4GNKA

Crystal structure of galphaq in complex with full-length human plcbeta3
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
337
structure length
337
Chain Sequence
ARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gtp-binding protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
total genus 92
structure length 337
sequence length 337
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4gnkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gnkA01
2H16A 1GSIA 2XTMA 3CLVA 4I1VA 5EZ6B 4TMTA 4URUR 2YC2C 1ZIOA 4US2R 1HQYE 3GLIB 4FMCB 1IN7A 2B7BA 4B2IA 721PA 2DR3A 2FH5B 3NEJA 4DSUA 1E1QA 1US8B 1DG3A 3CW2A 3QE0A 3KL4A 1E9BA 2QMUA 1PUIA 3K0AB 1P75A 3K9HA 3PUVA 4LGMA 4TZ0A 2KJQA 2ZE8A 4ZI3A 1S1CA 5FR2A 1G5TA 1E32A 3FE2A 3L8ZA 4C3ZA 5LD2C 2QM7A 2X2EA 1CJMA 3RABA 3OIVA 3TW4A 3R8CA 3KQUA 1VYVA 2RKOA 1KI1A 1RRGA 4V0KA 2QPOA 521PA 1E2KA 3QI2A 2Z43A 4A0HA 2DFLA 1U98A 1G18A 2XNDA 4AG6A 2MSCB 1AN0A 1JR3E 4AWXA 1T5LA 3QKUA 4OQMA 1E9RA 1NVXQ 2BBOA 1DAFA 2QAGC 4HZIA 1EX6A 3G82C 1U90A 2W0MA 3C41J 3U5ZB 1OB5A 4LHWA 3LQRA 5LDDC 4EIWA 3NDPA 1ZUIA 2IA5A 1N6LA 3EG5A 3P4XA 2OZEA 4BUJA 3UG7A 4Z8XA 1MH1A 2HT1A 4C7OB 1D5CA 3LBNA 1RKBA 3VR6A 4URZR 1NVVQ 1KO8A 4RCZA 2O8FA 1F6BA 4NCIA 4LUCA 5P21A 4ASUA 1OYWA 2ZYVX 1RC8A 3FKSA 5A4JA 2FNAA 2CVFA 4F91B 2X19A 2QAGB 2P5TB 1M6NA 2ODWA 3MMPA 4QJ5A 5JRZA 3I8SA 3I73A 4DVGA 4ZKDA 1G5PA 3VR3A 3AF1A 2OBMA 2RGXA 1VPLA 2GCPA 2JJ1A 4Q9IA 2WJVA 2C9OA 3AVOA 2DFKB 1BIFA 2F9MA 3DKVA 4RZXA 2BV3A 4TSFD 4XOIA 3ZS8A 4BFZA 4PPGA 5A5GA 3RS3A 2OM2A 1T8TA 3QIAA 4PC6A 3T15A 2ZR9A 2ZS8A 4JZKA 3WHKA 5KDLA 1NI3A 1N5JA 1R8SA 2C04A 5HKKA 2NPIA 5DISB 1IY1A 4LJ7A 4AKIA 2WSMA 3X2SA 4C7OA 1VG0B 1P9RA 1YHNA 4AD8A 4QGAA 4GPTA 4MGZR 3A8TA 1YR9A 2HEIA 5JZVA 4G0NA 4C2TA 2D7CA 1J8YF 3A1VA 1TEXA 3S1AA 1UBCA 2JJ2A 2NMVA 1IAQA 2ZVPX 1YR8A 4C0KA 3RS5A 4D6PA 3AH8A 2GEVA 1CJTC 4MRNA 5AJZA 1ESMA 1OH7A 4Q4HA 5JHHB 1SVMA 2WWHA 1NLFA 4HB4A 2E1RA 4M21A 1M34E 1W4BA 2R62A 2V6JA 5B2ZA 1KNQA 3T1OA 3C16C 1VTKA 1PLJA 1A82A 1G8PA 2GZHA 1DVRA 3QXXA 2V9PA 5EZ5A 2QROA 1YZLA 1H8HA 3RDPA 2R2AA 3TSZA 4NU0A 4CVNA 2KSQA 1CBUA 3FDIA 4I4LA 1JBKA 1L8QA 4HAZA 1Q20A 3GLFE 1E4VA 2ZI5A 1R8QA 4IHQA 1Z6XA 2NQ2C 3AKEA 2KE5A 3KUCA 1E0AA 4LI0A 2JIZA 3VNVA 4FCTA 2V4ZA 1JJVA 1GRNA 2Z83A 3UATA 2F3RA 1W36C 4TSFA 4QNRA 1KK2A 5H8WA 4QGFA 1G17A 1UKEA 1N0WA 2GJ8A 1ZM2A 3IHLA 4CYMA 2FPMA 3ND8A 1KYIA 2IHYA 1Q1QA 5FTNA 4U5XA 2VRWA 3KQHA 4QHTA 4KBFA 4UJ3A 3WBJA 2O8BA 3IEVA 1XXHA 1M7BA 1SULA 2PCJA 2F3TA 2A5GA 1E4YA 4G5GA 3ZVMA 2QNRA 1RPZA 4MDEA 2X1VA 1MABA 1Q21A 2G6BA 3MJRA 1E9SA 5JEEA 5UKDA 3FHCB 3K9GA 5JJLA 2ODNA 5TXGA 5BN5A 4CEJA 4DLVA 1E2EA 3GPLA 3SJBA 3DMNA 4Q9JA 5FBLB 4ZO4A 1E2QA 2XEXA 1E2LA 1P4SA 1TNDA 4BLSA 4XD7D 4Q18A 3H84A 2CHQA 2IS1A 4TTPA 2FGJA 3AB3A 1UADA 4CIDA 3RHFA 4D4MA 4HAVA 5FTJA 4TYYA 2PZGA 2DY1A 2G3YA 3K1JA 3VHXA 2DB3A 4Q1BA 1VIAA 3NXSA 2B92A 1KMHA 2HXYA 4EFMA 1EFRD 3Q5DA 4TL8A 5HE9A 4EUNA 5ELXA 2QU8A 3P32A 3GLIE 3NC1C 2JJ8A 4NE2A 1G21E 5F98A 4D80A 1T9HA 3HP1A 1SVOA 4OI2A 1E2FA 2NOAA 2QENA 3VTKA 4PZYA 1KDOA 1ZNXA 2C9CA 1U8AA 4C0QC 3C14C 5GJVC 2PT5A 3SBEA 5CK4A 3GEEA 1X8JA 4PSVA 4URWR 4EQ6A 3RYTC 1N5KA 4I81A 4NPHA 4NONA 1AM4D 4C0SA 1FZQA 3FHTA 1GTVA 1OLOA 1XD8A 3EZ7A 5FBRB 1CR1A 2PMKA 1S3SA 1J70A 4CW7A 3AUXA 3ZVLA 1J7KA 2GJSA 1KO7A 4KLZA 1W5TA 5HZKA 2F7SA 3EASA 1TTTA 3LWNA 2V7QD 3THYA 4KFSA 4R98A 3Q72A 1OXXK 5FL7A 1UPTA 4A2PA 3TGPA 2JAQA 1JXMA 4PAQA 3KB2A 2ZSFA 2Q21A 2ORVA 2VO1A 5DHFA 5J4YA 3G5UA 4KLNA 2ZITA 3BFKA 1T3SA 4AKEA 3VKHA 4WAUA 3FHOA 3ADBA 3K9LA 2PEYA 2QMHA 5LB2A 3CX6A 3UMFA 4A8JB 2WIBA 1II8A 4GOXA 5SZJA 2GAOA 2QZ4A 2XAUA 1SXJE 2ORWA 3B60A 4G3XA 2FSHA 2V1UA 1P2TA 2BMFA 4YC7A 1XMVA 2NO7A 1ZNWA 1WQ1R 1N6HA 4PC7A 1PUJA 3R9XA 2WAYA 2Z0MA 1NBMA 5SZHB 1UAAA 4KCGA 2ZI3A 2OE2A 2DWQA 3T12A 2IWRA 1XBTA 2AFIE 3FGNA 2P0EA 5B57C 1UDWA 2OT3B 2L0XA 3F3YA 3DKPA 1K5GA 3B85A 5KDDA 3RVBA 1C4OA 4UNSA 4F92B 5TVKA 1XJQA 3EWAA 4HZUA 5A0FA 2NO6A 4JSTA 4OYHA 1CKEA 3BXZA 4M1WA 3NBYC 1WP9A 2H5EA 2XXAB 3KQLA 2PMDA 3TH5A 3IIMA 3I5YA 3R8FA 2QGNA 5LPNA 1E0KA 2ZRGA 1MT0A 2QE7D 3CUEF 5C2JB 5L3QA 5E3HA 2O8CA 3X1ZA 4QKQA 4WOPA 5M04A 4A0GA 3U3MA 4A9AA 1P3JA 3Q7PA 3QKRA 5CK5A 1GL9B 2AN9A 4OHWA 5FUWA 4LJ9A 1E98A 1NN5A 4Q7LA 4MYHA 1YZUA 5DI3A 3T34A 3PVSA 3SBDA 3JVVA 1DO0A 2XZLA 4Q7MB 4IOLA 3MCAA 4KI0A 4NL4H 4XWAA 1OPXA 4JSYA 4BRUA 2FA9A 2RHDA 1BH2A 2AKYA 3NDBB 3WMGA 2FFAA 1XEFA 2H17A 4RZUA 1E94E 4FMCF 4MYCA 2J9RA 1U9IA 1XTIA 2ZRCA 1A2KC 1IXZA 3QXJA 4M1TA 1PLKA 1Q0UA 4NHOA 4Q7JB 1YVDA 1BYIA 1LY1A 2PX3A 3AUYA 1WDTA 2VYFA 4DIEA 1XZPA 4TQ9A 2J0UA 2IYUA 4M1OA 3TKLA 1HUQA 2D2FA 3I62A 4GP7A 2G77B 1XXHB 1S9HA 1XPUA 1P62B 1ZD1A 1H8HD 2GBLC 1NBME 1HT1E 2EVWX 2QAJA 1ESNA 3PQCA 1CS4C 2PZFA 4B35A 2IYVA 2OCYC 4LRWA 1SXJA 3SNHA 4RFVA 3UMSA 1VHLA 2ZI6A 1COWD 4M8NE 4TMKA 2DYKA 3BB4A 3RRZA 3GLGA 4D25A 2QUZA 2VA8A 1KK3A 3TJZA 2Z4SA 3KXLA 1X1RA 4DLWA 4ZI2A 3L0IB 2PZEA 3LVRE 1VCIA 3SU8A 2QP9X 4B2LA 2PJZA 3IKJA 2ZI7A 1AGRA 3LVQE 3W34A 1LF5A 3UMRA 1HE1C 2WWIA 4LCBA 5TY0A 3SQWA 1TQ4A 4CDGA 4XWOA 3ONWA 