4Q02A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
b'GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q02A00
2GF9A 1OYWA 2R62A 4Q19A 4BQSA 1OYYA 2UKDA 5E7MA 1P2VA 3GP8A 2IYXA 5H1YA 1DAMA 1NG1A 3H1TA 5FTMA 5DN6D 2VSXA 221PA 1Z22A 4PZYA 3THXA 5AWFC 1T3HA 2ATXA 3SJZA 1T5IA 1QDEA 1PV4A 5JI3E 1G8HA 2BWJA 4HAZA 4H9GA 2CCJA 2JA1A 4G01B 5KTYA 2ASEA 2QP3A 1JQLB 3AF3A 4IW3B 2NOAA 2MSDB 4EJSA 1MKYA 4NYIQ 3HDTA 4PPQA 2ZE7A 2OG2A 1J70A 2XXAB 1T9HA 1CLUA 3D6TB 3EZ7A 1BYUA 3SYNA 1JAIA 1XU4A 4LI0A 1FTSA 3TR5A 3A6PC 3HYRA 1ZNXA 3HU3A 4L16A 1J8YF 1U98A 1A4RA 2OCBA 4W5WA 4A0HA 3BFVA 5JJIA 2P6RA 4Q4AA 3K0FA 3W8NA 5CIWA 4V0OA 4EPTA 2WKQA 1XEXA 2ZJBA 3EARA 4QNMA 5DN6A 3SJAA 4LPSA 1EX7A 1G5TA 4J0QA 2O8FB 1X8KA 5D3QA 1VCIA 2RGGA 1L7VC 3LH5A 1N6NA 5FTNA 4QGAA 2OM2A 1ANKA 3LX5A 1S1MA 3GLIB 3QF4B 3CRQA 1G18A 1A7JA 2RB4A 2WICA 4FIDA 5KNCA 1FQKA 3KJGA 1P61B 4XTCS 4A8JA 4JLPA 4D0LB 1X86B 2OBLA 3TSWA 4KITB 1OF1A 5CJPA 1RRCA 3SEAA 2Q9AA 2BJVA 4PO1A 4P32A 4I1OA 2PCJA 1S9DA 2WM9B 2ZREA 3A36A 4JIMA 3NDBB 1E32A 3VKGA 3PR1A 4ACBA 1E9AA 4JLKA 3SYLA 3FPAA 4M8NE 4P4SA 1ZD9A 3TVDA 3AVYA 2C2HA 3ZVRA 1TUEA 1KDPA 2QMOA 4CEHB 1RW4A 3A4MA 4JKIA 4QJ4A 2WMNB 4C0BA 1CS4C 3TE6A 1A2KC 1COWD 3I61A 1G3QA 2CE2X 4NZYA 3TSOA 2C98A 1DAEA 2MMGA 1EG7A 3Q9LA 4IDOA 4CVNA 1AQUA 4JT4A 3QPVA 2G88A 2JLRA 2ZI9A 3K0SA 4DSNA 4XWKA 1E79D 4OHXA 4BFUA 4AK9A 1LW7A 3QPWA 2GEVA 1GWNA 4RD3A 4YLGA 5AUNB 4GBMA 1KK2A 3DHWC 1LS6A 4HAXA 4EUNA 1R0WA 3EZ6A 4MRVA 1I2MA 4Q21A 4QHSA 3VR1A 4R98A 3T1OA 3C4JA 1JNYA 1MO5A 2FFQA 5D3MB 4D4LA 4ITRC 5FPTA 3BOSA 2ZRMA 1AA9A 3CRVA 5AJZA 1OIXA 1TU4A 3GEHA 3GJ7A 4JBWA 4DCTA 4DBLC 1E2HA 1IY0A 5K8LA 2JLSA 1Q57A 2QMUA 4RD6A 5FOUA 3SJCA 2GXQA 3TIFA 5C4MA 3I8SA 2IEZA 4CYMA 4DXAA 1Z8FA 2Y8EA 2IC5A 5EXTA 8OHMA 1NBME 3S1AA 2ZAMA 4LUCA 2VSOA 2WJIA 4ILEA 3U2QA 1XFAA 2OXCA 4JLNA 1Z08A 4YMSA 1E79A 4CRWB 3LD9A 4PQFA 4TLCA 1DAGA 5AJWA 4FCTA 3BBPA 2FPMA 2OCYC 4JJKA 4RFSB 2GVZC 4JYCA 421PA 2PEYA 3AH8A 3L0OA 1ETUA 3U6BA 2O8DB 3PUXA 3A1SA 3KTAB 2F43B 1TUIA 1VCMA 2IWRA 1DTSA 2WPDD 3FFAA 2QSYA 3HPRA 3IIJA 3PEUA 3QXSA 1IJEA 2ZJZA 5LB4A 1KMHB 1GKUB 4HLQB 3OIUA 4TTRA 3FB4A 5EXXA 4Q1EA 3EASA 2PJRA 1HUQA 1Z06A 5C46F 3NWJA 3PEWA 1R5OA 5BW8A 4PFSA 5CB8A 4B3FX 1GOTA 1PZNA 1QBKC 3OHMA 1NY6A 2CLSA 3THXB 4V02A 3SDZA 2NO1A 1J2JA 2FWRA 2QT1A 1Q21A 2OV2A 2XTMA 3H84A 3V4RA 4Q4LA 1X1SA 3TUZC 2E87A 4KO8A 4WW0A 1UBFA 4LOAA 4EJSB 5CDFA 2AWOA 4EDHA 5KOYA 4V0ME 3A58B 2ATVA 4PPGA 3V00A 4PSAA 1E2EA 2R6FA 1P62B 2VLIA 4C0HA 3EA0A 1R8SA 2H18A 5EXSA 3VU9A 3LVQE 5JRZA 1AN0A 1Z3IX 4B48A 1UBCA 4BFYA 4K46A 3GQBA 4AY2A 4YXWA 4Q4AB 5E4FA 3K0FB 1U8YA 3CF0A 2F1RA 2F3RA 4LPKA 1XEXB 4KVAA 4H1UA 1NIJA 4FMDB 1E2KA 1TL7C 2J45A 4PX9A 4AURA 3FMIA 1FPMA 4KFUA 4JL8A 3I62A 3A4NA 