3PXAA

Impact of brca1 brct domain missense substitutions on phospho-peptide recognition: g1656d
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
211
structure length
207
Chain Sequence
RMSMVVSDLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Breast cancer type 1 susceptibility protein
publication title Impact of BRCA1 BRCT Domain Missense Substitutions on Phosphopeptide Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 207
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxaA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxaA01
3SHVA 2COEA 3UEOA 3COJA 3T7KA 1JNXX 2M2IA 3L40A 1CDZA 3I0NA 3PXBA 1OQAA 4U4AA 3KTFA 3I0MA 3AL3A 2EP8A 3JVEA 1WF6A 3K0KA 2WT8A 2JW5A 4BMDA 3FA2A 1IMOA 4BU1A 2EBWA 2INGX 3QVGA 3PD7A 3L41A 2VXBA 1Y98A 3K05A 1KZYC 3K0HA 3PC7A 3PXEA 3U3ZA 2R1ZA 1GZHB 3HUFA 2E2WA 4IGKA 3OLCX 1Z56C 2DUNA 2XNKA 1T29A 4Y18A 3PXDA 4Y2GA 2L42A 2LE0A 3PC6A 2HTFA 1L7BA 3SQDA 3AL2A 3T7JA 3SHTA 3L46A 3K16A 3UENA 3EF1A 5ECGC 3T7IA 2AZMA 1T15A 3T1NA 1IN1A 4XPZA 3SZMA 2EBUA 3PA6A 4BMCA 1N5OX 3K15A 2VXCA 4OFBA 4JLUA 3PXCX 1T2VA 3II6X 2ADOA 3HUEA 4XQ0A 2NTEA 2K7FA 4IFIA 2COKA 4ID3A 2ETXA 3EF0A 2XNHA 2D8MA 3PXAA 4BU0A 2K6GA 3PC8A 2COUA 3PC8C 1L0BA 3QVGB 4N40A 1T2UA
chains in the Genus database with same CATH superfamily
4X7MA 4MVJI 1JSLA 4EI8A 2P0AA 2AR0A 2QIOA 1TTHA 2EGUA 1CHDA 1KPIA 3JVUA 2PH1A 2AUNA 4R3WA 1YVDA 2GK7A 4QJIA 1FMCA 5C8YA 5K0ZA 1KSHA 2B9VA 1PWZA 4HFNA 2GT1A 2ZU6A 3V8MA 5IVHA 1MZPA 1VPLA 1G4HA 1ZUIA 2V5UA 4WMLA 5EXDA 3WY9A 3A4LA 5ADVA 1HDZA 2WTUA 1ECGA 4YJHA 2WKPA 4OUKX 2C2GA 4OX9Y 4DCNA 4F38A 4I4CA 2WV9A 3Q0EA 3F49S 3Q8WA 4YJFA 5C35A 5KNDH 5KO2A 1Z38A 4AO6A 3Q1LA 2ZZKA 1DUVG 4KACA 3KUKA 1C7JA 1LDNA 3KQSA 2PT6A 1JVBA 3QPVA 1DBPA 4NKRA 5D5HA 3KBOA 3V33A 2WC1A 3HC7A 2ATEA 3P9SA 2R5WA 4LZLA 2D5BA 1D1PA 1UP4A 5DNUA 3N5KA 2X8JB 1JJBA 2XRMA 2GI4A 4OQXA 4U2CA 4X85A 5B3AA 5TQJA 3T1OA 4M7PA 1ECLA 4F06A 3W5BA 4CFZA 3P0HA 4NESA 4DLWA 3O8QA 5ES4B 1PJSA 5JNWA 2C0CA 1PE0A 1JJFA 1QP8A 2FRVA 1E0KA 4WASA 1WQ4A 1W47A 2Z83A 2ZLBA 2X9VA 4HF7A 3WL8A 4DG5A 1N2ZA 5HK9A 2YCBA 2FG6C 3GP3A 4YCJA 4IIYA 2FWIA 3FDZA 1DLJA 4RY8A 1NG9A 1LX7A 2AJCA 3VR0A 4D25A 1L5SA 4TKUA 1YZHA 4MHSA 5H70A 1LDEA 3KWMA 2EKBA 3T8YA 3IP5A 4RABA 3IOMA 3E6AA 3P2KA 4DTIA 2NTJA 3OZXA 4JEMA 4MQLA 3TLGB 1ZFNA 3I76A 4URYR 4XIGS 1DFHA 1GV1A 1I7LA 1PVDA 2NXJA 1JDTA 3BL6A 1DP4A 3CLUC 3L6OO 4MQEB 1ZLXA 5KTKA 1RRGA 4N7RA 2QRZA 2BKLA 1JJVA 3KE8A 3NONA 4YA6A 1EA5A 3ADCA 3KEGA 2O7NA 1SG9A 5DK4A 1RLJA 1VPVA 3VDRA 2HRRA 3LGXA 2HJHA 3H9JA 3ESBA 5KHOC 3ZDDA 1CR2A 5KTPA 1XQVA 1FFEA 1Q1AA 1RJFA 4R31A 4XJVA 4E88A 4OATA 3G9TA 1R00A 2CK3A 4I46A 1YA6A 3IKTA 4G4JA 2W6OA 5H68A 2VK8A 1CFJA 2G28A 2FY8A 3DYIA 1EGVB 4KP7A 1XMIA 4MTLA 4YH1A 4F7DA 4CQMA 2GPAA 1JIKA 4LYEA 2R4QA 3HUDA 2CNDA 2W2LD 2UZ4A 2NO1A 2IOHA 2ZIXB 2PUFA 3ZDXB 4LHWA 1V4BA 1CQIB 2WHXA 3D81A 7GPBA 2GD6A 4J29A 3VAYA 2YJ5A 3B3GA 1SR8A 1RI4A 3DZDA 2GPSA 1DIAA 1OI4A 3I64A 5C18A 5DE3A 3KOYA 4JQSA 2IWRA 4YGYA 4FDUA 3OPNA 1GFZA 2F4NA 4IGEA 2QW8A 4XGNA 4XE5A 4DABA 1CY4A 3JRNA 1UBCA 3KKOA 2VP2A 3PXGA 2Z09A 5J47A 1UZNA 3T4XA 4CL8A 3Q1KA 3IT0A 3QMWA 1LRLA 1Y42X 1NN1A 4LHYA 5KJEA 3G2KA 1KY4A 1YB1A 3OFSA 4XUGB 4OSPA 4CKCA 5FNVB 4KWIA 2HMVA 2OCGA 4JLJA 2COUA 4PY2A 4AZSA 1E6UA 2RMKA 5HZKA 1ADFA 1R6VA 3B1JA 4F92B 3PF9A 3KD3A 1NI3A 2P8JA 2ORVA 4KQMA 4POOA 1U4NA 4C06A 2IOFK 3RC8A 2GMWA 1O3YA 4H4DA 3FCYA 4AKIA 3FLMA 2CUZA 3EXEB 3IDQA 2C3OA 2WQ7A 1P9OA 4HOYA 3DHYA 4F4FA 5JBIA 4GKJB 3I30X 3OOSA 1QQTA 1LTQA 1IIRA 1Y1SA 2QM8A 3NTUA 3QU2A 5EFZA 1SB8A 3MS4A 4HG2A 1LFAA 1GTJ1 3AR2A 3DHEA 4HWGA 4KR9A 4EATA 3AUFA 3MBOA 1V37A 2F9MA 1U11A 4N0PA 2AMFA 2RHTA 3E5HA 4IUDS 5REQB 3K9GA 2WWXA 3DEYX 3FUCA 3JWEA 4LNHA 4UPDA 2H29A 1R9MA 4WKGA 3IAS1 4XGKA 3FBGA 3UN1A 4JP8A 2XF2A 1B6TA 4IDCA 2YIMA 3FZGA 1CHNA 4P3NA 2EWVA 5H83A 1XQ9A 4URVR 5BWLA 3GP8A 3QEAZ 5EJAA 1VSVA 2PU7A 3IGFA 1E2LA 4K03A 5G1NA 4AJNA 1Q0HA 1SCAA 1QG6A 3NRJA 1RAIA 3MRTA 4TMVA 1IE3A 2FZ5A 3QVOA 1SVSA 2FMFA 1IY8A 3PA8A 1NBEA 4MI3A 4Q3EA 4DJTA 4ZEMA 1T5IA 3Q87B 5L4NA 1J0EA 1U80A 4RJIA 3RAGA 1AKEA 1DJPA 3HZHA 4FGWA 4ZP1A 4B45A 1YFKA 4Q47A 2FR1A 5A1TA 1L4MA 1I4LD 1FFHA 4AJLA 1S2DA 1YE8A 4LJ5A 4G1CA 4KR7A 1NXWA 1WKBA 3IQDB 1H0RA 3AJ8A 4L76A 2PSSA 3U4DA 2VPIA 4M89A 5KJFA 3O8CA 3ONFA 1JAYA 5EKTA 4UEKA 2JBAB 3VOTA 1JDNA 1FFCA 1K06A 3QKWA 2GEFA 2XCTB 1ZONA 4HYTA 4ENTA 4FQ5A 4ND8A 2O0KA 2DWQA 3AI2A 5BSRA 3OURA 3ZJ4A 3ONVA 3DLPX 1OPXA 1RJWA 1ZJYA 2X1MA 3KTAA 5D85A 5KSOA 4RVCA 5E9JA 4FJ0A 1QG4A 1YR8A 1H66A 2Q6VA 4MGKR 3UENA 4IMIB 1K4MA 2GCGA 1RRMA 3GH1A 4ZU6X 1T24A 4OU5A 3TZ6A 1H85A 1UPUA 2ZCUA 1XK7A 1EG2A 3GQVA 3JAWA 1UIRA 1WCXA 3RUHA 2VF4X 1OH8A 2OUIA 1BEZA 2C2KA 3EXHC 3VC7A 4EPRA 1RLOA 1NP6A 3UG6A 3PF8A 2JK0A 4YREA 4FLFA 4PCVA 4QYTA 4V0LA 3WJ2A 2GHTA 1DRUA 3G0GA 1Y0BA 3GRZA 5F9FA 1E4YA 2VPQA 2IHYA 3MLAA 4H6WA 2QTVB 5JXWA 2C4MA 4QTXA 1NDUA 1XA3A 3V6MA 3DHVA 2A5DA 2FFJA 4M1WA 1WBBA 4Q02A 2ZDHA 3MS2A 3VUFA 2YFQA 3OSUA 3GZNB 2EIXA 1BCSB 4GWLA 1LPMA 4HQ6A 5K3FA 1I1NA 1NN0A 3DB2A 2AMYA 2Q6OA 2ZTMA 3FCSB 4QGFA 1N6RA 5JECA 