1AKYA 5EP2A 4C4PA 4X8LA 5EP3A 3U7GA 3L8YA 4M1SA 4II7A 5GJWC 2FFQA 3K9NA 5BWMA 5EE9A 4NYIR 4IVPA 5EXXA 4GMDA 3KXKA 2VP4A 5FBVB 4GRAA 2ASEA 3U3KA 2W2XA 2IWHA 2VPPA 1GAJA 4GNKA 2A2ZA 4PR0A 3GP8A 3LDAA 2ANCA 3QY0A 4MGIR 4TMVA 2AXPA 3TIFA 4R71A 3KJGA 3WMEA 1ANKA 2HYDA 1QVRA 5AWFC 4MDFA 4DDVA 5L3SB 4EPRA 2QBYA 2OAP1 3KFVA 4EFNA 4TMXA 3DM9B 3BC1A 2A5JA 2HJGA 3TVDA 1Z8FA 4CRWB 4LY6A 2GBLA 1I4LD 5AJXA 5H70A 5FPYA 2Q9CA 4CT4B 4DBLC 3R9WA 4JIMA 1DAMA 3JZAA 4D2IA 1HH4A 2FWRA 1N6NA 4M9ZA 4RFSA 2VF7A 3AVVA 3PUXA 3K0CA 4R9UC 2W6ID 4QRHA 4LJYA 2QEQA 2HF8A 2QQEA 4AKGA 1OSNA 4Q4LA 1Z6AA 3K70B 2BKUA 3H1TA 4WW0A 2CCJA 2ZYTX 2EQBA 2XB4A 4ERNA 2Y8EA 4ZPXA 2BVNA 4E5UA 3V4RA 3QOFA 1Z47A 2FU5C 3F5FA 4HLDA 4IVRA 3KXIA 3B1XA 4E03A 1UEIA 3THWB 4MITA 1ZD9A 2R6CA 3O47A 4ILEA 3X1DA 3D6TB 1VCOA 2IW3A 3CZQA 4DCVA 3LQQA 2ZUCA 2C99A 2CDNA 2GILA 3QKSB 2Z5FA 1AIPA 1Z0JA 5JI2E 1TU4A 1UKYA 1K8RA 4YDSA 4BQSA 2C96A 3GLFA 1NKTA 4P32A 4DSOA 4MKGA 1IY0A 1Q1EA 5G41A 3HR7A 4ARZA 4C0JA 2KWIA 3AVXA 5FBWB 5J40A 1YZNA 3C5HA 3TR0A 3TAUA 1WF3A 1MRSA 2CL0X 3W8NA 1XMIA 2JATA 1NN0A 2OUKA 3K0CC 1QBKC 4JVLA 2XB2A 1ZNZA 4QOSA 2ONKA 2YWHA 5BW8A 3Q3JB 3PENA 2CJWA 4KVGA 4UKDA 4ZCMA 1G4AE 1OH8A 1J8MF 4C30A 4B32A 4TTRA 3SJAA 4DLZA 4PO1A 2P3SA 4OQFA 4B3GA 3PUYA 1Q44A 2IXEA 4CEHA 4URYR 2GXUA 1ZAKA 2GCOB 2JEOA 1TF5A 4FCWA 1NG9A 3PJRA 4LC1A 3ZQ6A 4LZZA 1SKYB 5BQ5A 1Z07A 2VHJA 4PAMA 3I1FA 3P20A 3K8YA 3CX7A 1NN1A 4U7DA 1OFTA 3MRSA 4BZXA 5FOWA 2GVDC 4A4DA 3QBVA 5EP1A 1EXMA 4BFUA 3HU2A 1Q3TA 3I8XA 4IEIA 5BN3A 3AVYA 3FMIA 4XVUA 4TZ6A 1DEKA 4PQRA 4MKIA 2ZJOA 1GNQA 3ADKA 4XTCS 3O8BA 4DLSA 4R2HA 1NN3A 1E6CA 1E9AA 2EFGA 2OCAA 5H1YA 2GXQA 5K8UA 4HZUB 3PEUA 4A0FA 1DBSA 1ZM3A 4A92A 2ZS7A 2BIFA 2QN6A 4AURA 1FW6A 1D6JA 3Q9LA 3UKDA 5JHGB 2Q3MA 3IO3A 2ZRKA 4FIDA 5JBQA 2WIAA 3BAFA 2ZSDA 3U44B 2WVJA 1Z2CA 2PLRA 2FPKA 5DE3A 1KTVA 1P7CA 3DMDA 3UK6A 4B6FA 1CJUC 4JLMA 1JR6A 3HYRA 1G8GA 2BM1A 1US8A 1KNXA 2BBWA 1NJGA 2G0NA 4PHFA 1XFAA 3AV0B 3AF4A 2RB4A 1JPNA 3GEHA 4S35A 2GWHA 4DLUA 2VL7A 3ZS9A 2IS4A 1Z0KA 3X1YA 3LY5A 2WJGA 4Z51A 1RRPA 3NEYA 2A5FA 3BIFA 4B3DA 4FMDB 3RS4A 1P2UA 3O8RA 4QBGB 1U8YA 1QRAA 2ANBA 2OFOA 4XSHA 1GUAA 4POAA 3RS7A 4TMZA 2E9SA 2EYUA 2ATVA 2VIIA 3FKSD 4CEJB 4HYYA 2ZJAA 2ZJ8A 1Z6YA 2OXCA 1KK0A 4RD6A 1TF2A 3LNCA 1CEEA 2D4HA 4Z54A 4Q1FA 4GP6A 3FMFA 3TUJC 2ZUBA 3NC0C 4HUTA 3KUDA 4B71A 3AM1A 4I99A 2J0SA 5B64A 5DGXA 1KSJA 5TARA 3I3SR 3B6EA 4DT1A 4RSGA 3ZZ0A 1XD9A 2WJHA 5IF9A 2O8DB 1F5NA 2ZJBA 2WKRA 3BS4A 2J1LA 1NY5A 2WHXA 5JJIA 1Z0DA 4BFWA 1I2DA 2MMCA 2VSOA 2W0SA 3NBFA 1SVKA 2GK6A 1ZC4A 5K8IA 3T1TA 4OK5A 5K8LA 2VHUA 4O0MA 1HY3A 2WWGA 4C0BA 2VTKA 3KTAB 3U4QA 1TUIA 3W90A 4MGYR 1ZU5A 1KJWA 3THXB 1NJFA 1UKVY 4PFSA 1KHTA 1OKKA 1F3OA 2ZE5A 3A58B 2I1QA 3RS0A 1GP2A 2C9YA 4TL9A 3SOPA 1YRBA 2VSFA 2HJVA 1MO6A 1JAIA 5KSPA 2ZI9A 4W9MC 3OEHA 4Q1AA 5CJ2A 3GJ3A 3EXAA 4TLEA 3K09A 3OAAD 5BXQC 5DN6D 5FUXA 2X8AA 4QM7A 4A0RA 4DEYA 3W6NA 4JMPA 421PA 2OLKA 4A82A 1KY2A 2FV8A 3N2EA 3MWJA 3ICQB 2VQSA 4L9SA 3ICEA 5JJKA 3OE7A 1G5RA 1ZUNB 2FE4A 2CEAA 4AK9A 3A36A 4AIIA 1LFDB 2BDTA 4F4IA 1E2NA 1NVWQ 3B5JA 3FMPB 4NZYA 4P31A 2JA1A 821PA 1W0JD 5CITA 5HKKD 4DZZA 4XVRA 1MABB 1TMKA 2ZR7A 3BH0A 3ZD6A 2CLSA 1Z2AA 2YWGA 4D26A 3VFDA 3VR1A 2ODEA 2DWPA 1G3MA 4JJKA 2JASA 3FYHA 2ZSAA 3HU1A 3Q8XB 1IXRC 3WY9A 4HATA 1F48A 2ZYUX 3THXA 5F9FA 2RGGA 4TYPA 1XEXB 2VP2A 3GLHB 2NZ8A 5L3RA 1YZQA 3L82B 3DM5A 1NP6A 1EFHA 2ERXA 3DL0A 4Q01A 4Q1CA 4FMDF 3NIBA 1W36B 4XSGA 1U9IC 1KI9A 2AHOA 3UG6A 2O0JA 3NG1A 4B43A 1GDDA 1F2UB 4BLTA 4DT1B 3BK7A 5FPTA 1MOZA 3HJNA 3NHAA 5FL7D 2J46A 2J45A 1NRJB 3CF6R 1R2QA 1RZ3A 2DFTA 1R5BA 2V54A 3QEOA 5EXSA 2AL7A 2ZAMA 2XOKA 2RGEA 1KSFX 2ECKA 2D06A 3P4YA 5D3MB 5CB8A 1CIPA 3R9IA 3PG5A 3QVVA 4Q7KA 4DCSA 1HURA 2EYQA 5EUQB 1SXJC 4ZIRB 1OB2A 1ZVQA 2GEUA 5FOTA 3V9PA 2ZS9A 3ETLA 5G53C 3MWKA 2Z4RA 4UXIA 1RJ9A 4XJXA 1PZNA 1FQKA 5IHPA 3AVUA 1PV4A 2RHMA 4M9XA 1T5IA 4TLDA 5JI3E 1N6RA 2VHCA 3U7EB 1CULC 3QKSA 1G8HA 5JRJA 1DADA 5FPHA 2I3BA 1WCV1 5CLQA 3CX8A 5IK2A 1WBDA 3LXXA 4FD2A 3F0TA 1AS0A 4B48A 1S9DA 3WMFA 2QMOA 2YJTD 3IBYA 1Q12A 4PQFA 3VU9A 1XWIA 2NO0A 1M7HA 2IYYA 4US0R 1D9ZA 1T91A 4TT3A 1G3IA 3U6BA 2NO1A 3BJIC 1ONBA 1D9XA 4JVNA 4LV6A 3WHLA 3QQ5A 2BCGY 3WP1B 4DDTA 4HAYA 2PJRA 2IUTA 2ZEJA 3KKPA 1G20E 4JLBA 4KO8A 1N0UA 3M1IA 1TQDA 2G1JA 2QPTA 2ZU6A 4JYCA 4RJLA 5AUOB 5BYKA 2XGJA 4M53A 2CE7A 4PQYA 1CTQA 3SHWA 3BBPA 2GJAA 1QHNA 3THOA 4B33A 4DLXA 4GOKA 1W4AA 2IEZA 3WNCA 4HUQA 4QL3A 3H4MA 3LX5A 1COWA 2CLCX 4Z1MD 1KKMA 1KKLA 2CL7X 3E2IA 1QZXA 2OLJA 1HTWA 4KV9A 1HYQA 3W3ZB 2DHRA 4URVR 4MH0R 5DYIA 3B1VA 4G01B 3QKTA 2IUUA 2XTZA 4DSNA 5LBIA 1YE8A 2ZRMA 1I4DD 3P1JA 4LK2A 1JEDA 2DBYA 2OV2A 2H18A 2R9VA 1XTRA 1M2OB 2ZU0C 3DEFA 1IN5A 5JSZA 2VEDA 3NH9A 1NLYA 2B6HA 4P0TA 5KNBA 2UZ3A 3THWA 2GAAA 2Q9BA 3OIWA 5AUPB 1J2JA 2O8EB 4LPSA 4IKEA 1ZC3A 4QHSA 5B58C 1OXTA 1S0UA 1KSGA 3IGFA 1FOEB 2HLDA 2QL6A 4FINA 4H1UA 5JLJA 1A4RA 1DARA 3QPVA 1GIAA 4GFDA 4JL6A 4KBGA 4YMSA 3RWOA 4NYJR 4BLOA 5JCZA 4Q1DA 3OFND 2H7VA 5C4GB 2CNWD 1W47A 3LLUA 2OBNA 3S1AB 3UXMA 4BWYA 1L4UA 