4Q02A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q02A00
2C2HA 3TE6A 4KSBA 5KSPA 4B3XA 1Z0KA 1JR3E 4MGKR 2ZJYA 1OXVA 1JECA 3ZLJA 1E32A 4OI4A 5EZ5A 4E22A 2P2LA 3EAQA 3KTAA 1HE1C 1LB1B 5AR1A 4PSVA 1EWRA 2HUPA 2L0XA 1AQYA 3PR1A 5BQ5A 1S9HA 2F7SA 2QT1A 1XMSA 2AN9A 5F2EA 1AGRA 2FSFA 4W7SA 2EWVA 1QHGA 3N5CA 3ZVMA 4TLCA 1JAIA 1YRBA 3VMFA 2XXAA 2GXQA 2BCGY 1KK1A 4TMTA 2RCNA 4TL9A 5TXGA 3GCGA 4ZIRB 1G8YA 2BMJA 2J59A 1UBCA 3KZ1E 1HQYE 1PZNA 2OV2A 3CLVA 4MKHA 1N6LA 3GLFB 1E2IA 3IHWA 2NO7A 4TLDA 4M1SA 4DLRA 1RC8A 4DLUA 2AK3A 4Q9LA 3T1QA 4RVCA 5EXPA 1S9DA 3ECCA 3OAAA 3W9YA 1XCGB 4QHTA 2DFNA 3RSLA 4EJSC 2YINC 3O8BA 3CW2A 3FKSD 4LHVA 3RAPR 3PENA 5B64A 4C0KA 3GLIE 4FCWA 4P33A 3SJBA 4BLPA 1BIFA 1E2KA 2PMKA 3NXSA 4TMWA 2CE2X 2IXFA 1Q20A 1G3UA 4A0RA 1RFLA 1G5PA 4CEHB 4EPWA 2FPMA 5DLQC 1IHUA 4Z1MD 2ONKA 3K9LA 4I1VA 3KX2A 2EWWA 2PH1A 721PA 1SVLA 1W4CA 2BM0A 4DB2A 4FWIB 2J87A 2EYQA 4XD7A 1IJEA 4C30A 3SI7A 3WNDA 2ZETA 2QRZA 1HH4A 1XPOA 3U2QA 4L5BA 1JPNA 5M04A 3IBGA 4UXHA 1A5TA 1KMHA 3IKJA 3GLGA 1UBGA 2OFOA 3AUYA 1IY0A 4BECA 4D4LA 3MWJA 1R0WA 2ZQ5A 4M9XA 4RD3A 1UBEA 1VG8A 1COWD 4KVAA 3DZDA 1GFIA 1M7BA 4TTRA 4YXWD 4ZKDA 2K5UA 2G1JA 3QXCA 1IY2A 3HP1A 4JS0A 5L3SB 2AHOA 3KJGA 1RRPA 4V03A 1MV5A 2OEPA 4RZ3A 2CHGA 2WICA 1KDRA 2EFCB 2GEVA 2VLIA 1N25A 3L82B 2F1HA 5JI3E 3K0FA 1XTRA 3OIWA 2CCKA 3BS4A 4M0LA 3NC1C 3TR5A 2WM9B 1I4TD 1G5TA 2NZJA 4MYTA 2GHIA 2J0UA 1AS3A 3JVVA 5SZJA 5EE0A 3BWDD 3QXSA 2FE4A 2QE7A 4DIDA 5EXSA 4BFZA 2NZ8A 1TUIA 3BFVA 2AXNA 4M9SA 1OIVA 1XD8A 3SR0A 2P6RA 1CTQA 1NN5A 2CVHA 4L8GA 4RCYA 5GADl 3KKNA 3LQQA 1P60A 1XFAA 1Q3TA 4QL3A 2Q6TA 4C0QC 1G8HA 3VFDA 2C04A 8OHMA 1T91A 1TF2A 3QKUA 1ZM2A 1QHXA 3P32A 1GKYA 1DAHA 3GQBA 2RMKA 3WY9A 3ZZTA 1UDXA 3SHWA 2WWXA 3NG1A 3IILA 4ESHA 3JZMA 3A36A 3CH4B 3QXJA 2JCSA 4M9ZA 4KSCA 1ZW6A 4N0DA 4XD7D 5EP4A 4C0LA 2OBMA 2WKRA 3PIRA 3TW8B 5BN4A 4NYMQ 2GTPA 5JI2E 3MAAC 1JJ7A 3KJEA 1GRQA 3MWLA 3AVVA 1G291 1JR6A 2IHYA 1COWA 4LJ4A 4WAUA 4XJXA 3V4FA 2R6CA 3F0TA 4DHEA 2FEMA 4I1OA 3QG1A 5FPSA 4LK2A 2GRJA 5LD2B 2ZJBA 3SJZA 1Z8FA 1D2NA 4DCUA 1W48A 2C95A 1NLYA 2WWIA 4TZ6A 1HY3A 1G19A 4D4JA 3LBIA 1DELA 2ODBA 4OHZA 1LV7A 1YZUA 4HLUC 4TT3A 1QG4A 4G0NA 1JPJA 2IYLD 1NVVR 2AK2A 1XEWY 4TT3D 4B73A 1E9SA 4IVRA 2IXEA 3LX5A 1WBDA 3A1VA 4GOJA 4NYJQ 2R6AA 2ZYTX 5B57C 3T34A 3GJ3A 1Q1ZA 3TIFA 5JHGB 1I4DD 3THOA 1ZNYA 2D4HA 4PC6A 4LHZA 4CIDA 2PCJA 2QAGB 1XU4A 4U02A 3TUZC 2IA5A 1KI7A 3WMEA 1ZBDA 3ZQ6A 3EARA 3K0AA 3VR1A 2FV8A 1YZQA 2R6FA 4P4UA 3T12A 2XX3A 1ZIPA 1EFRD 3I32A 5DHFA 4BRWA 3KQKA 4JJZA 2KJQA 4LJYA 5BYJA 1VG1A 1CKEA 2EQBA 1W5SA 1KSFX 2QAGC 1AM4D 2F6RA 2PT5A 2H18A 3JZAA 1E1QA 3TBKA 3W6PA 5C18A 2GZDA 3U7FB 5AJVB 3I73A 4LZZA 3GLHE 4JLMA 2A5FA 3QBTA 4NPHA 1DO2A 4JLJA 5KHOC 1DG1G 3ZQJA 2EYUA 4JT2A 4D25A 1GKIA 2RGXA 3MMPA 5K8UA 2BVNA 4RY2A 4XIGS 4B3FX 4BFXA 4ERNA 4JLNA 2G9NA 4CEHA 2NTYC 3AGPA 3IIKA 3D7MA 4NHOA 3SU8A 3THYA 4IOJA 2J41A 3L2OB 4CVNA 4XWOA 1RW4A 2WWHA 1GTVA 2BMDA 4AK9A 3FFBA 1V43A 3BBPA 1U0HC 2QTVB 4KI0A 5C46F 4U5XA 821PA 4PHHA 2GCOA 1VKJA 2GA8A 1MRNA 2J46A 2N1BA 3FHCB 1IXRC 3ICQB 5CJPA 2O8FB 4Y0VA 1DEKA 2F1RA 2ZSEA 4DLVA 5SZKB 1U9IC 3K70C 3PJRA 1LF5A 4HLDA 4PC3A 3ETLA 1KMQA 2O8BB 4G1UC 4QJ4A 1QHYA 2N46A 1KAOA 4QM7A 2QORA 4ARZA 1SULA 2BBOA 4MGZR 3PUVA 1ZUHA 1RRFA 4BLSA 1CR4A 1QBKC 3CZQA 2C96A 1DVRA 4LJAA 3K0FB 1ZNZA 2RH5A 2VQSA 3NHBA 4HLCA 1H8HA 2BJWA 3HPQA 5LBIA 1G3MA 3GLIB 4DSTA 5JRZA 1TF5A 5CLLA 4BFTA 1Z6AA 1K5DA 1P7CA 4ZDIA 4DJTA 3ZD6A 5JHHB 4H1UA 4DUGA 4B3DA 2Q21A 3QJYA 1XBTA 2JJ8A 3AH8A 3WMFA 4Q4HB 1IN4A 3IIJA 3FGNA 3W3AA 1X6VA 1E1RD 3B82A 1IM2A 1UDWA 2GJ8A 2ERYA 2BV3A 3C5CA 2GXUA 2E9SA 2QROA 1KY3A 1WA5A 2DCUA 1OH7A 3M4YA 3N70A 4IDNA 5C4GB 3BERA 4UNNA 5CK5A 3T35A 3D3QA 1YRAA 1X8JA 2FPKA 3CPEA 4E07A 4B3GA 3Q7PA 4DDTA 1N5IA 1OW3B 2ZI4A 4NYIR 2ZI3A 1N2CE 1N0UA 5CLQA 2JJ1D 4Q9HA 2GCNA 1GITA 4O2RA 1TEVA 3IPYA 5GJCA 2OAP1 4MITA 2ZR7A 1E9RA 2QNRA 3C15C 5EUQB 2B7CA 1IN6A 3GJ0A 4G5QA 3CF0A 4QRHA 4JT4A 2C78A 3A1SA 3DPUA 3BC1A 1XXHA 3ND8A 3NEYA 4ZI2A 5HE8A 4FMCB 4YDSA 4A2QA 5KNBA 1E9AA 5HCIA 2QAJA 3ADBA 4PC2A 4P4SA 3R7WB 3WNBA 1CRQA 1JJVA 4LHYA 4TLBA 3NH9A 1LW7A 1HYQA 3AP3A 3E5HA 1M2OB 4IOMA 1FMJA 1UKVY 1VCIA 2FSGA 3OAAD 1W36B 2D2EA 3LLMA 3LO5A 5JWHA 2FF7A 3CIOA 4BZPA 1YJ5A 4D81A 4DRZA 2DWQA 2ZUCA 3CRQA 4YMTA 4AKIA 3FMIA 1E0KA 1NG1A 3WMGA 1OYYA 2B21A 3RC8A 3HYRA 3CH5A 3HPRA 3UATA 3QEOA 4LBYA 1E1QD 3E1SA 4MKIA 4B34A 2C9OA 2VPPA 4TSFD 4A4DA 2IX3A 4OK6A 2GVDC 2ZSFA 1G4AE 2BDTA 2CVFA 1RRCA 3NEJA 1YR9A 4E5UA 2GNOA 1S3GA 3KQLA 5JSZB 1QHSA 2P0EA 2R9VA 2VSFA 2MSCB 2H5EA 4NONA 4URWR 5L3QA 1U8YA 4MYHA 4AG6A 3HDTA 1CJUC 1VHLA 3TVDA 5EQTA 1F48A 4TYWA 1KJZA 3B78A 1G3IA 5HZKA 3FMOB 4OHWA 5DH9A 5L3VA 4OK3A 3IQXA 3AV0B 3TGPA 4CT4B 1RVDA 3X1YA 1KO7A 3RABA 2IWHA 1LVGA 4E03A 3MWYW 4JL6A 1KZ7B 3EPKA 5KSOA 1E79D 1Z22A 4GFDA 4HI0E 1N5LA 1GNQA 2IYXA 4JMPA 5C4MA 1E2FA 4IOLA 3C41J 3TUIC 2YV5A 3GP8A 1CF4A 1CJMA 2W0MA 2WVJA 2HDNB 2XITA 2HJVA 2IC5A 2JDIA 2A5JA 4OHVA 5K8LA 1AA9A 4BFWA 3I4LA 1MABA 