1QCDA

Crystal structures of adenine phosphoribosyltransferase from leishmania donovani
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
236
Chain Sequence
PFKEVSPNSFLLDDSHALSQLLKKSYRWYSPVFSPRNVPRFADVSSITESPETLKAIRDFLVQRYRAMSPAPTHILGFDARGFLFGPMIAVELEIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGTALSGLQLVEASDAVVVEMVSILSIPFLKAAEKIHSTANSRYKDIKFISLLSDDALTEENCGDSKNYTGPRVLSCGDVLAEHPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ADENINE PHOSPHORIBOSYLTRANSFERASE
publication title Crystal structures of adenine phosphoribosyltransferase from Leishmania donovani.
pubmed doi rcsb
source organism Leishmania donovani
total genus 70
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 1999-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qcdA00
4RABA 3S5JA 4QYIB 4ZFNA 5BSKA 4RHTA 5EUCA 2EHJA 4P84A 5BRNA 3ACBA 1OREA 1GRVA 1G2QA 4RV4A 1ECJA 5IAOA 1L1RA 4KN6A 1Y0BA 5KAMA 1G9TA 4JITA 3OHPA 5BQPA 3DMPA 5K51A 2DY0A 1NULA 3M3HA 1P4AA 1A95A 3GGJA 1XZNA 4M0UA 2C4KA 3ACCA 4S2UA 3N2LA 1I14A 2H06A 1ECFA 1XTVA 4RHYA 1FSGA 1DKUA 1LH0A 4JLSA 1A97A 1W30A 4P86A 5ESXA 4F8EA 3LRTA 1I0LA 1QK4A 3OZGA 1U9ZA 2JKZA 1ECCA 1ZN9A 1P18A 2HCRA 3DAHA 1NONA 2AEEA 1WD5A 5IPFA 4P3KA 1P17A 4P82A 1GPH1 1UPFA 1BD3A 2WNSA 1YFZA 1P19A 1VDMA 1DQPA 3GEPA 4RANA 1DBRA 2E55A 5HIAA 3MJDA 1ECBA 4RHXA 3ACDA 1JLSA 1ECGA 4MB6A 1QK3A 4RQBA 1TC1A 2PS1A 5JV5A 1PZMA 1OPRA 1VSTA 1QK5A 2JI4A 1A4XA 2H08A 4P80A 1HGXA 1VCHA 1ZN8A 3GGCA 2GEBA 4WMLA 4M0KA 1I5EA 1ZN7A 1J7JA 1O5OA 5HKLA 1A98A 3OZFA 2FXVA 4PFQA 1BD4A 3KB8A 4TWBA 2P1ZA 1HMPA 2VFAA 1Z7GA 1BZYA 1IBSA 1XTTA 2XBUA 1G2PA 1JLRA 3DEZA 4P83A 4RAOA 4LYYA 1OROA 3H83A 2IGBA 1D6NA 4M0PA 1A96A 1V9SA 2PRYA 1XZ8A 4P81A 4RHUA 4IJQA 4RACA 1UFRA 2PRZA 1I13A 1A3CA 5ESWA 4WN3A 1DKRA 1QB7A 1R3UA 3EFHA 4PAWA 4LZNA 3LPNA 1U9YA 5BQOA 1UPUA 4OHCA 1O57A 1QCCA 5E38A 1I0IA 1QB8A 1CJBA 1L1QA 4X45A 4LZAA 4RADA 3O7MA 1STOA 3HVUA 5KAPA 5JSQA 1AO0A 4LYGA 4QYIA 1DQNA 4RAQA 1MZVA 2H07A 4FYMA 4LZOA 1TC2A 3MBIA 3G6WA 2JKYA 2YZKA 4QRIA 4RQAA 1XTUA 1QCDA 2JBHA 3NAGA 3QW4B 4Z1OA 4X44A 1G9SA
chains in the Genus database with same CATH superfamily
5HZHA 2YZGA 4KQ1A 1J97A 1BS9A 2P2NA 3MTAA 4ZT6A 3OFNA 2FG7C 4K6CA 1I3OA 1BFKA 4IX1A 2P2GA 3NBYC 4X20A 4RTQA 3LCVB 2AX3A 2IY7A 5BVGA 1P4RA 2YXPX 2VDKB 3CJQA 4JB3A 3M6IA 4Q7LA 3ASYA 3A0UA 1NY6A 3C3XA 1OWLA 1UXKA 2NUPA 3OPYA 3EMKA 5A5GA 3UMRA 1EX1A 3RT7A 4DSOA 1SXHA 1NU8A 2GD2A 2QD2A 4F2GA 4TYNA 2ZYRA 5B6JA 3V3TA 1JYSA 5EAIA 3UHJA 1NI4B 2W6QA 2BWJA 2XAAA 3A1UA 2FWIA 3FDFA 5CPBA 4DQDA 5FPTA 4L74A 3N5KA 4MYRA 1WMEA 3G0IA 3NAMA 2QR2A 4B35A 1PYDA 3FZNA 3TMKA 5AKKA 1W30A 2QZSA 1EUQA 2OZLB 1ISIA 1IJBA 1RBMA 5LDGA 1NBME 5EE1A 1VPEA 1PYGA 4MO2A 4TXHA 1OW3B 4M83A 5AK5A 1IUPA 2P2CA 4BX2A 4EP1A 1ENOA 3OPQA 4IS2A 4WZAB 3W2IA 3RU2A 5BW4A 2ID9A 3TECE 1MXHA 4BXOB 3N07A 4IRUB 4BMYA 1T0BA 2YNMD 1FYFA 4OP2A 3EVDA 4CMGA 4CKWA 4QM6A 1MF7A 3W9YA 2J9ZB 1WXQA 2ZJ2A 5FBRB 4MVJA 3VPFA 1X19A 3IP5A 1AK1A 3R3WA 1YF3A 3MB5A 4DV1B 5A0TA 3R75A 4P80A 4G4JA 1RYFA 1WVGA 2DJ5A 1RMTA 2JGDA 4L6AA 4IDOA 4W6ZA 4HDKB 2RJ3A 4RK4A 1UPXA 2QRVA 2P35A 4MQ6A 1ULAA 2WNIA 4OJYA 3RRFA 4A82A 1NBEA 3FKSD 3OCXA 1YBVA 2IUTA 1ZXLA 3DT6A 3FIUA 3C3AA 2OXCA 3NWEA 1T1IA 3HCRA 5IYZB 2C3UA 4HAZA 2IH4A 4CTKA 4HQFA 2FRDC 3LOPA 3O8QA 2CN1A 5JXGA 3E4DA 4JX8A 1LQTA 4BP9A 1SB8A 2ZRNA 3IUEA 1ZSYA 2XY4A 4EJFA 5ENZA 4XQGA 2JRLA 3ZV3A 3AF4A 4QU0A 2QRKA 3MAJA 3DEHA 3R3ZA 4DWVA 2FSVC 3QVGB 1S0UA 2TMGA 4WN3A 1HK7A 1PK8A 4C4TA 3ZVRA 3IT3A 2RGEA 5JCJA 2Y0BA 4G67A 3P52A 2ZAIA 1Z0AA 1Z35A 3LIIA 1N7HA 4I5GA 4NV1A 4QXQA 1NQVA 3NG1A 4I9HA 2I1VB 4L07A 2VS1A 3HMQA 2V0GA 4KQXA 2ODPA 5F51A 4V0LA 4PEVA 3QI2A 1SM4A 1N1DA 3IXMA 3M5CA 2FHPA 1U8YA 1YBHA 5D5QA 4ZZ1A 1GD1O 1GCUA 1KIMA 3GP3A 4LQCA 3S2IA 3ZU6A 1HI9A 2JG3A 3OE5A 1OI7A 3LQKA 3TKAA 1SO8A 4C7XA 1JJBA 1WQ1R 3CUVA 4R1PA 1C14A 3DBOB 3N75A 1C8LA 4J1SA 2QL6A 3R9IA 4LJ6A 3SCZA 2BSAA 1ONOA 1Y6QA 3IP6A 4IIJB 3VZQA 4TZ0A 1DAEA 1E4VA 1E7WA 3IR6A 3OM8A 2DBRA 2IHZA 4GYYA 1NIJA 2FCAA 1BX0A 1C30A 3NBMA 1EAMA 2O57A 4ZD6A 3DF9A 2A9JA 2IOFK 3RC1A 1P45A 4P4GA 2RFLA 1Q19A 4MOWA 3IV6A 3A1DA 1QGAA 1W59A 1XLTA 2A0YA 3MJSA 3OEED 4I5EA 4CMCA 4OMUA 2I8CA 3UICA 2FFHA 2PUGA 2TECE 3MILA 3R5XA 1YQ9A 1GM5A 1YO6A 3SQDA 3VYSB 3F3SA 4GUAA 2DT5A 1GCGA 2NSDA 3ANNA 5F4ZA 2DR0A 5LDHA 3KQLA 2E4ZA 5KNCA 1F14A 3DSRA 2D1SA 1YA8A 2IHJA 2YWRA 3IC5A 5BMVB 1HEYA 2D54A 3FH0A 4YP6A 3K9FC 4Q5IA 2D5BA 1M1YB 4BMCA 3OQOA 1ZD4A 3WQQA 3F5QA 4AZVA 4Z4EA 1XKXA 1WS6A 3O0TA 3QU9A 1KEEB 221PA 3WC4A 2QSZA 1WR8A 3K96A 4YPOA 1SPXA 2C4UA 1PWZA 4O63O 2WZQA 3N7UA 4DQVA 2HFKA 3HJAA 1E1CA 1A8UA 3OICA 4PFKA 2XLCA 3A2KA 2SKDA 4D3ZA 4EHDA 3PXGA 2R86A 3ROXA 1XF1A 2AQHA 2XH8A 3U7QB 1GZUA 3U4AA 1NF8A 1NLFA 1ZPDA 4U7JA 1XZGA 2YFHA 4WMLA 4LGYA 1NJSA 4PVCA 4WW0A 4Y6RA 3VH3A 4IJUA 4COOA 4EUSA 4MGYR 2AOVA 1PR2A 3LUHA 2PX0A 2FX2A 1O08A 2XNKA 5HJ7A 4N9QA 1BD4A 3A3PA 3ON5A 3FXAA 5DPMA 3BBPA 4CKBA 3WP0A 4F04A 3QEKA 4H1UA 5K3FA 3TLJA 3O9MA 3ITDA 4FYPA 5P8WA 1I5OA 1TK2A 1L5HB 1QF9A 1Y5MA 3V7FA 4DILA 2OBLA 2QQGA 1Z13A 1Q3HA 3IUPA 1BE0A 4M87A 1N1EA 5DE3A 