4D0NA 4TL6A 4IFBA 1M1YE 1P9NA 5FR1A 2YWEA 4GBMA 5DH9A 3CRMA 1GL6A 4M9SA 4EPXA 2W6JD 5J47A 5JWRA 2F43B 1W4RA 4L9WA 1IOZA 4NYJQ 3N70A 1BOFA 4ZIRA 1G7RA 1T0HB 5GVSA 2IYTA 2IYLD 1IQPA 4A15A 4HAUA 2QPAA 3EARA 4PXAA 1TPZA 2QGZA 2XOKD 1VMAA 3RRMA 4CZ2A 5KO2A 4B3XA 4TLBA 4N0EA 3BWDD 4LBVA 2G88A 4Q9LA 1TUEA 1G291 3PEVA 4C0LA 4B3FX 1NLZA 1CF4A 4K8OA 2RAPA 3R20A 2BHRA 3B1WA 1E9DA 4KFRA 4K81B 2WMOB 2WJIA 3KQKA 3KKMA 2QAGA 1HV8A 3MLEA 4AYXA 1W5SA 1BYUA 2IYXA 4RZ3A 4HLQB 3DOEA 2HCJB 5DSZA 1ZIPA 3PUZA 3T61A 1IJEA 2QA5A 1R10A 1ZP6A 1SXJB 2IX3A 1EGAA 1NIPA 1D2MA 3EIEA 1DO2A 4BECA 4HDOB 2Q3HA 4IOJA 4PZZA 3LH5A 1KJZA 3IPYA 2J59A 5C4MA 5K8TA 1P5ZB 4PO9A 3CZPA 4GI7A 1Z22A 5CIQA 1SQ5A 3PEYA 3C15C 3BORA 2IS2A 1S4QA 2Z6VA 3CNNA 3ASYA 3NBZC 2QTFA 2P65A 3B1ZA 4DWJA 1N5LA 5CYPA 2WWFA 2CVHA 2QBYB 1DTSA 2IXGA 3SEAA 5L3SA 5DHAA 4TYWA 1YU9A 3BH7A 2KI5A 4PX9A 3QF4A 1UEJA 2BOVA 2WSSD 2JLQA 5C18A 3LRPA 5GJCA 4CGZA 4A1FA 3HU3A 4LOAA 1ZCBA 3RS2A 3DPUA 4B73A 1UFQA 3I61A 2AXNA 2JDID 2ZJ2A 2O8EA 4F4CA 4O2RA 1E2IA 3IUYA 3D31A 1E9FA 2J0VA 3IQXA 5HCIA 5KTYA 2I4IA 3B8HA 2JDIA 5F9HA 1R0ZA 2IF0A 1VG9B 4MRVA 3CRW1 4OJKA 3AF0A 1OF1A 3BH6A 3WBKA 2QI9C 2LKDA 1II9A 2FFBA 2VF8A 3AKCA 2WSSA 4LJ6A 1W1WA 4PPFA 5FPKA 2A9KA 3QG5A 4FWTA 1CU1A 4MRRA 3EWSA 1CRQA 2BKEA 1RJ9B 4QFMA 3WNDA 4LJ8A 1G8FA 4Y0AA 1U0JA 2ZRIA 2HXSA 3EPJA 3BFXA 1I4TD 3A1SA 3FOZA 3RRYA 4NYMQ 5EJEA 1HA3A 1IN6A 3LO5A 2F1JA 5DI3B 3A1UA 5D3QA 3PIRA 3CPHA 3QXCA 2X2FA 3AP3A 4YQFA 2WPDA 5AJYA 5CM9C 4LJAA 4B74A 3PR1A 1SXJD 1XCMA 2RGCA 3QSYA 2NPFA 4HDQB 1OW3B 3AVQA 2IYZA 4EJSB 4G5RA 5EP4A 1CRPA 1KI2A 2RGDA 3MG9A 5FL3A 1H65A 3EPKA 1QHXA 2W2TA 5G3YA 3T5DA 4HLUA 1Z6GA 5ANRB 3RC3A 4JLPA 2EU8A 3TQCA 3Q7QA 1SKQA 2V55B 5JECA 2GESA 3D7MA 2GEDA 1XEWX 5G3ZA 1LB1B 1FNNA 1RE0A 2QSZA 2WPDD 2WAXA 4OHVA 4V0OA 1P6XA 5JS8A 5KYKA 4YXWD 3QJYA 4Q9KA 3AVTA 4BZQA 3FPAA 2MSEB 3AKDA 5KSOA 4W5HA 4CEHB 4DUGA 4TWZA 1P73A 4BPBA 4U00A 5AJVB 4H1VA 4XWKA 3QKRB 4OI0A 4C0HA 3MD0A 5FOXA 1EFUA 4E07A 4Q9HA 2JLZA 3K09C 1GM5A 1PLLA 3EA0A 1WE2A 2FJUA 4C9BA 2FG5A 2GZDA 3LBIA 4DLRA 2EWVA 2ZPTX 1XD2B 1KIMA 2WKPA 2ZJ5A 3B82A 4LHXA 5B30A 1OFHA 3GJ8A 3O8CA 3KB1A 3QF4B 5AUNB 2XXAA 2GK7A 2CHGA 2CNWA 3SYLA 1QDEA 2QE7A 4D81A 2XTNA 4KITB 1M74A 2PCLA 4TYQA 1JAHA 3FFAA 4B34A 4DC9A 5JMTA 3WNBA 4UNNA 4DDUA 1XCPA 3WXMA 3TMKA 2VBCA 4GDFA 1JI0A 2O0HA 4US1R 2B8WA 3FKQA 3UPUA 4QG7A 3OEEA 2DFNA 3UWOA 3B7GA 2GDJA 3U7FB 3TQFA 1B0UA 3HPRA 1FP7A 1KZGB 3KFXA 4G5OA 2MMGA 4RKEA 4BASA 4TQAA 3CRVA 3U4QB 4YMUA 4B3CA 2A30A 4OHYA 2PEZA 2V6IA 2HDNB 3CIOA 1PVOA 4PANA 4URXR 5FH9A 1X3SA 2VHQA 5EE3A 1SKYE 3A4NA 1VCMA 2A5YB 3CPEA 1DS6A 2IC5A 1S2MA 3KJEA 4OK3A 1NBMD 2W58A 1LF0A 2YVUA 3KJHA 2Q3FA 5KUTA 1XEXA 2ORIA 3G0HA 4RD1A 2PLFA 1XTJA 1KY3A 3QG1A 2NG1A 1W36D 1ETUA 4DJTA 2GETA 4JL8A 1WMSA 3L0PA 4RY2A 4IDNA 1G7CA 1T6NA 2DCUA 4M1MA 5J4LA 2MSDB 5HR5A 3SJZA 2C03A 2DPXA 2ZE6A 3RANA 2Q9AA 3QF7A 4QC2A 3ZVNA 1YZTA 5F3WB 3CH5A 1EFCA 3BRWD 2N46A 3VX4A 5KU1A 3EC2A 3R7WB 2BEJA 2QT0A 3LV8A 4Q4HB 6Q21A 3PXGA 1SZPA 4B2PA 2CCKA 1M8PA 2AWNA 3ASZA 1UJ2A 1R0WA 3GMTA 1U99A 4IDPA 4LYAA 3U2QA 3OEED 3REGA 2ZXUA 1GL7A 1KAGA 2QQ0A 4PPNA 2B8TA 4NYIQ 1JNYA 3IEUA 3OE7D 4LWZA 4Q21A 1FPMA 2OILA 2IT1A 1IBRA 1NIJA 2W6JA 3WYFA 4UNRA 1E9EA 1N2CE 3FMOB 2J0QA 3B13B 2XZOA 1JEEA 1QG4A 4ZDJA 4DDWA 1JPJA 4RCYA 4B76A 1EK0A 2FZLA 3KKQA 4JBWA 4I1OA 4LV5B 4EPYA 3OEHD 3GJ0A 1N6KA 4NYMR 5FTMA 2XNDD 3C5CA 2IXFA 3L0SA 3SHFA 1VECA 2OBLA 3EA5A 3NWJA 3KQNA 4PHTA 2PT7A 4MUBA 2ZVQX 3RRNA 1XB2A 2W2VA 2ZSEA 2D62A 1VIYA 1EFRA 5HE8A 5BYJA 1M7GA 4JLVA 1S1MA 1DAKA 3I92A 2O8DA 3CRQA 4EAQA 1YQTA 4BE7B 1FTSA 2EFHB 3TVTA 2C8VA 1TEVA 3HPQA 2EFDB 3ZZUA 4JT4A 2WTUA 3TUZC 2CE2X 2GJ9A 4OQNA 2QRZA 4OQXA 1OXSC 5CIWA 4OL0A 4V02A 1U8ZA 1NSTA 3DOFA 4IOKA 4O2LA 5FI0B 4LHZA 3SR0A 1DAEA 2HT6A 1P72A 1OFIA 1EWQA 3GCGA 1Z6TA 2CBZA 2RGAA 1TQ6A 4I1SA 1ZRHA 4XH9B 1ZD8A 5JWHA 1E79D 4JLKA 5HPYB 1XTSA 3TSOA 1QHIA 1F2TB 3IPXA 2GF0A 1GKYA 4ESHA 2F43A 2GCOA 1V43A 3GD7A 2EFEB 3CF0A 1RFLA 2ZE7A 1P60A 4PC3A 3BB1A 4Z8YA 1G7SA 5FBQB 2CK3A 4HB2A 1QHHB 1VG8A 3EZFA 4HSEA 1KJYA 1YZGA 3VR5A 1NL3A 2WJYA 1GZSA 3TNFA 1SGWA 2VP0A 3Q5EA 4LC0A 1FUUA 5C1BA 4EPVA 4LYJA 1JQJC 4AI6A 5FOUA 3E70C 3QXSA 4V0MA 4FI3C 2QP4A 3HR8A 2FEMA 4DLYA 2O8FB 3W5IA 1KO1A 1OIXA 4P4TA 3TRFA 3UWKA 2C5LA 1CR0A 4P4SA 1ZBDA 5CB6A 2IYWA 2CLDX 4QGHA 4E22A 2JLXA 3AVPA 2DWOA 2GA8A 1W46A 3NTUA 4BLPA 4TMWA 2C95A 5CDFA 3GJ5A 3HYTA 2BCJQ 4EFLA 3GLIA 1XRJA 2IYRA 2QY9A 2CXXA 4B47A 3L43A 2GVZC 4IVQA 4GZLA 1XDBA 4DEXA 5AK0A 2OFWA 5EE5B 4DXAA 5CM8B 1VG1A 2Q6TA 2OEPA 5AUQA 4JKYA 3VKWA 4MA4A 3RSOA 3U3JA 2YYZA 3IDQA 1V5WA 1ZJ6A 2CL6X 2FMXA 2AFHE 2FDCA 3CNLA 3EPLA 2JLVA 2A7QA 5IT5A 4QJ3A 1DPFA 3B78A 5EE0A 3OESA 1KSHA 2ZSBA 4D4JA 3C7KA 2X77A 1E69A 3ZIAA 1KMQA 5JFGA 2F1RA 1NF3A 1ZW6A 5JCPA 3KKNA 4NH0A 3RWMB 4PSAA 1Y63A 5KNDA 1FX0B 5J4VA 4M1KA 3NH6A 2C77A 4MYUA 1E2HA 2ZRAA 1FFHA 4M9QA 4X8HA 4F93B 2NO9A 5HTKA 3AVWA 1LS6A 3HDTA 4YDHB 2JJ1D 2ZROA 1H8ED 4RZ2A 1J99A 3ZH9B 1CJVC 4LBWA 3D3QA 4I1UA 4F4JA 1VCNA 3CF2A 1E2JA 1KDPA 3PITA 3LD9A 1IHUA 