M0KA 4R1UA 4LHYA 3L7JA 1F8FA 3PUHA 2H9YA 3F6PA 4QYXA 1P61B 5COAA 1ZD4A 3V8BA 4JCCA 3BIFA 3G1WA 3GLFE 3W3AA 5J5AA 1CQZA 2JEYA 2HT6A 3UAZA 4XVHA 2ST1A 3WL8A 4MUAA 1HNXB 4JY7A 1ISRA 1DCMA 4GOKA 4O1HA 3MJDA 5AJYA 1B76A 1ADYA 3FBWA 1IQ0A 2H2WA 2Z3WA 3PJGA 1RE0A 2LXNA 4KX3A 1BXRB 5DRYA 1RNLA 1K5HA 1Q5PA 2ONKA 4GE0A 1TQ4A 3KHKA 5H3HA 1XEFA 2ZB7A 4E09A 4N48A 1J2YA 2ZRHA 2OQIA 4CXMA 1R5JA 4UATA 4DCGA 1AG9A 4QUJA 4FGUA 3O3MB 1EJ0A 1U2SA 2PS9A 2PX2A 4G5HA 4NPHA 4O02B 4WKOA 3TLJA 4CM3A 4LV6A 3VO9A 5L3VA 4HN9A 4K9MA 5FBHA 2HLPA 1ZPDA 2B7LA 2C5FA 4NBKA 3GJRA 4YA6A 1J5EB 1X39A 2BYTA 3AM1A 1RWNA 2CHUA 2HH9A 2QPTA 2ZS7A 2JFNA 4HD8A 4TV9B 4KSBA 4F1JA 4XQ0A 2JGDB 4BFVA 4KQFA 3T3PB 1NRXA 2JDID 4DYDA 1XDSA 2C84A 3ZDDA 4OVKA 1DIOB 4KMMA 3TSOA 1YSCA 2PUVA 3M6WA 4UCFA 1QVAA 2PQ6A 4IJ5A 5AI4A 4WGGA 3L6CA 3V4FA 3VDQA 5CLFA 1Y4AE 4Z0TA 3DOFA 3TLMA 3WYFA 5KS2A 121PA 3COJA 1R0RE 3L6EA 3BMQB 1KGDA 5IMBA 1Z4QA 4F8EA 1C30A 2DWOA 4CG1A 4PV7A 3ED1A 1NVVR 2Q21A 3WRWA 1LUAA 1EKXA 4Q7KA 1DAKA 1NVUQ 1FK8A 4RVSA 3ZS8A 4EGCB 3NJ8A 1J1UA 1IZ7A 4ZANA 3RT1A 1QFYA 2R44A 3KT6A 5ED4A 4IYRA 2D2FA 2FF7A 5CJPA 1WIWA 4JKOA 4MRMB 4YDHB 2E4VA 3HRHA 2UAGA 1Q1QA 4OIFA 1O95D 1XZBA 4S1OA 5CPFA 2TMYA 2RGXA 3WHIA 2I6UA 3VYVA 4CT5A 4DR1B 1M9NA 2B1JA 5KOJB 4MVWA 3PJRA 4RY8A 2O2DA 4NYIR 1CUEA 1MC5A 2DUWA 3NPAA 3L79A 3CLVA 1NMQA 3IQEA 4QGAA 4HXGA 1PNRA 2VHWA 3DOOA 1I0IA 1Y8RB 1FY2A 4RSGA 5K01A 3QM1A 3OQOA 2ZE5A 1DTSA 3WGLA 5A4FS 3ZJVA 4EDHA 3D4IA 3ZQKA 3KVVA 3FPJA 1WVMA 5DYIA 4JLNA 2XUGA 4WOBA 4DCCA 1M1NB 2W9XA 4DRXA 3V5NA 1I2AA 4LF5B 3DCIA 3UPTA 1V37A 2VRWA 2VVTA 3HL4A 4JJIA 1U8FO 2LKCA 3E8SA 3VR3D 1IHYA 3VX3A 4C0JA 2GD6A 1O6GA 3F6EX 2AXQA 4CCSA 4JLJA 3DHYA 5AKKA 4A8JB 1QV9A 1CVLA 2VP0A 2IT1A 1P1IA 3PR1A 3EVGA 4HDSA 4AY5A 4IDQA 2YV1A 3EASA 4I9UA 4MQEB 5BR7A 4S35A 1YR1A 4QGGA 2GVNA 3N8KA 4KLCA 1MC4A 1CT9A 5DI3B 2XBLA 4Z51A 4ZU1X 3Q8LA 3U37A 4KKVA 5JAHA 3FZNA 1P5RA 3UGTA 5ER6A 5I7RA 4BBPA 1F0YA 4W6QA 3USZA 2R97A 4M1ZA 1TMKA 1XJ5A 3N9IA 2IZZA 3NHPA 3NHKA 1WSDA 3P94A 1PFWA 1X9GA 3VKWA 4O2AB 1GT91 4LJ5A 3N75A 4GEGA 4E7PA 1GUZA 4ZCQA 1IG3A 2JJYA 4WN3A 1P7PA 5K0GA 1ZZGA 3PUZA 1L5MA 1DWOA 1TKAA 3MT8A 4Y0VA 2HK9A 1YVPA 1WM1A 3KPJA 7MHTA 3I6YA 3LKZA 3AH8A 5AYVA 3RRFA 4FGWA 3NJ4A 3OLZA 3R5JA 3PPYA 2DQYA 1X1DA 1PJBA 5TE9A 3ZGXA 2YVAA 3U7RA 2J9YB 2V03A 1TEVA 5CLIA 5EIOA 2O2YA 1KPGA 5CVCA 1JVSA 1U4NA 4J16C 2WM3A 2AKYA 2E9SA 5HOQA 1Z26A 3A1TA 3DZIA 2WB4A 4H1WA 1RRVA 1VPVA 3KQQA 2YRXA 3HJTA 1E0JA 2P75A 2A0UA 4NQZA 4ZI7F 8ATCA 1E1QD 3P2OA 3R0IA 2ZWIA 3WC4A 3K9NA 3CKMA 4HH1A 3UIEA 2HWYA 2B82A 5LMCA 3O38A 2JBHA 1UC9A 4NE9A 1IN8A 4ZHSA 1UIMA 1H3FA 2R1TA 3B6IA 1QG2A 2P77A 2VRCD 1KRHA 1MCZA 2ONZA 3G82C 2G17A 5FWYA 3LUBA 4DQVA 1XAGA 1H4SA 2BTQB 5CK4A 3O8QB 5DYYA 3VO8A 3U5ZB 3JYHA 3NBMA 1NVKA 2AF3C 3QA9A 3TK1A 3RIMA 4QTYA 3S2ZA 3GWZA 4KQWA 2TSYB 3A1WA 4D4LA 5C1DA 3IOEA 1YI8A 1DKOA 3HNPA 2A9FA 4IDDA 3T1VA 1L6RA 3UFXB 1F2UB 3QYFA 2QEQA 2XR1A 2CE7A 2AG1A 2C4NA 2JIQA 3DEIA 1AZSC 4TS9A 2I4NA 5IVIA 4BBZA 1E5TA 4YAUA 1QLHA 1D4AA 4DWOA 4Y2XA 2ZI7A 2F48A 5CVTA 3LDAA 4YJ3B 3CZPA 3NWJA 4BLPA 3ZGLA 3OT1A 3D0RA 4LYEA 2ERCA 1KZ9A 1QZZA 4WX2B 3RUEA 3EW9A 4KVAA 2QE6A 3C7DB 3M5WA 3A7EA 4GC9A 1QHFA 4HPXB 4YS6A 1UIRA 4IGKA 2Z4TA 4KQEA 4UE6A 1JG3A 2CYCA 5ESRA 2V4MA 1ONPA 4UEJA 3THWB 5CCDA 4XKJA 4BE4A 2G7ZA 4EM6A 4HRYA 3LTEA 1A4IA 2EIXA 1UBTS 1RR6A 2ABWA 2C9ZA 3N53A 4Y6QA 3GJXC 1OV4A 3VAYA 4ZZ0A 1HYEA 3RVOA 3BK1A 2F3PA 4A0RA 2CV1A 4GO1A 1RRPA 3HA2A 2DBVO 3ONDA 1DC8A 2P9YA 3B5IA 2XUQA 1DTWB 4R8LA 2XMDA 2AQIA 4FLFA 4LRTB 2Z6AA 2O48X 3OMXA 4RC9A 2XZPA 3V4PB 1MJHA 3H11B 1IN6A 2X7HA 3BDIA 3GF4A 1NLUA 4HBGA 5F76A 1X7HA 2VEDA 3F4LA 3WO1A 1J8VA 3U5TA 1MH9A 3CVJA 1N6IA 1OTHA 5CIWA 3LA8A 3V34A 2F2TA 2E1PA 4ZC1A 3SDBA 4CL2A 1WOMA 2EW2A 1TUBA 2HYDA 3PUIA 3IVAA 2AG6A 2AJBA 2BRUA 3OEHD 3H16A 2FPMA 3CG4A 3SHVA 5K0SA 5DTJA 4EQZA 1HURA 1AE1A 3QE2A 2J9RA 4HLDA 4MH0R 3LDFA 3T1YB 2WYWA 2IEAA 2GILA 4K05A 5J2TB 1RQGA 2OGUA 2X2EA 2WUVA 4JD5A 1J22A 4LAFA 1JJVA 5C0OE 3VZDA 3N2YA 4TV8B 1WP9A 4HPJB 5IAEA 1QV6A 2E7ZA 2YUIA 3ONEA 3TLYA 5JAPA 4PQYA 1KY2A 2V7TA 1NW3A 3SNKA 4KCGA 2YC4C 3BMOB 1KSFX 4HWKA 1AKRA 4L2IB 4KV7A 4E07A 4EY6A 2Z6UA 5BSMA 2EQAA 3HYTA 4W5QA 1PFQA 4GD3Q 4JC4A 1M2HA 3AETA 1TM3E 521PA 2WJ3A 3ZGZA 4W5HA 2NXEA 2GEVA 5HBRA 2A57A 3NKFA 5JYEA 3ADBA 4QM7A 3DVAB 1QIIA 3DH0A 4ES6A 1Q16A 4KBGA 4CMKA 3KE9A 2P9BA 1QK4A 4AJOA 1VSBA 3WYEA 4BKQA 1AHHA 4PZAA 1NJFA 3OT5A 4DB2A 2GESA 4GMGA 3MTBA 4LXQA 3ZIUA 1PGNA 2DT8A 1UBCA 4RL4A 1CWUA 5FPKA 5JNUA 3AZQA 2QOEA 2OCYC 2XGGA 2F1KA 5ALJA 3I9V1 1G3MA 1Z62A 4L4YA 1MABB 1BEUB 2M6SA 2NO7A 2QUKA 3OZRA 1T4CB 1Q44A 5EIAA 3BF7A 3OIVA 5JZMA 1S2GA 4KZPA 5IFKA 3TUIC 2QYSA 1RVV1 3LOPA 3HDHA 1UMBA 4LDRA 1YH3A 1SEPA 4C6TA 4XWOA 4IIYA 3Q3JB 2CVPA 2NACA 4J7CA 2H9IA 4IZ6A 1ULUA 