3EFEA 3H75A 4ZYWA 4ZYVA 4Z1OA 2QT9A 4EY8A 5B2FA 3RSOA 2P9TA 4CCYB 1A69A 3U1BA 1D7AA 3VR4A 5J5AA 5AK3A 2G67A 3C43A 5D51S 5BSTA 3FVTA 1D2EA 5J1SB 2HO5A 1T6NA 3NIWA 3PGVA 4Q1DA 3EFHA 2R6JA 2JHAA 4E5KA 1NC3A 2YWEA 1PDOA 4AN0A 3RVBA 1B93A 1FVHA 5A71A 3R7DA 2MSLA 2OYRA 4LOIA 2IH2A 3GJ8A 4AXXA 4B7CA 4J8PA 4QNRA 4DUGD 2FA9A 1PG5A 4FTWA 4IQ4A 1FXWF 1PTJC 5DK4A 3A3OA 4X7PA 1G60A 1SIBE 3L6CA 4C5AA 3RM3A 5AW4A 1NVDA 1W47A 1J0CA 2VHZA 2VJAA 3COWA 3BGIA 3LGSA 3GYBA 4KMOA 1XTUA 2BP7A 4HUJA 5IBCA 1X7HA 4C29A 4CT4B 5FTWA 2BM8A 1Y3FE 3QMWA 5KYXA 2IC5A 1KVQA 1LI5A 2RONA 4YRBA 2V6JA 3ZU3A 4LXHA 2GPAA 2JVKA 4FGWA 1D2CA 1NVKA 1HE3A 1GU7A 1YR1A 4JVLA 4AJJA 2NZJA 4ND6A 5JXJA 3G0DA 4GOKA 3SS9X 4QA9A 3K0AB 4K9PA 4I36A 1DBPA 4OQNA 3I6ZA 4N12A 4UXJA 3T5TA 3ZK8A 4S35A 4PX9A 2IXGA 2Z58A 3HFRA 3MT0A 2XV1A 1EVLA 1Z5GA 1USWA 1F0NA 4L9RA 4QBKA 3ZIAD 2QQ0A 4UPDA 3V42A 3MWJA 4N76A 3C3YA 4J2TA 2IV3A 2YJ3A 3F1KA 5EP1A 1IK6A 3ZLUA 3IUJA 3TQOA 1FEZA 3OF3A 4ZCRA 4EABA 2GJSA 1HOXA 1HL3A 3B7WA 4JMPA 3AVPA 3UUGA 4WY2A 4K6MA 2OSVA 3DE3X 5KHOC 4HDNA 4LI3X 2PUHA 4M1KA 4TPKA 3NXSA 4B7AA 1AKTA 2BDTA 3UT6A 4YJ2B 2BCJQ 3FUWA 2W2LD 4QELA 2AGVA 2AWNA 2ACKA 1CU1A 2ZSUA 4WA7A 4B4UA 1G8MA 1QHXA 2HHJA 3AVTA 4D97A 2NTNA 2GN1A 4DV7B 1VI2A 1E9BA 5JMWA 1MT3A 1S3IA 4C2TA 1VG9B 3T99A 5AHKA 1IXSB 3I9OA 5MHTA 1GCIA 3WJ7A 4WZZA 4B47A 1KVSA 1OYYA 2X9GA 1IBCA 4L0CA 3O7WA 1KJIA 2FPIB 5C8YB 1TJ4A 3SS7X 3H5IA 5FPHA 1KRXA 3GEMA 4X71A 4YCSA 5KREA 1NP6A 1ZN7A 4PLCA 1CF2O 3MTGA 4F5YA 4KGZA 1W5EA 2G8LA 4G0PA 4DGQA 5BWCA 5JEEA 2Z4SA 4CVNA 2BM1A 3KTDA 3F6YA 4IO1A 1LFAA 3BEDA 4DBVO 2ZVJA 3EGXA 3TX6A 2GCPA 3A37A 5FF9A 4R1UA 4NH4A 1SKYB 2XZOA 1JKJA 3AJDA 3RNLA 4DLNA 1R6UA 1Z0ZA 3EK2A 2OHOA 4EGAA 2R6ZA 1XLUA 1L5ZA 1YHNA 5CA0B 1VPVA 3CZMA 3GX1A 2O1SA 3IDZA 2UV8A 1KZ6A 1UDXA 1QZUA 3D64A 3BEOA 3V8RA 1BDMA 2WHYA 3PWTA 3DJFA 4HC4A 4RULA 1AKMA 5TEVA 3JYPA 4NBLA 5HIKA 3C6KA 1EUCA 3QMVA 4D9FA 4B0OA 4XEUA 1DUSA 4YRSA 3GDWA 4GNRA 4URXR 4KR3A 4TYWA 4D44A 1QUEA 1M2KA 4J0KA 2VDVE 1RI1A 2QP3A 2ZJ6A 3DOFA 1EJ6A 4JS0A 3E1GA 4LZAA 4Z2YA 2PO7A 2XMCA 1CUVA 3JRXA 1IMOA 2ONCA 3TRKA 4PLWA 1DT5A 4GNKA 2PUWA 1Y37A 4GQBA 2K5UA 1GG8A 5COBA 3CVUA 3KWLA 2L17A 3MWYW 1N2ZA 1HKHA 4QFCA 3ZC3A 3UOAB 5CT8A 4NS4A 4I9FA 5WRFA 1CJSA 2B34A 3C98A 4BGEA 4QYWA 1YAJA 5J40A 1OC4A 2OXIA 2CT8A 5EQJB 4GGOA 4A6XA 2PAFA 5IAAA 1NUPA 3RKSA 3QH4A 1U0BB 3ORYA 1S3GA 1P0FA 3AFIA 3KYBA 3KQHA 3DKIA 4KG7A 5M3BA 3ODPA 3RYCA 5CAEB 1QG0A 2ZUCA 3KLMX 2P9QA 5J2TB 3D2LA 4NYJR 2XADA 1XVUA 3OZSA 3QBJA 3G79A 3WGUA 3PXAA 3IEXA 3H9UA 1XCPA 3L9WA 3ZJVA 3KJGA 4PTLA 2F8SA 2LP4Y 2ODAA 2IHVA 3OKAA 5FI5A 2WQ7A 1VGVA 1J9EA 2DG2A 1X1RA 4N40A 2YRWA 3G85A 4ALNA 1UBNA 1C3OB 1RWBA 2X4IA 1NYLA 3N9IA 1GQFA 2XB2A 3ED5A 1WW2A 4RKEA 2HZBA 2AMYA 1Y8RA 5G40A 4DXAA 1ZVQA 1UFQA 4KLAA 3I5UA 3PHCA 4AUMA 1N2SA 1MIOB 1U1EA 3OJLA 2ZKLA 3TL3A 4E2FA 3NFYA 5JS8A 2I62A 2VT2A 3ABOB 4JMLA 1X80A 4RD2A 1HQCA 2QMQA 3LD9A 4MGZR 3H3JA 3F96A 4MUAA 5FTNA 4EHJA 4ECAA 1NBIA 1Z75A 1XRPA 5IXSA 1MAVA 1L7VC 1SU8A 3QTBA 4CLRB 2IVZA 3UW3A 3Q9UA 3RAEC 4FCCA 4LHVA 4CR7A 1USVA 3OT1B 4ZAGA 4RIHA 1HYHA 3EUWA 4I50A 2CMFA 5IAEA 1JFFB 4G84A 3NJ4A 1GUAA 2GJ4A 3IBSA 5BQ3A 2AVDA 3W3AH 1E8DA 1S2NA 1XTIA 1O5IA 3EWIA 1K27A 1CNMA 1AQUA 3JATB 1LSSA 3D1JA 1A8QA 2Y2VA 1GCOA 1PSWA 1NQTA 3D4PA 3R5KA 2GF9A 5CA1A 3Q8MA 2XEDA 5YASA 1NKTA 2FEKA 2ZB8A 3EIXA 1U0OC 4O4HA 1Q0LA 3FPLA 4PXSA 5PNTA 4EVIA 1FX0A 3E9YA 3UK1A 1K6EA 4O4LF 2FW1A 2WIDA 3W9SA 4IJMA 3NTRA 3C24A 2AG8A 2IHNA 4M60A 3T4XA 3CUUA 5A4AA 1XD9A 3TTWA 2YOFA 4ZHQF 4RTOA 4JJ8A 2Q0XA 4JIGA 3GGDA 4EOGA 4GPIB 3VSAA 4RTPA 1YC2A 4D82A 3WIVA 5L7WA 4I55A 4NFYA 3H19A 4EHFA 3KSMA 1B0AA 3WSVA 2H1LA 4EO4A 3HYCA 2YVQA 4B6JA 4J1NA 5JXWA 3D7MA 3UJ6A 1YA4A 1BFUA 1D7OA 2A0KA 2P5TB 2OT3B 1OFUX 4BC0A 4KFUA 2XMGA 1Z2CA 3RPEA 4ZREA 1F8XA 4C04A 1D9ZA 1JLLB 4MRVA 3LJKA 3OZWA 3OEWA 4FFOA 4MS3B 3O7MA 1IOWA 4B6SA 4NBKA 3KT8A 4YUVA 3I8XA 1J5EB 1Z6YA 2B3TA 1R0SA 4G1UC 1E5XA 5JMTA 3PLRA 1UBMS 1DEAA 1GQQA 1LW7A 3I04M 3SE7A 1TTTA 2D3TA 4P0PB 3GFTA 3WHLA 5DHUA 2R5FA 3PQ4A 2FVYA 3F7TA 4G5SA 3NHZA 4UQPA 4AYWA 1CERA 4CDGA 4AB1A 1KVTA 2G83A 3M7IA 5E9QA 5HTOA 3V46A 4IGAA 3UAGA 3PHGA 2W0SA 3FRHA 3U7JA 1QMGA 4JLNA 3TJMA 2B4KA 1B15A 2H1SA 4M3NA 4JKOA 3QENA 2R6CA 3H5AA 2Y1LA 4IL5A 3HL0A 4UZSA 3CW9A 5FTJA 4OHKA 1XCGB 5KIAA 4GZ6A 3WYBA 5JNUA 1E5QA 2E2WA 2QA5A 2EJUA 5AQEA 2DKOA 1C9NA 3J7TA 4LS3A 4OOFA 3RIYA 1I14A 2OA0A 1KI3A 5KPJA 1GR0A 3TX2A 4Z8YA 5C51B 4C88A 2YNMC 1DEXA 2RHOA 2QM7A 3F9CA 3H42B 3OJ0A 4ZJUA 3ZUPA 4BLRA 5IG2A 2XYHA 1YBMA 3W5JA 5A06A 4L72A 5HCNA 2EKBA 2A57A 4Z7QB 5CB6A 1SBNE 4QKQA 3BRWA 1Z2NX 4WESB 5AW9A 2N47A 4O8ZA 2OM2A 2YASA 4IXTA 4QOFA 1N3IA 3AESA 3GYGA 1KS9A 5AK0A 4TKUB 4GKKB 4P82A 2ECOA 4AWBA 4GXRA 1U7OA 4W6QA 3JYHA 5AI6A 4E5UA 1JR6A 2OD2A 4U00A 1AS0A 1J2EA 1I7PA 1X1AA 2B94A 3RC7A 4ZIRB 5CDSA 4XPIB 2XMPA 3O4GA 4M99A 5BUZA 4E11A 1NRIA 5DZSA 1KDPA 1ZGBA 4BY9E 3E9RA 4LVNA 4G9BA 1V11A 4AF8A 1GDHA 3SF8B 1P61B 1EZZA 1Q12A 3OZ7A 3ZHCA 4CKCA 3T38A 4DCNA 3GRFA 3GQBA 1DT3A 2D2IA 5DBOA 3UF0A 3VHRA 2ZT6A 3MSCA 3DJYA 3NTOA 3EXAA 1YZVA 4F3RA 3E7FA 4QGSA 