3IGFA 1B0UA 5HTKA 3ASYA 2J0VA 2NOAA 4MRSA 1W4AA 221PA 621PA 3H2YA 2UVQA 2ZRGA 5DIFA 2CCGA 2AX4A 4YONB 5G3ZA 3RHFA 3U4QA 4O2LA 1TEXA 3UXMA 5L8VA 3EZ7A 1DADA 2WJYA 3RANA 3I5YA 4OI2A 1CP2A 3VX4A 3GLFE 5C1BA 3PEYA 1FL9A 1CR0A 1D2MA 2J45A 3Q9LA 4EFMA 2WJHA 5FBQB 1FTSA 2AL7A 2QUZA 5FOWA 1L8QA 1M7HA 1NVVQ 1X1RA 1AKYA 2ZRIA 4LHXA 3ZVRA 4E09A 3G5UA 1XCPA 2BM1A 2GJSA 3EASA 1XPUA 4N1AA 1OFHA 4URZR 3TNFA 1ODFA 3L0OA 3EPLA 3BB3A 1J2JA 1YE8A 4LCBA 2OUKA 4IRUB 3L8YA 1MO3A 3OFND 1MO6A 4AY2A 2QL6A 3LD9A 5BN5A 3HYTA 4PZZA 1I2DA 3EZFA 2ZM5A 1KO1A 1LS1A 4LV6A 3A37A 1DTSA 1YHNA 4RFVA 2IW3A 4FI3C 2F3TA 2QPTA 2WWFA 3EZ2A 3DM5A 4QFMA 2IEYA 2V1XA 4GNKA 2MSDB 4DXAA 1IXZA 4GZLA 1WF3A 1X86B 3CPHA 3DMNA 5DGXA 4A1FA 3X1XA 4JYCA 4DSUA 4TL8A 5H70A 1RYFA 3WYGA 1SHZA 2WOJA 3LAWA 4IVQA 2HXYA 3WHLA 4DZZA 5FR1A 4PO8A 2V6JA 3AEZA 2F9LA 2G83A 1NMYA 4JIMA 1R8QA 1R8SA 1MOZA 3MJRA 4B32A 1GWNA 3BOSA 4R2IA 2X2FA 4GRAA 5GJWC 1NN3A 2GZHA 5F9HA 2JDID 4UNRA 1HEIA 4FWTA 2IWRA 1UAAA 3B9PA 1WBBA 3VNVA 2ZJ8A 3Q85A 2QMEA 4M1TA 4OBEA 4QG7A 2NPIA 1NKSA 1BYIA 1JAHA 2GDJA 4GMXA 5IRCD 3FHTA 4KV9A 1NIPA 5TY0A 3W8NA 5LPNA 3W34A 4A0GA 4HZUB 3K0CC 1JBKA 2QPOA 4GMDA 2OCAA 1IONA 2YOFA 2REBA 3I3SR 4QHYA 3TW4A 4B48A 1UBFA 3CO5A 2O0KA 2GZAA 2HJGA 3LH5A 4Q47A 1ZNXA 4TYNA 2DWPA 1OXUA 4YXWA 3NDBB 3X1ZA 1Z0FA 1BKDR 3CF6R 4LUCA 5J5CA 421PA 3SJAA 2ZRFA 3B9QA 1CJTC 1II8B 3LBNA 4I81A 1P2UA 2VTKA 5FTNA 1SVSA 3GD7A 2PBRA 2W58A 2REOA 4QGHA 2QGZA 3CX6A 1WMSA 4XTCS 4D0LB 4LHWA 2J0SA 1MRSA 1OJLA 1XF9A 4ON9A 5DI3A 1OKKD 1SHKA 5CDFA 1FUKA 4C0AC 1Z2AA 4Q7JB 2WSMA 4Q4AB 1US8B 3LXXA 5IK2D 4ACBA 4GI7A 2WAXA 4EPTA 2W6ID 4YMSA 1G9XA 2IS2A 1E94E 3KFVA 4POAA 5J4VA 2FN4A 3K53A 3FOZA 2GK7A 1ZYUA 3KXLA 2JLZA 2WBLC 2XSZD 2QMHA 1N6KA 2O5VA 3CZPA 4DB4A 5HE9A 3EC2A 2F9MA 1N6NA 4KCGA 4F4IA 4LJ5A 1GAJA 1ZP6A 3VQTA 5CIQA 3VX3A 4GSYA 3WBJA 3GLGE 1C9KA 1PLLA 2G77B 4B6FA 3NDPA 5EUMA 4Q1EA 2WKQA 3QIAA 1UM8A 2F43A 3BH6A 3DKVA 1OXXK 4HUQB 3TK1A 4A8JB 1ELOA 2D74A 3GJXC 1N6HA 3NWJA 3W6NA 3CM0A 3BRWD 3F5FA 2QN6A 4PO1A 1HT2E 1KK2A 4BLRA 1RJ9A 2A5YB 3EX7C 1IY1A 4D0GA 4LJ9A 4BASA 3QY0A 3K09A 3DMDA 3TUJC 1OB2A 1EK0A 5DO9A 4PXAA 1UEIA 4IW3B 4G5SA 3OF5A 1GIAA 2HCBA 4M9QA 2DYKA 4P0TA 3K70B 1KI2A 2PEYA 2CNWD 4MRRA 1YKSA 1CRPA 2RGCA 1H8EA 3E2IA 4EPXA 3IIMA 1ZINA 3GEEA 3QVVA 3REGA 4JL8A 4GZMA 4DLWA 1XB2A 3U7HB 1NVWQ 3TKLA 5KUTA 4TN1A 2JLSA 4GL2A 1CJVC 2V9PA 4QGAA 1QHHA 4W9MC 1L7VC 2ZRJA 4M1YA 4NDZA 4IDHA 1E99A 1OSNA 4PTLA 2ZYWX 1KSGA 1JQJC 1KI9A 4B75A 5J4KA 1E2QA 2IYQA 1F2TA 2F1IA 3OEHD 3LFUA 1ZC3A 2OCPA 2GJKA 4NCHA 1S0UA 4X8LA 3LWNA 4QBHA 2ZIAA 4DLYA 1G6OA 4EFLA 1VYTA 4LSGA 3O8RA 2YVUA 4DLZA 4M1KA 5JWOA 3U7GA 2HLDA 3R9IA 2O8EA 4MRPA 1Z2CA 1NNEA 4TQAA 2QMUA 1WCV1 3DVLA 4IEEA 2O0JA 2V1UA 1K5GA 1Q1BA 1MO5A 4RD6A 3EZ9A 2XXAB 5KYKA 1FW6A 5D3MB 1YZKA 2QTFA 2YZ2A 1E4VA 5CM9C 4WIAA 1DO0A 3QOFA 4URXR 1F2UB 4B47A 4C3ZA 1TTTA 2O8FA 1VCMA 2PZFA 3M6AA 4LYAA 4Q4JB 4A9AA 3EW9A 5GVSA 1E0SA 1OFUX 4QNMA 2J9RA 5KNCA 3T5DA 1NLZA 3NBZC 3QEJA 4TYPA 3T5GA 5IF9A 4L15A 3VR4A 4JKYA 1E0JA 2IL1A 2ZR0A 5JWRA 3DL0A 3TQCA 1E6CA 4NBSA 3QE0A 5JCPA 4URYR 3ADCA 4CZ2A 5CITA 4URUR 5FFMA 3WHKA 1BYUA 3U7EB 2ZXUA 4K81B 2QBYA 3RYTC 1T6NA 4MQBA 4AYWA 2JLQA 2VL7A 4QBIA 4Q1AA 4V02A 1K8RA 2O8CA 3QXHA 2G6BA 4F93B 1U8ZA 1OIXA 2PX0A 4Q4HA 5B58C 1TAGA 4A36A 1EESA 1R2QA 5SZHB 2DB3A 2HYDA 2C9CA 2A3RA 3LXRA 2VP6A 4J0QA 2IYRA 4ZDKA 3C8UA 4B74A 4BFUA 1DAFA 3GLGB 3UG7A 2GAOA 2OLJA 5DNYB 4LPSA 5FR2A 4UNSA 4P3YA 1KZGB 3OHMA 4Q00A 4C7OB 2VO1A 2BKUA 1E2HA 1NSTA 1JXMA 3HU2A 4R2HA 2QGNA 1PVOA 4KXFB 2VSXA 4C2TA 3QF7A 1N6OA 4TLEA 1SXJE 4LGMA 5CJ2A 4ZI3A 2V6IA 4PR0A 2DY1A 5GJVC 4CT5A 1S96A 2H1LA 5LB2A 4JLPA 3DEFA 3I61A 1DARA 2B92A 4DEYA 1ZC4A 4IFEA 2RGGA 2A9KA 4HB4A 4QJ5A 2F55A 4OK5A 1OH6A 3SQXA 3HU1A 4XVUA 2PL3A 1J7KA 2WHXA 4KBFA 3BB1A 3CKLA 4KHZA 2F43B 1NF3A 2N42A 1AK2A 1CIPA 4P4SB 4XSHA 1W2GA 2ZUBA 1Z6TA 2G0NA 1N6IA 2W83A 4JYBA 1XPRA 4WXRA 1S1MA 5FUVA 3GEHA 4XWAA 3KQNA 4OQFA 1AN0A 3CRRA 1XDBA 2VHTA 2H92A 1RJ9B 4S2EA 3RS0A 4G01B 1Y3AA 2ATXA 2IF2A 4TL7A 4TYQA 4G5GA 2BMEA 1E79A 5JMTA 1N0WA 1FNMA 1WB9A 3OEEA 3I72A 1X8LA 1T8TA 2KI5A 2JLXA 4AKEA 521PA 3VNUA 4V0OA 2LWIA 4R98A 4WZ6A 4D2IA 4B3BA 1TF7A 3KB1A 3NVAA 1G8FA 4CEIB 2OESA 1G41A 1Z07A 2CLCX 2NQ2C 1VPLA 3LLUA 1NJGA 4C2UA 3P4XA 2IXGA 3V4RA 1LNZA 4LWZA 3RS5A 5KDDA 1G4UR 4MUBA 3OIUA 3LBHA 4D80A 3ZH9B 1QHHB 1XJQA 3FHOA 2HT6A 3GEIA 1UKZA 3CX7A 2WPDD 1FP7A 1U2RA 1ZNWA 1E2MA 3GFPA 5AJXA 2PJZA 4ZKEA 5E7MA 4PHGA 4MRNA 3X1WA 1G7RA 2JJ2D 2OZEA 3AF4A 4TMXA 3SOPA 1EG7A 3DOEA 1NRJB 3EZ6A 1TQ4A 3OZXA 3DZ8A 3FTQA 2J7PA 2BWJA 2IUUA 3RS3A 2ANBA 2IYTA 5KDOA 2FX3A 2WMNB 3NKVA 4JSYA 1F3OA 1E2EA 4RD4A 3MSXA 4GP6A 5JRJA 4JVLA 1T0JB 1GRRA 1CULC 5IDVA 4AC9A 1F6BA 3QG5A 4EPVA 2AFIE 4M4SA 3C7KA 2WKPA 1MABB 5D3MA 5BWMA 1CBUA 3UPUA 2AKYA 4W5JA 3M1IA 2R62A 1M34E 1N0VC 1NSFA 1W4BA 2CHVA 2RKOA 4HAWA 4HAXA 5EE5B 5AJZA 4Q1FA 3SBDA 4PQFA 2IYYA 4LYFA 3K9GA 3RS2A 2TMKA 4N3NA 3SHFA 4OQNA 3CNOA 1ZD8A 4C0JA 1DG3A 1U0JA 3GFOA 3VR3A 4WW0A 