4GT1A 2BONA 3WMXA 3QEOA 3FUWA 2OM2A 4I46A 5ITZB 1RXUA 2RCYA 1HO3A 2WPDA 1MRNA 1PX2A 2HRDA 2GNOA 3I12A 1QYRA 3LXMA 1ANKA 2GLTA 4MVJM 5HTKA 4D42A 4KACA 4O2BF 2FW8A 3OQBA 4AKSA 1IIBA 1FA9A 1OYWA 5JQGF 3MD0A 3K6SB 1XNJA 2A92A 1L7QA 2NT4A 2QE7A 3PQ8A 3DMNA 1JMYA 1WUJS 4PQGA 4HUQB 4CW7A 1OR8A 5KC9A 5J3JA 3H2KA 3HM9A 1ADCA 1LPBB 1I4TD 1YRYE 2F64A 3LX5A 2XHZA 3AHIA 1ZGHA 2ETXA 4IXTA 1VPTA 1M2KA 3R2JA 5G0VA 3W2TA 2HPZA 3SQNA 4LF9B 1XB2A 3FMPB 4QULA 3LY7A 3QLEA 1HSZA 4C87A 4FEAA 2QTHA 3KPWA 4L9WA 4RLQA 4X44A 5BN4A 3ETGA 1EFAA 1CP2A 3FHLA 4G5QA 4TUYF 1G8YA 3K0KA 3M8KA 1XMOB 3FWHA 4N41A 3E3LA 4X6YA 1JLMA 2H08A 3LWNA 4TVSA 2IPNA 5ALXA 3QPBA 4BATA 2WW8A 2XB9A 3AUTA 4YREA 2OVFA 3DCJA 4GSLA 4K03A 3HY3A 4DV1B 2P3LA 4KJXA 5CHEA 2P35A 3VV3A 3QPWA 2EZUA 1PKEA 4YLGA 3DA8A 2YVQA 4HF7A 2X2OA 2WVJA 1FU8A 1GPAA 1YKSA 2J5KA 4P38A 1K7FB 2OLJA 3UPUA 4RY9A 3N3BC 3WLNA 2WTXA 3TLEA 1ZEJA 3P2MA 2WU3A 1IBMB 3AIKA 2OHVA 4F97A 1J0AA 3IDZA 1PR1A 2B83A 1GN8A 2HADA 1F6DA 2R60A 4UBJA 2F3SA 3CR8A 1EGVB 4QYSA 1XEAA 2B9EA 1A9ZA 1A5ZA 1FP4B 2A4KA 1PV2A 5HILA 3BFVA 3Q5EA 4CM9A 4K8OA 1A04A 2WIDA 1YO6A 2GNAA 2OV3A 2QWXA 2YVLA 5ALRA 1U1IA 3COYA 2CHEA 1I30A 3Q0TA 2SCUA 1ULHA 5TMDA 4F9GA 1YFKA 3QPCA 2RBEA 4LJLA 1FMCA 3BGIA 1G7SA 3JQ9A 3GXOA 4KQCA 4UPDA 1PL6A 3EVZA 1JDNA 3VTAA 3CZ4A 4REMA 3TQRA 5FNZA 3U4GA 4R0MA 4IFIA 2FCAA 1DQRA 2OXFA 2W5UA 4E5NA 3G5TA 3E7PA 2B5VA 4IVRA 4Z9AA 3CVUA 1WKBA 1X1RA 2GEKA 2IJGX 1P91A 1Y8AA 4CV0A 4YXFA 4U2BA 3AVQA 2QG9A 1S2IA 2VR1A 4JXJA 1JAHA 3FBTA 2HV8A 1HOTA 2NU6A 4LFAB 5KHAA 3QP9A 4QZVA 1Y6RA 4II7A 3TX2A 1Y5NA 3VVLA 4CKBB 4BB0A 1RI5A 2IS6A 4MS1A 4CCYA 1Y42X 3ZBPA 3ADKA 2JFQA 2WE8A 3S68A 1A7JA 4J91A 1T9GR 2Z56A 3K6JA 1KDZA 3AY0A 5MFZA 1GNQA 4DIBA 1OKKA 3KPYA 1FMFA 3STWA 5B2ZA 421PA 4U6SA 3DM5A 1DT5A 1IH8A 1ZD1A 3MVEA 2QIPA 1B42A 2H06A 3HJCA 2NO6A 1E1MA 1G3IA 3C74A 4TMVA 5JDIC 3CLSD 4NZZA 3CEJA 5TR9A 4BNDA 4K1XA 1N3IA 1DIGA 3JAWB 4QARA 5FV7A 3RARA 4Q3KA 2X8JA 3O0TA 3QTTA 5FD8A 5B36A 2DHEA 3PU6A 4LZAA 3CLHA 2EERA 4X1KB 5C51B 1VHJA 1DLJA 5DNAA 1YCFA 2VWHA 4DS3A 1AQIA 1O2DA 3PV0A 5GIPE 4PICA 3Q3HA 1TU4A 3DZDA 3VM6A 1F2UA 1ZINA 4IIJA 3LNTA 1UODA 3HR7A 2R6ZA 1XMSA 3NUGA 4ZQFA 5HK9A 3RS7A 4EJSB 4PG7A 3CF6R 3ETDA 4DJFC 1HSOA 3D5QA 2PSDA 1CIPA 2Q5LA 2C0QA 4MRRA 4BMZA 5B55A 2ZBUA 1XD8A 4EENA 3UJNA 1NUPA 3NIFB 1T36A 1RLTA 2ZULA 3AV0B 1PT8A 4GUAA 3RI3A 3SMVA 1NQUA 3ORYA 4E5MA 4CTJA 3ZW9A 2R7MA 1OXBB 1XZEA 4FZ5A 3IAM6 3O73A 1HQYE 1QIEA 1Z0FA 2ZKIA 1B8OA 4CETA 3JALB 4S1PA 2WTUA 2H8GA 2Y1XA 1PYOA 2AR7A 1R0XA 4LJKA 4BNLA 1YR2A 3VVCA 4HVTA 4Y3UA 1PJ4A 4JNCA 2GQ0A 2WKRA 3RS2A 4ZMSA 4FGSA 2XVAA 5JAUA 4PXAA 4X3CA 1GZ7A 1KZ1A 1QVVA 3A4VA 2P2SA 4NESA 1ZI9A 3CUKA 4JHLA 5C3UA 2OYCA 3PTAA 4U63A 1GPWB 2H4XA 3VQTA 2E82A 2OZPA 2VBIA 4P4NA 4RGBA 2OCGA 2P41A 1EWTA 2EF1A 3SICE 4Z1OA 1KEWA 4FFRA 3AINA 1U1FA 3ECCA 2A9JA 1I3LA 3MOIA 3PFGA 1CK4A 4PZ0A 3LG2A 1QTQA 3UXMA 1YTUA 2ZRGA 4TS3A 3K92A 3KT3A 1DTEA 1JW9B 2O2HA 1I8TA 3IPXA 1G4HA 1NKTA 4Z7QB 2F43A 3DPSA 5IU6A 4Q4LA 3R5HA 3MGCA 1U7TA 4GQIA 2WF7A 3UAXA 2AV6A 5FA5A 1Y9DA 4QM6A 4NF2A 3W6ZA 4ZJZA 1EK1A 2A4MA 5KVAA 4MWTA 5IF3A 3PRHA 3DV2A 1CJKC 2JCXA 1P1KA 2JL1A 3FVQA 4ZREA 3T5CA 2KX7A 4D96A 3B3FA 2XT0A 1I5EA 3KVNA 5EE9A 1XTBA 2D62A 1WCV1 1ENZA 2VK1A 3LQQA 3CT6A 4BU0A 1NXXA 2QZ9A 2ZP1A 3UBMA 4BNFA 1GAWA 1W25A 2A7XA 4RZXA 4V2IA 5TEVA 3I1JA 5KTTA 1JN0A 2Q62A 5HX7A 1HZZC 4LE0A 4HNSA 2CFSA 3FLAA 1XCMA 5U1PA 1BDHA 4AMBA 3DMHA 5IAJA 2MMCA 3EIXA 4FR2A 4Y6OA 3QUBA 2XBUA 3P52A 1YVEI 4XEHA 2PZAA 5FWXB 4BNNA 5TVKA 3F2IA 2SECE 2DQSA 1P4SA 1QH1A 1VIAA 3T5AA 3ONNA 2BCJQ 2X0NA 4ZPXA 1ADFA 4TLDA 3W5CA 4OHRA 1VJ0A 1PJ3A 3BDVA 1ISHA 3CPJB 1K0UA 3JATB 4LZZA 1SCNE 2FUG1 1W36B 2XGOA 4HWPA 4QOEA 4X7BA 4YP0A 4ND8B 4C2AA 5JAOA 3S7TA 5KVSA 4HN2A 1P3DA 2IOFK 2ZTMA 3QYJA 1O8CA 4AROA 2QW0X 4WI1A 1C81A 5EERA 4B6RA 2JLUA 1XDBA 1PR2A 5BOSA 2G9UA 1VRVA 3GRFA 2BOVA 5IX8A 1PJSA 4BB9A 4U2GA 4BMXA 1NNI1 3ZK7A 2X6QA 3ABZA 2WWYA 1YRAA 2B4TO 1OH6A 2QN6A 3OLYA 1N1DA 4X6UA 3KYDB 3UMYA 1N5MA 3SX0A 1DX4A 2CJXA 3OEHA 4QUDA 1XLVA 5BMOA 3F5DA 1C9MA 4DMLA 4OQZA 5HF6A 4P31A 3I2IA 5GMOA 5SY6A 5JARA 3ZE2B 4FFPA 3KX2A 4LK3A 3HSSA 4POAA 5DPMA 4RFSB 2BHNA 5KPJA 5M29A 3E7XA 2BUAA 4TV8A 1QRUA 1OE0A 2ZAGA 1KJJA 4X41A 3TQQA 5BW6B 1H8ED 4MQ5A 4K28A 4RHYA 4EABA 4LRUA 1JT9A 1S9DA 1NHGA 4UAUA 1PAUA 3TGPA 1ZCFA 4FUQA 5B58C 4QG3A 1ZHOA 1DX9A 1VIVA 1B73A 1KARA 5AXDA 3ZTYA 2YJTD 1ISPA 1EBBA 3FF4A 4TV8F 4DMFA 3F46A 4F3KA 3F7MA 2BELA 4NYJR 2C82A 2JIDA 3FYDA 4JYBA 2JAWA 4RAOA 1ND6A 3QXXA 1WCYA 1V5GA 3TDKA 2AXNA 3BFKA 1RJ9A 3W90A 3G0DA 1L7VC 3OIGA 2X3YA 5JXGA 5U9CA 1A4RA 5IW8A 3GPIA 4G3XA 4UBIA 3V80A 5CGQB 3RFXA 3G3EA 4HLUC 1BA2A 1F06A 3V4SA 4U7FA 1CYEA 1JHUA 4H4EA 1A8IA 1RRGA 2HXYA 3KVRA 3L7OA 4FINA 5C4GB 1JQKA 3FUCA 3HN6A 3I05A 3QTLA 3TZQA 1C7QA 