3AONB 3O4VA 4QGHA 4F3NA 3BH0A 3URKA 1WSWA 3SPXA 3VMFA 3HN7A 4Q3CA 4WXHA 3D8UA 2R48A 4Z3KA 1N5JA 2G67A 3B3QA 4HAXA 4QXOA 1GR0A 3V8RA 2DU8A 1Z8DA 4DLSA 1H65A 4NE7A 3K9LA 4OHCA 3N8KA 4JR1A 3CX8A 5JJLA 1BO6A 3A1VA 4TMWA 3RVNA 2N1BA 3OPYI 3UHPA 5E4JA 2JBHA 3PNMA 4LMAA 3RYIB 1R15A 2I3AA 1QTIA 1E3LA 4HNTA 5JZVA 4E70A 5FT9A 5K3CA 2BM9A 2VZEA 3ZNPA 3HRKA 2VRCA 2XYPA 1N34B 2E7ZA 1C9MA 4RENA 1UQUA 3DOFA 1C8KA 4RDXA 2P90A 5LQRA 1KRXA 3EY4A 4C2UA 4W5WA 4IF4A 4LGYA 3OD5A 4PNZA 5FF9A 5FL7D 1GTG1 1CJUC 2AMLA 1IU9A 2JH8A 1OC2A 3T5GA 4NU6A 4EHNA 1GKYA 3NTQA 1XMXA 4BXOA 1B8PA 2G08A 4QICA 2CUKA 3EVEA 4YJ3A 4HFMA 1FLVA 4XQ9A 1VL6A 4KV9A 1WW3A 4Q6BA 4CDRA 1M8JA 2AG1A 1MKYA 2OV2A 4TVBA 5ULLA 4L73A 1GT91 5E3HA 1KY2A 3FPLA 2ZBUA 4N1AA 4W7IA 4X1IB 3WHPA 5A5GA 3FETA 2VJKA 4PAOA 4UZSA 1UF9A 5TB5A 4B9EA 2DKNA 3I9MA 4BLWA 1XP5A 2AI1A 1PR3A 1JR3E 2QW0X 3I3OA 3NYQA 4JZYA 1CQZA 5DT2A 1Q0RA 1PGOA 4MUKA 5G0TA 1NVFA 2DH6A 1TRKA 3ZE0B 5IDWA 1GPKA 2VYVD 1G41A 1U04A 3QF4A 1W9MA 5CVEA 5JS2A 1DSSG 3HDYA 5DYNA 2QTRA 3VYUB 3THWB 4PGGA 5DBIA 5ER9A 5HS6A 2I4IA 3KZKA 1S02A 4EHKA 3DEJA 1ESNA 3BHMA 4PYIA 4CTKA 1MIOA 5EIBD 2KJQA 3KUCA 2RJ3A 4E5YA 3ZHXA 3FOEC 1ORHA 3EK2A 4AULA 1JHZA 1RWQA 3L8YA 2DLCX 3A1DA 1WOMA 1ZSYA 3PE3A 5JUWA 2D1YA 3O8DA 3E1GA 5G1PA 2ODAA 3QVMA 5AR1A 3DONA 3GXOA 4YROA 3ZDCA 1H8HA 2GH1A 1GCGA 2RBKA 3NKVA 2WJPA 4HB4A 1E1CB 3M33A 3ZE8A 1FDTA 3STYA 1E32A 1KJJA 4KX3A 4CF5A 1NW6A 4QGAA 3GEHA 4XCQA 4W1QA 5JAPA 1DRWA 1ND6A 2NSJA 4M1OA 1ZMXA 4P3XA 5EN4A 4QNMA 4IKEA 4Y6LA 3CVJA 3NCHA 4ZT7A 3ZHOA 3ZJYA 2VLIA 1GY8A 1XTJA 2QZPA 1NGSA 4LBYA 3E48A 4R84A 1AZSC 4YQEA 2ZU0C 5SICE 3ZDQA 4C7BA 4CI0B 2Z4TA 3BULA 4GX5A 4DLKA 2AVNA 5IKPA 3UT5A 4DR1B 5J63A 5K0JA 2IEYA 1SULA 3OFVA 2Z4SA 4OGLA 1MAAA 4YLYA 4HDRB 5EIOA 3UA3A 3C6KA 3HKDB 1LZKA 1E5TA 3KOZA 2R62A 1DDGA 4OI4A 1U0TA 16PKA 3EVZA 3IAFA 2PV7A 1WKCA 5D8DA 1NY5A 1EFDN 4IJUA 5E4FA 3ZY5A 1T1RA 5CA0B 5AVQA 4PZ9A 4DCSA 3BUSA 1VG8A 1H1TA 3G0OA 1WW8A 4PHTA 1GA4A 2EEZA 4P8RA 3DGFC 2H2IA 5TIIA 4AXBA 2JGMA 1XAHA 4YTEA 3UHJA 5CYPA 4BB9A 1CV2A 3N70A 1J0CA 3UH0A 3M6VA 3AWIA 2RHMA 4Z8XA 4C88A 5FTKA 2IZZA 4MJLA 1NF8A 5LZ8A 1OIWA 5FAKA 2IZ0A 1B2RA 1V8FA 2X1HA 5K8JB 1MGPA 3ZN2A 4BNNA 2YYSA 4ZJPA 1UXJA 4OP3A 3UJBA 4D3SA 3KJXA 3EFHA 1T5OA 4J1QA 5KVVA 4FOTA 4ZPXA 4CM8A 2QY6A 2XWPA 4QHSA 2A7XA 1VCMA 2OD9A 4WNYA 2I62A 2J59A 1HDXA 5AVSA 1WXGA 1ZCZA 3M6UA 2EYUA 2II6A 4RFVA 4DPMA 3O21A 3M70A 1KWGA 5K8TA 3K92A 3RSZA 1LV7A 1X7ZB 4RKQA 3W4KA 1V95A 2NAPA 1QK3A 3B48A 5FOVA 4DFDA 3AXTA 3N6XA 2RDMA 3NUQA 3O95A 4UVHA 1F8GA 4NOJA 5T57A 4WK4B 5G0VA 4BB6A 4E13A 4ER6A 4ZCPA 3HCNA 2HM7A 1W36D 5CVJA 2NU6A 2VF7A 1FS6A 5TXGA 4Q1EA 4Q24A 6AT1A 3COSA 4RHEA 5LSAA 1CERA 4RM3A 1A69A 1ZNWA 2IZOA 3HV0A 3RYCA 3HABA 3AG5A 4WXEA 1IM8A 2EBFX 2IHVA 4P5DA 1Q12A 1XCMA 1GSOA 2ODPA 4KQIA 4AIIA 2Z2KA 3LA6A 4MVJP 2OXTA 4JV5B 4JA2A 1LY1A 1MAHA 2Z57A 4ZPJA 4C6SA 4L7VA 1P7YA 2HWKA 4EB8A 2HF7A 1GGHA 4ZOAA 3TMAA 2E2WA 3ORYA 2V1XA 4GX2A 4YQFA 2GN2A 2WSLA 1EJBA 2AT1A 2YINC 4LZAA 1T9ZA 4GOKA 4X95A 4RH0A 4XYEA 4FW9A 2IQIA 2DKOA 1DOZA 5TY0A 3F4BA 3V8NA 4EDFA 1FMLA 4L4XA 2X77A 1UFQA 4GVLA 3VZPA 5I7RA 3SWWA 1QP7A 4PG5A 4AZ0A 1DKLA 4EHBA 1AHIA 1ID1A 2BTQB 4H7PA 4HEJA 4RSRA 2XQJA 1QQ7A 1H3NA 3LDHA 2ZRQA 4RIHA 2IDMA 1FFSA 2GN4A 2J3IA 3ZU2A 1QFYA 4AWBA 5KTTA 1PJ2A 5EEGA 3E4DA 5I4BA 3QX3A 2Q50A 2YYAA 4JLNA 3LF2A 3N7AA 4JWKA 1XUOA 2Y99A 4Q3KA 3W2GA 1I7SB 3R4CA 3QF7A 5AM3A 3SYRA 3A4MA 4YO8A 1XTZA 1T0IA 1USKA 1SHJA 4HH0A 4IOLA 4BNTA 4H59A 2CV0A 4LF9B 2R1VB 3DL2A 2OHJA 2YWJA 2FSUA 3ONDA 4UNQA 5CFMA 3LNCA 1KZ7B 1CIPA 2RKBA 2ZTUA 1TL7C 4TTSA 3N58A 1QVVA 3U7QA 3ELYA 3R9KA 4C5BA 4QDZA 1K86A 3PA6A 1SU7A 3QJGA 4RW0A 4H4EA 3SE0A 2GHRA 3VXKA 4D7AA 5IPFA 1ODIA 2OWEA 4LJSA 4ZC1A 1SBTA 3WTCA 4BC0A 3MPUA 5KHLB 1AU9A 3M49A 5U9CA 2PV0A 3VNAA 1KYQA 1F8XA 2VRBA 2W6JD 3A9CA 4GRAA 4Q34A 4BNYA 3JAKB 4G2NA 4LF7B 2BGWA 5FWDA 1W35A 5DLDA 3II6X 1SCIA 5A6SB 1U28C 5AHRA 2BPOA 5FA5A 4R8LA 4Q5IA 1BTOA 1ULBA 3AEZA 2F9FA 1OI7A 3BGVA 3AKZA 1HE4A 2BDUA 4UPEA 1GZ6A 1MH1A 1AMUA 1E3QA 4AKGA 1HKUA 1F0NA 2JKYA 3JQQA 1W1WA 2GZAA 1N9KA 3U0BA 2VK2A 3W5IA 3D3JA 3BYZA 2BFBA 4ND2A 4DZTA 1NG1A 4L6IA 1P8AA 5KCZA 4LDZA 2VKTA 5C1DA 2JL1A 2YFKA 4EG0A 3SS8A 4QUBA 5A5VA 1C5KA 3RG2A 5IF3A 5MDHA 2IYVA 5BV2P 4G0UA 1HLGA 3O4HA 1EDOA 2PZBA 1YJQA 3K73O 4NICA 1YZQA 2J32A 2O8NA 5KQPA 2P4HX 2DR0A 1LBQA 1YS1X 2O2GA 2Y1LA 3B1XA 3OEED 4WXMA 4D46A 3GLGA 1X15A 1XLUA 3WGLA 4ED9A 5J43A 3D4BA 4HLUA 1WDMA 3ET5A 3WFIA 1V6AA 2DJIA 2GAJA 5JXGA 3NEPX 5KC9A 2WPDA 2NZWA 3RV4A 1OPRA 2VP9A 4XX1A 4CV3A 3UK2A 4PQYA 3Q0IA 3KQPA 5J5VA 4AP6A 2D0PB 1S5PA 4YAEA 2AKEA 2VAXA 3X43A 4EQ6A 3IBYA 3KQUA 3UA4A 3N2KA 4YRRA 2G82A 3PT9A 2PSEA 4JEIA 4OSEA 4FKBA 4JYMA 1D0VA 2QJFA 2CXQA 1SVIA 2WM3A 3QPUA 1NQAO 2JZNA 1KDOA 3IAXA 1F2UB 1DMSA 5AVRA 1YI0A 2ZQYA 1QIJA 2WU1A 2G1PA 2QXTA 4LZZA 2FP4A 3LTNC 4FFPA 3BBLA 3E23A 2G9UA 4D9EA 1KA9H 3C3KA 2VDMB 4XLLA 2O3JA 2C58A 3UOGA 1UOOA 4ZIRA 1U99A 5TNXA 4JVNA 4N3NA 3T5AA 4XYBA 4ECEA 3I39X 3L0CA 4OK6A 4RTLA 3MWDA 1GL9B 4HLDA 2YZ2A 4NHEA 3D8HA 1P0CA 2EFHB 2ZQZA 3CKLA 