4GNKA

Crystal structure of galphaq in complex with full-length human plcbeta3
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
337
structure length
337
Chain Sequence
ARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gtp-binding protein/hydrolase
total genus 92
structure length 337
sequence length 337
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4gnkA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gnkA01
2JJ8A 4NYMQ 2ZR7A 3SJAA 5DI3B 5DISB 4L16A 4NYMR 3K0AA 4UXIA 3C15C 1US8B 3U5ZB 1W36D 3S1AA 1TX4B 4ZPXA 3O47A 4Q18A 3IEVA 2VHTA 2CJWA 4ILEA 3QXXA 4C0BA 4B2PA 1KO1A 4V0OA 3KB1A 5K8UA 2R6CA 1HEIA 1V5WA 4L9WA 2GCPA 3DKPA 4JT4A 3WMGA 4D4JA 4Z51A 3KQHA 1UKYA 2ZSFA 1X8KA 4A4DA 3DZ8A 3K0CC 4C7OA 1QDEA 3WBJA 3MG9A 4Q21A 4ARZA 4YDHB 3CRRA 1S8FA 5L3VA 2Z43A 4ZIRA 1CEEA 1PVOA 1E9EA 2A78A 5JLJA 4N0DA 2I3BA 3A37A 1XD8A 4US0R 2GILA 5H1YA 3SE0A 3BORA 3GJ4A 3FPAA 1ZC4A 2CEAA 1NY6A 2HT1A 4M9QA 3CRMA 4JVSB 2JLWA 2VIIA 3TRFA 2CE2X 4OHXA 4US1R 1XXHB 4DSUA 1X8JA 2OUKA 5JI3E 1IXSB 4BFZA 1TQ6A 3GMTA 1K5DA 1F2TB 1F48A 1X86B 2O8BA 1BO6A 3RRMA 1G3IA 3ZYCA 5UKDA 4YMWA 3FOZA 4D0GA 4JLVA 4JZKA 3KJGA 1EFRA 3NBYC 1H8ED 3SQXA 4D6PA 3PVSA 2ZIAA 5FTKA 3U7EB 2ZREA 2ZJ5A 3KFXA 5E7JA 2O5VA 1NI3A 5IK2A 4Q7JB 2IC5A 3F0TA 4MITA 2FZ4A 2D4HA 5HZKA 4ZKDA 4CDGA 3G5UA 1ESNA 2HXSA 2VSFA 1ZW6A 5L3QB 2WWWA 1FTNA 1G8GA 5GJWC 1ZBDA 1E9BA 3VKWA 3GLFB 1N5LA 4LJ8A 3JZAA 4QL3A 1XTKA 3L8ZA 3MRSA 3H84A 3QNUA 3REGA 1ZMXA 2HJVA 2PJZA 4P4SB 2G83A 5D3QA 5DIFA 4IVPA 2W6ID 3I8SA 1QHGA 3EWSA 4S35A 5JFGA 5BN5A 4Q1DA 4BLPA 1Z6XA 3QF4A 4JSTA 3HYTA 3A1VA 1MH1A 4Q4HB 1P7CA 4H1UA 3GFTA 4EPRA 1E98A 1ZIOA 4ZI2A 1VKJA 2A5GA 2B92A 2XOKA 5AJVB 4C7OB 4ARZB 1QVRA 1G7TA 1Q1ZA 2FPLA 3TW4A 2ATXA 5H70A 1TU4A 2XJ4A 3CBQA 3SJCA 4G1UC 4KO8A 2HXYA 2WZQA 3GFPA 1OFTA 3OFND 4M1TA 4B32A 1FP7A 2H57A 2N46A 4KBGA 3NDPA 1KSHA 4Q00A 1ZYUA 5KPDA 1ANKA 1E9CA 2QQEA 3EPLA 2QA5A 3VMFA 3HPQA 3N2EA 4TT3D 3O8BA 5G40A 3TVDA 4E03A 1AK2A 3EAQA 3GEEA 1XWIA 3AF1A 3L8YA 4KSCA 1XD2B 3BBPA 3ASYA 4L4UA 2AN9A 4HZIA 2Z4RA 2FFAA 5HE8A 4A0GA 4D4MA 1YVDA 2ERXA 1N2CE 3AVQA 4EPVA 4PO8A 4NYJQ 3RABA 3K9NA 5EJEA 4KITB 1VYUA 2ZI7A 5CYOA 5JWOA 3B8HA 3C41J 4BQSA 1HURA 2GXAA 3WNDA 3LH5A 4LY6A 3UWKA 1FTSA 1KTVA 3OE7A 2WWGA 1R5NA 5FH9A 1UF9A 2PX0A 4EIWA 1OH5A 221PA 1HTWA 1N5IA 2CNWA 3EASA 2BBTA 3WYGA 3I72A 5DGXA 2XZLA 3AP3A 2PT5A 3JVUA 2OHFA 1GIAA 3OEHD 4CGZA 2NOAA 4Q03A 1Z2CA 4M9XA 1W4AA 3U7FB 5CITA 3ECCA 2J5XA 1CKEA 1TEVA 3R8CA 3H2YA 3FHTA 3VR5A 1T8UA 1S96A 2FWRA 821PA 4FCWA 3CR7A 4A2WA 2OZEA 3C7KA 2HF8A 2QTHA 3NIBA 1UDWA 4PXAA 2EFCB 4IEEA 4LYJA 4AIIA 1TMKA 3SI7A 1HQCA 4PAOA 2CXXA 1G3MA 3QF4B 3ZDQA 3CUEF 4O2RA 1GNPA 4M21A 4OK3A 1JEEA 3J81k 4F93B 1VPLA 2OE2A 1SKYB 3NEYA 3HWSA 2YC4C 4PHHA 3U61B 4NCIA 5HZHA 2JIZA 1EGAA 1JR3A 2LWIA 4NDZA 4IXMA 4FWTA 1OFUX 1X1RA 1GG2A 2OXCA 4JJZA 1COWA 1DTSA 4POAA 1Z22A 4XH9B 4HDQB 1IM2A 3BJIC 4TYNA 1CR4A 4LC1A 1F6BA 3B1YA 2QT1A 2WKPA 3QPUA 3PQCA 1XMIA 2QE7A 3KKOA 3C5CA 2PLFA 1S9HA 1CS4C 2VP0A 1DO0A 1P2VA 4OHYA 3T15A 3RS7A 1KAGA 3C14C 1PLLA 1IHUA 3KJIA 4PPGA 4DJTA 4M1WA 3NBXX 4JLAA 1NG1A 4QJ3A 2IA5A 4CW7A 1G3UA 3WYFA 2NZJA 2XNDD 2WV9A 2GEVA 4WZ6A 1N6RA 4ZKEA 2C04A 2ZE8A 2PL3A 2ZE7A 3CRVA 1QHIA 4RY2A 2CLCX 3I32A 2PZEA 5JSZB 5JS7A 2FX3A 3U7HB 2J0SA 4I81A 2IF2A 2IXEA 2QP9X 3PUWA 4HUQB 4YQFA 2QGNA 5CB8A 2ZR9A 3E1SA 4B48A 1II8B 2Q6TA 2CCKA 4HZUB 4B3GA 1KY3A 2QSZA 3R8FA 2QNRA 1AKYA 2P5SA 1XCMA 2GJ9A 4DCTA 3THXA 4MUBA 4BZQA 4MRPA 1ZD8A 4KVAA 4G5SA 2UZIR 3BD9A 4LUCA 4D0LB 3U3MA 1Z6AA 2O52A 1YZQA 2QRNA 4P3YA 3W5JA 1XMJA 3GLGA 1DAMA 1Z47A 2ODNA 5FTJA 4HLDA 4B43A 3MCAA 1RRFA 3QY0A 1IBRA 2GBLC 3RAPR 2G0NA 1UKEA 2AXPA 4DUGD 4V03A 2ZRGA 3WRXC 2QBYA 2BM0A 2RGXA 4KODA 4BFYA 1N6OA 1GRRA 1UEIA 4JVNA 2GETA 3PJRA 1RFLA 4YMTA 1VCIA 3LDAA 2IWRA 2C5LA 3CF2A 2XJ9A 4Q9HA 1SXJA 2CBZA 2JDID 4OQFA 1P2TA 4HLUC 2VP6A 4QGHA 1GKUB 3AKEA 3LRPA 5EUQB 2G9NA 4GL2A 2XNSA 721PA 1G16A 1L7VC 3A4NA 3CH5A 1W44A 3QPVA 1Z0KA 4OHZA 3UANA 1R6BX 4M8NE 4B3CA 1GILA 3LX5A 1E2FA 4MDEA 2QENA 2RHDA 3W3AA 2ZRHA 4OI4A 5HR5A 4B2IA 2B6HA 1IQPA 4Q48A 4RZXA 4A6XA 1R10A 4RKEA 4IDOA 1NMYA 4AG5A 1JEDA 3FWYA 4X8HA 2F1RA 1HQYE 3ETLA 2W6JD 2ORIA 4Y0AA 1TPZA 5FPHA 3AP2A 1AKEA 3M6AA 5LB2A 4EUNA 5JCPA 1OE0A 3TJZA 1JALA 4DCSA 4QG7A 5C4GB 1DG3A 2PBRA 2XXAA 4TMVA 1Z0DA 2QPTA 2NTYC 3UMFA 2ZRBA 1KSJA 4QNMA 1QHNA 1QHHA 3TSWA 1KKLA 3EZ2A 3RRZA 4Z1MD 4EKDA 1UKVY 4D81A 1CRPA 1TTTA 4HLQB 4OQNA 2QEQA 4R9UC 3THXB 2W83A 5HKKA 2H92A 2B7BA 5CDFA 4B71A 4LPSA 5KOYA 4PPNA 4Q1FA 5HCNA 1E2IA 2HEIA 4ZDWA 1KJWA 1XBTA 3BE4A 3N2IA 3LBNA 1MRSA 2IYLD 2MMCA 1P9WA 1EESA 4Q1AA 5D3MA 3GLGB 3ZLJA 4JL5A 2O8DA 4CIDA 4QBHA 3VNVA 5A4JA 3B85A 4V0ME 3HU2A 4KLNA 2XTNA 3GLHA 3R9IA 5DNYB 4G5GA 4Y0VA 1MABA 5ANRB 3FDIA 1TAGA 3IIMA 1T8TA 4BLQA 3CZPA 4OL0A 4MYTA 2A30A 1NBMA 3LD9A 1E3MA 4LZZA 1M8PA 3L82B 2CHVA 2PCLA 4M9SA 2FNAA 5FR1A 4YXWD 5KHOC 1RRGA 1S1CA 4MGIR 3AQ4A 2O8CB 3VU9A 2WWXA 3IIJA 1H65A 1E2KA 2GJAA 1WCV1 1KMHB 4C3ZA 2ODWA 3V4RA 4GDFA 2H17A 5C1BA 2OAP1 2WPDA 3L43A 3OIUA 4G3XA 2BDTA 