4PQRA 1ZM3A 2RGBA 1S4QA 1NJFA 1OKKA 3P20A 1ZUNB 1EXMA 2GF9A 2EW1A 3SFVA 5FOUA 3QXXA 2IK8A 2ZI5A 4TMVA 2CBZA 4ILEA 5EXXA 2VF8A 2RGAA 3LA6A 3OE7D 3QKTA 2QU8A 1UKYA 3LX8A 4LBZA 3PUZA 3G0HA 2QBYB 4B44A 3LQRA 1KI4A 4CGZA 2XOKA 3LVQE 1NP6A 1UPTA 2CLDX 4KAXA 2QSZA 4D6PA 4DEXA 1CLUA 2WWYA 3O8CA 4PANA 3SEAA 3RDPA 1Q0UA 3B8HA 1G64A 4M1WA 2GF0A 3AVXA 1E2DA 3GJ8A 1XMVA 1G8GA 4ZV4A 4KODA 1KOFA 4PSKA 1XTIA 3B1YA 4PC1A 3LVRE 3AP2A 1NLFA 4Z1MA 2HYIC 4C7OA 2HCJB 5JJLA 3JVUA 3QF4B 1OIWA 5HZHA 1GNRA 3RLFA 2ZJZA 2WJJA 4YLGA 4B71A 2J3EA 3A6PC 3D6TB 2CMKA 1Q57A 1D9XA 3ADDA 1XD2A 2ORVA 4JKIA 4M2LA 3ZS8A 4EJSB 4B43A 4RFSB 3ZIAD 1EFCA 4EQ6B 3B2EA 1P2SA 1ZU4A 3OEHA 5TB5A 1P9RA 4DBLC 4ZPXA 2ZI9A 121PA 1T3LA 3HR8A 3UWOA 3C4JA 2XTMA 4B2LA 1J8YF 1RIFA 4OQXA 4NTZA 2IUTA 3NC0C 2QEQA 5KOYA 1NMZA 1Z6YA 1ESMA 1JQLB 4JJKA 3PITA 1KI6A 1YVDA 4LV8B 4B2PA 5FOXA 2XTZA 2VHQA 5G41A 3D8BA 4ESVA 3DDCA 3A58B 4TQ9A 2GVZC 1W4RA 2P5TB 3MLEA 4BLQA 4MA4A 4HDOB 3IPXA 2ZUDA 2J5XA 4TTQA 4DT1A 3C14C 2C03A 1W2HA 4NKRA 5KDLA 4F91B 2X1VA 5J4YA 1E69A 1A82A 2JEOA 2CL0X 2E1RA 2W2TA 3T1TA 5HKKD 4O0MA 2I1QA 4BZXA 1MT0A 1SKQA 2VP5A 3K70D 3FMPB 4KFUA 3VTKA 4NCKA 1G3RA 2H8KA 2O8BA 5DI3B 1N5JA 2BBWA 3PUXA 5JZVA 3TVTA 4ITRC 2QQ0A 3NH6A 5DE3A 3HU3A 3ZD7A 3GLHB 1GP2A 5K8TA 2IYWA 4ARZB 3KL4A 1FQJA 4R7ZA 4IFBA 4AKHA 5DYIA 4WZAE 1VTKA 3FMFA 4L9WA 3ZZ0A 1W0JD 3CRVA 3N2IA 1D6JA 4NH0A 3SS8A 1Z83A 3AVPA 3W90A 1XEXB 4EPRA 3CWQA 1VCOA 2ECKA 2ZRKA 3R8CA 1VDZA 3Q5EA 2FU5C 4A0FA 1FPMA 3CBQA 4YC7A 2RHMA 3UIEA 5LDDC 3K9NA 4PPQA 1DOAA 1SVMA 1YU9A 3LW8A 5FPTA 1QVAA 3PV0A 3KKPA 4JLDA 3H84A 2PEZA 3BD9A 2GWHA 4RSGA 3BH7A 3DHWC 5FOTA 3ZS9A 4IHQA 3DKPA 4NL4H 1KYIA 4DVGA 3KKOA 1A1VA 2NG1A 4F38A 1IN7A 3CPJB 1LTQA 4OHXA 4D0NA 2D62A 4G5RA 2OCYC 3TSWA 1AZTA 4RJLA 1EFHA 3PUYA 4PC7A 2H16A 4NYIQ 1JNYA 3CRW1 2QM8A 4F4JA 5CDFE 2ZI6A 2CDNA 4HAVA 3ZZUA 4NCNA 4MKFA 3ADKA 5JSZA 5KTYA 1TQDA 4HUTA 5HCNA 1OFIA 3EG5A 3CR7A 1CJKC 2H17A 2NO9A 1LFDB 3OEED 4PAMA 3QKSB 4JVNA 3EA0A 1E9CA 1O87A 3P27A 4FMCF 5IK2A 1P2VA 2XJ4A 3B1XA 3IHLA 4ABYA 5G40A 4HATA 4QJ3A 1QZXA 2JA1A 1OV4A 1ZMXA 4NYMR 3T1OA 4BLOA 2B8TA 3FB4A 1XXHB 5CYOA 5GJBA 2HT1A 4I99A 3AF1A 2X2EA 3QVUA 4KFRA 3R7WA 3AVYA 3VKHA 3RVBA 4OQMA 5CB6A 1II9A 2ZAOA 1U0LA 3K0CA 4OHYA 1JEEA 5EJEA 1P61B 3PUWA 4PQYA 2ATVA 2GBLC 4BPBA 2W2XA 2J7KA 3B13B 1ZAKA 3W8RA 2BOVA 3KB2A 3K09C 3NBXX 4PPFA 1P72A 3DM9B 3U60B 4FW9A 3QPWA 3QKRB 5FL7D 2H57A 1AJEA 5FPHA 2VHUA 1S8FA 3U44A 2RAPA 4O25A 3WXMA 2XZOA 4WBSA 2QQEA 2OM2A 3U4QB 4EAQA 1HT1E 2VP2A 2JJ2A 3BK7A 4Q19A 1GNPA 4Q1DA 4U00A 4BFVA 3RRMA 5LD2C 3EWAA 1EX6A 3A4LA 4R71A 1U94A 1G20E 1H8HD 4GBMA 4HAUA 2WIAA 5FPYA 4OKSA 4WZBE 5TMPA 1T8UA 1F2UA 1D8TA 4M21A 1GOTA 4RD2A 2Z4SA 4V0KA 4FN5A 3B60A 4FMBB 4IXMA 3R8FA 2KWIA 2PLRA 4P4TA 4DLXA 1XJ0A 2JATA 3WNCA 1R0YA 2Q9BA 2IS6A 2RB4A 1E1RA 1YZLA 1Z47A 4M8NE 3AQ4A 2B7BA 4DDWA 1W7AA 1P2TA 2BEJA 4DC9A 4DCVA 3TSOA 2NIPA 3KXKA 1E96A 4NCIA 2D7CA 5KSZA 3THWB 4Q02A 1TU3A 3B1ZA 3TRFA 3Q7QA 5E3HA 1U99A 3Q5DA 3A1UA 4JLAA 5CYPA 1YR6A 4RZ2A 5BYKA 1NL3A 2O8DA 3NBYC 1Z0AA 4CW7A 2WWWA 1OLOA 1P73A 4GPTA 2ZE5A 1BMFD 4KYIB 3B7GA 4LJ8A 1Q3HA 1WRBA 4UXIA 1KI1A 1SQ5A 2OE2A 4XH9B 1R7RA 1WXQA 4QBGB 3B1WA 3U3JA 2EVWX 5EE9A 4PFSA 3QQ5A 3ZDQA 1XZQA 2W2VA 1ZM7A 1TADA 2KB0A 1EFTA 3FKSA 3T61A 1Q1EA 1RZ3A 1JI0A 1HURA 1QVRA 2GETA 4A0HA 2SHKA 4W5HA 3K8YA 4C0SA 4US2R 2HF8A 3TAHA 2XAUA 1VG0B 3AF2A 2I1VB 1XNJA 5CIWA 4D26A 1P5ZB 4Q7MB 3A1WA 5FTMA 2ZTSA 1SVKA 4BLTA 1KSJA 4HZUA 4Y0AA 1F5NA 2FDCA 2ZREA 5JECA 1VYUA 1E9FA 3IUYA 1ONBA 2V3CC 4WA7A 3HR7A 1WP9A 3CNNA 3ND9A 1EGAA 4GP7A 2JLVA 3UMFA 1Z0JA 2ZSBA 1II8A 3DO6A 3WYAA 2NO1A 3QPUA 5CB8A 4Z51A 1I4LD 3W3ZB 1N5KA 3VU9A 1BOFA 2GEUA 4JBYA 4XSGA 3RC3A 3TAUA 4X8MA 2ZYVX 3CNLA 3I8XA 2C5LA 2ORIA 3BJIC 1Z08A 4NZYA 2LKDA 5KSYA 2GXAA 4HZIA 5IHPA 2IYVA 4Q21A 4Q4AA 1P9NA 1P62B 1US8A 2JAQA 4EUNA 4JL5A 5EP1A 5AWFC 3MG9A 4B2IA 2O52A 1GKUB 4OL0A 2IYSA 4DSOA 2KE5A 5G53C 5JBQA 3SFZA 1E9EA 1OYWA 1C1YA 4JLKA 1T3HA 4CEIA 3Q3JB 4YMVA 3I5XA 3TMKA 4TLAA 2ZROA 3H0KA 3VR2A 3OESA 2YKGA 2PMDA 3D31A 4Q7LA 4C4PA 1D2EA 2P67A 2CL7X 1QHIA 3WBKA 1KKLA 5J47A 5FBWB 1XX6A 4KLZA 4Q66C 2YWFA 3RS7A 1W0KD 2OT3B 3IDQA 2Z83A 4ZDJA 1TX4B 4LRWA 2A5DA 1KHTA 4LC1A 4LBVA 4MDEA 3ZGXA 2GXSA 1TQ6A 2FSHA 1PV4A 2VHCA 1BH2A 2QENA 2PLFA 1G16A 2QG6A 2VHJA 3EWSA 3SZRA 4CYMA 3KQUA 2XJ9A 2PZGA 2Z5FA 3G82C 1XEFA 3KQHA 1GSIA 3KTAB 1J90A 1W47A 4OJKA 5DN6A 2ZJAA 1GUAA 3QKRA 3MJHA 3X1DA 1S2MA 4TMKA 1IXSB 3LW7A 3B85A 4R9UC 3F3YA 1BO6A 1M8PA 3AF0A 1L4YA 3AVOA 1U8AA 3AB3A 4LY6A 3WRYC 1Z06A 5JEDA 4TL6A 5HR5A 3ZVNA 2J7PD 3LNCA 4A2WA 3BIFA 2Z43A 2Q9CA 4CEJA 1AZSC 1ZM4A 2QI9C 1CEEA 5JS7A 1MO4A 4F4CA 1OXSC 1VCNA 2H7VA 5EXTA 3QUSA 5EP3A 1NBME 1Q22A 3IO3A 2BCJQ 2YNMA 1FFHA 3EC1A 4UNPA 2JLUA 3EPHA 2GAAA 1F2TB 2OXRA 1GL6A 2VEDA 3X2SA 4X8HA 2BBTA 2ZJOA 3AVUA 1E2PA 2ZRAA 3Q8XB 1VMAA 3F8TA 3MWKA 1AGPA 1GRNA 1JR3D 2NO0A 3E70C 4JVMA 4AWXA 2FMXA 4LJ6A 3KUCA 5JCZA 3S1AA 3U3KA 4XVRA 1JXOA 3CONA 5ELXA 3TQFA 1PLJA 4QNRA 4BWYA 2O0HA 2GESA 3O8DA 