4LYAA 4LYHA 4JY7A 1QLJA 3I12A 1PD0A 2A57A 4JUAA 1A4IA 5K8LA 3G5MA 5T64A 3VFDA 1QYDA 3GOHA 3PFCA 1KSJA 5H1YA 1TYCA 1L4NA 1IY0A 1VZ2A 4OLHA 1I94B 4Z4EA 2QN6A 1VDMA 1SHLA 5MHTA 1BHQ1 4CKBB 4R68A 3D0RA 2NU8B 2BYTA 1W6UA 3K72B 3RO7A 3PHGA 4I4LA 3GJ5A 2FPPA 1JQ5A 2BWJA 3VPSA 5LLSA 2J5BA 2PU5A 3O1JC 3SN6A 3ZDAA 1AVTA 1WG8A 4N49A 3DQPA 4PBRA 2X9GA 2CFOA 3WWYA 1TJPB 1GL3A 4ZGWA 1E4EB 4NECA 1GR1A 2WHRA 3BD7A 1FK8A 1SBQA 4KL8S 1U8TA 5EPEA 3TUJC 1V9CA 3K0AA 3MINB 4ANFA 1ORIA 2G1JA 4Y2XA 4AZVA 4YDHB 1X1SA 1T2FA 1ZICA 3PFIA 3H75A 4RHUA 4K2AA 2RHGB 3R7WA 1JLMA 1ODFA 1RWWA 3B2EA 3PRYA 2QM0A 5A3VA 4JQCA 5B3JA 5L3VA 4B3HA 3UWSA 1GL6A 1JKMA 4B81A 4D99A 1XKTA 4AI6A 2FETA 2VJOA 1K6EA 3LUAA 4H1WA 3B9QA 2KI5A 4QLOA 3F6EX 1FDOA 1MN6A 3JX9A 2JAXA 5ADWA 1UC5B 2Q0HA 2R00C 4HPWA 4LHXA 3ONNA 4PC7A 3MHTA 3ZWBA 2IYFA 3FYUC 4RL4A 1R4NA 1G98A 2UYQA 1WXQA 1IZYA 2VP4A 3UHFA 2ABWA 4BEJA 2Q5OA 4LHVA 2JI4A 2WV7A 3ABRB 4QDKA 3UJCA 4F5YA 3OZFA 3Q6IA 1JQLB 2CF5A 4NXMB 2Q9BA 4CL3A 3N76A 4WOBA 2I4MA 4Z4HA 1YRAA 1KR5A 1J1IA 3L8EA 2WWIA 1SOAA 3IUPA 4HZGA 3Q9SA 1FNNA 4FFWA 1WHTB 1JDBB 3HY6A 5KYGA 4CCYB 1Y6FA 4H7KA 4U5XA 4UM8B 3IQEA 5LOVA 1YWGO 3GBVA 1M5TA 4DDTA 1W30A 2JASA 1U0HC 1KJNA 2BLNA 4EPTA 4OCZA 2I91A 5C8YB 3ZU3A 4Q9HA 4CKWA 1WX1A 3PDIA 2MYPA 1RHUA 2C9YA 4PZPA 1MTZA 5CDFA 4B6PA 1IZ8A 3ETHA 5JDCA 4NH4A 4YYZA 3JWJA 2BE9A 2AH5A 2YRFA 1C8LA 1I9GA 3JQPA 4DAEA 4ESVA 4O2BB 2FE1A 4CIYA 1FTNA 2OK7A 3RKRA 3T3OA 4NMWA 4MQ4A 5A5FA 2YWXA 3JCZA 1OFUX 4TLEA 1UJ5A 2Y9PB 5LYJB 4RVGA 2XXAA 3M9XA 3RADC 1HDCA 1SUAA 3I0ZA 3LHIA 4NOMA 4BQSA 5HM6A 4RTMA 1ZMBA 3TLMA 1RP7A 1TO1E 3NIWA 3PIDA 5FTLA 3OECA 1TOAA 1O2DA 1QORA 3MUNA 1MOSA 3RC3A 5B4TA 2XNJA 4JU9A 1BROA 1U8UA 4QM6A 4K3VA 5GJBA 1FP6A 5EHQA 2X42A 3BFPA 1W93A 4KMSA 3FMVA 3RGGA 2EJVA 2R1ZA 2VI5A 5DP1A 1CJKC 3T3PB 4DYVA 1XLWA 1RBZA 5AW1A 3L0SA 4QBFA 2NQ2C 1PYOA 5L53A 1U6IA 3C8DA 5EE0A 2O2ZA 1J90A 5BOSA 2GM9A 2ZAIA 4JWTA 4R7ZA 3ER8A 5DBOA 1B7GO 2QI9F 1T29A 4UUBA 5T3UA 5HG0A 2IRWA 4DC9A 2PO7A 5H4GA 2O14A 4H3SA 3DZGA 4DR2B 2ZJ7A 7AT1A 4OOEA 1DIOB 1XD2B 2J48A 3OWOA 3R2JA 4RVFA 3DE7X 3RC7A 3AP1A 4S1PA 5DF1A 1NVGA 4L51A 4PSUA 3RT9A 3ZGNA 3KM0A 4YRSA 2Q5JA 1N5IA 1RHMA 1SQGA 3O73A 1JAHA 3LVQE 3WQHA 4D9JA 2ZJBA 1UEIA 4H1UA 3M7IA 4IH4A 3SIWA 3T1VA 1GTL1 1LFDB 3IALA 2BMAA 4JU8A 3MS7A 3N86A 2V58A 4UPVA 4YJ3F 4CLDA 4ENSA 1GQRA 1MDFA 4GMKA 4AO7A 4CVNA 3ZVKA 1SU6A 2YWEA 1V43A 1T15A 1P3DA 4RU1A 5CITA 721PA 4DLLA 5IJWA 4Y2VA 1YDHA 3FOCA 3PBKA 4GMXA 3VGPA 5J4LA 1ACLA 1C7IA 1DKPA 4YP9A 2Y4NA 3EPJA 1B15A 3HDJA 1PEAA 3DCYA 1T8YA 4NZYA 3ANXA 3PG5A 3AVOA 1NC1A 2O0LA 3O91A 4LJKA 3REQB 3MJTA 2V6FA 4X8OA 5HFNA 2WR8A 2ST1A 3JD3A 3OZEA 3QA9A 2Q62A 3DLAA 1V2GA 3K09C 1VMIA 3QH4A 3TWOA 4WEOA 2DSNA 4ZHQA 2ZT8A 1D2HA 4NCXA 1XN1A 2IHKA 4PHCA 1V11B 1JR3D 4FYWA 1RNLA 2AWOA 3E03A 5DGCA 3T9AA 3P5BA 5KJ6A 1AXRA 2OG1A 3SQLA 2C7RA 1RYFA 4CKXA 2GEJA 3SEAA 1CYDA 3OE1A 1KYZA 3V9AA 3ISTA 2I8CA 3O2NA 1DU4A 3H9EO 4KUGA 5DNDA 4A8HA 3PNVA 4YPOA 2QE6A 4V0RA 1DV2A 3F4KA 1KI6A 2OCKA 1IQRA 3QBVA 1FFXB 1KI9A 5JNRA 1LJ8A 4W5RA 2O0HA 2AMJA 2D6FA 3F1LA 1QWSA 4B3FX 4N76A 3VR5H 1V5IA 2C84A 1QH8A 3IR5A 5FOSA 2C5HA 1RMQA 4FOOA 1U3CA 2B82A 3WL7A 2WSSD 1GUYA 3NAMA 4JOBA 5DX8A 5ENVA 3BE6A 3HJRA 1E2FA 2OFXA 3QE2A 2DXIA 2Z8ZA 3K3PA 3IKMB 2HA2A 1MO5A 1RBYA 2H7XA 4E30A 3CURA 4LFBB 3VDQA 4GZ5A 3PC4A 2AG5A 3CF4A 2JH9A 2D2XA 3HEBA 3FD8A 1W2HA 4B7AA 4MITA 5E0OA 4KH0A 4G89A 3TAUA 1C4KA 4WNCA 1FLNA 3C74A 4M8IA 4MW1A 2I87A 3G17A 4X92A 3NI2A 1M8GA 3ABQB 4OD0A 1IPFA 1NVUQ 1PSZA 1E0JA 1QIIA 1W52X 1XDWA 3FH0A 3OQ1A 4YCAA 1RPAA 1P0MA 5FLXA 4DUYB 1H6AA 2VSOA 3ZQUA 4FMPA 4QOHA 3P5SA 2ZJ4A 3C7DB 3ZLBA 3P0FA 1KFEB 1RPTA 2B92A 3PKIA 3BWMA 4UNIA 5EERA 4H7FA 4UJ3A 3FPEA 3KETA 2BTOA 3I72A 1PJZA 3ZGXA 2ZXFA 3WLPA 4H6PA 1GG5A 1Z56C 1NVXQ 2IEAA 3GPBA 1HDIA 1UZUA 2WKQA 3CG0A 4B35A 5A4JA 4ETNA 4DWOA 1T91A 2P5YA 2TRSB 4BLUA 1IXZA 3B7PA 4QDTA 3AUSA 2WAYA 3QI2A 1YDFA 2IPMA 5IAKA 2VDOB 4EY3A 1E1DA 3S68A 2C2BA 4YIHA 1RHQA 3DVAB 5CNJA 4URWR 1I2DA 1AGRA 1LCIA 2C7QA 4DLUA 4LC0A 3WIDA 4XYGA 1I30A 4O2RA 5HBRA 2B94A 2M1XA 2PQ6A 5DM60 2B4KA 1H5UA 1NC3A 1QHNA 1S4QA 2ODTX 1XKQA 2WM2A 2OOKA 1EFHA 3NBFA 3PQFA 3TRJA 3H11A 5FL7A 4ZYWA 3RIGA 1SN7A 3AHGA 2ZUTA 2YJGA 4LC9A 2OG2A 4PRYA 1TB4A 4QO7A 3RRMA 4WH0A 1RYZA 2HLHA 4JNKA 4TRJA 4DYHA 3VKHA 4O4HB 5BXQC 2QK4A 4GUDA 5BQPA 4UXHA 4IIVA 3ZZMA 3OOHA 5HOEA 1JR6A 3NJ4A 1LQ2A 2W2PA 1PDWA 3OFND 2DUWA 2CVOA 2BEUA 4OFBA 1Q14A 1JDZA 4JJIA 2H3HA 1JS1X 5HX7A 4Y1RB 4DNQA 3FNIA 3DZKA 3IIMA 1RW4A 2BKVA 3QKUA 1Q50A 5L95A 1JKJB 4IWXA 4M60A 3OLYA 1UBGA 2VYVA 3DBIA 2ZAGA 1RKBA 2ZULA 3I3SR 3LP5A 3RS8A 1L7XA 1UFOA 4E7OA 3HEAA 4QPNA 4G4SO 1PS8A 3ILSA 3KQYA 2FMXA 4J2OA 1KFBB 1P39A 5DM0A 3UHOA 1B8VA 4KI7A 1S2NA 4CM7A 2IYEA 3GT7A 3REFA 3AIIA 3OMWA 2PM8A 4CM4B 4L9AA 5LC1A 5D1HA 1HPLA 1RQXA 2ZR0A 3WNZA 2X2EA 1EWVA 3NIFB 4MP6A 3BQ9A 3H19A 3KAKA 2FSPA 3WA7A 2I4TA 3EZ9A 4X1KA 1SXHA 1Z28A 3HFJA 4LY9A 2K7ZA 3KPWA 3PHCA 5THXA 3C6ZA 4CMGA 1GGNA 2LDBA 3IAUA 4G5RA 1HLPA 1M34A 1RM4A 3FUTA 4A8JA 3H0EA 4K05A 2C2WA 4D26A 2ZYRA 3GGPA 4GLBA 5BN5B 4I5GA 