2ZJ8A 1OW3B 4EYOA 2AL7A 2NTYC 4C4YA 3KQOA 4NG5A 4BMPB 5A71A 1UOOA 3QX3A 3EIUA 1JHYA 3C3MA 2R8ZA 2OFFA 2VRNA 4PCVA 3WJ2A 3KLBA 4YV2A 5BWMA 4JHXA 2QTTA 5KQRA 2IP1A 2PUDA 2B6HA 2QX9A 1WTAA 1DU4A 1JU4A 2Z57A 2P9CA 4ND1A 4C5BA 2QUZA 1WCWA 2VWQA 3RR2A 4CEJA 2O8CB 2V6BA 3KSUA 3RS0A 4BFWA 3KG2A 2AB0A 5AI0A 1DLIA 3D8BA 3I23A 3U44B 3HY4A 1WPRA 1KYWA 2IZ1A 4L9AA 1L3CA 4EHBA 5KQMA 1OLXA 3U48A 2GDZA 2XD4A 3ILVA 4QRIA 5FEUA 3SC4A 4GOXA 3R9KA 1RXWA 3QV2A 3GLQA 3WIBA 1YFZA 1V4BA 2CEAA 2NW6A 4WW0A 3THXA 3L6RA 1GU1A 1Y1TA 1ZRHA 1W4AA 2GJKA 5KWSA 1XJ0A 2VNHA 2QRLA 2POCA 4PSCA 1O87A 5CLQA 1QP8A 4MUKA 2BMEA 1W36C 4P22A 3AW9A 4DG8A 2MYPA 4HK4A 2YHUA 2FGJA 4UQPA 1T9ZA 2YWFA 1DZ3A 3PHGA 4AMVA 4D46A 3WHPA 1Z4MA 2IUUA 1CJBA 1UFRA 3EXIB 1JR3A 3ILXA 3ILSA 3OTQA 4ND3A 1GNPA 5AQEA 2C7BA 5IF9A 1FP2A 1G6KA 3PDWA 1I2DA 4PG6A 1SBTA 3QMWA 4IAOA 4FCTA 1FVOA 2QX4A 4JQCA 3G8AA 2WVHA 3IUEA 3O83A 4LE2A 1F8XA 2H2IA 4OAOA 5ALNA 5EAIA 4RTSA 5AJXA 1DUSA 4XX0A 1P1BA 3TZKA 2B7BA 2WZBA 1H2ZA 1J25A 3NTXA 1TF5A 4TZTA 4TYNA 1F9AA 2QG6A 4S0XA 3U7FB 3EZYA 1NFRA 4QOGA 2BGTA 2CUZA 1N2OA 2BISA 4KNVA 3BK7A 4O63O 1ZU5A 5HJ2A 3ZZNA 2JASA 1A69A 4CQLA 1YGPA 2P79A 3HSKA 1BHQ1 3HYRA 3PD7A 1E94E 2VJMA 3L84A 4J3NA 4A2PA 1SXJE 1ZMTA 3CPEA 2UZAA 1M2VA 3V4VB 5HKAA 2VG8A 4MHSA 3EGIA 3BZWA 1IB0A 5LP6B 3IUJA 1GT6A 3ZNNA 1AS0A 3HDYA 1GGMA 1JJAA 3ZDBA 1FFBA 3ELDA 3WFIA 5B7GA 3F5QA 4FFLA 2XMRA 1TJPB 3FUXA 3BD6A 3LDHA 5E0OA 1II0A 4OHUA 3UMCA 3I5UA 4G0MA 1IY0A 2WU0A 4GXTA 4B3BA 1IXZA 3BWXA 4RD4A 1E4OA 4RF3A 5E8JA 3WNQA 3HLYA 4EG5A 1Y1RA 2AYZA 2I7CA 5EG5A 3CX3A 3OEEA 3Q85A 4J0HA 4GI7A 1M2JA 3AEKA 4J4HA 3T9AA 1M34B 4JYAB 3QVUA 4QEZA 4Q6WA 1UFOA 3VSDA 4CG0A 1I1OA 3QBEA 3R5SA 2AI1A 2OPBA 2QT0A 2Q5EA 5CHYA 4MUYA 1ZH4A 4XOIA 5AVVA 4W7IA 3QHAA 3NASA 1DP4A 3GFBA 3GG9A 4HP8A 1HTTA 1KJYA 1YBAA 1L7XA 2ZBRA 3EHEA 5DWQA 3JASB 3ED5A 3QKTA 4L51A 1C7FA 2FEXA 4J0FA 1G38A 2KQUA 1JG2A 3F1KA 1XYVA 1EM8B 3KL2A 1NMSA 3C3AA 4H3VA 1GTL1 3LZDA 2HMYB 2VA9A 5DCYA 3IOBA 4FQ7A 3RC1A 2MJLA 1KIMA 3QWHA 3TFWA 1ZOLA 1AVTA 3DBRB 4I6EA 2K5UA 4TSFD 2B94A 2VC2B 4N0MA 4PAGA 3ZH9B 4MR7A 2MSCB 1JB9A 4WLOA 5DHAA 3B2NA 1A0OA 1LLDA 4EW2A 1KI3A 4NZ9A 1AK2A 3RVBA 3TPCA 3LFUA 5E2AA 5FHQA 2OWDA 1VSTA 1B3BA 1QQAA 2O1SA 1A8HA 1YT5A 4MWBA 3K0EA 4BLSA 4KR2A 3IAEA 1JGTA 4GBMA 2IXGA 4QPZA 1KJNA 2Z5VA 2ZTHA 5CFMA 2FWBA 1RBZA 2MTBA 2OLKA 2GZRA 1PZHA 1BEEA 1Z6YA 2WIAA 1UJ6A 1I32A 1UFQA 3QKWA 4Y6GB 3DL7A 1D8TA 3IKJA 1IE3A 1SIBE 3IAXA 2N46A 3Q7PA 1JWBB 4EI7A 4YO8A 2QNBA 2GZHA 1SU4A 3HV0A 4JLPA 2NUTA 3S2SA 3Q2KA 1VKZA 3NYIA 2PWAA 3KNZA 4TRJA 5HBGA 1R4NB 2M2IA 2P7IA 4ZFNA 4HXYA 1YB2A 3TL6A 1RM3A 2GB4A 2D5CA 2FPPB 1WSAA 1JYFA 2JFGA 3TEJA 3ILHA 4CUKA 2PV7A 1XLUA 3HSYA 3ZCQA 1OILA 3ZV4A 4UM8B 1N6HA 1AU9A 1LWNA 1RZ3A 3CCFA 1VP3A 1OA0A 2I71A 1WXWA 1Y3FE 4UUAA 5K3SA 3G0BA 4M0UA 2GRAA 5GGXA 2FMXA 1A8QA 2PMKA 1VXOA 3BN3A 3L8MA 4AMZA 1FP4A 1VLQA 1KFBB 4MQ4A 1EFHA 1D6SA 5EIHA 3EIEA 1JIXA 2E4AA 3SBEA 1RDFA 1Y1LA 4TMYA 4GXRA 4G4GA 3UZUA 3PC2A 1S2LA 5HCNA 1MRSA 2C1EA 2I7DA 2Q0XA 1I01A 2UZ0A 4KMRA 3R76A 1Y9JA 2VCEA 4HSEA 1CPYA 4MMYB 3T7RA 3CRNA 3OJ0A 1ZG3A 1U0FA 1XZAA 2XAAA 3DQPA 2J7KA 4NCXA 1PCXA 1SBQA 2D1YA 3DP7A 1ISFA 3HU5A 4I1PA 4LOKA 1NFFA 4YJ3F 1S2OA 3DSRA 3FPKA 5DRTA 3INRA 1G98A 2AS0A 4J1TC 3RT7A 3AF2A 1LNQA 1IB6A 4KLZA 2J0UA 4KGXA 5ADUS 4BNGA 4IQGA 1M2WA 3ZNQA 4B6SA 3UG7A 1VOTA 2XNJA 1UJCA 3CKYA 4HEA6 2CJPA 1OU4A 2B8EA 3OQ6A 4BRSA 3SHTA 2PUEA 1X92A 4LV8B 4AO7A 2AKEA 4HQNA 3D6JA 5BT8A 3MBIA 2AK2A 1VSVA 4C06A 1QM5A 1NVAA 2I3BA 2QM0A 3EWAA 5F23A 5CITA 2EP5A 4FHDA 1SULA 2GD1O 2JD0A 2W58A 3C1OA 3PDIB 1JHZA 1KAMA 2H2DA 2QLNA 3NPMA 4BMSA 5JQWA 1NQOA 5FYDA 5K51A 4JGGA 4R7GA 2J07A 5IKPA 2O0MA 3KR9A 3RFCA 2BEWB 3DQZA 3JAWA 5FRDA 5HE9A 3R6GA 3D4OA 2QLBA 1L5GB 3UXYA 4E2FA 1RWQA 3AUKA 1VJRA 2QNRA 3UXHA 3WK5A 2LWIA 2ZRAA 2BBSA 2VKTA 1I2BA 2R85A 3MCVA 2O8FA 5D3ZA 2E5WA 2RK6A 5CU7A 5LNK1 3CX7A 4M7OA 4CKXA 1IL0A 5HIIA 2ZS8A 5DNYB 3KJHA 4MDFA 1KNQA 2JIOA 1NMZA 1BJRE 2J9ZB 1D8AA 3NTQA 1O5OA 4BMCA 4C0KA 5IAOA 4N0QA 4FW9A 1Y6FA 2Z0MA 3BCSA 5K0FA 3W1EA 3KLMX 3HYNA 4X92A 3NFRA 1TECE 2JCYA 3B48A 3MWJA 2O9JA 3DE7X 3AI2A 5IH3A 4DEYA 1RAEA 4X9XA 3UAOA 3AOEA 2W4QA 4Q05A 4MB6A 1Q22A 3P5SA 1POXA 4QRHA 2X4LA 3R3WA 4H6VA 4E94A 2RGBA 2R00A 1TZJA 3TL3A 3C7KA 4RK0A 3TQSA 4A03A 2O6LA 4MQEA 4CF6A 2E85A 4GL4A 5KIAA 3OD5A 3VZCA 2QY6A 3LO8A 3DHNA 4F9TA 2W00A 4J07A 3K0AB 5JZOA 2HMAA 4NVRA 4JSRA 3PWZA 3R7FA 3H2YA 2MSEB 2RIRA 4QBFA 1QIHA 3JPYA 2J09A 4XJTA 2NU8A 5IZ4A 1BH2A 1JU9A 4TQ9A 2VKQA 4FFNA 4KXUA 3GZJA 2I87A 5KNDA 4P2GA 3NVKI 2RAFA 1LK5A 2WTBA 2YS7A 4MVJD 3ZI0A 3DP9A 3GROA 5K05A 3GHYA 1GO2A 3ZR4B 2SICE 1CUYA 2QI9C 5DGTA 1PX0A 1U7DA 3DBRA 2Y6VA 1ZONA 3FB4A 4Q9KA 5BSKA 1G4AE 4HAIA 3A2KA 3KZNA 2PJRA 5CTJA 2V97A 1R8JA 2Z8ZA 4IVPA 3HH8A 1DEAA 2PUTA 