1QRAA 2HXSA 5F3WB 1AIPA 4LDJA 4Q7KA 2OSBA 2YHSA 2ZVPX 1E9BA 4QBFA 2FOLA 2A78A 1NIJA 2C77A 3PCRB 3AVTA 3U3RA 4IDPA 4L16A 2AD1A 2AWNA 4URVR 2FG5A 1SXJC 3QNUA 2RGEA 3OE7A 3V9PA 1MKYA 3L0PA 2ZPTX 2LKCA 2IUSA 3BXZA 3CF2A 4PPNA 4RKFA 2CK3D 4KFTA 1KMHB 1LY1A 2ZJ5A 1G5RA 1DPFA 3SQWA 1SVOA 2PZEA 1F60A 1YR7A 4BGDA 1FOEB 3BFXA 1VIYA 4XVQA 3SYKA 3PFIA 3V00A 3GFTA 1UEJA 1IQPA 2REXB 2WIBA 2V55B 1Z28A 4IXNA 5FOSA 4WXPA 2IEZA 3K1JA 3RWOA 5B30A 3RRNA 2FZLA 2GCPA 1XD2B 1N3BA 4MRVA 1KJYA 1XMIA 4NP6A 5FUXA 4EQ6A 2HEIA 1KNQA 3H86A 1FX0A 3MRSA 1IOZA 2RGNC 1FP6A 1JEDA 4DLTA 1QHNA 4V0ME 4AKGA 5C2JB 1NBMA 4WVFA 3U61B 1G21E 1OPXA 1XJCA 3BGWA 2CL6X 4B76A 2O8CB 3W6OA 2VYFA 2DFLA 2FPLA 5F9FA 1EFRA 4Q1CA 1Q21A 1G3QA 2O8EB 2Q3FA 1ZCAA 1P9WA 3EIQA 2WTUA 3SYLA 1O3YA 2JLYA 5KPDA 3PG5A 5TARA 3VU9B 2QP4A 4US0R 2ZS8A 4P32A 2FJUA 2R8RA 1EX7A 1T9HA 2ZYUX 2FFQA 1XP8A 1MH1A 2P3SA 3UG6A 1GDDA 4U7DA 3RRZA 3I92A 1E2NA 5DI9A 2IS4A 1FTNA 3CR8A 3VR6A 4LOAA 4C0HA 2BIFA 2WJGA 1Z0IA 4HAZA 4MGIR 4C0BA 4Q01A 5F98A 2QP3A 4DIEA 4JBWA 4Q4JA 2JIZD 4PO9A 4C9BA 3OIVA 1PUJA 4ZDWA 4P31A 4M1MA 4BE7B 5FTLA 2RGDA 4FINA 4HLUA 5AJWA 4UJ5A 1PJRA 5EE1A 1H8ED 1OXTA 1II0A 4TTPA 3RSOA 1W46A 4EPYA 4W5WA 1LS6A 4LX0A 5ANRB 3UWKA 1OB5A 1A7JA 2CK3A 1NVXQ 4PX9A 3CX8A 3I1FA 3U6KA 5KPJA 2RHDA 4Z8YA 1OE0A 1XTKA 3NIBA 2PT7A 4HDQB 4CRWB 3PEVA 1FMLA 2NO6A 3NHAA 1B23P 3R9WA 1XEXA 1S1CA 2J0UB 4FCTA 3QSYA 2QE7D 1SXJD 2AWOA 1PUIA 2EFEB 2YC2C 1IN8A 4DWJA 3K0EA 4Q9KA 1W5TA 2GBLA 2DPXA 3VHLB 2V7QA 4DDVA 1TMKA 1X1SA 4LBWA 3W5IA 3U3OA 4Q18A 3FE2A 3RWMB 1H65A 3TSZA 3CB4A 1HV8A 2D06A 4TYYA 2W6JA 2CHQA 3OIYA 4HDCA 5DSZA 4Q48A 3CRMA 1UJ2A 6Q21A 3RRYA 2FA9A 1X3SA 3P4YA 2QAGA 2ERXA 3KKQA 4L4UA 1UF9A 5JEEA 2V54A 2XNSA 2ZRHA 4HB0A 1NG9A 1YR8A 3QENA 5AUQA 5H68A 3FPAA 5B2ZA 3AKDA 4G5OA 2FSIA 2VSOA 4RD0A 4CEJB 3Q72A 4H9GA 4MH0R 2PJRA 4DUGD 2UZIR 1OH5A 2ODWA 2YC4C 4FCVA 1DAEA 5KNDA 1K6MA 1SZPA 1XD9A 2JJ1A 3FYHA 3SDZA 1E3MA 4Q1BA 1XRJA 2B6HA 2FH5B 2ZRNA 2FFAA 3SYNA 2VH5R 3A8TA 2X19A 3A4MA 3QBVA 2QZ4A 2R65A 2ZITA 4DKXA 2ODEA 2ODNA 1P75A 4JBXA 4BEBA 3L0SA 4OI1A 3VAAA 4A6XA 1ZU5A 2ZI7A 4RZUA 3S1AB 3R9XA 4JLVA 1SKYB 1IJFA 1E2LA 2WV9A 3IEVA 2D2FA 1DAKA 2W6JD 1Z29A 4AD8A 3SE0A 4QKQA 2Q9AA 2BC9A 2A7QA 3T1VA 2FGJA 2E87A 2WJIA 4HB3A 1VHTA 2C99A 4PZYA 3UKDA 2WAYA 2MSEB 3AKEA 1M6NA 2V7QD 5E4FA 4AURA 1YZTA 2WMOB 5FBRB 3GJ6A 4US1R 2J1LA 4BQSA 3TJZA 3TR0A 1FQKA 1LF0A 5JFGA 3WRXC 4A92A 2X8AA 4K8OA 1E2JA 1T5LA 1Q12A 2WSSA 4DDUA 4FMDF 4L9SA 1KJWA 5FPKA 1EFUA 4HEJA 3C16C 1R6BX 1FNNA 3SC3A 2YOGA 3EA5A 1HE8B 3AGQA 5DISB 4N0EA 3P26A 4ZCIA 2ZRCA 4BZQA 1TNDA 1R0XA 1XEWX 2A2ZA 1G17A 1G7CA 4LJ7A 4K46A 1G7SA 2R6GA 3GLIA 1FX0B 1UADA 1N6RA 2WWGA 1SXJA 2AD5A 4UXJA 2XNDD 2ZRDA 4IDOA 1DBSA 4JZKA 2JLWA 4RKEA 4ZCMA 1Q1QA 3SBEA 4ACAA 4HB2A 4DLSA 4MKGA 1U90A 3AKCA 2VA8A 5DYGA 5BN3A 1GILA 2V4ZA 4CDGA 3THYB 1QF9A 4M1OA 4XWKA 3B1VA 2ZS9A 3FFAA 2CXXA 5UKDA 1KSHA 4I4LA 2IYUA 1KGDA 1GL9B 1KO8A 1TUEA 2FWRA 2ONJA 4MUAA 1W0JA 2NGRA 2YYZA 1YZNA 2G1KA 2BBSA 2GCOB 2ZSDA 2OBNA 3EIEA 4YQFA 1KNXA 4ZIRA 3H1TA 3QF4A 4M53A 4AYXA 2ZE7A 3LRPA 4Q03A 1T5IA 1DE0A 3AVWA 2ZS7A 3FWYA 2OFWA 2OG2A 4HAYA 3GLFA 5JJIA 1DAIA 1PLKA 4IDQA 2XSZA 4Q5IA 1XZPA 1KK3A 1NKTA 2XB2A 3BH0A 5H8WA 1J8MF 4KVGA 1W36D 2QSYA 1G7TA 3CWZA 1U98A 5L3RA 1ZRHA 2W6IA 3GJ4A 2Q3MA 4KFSA 4QM6A 1E2GA 4GT1A 4LI0A 1KAGA 4ZO4A 5FBVB 2P6NA 1ZIOA 4JSTA 1C4OA 1EWQA 1G18A 1JR3A 2J0QA 1DAGA 1M1YE 2G88A 4BEJA 4D82A 2FFHA 4V0MA 1Y63A 1GZSA 2XGJA 4ASUD 4F92B 1KTVA 1YQTA 2WSSD 3ZJYA 1KI8A 1ANKA 1UFQA 5E7JA 1D9ZA 2YJTD 3EIHA 1NY5A 1ZD9A 4TZ0A 3QPVA 5G3YA 1XWIA 2YOHA 5KU1A 4DT1B 2YWEA 2CEAA 2DFTA 2HF9A 2FZ4A 2DFKB 1XXHE 2IYZA 4YMUA 2OCBA 3A4NA 5E95A 1OFTA 1VYVA 2F3RA 2OAQ1 5K8IA 5HKKA 2XNDA 1OT3A 3FDIA 4TMZA 4Q9IA 3HJNA 4IKEA 2BMFA 1S3SA 3MUFA 1XTSA 4YDHB 1VG9B 4AG5A 4GOKA 2VIIA 2VP4A 1MR3F 2D7DA 4OQLA 4MYCA 4RCZA 3U3MA 3REFA 3K0SA 3P1JA 4FIDA 1CS4C 1T4GA 3IQWA 4TWZA 4EKDA 1GM5A 4EJSA 3H4MA 2ZANA 4D4MA 4O3MA 4PHTA 4RFSA 1JB1A 3T15A 5L3QB 1A4RA 3OFNA 4A15A 3ZYCA 4CF7A 2JGNA 3KJIA 2X77A 2ZJ2A 5JJKA 1SVIA 3EPJA 1G1MA 1KDPA 1NMXA 2CLSA 2OLKA 2AXPA 2HV8A 1HUQA 2OO7A 2OBLA 1OHHD 5BW8A 4DCSA 3BFKA 3UMRA 3TLXA 4Q4LA 1E4YA 2IT1A 1KI6B 2Z0MA 3LY5A 2XEXA 1ZVQA 2ZAMA 5AJYA 2G0TA 1ZUIA 1Z5ZA 2A30A 2YWGA 4FD2A 1R5OA 4MYUA 1Z63A 2C9YA 3FKQA 1ETUA 3GMTA 3ASZA 1XCMA 3IEUA 3THXA 4WOPA 4PAOA 3FVQA 3MFYA 2P65A 3RS4A 2NMVA 4UKDA 4B33A 2QMOA 4QGFA 4NU0A 4EFNA 3B5JA 2FNAA 2GKSA 1WQ1R 4AI6A 3L43A 2CJWA 1RKBA 3LV8A 5E7IA 5EP2A 5FUWA 4BFSA 3U5ZB 4NMMA 1DS6A 3PEUA 1AQUA 3GLHA 2DBYA 4B6EA 5LB4A 1SGWA 3QKSA 4S35A 1VECA 3U6BA 3LDAA 4UNQA 1J99A 2R44A 3KKMA 2QM7A 4QC2A 2Q0HA 4JVSB 3SN6A 2JLRA 1ZJ6A 4LYHA 3VHXA 1D5CA 1KKMA 1E9DA 4JLOA 2PX3A 1WDTA 2OHFA 2EU8A 1GL7A 2FFBA 3AM1A 1XMJA 2MMGA 1SVWA 5FTJA 2QRNA 4ZCLA 1W44A 5DN6D 4IEIA 2B8WA 3K9HA 2BEKA 2QPAA 2VBCA 2WOOA 1NI3A 4GOXA 5TV2A 2IF0A 1TU4A 4FXPA 4TQUS 4KITB 3AUXA 5A4JA 2CCJA 1SXJB 4PZLA 4DCNA 5AUPB 1YZGA 1I2MA 1R0ZA 4M22A 4G3XA 4DSNA 1KO4A 1E0AA 3MGCA 4QGGA 