1Q12A 4GZLA 1G3RA 3ECCA 5A5GA 4A8JB 1W4BA 1XP8A 4FWTA 1E9SA 3CX7A 3WMGA 3U3RA 1N6RA 4DKXA 3D8BA 1D6JA 5FBWB 2FFHA 1J99A 2JLUA 3FMFA 4MKFA 5EP3A 5KHOC 2B8TA 2FMXA 4Q9JA 2G9NA 1W46A 4F7WA 1TEVA 1RE0A 1YZNA 2XOKD 4C3ZA 4D80A 4UXIA 2QEQA 4B6FA 4DSTA 5FH9A 4TYQA 1XJ0A 3BD9A 4Q7KA 2BEKA 2GXSA 1IAQA 4M21A 1E2GA 4JVNA 4P4SB 1SXJD 1ZUNB 1VCNA 2GAOA 1G4UR 1T0HB 3MWYW 3MGCA 2FG5A 4GDFA 1ZRHA 2I1VB 4NMMA 5AUQA 2A5DA 4P4UA 3WP1B 2XNDD 1NJGA 5HKKD 3AGQA 3WBKA 3UMSA 4MKGA 2YNMA 5DYIA 3T5DA 4O3MA 1E2QA 3AVUA 2O8EA 1G64A 3AVPA 3BB4A 3LBNA 4I1VA 3KJHA 3OFND 4MGKR 1YE8A 5CITA 1U9IC 4XD7D 2L0XA 3L43A 3IKJA 1KI9A 1E3MA 1S0UA 2BEJA 1OXXK 1XX6A 1QHIA 4LBWA 5IHPA 1CR2A 2BV3A 4A6PA 4BZXA 4I1SA 2XOKA 4M2LA 1M2OB 2ZRIA 1TQ4A 3DPUA 3UIEA 3UKDA 2VP9A 5IDVA 1OHHD 5JWOA 1KO4A 3W9YA 4JL6A 2WIBA 1IOZA 1KSGA 3EPHA 3BB1A 4IFEA 3QKUA 3O8RA 3KQLA 2G6BA 1GG2A 1SXJA 2IYWA 3OEED 4QG7A 1T91A 1Q1EA 2HUPA 5B2ZA 5G3ZA 2XZLA 2ZSDA 4LJ7A 4PAQA 3PV0A 1CJUC 4YQFA 1CF4A 2KWIA 2XNDA 3U4QA 2GJKA 3B1XA 2NGRA 4TQUS 5AK0A 2Q3MA 5HKKA 3SC3A 4CDGA 2QZ4A 4URZR 3S1AB 4F38A 5FTLA 2B8WA 1XTIA 3O8DA 1F48A 2WHXA 3UG6A 3OFNA 4MGZR 4PPFA 1JR6A 1T0JB 4PAOA 4XD7A 3KB1A 2W00A 4HAUA 4JSYA 5CJ2A 2Z4RA 3I92A 3X1YA 1TQ6A 2QTFA 3P32A 4RKEA 1OLOA 3DL0A 5FL7A 4KLNA 1DBSA 3CLVA 4Q7MB 1OHHA 1Q20A 4O25A 3RS7A 1FMLA 4AWXA 2VP2A 5FBLB 5EE3A 1Z28A 3VR5A 3OEEA 3SI7A 3T5GA 5FOVA 1ZC4A 3B60A 2AN9A 3D7MA 3CR7A 1E2LA 2ZROA 4LC1A 2QBYA 4WVFA 4CIDA 5J4VA 4TTPA 4FD2A 2EW1A 2FN4A 2KI5A 3PEVA 3ZJYA 3NEYA 4P31A 5HR5A 2C04A 5F9FA 3B2EA 3I1FA 1VDZA 2IBMA 1YQTA 2PCLA 2C9YA 4E09A 3ICEA 4NYJQ 4RKFA 3EXAA 1E9RA 2IUTA 1LB1B 1XXHE 2JASA 3GJ8A 1NVVR 1GL7A 3WBJA 3CBQA 3KKPA 1WMSA 4URWR 4Q7LA 4L9SA 5SZIA 1N2CE 2GJ8A 4DRZA 2J7PD 4GSYA 3I32A 3C41J 4DLTA 1XBTA 2GK6A 2ZRNA 4WBSA 1ZBDA 2YHSA 4MUBA 4NP6A 1IN5A 1DE0A 2J3EA 4BPBA 3VU9B 4H1VA 1OXUA 3QG1A 1R2QA 3QNUA 2WJJA 5FBQB 1F60A 2QY9A 1P9WA 2WJYA 3A1VA 4DVGA 4LHYA 2XITA 4LK2A 5JJKA 2ZVQX 4HB4A 4JYBA 1S8FA 3AV0B 4F4CA 1Z6XA 621PA 1PJRA 5EZ5A 1NN1A 1G21E 2QRNA 4HUTA 2AFIE 3WYAA 1OIVA 4EPRA 3TGPA 1BH2A 3QXXA 1NVWQ 1R5BA 1QHHA 5J40A 1KDOA 4Z8XA 4FMCF 1IY1A 2VHTA 3VR3A 4TMWA 1YZGA 5FUYA 2W83A 4D4KA 3FKQA 2J7PA 4JMPA 4A4DA 1GDDA 3W6PA 2F3TA 4E5UA 1YRBA 1X1RA 4AC9A 3UG7A 4B35A 2RGNA 4C0QC 2PZEA 3ND9A 2WWXA 1Z6GA 2LKDA 4OI1A 4XJXA 2B6HA 4IHQA 3NBXX 4XSGA 5GJVC 3EIEA 3K0EA 2ANBA 3GPLA 1SHKA 2OO7A 1ZYUA 2PZFA 4LWZA 5FI0B 1N25A 2RGXA 1IQPA 1GNRA 2YOGA 4ZDJA 4QM6A 1AGRA 4RCZA 3W3AA 2J87A 1R0ZA 4KBFA 3L82B 4GL2A 1TF5A 2FZLA 3LXXA 3NG1A 4MYTA 3THOA 4EFLA 4RZ2A 3VKWA 3IEVA 3K0AA 1FNNA 4DSOA 1GM5A 3RNLA 1M1YE 2ZJYA 2N1BA 1QVRA 1SQ5A 4B2PA 1VPLA 2AXNA 2O8EB 4W5HA 2GXUA 4LSGA 5G53C 4JLMA 1VG9B 5FPSA 1S1CA 3W8RA 2MSCB 3LW8A 2GZDA 1SKQA 4QC2A 3K8YA 3RRMA 