3K0AA 2VH5R 3GJ6A 2OESA 1UBEA 2Q0HA 3QPWA 3BERA 1QHYA 3T1VA 1DAHA 4FMBB 2FZ4A 1JR3A 1XTQA 2QRNA 4HUQB 3JZMA 1ZYUA 4ARZB 2RH5A 1CXZA 4DRZA 4NCNA 1T4GA 2BWJA 1W2GA 5C46F 1G64A 1D2NA 2BM0A 4QBIA 2OXRA 2H8KA 2GTPA 1YR7A 2VLIA 4YMWA 3T35A 2XJ4A 1EESA 1P2SA 2RCNA 2JLRA 3P27A 3CONA 2O52A 1OH5A 1AK2A 1SHKA 5HZHA 1S96A 1XJCA 2BJVA 1G7TA 3K0FB 1X8LA 2ZQ5A 4H9GA 5D3MA 2YWFA 1JQLB 1ZNYA 2UKDA 2EFCB 2OG2A 3CM0A 3LAWA 4N1AA 2ZAOA 5E7MA 5DO9A 2F1HA 1QHSA 2UZIR 4QNMA 5SZKB 1WRBA 1XU4A 1XPRA 1S3GA 2OFXA 2GHIA 1XZQA 2R6GA 3LW8A 4CT5A 1JJ7A 1XXHE 4M22A 4WVFA 1E1RD 1GKIA 4NDZA 1B23P 3ZD7A 1F2UA 2UVQA 5KHOC 1H8EA 5AJWA 4EDHA 1E0SA 1N6PA 4KU4A 4RVCA 4W7SA 4IEEA 1FL9A 4RKFA 2ZRDA 1E79A 3AKYA 4KSBA 5F2EA 2JLSA 3H2YA 1YR6A 1Z0FA 1S8FA 2E87A 2SHKA 4Q03A 1D8TA 4V0ME 4LBZA 4MYTA 4OK6A 1G9XA 4BGDA 4QBFA 4ABYA 1W4CA 1XMSA 5FPSA 4XVQA 2XITA 2N42A 4OJQA 5TDHA 1NKSA 1G41A 1P9WA 1W2HA 2NIPA 3E1SA 2IHBA 4KJZA 3WYAA 2C78A 1IY2A 2REBA 1NY6A 1SVIA 1KGDA 3IHWA 3THYB 1GWNA 1CJKC 4DB2A 4LJ5A 3FB4A 4WIAA 2RGNC 2W00A 4GSYA 1R5OA 2RGBA 2K5UA 4IRUB 4BEJA 4D0GA 2BBSA 3TW8B 3IQWA 1FNMA 3GLGE 1G16A 4QHYA 4AKHA 1C9KA 1OFUX 1X6VA 2P2LA 4HDCA 2WOJA 1AKEA 3AGQA 3GLHA 2R6FA 1NVVR 4LSGA 3OZXA 4KFTA 1GNRA 3EIQA 1UKZA 1JXOA 1W0JA 3CRRA 3D8BA 1R5NA 5J4KA 3GFPA 5CJPA 4GZMA 1QG2A 8OHMA 3DVLA 1E2PA 3CWZA 3M4YA 3AF3A 4RD2A 4XTRA 2AD1A 3SI7A 3JVUA 4X8OA 2NZJA 3A6PC 4YLGA 2WWWA 3UIEA 3K0FA 1ZM7A 3GLGB 1X1SA 2WKQA 3K70C 1L4YA 4DHEA 1KK1A 4YXWA 3OHMA 1E2GA 1R0YA 3OF5A 3VR4A 5DI9A 2C2HA 2AK2A 4JLJA 3ZZTA 4KAXA 1VHTA 3U7HB 1Z0IA 1KI4A 2PL3A 3QUSA 221PA 4JYBA 3K0SA 1Z3IX 1HEIA 4D82A 3ZDQA 1KI3A 4WXPA 1GNPA 3K53A 5DLQC 4M1YA 4OQLA 5GADl 2QM8A 2J0UB 2CCGA 3W9YA 1TADA 3A37A 4V0NA 1CR4A 4GMXA 1G4UR 5AR1A 3IIKA 4D4LA 4ZDKA 3N2IA 2AWOA 1NMXA 3NKVA 3MAAC 4C0AC 2WWYA 1UF9A 1OIWA 4DKXA 2ERYA 5KPJA 3KTAA 4IOMA 3ZYCA 4OI1A 5KDOA 3KJIA 4HLCA 1RIFA 4A8JC 3CH4B 3CB4A 2J3EA 2BEKA 3NHBA 4LX0A 1L2TA 4KYUA 2LCFA 1DG1G 2ZTSA 2CJWB 2F9LA 2H57A 1G3UA 2EW1A 2P5SA 3PV0A 4LV8B 4ON9A 3B9QA 1KZ7B 3QENA 3VAAA 4EJSA 2JLWA 3RAPR 4PHHA 2D74A 2A5DA 4Q4JB 4DB4A 1E2DA 1KO5A 1RYFA 2GJKA 2J7KA 4MQBA 1WXQA 3U44A 5CDFE 4TLCA 5HCNA 4PAOA 1CLUA 4HEJA 4KHZA 3LFUA 3ZJYA 1HT2E 4Q48A 4PPQA 2HCBA 4KSCA 4FWIB 1Z63A 1U0HC 2XNSA 3OFNA 4PSKA 4LHYA 4M0LA 4OHXA 2ZANA 621PA 2ZRBA 1ZUHA 1II0A 4YMVA 2ZJZA 2FOLA 3GLFB 2C98A 4B3BA 5FI1B 5FUYA 4LHVA 4Y0VA 2D2EA 4JBYA 2YOHA 4NCKA 4O3MA 1G6OA 1LS1A 1XP8A 1MR3F 2WV9A 2ZRLA 4MKFA 4P4SB 4F38A 1GILA 1LTQA 4AG5A 5DN6A 4TN1A 3V4FA 2HF9A 5H68A 1R7RA 1X86B 3IIJA 3LLMA 3QNUA 5GVRA 3VHLB 4BLRA 4OI4A 2WICA 3SFVA 2QTVB 4HB3A 3MJHA 4L4UA 4QM6A 4XIGS 4ZKEA 4NCJA 1Y3AA 4A8JA 3AP2A 1HE8B 1XF9A 4FW9A 1T8UA 1OXVA 5FFMA 1OT3A 4QBHA 2WOOA 1JB1A 2XZPA 5CLLA 3RLFA 3GFTA 3LXRA 4E09A 3DO6A 4Z1MA 1GG2A 1QHHA 1RYHA 2AKAB 1SVSA 3H86A 4JL5A 1TL7C 4A6XA 4WZAE 4AYTA 1XEWY 2YHSA 4NKRA 4EPWA 2R6AA 3GJ7A 2IS6A 4RFSB 2ZRPA 4BFYA 1KI8A 1CP2A 1NG1A 4Q4AA 2QT1A 5KPDA 3CWQA 4ASUD 4D0LB 1NMZA 5J5CA 5KSZA 5FOSA 4O25A 3BE4A 1R0XA 3EZ2A 2F55A 4KYIB 4HLUC 5TB5A 1J90A 4BLQA 1XMJA 1ZU4A 2YOGA 4Q66C 4BEBA 1OJLA 2IYQA 1DOAA 2QSYA 1W0KD 4EQ6B 2GXSA 3BGWA 4BFVA 2PBRA 1AZTA 2JLYA 4K46A 1Q57A 2QP3A 5JS7A 2BC9A 5DIFA 1P61B 4F7WA 4PTLA 3AF2A 1FMJA 4DSTA 1MO4A 4Q19A 5EXTA 1A5TA 1EWRA 1BMFD 3WP0A 1Z0AA 1VDZA 4WXRA 2GCNA 1G1MA 1R4AA 5DNYB 1OV4A 5JEDA 4JLDA 4IFEA 3KX2A 2AR7A 4JLAA 1AS2A 1GFIA 2VP6A 1OYYA 2A78A 3PUWA 3VQTA 4Q02A 1W7AA 2HV8A 3TUIC 4UXHA 1TF7A 1BKDR 1WB9A 4ZCIA 2J41A 2ZRHA 2G0TA 4NCHA 2ZI4A 2P6NA 3ND9A 4IW3B 1W0KA 1Z29A 3KDSE 3UANA 4FCVA 1LW7A 2R8RA 1E1QD 3B9PA 2WM9B 3A1WA 3EAQA 2N1BA 1A7JA 1MO5A 1KI6A 121PA 1IJFA 2ZM5A 3EW9A 3KZ1E 3CO5A 4UQOA 2GNOA 4WZBE 3SJCA 2WJJA 3BFVA 1KO4A 2R6DA 4NP6A 3WYGA 3DZDA 4G5SA 3NBXX 4JKIA 1XCGB 2BBTA 2F6RA 5EXPA 3O8DA 3U61B 3I4LA 4MRPA 1XJ0A 4G1UC 1E9CA 3SYNA 4ACAA 1MO3A 4A2WA 1ZM9A 4R2IA 1KI6B 3DDCA 1QF9A 4HB0A 4P4UA 4PC1A 4ZDWA 1E96A 2V1XA 3L2OB 3I72A 3W8RA 4DCUA 1O87A 4WBSA 4PZLA 2B7CA 4RD4A 3TLXA 2LWIA 2PX0A 1XX6A 3K0EA 2FSGA 2J7PA 3LA6A 2I1VB 3VKGA 1OHHD 3REFA 4PC2A 3B2EA 1U2RA 2J7PD 2P6UA 1NSFA 3EZ9A 3TBKA 2BMEA 1YJ5A 2CHVA 4M2LA 1PJRA 2FF7A 5SZIA 1IONA 5KSYA 1GVNB 3QEJA 4TT3D 4ACBA 3PFIA 4EKDA 1IN8A 1U94A 3H0KA 1MV5A 4P3YA 1A2BA 2J5XA 3Q85A 1X8KA 2WMNB 4C2UA 5GJBA 2ZRNA 1ELOA 4KFUA 3AEZA 2V3CC 1I2MA 3WRYC 1AQUA 3U60B 3C4JA 3A4MA 3SC3A 3TSWA 4DCNA 5L3QB 3AQ4A 4MGKR 1E3MA 2R65A 2BMDA 2GZAA 2HLDD 1Z06A 3F8TA 2GRJA 1UM8A 4UNPA 1KOFA 3X1XA 1QHGA 4OKSA 2ZIAA 2ZRFA 5TV2A 1OKKD 4IDOA 2A3RA 3GEIA 5E7JA 4QJ4A 1LNZA 1GRRA 3SE0A 4A36A 3AGPA 4IDQA 2QTHA 1MRNA 4IXMA 4OHZA 5J4HA 5E95A 2VP9A 3R7WA 4L8GA 1BS1A 2KBEA 4JT2A 4PHGA 1TQ2A 1GRQA 4Q4JA 1AGPA 4NBSA 5EUMA 2NTYC 5EE1A 1IN4A 1BO6A 2VSXA 3MUFA 4RD3A 4U02A 2ZREA 1DE0A 2ATXA 3I32A 1XPOA 1OIVA 4HAWA 2YINC 3QXHA 2ZYWX 1N0VC 1OE0A 3A4LA 2FFHA 4JVSB 5L8VA 1FTNA 3W6PA 2CK3D 2IUSA 3AP1A 4XD7A 1Z5ZA 2JLUA 1O3YA 1RRFA 1II8B 2FGKA 5L3VA 4CF7A 1TU3A 3I5XA 1ZINA 3SFZA 5JWOA 3RC8A 1YRAA 3MSXA 5EQTA 1EX7A 1F2TA 1XNJA 2ZETA 2J87A 4Q5IA 3ZVRA 3GJ4A 3EIHA 2QMEA 4WA7A 4W5JA 