4OJQA 3AVQA 1G8PA 3UANA 3L0IB 3KFXA 5FBLB 5D3QA 1P4SA 5J4LA 3GJ5A 4II7A 3U44B 1AKEA 1DAMA 5A0FA 4A8JC 4A6PA 4ASUA 3HWSA 3K0AB 2ORWA 5BXQC 4LV5B 2ZU6A 4PAQA 4QXAA 5H1YA 3J81k 4MDFA 1G6HA 4KLNA 1W1WA 5J4HA 3PVSA 1QDEA 1KK0A 1M74A 1Q44A 4KU4A 1ZD1A 2ZRPA 2W00A 3I62A 5FI1B 4HYYA 4OI0A 2KSQA 2JIZA 4D4KA 3L8ZA 2HLDD 3PQCA 4BUJA 2ASEA 4LYJA 4LC0A 3O47A 5FUYA 2DWOA 3THWA 2EFHB 2AKAB 2VRWA 2KBEA 2NPFA 1V5WA 1VIAA 2UKDA 3KJHA 4I1UA 3VR5A 5J40A 4NCJA 3GJ7A 3PEWA 1X8KA 4HSEA 2MMCA 1RPZA 3RNLA 1Z6XA 4KBGA 1JALA 1CR2A 1TPZA 2ZU0C 1KIMA 1NVUQ 5FTKA 3BORA 2R2AA 1P6XA 4F7WA 1L4UA 4AYTA 3A1TA 2ZVQX 5FOVA 2ZE6A 1HA3A 1TL7C 4LPKA 1N6PA 3WP0A 4BRUA 1CXZA 2IBMA 1NN1A 2GJAA 2QP9X 1KO5A 5DHAA 3BAFA 1KY2A 2PCLA 3EXAA 1P3JA 2ZR9A 3AKYA 4AIIA 3ZVLA 5FI0B 3WP1B 1KI3A 1CR1A 3ZIAA 3KUDA 2JASA 2DHRA 2OFXA 4NE2A 1IN5A 1IAQA 3M0EA 1J70A 4HLQB 2W0SA 5JLJA 1TQ2A 2ZRLA 4GDFA 4FMDB 1R4AA 4MGYR 2OXCA 3WYFA 3IBYA 4QOSA 2ZSAA 1NN0A 2QA5A 5AUOB 1T0HB 2QT0A 3UK6A 1T3SA 2QY9A 1WE2A 2GILA 1L2TA 3QI2A 2AR7A 2XZPA 4IVPA 2D3WA 3B6EA 4IJMA 2BHRA 5AK0A 1U81A 4HUQA 3AF3A 5P21A 2GJ9A 4I1SA 2VF7A 2O8DB 2C8VA 1RYHA 2DR3A 2XOKD 3ICEA 1AS2A 2GEDA 1W36C 5GVRA 4A2PA 1A2BA 1IBRA 3IO5A 4DCTA 5TVKA 5A5GA 2QTHA 5AUNB 1ZCBA 3BB4A 5CM8B 3PXGA 4Z54A 1M7GA 1W0KA 2V8OA 2CJWB 3VKWA 1BS1A 5FL7A 2P5SA 2VP9A 3ONWA 1ZM9A 1R5BA 5HPYB 2BJVA 1U9IA 2F1JA 2G3YA 4PSAA 1FUUA 1Z6GA 2VP0A 2A5GA 2I4IA 4KJZA 1E98A 3R20A 2ZEJA 1HQCA 2OILA 2XTNA 5L3SA 2XB4A 5IT5A 2Q3HA 1R10A 3KXIA 1Z3IX 2UZ3A 2AFHE 4B35A 5EZ6B 4Q9JA 1A2KC 1RRGA 1W49A 4NYJR 2XZLA 4RZXA 2ZRMA 4OYHA 2CE7A 2Z6VA 5FH9A 2GK6A 3VKGA 2WJVA 4H1VA 3N2EA 3T06B 2EFGA 1NY6A 2I3BA 3MD0A 4X8OA 4B3CA 2Y8EA 4EDHA 2FEOA 2ANCA 4JLBA 3BE4A 4A8JA 1UKEA 5KO2A 2BKEA 2R6DA 1KDOA 1R5NA 1RE0A 1SKYE 3KDSE 2ZRBA 4KO8A 5TDHA 3CUEF 1CU1A 1Z0DA 1GG2A 1AS0A 2IHBA 4BFYA 2RGNA 4UQOA 3TH5A 3NTUA 5CK4A 4PPGA 4Z8XA 3SNHA 4TSFA 4UJ3A 3I8SA 3MCAA 3UMSA 2C98A 2WPDA 2ZE8A 1HTWA 5JS8A 3GPLA 2EFDB 3THXB 3W5JA 4IOKA 1GVNB 2Z4RA 2FGKA 4RD1A 1XTJA 1XTQA 4XTRA 4EIWA 4XOIA 1ESNA 3DOFA 5FL3A 4KYUA 4YMWA 2CNWA 5EE3A 3C5HA 4A82A 1QG2A 4PHFA 2WZQA 1FZQA 4QHSA 3AP1A 3NBFA 3SJCA 5SZIA 2P6UA 2YWHA 4V0LA 2KBFA 4V0NA 1BMFA 2IS1A 1OH8A 2LCFA 1NBMD 1OHHA 1OF1A 1KDTA
chains in the Genus database with same CATH superfamily
3TE6A 4OHBA 1YXMA 1EDBA 5KSPA 3P0HA 4EX7A 1OBCA 3ITNA 1A2OA 2IOYA 3OSUA 2X14A 2GYVA 4MGKR 4XPZA 4LY0A 1EP9A 4U0KA 2BMAA 3BWYA 2ZJYA 2FF5A 3DQPA 4L7QA 4BHTA 5HZGA 5KEIA 1IVNA 1PEKE 4TWIA 1WDLA 3JD2A 4K2HA 1I2CA 1QGAA 1MORA 4OI4A 5EZ5A 3VZDA 3E03A 1A8IA 4OH1A 1L6RA 3F9CA 4XQ9A 1VMEA 2H48A 1EWRA 5K6AA 3C6KA 1AQYA 3PR1A 4OEHA 4OXKA 2R7MA 4Q37A 2WA1A 3F74A 3VZRA 1P77A 4JEUA 4MB0A 1N1MA 1PF7E 1BMTA 4I9GA 5HF5A 1A5AB 4W7SA 4X7PA 1QHGA 3CUSA 1T36A 3ZTWA 1M72A 1OX4B 4OVKA 4QU8A 1XHEA 1ZMTA 3UA3A 4YVFA 5H9WA 2RCNA 2HC9A 3MOSA 3GCGA 2O19A 2QR2A 3KZKA 4PYLA 3AR3A 4O4HF 2BMJA 4P0QB 3KZ1E 4GS5A 3KDPA 1BA2A 1HQYE 2BM8A 2YJGA 1MVLA 3CLVA 3EOZA 4MKHA 3LY8A 3TTWA 4EY8A 4D8TA 3RS8A 5AHKA 3IHWA 2JIMA 3ZLTA 3F9RA 2P90A 4K9PA 5EXPA 3ECCA 1V41E 1PNQA 4MUEA 3I9V6 4JI4B 1A8SA 1H1DA 2H2DA 2VJOA 2ZDGA 2DFNA 3CURA 4EJSC 5FLKA 4LHVA 1I4WA 1KP3A 3O8BA 2NZYA 4TT8A 5KVSA 3F6EX 1JR2A 3PENA 5LMNB 3T3OA 4KK4A 2FXIA 1XRLA 3ILXA 2CXNA 4L6AA 4NMLA 4M7WA 3STVA 4CF6A 3GLIE 4FCWA 1W8DA 3SJBA 2NZUG 3NXSA 2PMKA 2CE2X 1Q20A 1G3UA 2Y77A 1RFLA 1AKRA 3F96A 4M8KA 4PCVA 4E4RA 4GPIB 4EPWA 4F60A 3GFRA 3MCWA 2AMLA 1Q83A 3AW8A 3K9LA 1O8CA 4I1VA 3VR6H 4C6RA 1XLTC 4OA8A 1FUIA 5CVJA 4JNKA 1L9KA 1P1BA 3CNQS 4MWBA 2ZIEA 2XCOA 4XD7A 1NXTA 1IJEA 3GT4A 4K40A 5LMZA 2PSEA 4KW7A 5HIMA 5KOHB 1ZKMA 2Y93A 1YL7A 4OLAA 2R87A 3NRBA 3LSTA 4MQLA 5CNKA 3N6RA 3U2QA 4NS4A 3WLHA 5A3RA 1T2DA 1AZLA 1WSAA 4Y2UA 3AUYA 4X7BA 1KRHA 2Q1TA 3MNFA 3QVMA 1OOEA 2YMPA 2AJBA 4BB9A 3IUMA 4BO1A 5JHHB 1UBEA 1B6SA 4MI3A 3OURA 4U6QA 3DDUA 4HAOA 2A9VA 1H0HA 5FYQA 5L7TA 2Q2QA 1IULA 3U81A 1THZA 3EIOA 1IY2A 4I6JA 2I2CA 1JIQA 2AHOA 3H1PA 2RG7A 1MV5A 1E3QA 4MRAA 2OEPA 2Q50A 1V47A 3GA5A 3R09A 2EFCB 4KNVA 4PU0A 5E6UA 3HVRA 2NTJA 2F1HA 1A71A 5H7XA 4AT1A 1C9EA 4TV8B 4LNUB 1HO3A 4JR1A 1QU3A 2RHCA 4XCQA 3VDQA 3ELWA 2ZDQA 1JE1A 1I4TD 4YO8A 3G2MA 4A03A 3E61A 4C4YA 3JVVA 2C9MA 2GO1A 1VJ0A 1XKQA 1XTVA 2C4HA 2OBYA 1OWOA 1R18A 5SZJA 5A3SA 2KLHA 3BWDD 3A70A 2FE4A 4F2DA 5EXSA 1EK1A 1OLXA 2B5OA 2R8OA 1TUIA 1BDJA 3MWGA 5ED4A 2VXBA 2DERA 1D3AA 3QBDA 5JMOA 1XRSB 2CVHA 2J30A 2J3LA 4RCYA 3P2KA 3KKNA 2Q5OA 3LQQA 4UBNA 1CY0A 4ARIA 2BR4A 3W5VA 3SF0A 1O2DA 5AHXA 3AUAA 3GAAA 3U26A 3FPBA 2RSLA 4MVYA 4BNYA 1RYDA 3QWFA 2VJMB 3HCEA 5BWNA 1TF2A 3QKUA 4M87A 5J1TB 5CDSA 3O4FA 1PS9A 2AX3A 1GKYA 1O6BA 1JMVA 3CWCA 3GVCA 7REQA 1V39A 2DTEA 1TA9A 1PK8A 1VHWA 1ZUWA 4HDNA 1IQRA 2PRYA 3OZGA 3X1KA 2NO5A 3KLOA 1A7UA 3EDYA 2A9JA 3N0RA 3IILA 5K3BA 1AX9A 1XAHA 1TTQB 4E88A 3OU7A 3HKBA 3IUEA 1EEXB 3QXJA 1ZLXA 4KSCA 4YCAA 4YAWA 3CVVA 1DIHA 4MTCA 2I2WA 3ZZNA 3CISA 3HU5A 2WKRA 3PIRA 3RROA 3TW8B 1DRWA 5DCLA 5E38A 3TB4A 3WB9A 5TPZA 2ZJFA 1TM2A 1VL8A 4DCOA 3NT4A 1AXGA 1JJ7A 