1E77A 1T25A 1O9GA 3RC2A 4CL3A 5TGDA 4ZK6A 1AKVA 1G8MA 5HW0A 1FSFA 3JD2A 4K86A 1T1IA 1JIJA 1WRBA 4LYDA 3A1UA 1XKTA 5EXDA 4EGQA 5B2FA 2P6RA 1ES9A 1KQ3A 3GV0A 1OBHA 3L6OO 4L07A 1DG9A 2DBRA 5G41A 1GPMA 3HMQA 4C0QC 1AZTA 5FEMA 5H81A 2CNWD 4LOAA 4ZC8A 4OAPA 4FXOA 3EOAI 4WHMA 2XKAA 3NV7A 1G6HA 1Y8CA 1AT1A 1R8YA 5LOVA 3G8BA 1JU3A 1QCYA 3SQLA 4D56A 1HA3A 5AM2A 4PXYA 1W73A 1ZUWA 4XM2A 3WWPA 4AKEA 4KEAA 5TEWA 1N7IA 2I29A 1VI5A 3IHTA 3MAAC 5L95A 1FDVA 5KYNA 3JD3A 1G5PA 1M0SA 3EAQA 3OTWA 3L5KA 2XOEA 2AFIB 1UDBA 1X14A 2FPPA 3TW6A 1GD1O 5FAKA 1OPRA 5CTAA 1EGAA 3OPMA 1DSSG 2QL5A 4OXRA 1TK3A 4JLMA 3TVDA 2YZMA 4Z0PA 3R7SA 3DFZA 3W06A 1IIRA 4OJQA 2B1GA 4TTRA 1CR6A 2JZNA 2W4IA 2PQMA 1QGED 4Q4HA 4Q3AA 4YQZA 4XPZA 3EQZA 1NRWA 2Z9CA 3N7TA 4MCIA 1MDFA 1G20B 5CFQA 1I14A 5REQB 1NT2A 2O3TA 2YIJA 3TCKA 2J7PD 4YP1A 3VOBA 4TUYB 4X91A 4NMMA 3U49A 3OESA 4IDCA 1FFCA 1KI6A 3ITKA 3BHIA 1OY1A 4FDUA 5GJBA 4UTPA 1ZWKA 2WTNA 4MRNA 2JPDA 1REQB 3LF2A 4OQNA 5FOSA 3WWYA 3ZKWA 4YUZA 1RPNA 3O31A 1E3SA 3TLBA 1Z4NA 3AILA 2N0SA 1J5XA 2RHBA 1PD0A 3QKSA 3C97A 3HVIA 3HEBA 3QBTA 4GBGA 4MPTA 3SYMA 4F2HA 2Z9DA 2FSHA 2OUIA 3DS8A 1VP9A 3MOSA 1ESCA 1PNTA 1C3VA 2DOKA 3FG9A 1MOQA 5FUWA 2RHTA 4DLBA 5JJCA 3T7AA 5LWQA 2G6TA 1I51A 5CXSA 1JZQA 1JECA 3AFHA 1VPDA 4MR8A 1DOHA 1CR0A 5EYPB 4L08A 3D2CA 3WR5A 1I33A 4MVJA 2K4MA 3HKEA 4IIGA 2FHSA 4IXDA 3M6LA 2W70A 4O08A 1JKJA 1FUYB 4YJKA 1BFDA 1TB4A 3RHSA 1LF5A 2WB2A 2BFAA 3NDBB 5B4UA 1TLFA 2MSKA 3HBMA 1UBOS 2VBCA 4XI9A 5HOEA 4DABA 3MJCA 5AKGA 1JQEA 1RJDA 1K7CA 1S8NA 2Z30A 2V9CA 4ZO8A 5DLYA 5ALQA 4IW3B 4BS9A 2FPKA 1BXGB 4CV1A 1YZVA 4KLNA 3LLSA 2Q5JA 1BVRA 5JT1A 1Y7HA 4UEWA 5BNFA 1YQTA 1MT3A 2O1XA 3AETB 4JV5B 5ECYA 4GYKA 1HT0A 3IBFA 4IDOA 3DB2A 2IY9A 2QENA 4NYMR 1KVTA 1O08A 2DUMA 4BO9A 1OAKA 2Y3IA 1WB5A 3GRZA 4YRKA 4KKXB 1VA5A 1US8A 3LCRA 1VLJA 4WKGA 3T6KA 5KZMB 2K2QB 3NLLA 4U0KA 1Z5ZA 4MB2A 1N9ZA 1YDMA 1MC1A 3D2AA 4J4BA 4RSMA 2H5EA 3WDMA 4JP8A 4BKRA 3GBSA 2EV9A 1GL6A 3VU9B 2EL9A 5CB4F 3V3KA 4YC7A 1C7RA 3WRVA 1J0XO 4PLCA 2QMYA 3PX3A 1USGA 3F49S 2C7VA 3H4VA 3ID6C 3QRWA 4ALKA 5F3DA 3WLQA 3EVNA 1GTSA 5AIAA 2WJJA 1UXJA 3UUGA 4EF4A 3QPUA 3ZWQA 1T9BA 4UVDA 4NJEB 5NLLA 5BR4A 1N7HA 2HA7A 4NS1A 1UPBA 4TLBA 3ZCXA 4XQGA 4ZEXA 4C0LA 2G1JA 3JQBC 2CJWB 3NHBA 4MV5A 4QXRA 3PT5A 1MG0A 5AVSA 3MGGA 4X8OA 4WJZA 4C14A 4URVR 3KTOA 3AUFA 3B1KA 3LT2A 5GQSA 2ZANA 3E05A 5E9AA 1NXVA 2QUBA 3OE4A 4LZJA 1EWYA 2V6JA 1B41A 4RWEA 4RY0A 4OQQA 2ZDHA 1Z8HA 2OHXA 3PC6A 5CG2A 5H4GA 5KCZA 3STVA 2X7JA 3NTRA 3ET4A 3AW8A 1FF9A 1I36A 3LFTA 4IRMA 2GN6A 3UPDA 1UMCA 5I8ZA 3WQRA 3KD2A 4MIOA 2ZRNA 3AXTA 4K88A 1NI4A 4Z99A 3WX0A 1Q92A 2VP3A 1J39A 4OXQA 4GQBA 2DJ5A 4ARZB 1AK9A 1D0SA 1GGJA 1RYBA 2HF7A 3EXIA 3KJZA 2Q5CA 4PC1A 4NBNA 4Q9IA 5L4SA 4ZRMA 4K9LA 4XR4A 3VR1A 1M6VB 1QP0A 3GCWA 2W93A 3JPWA 5IVDA 2D4HA 2IPAB 3HNRA 1ZQ1A 1C1XB 2PRSA 2VHXA 1GVNB 2ZYTX 3MTJA 3FNRA 2E4ZA 3R8CA 5CFOA 4I3GA 2KS6A 1T10A 1UKEA 4NNOA 3SOZA 1V45E 1T2FA 4RH3A 1KKLA 1TMGE 3GGPA 4FIDA 4JJ8A 3UGKA 1PS8A 3UGJA 4I4TB 2L69A 4MEBA 2Q8QA 2DVMA 3RAFC 1OVMA 2WT4A 1R3DA 5TC4A 1Y89A 2J3HA 2M6KA 5H70A 2HPAA 2HIGA 1SQ5A 1L4GA 3CIFA 4F4FA 4PZ9A 2O19A 4RQTA 5BOVA 2A9QA 3J7AC 1Y8RA 2IYRA 4O2AA 1RADA 5EHQA 1QLJA 5KYYB 3NEYA 4HWRA 3COWA 2A88A 2GCOA 1ODLA 4B6PA 5IHXA 2PZGA 1HDYA 1G291 2FQWA 3K2IA 4RMIA 3EXAA 4OHOA 3ZU4A 5I9LA 2Z2KA 1K0FA 4JEUA 2CLOB 4RK4A 4EW1A 5KTNA 4G5RA 2ZYAA 1ZRNA 4XGNA 1WMEA 5FB3A 3VDMA 4DV4B 4ACBA 2VXOA 3M1AA 4FB5A 1B8VA 4LE1A 3E9MA 2ZWVA 3SEAA 2GAOA 2HNKA 6GPBA 3KZVA 2UVDA 3GAMA 5JSFA 3H9GA 1G20A 1BD4A 5J63A 1HYHA 2GF0A 1E9SA 2O2XA 3FPLA 3OBBA 4MCJA 4TV9F 2HRBA 1FLNA 3PYLA 4CMBA 2PS1A 3GRYA 2Y0PA 3PZRA 2FZ5A 5EJ8A 1DEKA 3FDJA 2ERXA 4G0VA 3HCDA 2DRIA 3D6TB 3NM6B 2JFYA 3NIGB 1M8KA 2L82A 2OV4A 4TM8A 4I1OA 5KI6A 4XQCA 4L73A 1MGPA 4JL6A 3REQB 1RXEA 1QXSA 4GMDA 1Q3HA 1EPUA 1Q57A 4MLZA 2ODQA 1S2MA 5FWYB 1VSUA 4G25A 4LJ8A 1PS0A 3IVMA 3QVXA 4OBBA 4US0R 3ROMA 2JJ1D 4Q12A 5ERGB 2IXDA 2FG6C 3SHFA 3W7VA 3BKWA 4NV3A 5C80A 1LGYA 4KREA 1QVZA 2FZCA 4IHJF 5C37A 2ECOA 2NAPA 1PJQA 4D9CA 2PK3A 3H6GA 4QXOA 2HWUA 2QD2A 2FVYA 2Z3VA 5KNLA 3E70C 4BHTA 3P0JA 1CS0B 3BSSA 1CZLA 1JPNA 2CD7A 1JLKA 1U6IA 4TKZA 3JQDA 5D1HA 1FUIA 3R5KA 4DJ5X 1B6SA 3PKIA 4S2UA 5ICSA 4KMSA 1CULC 3K73O 2GZMA 2BHSA 4ZYUA 4N7RA 3IAAA 4IG4A 4OKSA 2R6DA 1JHQA 4Q3LA 1ECGA 4ZIRA 1LFAA 1EP2B 3OZUA 5L4NA 3GUZA 3Q40A 5DP2A 1ZO8A 3TOZA 4Q4JA 4A8HA 1RU3A 1XBTA 1M2FA 5A3RA 2R47A 5MN6A 4J6EA 4EBBA 5IXJA 4KN8A 4B8ZA 5FNVA 4TWAA 4I55B 5JPDA 2IYWA 1OFUX 4O4HA 1QP4A 3I62A 1XA3A 3AR6A 1YV9A 2J9FB 3C7CB 3KELA 3LUGA 2I66A 1AUVA 4LIPD 2WR8A 3A28A 1N5OX 1KBZA 3ESZA 4ZYYA 3NNNA 1XMPA 1RJEA 2VO1A 1PUIA 2WWWA 3AJRA 4OP1A 4PZLA 1L4KA 1RYDA 1Y9EA 3KEFA 3MINB 3G2IA 3MJVA 3MXTA 4LC9A 4UXIA 4Y1RB 3TZEA 1QK3A 2G8NA 5K4GA 1PLLA 4H2DA 4EJSC 3V2UA 1ONOA 