5JRZA 1CJVC 3IUYA 1XRJA 2V54A 3RS2A 1N5KA 1NLYA 2IS2A 4NBSA 1RW4A 2FEMA 1XXHE 4TL8A 2XZPA 2Q9AA 3T1VA 1HY3A 2C2HA 1EFUA 5G41A 2WSSA 5A5GA 2WJVA 4NZYA 4ESHA 3CX8A 1SVWA 2J7PD 3TUIC 4ERNA 3X1ZA 1CP2A 1FUKA 4JKIA 2FOLA 4JIMA 1Z29A 2VPPA 5HPYB 2J0QA 2AKAB 2K5UA 2WWHA 1UM8A 5C4MA 3B7GA 2YWHA 5JEEA 3TAHA 4RZUA 3NBZC 1NNEA 5JMTA 4DSOA 1UBFA 1E2MA 1QHHB 2IK8A 5JJIA 1SKQA 4NONA 2OBNA 3DHWC 4Q4JA 5E95A 2IHYA 1M34E 1OKKD 1YQTA 2EVWX 1HT2E 3WHLA 3A58B 2A9KA 4LX0A 3NG1A 1TQDA 1W0KA 3AH8A 1SZPA 3B9PA 1AQUA 3GLFE 1AGPA 2QMHA 4LV6A 2PMDA 1RC8A 3X2SA 4TL7A 1DADA 1XTIA 2HLDD 2Q3FA 2Q9CA 2QUZA 4MUAA 3WMFA 5GVSA 4LPKA 2H18A 1SHKA 5EP1A 4LYFA 3UK6A 2O8DB 3SZRA 3EZ9A 1FFHA 2VHJA 4A8JA 2IS1A 2VO1A 5JI2E 5FPSA 3LWNA 2CL6X 3WBKA 1WRBA 4X8OA 1G19A 2YINC 4M1YA 3V9PA 4FMCF 4JT2A 4CEJB 3B82A 5KDDA 3KX2A 5L3SB 1EWQA 2WSMA 1SVOA 5E7IA 2AL7A 4HAXA 1KK2A 2NO6A 3W90A 2G77B 3CNNA 3GLIA 2KE5A 2C95A 4BE7B 4FCTA 3T1QA 3QOFA 1N6NA 1CR0A 1W48A 2FPKA 2Z4SA 1N6KA 2G1JA 2ZITA 4LJAA 4HB3A 1NN0A 2PX3A 4A8JC 2J46A 1Q57A 3CF0A 1VHTA 2HF9A 3EZ7A 4TL6A 2JLZA 3NDBB 2A5JA 2WWYA 1MO3A 3AVWA 3QEJA 5EE9A 5CIQA 5SZKB 3U44A 5EP3A 3RWMB 3ADDA 1X1SA 4LBZA 2QTVB 1LV7A 1Q1BA 3NH9A 4UXHA 1Z6TA 3TUJC 1GKYA 1IONA 3Q7QA 4HB4A 3Q8XB 3RRYA 3SDZA 3OAAD 2VL7A 1YZNA 1YRAA 3QKUA 5AUQA 1F3OA 2BBOA 2XSZA 2BJWA 4JJKA 2Z0MA 3GJ0A 1AGRA 3K9GA 3KKQA 4V0LA 3B13B 3ZVLA 5LPNA 2QU8A 1P2SA 1B23P 1CXZA 2J41A 4HUTA 5IRCD 1W4RA 4M9ZA 3MFYA 2JJ1D 2ZANA 1ZP6A 4TSFD 1KSFX 4G01B 2H5EA 2N1BA 2DFLA 2QAGC 4PQYA 2O8EB 3FMOB 2A5FA 3AKCA 2C9YA 3TKLA 3PEVA 5LB4A 1N0VC 1TF2A 4A8JB 1OXVA 3U6KA 4BLTA 3VR6A 1BIFA 5DSZA 2FU5C 121PA 2EU8A 2P0EA 2BMDA 3K09A 5FOTA 2P6NA 4HB0A 2DY1A 2J0UB 2GKSA 4GPTA 3VKHA 4RD0A 5EXSA 3AM1A 4PZYA 3AGPA 4DEXA 1OFIA 2WICA 4BEJA 1KIMA 2RGNA 1W0JA 3L0PA 3QG5A 2JATA 2ZXUA 4KFSA 4HB2A 1M74A 1KI3A 2X2FA 1Z0AA 4QOSA 1U0HC 2NPIA 2ZI3A 1BMFD 4BEBA 2VQSA 4AYXA 2IYSA 1R8QA 2WVJA 3CR8A 3THYA 3ZZTA 2OFWA 1HE8B 1U9IA 3NTUA 3K09C 4TMWA 2PMKA 3EC1A 4TLDA 2Q3MA 5BQ5A 2WWFA 1U99A 2CLSA 1JECA 3ZIAD 3KTAA 4A82A 3OESA 4NPHA 1OHHA 2FSFA 4JKYA 1YR9A 5EE0A 1P60A 2OBLA 2FH5B 2O0JA 3MSXA 4KU4A 1SVSA 3ZVNA 1PJRA 3W34A 1F60A 2QAGB 1ZD1A 1DPFA 2SHKA 5LBIA 1JAIA 4B6FA 5SZIA 5EXPA 1J70A 1F5NA 3NC1C 2E87A 2ZYTX 3P32A 2H16A 1G18A 2OG2A 3TAUA 2QY9A 5K8IA 3K70B 1A82A 2FSIA 4WZAE 1GDDA 4YC7A 2OFXA 4LHVA 3B1WA 4LV8B 3BB1A 2V6IA 2WTUA 4PC3A 2VHQA 2FFQA 2GAAA 2QG6A 3L0SA 5CYPA 4LJ6A 2ZI5A 3SS8A 1XTJA 1CTQA 4PPFA 1ETUA 4BFSA 1U0JA 2EW1A 3O8RA 2OO7A 1KO5A 2B7CA 1JNYA 1DS6A 3LVRE 3LQRA 1SGWA 5HCIA 2ZUDA 1XEFA 1I4LD 2H1LA 1O3YA 3A1TA 1E2LA 5DLQC 5FTNA 1MR3F 2R2AA 2AX4A 2BJVA 1Y3AA 1RJ9A 1H8HD 2Q9BA 3VAAA 1WXQA 4S2EA 1NVVQ 3ASZA 4Q4LA 2O8FA 3QKTA 3FTQA 5AK0A 3GJ3A 2QM8A 4EQ6A 3BH6A 1VG8A 3H4MA 1W5SA 1OH8A 4BWYA 1CF4A 1JBKA 2ZE5A 5B64A 1Q22A 1SQ5A 1TUIA 3I5YA 2GEUA 3IGFA 3LBIA 4ON9A 1PLKA 1KI1A 1ZUNB 4JBXA 2GVDC 2NG1A 1JXOA 3ZQJA 2ZS9A 3DVLA 1BKDR 3T61A 1JPNA 4GMXA 4NYIR 4PC7A 4B73A 3UXMA 1ZIPA 2R6FA 4P4UA 3IILA 4UNRA 2DWOA 1N6LA 4PQRA 2R62A 4Z8XA 4NL4H 3AP1A 4DIDA 4CEHA 2BEKA 1JJVA 4JSYA 4ZCLA 2ZRJA 3PEUA 3THYB 2FV8A 4CEIA 5CLQA 2QRZA 2OILA 2PZFA 1WP9A 1NL3A 3QEOA 5L8VA 1M6NA 1PUJA 1W2GA 1N6HA 3PXGA 1IOZA 2P67A 1Q12A 1AZSC 2C8VA 3T34A 3ND8A 1VHLA 1NMXA 1VYVA 5FUYA 3W8RA 1TF7A 3B2EA 4LWZA 4FMDB 3K0FA 1UADA 3KUCA 4LBVA 1SULA 2V7QA 2ZRKA 1IJEA 1XP8A 4UJ5A 4DLTA 2GJSA 3LO5A 2VF7A 3UPUA 3QBVA 1S4QA 1AJEA 3SJBA 4KYUA 1G3QA 1OFHA 4W5HA 3T06B 2JCSA 2ODEA 1E2GA 3G82C 2IXGA 5FUVA 4IEIA 1R5BA 2WJJA 2X1VA 3R20A 3D8BA 5ELXA 3P20A 3MD0A 5CK5A 5B58C 1AN0A 2NO1A 4JMPA 3R7WA 2ZAMA 1I2DA 3IHWA 4B33A 3GLGE 2ZRCA 3CF6R 1P3JA 1TEXA 1FZQA 2CVFA 4ZDJA 1QBKC 1YKSA 3CRQA 4GRAA 2H7VA 4C30A 3KXKA 3EG5A 3PFIA 1KDOA 3P4XA 2G0TA 4Q9LA 1FMJA 2MSEB 2D2FA 1L2TA 5FL7A 2ASEA 1GZSA 4ACBA 3RS5A 3SJZA 3AF0A 4EFMA 1G5TA 1OT3A 3N5CA 2O8FB 1G4AE 1N6IA 4TL9A 4I1UA 4LRWA 3R9WA 1OH7A 3MWLA 1RPZA 1KNQA 1FP6A 2EWVA 4FMBB 4UXJA 2ZQ5A 5BYJA 2I4IA 4QGFA 3AVTA 1XPOA 4NCKA 3MWYW 4QBGB 4Z8YA 3W6NA 4HAVA 1A4RA 2MSDB 2GCOB 4TWZA 1R7RA 4K8OA 1E1QA 3RRNA 4JLOA 5EE3A 5E7MA 3K0AB 1R0WA 3CWQA 3S1AB 2GTPA 2DWQA 4ZI3A 3U3KA 3EX7C 5FBQB 2QN6A 4A36A 3TE6A 3OEEA 1T3LA 2F1JA 3F8TA 2YOHA 1N6PA 1N0UA 1TQ4A 2CJWB 5J5CA 3TH5A 2YV5A 3W3ZB 1E2DA 2WAYA 3SQWA 1ELOA 4TYPA 1KI9A 2D62A 4WW0A 4BECA 2J0VA 1E4YA 1WDTA 4IXNA 4V0NA 5JWHA 3SN6A 1IN5A 1R4AA 1E1RA 1T3SA 4ZIRB 2ZYVX 2KB0A 4RZ3A 3K0FB 1IN8A 1KHTA 2EFHB 3RWOA 4AKHA 1D8TA 1FUUA 4TMKA 3QSYA 1J8MF 1EFCA 2IF0A 4RD1A 4U5XA 4PSKA 4LGMA 1T3HA 4JLJA 1C4OA 4WXPA 2IEYA 5KNCA 5TDHA 1F2UA 1ZNZA 3RHFA 4DLWA 2QMUA 4K46A 3V4FA 3DEFA 2ZJYA 3NXSA 1XB2A 5AUNB 1XMSA 2YYZA 3LVQE 1T5LA 3T5GA 1D2MA 2KSQA 2ANBA 1G7RA 4TLBA 3UIEA 4A0FA 2ZVPX 4M1MA 4QRHA 2O8BB 4JVLA 3RYTC 3EPKA 5F3WB 4DB4A 2YHSA 3TIFA 2QP4A 3FKSD 3I92A 1GL7A 3MJHA 1EWRA 2D3WA 4XOIA 2GZAA 3QENA 1VCNA 2F6RA 3AUXA 3UWOA 5F98A 4B44A 1QHXA 5TB5A 4ZDIA 2CHGA 1NVUQ 4HAYA 1G20E 1NBME 1OSNA 3R9XA 1ZUHA 5EZ6B 2IL1A 3MWJA 5CM9C 4Z54A 4URUR 2XZOA 2XGJA 4C0AC 2NMVA 2H8KA 4URXR 1K5GA 1ZC3A 1G7CA 1DAIA 1NVXQ 1P75A 