4BP9A 5JI2E 1WCIA 3SYMA 1G291 4YS6A 4Z4QA 4XJXA 2LIVA 2FEMA 3O83A 1SC1A 1E64A 2O6LA 1WJGA 1DKRA 3PKZA 5HBGA 1M9NA 3AY6A 5HRAA 4LTNA 4MQUA 3DDSA 1U2TA 2WSBA 2ZJBA 5LD2B 1EU1A 2Z1NA 4K6OA 1Z8FA 1D2NA 4DCUA 4QVKA 4AMVA 1W48A 2C95A 4WCFA 3QW4B 1XQVA 3JRNA 4J7CA 4D5GA 4UZSA 4PGGA 2H1WA 1PR4A 4J6FA 4ZVUA 5JMWA 2CMGA 2RHJA 2WVHA 3AWDA 4YI3A 2PGLA 4EJ2A 4AY3A 1IDOA 5EERA 4JJAA 3BVPA 5A4AA 4GLLA 1V2HE 4PR3A 4G0NA 1SC3A 4IGIA 1FLAA 3FJYA 4P3PA 3D7LA 2J3KA 3L1IA 4TT3D 2WG2A 4WOCA 1ECLA 1PYDA 3OO0A 4IVRA 3D4OA 2IXEA 3LX5A 4LJKA 4B73A 1L5NA 4OXIA 3WGJA 4NYJQ 4C4TA 5G1NA 1ZUD1 5JHGB 2JBWA 1Q1ZA 4MYRA 1KBOA 3PNMA 3NHWA 1PJCA 3NI2A 3F5DA 3GR6A 1E3IA 2D4HA 3D8NA 4MVJG 4PC6A 5FUBA 3U7JA 1PFVA 2PCJA 2WPNA 1XU4A 1DC6A 3FCOA 3ZWAA 2IA5A 4I4CA 4JROA 3R3SA 2AW3A 1ZD2P 3WMEA 5M5BA 3ZWBA 1OBHA 1SU7A 3GXOA 4EA8A 3RRJA 4P4UA 3T12A 4N6GA 3ZVKA 3DONA 1G9SA 1T0BA 4KO1S 2JZCA 4C2BA 2P9YA 3BWBA 5TMDA 3EXIA 4YH1A 4XIYA 1HR0B 3AFOA 5JZSA 4UBIA 1VG1A 4ZQGA 1I33A 3ORQA 3G88A 2CHEA 5KJEA 1LPAB 4D41A 4EX6A 2Z5GA 4FMPA 5L6LB 1GPUA 1E1QA 3ABSB 4ID9A 5KTOA 3E3MA 1POXA 2GZDA 3R74A 3U7FB 2ERCA 3OH8A 1XMXA 3E6AA 3DWGA 4LZZA 4UVDA 3HY3A 4QEZA 1P31A 3QBTA 4Q93A 3OPYI 3QV1A 4DV3B 4U1RA 3D6AA 3ZQJA 3OQHA 4D25A 1GKIA 1H4TA 2J5RA 1BXZA 5K8UA 2JGKA 1R9GA 1ECGA 4XIGS 4ERNA 4N41A 4AECA 3D7MA 1RHKA 3NT2A 5T8KC 1NT4A 3OPYA 1GRCA 5GM1A 1S8AA 1DXOA 3VGPA 3L2OB 1VXRA 1VL5A 2VI5A 2I62A 2BMDA 2WWHA 1NA5A 3HN7A 4UDOA 5ESWA 4X1KA 5CVCA 4WKGA 3UV3A 2ENWA 2QTVB 5C46F 2A1TS 2GZ3A 2H51A 4QYWA 3U0BA 5HQTA 1SG0A 1TGYA 2GA8A 1MRNA 2J46A 3FHCB 3TEFA 4AY4A 4E2YA 1FVFA 2PZJA 4DLVA 3IT1A 3Q7SA 4GOLD 5HBRA 1LF5A 1QFYA 3I2GA 1ICEA 2CB0A 1C29B 3D8HA 1E63A 4HY3A 4GR5A 4EVQA 3HB7A 4D8WA 5KWSA 4U7PB 2CD9A 2N46A 4AMBA 3QPCA 4S2UA 4ALMA 2QORA 1WLYA 4UTNA 4QM7A 3OP1A 1V1MA 4H35A 1MB9A 4IIYA 4MGZR 4RUKA 2H0QA 4U0JA 1CR4A 2OHOA 1ZVMA 3CZQA 4G89A 1HLPA 5DNVA 1JDPA 4ITUA 2V6MA 4HLCA 4KIGA 4E1AA 5JXGA 3NX4A 2ETVA 4LNUA 4QD3A 1N78A 2OK8A 2R48A 4DSTA 4PG8A 5CLLA 4BFTA 4LJLA 1YDEA 1TUBA 4QG3A 2YNMD 1GV1A 3ZD6A 1Y4UA 4L8FA 2VZ9A 2X0JA 3ZCQA 3OTHA 1XBTA 1TZKA 2AN3A 1JIVA 4RF4A 4Q4HB 5HG0A 4HJXA 1W9HA 3O3CA 1PZHA 1ST3A 1WKCA 2X3FA 3CF4A 3W3AA 4RM3A 3WV5A 3ZWQA 5BN3B 5BVHB 2CV0A 1IM2A 1O6CA 2GJ8A 4YBRA 1F3LA 4J16C 1CUZA 1KY3A 2QROA 1C7RA 4CGYA 3LK7A 1HRDA 3DNFA 3GJTA 3BERA 5CK5A 3T35A 1X8JA 2XXBA 4R3NA 4EI7A 1BN6A 3HXMA 3F5QA 4TWRA 4B3GA 4JFRA 2ONCA 4DDTA 3RGGA 4CETA 5BVGB 2ZI4A 1LBQA 5K20A 1YL6A 1UPCA 4FVTA 4I4TB 4AFNA 4NI5A 1T0PA 3PXDA 5AKYA 3WZLA 4NARA 1DWPA 2OB1A 2IHJA 5GJCA 1AUVA 2A14A 3IS3A 1JHYA 4MITA 1E9RA 1MG0A 2OQ2A 2QNRA 3C15C 3E35A 1QRRA 3N0TA 4IIEA 5GQSA 4D99A 4MPRA 4PN3A 4KREA 3TW8A 3CF0A 3R7SA 4JT4A 3KQPA 1CUFA 1QH1B 4DR7B 1WCIB 3ANXA 3IR5A 2RHRA 4YR9A 1J22A 3BC1A 5EWMB 1LH0A 3ND8A 2QRHA 3RH0A 1WUYA 4FMCB 4NV0A 3USZA 3N2YA 4D1YA 2E5FA 2LXNA 2ZWMA 2EHDA 5HCIA 3NTVA 4E2WA 2JI7A 4KKVA 3T94A 4R1NA 4YWJA 1QE3A 2J4DA 4L22A 1CRQA 2E55A 2GTHA 2IOFA 3LHDA 4FEYA 4HWKA 2YIVX 4TLBA 1BKYA 1LW7A 3IAUA 3NH9A 1KE2A 1OASA 1HYEA 1MQ8B 3E5HA 4RTPA 4DA4A 1KJNA 4YRLA 3T7EA 1G21A 2FSGA 3BE8A 3OAAD 3R6LA 3LLMA 4M0DA 1W36B 4D81A 2XDQA 1W5AA 2QLJA 4QTTB 5J5VA 3O4GA 16PKA 4FFOA 3RREA 3GNSA 1E0KA 1Z39A 3AIKA 1IG3A 3HEMA 3LG2A 4F5EA 3RSQA 1OYYA 2QD4A 1PJBA 5CGZA 4W5NA 1PT9A 3QEOA 4LBYA 2YVLA 4MWSA 3TQTA 4A4DA 4WY2A 4OK6A 4IKPA 5CNIA 1GU7A 2GVDC 2TRSB 2ZSFA 3H5OA 5KB3A 1ZMBA 1L5KA 1DQRA 4V2IA 1L1FA 1P0CA 3A1NA 2RC5A 3K9CA 4K9KA 2XV1A 5B3LA 4QQKA 2R9VA 3RBVA 1E2BA 2AEEA 3W8FA 1V16A 3BULA 2BKLA 4F3KA 4FBLA 2J3MA 1O96A 1XVAA 2HMTA 3HDTA 4RYLA 4OMDA 4OQEA 4NLLA 3PP8A 3EXIB 4UAVA 5EQTA 5H4GA 4V1CI 1ZRMA 4M1ZA 1PAUA 2VDLB 4OQQA 1G3IA 2H1HA 1UXJA 1I36A 5IZ4A 3PFGA 4JEHA 5JT1A 2IUYA 1MN6A 2XH8A 1EX1A 4OHWA 4FZVA 4XDHA 5KC8A 2PD4A 3RHTA 2IWHA 2VXCA 1PV2A 2BP7A 3R77A 1R4ZA 3C39A 5DULA 4CNBA 4JL6A 3EPKA 4GWLA 3NAMA 5KSOA 1PW7A 3DCIA 1Z22A 2OV8A 2YJZA 3GH1A 3DDOA 1GNQA 1WXGA 3QHPA 5BWBA 3X3HA 2FCAA 3LUAA 4JMPA 2NU8B 1E2FA 1XCJA 3C41J 3G3EA 3TUIC 1GPBA 3CVJA 3HHPA 3PQ6A 4GBGA 1JYSA 2VBFA 3OPYB 3RU3A 4RCVA 5LP6F 3EULA 4NDNE 4AS1A 1K8XB 4KNYA 2JJQA 2JDIA 2O07A 2G40A 4OFWA 4NABA 1MT3A 1AA9A 5JAMA 4FR5A 2W48A 3GWGA 1W29A 1X2BA 4HQRA 1X80A 4ZQHA 1B0UA 5E8JA 1WUJS 2P4SA 3PL5A 4CIWA 2BSQA 1DIAA 1NW9B 2BZ1A 4AS2A 3OZVA 3RK4A 2GHQA 621PA 3VU8A 1IATA 4YONB 4GR4A 1VHQA 3RHFA 3U4QA 2J5KA 2FYTA 1J42A 2ORYA 4R31A 2QX4A 4KLCA 4L4ZA 4R5MA 2FLKA 3UXMA 3EZ7A 3PVZA 2GM9A 1KVQA 1PGJA 2BFBB 3EF0A 4P53A 4XIJA 3RANA 1U28C 3ZJUA 3OQ1A 2R8EA 4RHYA 3W7VA 4IAOA 2VLBA 5HF9A 5ITSA 3K5PA 2XY4A 2PXXA 1J0EA 4DA7A 4GGPA 2B4KA 1CUWA 1CR0A 2J45A 4IDEA 1C1XA 2GBCA 1XI2A 1FTSA 2QUZA 3N5KA 5FOWA 3J80A 1H2ZA 1SU4A 4LHXA 5EN4A 4AU1A 4BNGA 4AP6A 5K5EA 3IXLA 5ALNA 3ZXIA 2GJSA 2PL1A 2ZIWB 4FFRA 4N1AA 4URZR 3RVLA 1U3GA 3SX0A 2HPZA 5CA1F 3LVFO 1WSWA 3OFND 1MO6A 3FSGD 4GNRA 3LD9A 2AMFA 3Q6NA 2AW5A 4EELA 4KPFC 4IH4A 4G0UA 2HMWA 1K7EB 2OGSA 2ZYAA 1RI2A 1UBKS 2NU7B 2VT3A 4C20A 4RFVA 2IW3A 4I5GA 2JW5A 2F3TA 2QPTA 5CCDA 3FRHA 4BN5A 1NBHA 5D51S 