1TX4B 3KKMA 5TV2A 5HCIA 1WQ1R 3JZMA 3AVTA 4ESHA 3KUCA 1ZJ6A 4TMKA 1DEKA 4AYTA 1QVAA 3SE0A 4DLWA 1RIFA 3CWQA 1P7CA 3NTUA 2XSZD 4JLVA 4ZI3A 1SXJB 1IXRC 5EE0A 5EXPA 2ZR7A 4L8GA 2X8AA 4PO9A 1VG1A 4ZI2A 2DWQA 4DSUA 2FSGA 1M34E 3QEJA 3I5YA 3U4QB 4TLAA 2AL7A 2XJ4A 2ZRAA 4U7DA 1ZUIA 1KZ7B 1S9HA 5H68A 4NU0A 4ARZB 4Q4JA 3RRNA 3GJ3A 4L9WA 4IJMA 1XF9A 2IXGA 4TZ6A 2GILA 5J4LA 2NTYC 2IYVA 1SVWA 1Z0IA 1BYIA 3B7GA 4M9XA 2FEMA 2IUUA 2V4ZA 3AKEA 2NO7A 3WNDA 1LNZA 3RWMB 2P3SA 3VFDA 3LBHA 4Z54A 2XSZA 1ZP6A 2WJHA 1A2BA 4AIIA 3AF0A 4OK3A 4MYUA 3VNUA 2QBYB 1Q1ZA 1XJQA 4TYNA 2IX3A 1DARA 4IEEA 3ZD6A 4NYMR 3K9LA 3KKOA 2ODEA 3ZQJA 5KDOA 5K8TA 2JDID 2P67A 3CNLA 4D4MA 1UDWA 3MFYA 4BASA 5HPYB 3R9WA 3TAUA 4D2IA 4DT1A 2CVFA 2QN6A 1KIMA 3WYGA 5TXGA 1SVSA 2ZAOA 3L0PA 1E98A 4LYJA 2WWYA 5ELXA 4NE2A 4DDVA 5F98A 1CBUA 4QGGA 4BGDA 3LV8A 3U61B 2G77B 3CRRA 1RZ3A 2F1JA 1W0JD 2DFKB 2VP6A 5DI3A 2CHQA 5FUXA 3SQWA 2GEDA 1CXZA 1OXTA 1T6NA 3QBVA 4O2RA 2FPLA 5KDLA 1UKYA 2F6RA 3VAAA 5BYKA 2J0QA 3OEHD 3CH5A 2EFEB 4ZO4A 3VTKA 2Z43A 4DWJA 2P65A 2HEIA 1E2DA 5JLJA 1KNQA 4ZCIA 2JDIA 1EWRA 1QHHB 1JR3E 1R6BX 5GJWC 1MRNA 2J59A 4MITA 2G0TA 2GEUA 2JLZA 5KYKA 1WDTA 2J5XA 1GKYA 3QENA 3RYTC 3U7FB 3TUJC 3NDPA 1WF3A 2J7KA 3AKDA 3SBDA 4D0NA 2AWNA 3RHFA 1MRSA 3KFXA 3LLMA 3U3KA 1KI7A 5AJYA 5E95A 3AKYA 1W0JA 1XD2A 2OCPA 2D4HA 3MSXA 4II7A 4JLBA 4KU4A 4U5XA 3DOEA 1XB2A 1Q22A 3PUZA 1HQYE 4C4PA 2QPOA 4WXRA 3W34A 3OEHA 5HCNA 3FOZA 4JVLA 4DLXA 2AKYA 5BN4A 4MKHA 3Q72A 4XVQA 4X8HA 4FINA 2WVJA 1ZVQA 5EUMA 5FPHA 1XMIA 1XNJA 3PUWA 1HTWA 1G9XA 1T8TA 2IYRA 2I4IA 4G3XA 3K0AB 3TNFA 3B9QA 1W36D 1N0WA 5JHHB 4HEJA 3DZDA 2GF0A 1MOZA 1XMJA 1GILA 1W5SA 1R10A 3IDQA 2GJSA 3NHAA 1W49A 2O0KA 4XIGS 1YHNA 1X8JA 1RKBA 3Q7PA 1XTRA 3U44B 1YRAA 1CJVC 3LWNA 1S2MA 3SQXA 4PC1A 5FBRB 5KU1A 1NI3A 1ZU4A 5FTKA 4ZDKA 3CM0A 4KYUA 4IOKA 4M53A 2ZS8A 2VF8A 1KHTA 4FMBB 4Q9HA 4MGIR 4N0DA 2NPFA 1OIWA 2CBZA 2F1IA 4IDQA 4D82A 3WMEA 2WWHA 4S35A 1Z6YA 2WKPA 5EUQB 3A8TA 5GVSA 1VG8A 4NCJA 3MJRA 1E94E 1I4LD 1KSHA 4JS0A 2FA9A 3X1DA 2XB4A 3K09A 1XRJA 4CW7A 2CLCX 3Q7QA 3CW2A 4Q4JB 3K9NA 1BS1A 4KODA 2DWPA 1VMAA 1U0LA 3DMNA 4Q47A 4HLUA 4ZCMA 1GNPA 2V8OA 1OSNA 1JI0A 1C9KA 1FMJA 1YR7A 4Q02A 3ZIAD 5KNDA 4D26A 3NC0C 2V7QD 3EA5A 3QUSA 1Z07A 1Z0AA 2ERYA 3EIHA 3VX4A 4IVRA 1E1QD 3M0EA 2YWHA 3CF2A 4TT3D 3H0KA 1L4UA 2GK7A 4MRPA 4DLUA 4OK6A 2DR3A 2Z0MA 2OFXA 1G5PA 3BXZA 2AK3A 4NHOA 3AKCA 2ZE8A 3SHFA 2D7CA 3K0CA 1XEFA 3TSZA 2IS1A 4FWIB 2GBLA 1WXQA 2AXPA 1F6BA 5KSYA 1V43A 4PHFA 3CO5A 3FDIA 5FTJA 4N1AA 2OBNA 1MT0A 4HSEA 3LLUA 1CJKC 3UATA 5AUPB 5KSZA 2A2ZA 2EYQA 1GZSA 4PZZA 2REXB 4DT1B 1S96A 1VHLA 5EJEA 1MH1A 2VF7A 3ZIAA 1OW3B 2AFHE 2ODWA 1ZINA 3SN6A 2V7QA 4PO8A 3TW4A 3EZ9A 1ZNYA 1GRRA 2TMKA 2X19A 2E9SA 2YWEA 4NPHA 3SS8A 