2X19A 3KP1A 4ZXPA 4F2PA 3WYNA 2MMGA 1GPWB 4LZWA 3A7DA 3FMVA 2C9ZA 1ST3A 3QVVA 4H0FA 2AJCA 3CZPA 4ON9A 5CNMA 1CS0B 4X6UA 3K5IA 4PV7A 4P7BA 1DV1A 1P8JA 4G1EB 3TRFA 4KITB 4RTRA 121PA 4CIBA 4EYGA 4OATA 1L5KA 1FYVA 4DLSA 3B1KA 2FN4A 1F20A 2IUYA 2O05A 3RG8A 1QNFA 5B1IA 2B7LA 2W8BA 3SYKA 1X0XA 4UBJA 1V9CA 2PMEA 3T1YB 5JRJA 2E1RA 2Q1XA 1THTA 2EJBA 3CURA 3UMJA 4XGNA 3K20A 3ZDDA 2WD9A 1V1JA 1UKVY 4KQKA 4FKZA 4X8MA 2W6JA 2XDQA 3NR2A 1U7TA 4QWWA 2PGIA 1X77A 1BKDR 2Y92A 3OG9A 4GZ3A 3KSDO 1UMDB 4ETNA 2PRSA 1TFUA 2PG3A 4G1CA 1HYGA 1I2AA 1UPCA 2QI9F 5T5QA 5JAUA 1XZHA 5GJBA 3U3XA 4G5OA 1H1TA 2JF0A 3T7KA 1IY1A 4NWIA 2ZRIA 4W9NA 3MJCA 1UL1X 2XVXA 2BGUA 4OJTA 3AX6A 1VHDA 2ZUSA 1V3TA 4X1KA 4BNUA 4EW2A 2IGTA 1JIVA 4QAQA 2CUNA 3RYHA 1MFZA 5TSDA 3D2BA 4C87A 1KJQA 4KHPB 2G28A 3A9CA 4M1QA 5C4MA 3QEMA 3DQPA 4IIYA 3SX4A 2CXHA 1JE1A 4RIEA 1RRKA 1YCGA 2NZWA 1CJUC 2FZEA 2HUPA 4QBGB 5DTQA 3IH5A 3VYWA 3CISA 1P31A 3JQDA 1SQ5A 1H6BA 3FN4A 3QVMA 4DJ5X 4X41A 1WCYA 2HJVA 3F78A 3HJCA 3PPWA 1JH8A 2C5EA 2RBGA 1R6DA 2V55B 5B30A 5FFMA 1UDBA 4HY3A 1PJLA 4O2BB 3NDJA 3T34A 1F2TA 1T9BA 3KOYA 5IKPA 4WOCA 3DTYA 3BXHA 5IH3A 1PK9A 2RHWA 1VLHA 1Y6FA 1XLVA 1H2XA 3G82C 1PLKA 2RIRA 3KSRA 4QUHA 4WLNA 1MEJA 4DR5B 2JFNA 4PZZA 5ER9A 4GKBA 1CHDA 4DNXA 1A97A 2VKTA 1A4RA 1ZWKA 2BGTA 2FP4A 2WHPA 3FHOA 3GD7A 3QK7A 4FX2A 4A2WA 3DLPX 4H60A 4B34A 1NYQA 4F9FA 3LP5A 3P32A 4KPGA 5C1PA 2G8NA 2NPIA 4ZCLA 3S6JA 2JFFA 3BE6A 4RESA 5FI3A 3C5VA 3UWSA 2O8BA 4P5PA 1WXDA 4F9GA 2QZJA 1N0UA 2FFAA 2V54A 1PHRA 3MS7A 4BN4A 2XKKA 4B6RA 1WU7A 1DNPA 1S3FA 2VK4A 5AW0A 5ALDA 3U7GA 3BXOA 3EXG2 1FDOA 1OFHA 4NF2A 2V03A 4YQYA 5I9MA 2CEKA 1P29A 3QV1A 2F90A 4MYCA 3TRJA 5T67A 3ZZ0A 4PG6A 4C01A 1S01A 2OORA 3D81A 4E6PA 2R7KA 1SCUA 2EOAA 3ORSA 5DSZA 1Z0FA 2AJDA 1UXOA 4C22A 1ZOSA 4MWTA 5AW1A 3RODA 1GUYA 3E9EA 4FCWA 3H5RA 3WQSB 1IG3A 4W9RA 5IYZF 5BSHA 2EC5A 3ICVA 1CY1A 1L8LA 3I2YX 5B3LA 4ER5A 2N9UA 3ZLVA 5LP1A 2J7PA 3R74A 5HILA 4BJ1A 1XMIA 2PIAA 4JJ7A 3SDBA 3WK6A 3WDLA 4ZAXA 1CRQA 1VA4A 3Q3CA 5KKCA 1TIBA 4BVBA 2OK8A 1JG4A 1QIKA 1TM7E 3R7AA 4CG1A 1GGNA 2W48A 1QH8B 1LVGA 1P2VA 1NT4A 2C5HA 3PNMA 1E4YA 3S70A 5L3QB 4V0ME 1U63A 2WUFA 1RAAA 1EVYA 2FPPB 4JJAA 4K46A 5CLHA 3FTNA 1XOIA 3UCFA 9LDBA 5FUMA 1VQ1A 1R8YA 2LV8A 4ZU1X 3M1AA 3C8DA 1B00A 2PUTA 2W7TA 4UBLA 1YQQA 1JHPA 2I76A 2WU0A 3MWDA 2RHGB 3BD9A 1R6AA 3W7BA 2YDXA 4XUDA 4IFTA 5JXIA 3ZQJA 1GAWA 1T8WA 1YMQA 2FG6C 4ISBA 2ZDGA 1QB8A 2X1MA 4LCEA 3PDIA 3R7WB 4YMTA 1U7WA 2DSNA 2G9UA 3UFBA 1O97D 2HNKA 3DDHA 1RWQA 3LDFA 3QWIA 2Q4RA 2W4IA 4WXEA 1SWVA 1T8RA 3L92A 4UUMA 1KNXA 3TTVA 1JTVA 3O1HB 4MV3A 3UA4A 4IIJF 4Q4AA 4QRIA 1S4QA 3KAPA 1ZUWA 1HE1C 4YCLA 3QW4B 3LBFA 5C4GB 3GPDG 3SZLA 3V33A 3KQTA 1KMNA 4NENB 3GNTA 3M6AA 2WG0A 3WKCA 1YRLA 3IAHA 3UJDA 5AKHA 1R15A 3BICA 4TTTS 1E8NA 2R6DA 4DLKA 3WNBA 4D9NA 1OXVA 4WZAE 2VZLA 3CINA 3UAOA 3RNOA 4EY7A 1OKKD 1NOJA 1P74A 3F5MA 3PJDA 2VP6A 3WGOA 4PLYA 5HOEA 5TPWB 3E3LA 1I32A 4K87A 2JW5A 3EXFA 3MJ4A 3NGXA 2NUTB 1BROA 3GQVA 3VJLA 4EAQA 4EYQA 1CDZA 1ILWA 2X42A 3JR7A 2J33A 2WZBA 3E23A 4NC9A 4S2UA 5EE5B 4CF3A 4BZQA 2WHXA 3EIHA 1HZZC 3VR6A 4O2AA 1GTG1 2ZATA 4US1R 1KAGA 1Q14A 5L7YA 2BMFA 1TVKA 4I1RA 2PTHA 5BMVF 3L7OA 4EYKA 4RA6A 1L5FA 2O19A 2NSHA 4V2UA 3C74A 3LI2A 1DXHA 1E3WB 1QCZA 1Z9BA 3HR8A 2I7DA 2XGSA 1QRRA 2WMOB 3OQBA 4QU8A 1CYEA 3NALA 4KSYA 4GHWA 2CXPA 1ZHHA 1W581 1W36B 1IVYA 5A9TA 3PUJA 5FO0A 2GB4A 1ISGA 4AJKA 4I81A 4R40A 4I14A 1CYDA 4UNQA 4OQDA 4UTNA 2J3KA 1XI2A 2W2KB 2WNSA 4LX8A 2ATEA 2QVZX 1CEQA 1K5PA 4FSXA 4F56A 2SECE 3NNSA 5LMCA 4MKRA 1GSIA 4P5EA 4TGLA 2WVAA 1AXEA 1S5PA 3EGEA 3RGGA 1SCNE 2G80A 4GC9A 3D0QA 4R2JA 4Y18A 2X4LA 1F6WA 4I4TA 3TAHA 3ZCQA 1RI3A 3UM9A 4KIGA 4N01A 1SEVA 1L5GB 3R7LA 2ZE7A 3KSUA 2WOOA 4BNTA 1TUBA 2VEDA 2BBOA 1LV7A 1OT5A 1ZI6A 1FIUA 2C82A 4L5JA 1LRJA 1T4GA 1ZNWA 3VC1A 3R4VA 1TJ3A 1JLKA 1SXJB 1TQHA 1TM2A 3FWNA 3H8VA 1TCBA 2QD1A 1DG3A 4M21A 5K0SA 1CJCA 621PA 2CHQA 2VSQA 5I7EA 1HMPA 2ZEJA 1NPDA 4P4UA 4XFJA 2ZRBA 2NVUB 3QKTA 5J5CA 2YV2A 4HDSB 4FWIB 2ZRKA 1RWXA 3QXXA 5JROA 1I7LA 3FCEA 5BMOA 3SBDA 3VI3B 3ZHQA 5C46F 4GPBA 2YHIB 3QVWA 2PGAA 2WFLB 4LYHA 2GYWA 4MWDA 4WCDA 2ODBA 4AJNA 1FFDA 2AYXA 3JTMA 2H0RA 2ADOA 2JI9A 4YT5A 2G6BA 2HTFA 2GO7A 1DC6A 1E6CA 1C0LA 1JHZA 1RABA 3HXKA 5LZ5A 1ZK2A 2VHTA 5DOVA 3WHIA 1IPHA 2X8LA 1LLFA 4GGMX 3ZI0A 3Q8KA 1CQJB 3G49A 5LZ8A 2KLHA 4QDXA 1A7KA 5HXAA 4S1PA 4D9GA 1VZ2A 4EFDA 5JJCA 4KKVA 1LDGA 3BS4A 3DE6X 4OLHA 5FL3A 3CC8A 4XASA 4GVLA 3SOZA 5H70A 3PWZA 4G1VA 2A67A 2ZSFA 3NKVA 4L73A 5LUAA 4KFCA 2HU2A 3AR7A 1Z47A 4IM7A 4XM1A 3VDNB 4E03A 1CF4A 3EGDB 2E82A 1D1SA 4C7OA 2PN1A 3PFGA 4U3JA 5EHXA 1UOPA 3HEBA 3GRAA 4LJLA 4ZOQI 3NCHA 2KWIA 4K81B 2QYSA 3SQLA 2HBRA 3X1WA 1ODCA 2HWXA 2X58A 2QTNA 4QU5A 4OKIA 2FLKA 4K6OA 5HF6A 4P7JA 3N58A 3U26A 2AJTA 4MIOA 1M1YE 2VHWA 3WYAA 2G04A 2IYXA 3BF7A 3NEPX 5DGXA 3UT5A 1JPJA 1RPNA 4RDHA 1PGNA 1JR3A 1OLXB 2J4FA 3ND9A 3W0LB 2OG2A 2W6PA 4WNAB 3QWHA 1JQLB 3GRZA 4RVHA 1X42A 4DNFA 2O7RA 5EWLA 3HEAA 3ILVA 3OLYA 2R6R1 2RH9B 1OR8A 1ZK0A 2C58A 1HBJA 2YN2A 3M33A 3PVZA 4FJ2A 4F4IA 5IZCC 1A1VA 1Y9DA 3LVRE 4FHEA 1HQKA 1NQOA 2OCAA 