1Z6PA 1WDWB 2XRYA 1OA0A 3RQSA 5FA8A 3R44A 2IELA 1M0TA 3H97A 4BBJA 2BFCA 1DKNA 1CZRA 1XDZA 2PQ2A 4KFCA 1RXCA 1PU2A 5A62A 1Q19A 2EF0A 3OOJA 4ALLA 2JFPA 5IXJA 1KFJB 1L5YA 4GX0A 5J1TB 3CEMA 2BH2A 3FPBA 3QEOA 3BRQA 3KP1A 3OKCA 3AR7A 1Z45A 1L7QA 1RCFA 4BMDA 2BCGY 5EZ5A 4AZTA 5AUNB 1U9IA 3WLLA 3PC3A 2PZLA 3H4MA 4IJKA 5CK4A 5LCXA 3W3ZB 3MAJA 2QUKA 3W9BA 3BTSA 1EI9A 1RHJA 2WNSA 5CW1A 5FI5A 2NGRA 3S2FA 2XI4A 2QTHA 5DTJA 4ZYXA 1BMTA 2NN3C 4BHTA 3PC7A 5JU6A 1UDCA 3QHPA 1QKIA 3QU5A 3LECA 5AJVB 3WLNA 2AFIE 3EOAI 3FCXA 3G1UA 2R8BA 5KYWA 5FFNA 4AUKA 3PSAA 3ZWCA 1KO1A 3D7KA 3HCDA 4GI3A 5K45A 4HWPA 5FL3A 5KOIA 1DL5A 5NULA 3CLKA 4F3RA 1NVWQ 3IEIA 3K70C 1GUAA 2P9QA 3SX2A 4BZQA 5LIRA 2JLYA 4J7UA 2I2AA 3IQIX 5SY6A 5AVUA 3GJ0A 4PNPA 1JLSA 1XLTC 1K0UA 4KQXA 3HXTA 2ECOA 5B4VA 3I9FA 3PUIA 2AZDA 4OGFA 3HVUA 1YB2A 1UWKA 2LRHA 3L7AA 3R09A 4I3FA 5T5QA 4C0SA 2PGJA 1M8KA 1DIBA 2WOOA 4HI0E 4GMDA 4O4IB 4QTZA 3T5DA 3KYCA 1CY7A 2LP4Y 2VUHB 4YPVA 3NXKA 1XKLA 4RYLA 4H3VA 2Y05A 2RJOA 1JHAA 1SCBA 2VUIB 3GN2A 3Q5DA 1GQ2A 2KLHA 4V3CA 4WKOA 3GZTB 4EY6A 3UJAA 1W85B 3CUVA 4O5OA 1C50A 3KR1A 4OJKA 1U7UA 3M1IA 4DIEA 1DC8A 3C1TA 3O9VA 1QIEA 2TMDA 1G5QA 2XDAA 2EBUA 4PIPA 1N6KA 1N7IA 3ETJA 4EGFA 1T9AA 4MWEA 4ZJZA 5CX1A 1R4MA 2Z1MA 1BSVA 4CMEC 1TZBA 2H00A 1VL1A 1W4BA 1WZNA 2L69A 3CXUA 1Q1EA 2H31A 3EMKA 2OILA 4KQJA 4MR7B 4OB6A 1TIBA 5DTQA 2FZVA 4ZU1X 3UFBA 4L3VA 2NUPA 1D6JA 1GKLA 1NSTA 3JQAB 3OLXA 3NVDA 1R6BX 3E9DA 5LD2B 4GT1A 4U9IS 2VWHA 3HUEA 3KHSA 1T9GR 4BKQA 3Q7SA 4JQOA 5GVRA 4AG3A 1F14A 2J87A 3CZAA 4U00A 2SICE 4Y9SA 3SHWA 3WIEA 5FEUA 1N2HA 4F85A 2X4IA 2WDPA 3M6IA 4YQYA 2AUMA 1AB5A 1YKFA 3RW9A 3L43A 2KB0A 5ALTA 1Y9ZA 3KSMA 3MLEA 1PQWA 5ECWA 3TL6A 5BWCA 3M89A 2BMJA 5EGSA 4DKXA 1VFNA 4A2WA 2B1GA 2ZJZA 1N2CE 3ZLUA 1GLGA 2XQIA 4E22A 1RBMA 4P7KA 3PK0A 2IOFA 3FJOA 3FSJX 3HNPA 2XQVA 3DE1X 3EG9A 3PTZA 1ZN2A 1RKUA 4JIGA 4LNAA 4PLWA 5ALQA 3D8BA 3V4VB 1GDDA 1I4TD 1E3WA 4LRSB 1Q74A 4TS3A 5CW2A 5BVHA 9ATCA 5JJKA 5DHSA 1MJGA 4KXNA 3DUFB 2W6JA 1A2QA 5AD1A 1B0UA 2ZUSA 5C5CA 4N5HX 5KQRA 1WF6A 4CETA 4PE5B 2B36A 4L16A 1YL5A 4GKBA 4F4UA 1HNNA 1AGPA 3JZAA 3VSCA 3FGNA 2VHXA 1T9KA 3M4XA 3PTLA 4UZFA 4V03A 2F3RA 4XJTA 5I9IA 3DA8A 4EF5A 5EE9A 4LE1A 4FYIA 4K2HA 3GWGA 3Q7TA 4LQ4A 3BSWA 3N5CA 4N41A 4EARA 3ROKA 2E1PA 1RLUA 2ATVA 3QEMB 4YAOA 1NOIA 3JZFA 5LOVF 1L8XA 1UBUS 3VPFA 4F56A 1P2SA 1EFPB 2FWJA 1RTTA 4A26A 1KH1A 3DC7A 3NG1A 4BO5A 1BH2A 3NIBA 1ZGGA 4KQEA 4ENPA 3ORSA 3OEEA 4BB5A 4CUKA 3GLHB 2Y2VA 5CYGA 1CUJA 1GNSA 3E3MA 3LC2O 3ENQA 2IJGX 5CEJA 1GHTA 4ZOEA 5JPDA 1VLHA 1K68A 4INJA 4FCWA 4P58A 4RQTA 5IDVA 3TUIC 4LNUB 4D74A 3QTLA 3UJHA 1NZJA 4BC1A 1R9GA 4BTLA 2GJKA 5J5AA 2ZYTX 3EDQA 1OB2A 3GNSA 2BI7A 3NV9A 1HXHA 3MBKA 3HA7A 4RAOA 5GQSA 2M98A 3IH5A 3UUFA 4TYWA 1T10A 2XGOA 3P4UA 4IAOA 2VT3A 4A2PA 4ZEVA 3V9PA 3B89A 4NONA 1L8QA 1U2QA 2Z8YA 4ZOLB 4E14A 2NO9A 3OTOB 2IH4A 2PNFA 1NBWB 5E6RB 2WYUA 4L0CA 4MJ3A 1N2XA 4ZOCA 1L1FA 4TWAA 2DWPA 3NH6A 3NH9A 1F6DA 2HU5A 3HB1A 7REQA 1WO8A 1RC8A 2GCEA 4KHPB 1K8YB 1AUVA 2XZTA 3N0WA 5AIBA 2ECFA 2WU3A 3ZYCA 2WU4A 3S99A 3UK0A 3WK9A 2PGAA 4W8GA 2Z6VA 4LHZA 4B3SB 3IVCA 3DV2A 2Q6TA 3HN2A 2QX4A 3U4MA 3F6CA 5HFAA 3ZXYA 4FX5A 5CFOA 1JKXA 4EUNA 3LHFA 1QCZA 4DMFA 4ZK2A 3WICA 4EAAA 4IHJB 5DMHA 4QRDA 3IBTA 3ESYA 4ALIA 3GIDA 1GFSA 4HTFB 4OL0A 2JLSA 1XZBA 3BHJA 1XZGA 2CXRA 1P2GA 3SR4A 1X70A 5BUSA 3G8BA 3OZVA 4OXNA 4ZREA 3IUMA 2ZAOA 4IMJB 1VSQA 4QLAA 1P62B 1S6YA 1RRKA 5ICSA 4NYJQ 4YFVA 4M9RA 5AK5A 5IT9A 5LQMA 1Z82A 3R7FA 4C21A 2G4LA 4IJ6A 2PZEA 5FTWA 1EVKA 1ZGAA 4OBWA 3VVMA 1EUQA 3ZWMA 3X1ZA 5AVWA 1NQ5A 4JT2A 3VBEA 4GVXA 3UUGA 4HX9A 4HWTA 2J3EA 1LSSA 1T4DA 2RGNA 4CF3A 5I4CA 2G4VA 2WTBA 2BGIA 2YN2A 1DQRA 3EWIA 3IQHX 4OXKA 4EZIA 3A6PC 1Q3HA 3S44A 2RJNA 3V8EA 3NRCA 4L07A 3WX0A 1J20A 2EV9A 2QA5A 1PT9A 1DB3A 1VIAA 2JW5A 2QRVA 2R8EA 3LMKA 1Q91A 2V7BA 3SY8A 4PYNA 1F0PA 4L85A 4D3DA 4EY8A 4ZHQF 1M1UA 5JAOA 1A9XA 2XCQA 2GZMA 2ANCA 4FFBA 4G9GA 5DNAA 3PD0A 4EGJA 2PLNA 4IS2A 1JTVA 4A1OA 4Q7KA 4Q9LA 4CDGA 2Q1UA 2CSUA 4GSLA 4EA9A 1RQGA 3TR6A 4EMSA 4C4SA 1M0EA 1KOGA 4FFDA 3TTTA 3HO6A 1JIXA 1YULA 2JNWA 4OQYA 1DTSA 1G20B 1ZJ5A 4QO8A 4WVFA 3T7EA 4RTOA 4MKFA 4HXYA 3UW3A 4QU5A 1Z4PX 4X8LA 1IIBA 2CLKB 1TVKB 4ZYVA 1IAVA 1RHKA 1SVUA 1YO6A 3GGJA 3QFFA 3ANMA 1PNRA 3GA0A 2HRQA 5GY7A 1BAPA 3R3JA 2XYQA 1Z2CA 2NYAA 4GLOA 2PGNA 4IP0A 2IV2X 4DIDA 2R8ZA 5F2KA 4BLPA 2H6EA 3VNBA 3RBAA 4KQ2A 1BX0A 4TRNA 4Q3NA 2GJ4A 4HJXA 3I2JA 1E79D 4RQBA 4C7OA 1DC6A 1E64A 2BDTA 2IF0A 5F9MA 4CM5A 1E1NA 4B7CA 2IDJA 3L8GA 1L1RA 1EWQA 4B6SA 1A8UA 4IJWA 4ZQGA 2DWCA 3B70A 3NPAA 4LY0A 4NFHA 5DEOA 5T6MA 2A9VA 4MW5A 3ZIDA 3ICQB 3H6GA 2WP8J 1TIPA 2PBZA 1E7RA 3IURA 1IATA 5IXSA 3JVVA 4CEHA 4AKHA 1I33A 2HN9A 1IHPA 3WLHA 4Y1EA 1TEHA 3AY0A 4MX8A 4EBBA 1TM5E 2P6RA 4JI1B 4ESHA 3WK7A 4DV4B 1W2WB 1YAHA 3PQEA 1RWMA 2OCAA 1DG9A 3EEYA 4CR7A 1Z5WA 2WMNB 3I2GA 4NCAA 1KIAA 1OASA 1OX4B 4J07A 3OJCA 2C8JA 2AF4C 3EXIB 4IRUB 4RA6A 2QLMA 4HRVA 2BELA 1RIFA 1U2GA 2P6PA 4MLZA 3FXAA 2P0YA 4A6PA 4FQ8A 5H81A 2B30A 1O7JA 1UZLA 3EDCA 2HA3A 2G9RA 4H3KB 2XD9A 4H16A 1R0WA 3U9LA 4P7FA 2OECA 