5D87A 3DTTA 1YC2A 3UWPA 4HNVA 4GM4A 4RH0A 2Q8QA 1LBHA 1X7GA 3ETGA 5E6SA 4DREA 4AWAA 4OSOA 2IV2X 5BPFA 4JYCA 3UGTA 4DSUA 5IHXA 1RYFA 2V8BA 3WYGA 4LW8A 3LAWA 3ZLVA 1T0UA 2HXYA 2SICE 2F9LA 3LUJA 4ZZ2A 1HSZA 1WU8A 4JIMA 2IZOA 2YRFA 2Y1FA 2FR8C 1MJFA 5MFZA 3UJDA 4H7IA 3ZWWA 5KX5B 1CRZA 4UBJA 4GRAA 1NN3A 2GZHA 2OC4A 4CQMD 2ZTLA 5HZMA 1TZJA 1EWTA 5EJAA 4FWTA 1TAUA 2ZJ3A 3O21A 4IX1A 1WBBA 3VNVA 4COKA 4M1TA 1QH1A 2AI3A 2VRCA 4K9OA 4OBEA 4I14A 4QG7A 4XA8A 2NPIA 4GMXA 4DM3A 1BQEA 3OM1A 4YPOA 2PTGA 1ZH8A 5LPNA 2DM6A 1UODA 3K0CC 4RIGA 2QPOA 3GN1A 4GMDA 3G2JA 1TJ5A 3A0UA 3CUUA 4QHYA 4WY8A 3TW4A 4OB6A 5HFAA 1RI5A 2HF2A 4XLTA 2O0KA 3LH5A 1W59A 4MSUA 5AVTA 1B0PA 4M0CA 5AW4A 2OBFA 1LDMA 1IZ9A 4O59O 1Z0FA 3FKJA 5LOVB 2PT9A 1TT7A 5AW7A 2OCIA 3L6UA 4ZALA 4JUIA 2ZRFA 2NU6A 3B9QA 2M6LA 1THGA 5IKPA 2SKCA 1CDZA 5K4HA 5FTNA 2RI6A 1SVSA 3QYJA 2LR0A 4Q3CA 4R05A 3EGDA 4AIRA 4C4RA 1KXZA 3TCXB 2REOA 3GDFA 4C5BA 3CX6A 1WMSA 2X4GA 3D4PA 1PDOA 4HQKA 4UAJA 1JT9A 2J0SA 3VR3D 3GU3A 1M2WA 2JGDB 1YTLA 3R5FA 3X1MA 1JHAA 1XF9A 3EFHA 4ON9A 1ULSA 1PIWA 3KJFA 5IAAA 4C0AC 1IWOA 3GHYA 1S3IA 4C87A 2XBLA 4FKZA 5CIYA 4GE0A 4PZEA 2OZPA 3D7RA 3UV6A 3BILA 3UYKA 4YJHB 5ECGC 3OQMA 3IURA 1E94E 1C3LA 1T29A 5J4VA 1XTTA 1CVIA 4WWHA 4KQFA 2D1QA 5E9AA 1ES9A 2CNBA 3RIGA 2H0RA 3IAS1 2R8YA 4EWLA 4BXOA 2F9MA 4DYDA 3PEEA 4QPZA 4F4IA 5FPPA 2D3TA 1USGA 4TUYA 4ZANA 2VJLA 1W88A 3VQTA 2PMEA 1G4HA 5IJ0B 1AVTA 1USUA 4CV1A 1MB3A 1GCAA 4L85A 4M83A 4RTMA 1PLLA 4HMQA 2VHYA 1LSJA 3CNEA 5BQPA 3ZWPA 4B6FA 4HN2A 3DFFA 4LY9A 3NDPA 5BSKA 1I01A 1YB1A 2F43A 3BH6A 5DM70 1OXXK 2YZMA 1TC1A 4A8JB 5C32A 5C7OO 3GFGA 3GWZA 1QLWA 3SK0A 2AZXA 1AQLA 1OAOC 2D1RA 4M0FA 3BRWD 2Y9MB 3W6NA 1TJ4A 5JRDS 4RVDA 5B6PA 4G37A 1V26A 3SGLA 3WDKA 4FGWA 2BGIA 4BLRA 1PZMA 2A5YB 5HQ3A 4X84A 2Z57A 3T4EA 3VPSA 5H81A 3C3YA 2YWDA 3FOCA 3QY0A 1KORA 3TUJC 3B3FA 1EK0A 3ST7A 3I0MA 2C5GA 3H1GA 4YT8A 4ZZ1A 4EHLA 1N2HA 2VR1A 2HCBA 1KI2A 1YB2A 1YKSA 4RMGA 1K89A 1JU3A 5AI8A 2RGCA 3N75A 4PGMA 1ISGA 1DC4A 1U7OA 3W2FA 4M0KA 2A59A 4EW3A 4X24A 3QVVA 1ZRSA 2YQZA 3REGA 4RM2A 1Z4IA 3IIEA 1NVWQ 2B69A 2E4ZA 1M5TA 1L7VC 4Y6SA 2XQVA 1E99A 1TMGE 4HOYA 2AE2A 1B14A 1SCQA 5B7PA 1AA6A 2M6SA 4HMOA 2HOQA 4LRTB 3TIXB 2NYUA 4BNFA 1QTRA 2PWZA 1E2QA 2IYQA 4S24A 4WFJA 1A5ZA 4I4IA 4CMEC 4KFCA 2IXTA 3LFUA 2I5PO 2GJKA 3UAXA 5HIJA 1YJ8A 2HA0A 1S0UA 1NXPA 1T5DX 2AOUA 4X8LA 4ZC8A 3BN3A 5AVQA 2ZIAA 1GUDA 5I9MA 4YX9A 1G6OA 4F3TA 3JQGB 4ZU3A 2NVWA 1Y34E 3KEOA 4I1YA 1LC3A 5IDXA 1UJNA 1Z2EA 3GRYA 5JWOA 1A4XA 3DHYA 4E21A 5H16A 5KS2A 1LBSA 4F72A 3M6XA 2X0KA 1Z2CA 2WTNA 4TQAA 4B83A 2QMUA 3DVLA 4IEEA 1G6KA 4FJ0A 1PO7A 3TQQA 5A4KA 3U39A 2V7TA 3EOBI 3ZX5A 3T95A 3EZ9A 2FMUA 2XXAB 4HTAA 3OOEA 4B8YA 3GPCA 5KYKA 1ONNA 1Q7RA 3E4CA 4NU5A 5D7NA 2HMVA 3FJOA 2NWQA 4DMGA 4WIAA 1DO0A 1A95A 3QOFA 2Q6OA 1KERA 2IU6A 4C3ZA 1TTTA 2O8FA 1BWRA 2PZFA 3T4PA 1JV2B 4FFPA 1I94B 3NUQA 1UOPA 2PWAA 3D64A 2P9QA 4A9AA 1E0SA 1OFUX 1GCOA 5KNCA 2J9RA 5EQDA 3T5DA 1NLZA 4GUDA 4DDKA 3T5GA 2WWTA 4L15A 3VR4A 5E4YA 5L51A 1ZUNA 4WGGA 2VNJA 2Y1OA 1E0JA 2IL1A 2XVZA 5D3ZA 5FWYB 3WWZA 2Z58A 4B80A 4EJFA 1GCGA 4YJFB 4ALLA 3TQCA 4BTVA 3MHTA 1YJAA 1ECBA 1W25A 2R1UA 4AJ4A 2P1RA 1I1NA 2WF6A 3P2JA 1CUEA 3LM8A 3ADCA 5CITA 2R66A 3KVVA 1BYUA 3U7EB 2ZXUA 4H7JA 5LZ9A 4EKEA 1RXWA 3OJXA 5U4XA 1Y7LA 1T6NA 2I33A 3OC6A 4M89A 4MQBA 3RYTC 2XB9A 2J9XB 3IAS6 4X7MA 5LM3A 5LOVA 4NU8X 3GOHA 4PQGA 5FI3A 2O8CA 5FJJA 3HTXA 2DUNA 3IVMA 2Q41A 3FYTA 1QTNA 2Q3DA 2FZWA 4HBGA 3RVOA 5B58C 2XPCA 5GINE 1TAGA 3PC7A 1VP3A 1R2QA 4PSCA 4ZAGA 5SZHB 4J4BA 2UYOA 4TVKA 2C9CA 5C8YA 2VP6A 4J0QA 3U3XA 4BNNA 1PG5A 4A5SA 4AZSA 2M32A 4BFUA 2X22A 3M8KA 1DIOB 1JXQA 2JGDA 2OLJA 5LCXA 4EKIA 5CA1B 5CRIA 4RXMA 5CT6A 1EK2A 1N5RA 1KZGB 4Q00A 5BWLA 4PVCA 3URMA 4TTSA 4MICA 4C7OB 2VO1A 1MLDA 1E2HA 3LHKA 4K88A 3DLAA 3HU2A 1WTCA 4YJHA 4EK9A 3FPLA 2H00A 3ITDA 2I6FA 3HKEB 5BQFA 4IDCA 3UMCA 2AFIA 4NBLA 3WIDA 3WGGA 4LGMA 2Q7OE 1Y5NA 5EJIA 1ODCA 1Z5VA 4BQFA 1GGKA 1ZH6A 3EZYA 1EXNA 3H13A 4FC6A 4JLPA 3I61A 3QLTA 1ZC4A 2C5AA 1QUEA 4YI5A 1L5QA 1RJDA 2A9KA 4RY0A 4QJ5A 5MN5A 2WE8A 4X45A 4OK5A 4X54A 1OILA 5ALPA 1ZJZA 1W0CA 1OH6A 2PL3A 1J7KA 3KZMA 4O4JF 4LDZA 3WGQA 2HK9A 3KJNA 4DV2B 2F43B 2WSIA 3AERB 3FNRA 2E82A 4G0OA 4P4SB 3ZW8A 3NTOA 4FDLA 3KEQA 1JZQA 2W5UA 4MMZB 1N6IA 4LKRA 2W83A 2Z8YM 3GEMA 5KQPA 4WXRA 1KQGA 3GEHA 4R3UC 4KX3A 3TXYA 1AN0A 2D1SA 3WIEA 4X0EA 1N3LA 1XDBA 2VHTA 2H92A 4MR8B 4CM8A 1M5RA 1PTJA 1ONOA 5IC4A 1D4AA 2NYVA 1VIVA 4ZCPA 4TYQA 5TQVA 1J25A 5FORA 3SF8A 4CTJA 1E79A 5C7YA 5JMTA 3LQYA 1WB9A 2J33A 3IHKA 2GJ4A 3I72A 1P1IA 3LKVA 3HCDA 3LKZA 4J3JA 3I64A 4V0OA 3VNUA 3N8IA 1NPTO 4ZYTA 4D74A 3ER9A 4B3BA 3JR3A 4UDXX 5JYBA 2BFMA 2W2KA 4HDAA 5B37A 4CEIB 2OESA 1QM5A 4WLUA 3KYCA 5A5VA 2NQ2C 2P69A 2NSJA 1XRPA 4K5QA 4MWOA 2IXGA 4YRFA 4C2UA 3I6ZA 5KDDA 1G4UR 4MUBA 4KR6A 3LBHA 4E6PA 1XJQA 3FHOA 3Q3VA 2YV4A 2HT6A 2Q2NA 1LRJA 2C3OA 2R5FA 3CX7A 4MW4A 4CKWB 4PX2A 4GM0A 4W6ZA 4A8TA 2WU0A 3D7KA 1ZNWA 1E2MA 1DDIA 1E1LA 3MJVA 3W7AA 4ZKEA 2V7EA 3IAFA 3SWWA 