1U81A 3EPHA 1Q1ZA 2R44A 3RSLA 4Q4AB 3GLHE 5KOYA 2O8CB 1F60A 4X8MA 1Q22A 2XJ9A 4G5QA 1R6BX 2IF2A 2LKCA 2ZUDA 3E5HA 3CNOA 4NMMA 2NGRA 4B44A 1NVUQ 4JLNA 1EG7A 1JALA 2XSZD 3IO5A 4DIDA 3MGCA 1GITA 1NNEA 1K6MA 4FXPA 2V7QA 1N6IA 2FEOA 4LYFA 4L16A 1UBFA 3TR5A 2V8OA 1XD2A 3MFYA 1ODFA 2G1KA 1JECA 2JGNA 3CBQA 4V0LA 5LB4A 1AS3A 3IILA 4KODA 2P67A 5E7IA 4WZ6A 4P33A 1K5DA 3K70D 4TQUS 3VU9B 1BMFA 3P26A 4B75A 4AYWA 4D4KA 3DHWC 3OAAA 4LPKA 3PEWA 3WRXC 3OIUA 2F1IA 3CR7A 3M6AA 4QGGA 3W5JA 1L7VC 1FQJA 3X1WA 1ZCAA 1KAOA 4BFSA 2ZRJA 4JS0A 3NVAA 5E4FA 4HI0E 1VKJA 1FP6A 4Q00A 2OHFA 2YZ2A 4JJZA 4Q47A 3LBHA 1RVDA 1SHZA 1FMLA 2WWXA 1LV7A 3ZLJA 2JJ2D 1P2VA 2IL1A 3T1QA 2G83A 1QVAA 4GL2A 2IEYA 3HWSA 3SN6A 2YC4C 4JVMA 2OSBA 3VNUA 3SYKA 2XSZA 1TAGA 3TK1A 2JCSA 4BZPA 3DZ8A 1AJEA 1A1VA 4AY2A 4JBXA 1OXUA 1CR2A 2GF9A 1KI7A 3ADDA 3V00A 1GKUB 1HQCA 1VYUA 4HAXA 4BFTA 4KXFB 4MUAA 1G3RA 3TE6A 2IBMA 1IXSB 4Q1EA 1JR3D 1FUKA 3LX8A 1Z08A 3OIYA 4JLOA 1DAGA 4M4SA 4NTZA 4AC9A 1KDTA 5FTLA 4V03A 2RMKA 4J0QA 1LVGA 4TTQA 2G9NA 4N3NA 1E1RA 4FN5A 3U3OA 4CEIA 2XX3A 3SZRA 2YOFA 3EC1A 2P6RA 1YKSA 2FSIA 4IXNA 3ZQJA 4TYNA 3ADCA 4PO8A 3SDZA 2REXB 2FPLA 2WBLC 3A1TA 4OBEA 1W49A 3N5CA 1N3BA 4EJSC 4ESVA 1ZMXA 1Z28A 2ZR0A 3GJXC 1WA5A 3T06B 3W6OA 2EWWA 1AQYA 1VYTA 2QG6A 3W3AA 4A2QA 3C8UA 2OAQ1 2QORA 5LD2B 3T5GA 2YV5A 4QXAA 4RD0A 1G19A 5TMPA 1ZM4A 2CMKA 3CPJB 4B6EA 4A6PA 2H92A 2YKGA 3SQXA 3FWYA 3L0OA 1UBGA 5IK2D 4TLAA 1G3QA 2ZJYA 1E0JA 2REOA 4YONB 1G6HA 2IYSA 1T3HA 5BN4A 1YZKA 1OH6A 4KVAA 3MWLA 2D7DA 4LDJA 4BFXA 2D3WA 2OCPA 5FTKA 3GFOA 4R7ZA 2H1LA 4ZDIA 5FUVA 1N25A 1Q1BA 1G8YA 2GXAA 2KB0A 3J81k 4MKHA 1AZSC 4UNQA 3U3RA 4L5BA 2AK3A 5G40A 2KBFA 4W5WA 2BJWA 3M0EA 2YNMA 4ITRC 3U6KA 1SVLA 4IJMA 4TL7A 4DUGD 2GKSA 1T0JB 3KKOA 1C1YA 4BRWA 2W83A 3FFBA 4DCTA 3CKLA 3VX3A 3QPUA 1Q3HA 2OCBA 4IDHA 1MKYA 1XTKA 2OO7A 1RRCA 2FN4A 4ZV4A 3QVUA 2O0KA 2FX3A 1KDRA 1UDXA 1KMHB 1GOTA 2IK8A 1W44A 1U0LA 2VP5A 3IBGA 4GT1A 1T3LA 4MRSA 5JSZB 4YMTA 5IRCD 3CR8A 2HYIC 4CEIB 2W6IA 3ZGXA 1E99A 2AX4A 4UXJA 5FOVA 3ZIAD 1FX0A 1N6OA 1OHHA 1TX4B 2BMJA 5CYOA 4LYHA 3B1YA 2FSFA 1DAIA 4DLTA 1N5IA 5KNCA 2TMKA 3ECCA 3LW7A 1RW4A 2HUPA 4LJ4A 2ONJA 3EX7C 2WZQA 3TAHA 2PH1A 4L15A 3VMFA 1Z83A 2ODBA 5DYGA 2O5VA 3GQBA 4ZCLA 3EZ6A 1SVWA 3BB3A 1EFTA 1D2EA 3MWYW 3QBTA 4EPTA 1WBBA 3FTQA 4GOJA 3PCRB 3RNLA 4UJ5A 4N0DA 1E2MA 1W48A 3VR2A 2RGNA 2O8BB 3BOSA 5IDVA 3BD9A 1AA9A 3FVQA 2VHTA 4S2EA 1DELA 2B21A 2AD5A 4LBYA 1NMYA 3SS8A 2JIZD 1IM2A
chains in the Genus database with same CATH superfamily
3FH0A 4NFYA 2EG9A 2PKCA 3NT2A 4UEWA 4WKOA 5FDFA 3LK7A 3CLVA 4O6VA 4UHCA 4YUVA 2W11A 3BWBA 3EFOB 3KVVA 3S2GA 1IN7A 3D3JA 1QCZA 4PZ0A 3QI7A 3PJFA 2X2OA 4QO7A 4DSUA 1E1QA 1WHSB 5JYBA 3QYFA 1VHWA 3HDHA 1S6YA 1E5QA 2QMUA 1NF9A 2C9MA 3PUVA 2IV2X 4NQRA 2QW1A 1W29A 2KJQA 1JT2A 2P62A 3I9V1 4I6GA 5FR2A 4ZI3A 1G5TA 3C97A 2ENUA 3L8ZA 3BJMA 2Y0CA 1YU6A 2Y4NA 3IELA 3N8IA 1CJMA 5E0OA 2A33A 3RABA 3TW4A 1PNOA 4AQDA 2YY6A 4ZRDA 4V0KA 1KI1A 1M5TA 5G0UA 4IJKA 3HK2A 4E31A 1ONOA 3KELA 3WADA 2UXCB 1MGOA 1LBTA 2FB9A 2FUG6 3RU9A 1NZFA 3EK2A 3ZUGA 3PQ6A 3GX1A 4XASA 2IEIA 2MSCB 3ANNA 2XODA 1E7YA 1T8WA 1ZJ4A 3K6KA 1XZCA 1Q0HA 4P93A 1TGVA 3MLBA 1NVXQ 2BBOA 4MUJA 4WZAA 1E7SA 1RWPA 3EXEA 1C0IA 1U5BB 1EX6A 2QAGC 4HZIA 4KK3A 5GINE 2HB6A 2RHLA 3JD2A 3W5AA 3PXDA 1MD9A 1NXQA 1FP1D 5B1YA 1CCWA 1YDFA 1WNTA 4EIWA 5BNIA 6ABPA 1ZUIA 1U31A 1N6LA 4A6DA 4BFCA 2OZEA 2XWJI 4BUJA 5JY1A 3IUNA 1E1YA 1XNGA 2B5OA 3LBNA 1RKBA 3OUUA 4URZR 4V1CB 3C1AA 2YFHA 4IIEA 5FI5A 3N7AA 3NATA 2O8FA 3OJEA 5BW5A 4LUCA 4CM9D 1P2FA 2P75A 2VYCA 3FKSA 5HVNA 1AMNA 1GYRA 1M6NA 2P5TB 1CQIB 1PDWA 4ECEA 4D02A 1VJ0A 2JFQA 1K4MA 3F6SA 2HHAA 3I2YX 3I73A 3OU2A 4QTUB 1A88A 4QVKA 4YRRA 2EEZA 2H1RA 1CETA 3RARA 4DC1A 4DVGA 1G5PA 1EXDA 1G8JA 3UF0A 2OBMA 3H83A 4WZBA 1H9CA 3KZVA 5ECYA 4Q9IA 1Y4AE 2C9OA 4JH0A 3IQHX 2OV6A 1RPTA 3DKVA 2E5WA 1XOIA 1OWPA 1JLMA 3HYNA 2XNJA 3KBBA 1CQIA 4L50A 1ZGHA 2VZLA 1A5AB 1TW3A 3JPWA 5AI0A 4I4TB 2ZSJA 3SNKA 4EI8A 2G71A 3ZD9A 4EENA 3E5MA 1N5JA 1R8SA 1AUXA 4H1TA 1BVYF 1CJCA 2NPIA 4NV0A 2XIQA 5FA8A 4CMKA 4W5QA 1ENOA 1GPWB 1RKVA 2OD7A 3IH5A 1L7PA 2DPYA 3CWCA 5EKTA 1VG0B 5HJ5A 4O0LA 4BP8A 1YHNA 4AD8A 5FF9A 1PG5A 3L40A 3QVMA 4MGZR 1FS5A 1PCXA 3A8TA 5CEFA 3AVYA 4MVJA 1JAZA 1VJ5A 1NVEA 3MTEA 1SRRA 2EF0A 1IAQA 3V42A 4I9GA 1TIBA 2AQHA 5F5NA 3BA6A 2Y1KA 1TCAA 1X1DA 4Q82A 3NOQA 4PLTA 4MRNA 1W0CA 2G80A 4GP9A 4Q15A 3DWGA 4Q4HA 5JHHB 2JBAB 3MT0A 2OGWA 1Z0SA 4X1KB 4JB8A 1DPGA 2GSDA 4M21A 4CCSA 2C4WA 4ZVMA 2R62A 2V6JA 3STVA 2PZAA 4D74A 3PU6A 3NWBA 5DU2A 2DWUA 2IYPA 1R8XA 2J5RA 3GMIA 4RY8A 1RP7A 2GZHA 2Q7XA 1USIA 3FNBA 1JB9A 1HL3A 1NTRA 2JFWA 3TSZA 4NU0A 4B3HA 2KSQA 1SKAA 4CIVA 2LVBA 2HPAA 1CQXA 4CGYA 3GLFE 1L8QA 1FDRA 1Q20A 2Z8YM 4HAZA 1DUVG 2NQ2C 2P8JA 1R16A 1H93A 4M9UA 4Y30A 4LI0A 3L1KA 1EPUA 4FCTA 4Y2YA 2PANA 4RS4A 5DCLA 1XROA 4LGVA 2BF4A 2AYYA 1RTTA 4QGFA 3BZUA 3SQMA 2Y3IA 3GUVA 1NLUA 1YKFA 3QQPA 1F4PA 4MEAA 3LY7A 3K8ZA 3BXPA 3ND8A 3SD7A 1KYIA 1L7DA 3FPFA 3G9ZA 4WLOA 5IYZF 3S4YA 3PQ5A 1QS0B 1T2CA 2VRWA 3DV0B 4RZQA 2H59A 4KBFA 