1B4DA 2ZI3A 3I45A 4HWOA 3WGUA 3DWIA 2R8RA 2HBYA 4KYVA 3R7BA 3OOWA 5EIWA 2PH3A 1GPJA 4XARA 1U0EA 1RWKA 1HDOA 2GDZA 3MGCA 3HA3A 2AFHB 2ZUWA 3TZKA 3FHLA 1WZUA 1S9DA 5TGDA 4WA7A 3FYTA 2NYUA 3HHPA 4URZR 1QIFA 5G3YA 3TL3A 5A9RA 1G8YA 1UM8A 4GPZA 4QYMA 4JDUA 1GKKA 1PS9A 5TMBA 4JI5B 2A86A 5A3RA 2FUEA 4EJ0A 5EMJA 4BNWA 2COEA 3KYDB 1BYUA 1JSZA 1U8ZA 1YA8A 1NUSA 1HMYA 1UPBA 1Z8FA 2G9VA 3MWGA 2RARA 1IQPA 4WLNA 4BRSA 1UR5A 1MXHA 1F3LA 4UXIA 3OIYA 3A6LA 1FP1D 1ZGCA 1TU4A 2DTEA 2FQXA 3D6JA 2O2YA 2PD3A 2Z95A 1KAEA 4P2GA 3HWWA 3W1VA 4ZZ3A 5IX8A 4DKJA 2QD1A 1LPBB 3WLQA 2NVBA 3LIPA 2W58A 3HTXA 3ZQJA 3AQ4A 3TBHA 2I9PA 2CMGA 1I5RA 1ONSA 2QYSA 4UBKA 4N3CA 4NFSA 2YWCA 2GTHA 2IU4A 4BTEA 1AXEA 5DX0A 3ZQ4A 1M2OB 5AM2A 1RS0A 3A3OA 4R9VA 1LW7A 3NLLA 3QM1A 3C6XA 4WBXC 3CEPB 4HT3B 4DJAA 1YJ8A 5EPUA 1JHUA 2R65A 4K8OA 4BWFB 3R7DA 2FVXA 4QBIA 3X2EA 1VKOA 2FKNA 4PYMA 3UW1A 4DPLA 2O59A 2O8EB 1GPWB 3L8FA 3NDBB 1UK6A 2PX2A 3KQWA 4IUYA 5BR7A 1J2JA 2QZSA 4ZWNA 4D0GA 4D9CA 5FJJA 5I9MA 3NHLA 3I1FA 4HNAA 4QQ8A 2PQMA 1VI2A 4QPJC 5EIFA 3IEVA 1A50B 1MQ8B 1FRFS 3PDWA 1XD9A 3EVNA 3G02A 4XSGA 2M6LA 3SX4A 3SVZA 4P7GA 1OD6A 2BR4A 2GN8A 1VIDA 4F21A 4ZA2A 1RU3A 1IY1A 2WSSA 5TF4A 1KQOA 1FPQA 2BFFA 3LL4A 2LCFA 3ZZ0A 1Q0PA 5DV9A 1CXZA 2I2CA 4RORA 4DV0B 1UXHA 4M0FA 1WCIA 3O4GA 3QG1A 4EYGA 1I6LA 4C6RA 1CIVA 1Z4OA 2PSJA 1JBQA 3CY6A 3EIFA 3B1KA 1WQ3A 4WGFA 5LQSA 4GD3Q 4U39A 4DQ0A 3PNPA 3ORFA 3TLJA 1EWYA 2VSNA 4CR8A 1XZAA 4M6WB 5FADA 1JLLB 1NUQA 4DMRA 3P9PA 5HP4A 2ES4A 4D5EA 1R66A 4BQOA 1F38A 3EE6A 2P78A 3HLYA 3RFUA 5KTSA 3OCZA 4IX1A 2F8SA 3CUTA 1EPUA 3SICE 6ADHA 1XPJA 4RJLA 3L7OA 2Y1CA 4RELA 4U2DA 4HWKA 1OT3A 4MPPA 2Q41A 2JI7A 5AJYA 4BO7A 4DM3A 4HTAA 1YZ3A 1LTHR 4YT5A 1NNUA 1UH5A 1ZH2A 2HDOA 4V0KA 4C3VA 1XZNA 5ENDA 2CWDA 2H5IA 2Y27A 1HT2E 2MMCA 4J43A 3USES 2WSIA 3G2QA 5LMUB 1FX0B 3H5RA 3LLVA 3H87A 2PVCA 4IHKA 3A2KA 4MPDA 1K89A 5FTMA 4AN4A 3IAS6 1XTQA 2XT6A 2GEUA 1YFLA 1CZNA 2O3TA 2CLHB 5DLQC 3RBZA 5AVYA 3K0SA 2C4HA 5AIAA 1DBIA 3IXQA 3NMUF 2FQYA 3TQOA 4GPEA 3T1YB 1I14A 1T5HX 3NAZA 4BFXA 2CXXA 1LPPA 3IQZA 4US0R 1NULA 2EP5A 1C1DB 2GBGA 2KX7A 2QROA 2QSUA 2RCYA 2V98A 3T9CA 3V4SA 4BE4A 4MQFA 1Z83A 4YO7A 4DM4A 3JVIA 2Z43A 1U2TA 3IDFA 1DBRA 1A4RA 1XA0A 1GITA 1SA0A 3IPRA 4B33A 1RC1A 1CK4A 2AOTB 4IYJA 4HYEA 3VO2A 2YY5A 1R64A 2NWQA 1QH8B 4PCAA 1WEKA 2DFVA 5ILOA 3LL7A 5AI6A 1Z12A 3M1AA 1EBUA 3JQRA 2Z2JA 1JDUA 4IMRA 2WJIA 3OM0A 3OFNA 3PQCA 4KE6A 2PANA 5H0IA 4XASA 3W6ZA 4BQFA 1T4GA 2XTMA 2ZJAA 4OA5A 4XEUA 1B3RA 2Q1TA 4GYJA 3PCTA 5B1SA 1SBYA 1GVHA 1LBHA 2OXCA 3HDHA 1D2RA 2J3MA 4BQRA 1UBRS 4CM3A 5JD5A 1ST3A 1RI1A 5K09A 1WE2A 2G77B 2ZIUB 2GN9A 4RGQA 1DGQA 5DHAA 4TUYA 5LPNA 1I2MA 3FDFA 3BMCA 4ZQFA 2OOSA 3ELUA 4TZTA 5KAPA 3RUAA 3UOAB 5JRJA 2PKXA 5IT0A 1DNPA 4GR5A 1QH1B 4EB6B 4NS1A 1VYHA 3D4NA 4LRUA 4G63A 5D7NA 1C81A 2PMCA 4Z9BA 3WMXA 3EQ2A 2P35A 1KZYC 3HGTA 3HA2A 2WG1A 5AHWA 2CL5A 3V7NA 3VPAA 4O4LA 1PR2A 2OXRA 3CG4A 3KV1A 1FYXA 1GZHB 1FDIA 1Z4QA 1KBOA 3LT2A 3PL1A 1KYIA 3KVYA 4OFZA 1SXJC 3AESA 4Z8YA 4PN3A 2VN8A 3D4LA 1VYUA 3LC0A 4QT0A 2HK9A 2VAVA 3IERA 1KSFX 3MC1A 4HQ0A 3ZNOA 5T4EA 2PNJA 3AEKA 4B3BA 2VF5X 4RZIA 5JSZA 1NONA 2JIPA 2VP3A 3PXDA 4YECA 3JYPA 3RSHA 5DN6D 2NT4A 1CQJA 1RRVA 1LRKA 3G23A 3KB6A 4PHFA 2FRXA 1PJQA 1XSEA 5DXJA 4ABYA 5B7NA 2I7VA 3SF0A 1ZD2P 1ZUNB 4OLAA 4BJ1A 4JOSA 3IAM1 1OIXA 3FWHA 4KYTA 5JS8A 1CPYA 4UMVA 3F78A 1KTVA 4U7JA 2ERCA 2MTBA 3EH1A 3NZEA 2QYOA 2H85A 3I4CA 5AK0A 3WKAA 4QYIA 6REQA 5TQ2A 3OA0A 3DLCA 5HQ3A 1U98A 1CNEA 1XEXB 3JYQA 3QUTA 3BMNB 1W8DA 2WY2D 1DVRA 5KOJB 2H54A 5KWJA 3LKVA 1F5SA 4ZYYA 4B43A 1II8A 4V1CA 2XRZA 3OIGA 4RPIA 2A94A 2YY7A 3WKEA 2AYZA 2GSWA 4AB1A 1R5NA 4ZEXA 4H2DA 3GN1A 5IVIA 1P1KA 4HMQA 3WWEA 5FFFA 1TXGA 3H2IA 4DA9A 2BBOA 2Q5EA 4IJMA 3HR7A 1I3LA 3VR5D 2FW9A 2OPHA 4MH0R 5GINE 3IV9A 5TT0A 4B85A 1SKAA 3A9VA 3KBBA 1UMCA 1WWKA 2CHFA 3KE9A 3F74A 4KQKA 4MV9A 1OR8A 3CUEF 2FHSA 1KAQA 1U7ZA 3LY5A 1E3SA 1KK2A 3EGCA 1S89A 2J3LA 1LS1A 1O9GA 3HXLA 3O8OA 1XJCA 1PZXA 1P9WA 3SI7A 5CD9A 9ABPA 3F46A 3HZRA 2V7WA 1OZHA 3V8BA 3NGXA 1SGWA 2EFJA 5DNCA 1MC8A 1XI2A 5KINB 1HQCA 5E7QA 5F3RA 3L7KA 2ZSHA 3I2YX 4LTDA 3QYPA 2A0KA 5SZIA 2CV1A 1R0CA 4BMVA 1ZD4A 5I51A 3A9RA 4PSCA 3WNQA 4KE9A 2BFNA 4GPTA 3U4IA 5ALIA 2OTCA 2QHXA 2YJZA 5K05A 4PX2A 2RI0A 2WT9A 2QX7A 5BWNA 5LP6C 2PSDA 3IBCA 4JH0A 1KI2A 1AN9A 2DQKA 2Z5VA 3HM9A 1NDQA 3M3HA 2PUAA 3LUFA 2GD1O 4PLVA 3RVBA 4D3YA 1TMGE 5CVUA 4HNVA 3KZCA 1GNRA 4XLZA 4BN0A 4U02A 3CEJA 3T3DA 2HPHA 3NXSA 3TOZA 1V7PC 3H65A 5K51A 4D42A 1Z2PX 2CJPA 4V24A 3NM6B 1ZBDA 1K97A 4EYOA 3O94A 3H9CA 1DS6A 1E0DA 1QE5A 5AM5A 2I6TA 2AGVA 2PUCA 4H7DA 3BHIA 4BRWA 3V97A 3WLOA 1MO3A 1T8WA 1JZQA 1JPJA 1TKRA 1XBTA 2BF4A 2DZDA 3AB3A 4MWGA 4TSFD 4UEJA 3E0QA 2NQ8A 5F3WB 1ODJA 5KDDA 1ACMA 1W94A 1ZW6A 1QNFA 2O2XA 1GQSA 1CB0A 1JLRA 2O3SA 2QNRA 3B1VA 3F5SA 3JQ9C 4L2IB 4P92A 5IJXA 4XYLA 1PLKA 2NV2B 3HDTA 4GI2A 2AEFA 3EUWA 4O6VA 4DMUB 2CUTA 3H5WA 3KNZA 4WZAB 5KYWB 4M53A 3ND5A 1M2NA 1UFKA 2ZE8A 5E6UA 4Y6OA 4Y2UA 5EWMB 4XR4A 1C30A 4HHEA 3G9UA 2FFBA 3LBFA 5EKDA 3AP2A 2V5VA 2J3KA 3K9QO 2CBXA 3ZR4B 1AUQA 3U49A 