3BC1A 1E3WB 3BX1A 3O4HA 1XK7A 4W99A 5FWAA 2IS2A 1H2FA 1Y4SA 3EPKA 1X3SA 1X80A 4H60A 1KY3A 3V8PA 4DWWA 4B4VA 2BMJA 4NU5A 1MPTA 3ZDFA 3MWYW 3LUDA 4QLOA 3HJFA 2CLIB 2WHXA 1H05A 3H65A 4KPGA 4ZEOA 1E3MA 1XDGA 1Z5PA 3EC7A 3EBLA 3WL3A 7AT1A 1KOJA 9ATCA 3PI7A 1M66A 3S28A 4PX9A 1KFEB 2FN3A 4GDFA 3C5WP 4XXHA 1TADA 2BMDA 2H1SA 1NW5A 1XZFA 2QQ0A 4IRUB 3QPVA 2I2CA 1ZWLA 5CR9A 4EKIA 4PZCA 5KYGA 1BW9A 3A36A 2V7PA 4RE6A 1BHSA 3LMKA 1FDTA 4PLYA 5KTRA 2QE7D 4M8SA 1KH2A 1ZM9A 3VOAA 2ZFUA 1AQ6A 1YL5A 3OEWA 5T41A 1U8UA 1H6CA 3H17A 1IOVA 4MYTA 2IV7A 1YQWA 1L5HA 5BP7A 1H5NA 1BHO1 1Z4JA 3JRXA 3PWTA 4BEBA 2GBIA 2VZ8A 3HXKA 1KYYA 3RM3A 2IGTA 3JCZA 5AM4A 5FR2A 1JKJB 1FYDA 2BZ0A 2HK6A 4RACA 4TKVB 1KSGA 3UC5A 4DQKA 2Q5FA 3SE0A 3DDOA 3UH0A 2CUTA 3VNBA 4LNHA 1ZK0A 3CLUC 4NP6A 5CD1A 2DERA 1JR3E 1ICEA 1KE2A 1SXJB 3GC6A 1LBSA 4JJ4A 4MUBA 2PFGA 1KR2A 3UV6A 1O97C 1JZSA 1BWRA 1JH8A 4CDRA 2GAJA 3VR6A 4HNHA 1PHPA 1QDEA 1IBKB 4G4IA 1RHMA 5DSXA 4A10A 4JSTA 3UJDA 4M36A 4EF6A 1JHAA 2WUFA 5CT4A 4EFKA 2FI1A 2G0NA 2QN2A 4N65A 5KYUA 5AJTA 3GJ3A 1UBUS 4NH0A 1PT7A 1E2NA 1P7YA 2VT3A 4ZMRA 3M3HA 3NHSA 4PPQA 4BAZA 3ZY6A 5BUZA 6PFKA 2NP7A 4RPJA 3K05A 1WHSB 1HC7A 2HLDA 1NPDA 2ZSFA 3CT4A 4I2NA 4LMAA 1Z4OA 3LH5A 2IHKA 2G67A 4CKEB 2P8JA 1R6VA 4X1IA 5KTMA 3VISA 4D92A 1Z7WA 1K5PA 3QG1A 5K3OA 2X5OA 3QVOA 2CV2A 2UZ3A 3L0SA 2FW7A 1JWLA 5CW1A 2JLWA 3NAZA 4EK9A 2QMEA 4G23A 2DECA 3GBVA 1E7MA 1NQ5A 2C96A 3HBAA 1FNCA 4DJAA 4EAAA 1LKZA 4IIUA 2GVDC 1PG2A 5T6BA 3NEJA 5ETJA 1BZYA 1U9ZA 2ZTSA 4L5YA 1Q84A 1Z7YA 2P11A 1LZKA 1CR4A 1T5HX 3QE4A 4NK4A 1C3EA 4NDAA 4C03A 5MDHA 2X1VA 1ZN9A 4UU0A 4HGOA 4LRQA 5KOYA 5AVRA 4X1OA 2WRZA 2G3YA 1IC6A 1GUAA 1K8QA 2I2AA 1AGPA 3GO4A 3H97A 3CUEF 3IQIX 1QAQA 3S44A 1UJ2A 3TZCA 4DLTA 3OOHA 5LDHA 1FTNA 3LVBA 3AUJB 5KDDA 4IGIA 3L7IA 4L8VA 5J2TF 1OA1A 3DZFA 4DVJA 2WIJA 3IUNA 4MP8A 3GL9A 5GPBA 3HP4A 3KUDA 3GD7A 2PUCA 4DILA 2I22A 4Q02A 3ZZMA 3CH6A 3LCUA 3PQEA 1K8ZB 3H5RA 1E2FA 1NPYA 2PX0A 4PHGA 4ZZ1A 2HJRA 1HMYA 3PE6A 4D25A 2OE2A 2ZU0C 2A84A 3ZGOA 3MFYA 4F6LA 1S4QA 2EJVA 2NXJA 4UMEA 4B74A 1MUUA 4JB3A 3JU3A 1DO8A 3D7RA 5KSPA 1Z28A 3RKRA 1ID1A 2CY0A 4HAZA 1QQ6A 3WBFA 1XNRB 1GZDA 1GAEO 4NMLA 4N5DA 2B20A 2PBFA 1YA6A 4MZDA 1DAIA 3IULA 3SBOA 1VL0A 3FWPA 1K9VF 5IMSA 4PRZA 4I4TA 4B8YA 5ARCA 1BU5A 1EAMA 1T36B 3ROZA 2EZ9A 1N8NA 1YS1X 3PGJA 2FHPA 2EX1A 1TAHA 3OZVA 2WKPA 2AFHB 2Z9BA 2M32A 1WV0A 4KRXA 5T8KA 4BVAA 3BWMA 3RYHA 1KAHA 3SC2A 2YFQA 5INTA 1VZ2A 1XA4A 4AFNA 3W2FA 4BUZA 3B1JA 4C0AC 3U19A 4ZCPA 1HORA 2V8OA 1W0KD 3L0BA 3R7BA 4ZKDA 1V39A 3GVCA 3HKDA 1KQGA 3ZGNA 3OIUA 3PFCA 2PLFA 1NBEA 2WIBA 4QXPA 2VDUE 1ZIXA 2VSFA 2YXNA 5GV7A 2ONJA 3J81k 1PR9A 1VCIA 4YALA 2PRJA 2REXB 3P20A 2G08A 4RCYA 1AGYA 4WY2A 1ZVKA 1UBRS 3R0VA 2I76A 1G0OA 1TFUA 4NBLA 4UHDA 1Z2EA 4FHCA 1HDIA 5HWSA 5IK2D 1RHUA 4NBTA 5DK6A 3CRMA 2LD4A 4YUXA 4KG7A 4Q9JA 2J3LA 5EXSA 3RSOA 3ELYA 1JFTA 2KI5A 3GZNB 2R65A 1QH8B 3VNRA 5JADA 1PSWA 2FV8A 1O77A 2D1FA 1ZM7A 3WGTA 3DKRA 1TQ6A 4RVNA 1LVUA 2BF4A 1JXAA 1YVRA 2QRHA 1WULS 4RU1A 3LBFA 3NHAA 3RNOA 5CCBA 4LJSA 2AR9A 4KOEC 2KLBA 5E1MA 2Q1TA 1SXHA 1YS9A 3M2PA 3BERA 1IUOA 2W0MA 2ASVA 2QW1A 1GPNA 1ZJ6A 3G2HA 3LYAA 4JDPA 2ARKA 2YMPA 4RY2A 2DMRA 1GUYA 2CZCA 4GWGA 4C76A 5FKJA 4YAOA 2X42A 5CB8A 4IJQA 5HPYB 1UEJA 4DMGA 1KPIA 2WMDA 4MQMA 2MSNA 2FUG6 5EMNA 2VAPA 5G2OA 2OO5C 4MV0A 3UJAA 1ZVVA 2UUAB 1KYVA 3W4KA 5JZSA 4U7HA 1LX6A 3RIGA 4DR4B 2PZEA 1KKMA 1RLMA 1TAGA 1WXHA 4MI9A 4TT3A 3ZD9A 2V9ZA 1YZKA 2NUAA 1N2BA 3P9ZA 4N12A 2H4FA 1L8XA 4EEXA 5I7UA 3VAZA 4D7AA 3ETNA 3UM9A 1E2PA 5JNVA 1MEEA 3TZHA 2D3WA 1OV6A 2NNLD 3P9YA 5CYOA 1CQXA 1CY8A 3GCDA 3IO3A 5C31A 1LC0A 2O3UA 1PVDA 1NLZA 2FMKA 1A5BB 2P2DA 4X63A 3OCJA 4LCEA 5JXJA 2AN4A 4F71A 1UPTA 1R27A 1XRPA 3R41A 1QQ5A 3P0EA 3NHWA 3QVWA 3ZU6A 1V7CA 1WP4A 1RPJA 5BQXA 5C8YA 5IZCC 3IUSA 5I4IA 2ZCUA 1BE8A 1FNMA 3DG9A 2PXCA 4RMJA 5I7WA 2GH1A 3E9EA 4I55A 2NPOA 3FHTA 5JSZB 4BN4A 1D5CA 3N74A 1FTSA 1KEPA 3QYPA 2BV3A 4JCOA 2PKXA 1G55A 4N03A 1E1YA 2J9FA 4YLEA 4YROA 5LYYA 3AVXA 4ENRA 5JQGA 1WLSA 2YRWA 1I6KA 4NKRA 4C4RA 4XAQA 1LBEA 4R1MA 1VYUA 3HFGA 2EKDA 1NLFA 1RBQA 2ROQA 3PVZA 4LF8B 1THZA 2XVYA 5I6DA 1QU2A 4MQBA 2HHAA 2O4CA 1HI9A 1E6UA 1IOWA 1VBMA 4P53A 5GIOE 1B00A 2HBQA 2J3EA 2ZBEA 4QJ5A 4DIOA 4HNUA 3DPUA 1X80B 1SURA 5BV8A 2WDPA 2QRGA 1ETHA 3CLRC 4RPIA 1XN1A 3NT5A 4QGFA 1LTHR 3FVVA 5C7YA 1COWD 2QMOA 3OQVA 1W35A 2FFRA 2ACEA 2XWQA 4GLLA 4GU5A 3ZBQA 4BMDA 1KMIY 4EFLA 4EY4A 2Q3CA 1SH7A 1SC4A 3ZVKA 3JWIA 2HBYA 1CFJA 1SUAA 3KQNA 2G5PA 1V71A 1Z2AA 3E5RA 5H80A 1FJ2A 3H8SA 1M6VA 2B7CA 1K86A 2IA5A 3Q41A 1N3YA 4KU4A 3ZQUA 3ZWCA 5DOVA 4AN0A 4D9BA 4ND2A 2Q29A 2MSLA 3ZZUA 3TG8A 4WXEA 5F9MA 1K6IA 2UVPA 3AZOA 4MYCA 4HKTA 4HDQB 3PS9A 4PFSA 2CXHA 4IICA 4Q4JB 2H11A 5JLAA 5JMTA 4FTWA 1XDUA 2R7NA 1ZKMA 1XZHA 3PGVA 4KUEA 4M49A 1CY1A 2VT7A 