3GEIA 2GZHA 2GK6A 4AKGA 5DN6D 1D2EA 4GOKA 1GRNA 5TV2A 4FN5A 4XD7D 3I62A 1Z0FA 3BXZA 5AR1A 4XJXA 2WBLC 4L5BA 2ONJA 3RC3A 1E2HA 1UDXA 2EYQA 1BYIA 5FTMA 4RJLA 4B34A 3ADKA 2VYFA 1DAKA 3IDQA 4OJQA 3RDPA 2ZROA 2VF8A 3TW8B 2DPXA 4O2LA 3AVVA 2TMKA 1KOFA 2D7CA 1NG9A 4GT1A 3UG7A 5EQTA 2A2ZA 2IUSA 2IBMA 1DO2A 2ZYWX 2IUUA 2BCJQ 5AJWA 3WP1B 4F92B 4RFSA 4IOLA 4RCZA 3H1TA 2CK3A 2CCJA 4GZLA 2QMEA 3JVVA 3AF3A 4LDJA 3W8NA 2GF0A 4LJ7A 1Z28A 3G0HA 4JLBA 1SHZA 4V0KA 2E1RA 4DT1A 1G8YA 4DZZA 5CK4A 1E9RA 4EPTA 1SVLA 3KJEA 4Q4AA 2IYUA 1RIFA 1Z6YA 1TNDA 4TYQA 1ONBA 1KZ7B 1OYYA 1L4YA 1IY2A 4O3MA 3ONWA 1YR7A 1MV5A 3A1UA 1RYFA 4DDWA 3VQTA 4UNQA 4Q47A 4TYYA 2P2LA 1G4UR 3QBTA 4PC2A 4GP6A 2X2EA 5FOWA 5FUWA 1JXMA 1Q0UA 1OH6A 4TLCA 4KLZA 1GUAA 1CR2A 3H86A 1G17A 3T35A 4QXAA 5J4LA 3SEAA 1RZ3A 3A1SA 5AJZA 1YU9A 2BM1A 4JL8A 1YZKA 1OB2A 3M1IA 1X8LA 5DO9A 1YR8A 1C9KA 2VHUA 3B1VA 3QJYA 4M1KA 1RVDA 3X1WA 4CZ2A 2FDCA 3DO6A 2GZDA 4DDTA 1GITA 2QMOA 1EFRD 1VMAA 2JJ2A 5DI9A 3HP1A 3CO5A 3Q9LA 5CJ2A 1EG7A 2AWOA 3B1XA 4MRRA 2DFTA 5IK2D 4XSHA 4IDQA 3Q5DA 1E9FA 4N1AA 4TQ9A 1TUEA 2DYKA 4XTCS 1L4UA 2CDNA 4Q9KA 5IDVA 1QG2A 4Q01A 3TGPA 3DL0A 4PANA 1E2NA 2PCJA 3MWKA 3OF5A 4JBWA 4IOKA 1IY1A 2JLYA 4D25A 4QJ5A 5FPTA 2PT7A 3WXMA 5BN4A 3SC3A 3X1DA 4A9AA 5M04A 1ESMA 4I99A 4C2UA 1U8ZA 5BN3A 2W0MA 5BXQC 1RE0A 4OQXA 1GTVA 3QG1A 4GOXA 2W58A 1G41A 1DELA 3C16C 4BFXA 3TVTA 3I73A 3PIRA 1KGDA 1SVKA 1UPTA 3TMKA 1Z8FA 4BLSA 1P61B 1XPUA 3K9HA 2NO9A 5EXXA 3I4LA 5JS8A 4LK2A 1NF3A 2RMKA 2XOKD 4UJ3A 2NQ2C 4JL6A 1GFIA 2NPFA 4DT1B 2QORA 4PR0A 4NMMA 4NP6A 4AD8A 1E79A 1EX7A 1XTRA 3B5JA 3BOSA 4Q1BA 1U98A 2YOFA 4Q4AB 5FR2A 521PA 2ZU6A 1FQKA 3ICQB 2GEDA 4B3DA 3NC0C 3QVVA 5AWFC 3EXAA 1G6OA 1SXJC 4D2IA 1FPMA 1IN7A 1KDTA 4KFUA 1OIWA 3W6OA 4OI1A 1ZD9A 2OFOA 3ZJYA 4D26A 4DLYA 1GP2A 3WNBA 3BERA 2V6JA 1ZU4A 1CJMA 1VDZA 2BBWA 2P6RA 1WQ1R 3EARA 1VYTA 3CM0A 4LC0A 1D5CA 5JJLA 2OV2A 4C0SA 2VP9A 1Q20A 4IW3B 4J0QA 1TADA 4DLUA 2RH5A 1KNXA 3K53A 4W5JA 4P0TA 3BGWA 1LS1A 4C0JA 4AURA 1UBGA 4PHTA 3OE7D 3U7GA 3HPRA 2OLKA 5EXTA 1PV4A 1J2JA 3NWJA 2CNWD 2R44A 2AK2A 4IOJA 1GNRA 2W00A 1E96A 2X8AA 1S2MA 4BRWA 4C0KA 1N3BA 3BWDD 4E09A 2QBYB 2QTFA 1YZUA 3QI2A 2JA1A 2W2XA 1J7KA 4PO1A 3SBDA 3SFZA 2UZ3A 2CL7X 4FWIB 4DVGA 3Q72A 4I4LA 1TU3A 2ZU0C 2ZJZA 2JLXA 4DLSA 4FINA 2UKDA 2QSYA 2VH5R 4PC6A 5JHGB 1SXJB 5AJXA 1G1MA 5GJVC 3CX6A 4I1VA 3REFA 4TZ0A 3T5DA 2BC9A 3LFUA 3CIOA 2HCBA 1E0AA 2QM7A 4Q02A 4AYTA 4MGZR 1NLZA 5AJYA 1KDRA 1P6XA 1G8FA 5FI0B 3CWZA 1E0JA 3Q85A 2JIZD 1JR3D 1E0KA 2VLIA 1CJKC 3BH0A 3MAAC 3RLFA 4M4SA 2MSCB 5F9HA 1COWD 1YR6A 4DLRA 3LLUA 4PQFA 4A0HA 4B3FX 4XWKA 4PTLA 2V3CC 4G5OA 2QE7D 4CT4B 4WVFA 4Q7LA 3AV0B 1GRQA 3BRWD 2XXAB 2IYRA 1HV8A 3EA0A 4R71A 1KI8A 1ZM3A 1TL7C 1II0A 1MO6A 2OXRA 2YVUA 1E99A 3UMRA 4W7SA 3KKNA 3BFXA 5EZ5A 5KNDA 3AVYA 5A0FA 1S9DA 4Q66C 4IOMA 2IUTA 2V9PA 4ITRC 1KZGB 5G3YA 4Q5IA 4WZBE 2WIAA 1P2UA 1XCPA 5DYGA 2PZGA 2GK7A 2KBFA 4NHOA 4P32A 4NCHA 3KZ1E 2EQBA 3GD7A 4JBYA 2O0KA 4QHYA 2AK3A 4F91B 3IKJA 5D3MB 5L3RA 2ZRFA 1CU1A 2C9OA 2BVNA 1XEWY 1ZINA 1R2QA 1M2OB 1D9ZA 1OV4A 2IYTA 3GLHB 5DYIA 2C98A 3L0IB 1MABB 1W47A 2ZSEA 1AQYA 4UNSA 5J47A 1I4DD 3GEHA 4TLEA 2IEZA 2GA8A 4GNKA 2BKUA 4PSVA 3CPEA 4H9GA 4TLAA 2ATVA 2WJIA 2ZS7A 3PENA 3W5IA 4PHGA 2CLDX 5FTLA 4LHWA 3H0KA 3VU9B 4OI2A 2ZE6A 3IQXA 1UFQA 1QRAA 1T91A 2F7SA 2VRWA 4HYYA 4LBYA 3DZDA 4OYHA 3WNCA 4AYWA 2ZRIA 2NO7A 4NU0A 4AY2A 3BFKA 5KDOA 4ASUD 5GJCA 1E69A 1SXJD 3CNOA 1N0WA 5E4FA 3E70C 5H8WA 1A5TA 3RS3A 4HAWA 4P33A 2V1XA 5DHFA 1ZCAA 1NN5A 1E4VA 2ZSAA 5LDDC 1X3SA 3BB3A 3U3JA 5CM8B 4P4TA 1S3GA 3RS0A 3VX3A 3ZD6A 3KB2A 3ICEA 1XJ0A 2F9MA 3LLMA 2RGDA 1MO5A 4BUJA 1FOEB 3IPYA 3BC1A 5FOVA 4PZZA 3JZMA 1G5PA 1Q1QA 4BFUA 4QFMA 4UKDA 4URZR 5AUPB 2FGJA 4B47A 2WOOA 2WMNB 3D6TB 3TK1A 1Z0JA 5JRJA 2F43A 1AS3A 2IWHA 1Q44A 1WMSA 1XEWX 4HAUA 5IF9A 1EXMA 4Q4JB 5SZHB 4MA4A 1W36C 1G3RA 4U00A 2IW3A 3U2QA 4UNNA 1U81A 3FMIA 3SYNA 1W5TA 4II7A 1VG0B 2ZJ2A 1K6MA 2W2VA 4PFSA 2YJTD 3LAWA 1KK3A 3SYKA 3QXJA 5B30A 1P72A 2GXUA 2IYZA 1K8RA 2FF7A 2VP2A 4C0QC 4CRWB 4DDVA 4XIGS 1J99A 3O8CA 2ZETA 1OXSC 1KJZA 1CR1A 2VBCA 4BFVA 4XWAA 4E07A 1VCMA 3P26A 5HKKD 2YKGA 1KKMA 2HUPA 3K70C 2KI5A 3ZGXA 1JPJA 1XX6A 4JLMA 1UBCA 1E32A 1AZTA 5DHAA 2HT6A 3PEWA 4PO9A 4G0NA 3GJ5A 3THOA 2ZVQX 1XDBA 5J40A 1CLUA 1H8EA 1ZAKA 4KVGA 2XX3A 4WA7A 2PH1A 5EE1A 2NZ8A 2W2TA 2PEYA 2KBEA 3L0OA 4TTPA 4C9BA 3GPLA 4BPBA 3FFBA 2LCFA 2DB3A 1DAFA 1MKYA 3GLIB 4B74A 5TY0A 2IXFA 2IT1A 1NBMD 3A1WA 2WAXA 3RS4A 1E2JA 4KFRA 4AI6A 1NP6A 5TXGA 4YDSA 2IHBA 1P62B 4OHWA 2HCJB 3QF7A 4EJSA 2HJGA 1DVRA 1DARA 5TVKA 2OCAA 3GJ6A 1EK0A 1W36B 1FQJA 4BZXA 2W6IA 4QHSA 4EFLA 3QPWA 3U44B 2WPDD 1FNNA 2IS4A 1NMZA 2X77A 3VX4A 1P9RA 4QM6A 1PLJA 2RGNC 2J59A 5IT5A 3ZVRA 1BOFA 1DEKA 3L2OB 1VG9B 2ZEJA 3ZQ6A 2WSSD 2XB2A 2ZTSA 4HAZA 1XEXA 3NHBA 1Y63A 5B2ZA 5K8TA 1IJFA 3OFNA 1GAJA 2QT0A 4MRVA 1D6JA 3UKDA 3CW2A 4LYHA 1I4TD 2G88A 3LBHA 5FL3A 1U9IC 4GOJA 5F2EA 3IPXA 2ZUCA 1BYUA 1I2MA 1NIJA 4TT3A 5IHPA 4X8MA 3WMEA 4M1SA 4V02A 3RANA 2A7QA 1VG1A 2DHRA 2OESA 2BCGY 1NVWQ 2FEOA 3KL4A 