4NCNA 1E1QA 1X8LA 4BLQA 1ZNWA 3GJ5A 1E0AA 4FCWA 4RSGA 2O8CA 4FCVA 4EIWA 4TT3A 2LKCA 1ZM2A 3OAAD 5DI3B 5GADl 2OXRA 3LVRE 1MABA 4P3YA 2Q9BA 4BEBA 2NQ2C 1KI1A 5DSZA 3A1WA 1ESMA 4KCGA 1U8AA 3PITA 1YZUA 1VYUA 4JLDA 1UFQA 1II8A 1P2UA 1TEXA 2CNWD 2HCBA 4NYIR 3EPJA 2GCOA 3KJIA 3MLEA 1MO3A 1P73A 1G8FA 3Q8XB 1C4OA 1P75A 3JVUA 2C9OA 3C5CA 1EFHA 2PEZA 4URXR 5GVRA 4EJSC 5E7JA 1YR9A 4WIAA 3TBKA 3TLXA 3FYHA 1Z0FA 3G5UA 2EYUA 1FP6A 4HZUA 4BLSA 4HYYA 4HDCA 3BFKA 3KDSE 2Z6VA 4TL9A 1COWA 2VRWA 4QNRA 2HDNB 1G6HA 1OKKD 3AGPA 1G16A 3IO3A 4YDHB 3RS2A 5IK2D 1XD2B 5IT5A 4KJZA 3OAAA 4Y0VA 4WZAE 1II0A 1KMQA 1UDXA 2VH5R 1WP9A 5JCZA 1DG1G 3OESA 1TTTA 2GZAA 4URVR 2FJUA 1ESNA 2FSFA 1G5RA 1SVMA 5DIFA 2VL7A 2BBSA 2C03A 1CJTC 1OFIA 1A1VA 1U0JA 2CNWA 2OFWA 4GZMA 2A3RA 2IHYA 3W5JA 4OHVA 4UXJA 3RS3A 4NL4H 2IF2A 3PFIA 4A8JC 2KB0A 4TMXA 1GL6A 3KL4A 2G3YA 1E0SA 2D06A 4QXAA 3NBYC 2AR7A 2R9VA 1RPZA 4ACAA 1KO5A 2ZJ5A 4I81A 2CVHA 3FMOB 3QIAA 4IVPA 4I1UA 4LX0A 1G1MA 1Z6TA 5DO9A 3CWZA 4ZDWA 4DLVA 3KXLA 1L2TA 5JHGB 1OKKA 4TLEA 5IK2A 2JLQA 1K8RA 2ZJ8A 4I4LA 2J41A 1ZM9A 4TMTA 2YC4C 1P3JA 2Q3FA 1IXSB 1Z0KA 1NVUQ 3CPHA 3RSLA 2VPPA 4OHWA 3T35A 5DI9A 1D5CA 4G5GA 4EAQA 2WKRA 5JSZA 4GOXA 2JLYA 4Q9LA 4A0FA 4M1SA 4RY2A 1E99A 2WSSD 3B1ZA 2XZOA 3UK6A 3KX2A 2BVNA 1KJZA 5L3RA 3GLHA 5J4HA 2WPDA 1M74A 4NCHA 4DCUA 1XEWY 5KSOA 4KFRA 3BS4A 1W36B 3Q5EA 4B3DA 3FTQA 2CHGA 3PUYA 1Q3HA 1XZPA 3DDCA 4RZUA 1K5DA 3QE0A 1P72A 2WZQA 1KO1A 3QBTA 4KV9A 2OLJA 2HT1A 1Q0UA 1CULC 1IJFA 4ABYA 3ONWA 4JVSB 1ZIPA 1NP6A 1V5WA 5EP1A 5A0FA 2VHCA 4CEIA 2QP4A 1AKEA 1EK0A 4Q4HA 2QENA 2CL6X 4OQXA 4YC7A 2QRZA 4A2PA 1SGWA 2H8KA 4D6PA 2AHOA 3QF7A 4ASUD 4G1UC 2WSSA 3AVVA 2WV9A 3C5HA 2R8RA 4O2LA 4UKDA 3B5JA 3QKTA 3ADDA 2YOFA 4FN5A 1CR4A 1GITA 1XD9A 3UMFA 3VQTA 5AUOB 1D2EA 1KO8A 4DEYA 1ZD1A 3IILA 2H5EA 2JJ2D 2QM7A 4HDOB 4UNPA 4DLYA 2IT1A 3B1WA 3GLFA 1BKDR 1TPZA 4FMCB 1JXMA 1IN4A 4GFDA 5JEEA 2I1QA 5KNBA 4Q9IA 3SNHA 2Z4SA 3QOFA 4DLZA 2V6JA 4HZIA 1G3UA 2P0EA 4AD8A 3O8BA 1AS0A 1IONA 1GNQA 3BB3A 5B58C 5J4KA 4CEJA 5F9HA 1CTQA 1KKLA 2MSEB 5CK5A 5SZJA 2H1LA 4A9AA 3PCRB 2W6ID 3MUFA 3PENA 2O8CB 1OT3A 1ZNZA 5L3SA 2QU8A 2ZU6A 4LJ8A 4KLZA 1UKVY 3SZRA 1JJ7A 4ASUA 2A5FA 5E3HA 4WZBE 1M8PA 1P60A 3BH0A 3O47A 4QGFA 4BLOA 4OKSA 4BZPA 1MABB 1HY3A 1QG2A 3NBFA 1HV8A 5FOSA 1NLYA 2JJ2A 4RD2A 1II8B 4N0EA 4TSFD 5FL3A 4HAYA 1JECA 2GCOB 2PT5A 3QVUA 1ZIOA 2YINC 4KAXA 2R2AA 3WRYC 2FDCA 5FPYA 3DM5A 2HJVA 3PIRA 4WZ6A 3EPLA 1R0XA 1W4AA 2XTZA 5JJLA 1KDTA 4C7OA 2FE4A 4HZUB 5IRCD 2BIFA 5KO2A 1HT1E 3GJXC 2VP0A 1N6OA 2W6IA 5KSPA 3ZS9A 3ZQ6A 2W6JD 4MRNA 3I72A 2KBFA 4R71A 2WJVA 4US0R 2QMEA 4R2IA 3IHLA 1NSFA 3FHCB 1FZQA 5JMTA 2IYQA 4UNQA 5JECA 2FSIA 1TF7A 4S2EA 2AK2A 3TQFA 4TSFA 3I73A 3UWOA 2ORVA 4MGYR 2G0NA 1IN7A 3UMRA 1BIFA 