4IDQA 4A5SA 1QGOA 2WAXA 1I3KA 4MRNA 2CJXA 3EQ6A 3N2IA 1P1KA 3HZOA 4E30A 4YJ2F 1Z56C 3BIWA 1NRWA 1LF0A 3GLSA 3OFJA 2DOKA 5CEJA 2VYNA 1VPTA 3JD1A 2Z8YM 4G24A 2GZ2A 3NJ8A 1DX6A 3B3FA 5KCMA 1PVVA 2BKEA 4CIWA 4K05A 5HNKA 1U2GC 5H5JA 1Y63A 2Q7XA 3CNOA 3T35A 4NKRA 2YOHA 1PAUA 5I51A 3KAKA 4G5GA 1BD3A 3IKMB 5CT5A 1IY9A 2DAPA 1HEUA 4B73A 4ENVA 3TLKA 4JL8A 3H8WA 5C8YF 1WHTA 1B23P 1Z5ZA 3OO1A 3I5AA 2CBZA 1W87A 1N8TA 3DPIA 1Z33A 2LIVA 3ZXUB 4DLRA 5T6BA 4ID9A 1K8QA 1EUYA 2O3SA 2P8JA 1GSOA 2JAWA 1H5NA 1HX7A 1KDZA 3AVYA 3OF5A 3RW9A 2ICAA 1W35A 1IL0A 1ZDMA 3B6MA 3B1FA 2IQ5A 1M6EX 2QVCA 3QI7A 4NAUA 3THOA 2O6LA 1S02A 1TX4B 1PUIA 1HZJA 1UAGA 3WIBA 3ESAA 3RHSA 4QRDA 4RMGA 3HBMA 2OYCA 5CA0F 2A4KA 3I2KA 4GWGA 3V9AA 1PFQA 4FX5A 3RBZA 1EX9A 3DEKA 1US8B 3QIVA 3U6KA 1WMBA 3TTXA 4DM3A 1V16A 3INTA 4Y2TA 2D1FA 4DV0B 3D0OA 3ERCA 3LW7A 1A9OA 3DEIA 1GUFA 1QQ5A 1A9XB 4GIBA 3GCXA 3ETCA 3RSCA 1Y5LA 1JSLA 2A8YA 4OREX 3UJPA 3VYVA 4S12A 3HVRA 4I2VA 3QKSA 4EEKA 1WEKA 2CXUA 2EKPA 4UXHA 4Y7CA 3RWBA 1YOVA 3VYRB 5TGZA 4YRPA 3NWBA 4MW9A 3MELA 1E96A 1AU9A 2ZRHA 3DZFA 5FEMA 2YY6A 4JT2A 2PZGA 5H82A 1PZXA 2PKYX 3GVXA 1XTBA 3FPFA 1CJBA 3ISJA 4XVCA 4H6VA 4JLDA 1FQWA 5AHRA 1XFDA 3LRXA 2HMSA 2GPYA 1BNCA 5JIBA 3UJ9A 2B6HA 4C0QC 3C3KA 5KJ1A 5KI6A 2XECA 4B17A 3VSEA 3AR4A 3ZDYB 2XE7A 3ZLJA 3O94A 4QEKA 1XXLA 1JEOA 2H5JA 4B71A 2GVNA 5CLJA 3MJRA 2FW0A 3AB8A 3KR9A 2IXEA 5EYPB 2OBFA 1EVQA 4KQHA 4CEHB 3PQ5A 2AWOA 3QPCA 5TGDA 3V97A 3OKFA 1I2MA 2WSSD 2R751 5J2TF 4B79A 1AMUA 4K86A 3C3EA 2XSZD 2P9JA 3C16C 2AJ8A 2FF7A 2JLYA 2EJCA 4FOSA 5C37A 4BVJA 3FRIA 3JZDA 2KE5A 4IWNA 3GJZA 2B9EA 3LKVA 5GAJA 4AZSA 3I83A 1Q15A 1TF2A 2GBGA 4MKHA 2VA8A 2ZYSA 4FFDA 4KXNA 1NXTA 4Q4DA 1JX6A 1OLUB 3QF4A 4GF5A 4R81A 1TQ2A 3FYUC 1O6GA 4UQOA 2DPGA 4Y0VA 1EZ4A 3PEVA 3KPYA 2J09A 3EULA 1T6YA 2PD4A 3R24A 1E7SA 3WV4A 1DC7A 4I1VA 5KNBA 1VRWA 2XDAA 4RD6A 3WWOA 4BWVA 4DQKA 2R2AA 5M7EA 3DFKA 3FOAA 1PLLA 5L3SB 1VSVA 3Q7QA 5LQCA 3TTSA 1N3LA 2R4UA 3W2EA 2NXEA 5HE9A 3I6BA 3TE6A 2FOXA 1SBZA 5EPEA 3KQOA 4OIFA 5DGTA 4IDFA 3OFND 3AOEA 1Y34E 1M1NB 2Y9MB 1X7YB 1X9HA 1XSEA 4HRAA 5DCYA 2Z98A 4H6WA 4TMWA 4AJ4A 4EECA 3SJAA 1GTRA 1EFPA 3BTUA 1ZICA 1O1YA 2B2XA 4GXQA 5D3MA 4HT3B 4XWKA 3DYIA 4R83A 1E6EA 2Y1OA 5D84A 4KXFB 4AP5A 1PD0A 1QK3A 2GZMA 3Q3JB 5D5PA 3W8FA 5JH7B 2DETA 4OK5A 1WPQA 4JC0A 3PPXA 4Y1RB 4IVQA 4BQSA 1NQWA 5EJGA 4F8JA 1I9GA 1X1SA 1SKMA 4QTXA 1QMPA 2PS3A 2PWYA 2RHTA 3BK7A 3V1MA 2B98A 1EPUA 1PX0A 1WRBA 1YQGA 2QL9A 2W22A 4I08A 4MR9B 4J94A 2IU3A 5CYOA 1UBFA 2ORWA 3LLCA 3QU2A 4KPUB 4MKFA 1PWEA 2OO5C 1VRVA 2HDHA 3ZTTA 1V8FA 3QVSA 4HR7A 1RFLA 2IEYA 4YGXB 4F92B 3I39X 2P9YA 4TQAA 2PUEA 3LY9A 4Y2XA 1EUDA 4B6QA 2FV8A 3FSGA 2VHVA 3HBLA 4LYYA 2ZJFA 4DCSA 2OBNA 2Q3FA 2P9EA 3OBBA 4FYIA 3QOWA 1L4MA 4L76A 1D6NA 4FMPA 4QO8A 1A8SA 4BX0A 4MVJD 1XZQA 1L3CA 2VHCA 1J23A 4YJHA 2QT1A 1MB9A 1ORWA 3TLXA 3BFXA 1QO7A 1BWPA 1KBOA 4RZIA 2IYRA 3QUSA 4KK3A 1N1GA 4RFLA 2YH2A 3D6JA 3X2EA 4AAYA 3SZRA 3HDHA 5DNEA 5EN4A 3NEJA 1SG0A 1PDVA 3I62A 1SBQA 2IVFA 1LEHA 1JDUA 1XZPA 3FLBA 3OF2A 2CVQA 5ESRA 3DEAA 5A6SB 1FVOA 1T4MA 1JQDA 2YY5A 3WGKA 3QELA 4NG4A 5CLQA 5J47A 1XTKA 4BLVA 4EPRA 1BA3A 5L4LA 1BWSA 5AYVA 4RD4A 1DRWA 1RVV1 2ZU6A 1YRAA 1K9SA 4GPD1 4TRMA 1HY3A 2IA5A 2TS1A 4FYKA 3GEHA 3DDSA 1WTCA 3VH1A 2YC4C 2DT8A 1KY5A 3BDIA 5ECYA 4C4AA 3IBFA 4YAWA 1L7BA 2D59A 1WMFA 4P4TA 4ZKEA 2WE7A 4AO8A 1R88A 1I1OA 3JALA 1QV6A 1T9CA 2HA5A 4PBTA 3KPVA 3A28A 3L7AA 4PO1A 3S5JA 3P0FA 1Z68A 4S1TA 4W7HA 4XWAA 3WAKA 4C03A 5BSKA 2BHLA 5JCJD 3RF7A 4C3UA 4HXYA 1HT2E 3Q15C 1MTZA 3RVOA 2ZR0A 2ZXEA 3CH7A 3DFMA 3HBFA 2I55A 4C6HA 4ZHSA 1NQUA 5IWCA 2GSDA 3REOA 2F8MA 1N5RA 1Q11A 3AUUA 3ESRA 4FMBB 3PQEA 5AJXA 1C7EA 1A95A 2BKUA 3IAM1 4BO6A 4Q9DA 3EXIB 4HBGA 4IFEA 1D8TA 2C4KA 2X8AA 1UJ4A 1T3ZA 1VIVA 1NXWA 4FHDA 3T94A 4Q39A 3V2UA 4CLDA 2H92A 4WKNA 4UARA 2AYYA 1FDUA 1R5BA 4Q4HB 1LCIA 1VBNA 1Z5NA 2XUFA 2QE6A 1FFXB 3JAWB 3PJGA 3MMPA 4HDRB 2CNDA 4JGIA 4UEOA 2EERA 2FQQA 5IN5A 3RCBA 1KFCB 2HYDA 3JY6A 1WLSA 2WTMA 1F6BA 2XYQA 1ZRSA 3TQSA 4AUKA 1ZVVA 1G17A 5ALTA 1DJNA 3UHPA 3TI7A 2IU6A 2W2MA 1VKOA 2W2TA 2W4QA 5IDYA 1ITZA 2B36A 3KJZA 4PYQA 3GGGA 1IXKA 2B7BA 4OHBA 4QBFA 4RKWA 5HKOA 5KNDA 3CFYA 1ZIDA 1P0MA 3B2EA 1FJGB 3KKMA 3KKZA 4U2DA 5EHZA 5K0ZA 3CLUD 2EATA 3R3HA 5F7JA 3WLRA 3AR6A 3HB5X 5LLSA 3AK4A 2B2NA 3A0RB 4DRXA 3ROKA 5KC9A 3EC7A 5U9CA 2Z6VA 5F3RA 4H7PA 3DNFA 1XDUA 5I7VA 2CBGA 1NI5A 4DEXA 2GK6A 4DZTA 3RE1A 4M0KA 3NEYA 1S9DA 2PSDA 5KNCD 4LWQA 2HF7A 3G0HA 1YR9A 1POXA 2YL2A 1EEHA 3ZUGA 5ISMA 5I7UA 2JVJA 3BREA 4HPJB 5CCDA 2J30A 2W2OA 4DIDA 2ZUDA 5ABPA 1K7CA 3DV2A 2IH5A 3O4RA 4JXKA 4OYLA 5CURA 4DADA 4G37A 1PEKE 4WZBE 2COKA 5BN4B 4E3ZA 3CX7A 1QE5A 1XMOB 1FY2A 1TU3A 2BC9A 3V1NA 2OFXA 3RFTA 5JNRA 4IR7A 4KRXA 4BAZA 2QMOA 4OHYA 1QKJA 3HCAA 4FYVA 1GL3A 1YMVA 2XUDA 1NHGA 5FULA 2DECA 1EHCA 4I4CA 1V4VA 3Q6IA 5J1TB 2E37A 1T3TA 3URMA 3TNJA 1I1NA 4JN6B 2H48A 1A0OA 4YRKA 4H1TA 1QSGA 5F33A 1YJ5A 1C81A 1U2QA 3NTXA 4C76A 4A6PA 5THXA 4M7RA 3GRVA 3NV7A 5ETJA 3BGVA 4G1FA 3WGYA 4TVOA 1OV4A 2EJTA 2I6SA 3A4LA 3G2OA 3EZYA 2RGWA 1VE7A 4NMWA 1HFJA 1ZI8A 3WA6A 1Z16A 3M4JA 