2RCNA 1LB1B 3OIVA 5BW8A 4DLZA 4Q9IA 3DPUA 3IEUA 5KU1A 3LXXA 4EPXA 2XTMA 4HATA 2IS6A 3VFDA 4TN1A 4E22A 1W0KD 2O0HA 2F3RA 3CH4B 5JHHB 1NSFA 3FGNA 1E2QA 2GESA 3MMPA 3GJXC 5H68A 4LJ5A 4TTQA 4KV9A 2VSXA 2EFDB 1RYHA 1JR3E 4D80A 2F1HA 4DEYA 2KWIA 2F1IA 4NYIQ 4DCNA 2FZLA 4WXRA 2LKDA 2DFNA 3B1ZA 2R9VA 3D3QA 3OEHA 1NY5A 1OB5A 3AB3A 4MRSA 5FPYA 5E3HA 4RSGA 3AKYA 4MYCA 4BLOA 4ZCMA 1XJQA 1AS0A 3CX7A 2RGEA 4EJSB 1BS1A 4MGYR 1T0JB 4YONB 4TMZA 2L0XA 4BRUA 5L3QA 3K0CA 4UNPA 3AEZA 1XFAA 4DLXA 1Z6GA 1Q3HA 1WF3A 2JLVA 2GHIA 5GADl 1NRJB 2VP5A 5JWRA 2P6UA 1OLOA 3KTAB 5BYKA 3NBFA 4FXPA 5J4YA 1HE1C 3I8XA 3NH6A 2IX3A 2QPOA 4A0RA 2FA9A 4P4SA 3PG5A 4OJKA 1WBBA 2IYVA 2A3RA 3TR5A 4R2HA 1JB1A 1NJFA 1XEXB 2GVZC 5KSYA 4B3BA 4YLGA 4Q4HA 3KUDA 5JZVA 2J3EA 2WKQA 4CVNA 4DBLC 1T4GA 3DMNA 1XU4A 1WA5A 2QGZA 2ZJAA 4AKEA 2C78A 4MKFA 4KXFB 4LHZA 3U6BA 2YOGA 3B60A 2GRJA 3AGQA 3BK7A 1LW7A 3P27A 3K70D 2PLRA 2XSZD 1LF0A 3QVUA 2DCUA 2VHCA 4ABYA 5KTYA 3OZXA 5KPJA 4TYWA 1Z83A 3LV8A 1OXXK 2XNDA 4MH0R 2J1LA 1GL6A 3U4QA 4DWJA 1KI4A 1UKZA 1RJ9B 2VSOA 4ZO4A 3WP0A 4GMDA 5JECA 1UJ2A 1XD2A 2PEZA 5FOXA 421PA 1UEJA 3ZZ0A 3TSZA 4EQ6B 2RGCA 2EFGA 2R6GA 3CRW1 4HDCA 1ZCBA 4TZ6A 1CJUC 2GAOA 2C77A 2JLSA 2ECKA 1LFDB 2D74A 1SXJE 4OHVA 4L9SA 1GOTA 2VTKA 1Z0IA 2IYQA 4R98A 5C2JB 4XVQA 4F4IA 4DXAA 5FOUA 4AWXA 3QUSA 4HLCA 1T5IA 1L8QA 4HDOB 5F9FA 2AXNA 3BS4A 1S1MA 1YZLA 3DMDA 2ZM5A 4RKFA 3AF4A 1PUIA 4OK5A 2G6BA 2RKOA 1E2EA 2NIPA 1G291 4Q19A 4CEHB 1W0JD 2P5TB 1E6CA 3Q7PA 4U7DA 1N5JA 2ZI9A 4A1FA 2ORVA 1PZNA 3EWAA 3IHLA 3GJ8A 3IO3A 4NE2A 4CEIB 2Q3HA 5KSZA 4DUGA 4DKXA 4DRZA 1QZXA 4HI0E 1O87A 2GJ8A 4TTRA 1G8PA 5KSOA 1BH2A 2AKYA 4Q7MB 2OCYC 2I1VB 1ZNYA 4BZPA 2JDIA 4X8LA 4M1OA 3QE0A 5KDLA 1JQJC 4JYBA 621PA 1LVGA 1EFHA 2QQ0A 1YE8A 1OHHD 4RD4A 4OI0A 2W0SA 2XITA 3QXCA 4IRUB 2QAJA 1G64A 2FE4A 2AR7A 3SYLA 4XWOA 3B6EA 2YWFA 1R0ZA 3IBGA 5CDFE 2DWPA 4OK6A 4GZMA 4RVCA 3U3OA 3A36A 4MQBA 1FL9A 3R7WB 1LY1A 1KK1A 1MRNA 1B0UA 2F3TA 2GXQA 2CMKA 1LTQA 2QZ4A 3VTKA 5FBVB 4F4CA 5KNBA 1XF9A 2W6JA 3GLHE 1LNZA 3RSOA 3UATA 3AVPA 1ZUIA 3ZD7A 5FOSA 3PUZA 2REBA 1LS6A 4EPWA 3U4QB 3GJ7A 2ODBA 4KBFA 3CONA 1S0UA 2ZSDA 4K81B 3SR0A 4KI0A 4QHTA 5TARA 4N0EA 4IDHA 1J8YF 1FMLA 3GFOA 3EPJA 3SBEA 4ZDKA 1KO4A 1NN1A 4Z1MA 3PUVA 3I5XA 1VIYA 2WKRA 3B78A 1CRQA 4NH0A 1XTSA 3KDSE 2EWWA 1YZTA 5JSZA 2WJGA 2Q0HA 3SU8A 3K0EA 2ZRMA 3CNLA 1W49A 1E9DA 4NYJR 1M7HA 2Z5FA 4HUQA 5B57C 1W1WA 2LKCA 4MRNA 4E5UA 3NVAA 3BB4A 1II8A 3ZH9B 1VTKA 4HZUA 3C8UA 1IXZA 4L15A 4TQUS 3PEYA 3QQ5A 2WHXA 5FBRB 3IQWA 4CF7A 5K8LA 4A2PA 4DSNA 4M2LA 1VIAA 4O0MA 3A6PC 2Z83A 4L8GA 3PCRB 1JI0A 4LOAA 3W6PA 4B75A 3BAFA 4YXWA 3ADCA 1XD9A 3T1OA 5FFMA 1Q1EA 2BIFA 1OF1A 1P4SA 5P21A 2JGNA 3C5HA 1W2HA 4URWR 1KK0A 2JLRA 1G5RA 2ZYUX 2J9RA 5CIWA 2QROA 4BFTA 1WBDA 3VR4A 1F2UB 3BFVA 4RZ2A 1U94A 4D0NA 3KXLA 2V7QD 4KCGA 5FBWB 1Z2AA 3ND9A 3FMFA 1ZVQA 3HR7A 4OKSA 5HTKA 4O25A 2WJHA 4F4JA 4KHZA 4EPYA 4I1SA 2J7PA 2D2EA 5J4KA 2GNOA 4QJ4A 3KFVA 3RC8A 4FMCB 4KFTA 3GCGA 4F7WA 1HYQA 4D4LA 2BWJA 4QC2A 1JQLB 1DE0A 2OCPA 3FHCB 4DCVA 4G5QA 1JJ7A 1EX6A 1XTQA 3EIEA 1QHYA 3AVOA 3QXHA 3VKGA 1IN4A 3DM5A 3PUXA 4M0LA 3K8YA 3F5FA 2OM2A 3TSOA 3GLIE 1OKKA 5FL7D 4PAQA 5FPKA 4LSGA 1J90A 2IYYA 2GBLA 1XJCA 1GSIA 2WJYA 2YNMA 3EZFA 3D31A 3U3RA 4N3NA 3TBKA 3VHLB 3HJNA 3FHOA 2BMFA 3DOFA 1DOAA 2HLDA 2XAUA 4FMDF 2HYIC 1RRCA 4DHEA 5EE5B 1NLFA 1ZRHA 2C03A 3CPJB 1CBUA 1OIVA 2C9CA 1XPRA 2B8TA 5EP4A 4DIEA 5G53C 1HH4A 1E1QD 1YJ5A 2IYXA 1NKTA 4HLUA 3OIYA 1XCGB 2QI9C 1VECA 1Z06A 2XEXA 2ANCA 3OEED 2JLUA 5CJPA 2CHQA 1AS2A 1G6HA 2WOJA 3ZZUA 1KI2A 4RFSB 4LBWA 1ZNXA 3AF2A 3TUZC 2GJKA 2Q21A 3ADBA 2ZI4A 3B9QA 4W5WA 4TQAA 4XVRA 1MT0A 2RGGA 1II9A 2ZJ8A 1GL9B 4GFDA 2OT3B 1OYWA 3HU1A 4PPQA 1EFTA 4OQLA 3KQLA 1E1RD 4QNRA 1M1YE 1XZQA 4IFEA 4ASUA 2O8CA 4AKIA 2OLJA 3Q5EA 1KMHA 1X6VA 4NCJA 2QL6A 2B8WA 4IJMA 3E5HA 2JASA 3KXIA 3QKRA 4JLKA 5LD2C 1W46A 4JLDA 4PX9A 3QIAA 2GXSA 5GVRA 4NKRA 4WIAA 4PAMA 2P3SA 4QGGA 4B6EA 3M0EA 1WE2A 4OQMA 3LW7A 4GI7A 4W9MC 2WWIA 3SFVA 5JJKA 2CVHA 3OAAA 4IKEA 1IXRC 3AVUA 2E9SA 2ZSBA 1T6NA 1OXUA 3TNFA 1V43A 4FIDA 2FSGA 2C96A 1Z3IX 5KSPA 1P9NA 2Y8EA 4M53A 1T9HA 4IFBA 3TLXA 4TMXA 1UBEA 2FGKA 3IIKA 2JEOA 3LW8A 1S3SA 5G3ZA 4R7ZA 2JJ1A 2ZI6A 4TSFA 4IVRA 3TQFA 2QPAA 1E0SA 2ZPTX 1OXTA 1YZGA 3ZVMA 2QP3A 4WBSA 3K1JA 4EFNA 3D7MA 2HV8A 2NGRA 5KYKA 1D9XA 3EIQA 3LY5A 1KI6A 1AM4D 4QGAA 4FI3C 3PV0A 3KJHA 4MDFA 4LV5B 1M7BA 3M4YA 2V1UA 1ZJ6A 3FB4A 3DM9B 5LD2B 3EPHA 3UG6A 4FCVA 5C46F 3DOEA 3P1JA 4RD2A 1ZM7A 3T12A 3ZS9A 1VCOA 1R0XA 4B2LA 3HDTA 1AA9A 3LQQA 3MGCA 4MYUA 1E9SA 4PHFA 4B3XA 1G9XA 1NJGA 4IHQA 2BKEA 4CEJA 4MYHA 1E94E 5L3SA 1G8HA 2DBYA 1KY2A 2V55B 4LYAA 4QKQA 3BIFA 1BMFA 4ZCIA 4C2TA 2R6DA 3O8DA 1XNJA 4B35A 1RRPA 2FSHA 2BOVA 4LI0A 2CK3D 2FG5A 1GM5A 3QKRB 5FI1B 4CT5A 3WY9A 1IN6A 2F55A 2VA8A 4JYCA 2OBMA 3RSLA 3OIWA 3ZIAA 1E9AA 4IDNA 1Z08A 4LHYA 2A5DA 1KSGA 5CB6A 2ZRDA 5JEDA 5CLLA 4RCYA 1R8SA 4FW9A 4IDPA 4R2IA 4MGKR 1AIPA 2YC2C 2ZS8A 3Q3JB 4QBFA 2V4ZA 3KQNA 5EUMA 1DAGA 1JAHA 4QM7A 1W4CA 5FUXA 3EIHA 4D4KA 4Q1CA 2AD5A 3EA5A 1P73A 4DC9A 