1O3YA 4HB0A 3PQCA 4PANA 4G0NA 1KJWA 2H92A 2QAGA 5BQ5A 2H17A 4ON9A 1XPOA 2IXEA 4IOJA 4HI0E 1Y63A 5UKDA 3RWOA 1A5TA 3WNCA 1B23P 2ZXUA 1D9XA 4HB2A 3FHOA 2NZJA 2RKOA 3N2EA 4KXFB 3T34A 1R7RA 1E2JA 4B3GA 4QRHA 1N5LA 1LY1A 2IK8A 2W6JA 3C8UA 3CF6R 3ZVMA 1E6CA 2IXFA 1XMSA 3RSOA 1GVNB 3SOPA 4DDUA 3KQNA 5H8WA 1N5JA 1W4CA 4TQ9A 2YV5A 2R6CA 3ADKA 4LHWA 2IW3A 3L0SA 3TW8B 4A15A 1S3GA 4KSCA 2GJAA 1XTSA 3EWAA 5H70A 5JSZB 1U81A 3SHWA 4GP7A 2ZJAA 4MUAA 2ZI6A 5G41A 3LO5A 3TKLA 2YJTD 2ZRBA 1Q3TA 2ZJ2A 4E07A 4X8MA 1BMFD 3AP3A 1CKEA 3EC2A 1GFIA 5TDHA 4ZKDA 2WSMA 4UJ5A 3GLHB 1N6KA 4GI7A 2BBWA 1GTVA 1C1YA 3THWA 1UAAA 1N6HA 1CRPA 2BCJQ 4Q18A 1T8UA 2R6AA 1AM4D 2O5VA 2XX3A 5FR1A 4DCSA 2E1RA 4ZDIA 4PC7A 3IPYA 2ZRKA 2QUZA 3BFXA 1NN5A 3MRSA 3RS5A 3RRYA 1OB2A 4QGHA 3NVAA 2QGNA 3R20A 4LJAA 5FI1B 4L4UA 1QHXA 1BO6A 2ZRJA 1HH4A 1VCOA 1TQDA 4B75A 4IDHA 3B1VA 1MR3F 2NMVA 3T12A 2WWWA 4CEIB 3TAHA 4Q4HB 2QTVB 4NCKA 2ONJA 1T3SA 3TH5A 2JIZD 4B71A 5LDDC 5FPKA 1SXJC 3U7EB 1E2IA 2B92A 1VKJA 1NBMD 1ELOA 3P26A 4DDTA 3NH6A 1F5NA 1OJLA 1UPTA 2PJZA 4LJ9A 1XPUA 4LBYA 1UBEA 4POAA 4YMUA 1BMFA 3REGA 3WMFA 2DFTA 2HXSA 4W7SA 5KUTA 3J81k 2JLWA 2ANCA 1P9NA 2R6DA 3TVTA 5CM9C 4Z1MD 5SZKB 4CT4B 3NKVA 3THYA 3B6EA 2ZRDA 4RD4A 3VR2A 3GLFB 1M7BA 1RJ9A 1L4YA 1BOFA 1X3SA 1G41A 1SKYE 4E03A 3VX3A 3A4LA 2QE7D 1JQJC 4TQAA 5AR1A 1G8GA 1K6MA 4N3NA 4ZV4A 3EG5A 4GRAA 5JRJA 3U7GA 1OE0A 3ZZTA 3TR0A 2D74A 2WOOA 1OFHA 3RS4A 1TU3A 1XCGB 1EFUA 3AF1A 3EZ2A 1YZKA 2JIZA 2GETA 2ZRPA 4L15A 4PZLA 4QBFA 4R7ZA 5L3SB 2NO9A 5J4YA 4XH9B 2D2EA 4B34A 1NBMA 4NYJR 2GCPA 3N5CA 4DLSA 1ZUHA 2EWVA 4NDZA 3G0HA 3IIMA 1LVGA 2WAXA 4YMTA 4Z1MA 4US1R 3MWLA 2FNAA 3MJHA 1OH6A 4JVMA 1KOFA 1P2TA 2OT3B 1ZC3A 1AK2A 1Z63A 2ZRFA 4V03A 3VHXA 1N6LA 2QE7A 3IEUA 4MYCA 3V4FA 1M7HA 1XCPA 1N6PA 4C9BA 3W6NA 1I2DA 4C7OB 1KI6A 5LB2A 2A5JA 2I3BA 2OFOA 4NCIA 3OIWA 4LJ5A 3VHLB 3KQUA 1Q44A 1AJEA 2GNOA 2O52A 3MG9A 4OI4A 4TN1A 4Q01A 4XOIA 4C0LA 3WHKA 2C96A 1YJ5A 4UNNA 5JWRA 2OE2A 2CHVA 3WHLA 3T1QA 2CLDX 2XNSA 2IS2A 1E2FA 3GJ6A 1XCMA 1VIYA 1G4AE 4KBGA 5EQTA 4TLDA 1Z29A 5J5CA 3CNOA 1KI4A 4FI3C 4XTRA 2FV8A 4V0MA 4BFWA 1DELA 3QKRA 3BK7A 1G8YA 3HU1A 1CEEA 2RGDA 3KJEA 3FGNA 3REFA 2IYUA 2ZUBA 2QAGB 3AEZA 3IPXA 1P5ZB 2W0SA 3FMPB 4DEXA 4URYR 3GLGE 1JEEA 1XTQA 5JS7A 2RGNC 4AYXA 3P4YA 4XSHA 4OHYA 821PA 5ANRB 2QM8A 1E2NA 4MQBA 3RANA 4QHTA 4DCNA 4A2QA 3BH7A 3P1JA 2B7BA 1N5KA 4PXAA 2VO1A 3P27A 1DAIA 1DAHA 1L8QA 4M1YA 5TARA 3CRW1 3ZVLA 4BRUA 2XB2A 3MWKA 1DG3A 1W5TA 4Q1FA 3WRXC 4DLRA 4F91B 2GKSA 3E1SA 5F2EA 2YC2C 2H16A 3LRPA 4GP6A 5CDFE 1XEWX 3VR6A 4A0GA 2IS4A 5JWHA 1PLLA 2IYZA 2OAQ1 2EU8A 2HT6A 3G82C 5IF9A 2O8BA 3C15C 4Z51A 1TMKA 3CPEA 1PUIA 2FPKA 5TMPA 2RGAA 4OK5A 2QQEA 3KQHA 2N42A 3L2OB 2DFLA 1KY3A 1MO6A 2RHDA 3NXSA 4QKQA 