4U5XA 4ZYYA 5H81A 3NFRA 1JR2A 3AEKB 3ONVA 1KYVA 2HBQA 3WBBA 4IO1A 4XB6B 4BP3A 4IWXA 4LYGA 1E4YA 2WE8A 4PEVA 5BY2A 1JHVA 4BBZA 4X3OA 4DXDA 1MABA 3KTOA 5HZMA 1KQPA 1E9SA 5CVJA 4YRBA 5KTMA 5MN6A 3UAYA 3NVKI 1YRYE 1VMIA 4MVXA 3E0XA 2J85A 3FHCB 4WK0B 4P1ZA 2ODNA 4I5FA 3Q1LA 5HKOA 2BELA 3PWZA 1DTEA 3DMNA 4R2WA 1GPH1 4Q9JA 3E15A 1L5SA 5GTDA 4ZO4A 3V4SA 1E2LA 3A4TA 1MNQA 4GPZA 4XD7D 4BCCA 3OPYB 4CNQA 1J07A 3QEKA 3KAQA 4WLNA 5CT4A 3STUA 1I01A 1UPCA 3H5IA 4FIZA 4BKUA 4TTPA 2VI5A 4IHAA 2DGDA 4R0NA 3VR4D 3RHFA 3AF6A 1N2IA 4MUXA 1QE3A 4O4IB 4Q1BA 3ABQB 3CQ9A 2CBGA 3D64A 3NXSA 1KMHA 3VR0A 4P0PB 3DTVD 4X71A 3ZE9A 2HQRA 2P11A 4EUNA 3ABZA 5FUMA 1RQ2A 2QOEA 2AMVA 1WLSA 1Z25A 3P32A 4N8EA 2JJ8A 4EUHA 2X0FA 2HWUA 4IHJA 2VAWA 3NHJA 4JGBA 4MDYA 4CM4A 1T9HA 4C7JA 4ZAFA 1SVOA 1E4OA 4Q34A 2NOAA 3WTBA 2AJCA 4PZYA 2NUTB 1U8AA 2HMTA 3A9UA 3WGNA 3C14C 1BG6A 2MYPA 2ZBGA 2R79A 3G2LA 3GEEA 4PSVA 4URWR 1M83A 1MC8A 1B0ZA 2BHTA 1N5KA 2FKAA 3HDVA 3RYTC 4EQ6A 5BVHB 4NONA 1AM4D 1FLNA 2BEVA 3KS9A 3QGMA 3BCHA 3R0XA 4QRIA 3RVLA 4C4ZA 1DDIA 4L3WA 2B7LA 3EZ7A 2W6ZA 3WLNA 1EUYA 2JFNA 4ZI5A 5AKIA 5BR1A 1DNPA 3G23A 4ZOLA 3I76A 3S8YA 2Q3DA 3T9AA 4RIEA 3QP9A 4EA6A 2O2EA 3THYA 3VO1A 2YVQA 3KTDA 3FM9A 2B1IA 2OD2A 4AZ0B 1P77A 3D5TA 3ELDA 5AK3A 2PWZA 2HL6A 1QB8A 2XB8A 3LO8A 3FBWA 1JXMA 1TJPB 1NUTA 1ZQ1A 1RCTE 3NGLA 4PLHA 3KB2A 2IXDA 3EEQA 4NX2A 5DHFA 2HIAA 5ITZB 2EAUA 1JAYA 3G5UA 3EGWA 3NWEA 3FW1A 4KLNA 4NBWA 5MN5A 4AKEA 1UPXA 3EC7A 2J9ZB 1BGXT 4WAUA 3C87A 2I4MA 5KVSA 1UJ4A 3PUIA 4L9AA 4EMUA 1E7RA 5LB2A 4B3DA 2WIBA 3F3SA 3DVQX 4GOXA 4LHSA 3B1FA 4NBKA 3H5OA 5DK4A 5SZJA 4AZTA 1VDMA 4ARUA 4B0OA 1SXJE 3B60A 4G3XA 3WOVA 2FSHA 4V1CI 3AJRA 2R68A 4FZ5A 4ZEWA 2V1UA 3SLRA 4YC7A 2E48A 4ZARA 3VZBA 3WSWA 4Y3UA 2J48A 2XYHA 4QBTA 4RVSA 3PFWO 3T9EA 1NBMA 3JQ8A 4K05A 4Z7NB 1RC0A 5JXWA 4XRGA 1HGXA 2XVAA 1XKTA 5BMVF 4HX2A 2HADA 1TZJA 2VPQA 3GGJA 1CZNA 2DWQA 2X9QA 4UTNA 2MWMA 1XCBA 2XYPA 3L7MA 4M76B 2JFYA 1SC3A 1UDWA 2OT3B 5E2IA 2QYHA 3IJEB 3AUUA 4FT2A 1Y9JA 1K5GA 3I39X 4JDPA 5IT4A 3M6FA 2GN1A 3GRCA 5KDDA 3D8RA 4MVJD 3F71A 1E3TA 1QBGA 5F21A 3NV7A 1O1YA 5A0FA 4ENPA 2EGHA 2G76A 2NO6A 5F4BA 4K6KA 3VNBA 4QXMA 5EKDA 3NBYC 1H4SA 3URMA 2YNMD 4IEFB 2ECPA 2PMDA 1R74A 2HSZA 3I5YA 4NAVA 1QFSA 5KX5F 1E0KA 4ZVVA 3KYCB 1CX9B 1N9GA 1JIJA 3TTVA 1OAOC 1S8OA 2C94A 3LZDA 3MCUA 2WP8J 3QFRA 3EDYA 3WIEA 4X1YA 1YH3A 3RS9A 1V3UA 1Q83A 4WOPA 3H9QA 5ILGA 5IVPA 5KNBH 3INYA 4A9AA 4BNYA 5FV7A 1GL9B 2ZTVA 4OHWA 5FUWA 1E98A 4IMJB 1IDOA 2F67A 1NN5A 3O03A 5C80A 3GBVA 3ASVA 1YCHA 4OX9Y 4NY1A 1X42A 3DEAA 1XKXA 3BJEA 3T34A 3DT6A 1CUVA 1ZEJA 2ONCA 3JVVA 1ULZA 4GMKA 1QHFA 1Z4IA 5GM1A 3G2MA 3WRYA 1HF3A 3MCAA 1D4OA 4KI0A 1OPXA 1R15A 4IJQA 1KEKA 4BRUA 1MP0A 1RMYA 2AKYA 5BQ3A 3NDBB 3PC7A 3WMGA 2H17A 1MFPA 3OQHA 3UJBA 1U9IA 2ZRCA 1A2KC 1IXZA 2GZ1A 1HDOA 3N2LA 4JIGA 2P27A 3GP3A 2WVAA 3RF7A 3S99A 4Q7JB 1YVDA 1BYIA 2DRIA 1LY1A 3QBJA 3TFOA 3SZMA 2XRZA 2HQ1A 2BFDA 2P41A 2YHAA 2IYUA 3SICE 1J0BA 2HRDA 5LBTA 4OB6A 2ZUUA 5BR4A 2D2FA 1P4RA 4U2DA 3KWJA 3IQGX 4W9NC 2C2GA 4OLBA 4GP7A 5HMMA 3VPSA 5LZ8A 1S9HA 1LPMA 4D9GA 1EYZA 2GBLC 1HT1E 2W6PA 2EVWX 1OWLA 3PQCA 3QYJA 1PW7A 2WSIA 3PRKE 1CS4C 2FWAA 5ESWA 1Z34A 3RK1A 4B35A 1ECJA 1QIIA 2PGDA 4LRWA 4C29A 2JCXA 1G21A 2R97A 3RUFA 3AFNA 3ICWA 4M8NE 4TMKA 3RRZA 3GLGA 3OLZA 3IUSA 5B53A 5BO5A 1KK3A 3O2SB 5BUCA 1OAOA 2WUFA 1FLVA 3H05A 3ISVA 1F8XA 3L0IB 5CFOA 1AO3A 3SU8A 4ZYUA 1NBWB 2MYNA 1VMDA 3V8BA 3AFHA 3IKJA 1KMMA 2ZI7A 2ZYHA 5L3ZA 4N48A 1VPWA 1EIWA 4JJ4A 4P58A 1I3OA 4MS4B 1QU2A 1MJHA 1Y7IA 4K5QA 3SKVA 5TY0A 4J3NA 2IXTA 1QQAA 2I67A 4CMHA 1GQQA 3CGWA 1AKYA 4M87A 4MZXA 5EP2A 5FWXA 2J9GA 4CKCA 4Z99A 2EJCA 2RAVA 3DTYA 4D97A 5LP6B 1EBBA 5GJWC 2FFQA 5BWMA 5EE9A 3CW8X 4IVPA 5ULLA 1ZESA 2HHCA 4AS3A 3IQEA 3JYHA 2QLNA 5FBVB 4GRAA 2CYAA 3ZHYA 2FUCA 2DOKA 1RD4A 2CUZA 2V5VA 4FSXA 1LXCA 3F7TA 3FHJA 4GEGA 4MGIR 4YJFA 5A7GA 2B34A 4TTJA 4ALJA 3R3WA 1J49A 2VT6A 2VWHA 4R71A 3GCWA 3WMEA 3KLPX 2JVJA 4RHTA 4ETWA 1MOQA 3FOWA 3CLKA 1KYWA 2EL9A 4EPRA 1VL6A 4L5JA 4W9NA 3ZVKA 3KFVA 2OP0A 5F3DA 1RT9A 3DM9B 3OJXA 1KEEB 3BC1A 4RJ2A 3FF1A 3CEHA 3HLTA 3TVDA 4ER0A 2GN2A 3M4XA 2IY8A 5H70A 4BB6A 4BCBA 1RAIA 4E4TA 1A8UA 1YQQA 5JDCC 1GU7A 2RI6A 5DKFA 4C6TB 3PC8C 4CCAA 1O0SA 1EHCA 1EVEA 4LECA 4QTTB 3HO8A 3P9IA 4R9UC 4WCVA 4PS0A 3UEOA 4QUBA 2GM9A 4Z3KA 1K4YA 4ZAVA 2HF8A 4H17A 3FOBA 3OEWA 1T5DX 1E61A 4EI2A 4J0FA 3WAKA 4OLFA 1P18A 3IAS6 4Q4LA 4MKRA 1FU8A 4JXJA 4HX9A 2ZYTX 4TXMA 2C61A 3EYAA 2C2ZA 3E2MA 4GICA 3AI3A 4MHOA 3S2YA 2Y8EA 4UQPA 3RNOA 4BVLA 1OFUA 3OCVA 1NV8A 3ND5A 3VYUB 4BVFA 2OAGA 2WUGA 3ANYB 3F5FA 4HLDA 3NUQA 4FHGA 4DJEC 3TQOA 1UEIA 1KC1A 2OORA 3THWB 5LZ2A 3LX4A 3O47A 5LYJB 3TTTA 1VCOA 7YASA 2VDNB 2PZ8A 2JHAA 2IW3A 2ON6A 4GGPA 2BTEA 2Q8NA 3S6JA 1C8LA 2OK8A 5HF5A 3PFGA 1PFKA 4H4DA 4R84A 3I09A 1C1HA 1MJNA 3AUFA 4GC5A 2XDQB 1Z0JA 5DM2A 5CT8A 3ZWWA 4BC0A 1AQJA 2HKIA 3VNQA 1KA9H 3KETA 4AO8A 3GLFA 5G02A 4MKGA 3WQBA 2PUEA 3HR7A 1SQSA 2EC5A 4AJ4A 4II3A 4ARZA 4KJXA 1PX0A 2F1KA 1XZJA 3LYLA 3FLEA 2KWIA 4OUDA 1WO8A 3EIUA 3AVXA 1UC9A 5HDQA 3C5HA 