4URYR 4ACAA 4DCUA 5BWMA 2BEJA 3KKPA 1QHSA 1G7SA 2RGBA 5TMPA 2ZRLA 4A15A 4C4PA 1CJTC 2Z6VA 4AC9A 1A2BA 2GF9A 4EDHA 2JJ2D 4HEJA 4GBMA 2FN4A 2OAQ1 2YZ2A 2UVQA 1M7GA 3NEJA 1KI6B 3AKDA 2D06A 2R8RA 4M22A 4A6PA 1A1VA 1H8HA 1GWNA 4JS0A 4CYMA 2ZRNA 2ZRPA 2GWHA 3FMPB 2BMJA 5J4HA 1Z5ZA 3MJRA 2VEDA 2BBSA 2ZR0A 4LJ9A 5DE3A 4DDUA 2ORWA 2V8OA 4ESVA 5HE9A 2FJUA 3AUYA 2O8EA 1T0HB 1NN3A 4JVMA 1GKIA 3PITA 4PZLA 1KO7A 2ZRAA 3SOPA 4Q7KA 4MKGA 3BH7A 4PSAA 2JAQA 2EYUA 3I3SR 1IY0A 4BFWA 2FFHA 3LNCA 3SNHA 2IYWA 2B21A 2J0UA 2WIBA 3WRYC 3KQUA 1W7AA 1U0LA 1U90A 2FFBA 6Q21A 2AFHE 5FBLB 1XMVA 2F9LA 4DSTA 1W4BA 3SHFA 1KJYA 5AUOB 4RD3A 4I1OA 4LJYA 3FKQA 3MUFA 3U60B 1DBSA 4ZV4A 3NKVA 8OHMA 2X19A 3CPHA 1SVMA 1E79D 1QVAA 2ONKA 3K0SA 3N70A 3I61A 1GVNB 2XB4A 2BMEA 1YRBA 2I1QA 2FPMA 3C4JA 3VR3A 3V00A 1KYIA 4IVQA 2ZAOA 1XZPA 3HR8A 1N25A 3UMSA 4B76A 4DLVA 1OW3B 1TQ2A 1U2RA 4JLNA 2REOA 4NCNA 2AWNA 1FX0A 2AHOA 2CCGA 1HUQA 1DAEA 2QAGA 3RNLA 4A2QA 4US2R 1KI7A 3K9LA 2G1KA 4U02A 2DR3A 5JCZA 4AK9A 1Q3TA 3WYAA 2ZUBA 2BV3A 4JLPA 4MKIA 5C18A 3QKSA 1OIXA 1U8AA 1FNMA 1D2NA 4WAUA 3P4YA 3CLVA 4PC1A 4GSYA 1ZU5A 1DAHA 4Q9JA 4FD2A 3FE2A 1ODFA 3W9YA 1FW6A 3KQKA 3GP8A 3IBYA 4HSEA 4UQOA 3THWA 2ERYA 2A5YB 2OSBA 2N42A 4KYIB 4QBIA 5KO2A 1A7JA 1CIPA 4C0HA 2J87A 1U8YA 3A4MA 2YWGA 2MMGA 4RFVA 4WOPA 3T1TA 4RD6A 1R5OA 1JR6A 1Q21A 2AFIE 4KSBA 3PR1A 3I1FA 4YMVA 1HT1E 3LX8A 2GCNA 4C0LA 4EAQA 1UAAA 1Z07A 1WB9A 1SKYE 1GNQA 2ZJOA 1LF5A 1R0YA 3KKMA 1KDPA 1Z63A 3CZQA 4H1VA 2RB4A 3TQCA 1G21E 1ZM2A 3VR1A 4Q1EA 5JBQA 4LCBA 1NKSA 3FVQA 4OBEA 4XSGA 4BGDA 3CKLA 4F38A 5DI3A 1ZNWA 2NO0A 4LHXA 5DH9A 1US8A 2G3YA 4KAXA 1ZM4A 2BHRA 5KUTA 1MOZA 4V0MA 2OEPA 4D82A 1RKBA 3NHAA 2REXB 2DFKB 2J45A 4NTZA 4GP7A 2F43B 5SZJA 2JLQA 4EJSC 2HYDA 3LA6A 1A2KC 3RVBA 3EW9A 1HA3A 1KO8A 2R65A 3IO5A 4A92A 2D7DA 4XTRA 1FX0B 2CL0X 3LXRA 2KJQA 3E2IA 4KJZA 2RAPA 3X1XA 4URVR 2WMOB 3DKVA 3AVXA 3QXSA 3HYRA 1SVIA 2EFEB 1ZM9A 5GJBA 3QKSB 3ZS8A 1OPXA 3WHKA 1P5ZB 1E2PA 2XTZA 2J7KA 2PJRA 3FKSA 4BASA 2WM9B 4DB2A 1CULC 1XXHA 4TMTA 1C1YA 3A4LA 3PUYA 1KAOA 4G5RA 3FFAA 3THWB 3A8TA 5J4VA 1F2TA 3EZ6A 2R6AA 2P65A 2ZJBA 4YMUA 1IAQA 4BLRA 3OHMA 2CE7A 4XVUA 3CB4A 3X1YA 2YWEA 2C99A 5EP2A 3MLEA 4AG6A 3GQBA 2RGAA 2RHMA 3DDCA 4YMSA 2VP4A 5DN6A 2GDJA 3VHXA 1MO4A 1NVVR 1OJLA 3FYHA 4P31A 1QF9A 4XD7A 1DG1G 3TR0A 1NIPA 1QG4A 4MKHA 3VR2A 3VNUA 2HDNB 3EC2A 3SHWA 2FMXA 1NSTA 1TF5A 2AD1A 2OCBA 2GCOA 3HU3A 4LJ4A 3GLFA 1YHNA 3F3YA 1KMQA
chains in the Genus database with same CATH superfamily
3E58A 4NYMQ 1C7ZA 1H6BA 4QYSA 3SJAA 3OHPA 1KP9A 2Q2QA 1A2OA 3FCUB 1YMUA 4L16A 1VP9A 2Z5GA 5DI3B 3VZCA 5YASA 1ZGZA 4F3NA 3PZRA 2PLAA 4Q18A 5DM70 4U7JA 2RDMA 3GX1A 1KIAA 3QFFA 5F78A 4LXXA 2APJA 2VRNA 3E9ZA 5EFOA 4I3HA 4EB0A 3VC1A 3WLRA 4MI6A 2FPGA 5JC8A 1L6IA 2R6CA 1HEIA 1V5GA 2HJ9A 2ZUVA 3DKPA 4L9WA 4LRYA 1NU6A 4RADA 4Z51A 1E3WB 1UKYA 1V4BA 4OJTA 4U7HA 3DZ8A 4A4DA 1YR2A 1J21A 2OZLB 1IK6A 2R5FA 4MB2A 5G0UA 1EFAA 4FFMA 3N0WA 1XKLA 4DNOA 3B53X 1KEWA 4ERXA 2AKEA 3HCBA 2HUNA 1C0EA 3WTBA 3JVEA 1PVOA 3RHSA 1E9EA 2A78A 2PKWA 4FYWA 2E89A 4LXYA 3IA7A 5L4NA 3OCJA 1NA5A 4QYXA 2QYOA 2R6HA 3CRNA 4ZJPA 3G5LA 5H1YA 1TFUA 5BQPA 4QTYA 2ID9A 3JARB 3MMXA 3FPAA 4X7RA 3LL7A 2HT1A 3R6WA 5C5EA 1DKUA 4JVSB 1DQNA 2P27A 3RYCB 4HGYA 3WWPA 3TRFA 2CE2X 3PSAA 4O4LF 4EYSA 4DSUA 5L40A 3RT9A 1PZGA 5JI3E 1C41A 3EGXB 1U31A 1THGA 4LZAA 2E48A 1T4DA 4FFSA 1JLLB 5EIXA 3LLSA 1J97A 3EY9A 2HH9A 5CT4A 2IE0A 3JTMA 5EZYA 4QBTA 5KQGA 4XFKA 4BOYA 2OM6A 2AEFA 3KVRA 4PLHA 1OYVA 3UAXA 4IMRA 2WJ4A 3A31A 4YMWA 3C8HA 3I34X 4JLVA 3WQBA 2XLBA 2NW6A 3K5HA 4S12A 5CVVA 1H8ED 3EMDA 3UW1A 3SQXA 3I9KA 3OQJA 1KYTA 3K9WA 4PLVA 3R7DA 3EVAA 1UPXA 3LHFA 1EVEA 3FAKA 4G8JA 2O5VA 3K0HA 4UVEA 1LWOA 5JMWA 3KEGA 3JAKB 4ZVRA 1LXCA 1KY4A 3O8LA 2AC2A 4ZKDA 1M34B 5HZKA 2PE5A 1ESNA 2WTNA 4JYMA 3Q4GA 3M8KA 3W7VA 1FEZA 3ST7A 1NXPA 2OHXA 3KT6A 2WWWA 3VZBA 5B6PA 3GT7A 5IVPA 2I3AA 3VVCA 5MGNA 2AUNA 3OE1A 3QEMA 3VBEA 1BCSB 3H2ZA 3ICWA 4D3SA 1JJAA 3BRQA 2FRXA 2CNKA 1PJZA 4LJ8A 1GPLA 3ILHA 2AFVA 3MRSA 3H84A 4JXKA 4WKPA 1ZAYA 1R4NB 2HJVA 2PJZA 4QFBA 1EXVA 3UBTA 4LXIA 4N01A 2XQIA 3VU0A 1CUWA 3GB9A 3I8SA 5B7GA 2C1ZA 4BKRA 1QHGA 3EWSA 4S35A 2VNJA 1F2VA 3UVEA 4OQ4A 4ZMBA 4Q1DA 5JFGA 3ZWPA 1J8DA 1I2ZA 5IBRA 3ED1A 2EZ8A 1CUBA 3NALA 5JPDA 3NIDB 4H1UA 3RQSA 5COBA 2VZ8A 4CJXA 1JG2A 3FDJA 3IULA 4MK4A 1U0NA 4BMZA 1UMCB 3JALB 3PFFA 2XOKA 4Q3OA 3PQ5A 5HDBB 3CY6A 1G7TA 4AJNA 2ATXA 2OD9A 4UEJA 2GN2A 1FU7A 2NUAA 4G1UC 2HXYA 4KO8A 3SJCA 4B32A 3LUPA 3U4CA 2N46A 1PR4A 1Q0SA 3EBOA 3NDPA 1XVUA 5KPDA 4DA0A 1ANKA 2QQEA 3JXEA 5CJJA 4QT4A 2OC4A 1V16A 4TT3D 2W2LA 2ECQA 2JHFA 3GEEA 1ZJZA 1PYGA 3SXPA 4ZI7A 4XXHA 3N5KA 3M5WA 2VHEA 3SGLA 4H35A 4ALLA 2BFPA 4ND8B 3EXFB 2I6GA 4BNVA 2NT4A 3N05A 3AO0B 2DSTA 2ZYDA 2FPIA 5AQEA 3ZY3A 1EA5A 1ONPA 2B6NA 2HKIA 2FFAA 3I05A 2VNHA 2A1IA 3OTIA 4ETMA 3I9V1 3RV4A 1SBHA 1BDIA 1QV9A 3A3PA 4EPVA 3RABA 4HK4A 4N7RA 4Q05A 1L5SA 1F4VA 3E03A 4RVGA 1P4AA 1QYIA 1ZJ5A 5CT8A 4ZQFA 5TMDA 5KYWA 5SYMA 1QZ3A 3DW3X 5T3YA 1C1XB 3WNDA 3K1YA 4DPMA 1I8TA 4UM5A 2WWGA 5FH9A 