2EFHB 1FDVA 2V5UA 3GMTA 1K8YB 2VDUE 4NMLA 1BJKA 3MT8A 3ADOA 4Q4LA 1NTOA 1DUVG 3VR4D 1RRGA 2QTLA 3FPCA 3D7RA 1ECPA 1E9CA 1K86A 4ADSG 4M98A 4O2BF 2IYWA 3HFSA 4ZZ2A 1B6GA 1JG6A 3ZGLA 4A4DA 5A5DA 1PV1A 4WGFA 3RIMA 1GXSB 1QZXA 1TO6A 2NOAA 4GX5A 1YGPA 3DTVA 1Q1BA 4RD0A 4JITA 5BN3B 4L5AA 2AFIE 3NCTA 2NZVG 2CE2X 2DCMA 2QN3A 1NULA 2H3HA 4XIFA 4DWOA 4S05A 3IO3A 4LSGA 2PV7A 3QLJA 1G8FA 1ZNXA 2R8XA 3WL7A 2QG9A 5B53A 3T5AA 1YK0A 2POCA 3GLVA 1GSHA 4L28A 2VJBA 1TI7A 1XCMA 2QS9A 1F12A 1T3LA 4QE3A 4ZCQA 2D74A 4B3GA 4GH5A 4D9IA 4MSUA 4HRXA 4A2QA 1G5TA 4J7AA 1E9RA 2PEZA 4WY5A 1HTTA 4C0JA 4M2LA 2C83A 2ZAGA 3QWBA 1VLVA 4LV6A 2GK7A 2JKZA 4DB4A 2OAP1 2C2KA 4XX1A 4CEJA 5K3CA 2DFTA 4I0WB 3KXPA 4JCOA 3JPYA 1T2AA 2J67A 4AC9A 4B33A 1XWIA 4EB0A 3KL2A 1RDFA 3L7LA 1KY4A 1O6CA 3P9IA 5IEBA 3RRYA 4AKIA 2HJWA 2BFFB 2Y1WA 2RB5A 3PFWO 4E1AA 2F1KA 1CVLA 1G291 1KU6A 3H18A 4A1OA 3IP8A 4FCVA 3UT0A 5BSGA 5CVVA 3ICEA 3GUUA 3EH2A 1CUFA 3BTSA 1N7IA 1OFTA 2ATCA 3IPXA 4Q1CA 2HC9A 3M5DA 3CX8A 4Q1VA 4RENA 4D6XA 2GOYA 1N6RA 1Y4UA 2E21A 3HCBA 5LQRA 1SKQA 5JDCA 5EIBD 1UBLS 4ROTA 4N3NA 1ZUNB 1ZCFA 5DYNA 2XVAA 4B3HA 1U9IC 2QP9X 4OV6B 5FRDA 1LB1B 1XA4A 3GIDA 2LD4A 5DKFA 5I48A 4LXYA 4FHZA 1WWKA 2P5YA 4M1YA 4BO1A 1FFSA 1LXCA 2IEDA 5JSZB 3OD1A 1DTWB 3SKXA 4F1JA 3HM9A 1T2EA 1W73A 2Q6OA 1DEOA 3NIFB 4DZZA 4PR3A 3DEZA 4B80A 3OWHA 2ZZMA 4OF4A 6LDHA 4YBZA 2V7QA 4YO7A 2C95A 2I91A 4DV4B 1MLDA 3H5NA 1M73E 1R0RE 2PSHA 3M5PA 3VRHA 3I01A 1WW3A 2JKVA 2JFWA 1EDOA 4UPVA 1O95D 5G0SA 3SGLA 1HYBA 1M2VA 5I9LA 2B5VA 3Q85A 1O54A 4WV3A 3VO8A 1L5QA 3ZD9A 1AF7A 2Y05A 3MERA 1S2OA 2XTJA 2DQ4A 2IF0A 4EEXA 2FSHA 5J4YA 1UXJA 1DOHA 2MSCB 3RANA 3VQTA 4KMMA 2QMHA 1PYOA 4LGMA 4OY3A 4V24A 1XJWA 4KYUA 2AJBA 1U2DA 1C8KA 3HYNA 2PFSA 4FYWA 5FHQA 1OUMA 4US0R 5G0TA 3K8OE 3L0BA 1TD9A 5AVWA 2Q0HA 2FWNA 5H83A 3VNVA 2DB3A 1RHQA 2NU6B 3VI4B 1ML3A 2VTBA 1FRNA 2GF2A 2X5JO 3FCSB 3RC2A 4DOMA 2XXBA 4FEAA 4QBIA 3C70A 2VQ3A 1N7GA 1Z73A 2DHEA 2ZYGA 4M8SA 4ZO9A 5JSUA 4KEAA 3WLLA 1BJRE 2YWHA 3TTUA 2FR1A 4EKYA 2ZR7A 3D5QA 3JS5A 4K9QA 2WWVD 4M49A 5LM3A 4EBFA 1T6ZA 4MWGA 4LN1A 1JU4A 4M9CA 4LY9A 3JRNA 4R7ZA 4TWAA 3CZ9A 4XYMA 3U9SA 1RFGE 4WL0A 5JJKA 1TFRA 1A50B 4KIWA 1EMDA 4PYRA 2IX9A 2P2DA 2SICE 3DH0A 2GZHA 2FWRA 5EHNA 1U1IA 1A71A 2BEVB 5BQPA 3ZGVA 1ESNA 2OK7A 5KQMA 1P4HA 1ACMA 3MJEA 4LGCA 3AF6A 2H5EA 3UEOA 2P2LA 2FN8A 1UC4B 4TV9A 3L01A 5EJ8A 3CVYA 3ZVNA 4XTRA 4CFYA 3T15A 4ER3A 2FSPA 1EDEA 4DNPA 5JS7A 5TQ2A 4K0RA 2IKQA 5KCZA 4C06A 1D4FA 4I5IA 3SLRA 3TQIA 1J2YA 5FX2A 3VNBA 4P3NA 1BDIA 1SU7A 4PQYA 5CDUA 3L6EA 5DM60 5A4JA 1MCZA 2QSYA 5ERYA 5F1YA 4CQMA 3K32A 1VCIA 1RYMA 3I0ZA 4FFBB 4L50A 2PJUA 1M34A 4X3CA 5G53C 3DDZX 1GZVA 3SSAA 2VH1A 1DKNA 5FNZA 1AXGA 4EB6A 3O03A 1QIDA 1ZGGA 2AZDA 4P38A 2Z5VA 1HF3A 1J22A 2OQ2A 4GE0A 3M6MD 4OAPA 4N0EA 5C1IA 1CF9A 3RBAA 3T7JA 3ZVMA 3L05A 2JGMA 1OX4B 3DUFB 3QX8A 4TQGA 3V7WA 4YAUA 1R6VA 2WJZB 5CCEA 4WN9B 3CJRA 1JXQA 1JVBA 1C9KA 2VSOA 4OP1A 5LQMA 1L4HA 4KRGA 4N7JA 1GL9B 4ITRC 1KYQA 2GK4A 5ES3A 4Z4CA 1WB9A 5IJ9B 1FMCA 5EFOA 1J20A 3KEQA 1XMSA 1BVUA 1O5OA 2HSZA 2V9CA 3E22B 1V7QA 3D6VA 3EGVA 3OPMA 5DN9A 1OPXA 4LOHA 5I7FA 2MSNA 2BIFA 1W4AA 1XVAA 4L3OA 2A5DA 1LPAB 8ATCA 4FWTA 4N5LA 3ZS8A 3BJRA 4F4JA 5ICGA 4YECA 4CI9A 2ZYAA 2WIBA 2Q07A 4HNRA 5EJAA 4GDFA 4CL8A 3GDFA 5JXHA 4HVTA 5GZ6A 2V7PA 3VDQA 3U60B 3BX1A 3ASZA 4G2TA 5H9VA 3D02A 4N7RA 3WL5A 2GPSA 2EBWA 1C4WA 2NNLD 3NBFA 4LHSA 1N1MA 4MPRA 4NICA 3TOVA 1E9SA 1N9ZA 1Y48E 4EG8A 4R2IA 2XQVA 3QKRB 2RHMA 2B8TA 1EZ1A 2VNHA 2Q3EA 4PGAA 3DAYA 2HF2A 3G9QA 3T7DA 2BMJA 1W96A 2XITA 3NHFA 3UFXA 3LLUA 1SK9A 4G0QA 2DH5A 3L8DA 1P1FA 4S3MA 4LYEA 2Q1WA 1E2KA 2J5RA 4MYUA 3ROFA 5BV7A 3D7NA 4LYGA 5H81A 4FFPA 4ICIA 2EFJA 4LE2A 3ES9A 3PEUA 5GIPE 4ARBA 1DAKA 2PUBA 5I45A 1JA0A 4MKIA 3ZTWA 1OT3A 1FTYA 1ZIOA 2OD9A 5FPSA 4EYSA 4AY3A 1MMFB 4TLBA 2REXB 1ZBQA 3G8CA 3KNZA 3OHSX 4IEEA 3AVUA 1NXPA 2H00A 3GDGA 3GRRA 4HEJA 1RE1A 2R1TB 3TN7A 3IKLA 2PMKA 1X6VA 3JQEA 3CVWA 1QV7A 1R2QA 4Q3OA 3RUPA 2ZE8A 1A7UA 3RVMA 1P7WA 1ZSVA 2P7IA 2XODA 2VAWA 1L5MA 3VPCA 2IXBA 5I3CA 4U7HA 4ZGGA 4Q9KA 5EZQA 1LC3A 4LEIA 2DWQA 2HXGA 1U7UA 4JSTA 2RE8A 4IJ6A 4KVAA 5COQA 4JB0A 1M2WA 1C0KA 1X74A 3H11A 3UXHA 2J41A 5LD2B 1RCUA 2JIBA 3ZVKA 2PT6A 4XGIA 4CWAA 2EGHA 5ESXA 4Z3DA 1UQUA 3O9ZA 3AHIA 3TBFA 4A2CA 5AVXA 1RW4A 4BFUA 5ALRA 1LBHA 1DQSA 4XWGA 2QD3A 1RXWA 2NTYC 3A58B 2A9RA 3HKCA 4U2GA 1XMVA 1NUTA 5I5EA 1V1RB 5IPFA 3U7HB 4QXAA 3SE0A 4IF6A 4P3KA 3A9SA 3KOXA 5JJLA 1P17A 5LQJA 2Z1MA 2IIQA 1ZM7A 3QBDA 3IV9A 4RX1A 4TTSA 2VJCA 1AT1A 2ZTUA 3KOUA 2ANBA 4NS1A 3TPCA 3LQQA 2Q6KA 1NKVA 3O1LA 3D4NA 4R8VA 1JLSA 2E1PA 2UUPA 4RW0A 3U49A 3WLNA 4EI7A 4ND5A 1JLHA 5BSRA 3U9TA 4UQLA 4FD3A 5JZVA 5FPKA 3M0EA 4B76A 1NBMA 1IAQA 4L0QA 2P4UA 4CF6A 2JASA 1NJ8A 4WLOA 5EGNA 2O52A 2OBBA 3EAQA 4GM4A 3ANSA 1MO6A 4BP8A 3WE7A 3MHTA 1L7QA 3ZZ1A 1CXZA 1C0PA 2FMIA 2IPOA 4DWWA 1P6QA 3NBAA 5LC1A 5KWSA 3SVZA 5K6RA 4YMSA 1OBCA 3BRWD 3EE6A 1ZAKA 2IV7A 1I4EB 2YS7A 3F4KA 1GPDG 4FP9A 4PG7A 4TWBA 4AKTA 2OQIA 4MQBA 2CJFA 2XW6A 1FUUA 2O3JA 5CYPA 1VP9A 3ND8A 2EWMA 2VQSA 4TKVA 1J49A 2WJ3A 3IT1A 4UMEA 1T25A 2J0UB 4N0DA 