2XPCA 2YNMC 4B2LA 4RK1A 5JMPA 3TQFA 4TKVA 1I1HA 4U6NA 4ZCTA 4EHNA 3MM4A 3NH6A 1TEZA 3GLFA 1ZDMA 1U2TA 2AFRA 4KXQA 4B7CA 1Q17A 4OJNA 5FTWA 4C0WA 4K6HA 1QOZA 1FP7A 4S0ZA 3M6UA 4BNKA 2OSVA 1WW3A 4G07A 3L40A 4XH9B 3GOHA 1HKUA 4JN6B 4MYHA 1IAQA 1E8NA 4UXJA 1PWEA 4MV6A 4ZYWA 4M1EA 5KNBA 5LR6A 4YR7A 2XQVA 3CRRA 4IM7A 2YJ3A 2I2BA 1XVAA 5ALEA 1UMKA 4LMBA 2JANA 3D8RA 3FIUA 4X7MA 4EYSA 4TMFA 1FX0A 5KAMA 4UU8A 5P8WA 3DTYA 2YNMA 4BNJA 4AMUA 4BO7A 3PFFA 2B92A 2R6FA 3NP9A 2E87A 5JSHA 1KMNA 2BP7A 2ZUCA 3EVEA 2YN0A 3L8EA 1JKFA 3QG5A 3BXXA 3GH1A 4EQ6B 1ZR4A 2D5BA 1LWOA 4BZXA 1KVUA 2AE2A 2DB3A 1L8LA 1JAYA 1MV5A 2G9ZA 1FTWA 2TS1A 3CB2A 3GUHA 5C7LO 3MB8A 3I6MA 4L0MA 4DLKA 2DFTA 2NO4A 3KC2A 4UE3S 1WMDA 5TX7A 2W8BA 3OZTA 3BXEA 2FUEA 1AO0A 3RWBA 1CDDA 3Q98A 3L6DA 3ZWNA 3KWLA 1XTUA 3S70A 2OORC 4FGKA 1EE9A 1QCCA 3PFWO 2WJZB 3B82A 5D5PA 1XMQB 3PF9A 2ZR9A 4HBZA 3B38A 4LGCA 1IBLB 2UUOA 1ZN7A 4ZRNA 5AVOA 3LE8A 4WZBE 1M2EA 1EFPB 2IK8A 5ARDA 5I45A 2OV2A 4DSAA 3D8NA 2QQFA 3A1DA 1T4DA 4UMDA 5C2JB 4NL4H 1YULA 2AW5A 4DPLA 1NR1A 1USIA 3O91A 4KWHA 4LTNA 1N6PA 4N5IX 1Z3CA 2IEDA 2WMYA 3E35A 1QC5B 3FAZA 3NDJA 1Q7RA 2CNOA 3JQPA 4YJHA 1KEKA 4IDHA 1T1SA 4KXWA 1JKXA 2P2NA 3IHLA 5JIBA 1WV1A 3LWZA 2GCPA 1MAHA 3GT4A 2O8FB 3BWCA 4BEJA 4ER6A 3M5PA 2IV3A 3RBXA 3SZRA 3QSYA 1YBMA 1LJUA 4KE6A 1P1CA 2A59A 2R8BA 1KU0A 1SB8A 1GZ3A 1RRKA 3JAKB 3ES9A 1SKYE 1M34A 1SNYA 3AKCA 3LSYA 3PRJA 3OQIB 3M4XA 2VEOA 2IRWA 4MWEA 5AO9A 3RD5A 4D9GA 1E4YA 1R64A 1W93A 2HGSA 2NYAA 5KNDH 4RHXA 3DF9A 2Q4DA 3GJTA 4UE2A 4RKWA 1AA6A 1A1VA 4AJLA 4JJKA 3EF3A 2ZSJA 4ABTA 4FZRA 3GT0A 1SBCA 3TMAA 4OA8A 5FT9A 2PHZA 4AB1A 1ESDA 1YHYA 4S1VA 2B99A 1FFXB 1Z7BA 2VJLA 2X9VA 3FSEA 3L43A 4RTNA 4YCDA 1ZK4A 4M1MA 1LK7A 3U6KA 1J9EA 1YRBA 3K1YA 5FTLA 2H63A 2IUYA 1H5QA 2Z2JA 4MZXA 4A5OA 4D97A 4LQ4A 2DPHA 1CUJA 1QYIA 5BRNA 3OAAA 3ORQA 5T3UA 1QJCA 4RHTA 1BQEA 2YMQA 4WZAA 4KN5A 5C1IA 5BSHA 1CY4A 3PTZA 4O3MA 4JYCA 1VMDA 2FPWA 1OTYA 1SVNA 4L0CA 4GOLD 2ZAOA 4YNBA 2Q4EA 3O8OA 1GPJA 5BY2A 1BE6A 1DB3A 5K8VA 1CVRA 1EVZA 2D5LA 5H82A 4FYIA 1NI5A 2QSUA 4H1TA 4B46A 1GR1A 3G6WA 3L9XA 1P4JA 3PHCA 3RANA 3JQAB 3OWOA 2ZSBA 2QVYX 1E1CB 1NX9A 1IMJA 3AHEA 3DBLA 3F5FA 1FVXA 1Z0DA 3H83A 2VA8A 1LS1A 2ZJFA 4FPXA 3BE5A 5GTDA 1KQPA 1W2WB 2R2AA 3CPSA 3ZHYA 3QBJA 3ESCA 4X0EA 1YDWA 1L5WA 3QFFA 4KIGA 4MHOA 5FLXA 1ZW1A 3KQUA 3URMA 3ZD6A 5J4HA 3TF5A 1R37A 3GFPA 1U1CA 4IDPA 3H8JA 3W3AH 3JD4A 2YKGA 1F60A 3I2YX 4V2UA 2Z98A 3NH9A 2D06A 3OZ7A 2UVPB 2IYFA 3HTXA 3EXFB 4FP9A 2WWRA 4ZZ2A 1ZYUA 3QGMA 2RGDA 1U7XA 2V58A 2CUNA 2IU3A 2Q1XA 3JQEA 3LRTA 5AK3A 2B1RA 2YYYA 2I3GA 1QHHA 5G3ZA 1B0UA 1E6EA 1W0JD 1XLTC 1YR8A 3ASUA 1POWA 4B73A 3WMFA 4ZVQA 5ICEA 2RBKA 5LPNA 1X7ZA 4CF5A 4HAYA 2BGKA 3G9XA 1FP1D 1JAZA 2YCBA 3W5VA 1CZKA 4F91B 4ER7A 2V98A 1YZQA 3ZWPA 1W8IA 3BFPA 2WVGA 4PS0A 2XE6A 3GQBA 4UNQA 2ORIA 1ZXBA 3I92A 2O50A 2W7TA 5MN4A 5A9SB 5TPZD 2XNKA 4TUYA 1DIHA 5ALYA 2X5NA 4ESEA 5KSZA 3SFTA 1W19A 1SBHA 1PL0A 5J23A 1HG0A 2QLLA 4XUDA 3DLAA 5LOVB 2YZ2A 1S1MA 4IL5A 4F2WA 1E92A 4WD3A 1HETA 2WJIA 3MTIA 2BMVA 1VGVA 4FYJA 1GGFA 3N8HA 1E9VA 1NG1A 3AONB 2YV2A 3FDIA 2AHOA 5CXXA 1DE0A 1P0MA 1QGZA 3K8QA 5DTQA 5LP6F 1Y8ZA 5F3WB 5AK0A 1QBGA 2F1RA 5EHZA 3DYIA 3I9FA 2I62A 2I6FA 3FE2A 2FNAA 3ULKA 2VPZA 4WNYA 1CQJA 1E1LA 1GSOA 1QZUA 5FXMA 5LN1A 5AUPB 1YQ9A 5EMHA 4PIMA 4BECA 5HKKA 1J49A 3AOGA 3X1XA 3L4JA 1LS6A 3Q87B 4Q47A 2XZTA 4PFKA 3DLBA 1N92A 3RYTC 3UJ8A 3LHIA 2PGJA 1SCDA 1XQ1A 2RGUA 4IIBA 2P3SA 5IULC 4FC6A 4DKJA 3P9RA 4ZI7B 1U6KA 4NNPA 3EGCA 2NLOA 1M7GA 3IYLW 2CSXA 4M0LA 1OHHA 4XVCA 2VDQB 3AWDA 3F4KA 3GIWA 4QFBA 1Q21A 3O9MA 4OY3A 3SEZA 2H00A 3NDRA 3GAFA 1C29B 5A06A 5IFLA 2PLAA 1A9SA 1N0HA 2V9PA 1MO2A 4DEVA 2NADA 1RZVA 1I0LA 1BDIA 2ANBA 1K3UB 2A5FA 2ZRFA 5JYDA 3U09A 4ZK2A 3N7UA 2YY5A 3G9ZA 3PRKE 5C8YB 3O8CA 2B25A 1W1WA 2UU9B 1E79D 3HFRA 2R4UA 5G1NA 3VKVA 3AVWA 4ON9A 3NT4A 1HT1E 3FI0A 4C1NA 4DT1B 4JXZA 5LB4A 3V42A 2AFVA 4JLOA 2QTNA 3H2SA 3A6DA 3QITA 2QR3A 3C6ZA 3JZAA 2OT3B 2VTKA 1YNOA 5F9HA 3COPA 1EVIA 1QHIA 1A71A 4NC9A 4AICA 4E5DA 2VP6A 3OF3A 1QU3A 3FBGA 4URYR 5TNXA 2J9XB 3SQMA 1N2GA 3LZCA 3QPAA 3RCBA 4E08A 2JJ2A 4HYYA 4K9OA 4L22A 2ZU6A 4CV3A 3WGNA 3ZHQA 4PYJA 4TSKA 2CDAA 2C88A 4X1KA 1LRKA 3KVYA 4P5PA 1P0QA 5F33A 3WLIA 1V5EA 2XUAA 2OFPA 3LQYA 3LUKA 4IFEA 4O4JA 1LV8A 5M34A 1XVUA 4MMZB 3VH3A 3TLGB 1ODKA 4HAVA 6REQB 4RHFA 1J2UA 1EX6A 1XR3A 2C3PA 3FKSA 4YCLA 1EFCA 1BMQA 4L5JA 4Q3DA 1B8PA 3BGWA 4E15A 2HA4A 3VNUA 2RH5A 2I6SA 1COWA 4KLRA 5DFAA 1WCXA 4RUKA 3HJAA 1KYTA 1K89A 3PITA 3HGMA 4NH4A 4FR5A 1HNWB 4Z2YA 4UZSA 1CUVA 3VGPA 2NZVG 5AKJA 2I1QA 2JIMA 2CVOA 2VF8A 4EMTA 5LU9A 3C16C 3CTPA 1MJGM 2YWEA 3D4PA 3G1UA 3VA7A 1PK7A 1UEXC 2VNSA 1SCBA 3D5TA 3MTDA 2IF2A 4NG4A 4MRSA 4LDJA 1A2OA 3QOFA 3WK9A 1RS0A 4TTIA 4C7MA 4F8JA 5LDDC 4XCQA 1B0PA 3WBBA 2RGEA 