3OD1A 4LYEA 2Z57A 2XTAA 2ZTVA 3EC7A 2XQKA 1RHMA 3QUBA 3ZJ5A 1JTVA 1DZ3A 5EIWA 5G0WA 1WR8A 2BBTA 3WYGA 4K8RB 2NU8A 1RI5A 3QE3A 4JROA 4X1KB 1E4EB 4KGXA 3AFNA 2INGX 2NOAA 4UTNA 3CMMA 4TGLA 3X2FA 1W4AA 3OZAA 4FSDA 5E9JA 4RIGA 2ID4A 4D9CA 1JQDA 1ODIA 3RTCA 3KYCB 1TEVA 3THYA 4R41A 3R8CA 2VTDA 1UWKA 1WTCA 3FHTA 1BMTA 1S96A 821PA 3EMBA 4FCWA 1DOHA 1NP7A 4UD2A 2AMYA 5CCDA 1KIFA 2HRDA 3NIBA 4WH0A 2ZULA 4PGHA 5FNVB 4IEEA 5DNEA 4LYJA 3OTQA 2O19A 4FQ8A 4EHBA 1EGQA 2CXXA 4CKEB 1P4GA 1WOMA 2OWEA 4Q3EA 4QPNA 1GNPA 1RRKA 4OK3A 1FNBA 4Y6RA 3J81k 3JD4A 3N76A 1JFSA 1SKYB 3EMVA 3TIVA 3HWSA 4PHHA 1ZIDA 5IMSA 4N7JA 5JQGA 5HZHA 1JDVA 3WDLA 1YB6A 4NDZA 2SKCA 1OFUX 1X1RA 3KUUA 1U28C 2VDJA 4FR5A 2NU6B 4IGEA 3CKKA 1N7JA 4XH9B 1FQOA 1IM2A 1KH3A 1SCJA 2RARA 1ZCZA 2Q5EA 4LC1A 4OIFA 1Q0LA 4PZEA 2WKPA 2OORA 1ESEA 1I9GA 3DUFB 3PQCA 3B6JA 3C5CA 1S9HA 2VI5A 3C1TA 2XHZA 2XUOA 1DO0A 3C3CA 4OHYA 1R74A 4DCMA 4P9NA 1RCFA 3AOEC 3A6DA 1FU8A 1D03A 3O2JA 4JX8A 3RS7A 4B46A 1TK3A 1Q14A 2DUUA 4B7UA 1ICIA 5A4DA 4R2KA 3JD1A 5MHTA 4CQNA 4R31A 4CR7A 4J0KA 4CW7A 2P1RA 3USZA 2VRBA 3WYFA 3OSUA 1ZOPA 2AJBA 3DMFA 2WV9A 4QEZA 4ZKEA 3I4FA 2UU9B 3C87A 2WE8A 1WXDA 2C04A 4XPIB 2HW8A 1U1DA 2YV3A 3RSHA 2PZEA 2FX3A 2IPXA 3UH1A 1KQFA 1T6YA 3PWZA 1C3VA 3BICA 1C9YA 2EAUA 1CSEE 3H19A 4IQ0A 4RTRA 3HB9A 3N86A 3NZEA 1ND5A 4NNPA 2TMGA 4MPDA 1B16A 1EB8A 1FX1A 3RFXA 1RYBA 2CXRA 3KYDA 3ZWCA 4EJ6A 1XAIA 4PAWA 1L9KA 2QNRA 1AKYA 1HC7A 1NXWA 2GJ9A 2P5SA 4DCTA 3THXA 1U2GA 1M1NA 4JC0A 4CM4B 1ZD8A 3PQ7A 4G5SA 4TUYB 2C84A 1WDMA 3BD9A 2X15A 1EFPB 4MMYB 2BJHA 1NASA 3WIEA 3BJEA 1GN9A 1Z6AA 4S1TA 2W4QA 5JAMA 4WNAB 1DAMA 1XAJA 3DEZA 1O2DA 3I01M 1OFUA 2XCTB 4YAEA 4QD3A 1D5WA 3QY0A 1HBJA 4WASA 2GBLC 3SX2A 4DCCA 4YT8A 3LKVA 3KT0A 2G0NA 3MXOA 4ZZ3A 2YNMC 3QEBZ 5BSEA 4GO1A 2AXPA 3RVOA 5U4QA 4DUGD 4L02A 4V03A 1GZDA 2BFBB 4B3IA 4YRNA 2BM0A 4KODA 2A0KA 1CUUA 2O3QA 4U8GA 5H82A 4FYYA 1IULA 1MU0A 2BGRA 3I01A 3PJRA 5F98A 1DG9A 1KXJA 1EAYA 1OU4A 4QFCA 3KZNA 2EJCA 4UTOA 3D6HA 3PYMA 3CF2A 1WTAA 4V39A 5D5PA 2JDID 5HFNA 1EWTA 4F9TA 5LMNB 1PL8A 3QPCA 1JEJA 2PV0A 3IUMA 5A3VA 5TX7A 1GKUB 2G9NA 3F2VA 2HO5A 4FEAA 3VA7A 3RJ9A 1RZRA 721PA 1J06A 1L7VC 2BMWA 3GZ4A 2VTEA 4G1CA 4KC0A 3JQ7B 1IB0A 1Z0KA 4OHZA 1Y81A 4PZAA 2R0QC 2XHEA 3LX5A 2CBXA 4X1YB 2VT2A 1T9DA 3V2UA 2C5BA 2QRHA 3RYFB 1SN7A 1ZVMA 1M8GA 3LCUA 4MV0A 1WETA 2HRZA 2BSXA 4RYLA 3Q0EA 4MUHA 5E3JA 1GDTA 5FTWA 2X7JA 3P0JA 4A6XA 4RKEA 5JAHA 5C8VA 3L7OA 1MJFA 3TDKA 1QRSA 1VJCA 1YO6A 3QI7A 2B4AA 4W6ZA 1IQ0A 1XELA 3ZE7A 1G1AA 4AIRA 3VZDA 2BFMA 1XIVA 1IB6A 3B6ZA 4QG7A 1DG3A 3ROEA 2PBRA 3V33A 1T2VA 4OUDB 1JLHA 3IQDB 4RTNA 3GZNB 4PFJA 1AY0A 4G07A 5JU6A 4YP5A 2AE2A 1X1EA 5LZ4A 1NYLA 2W5UA 3R3YA 2COKA 4JI6B 3FFXA 1NM5C 2EF0A 3FLBA 1VXOA 4W6QA 2ZB7A 1M72A 3RNOA 2DQYA 3ZDRA 3RVSA 3GDFA 4YJFB 2QEQA 4JENA 4CM6A 4R9UC 3UENA 2DBQA 2OR3A 3CXUA 5KOYA 1JYFA 4LZLA 1DXOA 2O2SA 4WFJA 2C3OA 4IIDA 4Q1FA 4ZEOA 5ABPA 1QU3A 1KJWA 1J8VA 1XBTA 4MVJF 2C9MA 3O3MB 5D3MA 4ZHQF 3LJKA 1LD3A 2VYCA 3ZIUA 1BAPA 2O8DA 2X23A 4QBHA 4WXYB 5HZGA 4MCJA 4FFNA 2VDLB 2AZ4A 4A10A 1M2OA 4KIWA 4CM3A 1OXKB 4P7FA 3IIMA 4ZQHA 3HKCA 4BLQA 2W6NA 2A94A 1X1QA 2WF5A 3TTUA 3G7UA 4M0FA 1GGMA 2F67A 5EVJA 1G20A 4E5YA 3EUFA 2QMZA 2XE8A 4XQEA 3SC2B 1ITZA 5IFLA 3L82B 2NUTA 1KTIA 1S01A 1UDAA 3FNGA 1Y3DE 4H3VA 1RRGA 1S1CA 2O8CB 2NSJA 3OLVA 4HWOA 3AXSA 2O05A 2GJAA 4WD3A 5DTQA 5G4KB 3W5DA 3B5IA 2NT3A 3CYFA 1TA0A 3C6MA 5GV8A 4BIMA 2VJPA 3R3SA 1GQFA 3WMXA 4C5CA 5JZ9A 2Z1NA 3QWAA 2ZP1A 5BOVA 3VR4D 4BO0A 5JRZA 2W9XA 3TE7A 5JZOA 3KV3O 3C2QA 1N5KA 3NGLA 4NJOA 1GU1A 3M6IA 4L75A 4YECA 5I48A 5IEJA 1ECPA 2IKQA 3CH7A 1RW4A 2FEMA 5DGHA 1OWNA 3G5MA 4WNCA 2EKPA 2JGDA 4TL8A 5KVQA 3IBSA 4EUSA 4LVOA 2VNSA 2XMSA 2XZPA 2Q9AA 1IBMB 4HWGA 3T1VA 2C7QA 1C9JA 2C2HA 3M1YA 2WJ3A 4NS4A 2Y0DA 4KMOA 4EO4A 1TYZA 3EH1A 1OBOA 2IHUA 3AEKB 1KE1A 4RK5A 3TUIC 1CP2A 5LYJA 2FOLA 1FSSA 5AP9A 1Z29A 3KQSA 1DV1A 4B17A 3Q9UA 3VSCA 4LDNA 2QG4A 4JJFA 2QWXA 3HLTA 3WSWA 5DSXA 4H2DA 5FWAA 5FBZA 4O5OA 2YWHA 3AJAA 1F20A 2FRDC 4YAFA 3S5JA 4RZUA 1BCRA 3PSHA 3RFVA 4Z3OA 4D56A 2CXNA 4JT8A 3ROPA 4DSOA 2ZB3A 5CA1A 1WZCA 1UBFA 1QHHB 1C5KA 2ZPUA 5JJIA 3UK0A 2GYVA 2QTMA 3IJRA 4XARA 1F4PA 3UAWA 1W75A 4EY6A 2IEBA 1PCXA 1G98A 1YQTA 2EVWX 3LPMA 3GGPA 1YJCA 5DHRA 3A58B 1PI3A 4B6GA 2ZJ7A 3LY9A 4WACA 5LP6B 2EJBA 2YNMD 3BMQB 1AQUA 2XD4A 3CH6A 1B76A 5HG0A 3GLFE 5L7TA 2QMHA 2I2BA 3X2SA 1OWPA 4TL7A 3KYJB 3RBVA 3RIHA 5B5SA 3LTNC 2FLKA 3MT0A 1J0CA 1NVEA 2NAFA 3UK6A 5LA6F 2HQ1A 3DGFC 2IPOA 3U09A 4N54A 5KHLB 4A8JA 1HZZC 2C54A 5HDQA 1X19A 4OGFA 2CEKA 3OJFA 1Y5LA 4X8OA 4RTPA 4M1YA 2G1UA 3IC5A 4UTXA 1U2TA 3UC5A 1QO9A 1FRFS 3B82A 3I2FA 5K0EA 3QYPA 4ZMRA 2FSSA 1BQ3A 3H17A 2G7ZA 3BTUA 3DKIA 5DBIA 3SQLA 3OWHA 4EI8A 2FMTA 2KE5A 1U5CA 3O4VA 4REMA 3MWDB 4ZVMA 1YB7A 1HMYA 1N6KA 1WUYA 1HNXB 1JQAA 4LJAA 4PZCA 1LW6E 4GPZA 3W5AA 4ROTA 4A8JC 3JQ8B 3WMWA 3WK8A 1OWOA 1Q57A 3CF0A 4LMBA 2IKSA 3HFSA 4JUCA 5IVKA 3DZBA 4E51A 4HPXB 2YN2A 2F9FA 3JZIA 4C7XA 1MMFB 2I1WA 3BMOA 1V9CA 4IIVA 5CIQA 5EE9A 5SZKB 3RTDA 3U4HA 3VBCA 3U44A 1EIWA 