1ZIYA 4C6TA 4PSKA 4K2HA 2FSUA 4M8KA 3IUSA 3LGXA 4L15A 4F97A 4V1CI 4YQEA 2UKDA 4AWXA 2HRRA 3K0FB 4RY0A 1P60A 4UKDA 1N0VC 1XCJA 3MTEA 4B5LA 1L8OA 4ZMSA 3DQZA 3AL2A 3BRSA 3HI6A 1NN5A 3HY3A 4M53A 4BNJA 1F5NA 1GZ5A 1WB5A 5EIAA 5MN6A 1T3HA 5JD4A 4OLBA 1T5IA 4LXQA 1NUAA 3DFFA 4CDRA 4F4DA 4Y6LA 3WGGA 4OXKA 2GXSA 1JJ7A 1KEVA 3N76A 3QXSA 5B7QA 1KMHB 4R16A 4RAQA 2C0QA 4YRRA 1J0DA 1Y4SA 4MP3A 3TLGB 4HNUA 3DR5A 1IONA 3F0TA 4XQ0A 2C94A 3U2QA 4D9CA 5A9RA 2IFTA 3H2KA 3VR5A 1ULZA 3W4JA 1CLEA 5JNTA 3UCXA 1HC7A 3UCEA 1BAPA 1HE4A 3SIWA 3E81A 4HNQA 3FHJA 2P2SA 3MWEA 2AQKA 4Y2JA 3DF7A 5T4FA 2XEXA 4UUPA 4DGSA 1XROA 4MHSA 4ALJA 1E2IA 2WIGA 2AR9A 1X1EA 1XE3A 3WNZA 1U98A 2NZYA 4D8VA 4OX9B 1GZ3A 2VXBA 1AMNA 3A6PC 2WJIA 2HREA 2NSYA 5AKLA 2BONA 2P68A 1EK0A 4PC2A 2CEAA 2SNIE 5NLLA 5KBYA 2QBYA 1E77A 2I3DA 2L42A 2CFTA 4BFCA 1HYEA 1Q5PA 3ENVA 3VV3A 1TTPB 4AURA 3ESQA 5GVRA 5I4BA 3S55A 3UJ3X 1HRDA 1XZAA 3PNOA 4LTMA 1YZUA 1I10A 2QTVB 1KY2A 2ZITA 5B6PA 1DBSA 3NP9A 2F3UA 2PZLA 3JZAA 1EVJA 3FWKA 3PICA 1GTZA 1QHHA 4EMUA 2FMFA 3A4MA 1XLTC 4HN9A 3W34A 3CLUC 2NU7B 4XCQA 3CSDA 4LZZA 4G85A 4JA0A 1OH8A 4X66B 4KDCA 4YMGA 1Y4ZA 3GZNA 1C7FA 3DG9A 3EQ7A 3L07A 3C3BA 3DPUA 1E98A 4NZMA 3F7MA 2E5WA 3ZXIA 3RARA 4XGRA 3X1JA 4R6XA 2ZW9A 1SCKA 1Z06A 3EDCA 4II7A 4ROSA 1DKQA 2AC2A 3F2VA 4FJ0A 5LOVB 5JH7F 3TM4A 3EGIA 4IKEA 1KJNA 4YV2A 2ZIWB 5G4KA 3PD1A 5J63A 3S7TA 2RAUA 4NJOA 1PD1A 4NCBA 2GN2A 1B43A 3S2SA 1HLDA 3DEJA 1ZD8A 2W2NA 3HB0A 4L1KA 5CX4A 5E8RA 1ESZA 5B37A 1HG1A 4QPZA 1TC1A 5BN5B 3TQQA 3KZKA 1O4VA 2DBZA 2JFVA 2NYUA 2WR8A 3G02A 3EVTA 1JSZA 4URHA 5C53B 4JQOA 2WYHA 2PUCA 2VNKA 3IEVA 1YFKA 4YVFA 3JVDA 4HJRA 2GRJA 2P6RA 2I7CA 3P2EA 1G0NA 1YVUA 4MMYB 4BP1A 1NNUA 1O94A 1BN7A 3H0KA 3RU7A 1J39A 1WSAA 1OGIA 1YL7A 3I9V1 4RHCA 1IHDA 1JB9A 3D2CA 3QVTA 2EAUA 1KFEB 4AP6A 3MLAA 4OHZA 3M3DA 2KBFA 1NF2A 3ETGA 2G9VA 2JLQA 3QF7A 2DX7A 3GLIE 4RAOA 1DEKA 4Q7MB 3W2GA 4GI2A 3ZW8A 5K4HA 2VJDA 4KE9A 1WAMA 3TZCA 4C5BA 1U2PA 3PI7A 2IY9A 3CMCO 3WS7A 1A27A 1PE0A 3H13A 3VSBA 4F1KA 1Q1ZA 1RQRA 1S2DA 3T3OA 3AERA 3TKYA 4EG3A 2P4SA 1Y7IA 3CRZA 2EJVA 4E0BA 1I6KA 4LQDA 2SCUA 3C6QA 5DXJA 5ADHA 2Y9PB 1V3UA 5ELLA 4BCCA 1HV8A 2PZFA 4JBHA 2EBUA 2QXTA 2J7PD 3FFXA 1NXSA 1NSFA 1ZW6A 3M81A 1RHJA 3BWEA 3EHEA 3KZVA 3QBVA 3N2KB 1P2SA 1IY0A 3WIOA 1TCVA 2IKSA 5LQKA 2IXAA 2GM3A 4N82A 2ACEA 2EQ5A 2BR3A 4N5NA 3JSXA 3EBPA 3WGJA 1HNXB 1D8AA 2VNSA 3H1GA 4PAOA 1UMBB 2RDMA 5D3ZA 4AD8A 5EWJB 1OBFO 2CD7A 1XPRA 1FNBA 4IMIB 3G9TA 3HJHA 4G0ZA 4R9RA 5BV2P 4LJRA 3NVMB 1K6MA 3V8QA 3P4YA 5AD1A 3TRIA 1H3NA 2BJWA 2C29D 1ADCA 1FQKA 1V6AA 4X3OA 2DXIA 4B48A 4AQYB 1NVMB 2JIPA 2ZTMA 3CKLA 3LAWA 4KH1A 3DMPA 1OXKB 2I66A 2IY8A 2X8JB 3I2GA 5BWNA 1B14A 3H8SA 3H0CA 4DJEC 2CV0A 4RLFA 4C0WA 1F2DA 3O8NA 4YIHA 4PO8A 5KSWB 1PWHA 3KKEA 1I3MA 1ZG3A 3DMGA 3RBVA 5EZYB 3ZCSA 1FCJA 1T9GR 4BFTA 5GGXA 2PD6A 4ZT5A 3MTQA 3TW0A 3PJFA 4C7VA 3KUUA 1UDRA 3U7RA 1K89A 4GLJA 5AKZA 3Q8LA 4IUBS 3IQWA 4BBZA 1B3BA 1LLDA 1UKAA 3BXXA 2GHQA 3A1TA 7AT1A 4B1FA 5KTNA 2VH2A 3O0DA 4HAXA 5EIBC 1ZM2A 2DZDA 3GZ4A 2XBLA 3P9YA 1EDZA 5GV7A 2I7TA 2JBAA 1YDHA 1VA5A 1O0BA 1K3UB 3PJEA 4FJ1A 1Z39A 4HZIA 3ZWMA 3M6WA 4Z3OA 5G02A 3NM6B 3EUEA 1L5WA 3R5TA 5I9NA 2GJKA 4P0QB 1GA1A 3L6BA 4RGQA 4F3YA 4FZ5A 3JV7A 4QVIA 1ONSA 4XYBA 4KQ6A 1XU9A 4BWFB 3FCAA 3OO0A 3PI6A 1VHJA 1SRRA 3VR6D 1PEDA 3JAKA 4WNYA 3RIGA 2XVZA 4EMBA 3OJWA 2RKOA 5B64A 2Y2UA 4OXRA 1HLGA 1D6JA 1TL7C 2ZVDA 3FNHA 3L8GA 3LQ1A 1IZ0A 1XEAA 4I7EA 3O4JA 4LDQA 2I5PO 2AMFA 2J8ZA 4L08A 4RDCA 4Y8VA 1GITA 1PJRA 2IUSA 1PGPA 1XD2A 3IB6A 1IN8A 4NECA 3O47A 3FE2A 3H9QA 3IHTA 1ENZA 4LHEA 2J0SA 1D09A 2O1XA 3LHKA 1DRJA 1CETA 4FOPA 2C7GA 1NW7A 1WXIA 5EQDA 5AXDA 5BYBA 2VJMA 5EY5B 5BNFA 4BZZA 2NO0A 3N2NA 3OJEA 5DX1A 1KTIA 3KQVA 5EWMB 5C7IO 1XEWX 1OH6A 1JKMA 3WA7A 3LC2O 4RFSA 2NWQA 4ZAVA 4W7SA 5I8ZA 4BQEA 3TZHA 2QVLA 3JQ7B 2JIQA 3PL1A 5EUMA 1NVFA 3MJHA 2O4UX 3E35A 2QR3A 1V26A 3EN0A 4DFDA 4YMWA 4D9EA 3K70D 3P1JA 2IYEA 4JR0A 1YFLA 4RZSA 3BWCA 3C5CA 2NAPA 1TF5A 1QCYA 1EFVB 4FQ7A 4YUYA 3H9CA 1AKQA 4JJFA 5E1OA 2HJ9A 1O6ZA 3TW6A 3BAFA 4C7BA 2QM3A 1YHYA 1YL6A 4MUNA 4TLAA 1ZRMA 3THXA 2HA3A 2JDIA 5FWXA 4Q37A 3GWGA 2V4ZA 1FNNA 2VXCA 3KYCB 4ZC1A 1RRPA 3W77A 4F96A 2Q3BA 2R6FA 4Q3NA 3P2KA 3PC8C 1WZNA 1PGJA 4AKEA 1TT5A 4Q02A 7YASA 2JCGA 4O3MA 2V7BA 1LDMA 3G6WA 4MMXB 2G6TA 2A1IA 3F9RA 1DIHA 2ZPUA 2PYIA 1TA4A 5CXUA 2YOGA 3ONFA 1RWVA 3GY0A 3LKDA 2GCNA 2QUZA 4ER0A 1MABB 2J6BA 1WF3A 1QX4A 4MA0A 4EFLA 1PT8A 1YJCA 4ZVTA 1XAHA 4MS4A 5JCPA 1ISPA 1AKVA 4D79A 4Q93A 2OV6A 1W49A 4YRLA 2P3QA 3FMOB 5KYYA 4OXQA 3R8XA 4J7XA 3OH8A 1FSZA 1J1ZA 1RBZA 1D2MA 1ODFA 3FNBA 3K05A 1JSXA 3UKOA 4DG8A 4JI2B 5EC8A 1YJAA 3DS8A 1IN4A 2H2IA 4ZZ3A 3AQ4A 4GX0A 2AMJA 4Y0AA 5ITZA 3QNMA 2V8OA 5J23A 2GAOA 1FNCA 2DPXA 4RA9B 2BGJA 1UBRS 1IAVA 2IE0A 2MU1A 1CR1A 2Q1UA 2ZTVA 3A6GA 3BHMA 3E2IA 3GF4A 4MQFB 5GWXA 3TM5A 4CM6A 3IBCA 3R77A 4NU5A 3EEBA 2WVHA 3GDOA 4R3NA 5I6DA 5IASA 4NABA 1GO2A 2JFBA 4JEHA 1TZKA 3K0KA 4IDCA 4OUDB 1AZTA 3O26A 3A2MA 5EXTA 1YA6A 4M0FA 1P5FA 1V48A 1NWCA 3LUGA 1BVHA 3GLHB 1Q91A 4MS1A 3GNLA 3JQ8A 4M6WA 1CNEA 1GN9A 1ZS9A 2X23A 1J09A 1JR3D 