1EVKA 4ZVLA 3T4XA 3F0TA 4DADA 2P0EA 2RHWA 4R83A 5EMLA 5EP2A 2WA1A 3DULA 5ECDA 1AM4D 5FA6A 3PL1A 2JHPA 3CLTC 1H1LA 3SKYA 1GRCA 4W1RA 4R9SA 3MD9A 3HMKA 1NKSA 1UKYA 2Q5IA 4GPAA 2DULA 1JKIA 4FVTA 1QUFA 4YJ2B 4ASUA 1H2WA 3H86A 2CZGA 5CDGA 3ESXA 4DFDA 3ICEA 3TR6A 1ZNXA 3B2QA 3NATA 4R5MA 2QTCA 2QYTA 3WNZA 1JTVA 1O57A 3FN4A 5F21A 1CUDA 1XZKA 1JFLA 4J7AA 1SHJA 5GVSA 5EXXA 4CR8A 4KDCA 3QY9A 1HRDA 4X5OA 2AI3A 3EMDA 3TRFA 1UBJS 5BSFA 3HABA 8MHTA 1PJ8A 4AL4A 5I7OA 2J3IA 4DN6A 1OLOA 3KYIB 3OX2A 4QICA 3R5TA 3ZHXA 2JLBA 4HUJA 1MX5A 3THOA 4R8RA 4D9IA 4GGPA 1CUCA 2C92A 3KKZA 4RIEA 5LA6B 5TV2A 3NGLA 1ODIA 4MCHA 2B21A 3RABA 4AF8A 2X86A 1ZJWA 2J8ZA 4ROTA 5AKEA 4LZWA 4DPKA 1XRSB 4L8LA 3TKAA 3VH4A 1ORRA 2L0XA 4R9NA 4WDQA 1U0HC 2BFEA 1KC3A 2ZBQA 4QBTA 1GYPA 3IKVA 3K4PA 2XE7A 3HGQA 2A0YA 5M7EA 3QPDA 1GVHA 3DZJA 3CXRA 3I83A 1QZ3A 1ZLYA 2H9AA 3W4IA 1RW4A 5SYNA 4WWHA 4IDAA 2E4UA 1TD9A 5E0KB 3REQA 2YOHA 4E51A 2K87A 1X1EA 4GR9A 3T7CA 3PI6A 5IJZA 3HKEB 4JT8A 5IC5A 4IIJB 1GXSB 3DZGA 4LY3A 3GFQA 3FGNA 2QAIA 1GZ5A 1JFVA 1M7BA 1SG6A 1V7PC 3FKJA 3GXBA 4BN5A 1CX9B 5K3EA 1UMBB 1VJTA 2ZBPA 5DZSA 4ZU6X 3IPYA 2AT1A 3PDUA 3SHQA 1HYGA 3JD0A 4AP6A 5DT9A 4CMGA 2COKA 3LPMA 4H77A 3OC6A 3WIOA 2Z4RA 4FHFA 2YIMA 2Y1FA 2IEIA 4JFAA 4RGYA 4U7WA 1URPA 4RVDA 1H4TA 2ID9A 1WF6A 4L9RA 4XIIA 3TQCA 3UMVA 5J43A 3OEED 4MJLA 2AIRA 5EN4A 4EHDA 2RH9B 4MVJE 1XTRA 1JLHA 2NXCA 4H1UA 1FXSA 2PKCA 2W71A 4OF4A 2I2XB 1V7QA 2LNDA 2P91A 3MUNA 2JJ1A 1P9WA 2JHAA 5DEOA 3RBZA 1Q1BA 3NOXA 3Q11A 4P35A 4YRLA 4C7JA 5KNCD 5JS1A 4XGQA 2OBBA 2AOVA 4CKWB 2RK3A 4I9NA 3WBJA 1FFXA 3KUKA 3SF0A 4Y9TA 4B3SB 1GHTA 3CVOA 1EUZA 2BR4A 4Q21A 1I5OA 1NT4A 3RV3A 4CEHA 3GLGE 1GJRA 4ARUA 2OZEA 1SOVA 4WKCA 1A98A 1FS4A 1JTEA 4KO8A 4LRWA 4TQUS 1Y3BE 1D7AA 5B7PA 4EL5A 4UXHA 2NVWA 1RPAA 3E7DA 2PYZA 3I72A 3PGMA 5FUBA 2VT6A 2OBFA 4LXTA 3IO5A 2OA0A 3RHFA 5K0LA 3TN7A 3X1YA 1G19A 4Y2YA 3UW3A 2BGNA 4PCLA 1WY5A 1E96A 2NGRA 2YWBA 1WNFA 1B6RA 1WU7A 4OXIA 1GUDA 3K4HA 3PNBA 5K9ZA 4BCDA 2O5EA 3IT3A 1YACA 1ODCA 5HXAA 3H2GA 2D7CA 3NI2A 4BVLA 4MRPA 1OBVA 2YZNA 4OKIA 2AMYA 5K8IA 3HFJA 2NSYA 5SYMA 2ADMA 2P2GA 3WWEA 4FWTA 4DV3B 1UXIA 1ECJA 4P4SB 1VCMA 3OE5A 4KQ6A 4H0NA 1TJ3A 1YZLA 2NNWB 3SI7A 3MXOA 4TTVA 2QRPA 1G21B 4Y2HA 4YUAA 3MFQA 3S3TA 4ERXA 5HEKA 4UREA 2A94A 2W48A 4I4TF 2JBWA 3OTIA 1T9KA 2AUTA 4LKOA 5BT9A 1GEEA 4ARIA 1L5HB 2RHGB 1E3JA 2QPLA 3K0HA 2DLCX 2FPXA 1XUOA 1R7RA 3E22B 3FTQA 1P73A 1UT6A 2F67A 1I2CA 1R5NA 1IJEA 4RYLA 4WEQA 5E7QA 3KXLA 1G9SA 1YJBA 2I2DA 1DQNA 4R2LA 4XIYA 3UJ7A 4RJTA 1R6UA 4UVIA 2CL0X 2F4NA 2EFCB 3P1JA 2ZKLA 3ADPA 1Y4UA 3H9QA 1ECBA 3IJRA 5FNVF 3OHSX 5EPEA 4ZD6A 4P4LA 3EQ7A 1O9BA 1X19A 1BC5A 1E98A 2HRQA 3SNHA 5AKYA 3MT7A 4AM8A 4B44A 3VYWA 2ZUWA 1DRUA 2ZT8A 4NZMA 3WLHA 2O8DB 5E6UA 1I7LA 3U40A 1MB2A 1YCDA 3OCCA 3FYUC 3O2QB 1DGQA 3FOWA 4Y6PA 3W5UA 2YMMA 2R7AA 3WJ7A 1OLSB 2Q2QA 4C7KA 2XWJI 3KJIA 1DKRA 1SQGA 2LZ0A 1Z0KA 2VS1A 1VB5A 2H65A 1U0EA 3PC3A 5ALIA 3RAJA 2XYVA 2IXEA 3WRYC 2GBGA 3ZWVA 3ACBA 1WUIS 3ZIAD 4XCVA 1UJBA 2JCVA 3LYLA 2BFCA 2PH7A 2ZJOA 3B1FA 1TTQB 3M6VA 3BICA 4WIAA 2FAXA 5F98A 2N1MA 3PA8A 3PVSA 4L6AA 1YXMA 4GECA 3RODA 1VHQA 3ITEA 3TWOA 5A7FA 1PVOA 1L7NA 3KKOA 4JI3B 4B32A 5K2OA 2KSQA 3GARA 3DQQA 2C59A 2RAPA 5CH5A 4P33A 4UVHA 2VQSA 5KYUB 1SVLA 1AGRA 3L07A 3TI9A 3ZHTA 4M99A 3ZE9A 4J43A 1QV7A 3EY4A 1QIMA 1BCSB 3H1PA 2ATEA 3NTVA 4GMFA 4WEOA 4FCVA 5HUHA 1P44A 3N2ZB 5ELLA 3DE6X 5JH7F 4JBIA 3EPLA 2H1OA 2NMVA 1SUSA 1DKMA 1RI1A 5KMGA 1DWQA 4KXFB 3AO0B 2WJHA 4CNBA 5K8CA 5AHOA 3OZEA 2BRUC 3LGXA 2XMSA 1OI2A 2FDXA 2M6LA 1C0PA 1F20A 1DJQA 4MGHA 2PYIA 3ZLVA 4GPBA 3NG1A 1U8EA 2G72A 5BSUA 3QUAA 1KP3A 4KAAA 1TW2A 1V5WA 2A3RA 4JVSB 2D2IA 3K94A 3P2IA 4TWRA 2ECQA 3OZXA 1NAHA 1NV8A 1EFUA 2X14A 1FDIA 1YBFA 2PR2A 4JBWA 2CDNA 1FMTA 3JWJA 2F00A 1OXSC 1MP0A 2WJ4A 3LP6A 3QW2A 4Z4CA 2BCGY 3S2FA 2GM4A 4I99A 1TGVA 4AJIA 1BQ4A 3UXEA 5B6IA 1AQNA 4DKXA 4GM0A 4KRYA 3ZDCA 2ZB8A 4CMEC 4BY9E 3TBKA 5CDHA 4L57A 4FCCA 2JRCA 3LPDA 1MVNA 2R6R1 4QOIA 2C83A 4QVGA 3GQVA 1UMCB 5DW3A 4BLTA 3KB2A 3LWBA 1AKQA 2O0KA 2FSFA 3MMPA 3UMSA 2W42A 2WFZA 2YQ5A 2GCOB 4M83A 4TTPA 3VMMA 3LBAA 1NRJB 1JR4A 2GUWA 1N6RA 2IZOA 4JLDA 4R0VA 3WMGA 3ZDEA 3MERA 4B81A 1D09A 1XYGA 4R16A 4G5XA 4G0UA 3ETEA 3ZH2A 1QTIA 1I9CA 4QA9A 4B4UA 2AC4A 1ZNQO 4QDJA 3K35A 2FDRA 1PW7A 1ZJZA 4TSRA 1XTIA 4BQRA 1XALA 2CXOA 3O1JC 4BO5A 3P8ZA 1GTZA 1DG1G 3C1TA 3FKSD 3G2MA 3MPUA 3OHMA 3ORSA 4GKAA 2H57A 5CVJA 5JH7B 2C54A 1HDRA 1X8LA 2YZ7A 1F48A 3R3ZA 2UUBB 3BM5A 3CZAA 1MMFB 2C58A 3EF0A 4MV9A 2VQEB 1XG5A 2PSFA 4G86A 1CY6A 3BKXA 4C1BA 5LWHA 4EO9A 2XB4A 4BDSA 2ZUDA 2PWBA 2WSLA 3FZYA 5GV8A 3Q72A 3ZW7A 3ZHSA 4ZAYA 1KJQA 3BGSA 4YRSA 2W43A 5DNDA 2UDPA 1V48A 1QS0B 1YE5A 2GETA 2C61A 1WE2A 4MAFA 1W4ZA 3QH4A 4AN4A 1ZIDA 2NTNA 2PDAA 4IO0A 3KZXA 5AUQA 3RQSA 5BMVA 4HDOB 2J0VA 