1GSAA 2O57A 1L7MA 1D1QA 5C4IA 3UOGA 3OY7A 2ISSD 4ZOAA 4IGFA 4B7CA 5I45A 3S2ZA 1O96A 1NPYA 4JFAA 3AU9A 5FD8A 1W93A 2WIJA 3AERA 2JCGA 2VL7A 4J2HA 4Q39A 3DHYA 3WHPA 3L7LA 4IDDA 3TI7A 1F3OA 1QWSA 1VOTA 1U3DA 1YOBA 2XSZA 3GBSA 4UMDA 4W4TA 3R0ZA 3GRAA 4G56A 4EW1A 5CDYA 3SF8B 4G1FA 2FG7C 1N2SA 1AGRA 3DE3X 1M5UA 2IYAA 4MVJG 1B23P 2QU8A 2J41A 2RAFA 4HUTA 3CVJA 4F6RB 5AM2A 4MXDA 1X38A 3DBHB 5E8RA 3H04A 4M9ZA 4PR3A 5B7QA 1UZAA 2ZANA 3G8BA 2H5EA 5DBEX 2ZT6A 5CD9A 3ZLVA 4CKYA 2EGUA 1JDBB 2XLCA 3W3AD 1FYXA 1UMBA 4RGBA 5K1ZA 1DUSA 2ZUSA 3TKLA 1C7IA 3K3PA 1K68A 1ZCJA 4I8DA 1TF2A 1SUWA 3FUCA 2QRUA 1NTRA 1Y82A 3D9QX 3FPBA 1AXRA 2FSVA 4Y9RA 1DDIA 4F0JA 1QTQA 3VO8A 3K73O 1NFRA 2WNIA 3RO7A 4GPTA 4CL2A 3VKHA 4OH1A 1E1NA 3AM1A 2J5BA 1OFIA 3KALA 1Q2XA 3GYGA 1HK7A 4HFRA 2CKMA 5HKLA 1J1ZA 4LJLA 1H9AA 2G9RA 2HSDA 3WLMA 5KWJA 5J2TA 4IHJB 3ZDFA 4F4UA 2OPBA 2ZXUA 1KR2A 1Q3KA 2CV0A 4KFSA 4HB2A 4YQEA 3S55A 1QO0D 4ZCRA 2ZDGA 1EEXB 3LGSA 1KI3A 3A2LA 2VJMA 1JA0A 2PWZA 3AHDA 4BMPB 4GGOA 2NPIA 2ZI3A 3I2GA 3KL2A 1BMFD 4GX1A 1NW7A 1NDHA 4KWTA 1F9AA 2AMJA 2C4MA 4JBGA 4WBNB 3H8VA 1CQIA 2AIRA 3MHPA 2AG5A 2LDBA 3C7AA 1K0UA 3DMTA 4QQKA 2WVJA 4COKA 1PDVA 5I8PA 4UHKA 2F4NA 4IDGA 1QVVA 1U9IA 2BEWA 2NSYA 2Q5LA 2ROQA 2PMKA 2VUUA 4P54A 3ZCRA 2F3PA 4F3RA 1BJRE 2WWFA 1U99A 3ZV4A 3AILA 3DV0B 1CF2O 1PX2A 3KTAA 1V8OA 4HDSB 3OESA 4X7MA 1CHDA 1OHHA 1RMQA 3QWBA 3ZHOA 1R6VA 3IOEA 4Z53A 1KOJA 2NZWA 2OBLA 3JD3A 3MGGA 4NU6A 1UK7A 5BSMA 5PGMA 1PG2A 1PJRA 3FPFA 3G2MA 4J4BA 4E2FA 2QAGB 4Z7OB 1DPFA 2GSWA 2SHKA 5LBIA 4EUFA 4WCFC 5SZIA 4B6FA 5EXPA 4MS1A 4LKRA 2B37A 2OL4A 2Q4DA 4F5EA 3NEAA 2ZYTX 1G18A 4B87A 4JA2A 4C6RA 3P9XA 3K70B 4DR3B 1B43A 2XXJA 1GDDA 4YC7A 4X64B 3SDBA 2WHYA 3B1WA 1C7FA 4H6VA 4P4NA 3DEYX 2V6IA 2XUKA 3WOVA 2C5FA 3L0SA 5CYPA 5IJ9A 5K45A 3R09A 2IEIA 4RK0A 4PGGA 4L8FA 4BFSA 2WUVA 1J0AA 4RA6A 3K6SB 3ZDCA 3L46A 3OJ0A 4J9UE 5TS3A 2OO7A 5FEUA 1ZUD1 3LVRE 5D3ZA 3T54A 5EMMA 5LQKA 2Y4OA 4JB2A 4RSRA 5IJXA 1KZ9A 2ZUDA 1XEFA 1E8MA 5ADUS 1O3YA 4II2A 1NBWB 1YFKA 1MR3F 2I91A 2AX4A 1RJ9A 3C43A 1H8HD 1P18A 3LWBA 1NVVQ 1LVUA 4RTLA 4LSZA 3PPVA 1IPFA 3QKTA 5I5EA 2O8FA 2QRJA 3GJ3A 3ZHXA 4CIXA 3DL7A 2HADA 3LGAA 1HI9A 1FDTA 1O8CA 4RXTA 5AJTA 5L45A 3OZRA 1W5SA 4DV5B 3KHUA 5EMHA 1JBKA 1U4NA 2ZE5A 1SQ5A 4GSKA 4P8RA 1CUXA 1EWKA 3IGFA 5FO0A 3RC9A 3FPJA 4ON9A 4X92A 3HRHA 3KUKA 1DJLA 2DLDA 1YRWA 1Z4OA 3IP7A 5F1KA 1QZZA 2QG9A 3DVLA 4INAA 5K0CA 2IVFA 4NYIR 4G37A 4W63A 3O2QB 4HNAA 1KPIA 3HS3A 2DWOA 2PS9A 4P4UA 5D1NA 4G1VA 4UBJA 1CEYA 4WBXC 1E3EA 1QX4A 3AP1A 3H87A 1XUOA 2C7VA 3TFOA 5DTRA 1K27A 1X7HA 4QFDA 2ONYA 4I4CA 4JSYA 4RZIA 1VZ2A 2WHEA 4W1PA 5BSWA 4C4AA 2ZRJA 3PDHA 5IWCA 5DYTA 4AMGA 1K06A 4RE6A 2FV8A 4TV9A 2P90A 3KVYA 2PGNA 3LF1A 4FGJA 2QRZA 4I4NA 4W9RA 5JDCA 4BVLA 1NL3A 4V24A 1M6NA 1UQTA 2OCDA 3U5TA 3PXGA 2C2BA 5LQRA 3IIIA 3RVNA 4I1RA 3PE3A 5CPFA 1LWNA 3WC4A 1VHLA 1NMXA 3W8RA 3B2EA 3KPYA 1EMDA 4NBUA 1SULA 2ZRKA 1V4VA 3G8CA 3F3KA 4I19A 1LPAB 1I01A 4UJ5A 2FW8A 2UZ1A 1TJ5A 1VLVA 4LAFA 3GROA 3SJBA 1J2RA 3GAMA 3I0ZA 4H27A 4R05A 1RPNA 3LPAA 3KV1A 1DLJA 2ODEA 4M9RA 1YE5A 1F8YA 3GGOA 3KZCA 1ZJYA 4CMJA 2XWSA 4KAFA 2J6BA 5CURA 4OMDA 2FX2A 1EHYA 2WSBA 3O1LA 3QELA 1JKFA 3OU2A 5CK5A 3TX2A 2WZCA 2NO1A 2D5CA 5CGQB 2BHTA 7REQB 1TPYA 3GLGE 3U1BA 4B33A 2BTOA 3CF6R 1N1MA 3INGA 2CVFA 1AUPA 1L4NA 1I7LA 1QBKC 1YB1A 2OMKA 1KBOA 3I83A 3C3MA 4X5OA 2Z1MA 4LSWA 4OQDA 2G5GX 3P4XA 4R2XA 3EY4A 4EL0A 4KYTA 5KOJB 4GR9A 4ACBA 3GQBB 3N5CA 1T5TA 1IDN1 1PYDA 3HXKA 1K0FA 4AUNA 1FYEA 4AY4A 2QNBA 2HQRA 1TKAA 3VHXB 4ENRA 2YHBA 4I1UA 4GOLD 4PFQA 4AG3A 1OH7A 3R6LA 3UJ6A 1RPZA 1F0PA 2EWVA 4FMBB 4FDTA 4WZBB 4XLZA 5DLDA 5AESA 3DDSA 2I4IA 3NRJA 3DLBA 5DGCA 4NCKA 1JEQA 2V7TA 3KE9A 4HC4A 4UASA 1X1TA 4JQZA 4HAVA 4S24A 2MSDB 3PHIA 2I2WA 1E5TA 3OECA 3T41A 1C30A 4CR8A 3ESAA 4MTCA 1Q16A 2H4HA 2CLEB 5E7MA 3JTEA 3E0QA 3B20A 4HLNA 3CWQA 2GZ2A 1Y5IA 2QLNA 3BREA 2I4TA 3EOAI 4QGBA 3KU4A 1PV1A 1W9MA 4IG4A 3ZTWA 3EXIB 5IYZB 1N6PA 1N0UA 2CJWB 2F8LA 3VAZA 2WHPB 3JYPA 5HOQA 1QQAA 1XU7A 2Y1GA 5J5CA 1SBQA 1XA3A 2YV5A 2GGSA 2A86A 3GHHA 4A5SA 1E2DA 3OD5A 5CP8A 1O9HA 1R0SA 1ELOA 1VE3A 1RRVA 4OSPA 4ROSA 2D62A 1WZUA 1HORA 1PWZA 5CW2A 5FLYA 2J0VA 4BECA 2DTEA 5KX5F 2XW6A 4EZBA 4JNKA 5BWLA 3SN6A 1SC4A 1T3SA 3DOHA 1ST3A 1W94A 2ENUA 2XCUA 3VTZA 5KYGA 5LP1A 1IN8A 4U6SA 1NUPA 4UZEA 1YAJA 5EJMA 1D8TA 1FUUA 1C1DB 1J8MF 4ZZIA 2YHIA 3Q40A 4MUEA 4PSKA 3H9QA 4LGMA 4RGVA 4FSXA 4JLJA 4UHBA 1N75A 1A9XA 1M10A 3O26A 1W1IA 5A02A 1AU9A 3VJLA 1P1RA 5TDHA 1QQ6A 1PN3A 3RHFA 3CUYA 4HQFA 3PCXA 1DCTA 2QTBA 4K46A 3OE4A 2FQQA 3UPDA 4MR8B 5AVQA 4B4OA 3NXSA 1XB2A 3LVQE 1G21A 4TRJA 3ILSA 1D2MA 3T5GA 4TLBA 5DKFA 3V8MA 1U0TA 1X14A 3UMJA 3R2JA 3ET5A 2WE7A 3S7ZA 1DXYA 3NUGA 1Z5VA 3CG0A 4EYGA 1XRMA 3EPKA 3L7IA 3QV2A 2XUIA 3FKSD 2YY6A 3I92A 2GK4A 3PXXA 4REOA 5CBPA 3R5FA 3QLJA 3FGPA 2D3WA 4XOIA 3DBIA 3QENA 5CFPA 5EIHA 3A6LA 1CX9B 1GO2A 1QHXA 2SCUB 4NENA 3MM4A 2HPHA 1ODSA 1NBME 4IM7A 1E62A 3R9XA 3DLIA 3AY6A 4C7MA 2IL1A 2VT3A 2NU7B 1A77A 3AW9A 3N8GA 2YIDA 5I9MA 4I1IA 5DNDA 4C0AC 1QSGA 5H02A 4URXR 