4UNRA 4WLEA 5ALWA 2IGBA 3IOBA 3IUJA 2XB2A 4I36A 5F73A 1HSOA 4ER7A 4JLSA 4X9XA 3ZCUA 1E2PA 5AK3A 4NJEB 3QJ5A 3OCXA 1VE9A 4B3DA 4DIFA 4EI9A 3KQKA 3JU3A 1BXZA 1CUBA 1Z4NA 1HL3A 2ZSBA 1RXSA 3ZHZA 1O94C 1ISHA 2IKQA 3HV2A 2WHEA 4TTQA 2PLRA 3FPSA 2H1OA 4UVIA 1PZFA 4EGCB 2HMAA 4TVOA 2QU7A 5GONA 3ZIUA 2XPCA 2XBMA 1FRNA 2WSBA 3LUDA 2FX5A 1GQYA 3ZUPA 1GYQA 2GZ2A 5D84A 5C52B 4J0IA 3RHZA 5C51B 2GPTA 3G8YA 4LWZA 3IL2A 3I05A 1Z25A 1YOVB 4RV4A 2I34A 2E87A 1ZSVA 2P3LA 3FIJA 2FOIA 3HB5X 3WLRA 4AP9A 4BX9A 2FG7C 1YASA 1ABEA 1FNDA 3AI1A 4NNOA 3ZNQA 1XCBA 3ZG6A 1X1QA 3KQOA 2J4FA 2WUVA 2R6HA 4CV2A 2EFYA 5IEJA 1G21E 3RSCA 3GUZA 1ZZGA 2FLVA 2F3PA 3LZCA 1VSTA 3KB1A 4OHKA 3U6BA 1EHYA 3SVTA 1Q1NA 2XYGA 4E2YA 4U7PB 1CUIA 3FPFA 1L7EA 2O48X 1VHDA 1JG4A 2DPMA 3GGOA 3WZ2A 1QOQB 5L40A 3GRYA 4PXSA 3OTWA 3BD8A 4OPMA 2LWIA 1BG6A 3TX2A 2HHHB 2B4QA 4OP2A 1QUEA 2UUBB 3EB9A 2QYTA 3T15A 3M4JA 1AGYA 2H4ZA 2FZGA 3Q85A 3ICPA 4OYHA 4YCBA 2ZREA 5E8JA 4DS3A 5C1IA 3EFEA 5LL6P 1CRPA 4HBGA 2VJQA 3KJNA 1SIWA 1ZVMA 4EHHA 1O95C 3ZYZA 3RVMA 1NLUA 1SUFA 2EJTA 2F48A 4Y2YA 3UEOA 1NMYA 2RGGA 3M5CA 4IO1A 5LQJA 4L8VA 4ZVPA 3JASB 1YDWA 4B83A 1WLYA 3L40A 3M8KA 2YMLA 5T8KA 5EMHA 2W42A 4FZRA 1NL3A 1YB6A 2E82A 1PK8A 4P82A 4NX2A 4WCFC 3VH1A 3C39A 4AY5A 2ZXEA 4FJ1A 4R69A 4OSOA 1SPBS 2B21A 1M1NA 3GUVA 4FFLA 4EHAA 1P4RA 2V45A 4HAZA 3M83A 1IY2A 5HILA 4IIJB 2I2XB 3WGOA 1BX3A 3DFUA 1H9BA 1O9BA 2BFEB 3DL7A 1EUDA 4QA9A 4UREA 2GCPA 4YJGB 4BDTA 5SZJA 4DMLA 1J99A 2ZCJA 1VLMA 1M1YB 1XCLA 2JEZA 3DYVA 3EIWA 1BQ3A 3BXOA 3SS9X 5FBHA 2ZP1A 5GIOE 1Z5OA 1D6NA 1CU1A 2XYRA 4QOSA 4BFLA 4HAIA 4CR6A 3GRPA 4KFRA 2H1CA 2RIPA 4DLVA 3AEUB 3WDLA 1E0SA 4LAFA 1ULSA 3CPSA 1YC2A 5JAQA 3AFOA 3AHDA 1SU8A 3C5CA 3HEMA 1YL6A 1JG2A 2R6JA 3TR5A 5C3MA 1WXWA 2XR1A 3KHKA 1LU9A 4QPCA 1OJ7A 1PKXA 1QYVA 1WMDA 2YX1A 3PUVA 1R1DA 4TM7A 2QOEA 2CEKA 2Q0XA 2GZDA 2X4GA 4P1ZA 1CEXA 5FORA 3VPXA 3RYFA 1V26A 3QU9A 2D4HA 2G25A 2HPAA 2NLOA 2Z04A 4WJZA 3SJZA 1DE0A 1PBTA 1Y9DA 1CRLA 4PG4A 1JB1A 4O1MA 3PX7A 2VL7A 3L8DA 4FI3F 4Z86A 1RI5A 4B6RA 4C5CA 5TEWA 4D41A 4C4XA 3N8IA 3QMVA 4KWEA 1H4TA 1W88A 3LG2A 3E9CA 3I6BA 1WUKS 2R2AA 3ODGA 3A6DA 2IYPA 3JQFA 3O1LA 4KWCA 1P9LA 2WIFA 3SR0A 2O8DA 4FYVA 2OY0A 3NDJA 3AHCA 4I4TB 4PTZA 1L8AA 1QO9A 4UEOA 5KIAA 5L51A 1SNYA 2FX2A 3BM5A 2I65A 3U61B 4R5MA 3PGMA 1URPA 2UUPA 3LHSA 3K6SA 1E3MA 1N3BA 1C3JA 3MGBA 5M5BA 3R3YA 3K0CA 3QKSA 1OXTA 4FEEA 4D9IA 1TDJA 3WB1A 2AJDA 1P9RA 2VYND 3CW2A 2K2QB 2MIIA 2PVPA 3I5MA 1I4EB 1LBTA 3H5LA 3IBGA 3LUKA 1GRNA 5AMXA 3WADA 1VSBA 1KMMA 3JAMA 1PFWA 4P3OA 3CA8A 2EW2A 3L7MA 5E2AA 1E0AA 1IUPA 1FFWA 3LRXA 3LM8A 4TXHA 3THXA 2PL3A 3TLAA 2MSDB 1ONNA 3K4QA 4BEBA 1U7XA 3VZQA 1J7KA 2HWYA 2NUTB 5KPJA 1PCXA 4I81A 1BDJA 4O0LA 3HCEA 3KQHA 2PJRA 1G0OA 2HKIA 2DHCA 3LQ4A 5CB4B 3CW8X 4I2VA 4A36A 2XCUA 3FW1A 1E79A 4TT8A 4ZO6A 5CUQA 3VDXA 3WK4A 3V2IA 1OX5A 1ZUHA 3IX7A 1O96A 4JJ6A 5H3LA 3IXLA 2DCUA 1LBIA 3PE4A 1AS2A 2LIVA 3E9RA 4IGFA 3AOEA 2CMFA 3VPDA 3OHSX 1X7GA 3K8OE 1NYRA 3JQ8B 5AXAA 5JW6A 2O1EA 1XZFA 3BAFA 3RVKA 5K0BA 4UM7A 2EU8A 1CUEA 3A14A 3TSOA 4FJ2A 2EJUA 3QBEA 3QELB 4C30A 1NQUA 2AEEA 4FB4A 3ROXA 2MINA 1OF1A 5F12A 2YS7A 4B6OA 5DJ5A 3GDOA 3K6JA 3R5TA 2UU9B 2A9OA 4HN2A 1QLHA 2Z2ZA 1J0XO 1TI7A 3QMMA 3VJMA 2DPGA 5BRAA 3QVTA 2Y2UA 2HDNB 2EG5A 1OWPA 4U6QA 4ARSA 5CJJA 3FPKA 4OY3A 3V2HA 2YL2A 3ZJVA 3K8QA 1N7HA 4EFLA 3OY7A 3KKZA 3TSYA 2JS7A 1FZTA 2YJ6A 3QI7A 5AKYA 821PA 2Z6UA 4O4JA 3V7UA 4EECA 1UBLS 4TV8F 3AF2A 4EA6A 2J9RA 2QV7A 2ZBRA 2QLNA 1JDSA 3AEQA 3ELWA 3L1JA 5KYVA 1UPXA 3IIEA 1TCBA 2HF2A 2QMYA 1KRHA 2VJYA 3MWKA 3PD7A 1LD3A 1FMTA 3H5IA 4L5YA 2FSFA 4G09A 2J33A 1Z5GA 4ZOBA 3UWMA 2JEOA 4F1KA 4BO9A 8OHMA 4XQCA 4K28A 1F2VA 4MGZR 5CYFA 1OZAA 5LFAA 4R8KA 4KLZA 2BLLA 1EUCB 5BNZA 2UZAA 1W0KD 1BCRA 3FKSD 1YC5A 3HQ4O 5CR9A 4RSGA 1EEXB 1F3OA 2J3JA 3JXEA 3TXAA 3ZZTA 2QVYX 5CGQB 2PO5A 2XNKA 3C14C 4DM7A 3D2BA 4FWIB 2OGWA 3TEFA 2GA8A 4E1BA 1SUCA 3G5TA 1ESEA 3ML1A 4MRMB 1UJ2A 1D6MA 3B1YA 4QU9A 3GO4A 5DNEA 2PE5A 3VO8A 1L7BA 5A6VA 1Q5PA 2JI9A 2RD2A 4YXWD 1BXGA 4JLKA 3KFLA 4EW3A 1R0BA 4B7ZA 1GAXA 5JG7A 1Y7IA 2PD4A 1QNLA 4G8JA 2SHKA 1IUOA 3H1FA 3UXMA 1BD4A 2DC1A 5D6OA 1SUPA 1PX2A 1V5WA 2XT0A 3RT1A 2CMKA 1E7WA 4MKXA 4N8EA 5E4TA 5A3JA 4TUYF 4RPKA 2QN2A 1WVGA 3E1KA 1N0IA 5A04A 1CS0B 3P19A 1I1QB 3ZWOA 2OHVA 1CX9B 4WX2B 4PLFA 4DNPA 2XMCA 3R76A 1X7WA 1KAGA 2PS3A 4UUPA 1IRXA 2A9KA 4DOMA 4K81B 1KARA 2ZWOA 1W5BA 1W8IA 3GGGA 3QPBA 4O4LF 5IEBA 4HNQA 3SBOA 2HBQA 2AVDA 1Z4LA 4X7RA 5BQFA 2ZKIA 1IFXA 2CE2X 2YQZA 2HEGA 2A5LA 2UYYA 2ZSIA 4CM9D 1D2GA 1KY3A 1I51A 5K1ZA 4EJSA 1UM9A 3INGA 3L02A 2JPDA 2ZVPX 3GYBA 5BQ3A 1JEOA 1MRNA 5JCJD 2VXYA 3KSZO 1IQUA 1G6OA 4UATA 4CYMA 4D4IA 4TKLA 5KYUA 1Y3DE 3I9NA 1KMQA 1SUIA 1XE3A 2A1TS 3PE6A 3WOHA 4TL8A 1TYBE 3T99A 4XUEA 1M83A 1XTPA 1ZCJA 2G07A 1HDGO 1L5HB 4FMCF 3PZBA 5IW8A 4P2BA 1HETA 4FZ3A 5A06A 4U3JB 2H92A 5DLYA 4UM5A 2JHGA 2OV1A 3A6KA 3DBLB 3ITNA 4KGZA 5EXPA 3T4UA 1NUPA 2QMEA 4G6ZA 1NN3A 4WV3A 2FSVC 1NZDA 3UPDA 4JI4B 1XR3A 3L9WA 3MOSA 2I54A 2PX6A 4B48A 2WW8A 2VJLA 5FKJA 2ZS7A 3OLVA 2FZ4A 4S1OA 2FEXA 2RH5A 3OPVA 3MWEB 3INRA 