3RS4A 3BGDA 5AW9A 2KLHA 3ZWYA 5LOVF 4UFOA 1GNRA 5BSTA 3S2GA 2DWPA 4RHEA 4GH5A 4B5KA 3RVPA 3MN1A 2GPTA 4ALJA 1C50A 2YYZA 3LQFA 5CCXA 4H3KB 3C8HA 3Q9SA 3DUFA 3P96A 4JA2A 5I7EA 4L1KA 4BBAA 4IVNA 4EGFA 1Z2NX 3PIRA 4QIHA 4QXMA 4OHWA 3UJ6A 5J4LA 3B7WA 3QF4A 2XWBF 4PC6A 3IA2A 1I4DD 3NHUA 3MWFA 4J3JA 1WDMA 1J42A 1VLVA 3QNMA 3AEQA 4ZT2A 4LHSA 2R0QC 1U2RA 2AXEA 3OCYA 2QKYA 1OXKB 1QDLB 4OSPA 3N2GA 4LMRA 1ZIYA 4BRZA 5TQJA 2WNSA 4QQ8A 2BFEB 3PK0A 4BVHA 4UUBA 3FLEA 3CC8A 3O47A 1HOXA 1DIBA 2PL1A 3RASA 1IHUA 1M1YB 1QGUB 2PQ2A 3JARA 3OFND 4YMTA 4TS4A 1E3QA 1R8QA 3H9JA 1QTRA 5K20A 3C15C 1KR5A 4C0HA 2BKAA 4CBVA 3TFOA 3D6FA 4A92A 3V1KA 5FV4A 5D3KA 5AVXA 2B0CA 4E3WA 4AMGA 1F4PA 1ODSA 4F93B 5JZBA 4DQXA 1TVMA 3BWYA 3DT6A 3Q0IA 3FJOA 4FFBA 2FA9A 1F38A 1S3IA 1E69A 1Z83A 2O3RA 5A5DA 4NOKA 1VCNA 2R00C 2RCNA 3P9KA 1DQPA 3M9XA 2R4TA 3NRBA 3QVMA 4IFBA 4HQ6A 1COZA 3BL6A 3V4RA 1YZHA 3AY6A 3SKXA 4A1FA 2LTAA 1CD5A 2VK2A 1DEXA 3O2SB 4V0LA 5J5CA 4E1AA 4ISCA 4W9RA 1NNUA 3TLGA 2W90A 2FPIA 4EHLA 1OH7A 3A1EA 1L9KA 2BGUA 2WWXA 4ZVVA 2QXUA 2IVFA 3OPYI 5TJHA 3NC0C 2VDRB 3VR4H 1U9JA 1QDUA 1SCIA 2P5TB 3LPAA 3E7WA 4F84A 3IR6A 1SOMA 1BGVA 1GFZA 3SKVA 1XRMA 3KBOA 2I7VA 3QF7A 2QMQA 4FDTA 4BQNA 1RPZA 4A8PA 5T57A 4NECA 3E9QA 1K8YB 2NQ8A 4BVKA 3V9PA 1BCSA 2X5JO 1RC0A 4A26A 1TQHA 4MDYA 1G59A 3CN9A 1N36B 5K0ZA 2YZGA 3SY8A 2VH2A 4M22A 3EWNA 3I9KA 4ZVMA 3BTVA 1NURA 4JJ6A 4KNWA 3D0QA 1DCTA 3QHPA 1XTKA 2BM0A 1ST3A 2HSWA 2ZUVA 4UDYX 2X41A 4US2R 1U3FA 2J5QA 3RWOA 1RACA 4LBVA 3OOEA 3NTUA 1N0VC 3ZWMA 3IH5A 1TAUA 2H52A 1N8TA 1OREA 3DO5A 2Z8YM 4CT4B 2CKDA 1G5FA 2OO5A 3R3XA 4MR7B 3MJRA 1PTKA 4M1OA 4AO6A 1CNMA 4KBFA 1GTRA 1VBKA 2FCRA 1X6VA 4ZO7A 3GLFB 4TL9A 2O7SA 2RHHA 5EKTA 2FQXA 2IITA 3KJNA 2H4YA 2D0DA 1P0FA 3EVTA 4AQYB 1XEXA 1W30A 3LPCA 1ACLA 4RQBA 4DG9A 5C8YF 5LIRA 3T3MB 5I9BA 2R6AA 1FJGB 1D1QA 2CCGA 2DJIA 2MR5A 1W49A 2QRKA 1TE2A 3A1SA 3KB6A 4XX0B 2VDLB 3A14A 4ENPA 4Q37A 1Z4IA 1CETA 2HMTA 4B45A 1UXHA 4YRTA 1CJMA 3BBLA 2WKWA 5KOHB 5HTOA 2ZYWX 4PGHA 4EECA 4EX6A 4AJJA 1IJFA 4EIWA 4AKTA 4WKPA 2DLDA 4B80A 2J59A 2E6KA 1FRQA 1G21A 1TMYA 2VRBA 4RV4A 4X6XA 3ZWWA 4AD8A 4DDUA 7REQA 3L1KA 2P2YA 1Q74A 4RD0A 5EJ2A 2GBPA 2HMWA 4OQFA 1K66A 1DO0A 2WKQA 3CH4B 1O3YA 4UM9D 3TS1A 2EWMA 2YJGA 4DZZA 2P8SA 2IZ5A 5EGNA 4F2GA 3GUYA 2CFOA 4DUGD 2OG1A 3O93A 1YDFA 2H54A 4M4SA 3U4HA 2ZWMA 1JIKA 3MCWA 2A8YA 4YGYA 1UC4B 4KIJA 2W2VA 4BB6A 3B60A 5F64A 5LKAA 3ANSA 3C7AA 1X7YA 1G6Q1 4REQB 4J0IA 4U3JA 4YRQA 3LLUA 4IWYA 5ALUA 4TRMA 2JZOA 5ALDA 5COBA 1HR0B 5AW3A 2UXCB 1YOVB 4LQDA 1Y6QA 1QHNA 4GBJA 3RRJA 1SRRA 1TM2A 2ORVA 2VT2A 2OGZA 2QU7A 3AFGA 4ZCLA 4EHHA 5J1SB 1QORA 1RQPA 2XD9A 3FUUA 4FMDF 1TU3A 4GVPA 5DM0A 2IHZA 5LDGA 1Y1QA 1RLUA 4RIIA 1XD2B 2BN4A 3C6MA 3ZXYA 5DGDA 1NXQA 2JJMA 4LVOA 4DNPA 2VTDA 4YDSA 5CVDA 2OMKA 3RH0A 4DLLA 4E5SA 5HKLA 3FNEA 1N2CE 2JKZA 5F12A 5DM1A 3NBAA 2HO4A 3BZBA 2G83A 6YASA 3GLIA 3RUAA 1XTVA 2BJVA 1JKMA 1MXFA 2HRRA 3EODA 1UJ4A 2PSHA 3PNYA 3PGA1 4KITB 5EEHA 5CEEA 4M89A 3CVYA 9MHTA 1BKYA 4Z3OA 3LHFA 5DJ5A 4YACA 2AE1A 4BLVA 5I8WA 2NZXA 1M8FA 2OCLA 3N0VA 1GG9A 1FS6A 2OG2A 2ZAYA 4R2HA 3MJHA 1DHTA 5EKUA 1NJ2A 3T5BA 3TH5A 2ODBA 3KTAB 1TCAA 4H59A 4QG7A 3HR4A 3IJEB 4GNRA 4BNYA 3TJMA 4WY5A 4A2CA 2EAUA 1W44A 4IILA 4OFBA 2X13A 3AUAA 4OK3A 4RFLA 5JY1A 5AR1A 4BCCA 1ZGJA 3SZLA 4P3NA 1DBPA 4LHVA 3X2SA 3RK1A 3ZXSA 4F5YA 1YL6A 4OU5A 2P5YA 1V3UA 5A6SA 1J0EA 1CUXA 1NC1A 4PTZA 4MEAA 3T9CA 2W2QA 4C20A 3G13A 5HSGA 2ZWOA 3HUFA 3IBGA 4IKOA 4P7JA 4OI0A 3K5WA 3RFUA 2R7LA 5FBRB 4GEKA 2OQVA 5I3CA 3NR2A 1TC2A 4YMIA 4JUAA 3PFIA 1N2JA 1NOIA 4MI1A 1YDHA 3EIHA 3TM4A 1N7JA 1RIFA 3BRWA 1II8A 1T1EA 1T2NA 3HXMA 4E33A 3OVMA 3P9CA 2ZW9A 4P58A 1XHEA 3WLSA 2PKEA 3LRPA 4LJ4A 4ZJYA 1C3XA 1IG0A 1P1FA 3WQHA 5LXTA 1RTKA 1QS0A 2DSTA 2Q3MA 2FZWA 4FNMA 4NU0A 5BXYA 2Z2IA 2FU5C 3AKZA 1GNLA 3M0EA 1TJNA 3K1JA 3JQGA 3HB5X 3S4YA 1ZEMA 2IXAA 3CWQA 3JQ8A 4W8OA 5ITZA 5HQ3B 2O8EA 3M5DA 1A72A 1HDXA 2Y66A 1KAEA 1X8KA 4CKCB 1S89A 1T6ZA 4Z49A 5G4KB 5EIBC 3BWDD 5I9TA 4O6VA 1NRIA 5BNIA 3V9AA 4D9EA 1K3TA 3COVA 5BSWA 3E1GA 2NPFA 4TWZA 3ZI4A 4B3FX 1H2RS 2I1WA 3RU9A 3K6SA 1SXJC 2FUKA 4XGIA 5ITSA 4WSOA 2YHBA 2MCFA 2ZIFA 2WV9A 3T3GA 3OP4A 1FNNA 4PHCA 2J85A 3IPCA 3MJ4A 1SG0A 1WXDA 3OWHA 4WNCA 4ZOLF 1O95C 4FSDA 3JYOA 1TZMA 2BR3A 1JXOA 2HF8A 1NG9A 5LYJA 4BV3A 4YRPA 3QEAZ 4IGFA 3I1IA 4B3IA 2ZREA 3MGAA 3SF8A 5A4KA 1SKUA 1DFHA 3GRRA 1EXMA 1Q1GA 2GS9A 3CX6A 4GI2A 4LSWA 4Y2PA 3SM3A 2C57A 2GRUA 1L4LA 2HHJA 2IXTA 2CYAA 1VL8A 4I4IA 3DR3A 3UOAB 2ZAIA 1VMIA 2VP4A 1RRFA 5YASA 1M1YA 3ROPA 3USES 4WCFA 4OUDA 3KHUA 4KHZA 3N76A 1UAAA 1LSOA 1QBKC 2AXPA 5AH0A 3VDRA 4EF5A 2ZBGA 3HZOA 4HSGA 4LJ6A 4FOOA 1X38A 4CF4A 2XNHA 5EYPA 2VXBA 3U7EB 1CTQA 4F2DA 2C2HA 3PHJA 3QU2A 4AZ0B 3REOA 1VTKA 4AN1A 2XXJA 3P7MA 1MIHA 1E1RD 1BO6A 1XXHA 2DM6A 2ORWA 4YAFA