4PE5B 2QXYA 3KALA 2QAJA 4U63A 3W5DA 4LVUA 1VDMA 1QPBA 1MVLA 1ECBA 4FLEA 1WXFA 2WTBA 2LXNA 1K6JA 2QQ5A 1KI8A 2GBLA 4HX2A 2BV3A 4W1RA 1AKEA 3VZBA 4W5NA 2BEUB 3JD3A 2NACA 4TSKA 2A6PA 1E63A 3FYUB 4P7FA 5TE9A 3UH1A 2VDWA 4U7WA 5BW8A 1KWGA 2CXTA 4YDHB 4R5HA 3WFZA 2XX3A 3K9LA 2IYLD 3D3KA 4ASUA 2VYND 4Q66C 5FYQA 3WL4A 2NYVA 1R9GA 2WZDA 3OURA 4MJLA 3JVIA 3QUQA 2J3EA 2Q3LA 3AFOA 3CE6A 3H3XA 3ZNPA 3F74A 2BM0A 2FI1A 3GFOA 4JLWA 3UH0A 4UUAA 2FNAA 5CJPA 1RXSA 2AH5A 4A91A 5ILQA 1CUAA 2ZBUA 1XBTA 2FDXA 3K8ZA 3WL6A 4TTAA 3R9XA 2C5AA 3I1YA 5I9TA 5BYAA 2D1YA 4XCVA 5K2MA 4W5TA 2B1IA 2ETVA 2WU8A 3ZK7A 1IM5A 3MC1A 4G6ZA 4TQUS 1C7QA 2AEJA 1RQ7A 3M6VA 3TGLA 2IYOA 3N05A 2FUG6 2ZZKA 3DAPA 4LX0A 4V02A 3UMCA 2JI6A 1SUEA 2W6CX 4OXNA 3F1LA 3EG9A 4BGIA 2R8OA 3STWA 3ZY3A 3KPJA 2OFWA 4G5FA 3MAGA 4URZR 4FBLA 2A1TR 3D8HA 2WMYA 3V2HA 5IULC 5GOZA 4PLTA 5EG5A 1SUSA 1U3FA 4KMRA 4I1PA 2K87A 4BASA 1II0A 4F3CA 1I0ZA 3Q98A 3U37A 1X0VA 2FN9A 3E2MA 4HH1A 4KR2A 3VBEA 4IYJA 1QP4A 3C5HA 4JCCA 3C4JA 5CX1B 2IOFA 1JNXX 4FD2A 4RIIA 1KJZA 3SDZA 5HUQA 4DLUA 2JKYA 3VUEA 1KXJA 2TMDA 4R8LA 4GDMA 3WIUA 4RF5A 1JVSA 1WCXA 3BGWA 1V96A 2VQDA 3CLRC 3QPUA 4AECA 4G23A 3WLMA 3CPJB 2H1IA 3H0EA 4P22A 4LF8B 2PXHA 2UVPB 3DULA 3EF0A 4Y98A 1KP9A 3DFZA 4PPNA 5TRTA 3N8GA 1NR7A 3QVOA 3CCBA 3GJ7A 1FFAA 3N0VA 4MUGA 3DBIA 5ED4A 3E7WA 2A9VA 1RZVA 2B5OA 3RS2A 4E5PA 1MJNA 3SEFA 4AF7A 3ZKWB 3HO8A 3SC2B 4LYFA 4FDVA 4WY8A 2FPWA 2HIMA 4E1BA 3MPUA 4IIEA 4EX6A 3OY2A 4DPLA 2JHFA 1F9AA 2CLFB 2O06A 3K1AB 3EODA 3PF9A 2R66A 1W0JA 4GAEA 4WLEA 4A10A 2QZ4A 2R6GA 3WYEA 1EUZA 5C8VA 3KIPA 3R7SA 4MX8A 1FP1D 1GQRA 3CRQA 4Q48A 4X7BA 2VCEA 4JBYA 5U1PA 3PTAA 5K4AA 4MWZA 2D2FA 5FH9A 5HDBB 4JENA 6ABPA 4JLSA 4Z6KA 1OY1A 3U4QB 3ZI7A 1G20B 4A16A 5MN4A 2NAFA 3P5SA 5BOSB 3IULA 2XCOA 3A1CA 3H4TA 4FXPA 4KQCA 2WAYA 2JBWA 3PE4A 3PDHA 2FW8A 3VNRA 4IGFA 1WD7A 3AXSA 1C9DB 2QAGA 4QPDA 3CQ9A 3D7LA 5BORA 4Q24A 2QGNA 2WYIA 4CKYA 5K8LA 3QHAA 3RUEA 4AROA 1F9EA 4QULA 2G72A 1YQDA 4QLAA 1YR3A 3EOAI 3OE1A 4TMVA 2JCSA 4RY8A 4UHBA 2GPWA 5E7MA 5EKUA 1NUHA 4NJEA 1N2JA 4IDPA 3EFOA 4PLFA 2MR6A 4O4LA 2IX3A 2JLWA 2AFHB 4CM4A 1GTMA 4N7BA 3TZLA 3DWIA 4DA0A 2VP4A 1E2LA 1JV2B 3VH4A 1TUIA 1YRYE 4ZVLA 1T10A 4AK9A 3R0QA 1TZJA 3IPYA 5AHWA 4X64B 4EIWA 2C5SA 2JAHA 1CE8B 1O7JA 2UZ1B 3LHFA 2BJHA 5HIIA 3TW8A 1PFGA 4HEA6 2X5OA 2YUIA 3RG2A 3CX6A 1IUOA 1RE0A 3ILHA 2ZB3A 3N2ZB 3T9FA 3DM5A 3KL4A 3SAJA 2P11A 2UU9B 1FQOA 2P9FA 1MVOA 2NXNA 5JANA 1WULS 1E1LA 3O8BA 2FGKA 4XIYA 3U7IA 1K8ZB 4M1EA 1WUHS 2P6NA 2QN6A 3RSSA 2BGMA 4PNEA 2DWUA 2JFXA 3ZR4B 4MGEA 3EW7A 1AE1A 2AYZA 1XN4A 1P6UA 3E7DA 5CVTA 1RYDA 1OGYA 1P5ZB 3DMTA 5M5BA 1N34B 1T26A 5DF1A 1YB2A 4ZAZA 4Z1MA 3TEMA 5DNCA 4NARA 3UNXA 1PSZA 2MINA 3FSGD 2CY0A 3P9CA 4MVXA 2QORA 3IDQA 4QOIA 5K20A 1CZRA 4PICA 4RVOA 4CUJA 3BWXA 4E2ZA 2WYOA 3DE7X 4PC6A 3ITEA 4E5MA 3CPEA 3B70A 4RUKA 5FT9A 4Z51A 1Q2XA 2W9XA 1TAUA 2EVWX 5E4FA 1LLUA 3FBGA 4CQLB 4V03A 1V4NA 4W9NC 3W3ZB 2IDZA 5F2EA 5FA6A 4U2FA 5GONB 4GMKA 1NL3A 2J5XA 3EDYA 4JBNA 3FHCB 4RNDB 5F77A 2ZUTA 5K8CA 4OI4A 1MHTA 2YJTD 4Z9FA 2XLBA 1IZYA 4YROA 3J81A 4MUXA 5JI2E 1XEXB 1N25A 1OIVA 4DLZA 1NW5A 2X0JA 1WX1A 2MWMA 4MJ7A 1RACA 4NE7A 2WKSA 1NNLA 3NHAA 2M6KA 3DW1X 4CLEA 4RIFA 2XCQA 2WQZA 4XWYA 2QRUA 3R5HA 4BGUA 4EHBA 4EX7A 1ES9A 1S8FA 2DLDA 4BEBA 2VSXA 4DT1B 2YDYA 1CFJA 1IIBA 2OHIA 2PX2A 4HSGA 1F4LA 1GIAA 3ESDA 3MS2A 1CC1S 1FP6A 3NOVA 4XQCA 3JW8A 2CLDX 5T41A 4BNHA 8AT1A 5A62A 1YFJA 4TKZA 5NULA 2I1QA 2IDJA 2ADMA 2OUIA 2F4NA 2GFIA 2R8YA 2JGIA 4DVGA 5FP0A 1MX9A 2D5IA 2I6QA 1G0OA 2ZRJA 3AZPA 1ZD1A 3PRJA 4L9SA 4PYLA 3T1VA 4EKNB 1HFEL 5J2UA 2FCRA 4L2IB 4N1AA 3LY8A 1Z7WA 4TYPA 5AUNB 4MPJA 4ABYA 5LU9A 1MENA 2UUAB 2BUCA 1HOTA 3N53A 1PP4A 1Q7CA 3ZN2A 4EHIA 3NT5A 2X5XA 1Z0SA 4YP5A 2RARA 1JBKA 4UZEA 5HMMA 1QP0A 3BMNB 3PA6A 4IXNA 4LW8A 5EPUA 2A94A 3X43A 3OQIB 1PZMA 5E1MA 4FOOA 1L8XA 3EGWA 1GZSA 4MHTA 3KZOA 2HIHA 3MVEA 3ST7A 5BSFA 5MDHA 3WGHA 3H4VA 2ZR8A 2ZGVA 3FPBA 3MCTA 2HSGA 4OA5A 5GY7A 2HZ7A 4U2KA 3RTEA 3UMSA 4H3HB 4BO5A 2PQ2A 2OORC 2HNBA 1O58A 2CFSA 3PD0A 4QFBA 1R50A 3AUKA 3G2JA 3LL7A 4H1VA 1BG6A 1E61A 4B5KA 2PQ6A 2LIPA 3B9PA 3BZBA 4TUYA 4DS3A 4XWOA 4NONA 4IWYA 3HYLA 3HB1A 4UNIA 4BQOA 3R0XA 3CTMA 3JARA 4I46A 5DHAA 4DIOA 5KNDD 3K30A 2H17A 1U5AA 1LUAA 1RR6A 1V5GA 3B9BA 4BNGA 3JQBA 3LUDA 2EXXA 1W88A 2Q49A 1SK8A 2BFBB 4G0YA 3KVOA 4LWOA 4X90A 1ABFA 2PIDA 3SLGA 3TH5A 2XXAA 4OBWA 2W6IA 3DOCA 3HLYA 3UTCA 2VPQA 2IIBA 1SNYA 3G2PA 1KXZA 1U8ZA 4NFHA 1P5JA 1Q92A 5EJ2A 2QSJA 4YWJA 4YRJA 1XNQB 1QOQB 2YJ4A 1XQWA 5IM4A 1X7GA 4NH0A 1HDXA 4CG0A 2VYQA 2AE2A 3D1VA 4QGAA 3ZZTA 3ETJA 3GHYA 5CW2A 2H4ZA 2J4CA 2BKXA 4ZTBA 5CB4B 3GXOA 2VF8A 4INZA 4HWTA 1XYGA 2FR8A 2LE0A 4L5CA 5IBQA 3UHFA 1EQUA 1GA4A 2CLEB 1NKSA 3ZOZA 3TLAA 3HO1A 3VZPA 4AMBA 1UCFA 4NTZA 5ITSA 4QUKA 4P08A 2AN9A 4V0MA 1L4KA 2RC5A 3FA2A 1TVMA 3ZYZA 2HWWA 4DPMA 5B4TA 3RWOA 3AG5A 4FQ8A 5JZSA 1QGYA 1QO9A 2VHXA 3IEPA 3IVXA 5CNIA 3E2PA 4DMHA 2HHLA 1D0VA 1PRYA 3G89A 1KMCA 3COPA 4M36A 4X44A 1T1SA 3E15A 5FEUA 2Y4NA 1ZK1A 1XJQA 4BKRA 4YH1A 2I22A 4OP3A 3BWVA 4Z86A 5BW6B 4BZXA 1RKBA 1NG1A 4OYRA 5A3JA 5LIPA 3C6YA 