3D1LA 4DCMA 3AV3A 3KRTA 2Q4DA 4N3BA 4E09A 3O4FA 1S9HA 2XUHA 1I0LA 5AFSA 1E8NA 3E58A 3K4PA 4O2LA 1U1FA 4MSUA 1GTVA 5EA2A 1O8CA 1QIKA 4ABTA 4AZ3B 4DCOA 3WS7A 4DDKA 3VVBA 1NXTA 3PJEA 3OEHD 4HDMA 1TMYA 1KJZA 2AFIA 4PU0A 4GS5A 2AS0A 5DN9A 1V5GA 3C3AA 4DXHA 2YXNA 5ALXA 4PSDA 4MVCA 2ZJ1A 4DLAA 3Q8LA 5CCXA 2FK8A 2VUSA 4KAFA 4TZ6A 3HZOA 3H4VA 3HNOA 4I55A 3GMDA 5EZYA 3QNWA 3ZH2A 4DGSA 5JAZA 4KRYA 5BN3B 1EVIA 2P6OA 5CAEA 4QJBA 2PL1A 5IT5A 1VOTA 2VHQA 3ZBUA 4PRKA 2QWXA 2JLZA 3HB7A 5HIJA 5ETJA 2O0JA 4HMOA 2HYDA 5HCIA 4CODB 4DMKA 4ENUA 5I9TA 5HIMA 2HWWA 1U1EA 4G56A 3L4BA 4WNAA 1G7CA 1RAAA 3EGOA 2H5EA 1Y5RA 3OM9A 2W83A 5KMGA 2HRZA 4QFMA 1YU9A 1P33A 1C3XA 2IYTA 4ITVA 3WLEA 3V46A 3X0DA 3AIMA 4I1UA 1XALA 5DOZA 3GARA 2GAIA 1SC6A 4Y1GA 4ZVTA 1B42A 4RTKA 4HNHA 2NZ8A 1QVZA 4G5GA 4W9NC 4AIRA 2Y1EA 1CEEA 3U5TA 2BONA 5BPHA 2EKPA 2JK1A 3N75A 1QG2A 1T4BA 3IHWA 5DIZA 5SYMA 3T3GA 2H51A 3CLSD 2CLSA 2BD0A 2FGJA 4YP6A 1Z63A 2CSXA 1WXIA 1Y48E 3WJAA 1KZ1A 4IFTA 2PPLA 4FK8A 4Z7QB 4RD4A 5KX5B 1CSEE 4GDFA 2JJ2D 4HLCA 1Z16A 1X80B 2VOEA 3BOSA 3ORRA 1IJKA 1OKKA 1ZLYA 3AVUA 2O8CA 1NSFA 1N8KA 1WAMA 3AB7A 1PK7A 3VMMA 1H0HA 2N75A 4DEXA 1H2ZA 4UBIA 3H9UA 3OD1A 2DUJA 1Z8HA 3N74A 2XODA 1JIUA 1PNOA 3KAQA 3L3BA 3AJRA 2LPMA 3DE6X 4IIEA 3V4LA 2BFDB 1I1HA 3UK6A 1EAYA 5JVDB 4DYDA 1FFBA 4E15A 4OGWA 5ELXA 4TWIA 3ROZA 2C2ZA 4HQLA 1WCYA 4NPCA 4RKRA 4RY9A 4JT4A 5FDFA 1K4KA 1CJSA 1U0BB 1UMBB 1PTJC 3NWEA 3P9IA 3GUCA 4Y6PA 4C3ZA 5K9ZA 2GD2A 5DN6A 5KWVA 1DG1G 5L3QB 4TWBA 1B6GA 4JUCA 1MEOA 1CUGA 4BATA 2NXNA 4FMDF 1KP2A 4I99A 4MVJE 1N2CA 1TD1A 4HN4B 1R0YA 5F23A 5JRZA 2BGMA 2FRDA 3WO1A 1P18A 2QUAA 3C70A 3OM8A 1M72A 1AHHA 1TYAE 1X8LA 5GONF 2HCRA 4LWQA 3BE4A 3EXFB 1DAMA 3PDCA 4U2EA 2QRJA 2X4LA 3GFPA 4L0MA 1EGQA 1QZXA 3N2GA 3Q9LA 1ZP6A 4NEHB 1FU7A 1XCPA 3NUGA 2HHCA 4RF4A 4Q1CA 2IYAA 2WYHA 2Z3ZA 3CZ5A 4GAEA 3RC2A 5I3CA 3HJCA 2VEDA 2QV0A 1N6OA 1YQDA 3PCXA 4XH9B 4HFJA 1AZWA 1W5AA 3ND9A 2EP8A 1QTNA 2VWPA 3NHSA 4KKXB 1IVNA 1E66A 1OFGA 1V35A 3JYOA 5IK2D 3CRQA 2UUCB 3HFSA 2X0KA 3D6VA 4FSDA 3VR5A 4UTPA 2AUTA 3BMCB 3IT1A 3O84A 3F67A 3RS3A 3VU9A 4FFVA 2ZIWB 1TCVA 3L6UA 3F0TA 1D0SA 2ZR7A 5B12A 1JVNA 2YW2A 2HB6A 2W22A 3BWBA 3EYWA 3G0IA 1C0KA 1GXSA 4IWNA 1I4OA 4OGGA 1TEVA 4IPTA 1Y98A 2ALJA 4F9EA 2Y77A 2IS2A 5ALRA 5A4FS 5KQSA 4OHBA 3SBDA 5K99A 4ZODA 3ABZA 3O3MB 3R6LA 2EIHA 5EJ7A 1C9YA 2BCEA 3EGIA 2GUWA 4Q05A 4Y6GB 1VDZA 5KSPA 1VFPA 4FSHA 1CVIA 1SXPA 1P5ZB 4QARA 4YAJA 2DCMA 3PB3A 2FEMA 1TA0A 3IB3A 4AJIA 2I6SA 1GUFA 2HA6A 2BCJQ 4UMDA 1N25A 2OBXA 3SS7X 4D8WA 4BQPA 2W9XA 1J4AA 4WNIA 3CR8A 4LGVA 2L42A 2Q29A 3K2QA 3PV0A 5COAA 1KRWA 2FEKA 4I1IA 2IHZA 3EC1A 2MWMA 1LI7A 3T3NA 1OFVA 3FWZA 3W1EA 1NJSA 1R0KA 1D2EA 4F0JA 2OENG 4MUFA 1GKUB 1SK9A 3GWZA 4XEHA 3ROPA 5K6AC 4K46A 1CG6A 3STHA 3MCZA 2XMGA 5FHQA 1PG0A 1HRKA 2QORA 1MHTA 1QZ3A 2DAPA 4IZ6A 2W8BB 2F1OA 1WSBA 1KJ8A 3IJPA 1RWOA 3JR3A 1MF7A 4G8CA 4TSFA 3AQIA 1V71A 4V1CB 4PICA 3CGGA 1PZMA 2QL6A 2QVLA 1O6GA 1YS2X 3SNKA 4UNSA 1DO2A 2TS1A 3HK2A 1HK7A 1YQEA 3DTTA 5LZ4A 4GW3A 1GPNA 2AQIA 3HU5A 1NI4A 3NB0A 1TCCA 3FUUA 4XPZA 1U3UA 3N53A 3DZ8A 5ALHA 2EGHA 3E3NA 4QATA 1IB6A 2FG5A 2ONJA 5IKMA 2GXAA 2VBFA 4DIUA 5I45A 1Q0SA 5KYXA 3P26A 3L06A 4Z2AA 1CZUA 2DBQA 4FU0A 1ZITA 3BRSA 5E3IA 1T2VA 2JAPA 1NAHA 2QR5A 4HGRA 4TS9A 2IYUA 3VHXB 3WRYA 5ARCA 2PUEA 1NP7A 3MD9A 1Q95A 4ROSA 5DYYA 1FBTA 4LYJA 3TQSA 2GVDC 4AS3A 4MGYR 3A05A 3UANA 3O8OB 1R0ZA 1ADGA 2KBEA 4DIKA 1L7DA 5T67A 4IV0A 4RTPA 3CIFA 1M6WA 1CD5A 3OPQA 5F52A 3LVBA 3M6MD 2X6TA 1AA6A 2Q9UA 4R1LA 4BGEA 2G6BA 2OK8A 4FZ5A 1DKMA 2IYWA 3R5JA 3QVGB 5IMBA 1OAOC 5C53B 1C4WA 4HXFB 4DIMA 3RTDA 1FUYB 2AYXA 2Q3EA 2WA2A 3MCUA 4UU7A 4K40A 5F35A 4DMHA 5ITZA 4U7DA 2ZROA 3OU6A 1A27A 2KWIA 5FBKA 3LT0A 3R3SA 1JDJA 3WP1B 3L6RA 4ROTA 2O2EA 3EVGA 1THTA 4KCGA 5IHXA 4WIAA 2Z5LA 3AF6A 1IEWA 2GAAA 1KP9A 1A8SA 3HFRA 3JYHA 3DZJA 3EWAA 1GEEA 2ORED 2QT9A 4QASA 2VSQA 4U4AA 1QRSA 3LIIA 3OLQA 4KRGA 3DTVB 3IJEB 4HZUA 4MRAA 4XIIA 4RCYA 3V1UA 2WB2A 5JCOC 3OFJA 4Y0AA 3LCUA 3BB1A 1FA9A 1UKEA 3QLEA 1FNCA 3W5AA 2BC9A 1U0JA 5SV2A 3E61A 1KFKB 1DT3A 2V97A 1TEZA 1FP4A 1T1EA 1NRXA 1B93A 2VT7A 3G0DA 3RRZA 4BP9A 3HMKA 1KMNA 4YT8A 4ZJUA 1A9SA 1GRCA 4GPD1 1JA0A 1OLSA 5E4YA 1J6UA 3O4RA 1J00A 4YAKA 1DQYA 5ICMA 2FMUA 1FS5A 3ZX5A 1VXRA 3RF7A 4AMGA 4KXFB 4OF4A 4EPXA 1ZVKA 3HBFA 4FE4A 5KKCA 3KAJA 3OMLA 4PQGA 1D9XA 1T9DA 1J5PA 1HG0A 1W5TA 2OFWA 2VOJA 5EJFA 4AN1A 2XUJA 4BKPA 1SZDA 3AUJB 1JSXA 4HDNA 2FDRA 4JQYA 4JEHA 4UC0A 5DHTA 3M81A 2F1RA 2XITA 4RVOA 1ZI9A 2X14A 1UDBA 4KSYA 5AHXA 2IODA 3WL6A 1JR2A 1QC5A 4QOGA 1QE0A 2FEPA 2WE8A 1C1YA 1DBSA 4B34A 3BFXA 5F2NA 1E1MA 1OYWA 3L18A 3CW9A 4P4LA 4N4AA 2C4NA 2WMYA 3CVOA 3BREA 3DFIA 5A9SB 3O4IA 5GP1A 1UQRA 3MWFA 3X1XA 3DFMA 4PVCA 3DLBA 3AIOA 4ATNA 3R9WA 4DJ5X 1NPDA 2R7KA 4DZRA 4ZT3A 2J7PD 5CMLA 2GM5A 4HDKA 3NFYA 4W1SA 4OK5A 1JPUA 1J8MF 3A70A 2PGXA 4AUMA 1E59A 2HJRA 3AK4A 3GUUA 3KLPX 3W78A 1ZXXA 2WWTA 3VVLA 2PKCA 3K94A 4UARA 5LMNB 4G37A 3NHRA 4OXRA 4OAOA 4Q4JA 3ZE6A 4M38A 3TEMA 4AX4A 3ECCA 2JGRA 3OJFA 4C03A 2ZRAA 3DAHA 2OHOA 3MTQA 4R5HA 1GUBA 4PZYA 3O03A 1YZFA 