4C2TA 3THWB 1US8A 1G6OA 2A7QA 3AB3A 5EZ6B 3P4XA 1LFDB 5P21A 2F1HA 1JB1A 4IKEA 5JEDA 5EE1A 3ZGXA 3RABA 2VSFA 1EXMA 2JJ8A 3FHTA 4P0TA 1TADA 2WMOB 3K70D 1FL9A 2X77A 2D3WA 2G83A 4PC2A 2Q21A 2WBLC 5BWMA 1KZGB 1LF5A 4Q03A 4Q5IA 2WTUA 3CKLA 3IQXA 2ZUCA 3VR4A 5L3VA 4B74A 2HF8A 3K9HA 3OF5A 2C95A 5CIQA 3F0TA 4C30A 3T1TA 2CCKA 1FUKA 4QHYA 3QVVA 6Q21A 1HA3A 2OEPA 4DZZA 2XTNA 3B78A 4TL6A 2BM1A 2ZITA 3BJIC 5DE3A 2EWWA 1JAHA 3DOFA 4LZZA 1HYQA 5BN3A 3SFZA 3TK1A 1E0KA 4A36A 4K8OA 1WA5A 2H7VA 1AZSC 4KSBA 3THYB 4LBVA 1B0UA 1G3IA 1RJ9B 1IHUA 4LHVA 5BN5A 3TQCA 2QP9X 4IFBA 3RRZA 1G7RA 4BWYA 1IN6A 4QBIA 5FOTA 3TMKA 1CP2A 2UZIR 4UJ3A 1ZAKA 3AF2A 4EPVA 1PUJA 3KZ1E 4Q9KA 2ZRCA 1TQ2A 2DY1A 1KAGA 3QXJA 1FOEB 3FVQA 4M1TA 3LQRA 1UM8A 4C0JA 2ZIAA 5B64A 4AKGA 1E2MA 2RGEA 5L3QA 3CZPA 3MMPA 2IA5A 4OQMA 1ZW6A 2QROA 2ZM5A 4QOSA 1YZTA 1UJ2A 2J0UA 1AKYA 1NN0A 2C77A 4IOLA 1SHZA 2O0JA 4HAWA 2Q9CA 2ZE5A 3GFPA 1XTKA 3PG5A 4B3CA 2EQBA 4FXPA 1ONBA 2ORIA 1G3MA 2QPTA 2BOVA 4U00A 3QXCA 2O8DA 3GJ4A 2BMEA 3F3YA 3QY0A 1NKTA 3BGWA 3LBIA 1R4AA 5GJBA 1WRBA 1YU9A 1QHNA 1G7CA 2PMDA 2W0MA 4LHZA 4MKIA 3ZLJA 4M9SA 1R8QA 1KI6B 2FEOA 2FGKA 4TMZA 5AJXA 1KNXA 3KQKA 4ESVA 3R9XA 2HJGA 4TYWA 4B73A 4D0GA 4IDPA 4BFVA 1NN3A 1PLJA 1XWIA 5LD2B 2BKUA 3Q5DA 3X1WA 4KFTA 5FOXA 4MRRA 3ADCA 4YMVA 4A2WA 1VYTA 3U5ZB 1IXZA 4KFSA 4LYHA 3TJZA 1FFHA 3LW7A 2RMKA 3LFUA 1DS6A 3K1JA 2EFCB 1KY2A 1R5NA 2CDNA 1XXHA 4JZKA 3LA6A 2VTKA 4OI2A 3R8CA 1P2SA 2VP5A 3T61A 3ZZUA 4BLTA 2IWHA 4F93B 5LBIA 4OYHA 2VHQA 1YKSA 4LJ4A 2NIPA 2W2XA 4PQRA 2QGZA 1ZM3A 2NZ8A 4P33A 3F5FA 4G5RA 4PC6A 1U90A 3L8ZA 3QKRB 5CM8B 4JBYA 2IYTA 1XPRA 4PAMA 1FX0A 1YZLA 3B9PA 4RD1A 3R7WA 2BM0A 2ZJOA 1KYIA 1TNDA 3IGFA 4IVQA 4JSTA 3CX6A 4Q1DA 4XWAA 4P4TA 1DO2A 1XMVA 1HEIA 1EFRD 1NL3A 3HU2A 3D3QA 3H86A 4URUR 4DHEA 4DB4A 1W0KD 2HF9A 4GMXA 1FTNA 3CX8A 4LDJA 3K70C 4MDFA 2ZUDA 2C9CA 1CR1A 4TLBA 2A5YB 2VIIA 4IXNA 2F55A 5L8VA 4C0KA 2FX3A 3BC1A 2O8BB 4LV6A 5CLQA 2D7DA 2EVWX 2GTPA 3BWDD 1W48A 1FP7A 2RHMA 3BH6A 2X2FA 4PQYA 5FUWA 2JAQA 1US8B 2ZSFA 1ZU5A 5BYJA 1KI3A 1Z2CA 1SVLA 3JVVA 3ASYA 2DB3A 4Q1BA 2BC9A 2BHRA 4W9MC 1NVXQ 1Y3AA 5HE9A 1D8TA 5TY0A 5LPNA 1OB5A 1EFRA 1JBKA 3AVWA 2HCJB 3HYTA 2DCUA 3T1VA 1F2UA 4JKYA 3BIFA 1W0KA 2GWHA 1N0VC 2F7SA 1NG9A 1NMXA 4B2LA 2VP4A 2OZEA 3EX7C 3PJRA 2B21A 3UXMA 3AVQA 4ZKEA 1Z2AA 4JT2A 2F9LA 3HPQA 3CH4B 3LY5A 2GAAA 2IEYA 4UXHA 1OH5A 1T3LA 4D4JA 4Q7JB 3K09C 2JJ1D 5DLQC 3EPKA 2GZHA 3ICQB 1W36C 2QAJA 4EQ6A 1U94A 1I4DD 1Z83A 4YONB 1CRQA 1EFTA 1GP2A 2NO0A 3M1IA 1RYHA 3E5HA 4Z8YA 2D62A 2HYDA 4HLUC 4TL7A 2HV8A 3H2YA 3IHWA 3O8CA 2ZU0C 1KGDA 2GVDC 1G17A 1GL9B 2BMFA 2XEXA 1NKSA 3K70B 1W44A 3WXMA 1QHYA 1H8ED 1OPXA 2UZ3A 4TMVA 3PUVA 4TL8A 1UADA 4D25A 1DADA 1SVOA 1HQCA 1N5IA 4BFXA 2IYYA 3HP1A 2WOJA 