2OZEA 3IOBA 3TFOA 1RWQA 5FAKA 1JILA 1NXWA 1PL8A 5L7YA 4N7RA 1NRJB 1QP7A 4YIHA 1RBYA 2FFJA 5B7QA 1Z5GA 1M33A 2HN9A 5KQMA 4B8WA 3TRDA 1MOSA 4LI3X 1O97D 1AQIA 4RHFA 1YSCA 3KQVA 5JH7F 1EVZA 4RF3A 1NZDA 1TYDE 3EVGA 5F12A 4WK6A 4REMA 2WMNB 3M82A 3NKVA 3LCMA 4RD4A 3MSXA 4GP6A 5JS1A 1WZ2A 1JG2A 4RSMA 3KUXA 4F84A 2PIAA 3R6GA 1UBRS 4FJ2A 3TE7A 2JK0A 2QU7A 4AC9A 3KPVA 1K7FB 1QVVA 4KGVA 2C00A 1NVBA 3VSCA 3EWNA 5ILQA 1E7QA 1UC8A 3MILA 4FC7A 2GBGA 1CYEA 3QG5A 4EPVA 1QQAA 4OXQA 2E1PA 2WKPA 1MABB 4K1XA 1CBUA 2C57A 2PRZA 3U1VA 2Y0DA 2BEVB 4HAWA 3PHIA 2CHVA 4HAXA 4I46A 5EE5B 3WISA 4FJ1A 3GRFA 4BMYA 4CTMA 3WLPA 3K9GA 1NXSA 1DUSA 1K97A 2TMKA 3R5XA 4PXYA 2X0DA 3GNQA 2P1ZA 1VPVA 2XWPA 1KAQA 4AQYB 4C0JA 5AK5A 1RKVA 2G4CA 4M0PA 3I2JA 4G0ZA 5HKBA 1J6UA 5KHAA 1S89A 1S4QA 1NJFA 3GCXA 1GFSA 3P20A 3PHBE 2PMBA 1ZUNB 3KU1A 4BN0A 2I4OA 3GGSA 1QKJA 3SFVA 3TPZA 4I4TF 3G89A 4HXGA 1ENZA 5BOVA 2WT9A 1WW3A 2QTMA 3QXXA 2IK8A 4OU5A 4RZIA 3FR8A 3EMDA 3ICCA 3MMZA 5DP1A 3QTLA 1I7DA 3A10A 4QU9A 4UOQA 2VF8A 3DO5A 4N40A 2LCQA 1P4GA 2HEGA 1UKYA 2KMLA 1QIFA 1L4LA 3HRIA 3PUZA 4S05A 2QSJA 4B44A 3ENZA 4CGZA 1CNMA 2LCIA 1I14A 1NP6A 1T34A 1XG5A 3GROA 3PC2A 1UPTA 4DEXA 5HJ5A 4OQZA 1SPBS 4PANA 1X7WB 3ZDYB 4C7VA 2CV1A 3BD6A 1SAYA 4UUNA 4M1WA 3WX0A 2GF0A 2XHZA 3H5VA 1G8GA 5HKLA 1SKMA 3B9BA 3KO8A 1KOFA 5DMXA 3B48A 1XTIA 3L4JA 3BQNB 3LI2A 4UU1A 2WJPA 4ENPA 5AXDA 5HFNA 1YDWA 2GYWA 1WHSB 1TLFA 2XE4A 1YBAA 2R7LA 4Z1MA 3C6XA 5CYFA 5BV2P 2HYIC 1MB4A 2HCJB 1JSRA 2MYNA 3UUFA 4WXEA 1FU8A 4B82A 4C7OA 3OQPA 1OIWA 5HZHA 5E9WA 3MMSA 1KEWA 3STHA 3NIWA 4B71A 1QC5A 2C92A 3B2QA 3C4VA 5DBFA 1QFXA 1GZ7A 2PLNA 3RYCA 4EEKA 4CMKA 5I4KA 2PXAA 2HM7A 4JKIA 3ZS8A 1QWOA 3OTGA 3WDMA 4U2GA 3W8DA 3ZIAD 5I9SA 3IAM6 3UMBA 4B43A 2DJIA 1T9BA 1I32A 5TB5A 1ZU4A 4NSNA 3JALB 4PG5A 1VJGA 5KBYA 1CVRA 2ES4A 3B89A 121PA 1NAIA 3HR8A 3KEMA 4M8IA 5TQ2A 3UWOA 3ER6A 2C4NA 1VM6A 2XVXA 4OQXA 1T1GA 3W2GA 2IUTA 3NC0C 3NVMB 5KOYA 1Y4ZA 4IGFA 1U3UA 1Z6YA 3PJFA 1N5DA 4ME6A 3O2NA 1JQLB 3EISA 2NP6A 2WM3A 3AR5A 5F51A 1F0YA 1IEQA 1TYEB 3I83A 3D8BA 3L8GA 1I3KA 2WVAA 5K7SA 1E7RA 2GVZC 2BT4A 3MLEA 3WQQA 4JIGA 4MA4A 4N7JA 4X1OA 5LQUA 1X39A 2J5XA 1Y8RB 5IPFA 2QIPA 3THXB 2C03A 4WLVA 3I9LA 1N75A 4F91B 5J4YA 1UXOA 3T7RA 1A82A 3TLGA 2FZCA 2FP4B 1VFPA 5IJAA 3Q9UA 2HAEA 1MEOA 5E7QA 4KE8A 4EG4A 1SKQA 2YV1A 5DNWA 3TZEA 3F49S 3VTKA 1GY8A 3N3AC 3AJ9A 5T8KA 3DE4X 5DI3B 1T2EA 1L7OA 1N5JA 3GNTA 3WNQA 5HRCA 4DUYB 2NV6A 1N2JA 2RC6A 4KLAA 2QRVA 2QQ0A 3NH6A 5DE3A 3HU3A 3UOWA 4C6HA 4RTOA 4MUGA 3ZD7A 1LKZA 3HKDB 3QFTA 5JROA 2UZ4A 3GQVA 3JVIA 4IDAA 1RQGA 5TPWB 1OXKB 3BCSA 3D5TA 2HU2A 3QVKA 4YUVA 3GP8A 1YRLA 3HA5A 1JAYA 3E3LA 4XFKA 5F7JA 5AVVA 4PX3A 4GICA 4RKYA 1TA0A 2VPXA 3AHGA 4JC8A 4WDQA 4PFQA 3ROMA 4H2DA 3WYBA 3ZZ0A 1YRYE 1MDFA 4NH0A 3WGVA 3W90A 4KTVE 1L1EA 2Q4BA 5KAMA 3V2IA 3PYXA 4OUKX 2ZRKA 3R8CA 4S1PA 3S8YA 1N77A 1DJMA 2FI1A 2DPYA 1WVMA 4ZCTA 2R8XA 1VRWA 1JIIA 1JVNA 2FU5C 1IPFA 2FJPA 4FE4A 4N3BA 4X63A 4YC7A 3ROZA 3UIEA 3UJCA 4PPQA 3WKCA 2RARA 4DNOA 5J9FA 5TQ0B 3JARA 4II3A 1MP0A 4X20A 3ZDFA 4KL8S 2PEZA 3RAEC 3BH7A 3WGTA 2HJSA 4MUFA 3C1UA 5GOTA 1HYBA 3DKPA 3ZGOA 2DHQA 1ZR4A 3DE5X 4DVGA 5FEUA 3KTFA 2QQ5A 1M2VB 3WK9A 4D4GA 1IN7A 1MIHA 1DC8A 4OHXA 2D62A 1I51A 1T8PA 1AZTA 4YV7A 3V32A 1JNYA 1PEYA 2YWBA 1PG0A 1XR3A 2JIDA 3GCZA 4FLMA 4AQ7A 2ZI6A 2CDNA 1Z34A 4NCNA 4MKFA 2Q7XA 3ADKA 4RABA 1UDBA 4BV3A 5JSZA 1PG2A 5HCNA 5AKXA 4NF2A 1NBAA 2PUJA 4R4JA 5K6TA 1WHTA 4PAMA 2O8VA 3QKSB 1SBTA 4FUTA 4NQRA 3SZ3A 4EHIA 3IE1A 1PJTA 4DR4B 4O4JA 2N9UA 4JXXA 1EIWA 2HRRA 3LLVA 1H9BA 3BWVA 3K2IA 4HATA 4DN6A 4QJ3A 5BMVA 3WKBA 4AN0A 3L8DA 3T1OA 4BLOA 4IMPA 2Q4EA 2B8TA 3FB4A 1NJ6A 1XXHB 3LIIA 1VRVA 4OP1A 2VK4A 5CYOA 3RLIA 4CT0A 4GI3A 3VH4A 3NOQA 3C6YA 4W9NA 5AM0A 3FYUC 3T1YB 1V0JA 3O74A 4Z0HO 3TLCA 4QVIA 3R7WA 2WY2D 2HHLA 2FKAA 2YXNA 4EB0A 2QVCA 3DXZA 3VKHA 4OQMA 1C4KA 5CB6A 2KYRA 2XRFA 4OHYA 5EJEA 2Q2OA 1P61B 3PUWA 1CHNA 2AQKA 2G76A 4BPBA 1GAXA 3KPYA 4HNAB 3SKVA 3B13B 1RWNA 1EVIA 1M6HA 3QWIA 5BN1A 3T9CA 2BOVA 2VNSA 3TD9A 3KB2A 1Z7GA 3K09C 1C7FA 4XYLA 1ZGGA 5IVDA 5CCBA 3L6BA 3M33A 1DFIA 2GUGA 3PDHA 3H8SA 4ZK2A 5EPUA 3NGXA 1EUDA 1TK9A 3MFQA 1CX9B 1QWSA 1S8FA 3OKPA 4CG0A 6PFKA 1EWVA 3QNMA 1P1HA 4LXXA 5FQOA 3WXMA 1XFDA 4WBSA 3AHIA 4BBZA 2XZOA 2V74B 2Z2ZA 2ZIXA 3GEPA 3BK7A 3GEBA 4Q1DA 4HPJB 1LRLA 4MO9A 3X2EA 1DFGA 1EX6A 2DTDA 1JKJA 3EK2A 3O92A 1U94A 2OHXA 3JYLA 4G25A 4MHTA 3V6LA 1B73A 1VBMA 2QN8A 1WD7A 4JT9A 5TMPA 1F2UA 1RI4A 2F17A 2I2BA 3TDKA 1ZHFA 3WQBA 1YBMA 5JAQA 4N5HX 1JEYA 4E31A 3QBEA 1K9SA 2BF7A 4WA8A 4PM4A 4ZT2A 5LXTB 3HJFA 4H7EA 3VAYA 5IVIA 5HM8A 1HDIA 1J0BA 2FTKE 3JQBC 1AY0A 4J94A 4XEUA 5SY6A 4N7BA 1CDDA 4NIMA 3WNCA 4CG1A 3VPFA 1L9XA 4D57A 1O9GA 3X2FA 5K9ZA 2Q0SA 4OIMA 1BGXT 1E1RA 2O7QA 3PPIA 4M8NE 3UT5B 2B7BA 5ADWA 3P8ZA 5BN5B 4DDWA 3P9CA 1P2TA 1ESZA 4DC9A 2FX5A 4XKJA 1ULTA 3TRJA 4DCVA 1PJLA 3RUDA 3ADPA 2WHPA 4BIIA 4NOJA 4CG2A 3Q7QA 4LVOA 5E3HA 4OMUA 5IXSA 2HF7A 3ISJA 5DNUA 1U99A 3OM9A 3Q7RA 1U6IA 2A57A 1MGOA 4BGVA 3EEYA 3I0NA