4KODA 3OO0A 2BGJA 4U6NA 3PGKA 4W5TA 3KS9A 4TX1A 5E38A 1FNBA 2MR5A 3L0DA 5IP5A 3M6WA 1ARZA 3NYRA 4Q12A 5TSDA 3GYGA 1MU0A 1XZMA 4QPZA 1H8ED 5TMEA 3OO1A 4AY4A 4PFJA 3TMKA 4D4LA 4BKOA 4JI2B 1G66A 3DF7A 3KJZA 3F9RA 1IN6A 2O9JA 3OZDA 1NA5A 3GLFA 3AUKA 3R8FA 2DT8A 4YV7A 5ALFA 2VTBB 4DCJA 5GM2A 3NEAA 2AWNA 3JR7A 1CVLA 3LC7O 5AW5A 1M2VA 1B0PA 1OJLA 5IAOA 1RYDA 1EGMB 1R6UA 2NO5A 4RADA 3KJHA 1KK0A 1YVRA 2ECKA 3G9XA 4KH1A 4Y98A 1L5QA 1AS3A 1P6QA 1Q6ZA 3DS8A 3GR6A 3N2EA 4TMYA 3UHAA 4K7JA 5A03A 2NXWA 4TXLA 1G60A 4I50A 2NO4A 1NX6A 4OLFA 4JI6B 2O5CA 1C80A 3LUHA 1YR2A 5JMTA 3ZY6A 2E4WA 2BI4A 2UDPA 4R1OA 4ZI7A 1ENPA 5IFLA 3OTGA 1BDBA 2Y6VA 2F43B 4NH0A 1PGJA 2B35A 1USVA 4FUTA 4E0BA 2GPNA 3D6AA 1PQ4A 1IDOA 3LT4A 2AC4A 2O7RA 1ZA2A 1T2AA 1QANA 2VYNA 3OQJA 4EJ2A 3EGXB 1AX9A 1H2BA 3QUQA 1IAQA 1NDHA 3DZBA 3D31A 3F6BX 5JATA 3HJFA 2Y1DA 2CNNA 3RS5A 2Q5QA 4EUKA 2VP0A 5JCZA 3QYFA 3AL0C 3AF4A 3AUAA 1DADA 3WFZA 1YE5A 3T5BA 5CCEA 5L7WA 3UQZA 4OU4A 1O0BA 1RJDA 2ZT6A 2BT4A 4K86A 4UMEA 1ZD3A 5IH3A 3NWJA 4HGQA 3F7MA 2OESA 3AETB 5B6IA 5EKXA 4FBMA 2BZ0A 3PYXA 4JIMA 1Q3KA 1JIJA 4E12A 5GGYA 4ZZ0A 2A14A 3AXSA 2Z2IA 2P9EA 3K0HA 3MIIA 4D57A 5LZ5A 2D74A 3KZNA 1UT5A 3N0VA 1G6Q1 1SC9A 4Q7LA 4RF2A 2WB4A 2UV8A 2XXBA 5A02A 2ZZMA 1F51E 1H5QA 1RYEA 5FI1B 4P84A 4DSNA 1K2VN 2DY1A 5HTKA 3UMJA 1SVOA 1BEEA 4LV5B 4BVAA 2OAQ1 4DUGD 2NZXA 3I8OA 3U1BA 1T5BA 5BW6B 4D43A 5KSZA 2ZB3A 5TJHA 4RFLA 3VGJA 3ZI7A 2I1QA 5EYPB 4LRTB 2NU9A 4TKVB 2F55A 1G38A 3NOQA 2QW1A 1DFGA 1H9AA 2GESA 2GF9A 2WUFA 2WA1A 3OE5A 3PNKA 5L4LA 4EF4A 4OXXA 4DIBA 1I8TA 1DXQA 2Q6LA 4G67A 4GX1A 3ZGOA 2D4AA 3MWJA 3PNOA 4F2DA 1TD9A 1DXYA 3C15C 3DVLA 2R0QC 1A9YA 4J16A 5D3QA 1K8XB 1CJVC 1NBMD 3WLIA 1EXMA 1Y3HA 3DLIA 1BWQA 3EXHA 1PG2A 4JC8A 2WLTA 1Y3FE 4WN9A 4YUAA 2NYVA 3E15A 3G0BA 2PPVA 4OAQA 3HLTA 3IMCA 4I55F 5EZYF 4X0EA 3BL5A 1ORVA 4O8CA 3ENVA 4CG2A 4ZZ2A 4D4GA 2OC4A 4Z6KA 4NBSA 1V48A 3N2NA 1W0KA 4M0CA 5KKNB 1OGJA 2X22A 1RM3A 4NATA 2OBBA 4D3ZA 3ZS8A 4N03A 1Q1ZA 3HR8A 4K9KA 4ZXPA 2GETA 4C7KA 4UHHA 2HTEA 2XV1A 3DVRX 3L8ZA 3U4QB 2F1KA 4FYKA 1IJEA 5FOQA 4JLDA 2CXHA 1EJ2A 4KQ9A 3HB9A 4DGQA 4HLNA 5KVQA 4WHMA 4JB3A 5TMDA 3A3NA 4RHYA 4ETWA 3G79A 4YXWA 1FU8A 3FVQA 4KZPA 1DKOA 2WWGA 4DN6A 3DBVO 1QPBA 1KI8A 1O97C 3HKBA 1K7CA 3HY3A 3MIZA 1ONPA 2Q2QA 3FMOB 1LA2A 3G2HA 4BEVA 1HT3A 3ZS9A 5HJ2A 1ZN7A 2XVMA 3F2IA 3TVDA 4QQRA 4NWIA 2Q4TA 5TE9A 3CRMA 4LSZA 3DLTA 1PJ4A 3ZIAA 3DEZA 3KYIB 4Y2QA 1IBRA 2Y93A 1E6WA 4AN0A 5KVAA 2ZOSA 1KEKA 4N54A 1SQSA 1OROA 2HT6A 2ZWVA 5BSGA 3JD2A 1Y63A 3BX1A 1GP2A 2Q49A 2OPBA 13PKA 1PUXA 1Z88A 1KDPA 3JQBC 4MDYA 3RU9A 3NJRA 3WK8A 1OZFA 2DFTA 2R7MA 4H6XA 4O4JB 4CM9A 4Z4CA 1AK1A 1VKNA 3MW8A 5AOBA 1T36B 2HDWA 3FSRA 3KT0A 1T4CA 1YHYA 2XUGA 3NBXX 4FQ7A 5JCJA 1GPLA 3FN4A 5JDIA 2HA0A 1DEAA 2RKWA 3FNRA 1KPGA 4KVZA 4B7XA 2WWYA 2Y1FA 4I14A 3IBFA 3MRSA 1VKRA 4G0XA 1CF9A 1L4HA 1R8XA 4ISBA 4C4PA 3DD1A 2H1HA 5HIAA 1PO7A 1UDWA 4TRRA 1V1JA 1DJLA 1FSSA 2FFAA 1L7NA 3DKVA 3N8DA 4ZV9A 4DANA 4JBNA 4HJRA 3F98A 4WCDA 3QUSA 4ESEA 4XAQA 2JAWA 2D62A 5HMMA 3U37A 3CRRA 4W1RA 4XM1A 2J0EA 4EEZA 4MVJD 2CHEA 1N1EA 4FB5A 1UMDA 3HU1A 4GE3A 1Q15A 9MHTA 2JFWA 1H2AS 4H6VA 2LZ0A 4G85A 2FOXA 3JVDA 4MO9A 4C20A 5LM3A 1DRVA 2JZCA 2ZIGA 4ARAA 5GIPE 4L27A 2QLTA 1U1GA 2ORWA 2MYTA 1ESMA 1M66A 3IRUA 1B26A 1AZLA 2D0OB 4ZQIA 3BIJA 3RSFA 4EF6A 5EVJA 1JWAB 4HVLA 1QPZA 1TGYA 2RHHA 1SBHA 3HCCA 3RRYA 4CQLA 2XTZA 5JIBA 3F97A 1FXWA 1PGPA 3TSZA 4C0KA 5JAIA 221PA 2R66A 5FB3A 3OEHA 4CU5A 6GPBA 3E22B 1D8TA 3GRRA 4QRIA 5F1KA 2FN4A 4EH1A 4UAJA 4ME6A 1X7WB 4MUXA 2Q3BA 4FE7A 2C8LA 3QX8A 3RIXA 4HRYA 1X7YB 1OLXB 1Z5PA 3SZMA 1KKLA 1LI5A 3KKEA 3SQWA 1NUTA 1ADYA 1MG0A 3G82C 1SBCA 3LQ1A 3JWHA 3WNDA 8GPBA 1T2EA 2DQYA 2V6JA 3AR3A 2AG6A 4JJEA 4TL7A 1XTVA 5F78A 3H9QA 2LKDA 1UM9B 4Z9XA 1HOXA 5F7XA 4KR2A 4P33A 2NZYA 3SSNA 1JFFB 4JHLA 2ZCVA 5YASA 3A6GA 4F7WA 4YJ2A 3DT6A 3AHJA 1A7UA 1Z74A 5JSYA 3RUIA 3HDVA 5HFJA 4K6HA 2VYQA 2RH8A 1LQTA 1FZQA 3L05A 3I5YA 3X44A 2F4VB 1WXDA 4EKYA 1RWBA 4HQFA 4FYXA 2QQFA 4QXRA 4X8HA 5DMXA 1GA6A 4BNDA 4G9BA 1NF2A 4JMPA 3EDYA 3B20A 5IJ0B 5IVPA 4DR6B 1PBNA 3B38A 2PXHA 3OX1A 4FHFA 3LI2A 4GBJA 1FS4A 1QYIA 2CXSA 3BZWA 1R0XA 5T3YA 2OHGA 4BX0A 2FSHA 1BFDA 4C3UA 4UVEA 1LPSA 1DDIA 3HUTA 1MA3A 2VK1A 4LXTA 4N0EA 4XZ3A 4YFYA 3CN9A 4F4HA 2A0FA 2JJ1D 2JJ2A 1II9A 4ZVVA 3TW4A 5LNK1 2DVMA 5CTAA 3K70D 3QLTA 2Q8PA 2GX6A 2V54A 3LDFA 5DSXA 4A3SA 3BQNB 4JR0A 1SKYB 3ER6A 3ETGA 4MGHA 1IXYA 3ZD6A 2ATXA 4KAAA 4M0PA 1HNWB 1LZLA 5G0UA 2CNLA 2ZIZA 3GLIE 4GZMA 2DRIA 4IG9A 4DMCA 3L0IB 3MMSA 2BP7B 2AN1A 4F12A 3RFTA 1QPGA 4F72A 4EL0A 3LKDA 4WXYB 4BZPA 1DC3A 1KXZA 1WB5A 2MOKA 4G0QA 4QWMA 4U1RA 3AFIA 2H2FA 4PPQA 5FUYA 1YTLA 4CKEA 3FA2A 2NO0A 2I2FA 1JDBC 3PS9A 3DAFA 1R8SA 2AW3A 3HGMA 4AY3A 2NMVA 1GSIA 1RE1A 2PXAA 2QT1A 4WAUA 3SC4A 2QN7A 1CF2O 1L9XA 3OPYB 4WKCA 1A04A 2C77A 3L1UA 1HY3A 2XB9A 5CLIA 3EF3A 3W34A 3FB4A 4NOKA 3EEFA 4GZLA 3DDHA 4PLHA 3MGAA 3H3JA 4RE5A 4GHWA 1JDPA 1ACJA 4PINA 4XCVA 3LCVB 1CIJA 2GFQA 3B3JA 3PXEA 1GGJA 3ZE7A 2HXGA 2QAGA 2YWRA 2XMRA 3MEQA 4X84A 3ADDA 5DGDA 3E9MA 4C9BA 4IGKA 1E9EA 2WAMA 2XJ9A