1EWYA 2V0CA 3HN6A 1DAFA 4MUYA 5E2BA 3O75A 1GPLA 3FCXA 2BT4A 3S28A 4LRUA 1IJKA 4J0QA 1DTEA 3KZ1E 3WGLA 2YJZA 4PPYA 1BCSB 3IE1A 1F8GA 5JECA 4G25A 1CUWA 2R8EA 4KFSA 3PQ3A 3OESA 1EJBA 2JAXA 3ZV7A 1CP2A 1C50A 1I7DA 5TJHA 1GLGA 4TYMA 5E8JA 1RYZA 3CYFA 4WZAA 5H4HA 4RMIA 5F7ZA 5LOVF 1EP3B 1SUCA 3M49A 2O2JA 4R1MA 4UVDA 3RRXA 3THWB 1GTJ1 2Z4TA 3HGQA 5A9SA 3FR8A 5ILOA 1NXQA 5L8VA 3D6MA 1Q95A 4Y6OA 4Y9UA 3T9DA 5KKNB 1C1HA 1QZ3A 1BQ3A 4MCJA 3QNUA 3ZDEA 4Z8XA 4A8HA 5GJCA 4B7UA 4CF7A 2QY9A 5H9WA 4YJFA 2W98A 4B31A 3DTVD 1WDMA 3TSYA 4W8OA 1O4WA 4RY9A 5D01A 3BL8A 1YKGA 5ALJA 3ZX5A 4E09A 5K09A 2AEFA 4HK4A 4G8BA 1J2RA 4NU0A 4X00A 3VX3A 3WNCA 4HDOB 3ZW7A 1UZMA 2WV9A 4WUVA 3VNAA 2Q29A 4IG9A 1N6NA 4B2YA 2ZLBA 2OGSA 2XDWA 3BFPA 5HUHA 2NTVA 3E18A 3AVOA 3PK0A 4G0NA 3KO8A 4KQ9A 3QTTA 1K1EA 4QDTA 1QONA 1Y4DE 1Z17A 2VATA 1KQNA 3PEYA 1QGDA 2H4FA 3UG7A 1R0YA 4DWJA 4FM9A 4XUGB 1Y1RA 1Z0JA 2HDWA 4PLPA 2BH9A 4UTVA 2XNCA 2AR0A 4IBOA 5L51A 2O8EA 1VMEA 3K70C 2Q3MA 1TLFA 3LTNC 4WLUA 1RWPA 4F5DA 1R4ZA 1FP4B 3PUZA 3SJUA 3QLVA 3QX9A 1MX3A 4P83A 3NC0C 4O08A 5F2OA 2UXCB 2IEAA 4BVAA 2FMUA 4LXTA 1U1GA 2Y76A 4BO8A 3L1UA 3RFFA 4QUBA 2IU4A 4DYDA 1USUA 4LQ4A 1ENYA 4ZI7B 3Q7EA 3GAZA 1FSPA 3B8EA 1KDTA 3BG5A 4IGEA 1N5OX 1U11A 4Q9JA 1M83A 1J4AA 1IUNA 4JB2A 5F73A 4MW5A 1QGUA 3REQA 5ADWA 2ILVA 3F71A 3IAS1 1NY5A 1U7PA 2IBTA 2OEPA 1NAHA 4K8RB 5JQGB 3HTXA 3EFBA 4QTTB 1Q0PA 1DTSA 1E6LA 2DULA 4DCOA 1V9LA 1Y8CA 1N33B 4N5HX 1OAKA 4LRXA 1D1PA 1XQ1A 1XDSA 3DP9A 2GAIA 2Q9UA 4OKNA 4U2BA 5A5FA 1GPKA 5EKTA 1M2HA 1FFBA 3BJZA 2V9ZA 3MMZA 5I7OA 1G8GA 1OZGA 1BN6A 2OCXA 4IKPA 4DBLE 2XUPA 4H0NA 2WJVA 2X7JA 3FYSA 3LK7A 3QSYA 3ECCA 5ILGA 3BBLA 1R6XA 2HHCA 4FMDB 3O8LA 5IC5A 2XCTB 4UU1A 1NMEA 2WK1A 1KI6A 5JZBA 2JI7A 1KR5A 3CUKA 1ZINA 1CEXA 4UD6A 1UFVA 2V7EA 2AD5A 4DSNA 1RMYA 1ZR4A 4WH0A 2M9MA 1ZRNA 3LPMA 1SHUX 3A1WA 1K0UA 5EZYF 5E2IA 4CMJA 1Q7GA 3PU6A 5FOXA 3HKEA 3IVAA 4COKA 1N7JA 1II8B 3CB2A 4G4GA 5EIEA 1JAZA 2O3TA 2ZQ5A 5AM0A 4Q9IA 2BOVA 1KPIA 5FPQA 4C1NA 4DEVA 1C80A 3FGZA 2PBRA 4IKOA 3AINA 3UUFA 4QGHA 3LX4A 5D3QA 1M1YA 3RJZA 1FXUA 1FX1A 3DZBA 2WWGA 3H2YA 3LRPA 4HDAA 1YHZA 4QJIA 4IILA 2IUUA 1JZQA 1UC8A 4YLYA 4HNVA 1Z2OX 1J2UA 2HXYA 3G2QA 1FU4A 4HMOA 5DGHA 2NSLA 4UC0A 1UP4A 2YWCA 3T0FA 4P36A 2NSJA 3VGPA 1ZM4A 1BGWA 3U17A 1FTQA 2GTHA 2PCJA 3D4LA 1IB0A 3OA2A 3SZMA 3K0CA 3DZCA 2GTPA 1MV5A 1ZLXA 1DCKA 3AI3A 4RIGA 3DDOA 1SXPA 5I8PA 2XE8A 3KKNA 5JISA 1ZXBA 3L7YA 1AUQA 3IELA 1K88A 4B3IA 1D1QA 1FNSA 3BWMA 3AHGA 2OY0A 1JJFA 1VJGA 3K53A 3BYZA 1A4IA 4RVFA 2R79A 4X20B 4GPTA 1Q7BA 3F6SA 3VZRA 2FN7A 5BVGB 4Z4QA 4FONA 1KSGA 4UHDA 2GVZC 3FPSA 4CV3A 2BHTA 3GGCA 3OPYB 2NUPB 4H9GA 4MLZA 1GFWA 5BYJA 1L5HA 4B6FA 4JP8A 4ARAA 5C7YA 4MRPA 4CQMD 1HEIA 3OIUA 3HMKA 1L7OA 1ORHA 4DF3A 2GZSA 2HXSA 1SC4A 4GXNA 3O31A 2B4AA 4M8LA 4NV3A 4YHBA 4ALLA 1JIKA 2C7QA 2VZ0A 1WVMA 2I03A 4ZJZA 5ALUA 3OEEA 2AIRA 3DWEX 2CNKA 1CDOA 1YR2A 2GGSA 1XJ0A 2VDOB 4KP7A 5K8TA 4HFMA 2Q7OE 1WUIS 2QNBA 5F2NA 4HWKA 4LDZA 4NPAA 3KYDA 2I2FA 5AM4A 3ZEAA 3OQHA 2O54A 3H1EA 5CFQA 3QEJA 4ZRMA 3RT9A 2NMVA 3N0RA 1XZCA 3TIFA 4ILEA 1WB6A 4REOA 2AOXA 1LLCA 1ZD3A 3MQ2A 5DI3A 2QAIA 3SYNA 2CVZA 4WINA 1U5CA 3LPAA 2FMTA 2IZ1A 4LFBB 1MKYA 2XQJA 1ZEMA 1XPUA 1JEJA 3GROA 2ID7A 2JGDB 3NTVA 3ZWDA 3IXQA 1ZVJA 2GMWA 4KMSA 1ADFA 1FP2A 1QHFA 5LB4A 2DTDA 1MNQA 3H16A 2WT9A 5CH8A 5JRZA 1NC1A 2EBHX 4P0TA 5GMOA 5A7GA 3GVPA 3K0AA 4EENA 4F11A 5EJ4A 3AF1A 4Z7JA 2WUVA 3JVEA 2V3WA 2ZB2A 3I42A 3R5FA 1SELA 1NSTA 4Q03A 4RHTA 3EHDA 1ZW1A 3O8QB 2X4DA 4P84A 1PLJA 4BTVA 4M8NE 1R27A 1ECJA 5HZKA 1TYAE 1S2IA 3T5BA 2ZRAA 4HAIA 4QTUB 3EYWA 1CVRA 4EHLA 1QF6A 1ADYA 1G5RA 4K1XA 2P8SA 5DOZA 4F3NA 3ROMA 1SG6A 2WG1A 1L6IA 1P0CA 1YCFA 1ENPA 3NYIA 3L3BA 2XJ4A 2D5LA 1KRWA 1VE9A 4WIAA 2CD9A 1OF1A 3L7IA 3L8CA 4F0JA 2AQ8A 5KHLB 3HFJA 1FF9A 2Q5HA 5EA2A 4QXMA 3E9DA 3Q72A 4DSAA 1H4QA 2ZKIA 2B25A 2PS0A 2ROQA 3LQ4A 4YP7A 1NMSA 3MUFA 3MCZA 4TKLA 2I2BA 3VU0A 2IS6A 3SMVA 4BZPA 1SUBA 3RKUA 4HGRA 1DC4A 2Y27A 4LY0A 4RKYA 1B7GO 4LQLA 2QMEA 3KX2A 4G2NA 2AG1A 2OXRA 3I45A 2R4QA 2CHFA 3GGOA 3SXUB 2HCJB 4D8TA 4LF7B 4D4JA 1JILA 1U1CA 1XVIA 1NV9A 3O3OB 1H1LA 3T1QA 1VLQA 3AOEC 1MA0A 4FFSA 4HQ6A 4Q4CA 2GX6A 1MJGM 1KOLA 1YC5A 1SBTA 1Q84A 2ILTA 3CO0S 3OX4A 2AMLA 3GMSA 3FD8A 3PUXA 1TQDA 4PF1A 1IN1A 1IWPB 1C30B 2NQ2C 3BWDD 2CDBA 5CXSA 4C4ZA 3PENA 3B3QA 1C0IA 4MRRA 1VLLA 5A5VA 5BNWA 1T2CA 4FGUA 1YR8A 3EWSA 3PXXA 1GUZA 3GCWA 4FHFA 1RBQA 4U02A 1H3EA 5F12A 5K3DA 5CA0A 3SVLA 4JLKA 5CFPA 1HXHA 2DUMA 1F06A 3CN9A 3B3JA 3DWGA 1L5NA 1T3SA 3MCUA 4UVGA 3SQXA 4XSHA 3ULKA 2PKQP 4LE1A 1I2BA 1DPGA 4JDPA 1ULBA 3RK0A 1J9ZA 1G59A 1NVUQ 4UHEA 2J85A 2VWQA 2QTGA 2ECFA 4L4YA 4KE7A 4DR6B 4NYMQ 1TAGA 2XUAA 1T9GS 1YONA 2FLWA 5TQVA 5HR5A 2OTCA 4D2IA 4W1SA 1MHPA 1AK2A 1NBMD 1SUWA 1I51A 3BD7A 1R16A 3ROPA 1TAQA 5AXAA 5JO9A 4JHLA 3SZOA 2ZI4A 2JIRA 3D8RA 1TT7A 1V2GA 3CXUA 4M9UA 4W5JA 3D3NA 2RHCA 2ZYVX 1T8UA 3FTDA 1G64A 4OG2A 5AVZA 1Y3DE 3P2IA 2F59A 2IZZA 1JG3A 4HQLA 1E1QA 1XYYA 2FRVA 1YJXA 3HDYA 1E1CB 3KTFA 1Z5VA 4MLPA 1MRZA 2PXCA 5TMPA 3CLSC 3WQBA 3TJZA 2OM6A 5KYUA 1KARA 2UZAA 4X60A 3TWOA 1HMYA 2QIOA 1OZ0A <