2X58A 5HIJA 4BX2A 1GAEO 3K2IA 3TAUA 2PMWB 1VSUA 3DZBA 5DW3A 4QUJA 5JDCA 2Q1SA 2WD7A 1XMIA 2WNIA 3PHIA 2IZ5A 3UKOA 3K0CC 4B7XA 2ZR8A 2AF3C 4RVGA 3IOCA 2KW5A 5G4KA 1YV9A 3WGYA 2NSHA 1DRWA 4KGVA 4C6HA 4C5AA 4DLLA 5BW8A 3PENA 4ZCMA 2I3GA 3CO0S 1LLFA 1G4AE 4OXKA 1OH8A 1PVVA 1KF0A 4L0MA 1MW9X 4C30A 5KJ6A 4IYJA 3MWEA 5J2TB 4RXTA 5KOIA 4IINA 2XE7A 2FUG1 4OQFA 1LW6E 3HA2A 3A1DA 5A1TA 1T43A 1H0HA 2V0NA 2IXEA 3TAXA 4F3CA 4R0MA 4CEHA 2CVOA 2X0DA 1SY7A 5A3JA 5L4SA 2O5CA 4O4JF 2GCOB 3VH4A 1TF5A 3DQZA 3PD7A 2OM6A 4F1WA 2WJ3A 1QSGA 3RC1A 3ULKA 3UZUA 5BQ5A 5LYYA 2AMJA 2G4VA 1AZWA 1GA1A 1FJGB 2OMKA 2Y71A 3LSYA 1J5XA 2RHOA 2YS6A 1Q15A 1S01A 4XI9A 2Q45A 2OCXA 3P20A 3K8YA 5DSXA 3R7AA 1NN1A 3HV0A 1YVUA 3RT9A 3RVNA 3FNFA 4ENVA 4ZJPA 5ED4A 1QIJA 3DZHA 2QIPA 3WLSA 1KKUA 2QD2A 3EPPA 2FOIA 4KR6A 1OR8A 2VQDA 4INAA 4BZXA 3F7OA 3I2FA 3PXAA 2CMDA 2ZSIA 1YQXA 1K7EB 1A9PA 1EXMA 2VAMA 3ISTA 5KNLA 1JKXA 3I8XA 3L1JA 2QX4A 3EHEA 2Q2QA 3O21A 3FMIA 4XVUA 5TNXA 1I4EB 3DE1X 5TVGA 4TZ6A 3F46A 4J6EA 1L3BA 3DWFA 5KJCA 2BKXA 2NSYA 2OL4A 1BKSB 1I1HA 3O8BA 3P5SA 4R2HA 3SJZA 1KP3A 2JZNA 1CRZA 3CZMA 4QG3A 2GXQA 5JASA 4HZUB 1W85A 3PEUA 4WOCA 5C18A 4TX1A 1FW6A 1D1QA 3UKDA 3NANA 5LA6A 3TDNA 4FIDA 5JBQA 4WMLA 4RPGA 3V8NA 4LTNA 1TVKA 3H5NA 1ZJWA 3MWFA 1YGPA 2B1QA 5CLHA 5DE3A 2IKSA 3Q9NA 3UTCA 4A3SA 2DUJA 1CJUC 4JLMA 3VYVA 3SJ7A 3PD0A 1G8GA 2C4NA 2BEUA 3PIIA 1C7JA 1US8A 2PX4A 3B38A 3M6UA 3ZJ4A 4J07A 2Q4EA 2CB0A 3TLEA 4S35A 1KBOA 2FX2A 1O95C 4KNYA 3NPAA 1WXXA 4MICA 5KQGA 3IOEA 3X1YA 1QHEA 1NMQA 4QWWA 1M33A 3L41A 9GPBA 5JD5A 3KSAC 4Z51A 1YZVA 4HVTA 4PTYA 2C7QA 1CW2B 3BIFA 3P8ZA 4YUXA 3D1JA 3CCFA 3T9FA 2C7GA 4KE6A 4QBGB 5F23A 1U8YA 1QRAA 2VDLB 2OFOA 4AJ1A 4POAA 2ECFA 1B3RA 4OXIA 2ATVA 3H65A 2XUZA 1NF2A 3RHZA 4J1TC 3IR5A 2RHTA 3JYLA 3LLCA 2VDUE 3N74A 2VWGA 3LKVA 1DOZA 5T67A 1KJQA 2OXCA 4OU4A 1TF2A 3LNCA 4MP3A 1CEEA 3PDHA 4Q1FA 1LQ2A 2P4HX 2QX8A 1YRQA 3NC0C 3CVJA 3TTSA 4B71A 1M5UA 3OCYA 4R3WA 3NHYA 4I99A 2NXEA 4YDQA 2J0SA 1C14A 4K9LA 3A4IA 1ITZA 4KUGA 3JQBC 1JSXA 1W88B 4GKJB 3EAGA 5TGDA 4Y6PA 3ZZ0A 1C3LA 2BFCA 1XD9A 2J1LA 5JJIA 3SE7A 4C08A 2OXFA 1PD0A 3C6MA 3LOPA 4UD6A 3GGOA 1W96A 3SHTA 2MMCA 2W0SA 1W5AA 3NBFA 1O6FA 1UMDA 3LCUA 1SVKA 1OI7A 5A04A 1ZC4A 3T1TA 4HEA6 2HJWA 4L5AA 2VHUA 5K8LA 1HY3A 2WWGA 1NYTA 2VTKA 3INNA 2XCSB 1QC5B 1Z4NA 3MOGA 3MAJA 4L3VA 3O9MA 4PFSA 1C8KA 1EINA 1KHTA 4EMTA 5T5QA 2O05A 3ZWMA 3A9WA 1JH9A 2ECQA 3DOHA 5DXFA 2TRSB 2CVZA 5JAHA 1YRBA 1JAIA 4RV9A 3V8QA 1ADGA 3EN0A 5CUQA 2ZCVA 3GJ3A 1UOPA 2IXAA 3QUCA 4QYIA 5E0KB 4ZICA 3USZA 4DEYA 3BMXA 2SICE 4JMPA 3G13A 2OLKA 3GGPA 4V0SA 421PA 1H2FA 2IEBA 5TR9A 4C14A 4H6PA 1LRLA 3N2EA 2VQSA 2BUBA 3K9BA 4L9SA 5IARA 5K0BA 2G36A 1JQDA 2QR3A 5LOVF 4F2HA 2O7QA 1D4FA 1NONA 4EQZA 4C07A 2HRBA 1IVSA 4HXGA 3D9QX 3T7EA 3HCBA 1F9EA 2VYVD 2FLVA 4P31A 4BVBA 5HKKD 1FEZA 3A14A 4JQOA 2G1PA 3I4CA 4LE1A 3AUKA 1W581 1NOIA 4KHPB 5BMVA 1X7GA 2CLSA 5M34A 2WTBA 1H2EA 4YJ2A 3VFDA 2GB4A 4JJKA 3AONB 3HU1A 1TC2A 3K5IA 1KZ1A 3PFNA 4HATA 2ZYUX 4KR2A 2AI3A 2RGGA 4OVKA 2SBTA 5K3SA 1YL7A 1R18A 2HIHA 3JAMA 3GLHB 3HFSA 3WJ7A 2NZ8A 3IV6A 3R76A 3L82B 4B3FX 3RJ9A 3FY4A 4UW9A 3NIBA 5K0ZA 4IXTA 4XSGA 1U9IC 1Y9EA 1KI9A 5L9AA 2O0JA 4UVEA 3HA3A 4A8TA 4Z7OB 4CM7A 3DD1A 1F2UB 1I5OA 1Z16A 4X97A 1NW3A 3MEQA 2P30A 1LSUA 2ZXFA 1GQSA 4BJ6A 4MUGA 5A4KA 2P9EA 2I9PA 5FL7D 2XUKA 3F67A 1AF7A 5KKAA 3ZK7A 1T1IA 3CF6R 2TYSB 4M8IA 1L5HA 1IYZA 1YDHA 1QVWA 3DONA 2CXUA 5JYDA 5KWJA 2AL7A 1RLJA 4EB6B 1XYGA 3F2IA 4HVAA 2ZUTA 1CNFA 5CXXA 5B3KA 5CB8A 2WU1A 3W7VA 1R6XA 2Z09A 1TIKA 1S8AA 1RJEA 4DCSA 1OILA 2K7ZA 3LU1A 5AW5A 4E08A 5EUQB 1KQ3A 4ZIRB 1OB2A 2CZCA 2XYQA 1O08A 2ZS9A 4Z7JA 1TT5A 5JAIA 1YIAA 3ETLA 3F6YA 5G53C 3MWKA 1HE3A 1FQKA 3HNOA 3TZKA 1PV4A 3AVUA 1DMSA 3ENNA 3DMFA 3KK0A 1ZOIA 3L04A 3TM4A 3H3FA 5JRJA 1GQYA 2YZMA 4I55A 4J7CA 5CLQA 1NHGA 1XVAA 4LDAA 5BSGA 2CL5A 5LJLA 4NCAA 4EY3A 1DFGA 2DPHA 2W8BA 3LXXA 3AJAA 4FHCA 1WBDA 2E4UA 1JIVA 2ZBEA 1TM2A 1Y6GA 4KQEA 3E61A 1Q12A 2WAAA 4XYEA 4EDFA 1YVPA 1XWIA 4OG2A 5F3RA 2NO0A 1MA3A 2OY0A 3AHHA 1RE1A 2R8ZA 5DNVA 3THRA 4YCLA 2NTNA 2RC5A 1VZ3A 4S1VA 3KB8A 4CKEA 1JDVA 5JFOA 5B58T 2X4GA 3O8LA 5DWVA 3F6PA 1ONBA 4DBLE 1FRZA 2A1TS 4QT4A 1D9XA 5C0OE 4EO9A 1QRDA 3WP1B 3L8FA 3OQ1A 4DDTA 4OPMA 5CB0A 2V96A 1GCUA 2OCGA 2ZEJA 3KKPA 2AE1A 2C9DA 3L1IA 2O3RA 4RUKA 2VBFA 5D87A 4DR3B 5BYKA 3L92A 2XGJA 4M53A 2ZATA 3L0YA 1J8FA 2PR7A 4NABA 3BBPA 4RPLA 4DLXA 4BEVA 1V2GA 1WS6A 3PRYA 4YPFA 3T5AA 2QRQA 2KM1A 2XVXA 4GOKA 1U0BB 2HPHA 1EM6A 2I4RA 2JD0A 3MUEA 2J07A 4O29A 1IHXA 1COWA 4Z1MD 1TD9A 2R86A 2EHDA 3HY3A 5K01A 4F0JA 2I0FA 3WV4A 4YR9A 5IZCC 3HKEB 5GIPE 3WAJA 2OLJA 1LA2A 4C3OB 3D6NB 1U6KA 1LVHA 4EH1A 4URVR 5JC1A 1UBTS 2O4UX 2W22A 4LNAA 2FLWA 3B1VA 3GXBA 2A94A 2H54A 3ED1A 3R1IA 1UZMA 4QX6A 2IUUA 4RANA 4DV0B 3ZV6A 2WM3A 4BO3A 1GV1A 2I33A 1DBRA 1YE8A 1QO0A 2ZRMA 3DKRA 4LK2A 4IR7A 1WTAA 4YMIA 2RB5A 3E23A 4P7JA 1T0PA 1JSLA 3DEJA 1PR0A 2JI9A 1ADYA 1WSDA 3CCCA 4HGOA 4P82A 3W8DA 4AJ2A 2EHJA 3JCZA 4W4TA 5DYNA 5JSZA 1RQNA 3NH9A 1PX2A 2B6HA 5B4UA 3ES9A 2UZ3A 4OAOA 3E8MA 3U4CA 