4QM7A 3SJBA 5L3QB 2CJWA 5EP2A 4Q66C 4ZIRA 1P6XA 1WE2A 1DOAA 1VIAA 3K0CC 4PHTA 1G20E 4TYPA 3B82A 2J0UB 2GBLC 2JJ1A 3V9PA 4BEJA 1CJMA 2R6GA 4F92B 3BRWD 3KXKA 2BBTA 2ZI7A 5E7IA 2PLRA 4B76A 2QI9C 4AKIA 2JEOA 1NRJB 1RVDA 1CR0A 4G5OA 4GPTA 3TRFA 5DISB 5FOWA 4ZPXA 1N3BA 2ZRHA 2AD5A 4IXMA 2ZYTX 3I8XA 1H8EA 3GEIA 3QKSA 5DHAA 2OBMA 2GCNA 3WNBA 5HZHA 1JALA 2OILA 3GLGA 3M4YA 2CK3D 4YXWD 1E2PA 3R9IA 2XZPA 1U9IA 1M7GA 2XGJA 2IUSA 4EFNA 3NHBA 2AX4A 4MYHA 4W5JA 3MAAC 5B30A 3CZQA 4DIDA 4OQLA 2A78A 4BE7B 1AZTA 5B57C 4BLPA 1JR3D 1OFUX 4Q00A 4RJLA 4A82A 1NMYA 4X8OA 1XXHB 4JBXA 5FBVB 1WCV1 3LDAA 4BZQA 2FF7A 1Z6AA 5JS8A 2YKGA 4NBSA 2GHIA 2PX3A 1S3SA 4B47A 4DJTA 3GLIE 4DC9A 1DO0A 3DMDA 1UF9A 4EPWA 1GRNA 2WWIA 3RC8A 1FX0B 3BE4A 2XJ9A 3MCAA 3R7WB 5DYGA 5EE9A 4OBEA 2WWGA 4PHHA 2YYZA 1HURA 1XDBA 1OH8A 1RRGA 1G7TA 2ZRLA 1QG4A 2CK3A 2Z83A 1N0UA 5A4JA 1J90A 2QL6A 1OXSC 5G3YA 1JXOA 2ZSAA 3HWSA 4LV5B 4QBGB 2CL7X 4A1FA 1CIPA 1U99A 1JPNA 1QRAA 2QQ0A 3QEOA 4AKEA 1GRQA 1JR3A 4X8LA 3CR8A 2FFBA 2HYIC 3AQ4A 4DUGD 1KJYA 1UEIA 4HDQB 4UNRA 4LGMA 5JFGA 4RD0A 3LXRA 2OLKA 2JGNA 1W2HA 3EW9A 5J47A 1IM2A 2Q3HA 3CUEF 2K5UA 4LHXA 4M0LA 4BRWA 4B44A 1VYVA 4FW9A 1YVDA 1ZM7A 3RAPR 4DCVA 1D2MA 1Q1QA 4PPNA 2C78A 2NO6A 2GDJA 2IHBA 4LJYA 2J0VA 3U3MA 4BECA 1ZD8A 3E2IA 4BFZA 3HR8A 1U8ZA 4OL0A 1Z0JA 1SKYB 3EZFA 1Q1BA 5TVKA 4K81B 4OJKA 1LTQA 2X2EA 2P6NA 2H57A 2OHFA 3FWYA 3UANA 4QFMA 4EPYA 2ODBA 2R65A 3W6OA 1XTJA 3RS0A 4BUJA 5CB6A 1F2UB 1TAGA 4Y0AA 4NKRA 3A1TA 3P20A 1KAOA 1MV5A 1W47A 3FE2A 4OJQA 2FH5B 4HLCA 1NVVQ 2A9KA 1Z5ZA 3OIVA 3ZZ0A 3B8HA 4R2HA 4DUGA 4PTLA 3NIBA 1YR6A 2FSHA 3VKHA 2C99A 1YZQA 1HE1C 1J7KA 4LRWA 2DHRA 1JJVA 4EQ6B 4GT1A 4CGZA 1D9ZA 1F2TA 3KXIA 1W4RA 3LNCA 1KTVA 5SZHB 5DH9A 2KJQA 1XZQA 2PZGA 5FL7D 2RCNA 1NJFA 1W1WA 4YDSA 4B43A 4QJ3A 2J1LA 4US2R 4V0LA 5DNYB 3KB2A 3X1XA 3I4LA 3U3JA 1H8HD 5EP4A 1X6VA 3X2SA 1E1RD 1NSTA 3CPJB 4XVRA 2VQSA 1XJCA 1E9CA 4HATA 1RYFA 2ZSEA 3ASZA 1RRFA 1TF2A 2ZR9A 2WJGA 4GOJA 2OUKA 4KI0A 3IO5A 4MH0R 3SFVA 2A5GA 1WBBA 1ZCBA 2CJWB 3NC1C 2W58A 4IEIA 1R0YA 2EFGA 3NH9A 4ARZA 4AKHA 4PR0A 3L0IB 4LCBA 4ZIRB 5C1BA 4HAVA 3GCGA 2DBYA 3A37A 3EAQA 3HJNA 5GJCA 1ZMXA 1DAFA 4WOPA 2MMCA 4DIEA 2LWIA 3AVXA 3PEYA 1LS1A 2P2LA 2ZYVX 4M9ZA 1FUUA 1ZM4A 3AVOA 4B3BA 1DAKA 4MDEA 1FNMA 4KVGA 4M9QA 1ZCAA 1D2NA 2G1JA 2JLVA 5KPJA 1QHSA 1NF3A 2OCAA 3AP1A 2LCFA 4AI6A 2V9PA 3NEJA 4V0NA 1H8HA 2ZI5A 3ZH9B 1OV4A 4B6EA 1E1RA 2ZETA 5JI2E 1T4GA 2CCGA 3QKSB 1OFTA 4M22A 2J46A 4TTQA 1KSJA 3GLGB 5CLLA 5EE5B 3SYKA 5C18A 3FKSD 1CU1A 2B7CA 5KDDA 2PX0A 1FQJA 2OAP1 1MO4A 2VYFA 3IQWA 3QJYA 2PLFA 1QF9A 2GRJA 3QXHA 4LY6A 5K8IA 3SU8A 1G7SA 4UQOA 4C0AC 2OESA 121PA 4AYWA 2QNRA 2ERXA 3A1UA 3M6AA 1ODFA 2ZE6A 3CNNA 2P6UA 3QQ5A 4LC0A 4OHZA 3U60B 2VA8A 2V3CC 3IBGA 