1K5GA 3DZIA 1G7CA 3GEMA 2RD2A 1DAIA 1P75A 2GK6A 3ZCVA 5DN6D 3O3OB 5REQB 1PO7A 3AG5A 5TV2A 1T1GA 1TT7A 4LQDA 1HE2A 4A0SA 4ZICA 1Z0FA 2JRLA 1U0BB 1WUJS 1GL3A 3DNMA 3P0HA 1E2HA 1T1RA 1ONOA 1IXKA 2PZBA 2D1SA 1VE1A 3KDAA 1ZIYA 4HXYA 4K9OA 1QJCA 4OQPA 2VZ0A 5CXQA 3FRHA 4JC4A 2ZROA 2VF8A 4OJQA 4O2LA 5CNJA 3RDPA 4CV3A 5BN1A 1KOFA 3QITA 2D7CA 4JV5B 5K7SA 4J75A 3FFWA 2AF3C 2H5IA 4GT1A 4KUGA 1E3QA 5ILOA 4AQDA 5EQTA 1NC3A 4PFKA 4RH1A 4OHOA 4R1SA 1I1HA 5KREA 3ZDDA 1WZ2A 1HL3A 2G63A 4LK3A 3ZHTA 1AG9A 3CSSA 4PPYA 5E1OA 1SCKA 1RXCA 2ZYWX 4RL4A 1M2KA 3I45A 5E9WA 3WP1B 1LK5A 4MS4A 2Q3DA 2C29D 2HC9A 2RHWA 3E84A 4OL9A 5J5AA 2CK3A 3KQWA 4GZLA 5HRAA 3CT6A 3AF3A 3W8NA 4JIGA 1FBNA 1Z28A 3F7OA 4QG3A 3EVGA 1UP4A 5TPZD 4F2DA 4F9GA 1HTBA 4DZZA 1E9RA 3HDJA 1SVLA 5F2KA 1RIFA 1Z6YA 4LNAA 1GYRA 5ETJA 3NAGA 4NMXB 1KZ7B 4UAVA 4PINA 1IY2A 1TECE 4O3MA 2NLOA 3JQ9A 4UFPA 1MV5A 2OUIA 3A1UA 3OO1A 1P29A 2FKNA 2L42A 4OU5A 1J5PA 3FD8A 4R3NA 5CVCA 1XNQB 3IRUA 3JRWA 4D44A 2X2EA 3M6UA 1SWVA 5FUWA 4TLCA 3V97A 3NYRA 5IASA 1MQSA 5H80A 1ESZA 3OQIA 4QXAA 1OT5A 1XZJA 4HWSA 3COWA 4GPBA 1QFZA 3EZNA 1UBUS 4G0VA 5J9FA 2BM1A 5A05A 1OB2A 4ZAYA 1Z4PX 3M1IA 1QAOA 1KYXA 2QE6A 1XYYA 4PZUA 3ZXUB 3L79A 4OXYA 4NZZA 2FDCA 2JGEA 5EJ7A 4DR4B 4X7BA 2FHSA 1G9SA 1ZFNA 2PYIA 1VMAA 1W30A 2ZUWA 4RS4A 3S4YA 1A8PA 3HP1A 3UUGA 1IZ8A 3O95A 2VUTA 4ONEA 4PG8A 1I6KA 1MG5A 2DKOA 3W8EA 3T1YB 3B1XA 3OUUA 5A7FA 1T4CA 4XFDA 6REQB 4XSHA 1A50B 4N1AA 3Q5DA 4F97A 1PT6A 1H4VB 4MJ7A 3ITEA 4BPRA 5LMZA 1TUEA 2C3MA 2PY6A 4KX3A 1FUEA 3OCXA 4ARUA 3SSAA 2QAIA 2I3GA 3I2HA 3NIWA 5L4SA 1UM9A 3TGPA 5IW8A 1T10A 3E05A 2J9FB 5IZCA 4L3OA 1E6UA 4RHFA 3UMBA 1IY1A 5AM0A 2JLYA 1QCZA 4U7PB 5FPTA 3ZDYB 1G5QA 4AMVA 2PT7A 2X5NA 3MW8A 3X1DA 4C2UA 1J1IA 3GT3A 1SCUB 1YJBA 2QTAA 2Q27A 2P4SA 1L5VA 1VFNA 2V0NA 2DUMA 2ACKA 1FYWA 3QG1A 4GRDA 4IBOA 4MWEA 4W9NA 4AF8A 1TJNA 1M2NA 2JPDA 2VPWA 1KH2A 1L0BA 2HLHA 3H1EA 3D8TA 3HMQA 3Q8LA 3PX7A 1Z68A 3QVXA 3WG9A 3TMKA 2AR0A 5KHAA 2H7YA 2NO9A 2P4HX 4ISCA 4PF1A 5CDSA 5KYYB 4UJ3A 5EESA 2Q1WA 1EINA 5FBKA 4KG7A 2BUBA 4FYJA 4ALNA 1JZSA 1KEEA 3EXEB 1EX7A 4R6XA 3F2IA 1U98A 2XMCA 3W6UA 2P7HA 2IQ5A 1IZ9A 2VH1A 3EAFA 4O33A 5FR2A 3CISA 3T5TA 2ZU6A 1FQKA 1UXKA 1V8BA 3I2KA 1WVIA 2GEDA 2JFXA 4JBNA 4B3DA 3QVVA 1MOSA 4P22A 5ALTA 3FSRA 1CEQA 2ZWOA 1G6OA 3EXAA 2FZVA 4MCHA 4AMZA 1FPMA 2JCBA 1U4SA 3QH4A 1KDTA 4KFUA 1OIWA 3V34A 4BGIA 1RXVA 4DM3A 4D9JA 1ODJA 1PNOA 3OPQA 1T26A 2V6JA 3BSWA 3ZU2A 5COQA 1KJJA 5A6VA 5DU2A 3F3SA 1Q7TA 2Z56A 1L5FA 1YRQA 2N75A 4MW6A 2R6ZA 4DDHA 3EARA 1SEPA 2ZG6A 3H9GA 3RU3A 2J3KA 2ZLBA 3KJZA 1B1CA 3DVSX 4TXNA 4ALJA 5JJLA 4F45A 3MJTA 1RT9A 3FI0A 2RH5A 3FF4A 1PT7A 3Q7IA 4FS8A 1Y4UA 4GYWA 4LE1A 4C0JA 3HCRA 4LWQA 5FPPA 5BSVA 3CB2A 4D02A 5KOIA 2CZCA 1T8SA 3S7TA 3L6DA 2R44A 3B6KA 2ZJ0A 3ONDA 3RJMA 1HTTA 3C3JA 3N2LA 1E96A 2ISCA 2X8AA 3WI7A 2Y4NA 3D8UA 1XA4A 1V5IA 3BWDD 3P9RA 4E09A 2VQEB 1FU4A 3O5AA 4YJKA 1JWLA 2QBYB 1WSWA 1J22A 1YZUA 4GX0A 3L1JA 3T7JA 3RIYA 5B2FA 1OI3A 3O4JA 3SBDA 4AN4A 2H8GA 1P0CA 4O59O 3VR5D 4FWIB 1ZZGA 3N7TA 4I4LA 1TU3A 3M1LA 1TKCA 3UT0A 4MHSA 2B83A 4F11A 4YV7A 2QSYA 2VH5R 3LSTA 4PC6A 4EHJA 1UAYA 3MERA 4RPJA 4NMLA 2GPAA 5AJXA 4ZRMA 2ODQA 2RH8A 5LZ7A 4TZ0A 1WCYA 4R1PA 1BA2A 2GN0A 4F9FA 2O3TA 4HDRA 1Q74A 1DHRA 2WV7A 3UJ7A 2V7XA 3W7AA 3Q9NA 4CCYB 4PCLA 3LTEA 4MKXA 2HCBA 4YJGB 1LI7A 1CUGA 1TB4A 1NLZA 3FTDA 1Y48E 3D8HA 3G2NA 2LRHA 5AJUA 1G8FA 5TPWB 5TQVA 4YAWA 4V1CI 1JR3D 2KS6A 4DILA 2VDWB 1YRLA 1JU4A 1B26A 3HXMA 2HGZA 4M4SA 4ZP1A 2DERA 2MSCB 1VL5A 4R16A 1QGAA 2R8PA 4GI5A 4PQFA 5HF5A 4C6SA 4B3FX 2XF2A 1R9NA 1H2AS 4BNKA 1ZVKA 5EJAA 1CE8B 2G1PA 3ROZA 3UGQA 1GZ7A 3AWDA 1RP7A 4RZQA 2ZT7A 3JQEA 2QU7A 1MC1A 2QOEA 3T3GA 1TJ4A 3HCEA 3BRWD 5GM1A 2JBWA 2IODA 4KX5A 1MO6A 3DLPX 4OF4A 2YVUA 5A62A 3AVYA 2NSHA 1BEUB 4ITVA 5A0FA 2Y3IA 3D43A 4LNUB 4IOMA 1RWBA 3LU1A 1N1GA 5G3YA 4Q5IA 1YFJA 3R7LA 2A88A 2HQSA 2B36A 3AZQA 1NR5A 2GK7A 4P32A 4GSLA 1CDDA 2MHCA 3KZ1E 4NCHA 5JH7F 1NW5A 1LLQA 1UK8A 2QUHA 5J2UA 4DIUA 4JBYA 3GJZA 3OUTA 4QHYA 2UZAA 2H2AA 3SVLA 3LDFA 3IKJA 3K16A 5I4IA 1JJBA 1TVKB 1EP9A 1NVAA 1H6AA 4MQEB 5K3AA 4J43A 5KCZA 4AXXA 4H7KA 2QD2A 1GAWA 2WFAA 1W47A 1AQYA 5J47A 2XRZA 4EB3A 4TLEA 2G6TA 1JZQA 2A9FA 2XWJI 3CPEA 4JQCA 4MZDA 5JISA 5AVZA 2ATVA 5FWDA 2WA1A 5KTPA 4PHGA 5FTLA 2BW0A 3G8AA 4UARA 1VPTA 3IELA 10MHA 4CPDA 5GWXA 3IQXA 2DY0A 5TRTA 4LVCA 4WCVA 1WY7A 3PZBA 3R7BA 3G1WA 4HSGA 3ZZNA 3JVIA 2JFZA 4HEA6 3FVTA 3P96A 3STWA 1AK1A 3WNCA 4PHCA 1HQDA 2UV8A 4L0MA 4N39A 4O4LB 4WL0A 4NU0A 4AY2A 3AEYA 1OZAA 4ASUD 5DZSA 4L8YA 2OVBA 4HQOA 3G9TA 2IY7A 4R0NA 4MP8A 3E70C 5E4FA 4KAAA 1ZQ1A 1Z74A 5TGZA 1FFDA 2CFIA 4NAVA 4HAWA 3ISVA 3H5LA 1D4OA 2DLNA 4MVJH 4MW0A 1S3GA 2AXEA 2RBEA 4OFZA 2EL9A 3KB2A 4CNQA 4FX5A 1NHGA 3LLMA 2D6FA 3ECSA 1QLJA 4BUJA 1C8BA 1QS0A 1FOEB 3LX6A 4PSUA 4WEOA 3BC1A 8LDHA 5FOVA 4AZSA 4PZZA 1Q1QA 1NOIA 2FLWA 4BFUA 2YMPA 1OFVA 2ZCVA 3CSDA 4RM3A 4UKDA 1KYYA 2GDZA 2GLXA 4URZR 3BFPA 5AUPB 1YDHA 3HV0A 2HA5A 1KEZA 3TK1A 4WJKB 3PDJA 2FVYA 2VYVD 1D2HA 1X80B 2M6SA 3NDRA 4GVPA 3IT0A 4YALA 5JRJA 1Q44A