5KNBA 1NAIA 1Z4KA 2GAAA 1U1CA 1Y89A 3NWPA 4NBRA 5C8VA 4LPSA 3LP5A 4IIFA 2JBWA 1ADCA 1E58A 1ZC3A 2EKBA 4IIVA 1MGPA 2AF4C 1X7WB 3BMCB 1MW8X 4J7UA 2PWYA 4H1UA 3L77A 4DLNA 1T35A 3RRJA 1A4RA 1IXYA 4YMSA 4JL6A 3OKPA 1P0FA 4WXEA 1PWYE 3KPUA 3WRVA 1JDTA 1VFPA 5DOZA 2H63A 3PRHA 1C3OB 5C4GB 3TBHA 3LLUA 5ALPA 3S1AB 2FPGA 2IJGX 5TQ2A 1N4AA 1N2OA 4G26A 5L95A 3Q0TA 3FZEA 1K92A 1GPNA 5FR1A 5I7AA 3RYFB 4AX4A 4OJYA 2OGUA 2R00A 4UEJA 4DM4A 5AXBA 5JRDS 2OLEA 3OQOA 3M2TA 5GV7A 1MX9A 4OJNA 2PQ6A 4P80A 1W8IA 4L22A 1W4RA 1Z0UA 2JFHA 2Y6UA 4P92A 1BOFA 1WOMA 2NV2B 4G0QA 4ZP1A 2EKDA 3R4VA 4IO0A 4ZIRA 1VB3A 4P3NA 3K6SB 2RHRA 4HAUA 4DCMA 2VJLA 1FP4A 3WLHA 1FU7A 4PG6A 2QGZA 3RRMA 2EQAA 4L27A 1LPSA 5KO2A 1JKJA 4N49A 3AT1A 3M6XA 2P68A 1J97A 1PSWA 4QPDA 4TLBA 3DAYA 1M8JA 4WCFB 4D99A 1Y3HA 3DFUA 5CNMA 5FNZA 2MR5A 2WNHA 5DCUA 2Q5HA 5E7QA 2WV7A 1NLZA 3KQOA 2EL7A 2BHRA 1E9DA 4DKJA 1QIHA 1YS7A 4M38A 3HU5A 2UVPA 5B1EA 2R1ZA 4ROSA 2Q5CA 2WSYB 2JHFA 1P7ZA 2HA3A 2HCJB 4HLQB 1JAXA 4X66B 2GD2A 1ZIPA 1NFRA 3PUZA 3SX4A 1AG9A 1L4KA 1ZP6A 5I4BA 1EGAA 1A69A 4N01A 4IFTA 1CEYA 4MV6A 3L8EA 3AR3A 1FUIA 3PPVA 1DO2A 4BAGA 4BECA 5I3CA 3KG2A 4PZZA 3IPYA 1XMXA 3LLSA 3FNQA 4LY9A 4PLGA 3CZPA 3K4PA 1D2CA 1RWXA 2I2DA 1XLVA 1ZOPA 2ZVJA 5LQJA 1R00A 4LJSA 3DHYA 2P65A 3B1ZA 1E8NA 3TE7A 3HGMA 3KT6A 16PKA 3FWHA 3EUEA 1XGKA 1TYBE 3QJGA 4II2A 1KZHA 5A4DA 1SU8A 5MN4A 1R8YA 2XTJA 4CHTA 2GKOA 4KE8A 5K20A 2VPXA 4ZC1A 4NOMA 5TJHA 1UEJA 1FF9A 2NSJA 4DREA 1C50A 3IB6A 3LRPA 2DEUA 1FZTA 5I9IA 3IAXA 1YBAA 3QWIA 4IV5A 1V1MA 1GZ5A 2QQFA 3A3YA 3G8CA 2L17A 3O3OB 2HZ7A 3GZNA 4HNQA 2HA7A 5K0FA 3RADC 2NXWA 4U7JA 2X5JO 4L85A 3ZLBA 2JDID 5TSDA 3JX9A 5A4FS 3GFQA 5C5IA 4F4CA 3IUYA 1ZWKA 2E0IA 3D31A 2KMLA 4ZXPA 4BO0A 4ZYXA 2I4IA 3Q4GA 1HZJA 1QVVA 1DEAA 2FPUA 3OTIA 1BROA 2P2NA 3OCXA 4GVXA 1R0ZA 4YAIA 3EVZA 3CRW1 4OJKA 2VTVA 1ZRNA 3AFOA 3DMYA 5CT9A 1ZUD1 3FTDA 4XOUA 3BWVA 2QI9C 3LJKA 3WBKA 2FFBA 3ZXYA 5JC8A 1RJGA 3AKCA 4I2VA 4PPFA 3H8WA 4JT8A 3KSMA 1CU1A 1JP7A 4UFNA 1H4QA 3MGAA 2BKEA 2XMGA 2QTWB 4QFMA 5CT6A 3WNDA 3SC4A 2A1UB 4HD8A 2VK2A 2CLFB 5FQOA 2HXSA 2VNJA 3VU8A 5KVCA 3BFXA 3LPLA 4RF3A 4U7FA 1F2DA 4F7DA 5EJEA 3EXG2 2NLOA 5G4LA 4Q7QA 3NWOA 3LO5A 2AG0A 2PSFA 1NJ6A 3A6DA 3A1UA 2Z1MA 5I7RA 2V9ZA 3Q12A 3U4MA 3L5OA 3AP3A 5AJYA 5A7HA 2QD5A 1EWKA 5HQ3B 3EEYA 3DEYX 4HDQB 3CY6A 3IRUA 2WT9A 4Z9BA 3UY4A 4C5CA 1CUWA 4CQMA 2CSXA 4LXIA 1L4LA 3WK7A 1ZISA 3U3ZA 1ATIA 1I7PA 4HZGA 5FO1A 3WK6A 3QMPA 1M3SA 4G5RA 1W34A 2I62A 2W6QA 3K35A 2RGDA 4KSYA 1C7RA 5EP4A 5FL3A 1IMJA 2F3PA 3G8BA 3JQ8B 4H7KA 3U49A 3SC6A 5ANRB 3RC3A 4MJ3A 1R4MB 2EU8A 1SKQA 5JECA 4BWFB 1DUIA 1WCIA 3PGXA 1Q0SA 1NKVA 2GEDA 3VPHA 1RE0A 2QSZA 5BYAA 2WPDD 3E7FA 1DX4A 2WAXA 4PSUA 4I9NA 1JLSA 5FFNA 4OHVA 1PJ2A 1ZJZA 1G8AA 4RBNA 3BIJA 3ECAA 1VOTA 3EW7A 5JS8A 1VE3A 1AB5A 1C5KA 1DRVA 1RPAA 1UXHA 3MTJA 1UIMA 4YRCA 4C7XA 5F77A 3N0VA 3P9CA 7GPBA 4AZWA 4OU5A 5JUWA 2XADA 1GPYA 2WU8A 4XCVA 2MSEB 3AKDA 2WK1A 5KSOA 4D9CA 5JDIC 3F6CA 4N82A 4R7GA 5HDBB 3PQFA 4CMGA 1P73A 5AVSA 4AY6A 3TG2A 1FQOA 2OGZA 4KTVE 4KIGA 3VSBA 1VBKA 4I5IA 3MD0A 3QE4A 3URKA 5FOXA 1L5GB 3UOGA 4UTXA 2BPOA 4RF5A 5FWAA 1QPZA 5ITWA 5HRAA 2YHIB 4LNUB 1C9DB 1A71A 1E64A 1LK5A 4U2CA 2WB2A 1RM3A 4HVLA 2C2YA 3HDYA 4B6QA 1E5DA 2QUBA 3H2SA 1X1TA 2EWVA 1W85B 2ZPTX 1E4EA 1KIMA 1KORA 4MW6A 4XJSA 1T3ZA 5AUNB 1K1EA 3JRWA 1R4ZA 2C7PA 3G8YA 2VPTA 3LPCA 2XTNA 4AVYA 2NAFA 2PCLA 4Q12A 2BR3A 4HS4A 5U4QA 3FSJX 4ACAA 5AVRA 2JIRA 4DC9A 4G4JA 4MV5A 1L1QA 2HJHA 4UNNA 4ARIA 3VC7A 1XCPA 2IEAA 1U0RA 3TMKA 3WXMA 4BAZA 1JI0A 1X7XB 2DPMA 4R1QA 3DKIA 4V0RA 4L07A 5KKNB 5D1NA 1U8XX 2PBLA 3TTXA 2JI6A 2DFNA 3FCUB 5IJXA 1GZ6A 3CVUA 3IR7A 1NW4A 3BTVA 1RACA 2CDCA 3HPRA 3VZPA 2Q2VA 3T8YA 1LFAA 2HNBA 4WOBA 1V11A 1R27A 3IBSA 1YSCA 3EGDA 3MZ0A 1WCYA 3E81A 4URXR 1Y9AA 1X3SA 2VHQA 4KX3A 3GJQA 3L7YA 4MMXB 1SKYE 3A4NA 2A5YB 3CPEA 3FETA 4ID9A 3RV3A 1GZ7A 3VO8A 2RK6A 5E2BA 1QU3A 3L5KA 4OK3A 2YVUA 3KJHA 3OWHA 3HMKA 2QL5A 2ORIA 3PZBA 1MFZA 1XTJA 2OECA 1KY3A 1OYVA 5K7SA 3KWFA 4FYPA 3V97A 1U3VA 1HNNA 1H05A 3PGVA 3ZCRA 4QU8A 1T25A 4Y1EA 3C6KA 2ST1A 2JH8A 1MQAA 1NI4A 5H9WA 4E13A 1GCAA 3B7PA 5J4LA 4M1MA 5HR5A 4G65A 3OECA 4HSGA 4L4YA 3RANA 1TTPB 1J6UA 4YRFA 2Q4BA 3O74A 1AKWA 4QC2A 1RLMA 2I6XA 5F3WB 2QVZX 1EFCA 2BFEB 2N46A 3BRWD 2UYGA 4U8GA 5KU1A 3EC2A 3DE2X 3R7WB 3TQRA 1NYLA 3N2ZB 4QDOA 2BEJA 2G5TA 2XNKA 3I9JA 3MWGA 2O06A 3Q7EA 3U1VA 1P17A 1UJ2A 3HVIA 2HY7A 1GFWA 3ZV3A 4CLEA 3REGA 1B16A 3WNQA 4PPNA 3WV5A 3IUQA 4GX2A 4NYIQ 2RH8A 3JAKA 1FMFA 1AXRA 2JFZA 5A4IS 3GAFA 5BVHA 3R3YA 1F7VA 3MGGA 1YRHA 1R3UA 5IM5A 2UUCB 3AFMA 1WZCA 1GN9A 2F9FA 2E49A 1DMRA 4HLNA 1CHDA 2W6JA 5T4HA 1SC1A 1E9EA 2G1UA 4JNKA 1U0OC 2XZOA 1JEEA 1QG4A 4V3CA 1EK0A 2AFIB 2WAMA 3OPXA 4OQ4A 4XPZA 3CA8A 3B6IA 3AK4A 4NYMR 2A58A 3IPLA 5TGTA 3C45A 1KPHA 5ALMA 3SHFA 3K0BA 3A2KA 3EA5A 1SD1A 3EZYA 2NZ2A 3UBMA 2PT7A 4DG5A 3FPBA 1DJQA 3W5HA 1VIYA 1SCKA 3DWIA 1EFRA 5HE8A 1K75A 2JFXA 1JT9A 3D4NA 3I92A 4R31A 1KEUA 1CF2O 1T1EA 5FYDA 4D96A 3OBIA 5LKRA 2GWRA 2I6UA 4BE7B 3NMUF 5DBHX 2G0AA 3TVTA 4AO7A 2EFDB 3QWFA 2I76