3K53A 3D31A 2IF0A 4B33A 2ZEJA 3PXGA 4JLJA 4FMDF 1UBGA 1EFCA 1IBRA 4KHZA 2HXYA 3GJ0A 2ZI3A 3KFVA 3KKQA 1EGAA 3WP0A 2JLXA 3B1YA 2ZQ5A 4D81A 5KPDA 2V1UA 5JCPA 2GESA 4G5SA 5G40A 2W2VA 1J8MF 2BMDA 4IDNA 4R9UC 4WXPA 2IYSA 4PSVA 1IN8A 2Q0HA 2QMHA 2JATA 3FKSA 1VHTA 2BJWA 2F9MA 1VG0B 1AQYA 2SHKA 2YWGA 4HUQA 2AKAB 4C0SA 4M1MA 5DGXA 2YOHA 1JEDA 1OXVA 1E9BA 1P4SA 1U0HC 1KK1A 3CB4A 1SVKA 4OQNA 4RZXA 2CMKA 1NY5A 4JL5A 5FR2A 1T5LA 4BFSA 3DEFA 4RFVA 1GKIA 2BBOA 3RVBA 2QA5A 1S4QA 2FU5C 2VHJA 4TWZA 2ZPTX 1JPJA 4L5BA 1NIPA 4DB2A 4E22A 1HT2E 4CEJB 4Q1AA 3KKNA 4BFTA 1Z0DA 4GOKA 2QAGC 4PHGA 4AG6A 1KDRA 4EFMA 2QT0A 2WWFA 4IOMA 4F4JA 2KSQA 3NBZC 1UEJA 3OIYA 4JJZA 4C2UA 1M6NA 1W7AA 2IYLD 1AS3A 1LV7A 2XAUA 5DHFA 5JZVA 3WY9A 4NYMQ 1UKEA 3C16C 5M04A 4YMWA 2Q6TA 4JLAA 3W3ZB 3EIQA 2HLDD 1SZPA 2O0HA 1E9DA 2NG1A 1NLFA 4LJ6A 521PA 3SBEA 3Q85A 2IL1A 3CRMA 3DVLA 3RLFA 5HE8A 3TUIC 2P5TB 2PH1A 3RC3A 2BMJA 5FFMA 4I99A 4AG5A 3DKVA 1SULA 2PBRA 3U44A 1KI8A 2N46A 2ZTSA 2ZS7A 2AD1A 3ZVNA 1II9A 1F2TB 2BDTA 1E69A 3GFOA 1AIPA 2ZSBA 2Z5FA 4UNSA 2KE5A 1YR8A 1KI2A 3ND8A 2C8VA 2QG6A 3LAWA 4LBZA 3SR0A 4CF7A 4KYIB 1KK0A 4O0MA 1NLZA 1RC8A 3BAFA 3JZAA 5AJVB 1EWQA 1XD8A 1EX6A 3CIOA 2DWOA 3MD0A 1NMZA 2ZANA 3H4MA 4PC3A 3WYFA 3ADBA 2D2FA 1E96A 4EKDA 3FFBA 1QZXA 2DPXA 3C7KA 2REBA 2ORWA 1KO7A 1SVIA 1VECA 1GUAA 2EFDB 2HLDA 3ZD7A 2XXAA 3B85A 3GFTA 2WAYA 3BERA 4DDWA 1KSFX 4V0KA 2ZYWX 2YWFA 2IS6A 5F3WB 721PA 2X1VA 4ERNA 4BLRA 4ZCLA 5C4GB 2P5SA 2EFHB 3DZ8A 1RFLA 4XVUA 3C14C 2RGBA 4WA7A 3EWSA 2R44A 4A92A 3QPUA 3U6KA 1RRPA 1G19A 3PVSA 2O8FA 4QL3A 3GMTA 2VHUA 4RCYA 4OQFA 2DFNA 3LX8A 3W90A 2CL0X 4M1KA 3ZYCA 3GLIA 4B2IA 3QF4A 2NPIA 4G5QA 4WAUA 3UPUA 3IIKA 4HLDA 3E70C 3VNVA 2CXXA 5CK4A 3GD7A 3N2IA 1KK3A 4CZ2A 5FUVA 2QORA 4F4IA 2QPAA 3GLHE 2RGCA 2FFAA 4LYFA 3AF4A 1FW6A 2V6IA 2RAPA 3DO6A 3U7HB 3VMFA 1GIAA 3EC1A 5TB5A 4A6XA 1E9EA 1E4YA 1O87A 2CE7A 3K9GA 4M1WA 3ZS8A 4M4SA 3OE7D 2WIAA 2YZ2A 2VBCA 2V55B 3AUYA 1G291 2FGJA 1N6IA 2V54A 2DYKA 4GMDA 2PMKA 3CONA 4B3XA 5K8UA 1DPFA 3B13B 4CEHA 3ZDQA 3DM9B 4JLOA 3Q3JB 2G1KA 2PT7A 5HTKA 3QI2A 4TYYA 2GA8A 1E4VA 1WB9A 1VTKA 1UKZA 4Q48A 4NTZA 3ETLA 1GAJA 1QHGA 2YVUA 3DKPA 2W2TA 1E0JA 2GJ9A 3F8TA 3MWJA 5HZKA 3N70A 3AP2A 3IBYA 3OZXA 4QJ5A 5LD2C 1A82A 1P9RA 2BCGY 3QG5A 4EPXA 1H65A 1U2RA 1NNEA 4HUQB 4PSKA 1OH7A 1AGPA 2ZVPX 1W2GA 3T15A 3GLFE 3I5XA 1GSIA 2ZYUX 2CEAA 2ZI4A 2ZS9A 2QTHA 4MRSA 1DVRA 4LYAA 4IRUB 4B32A 2UVQA 3OE7A 3T06B 5D3MA 3I3SR 1PLKA 3BORA 3GEEA 4QBHA 5BXQC 3L8YA 2QSZA 1HE8B 2RH5A 3LQQA 4RZ3A 2ONKA 2ZR0A 4U02A 1PVOA 4NH0A 4MA4A 1IY2A 3AUXA 1E9FA 3U3OA 1AS2A 1G8PA 4GNKA 3RDPA 2A30A 4LV8B 2VEDA 2KBEA 2REOA 2ECKA 3X1ZA 1I4TD 4A0RA 4M1OA 5CYPA 1KKMA 4RVCA 2C5LA 4NONA 5JBQA 1Z47A 2OSBA 1LF0A 2J9RA 2BKEA 4CT5A 5CYOA 2ODNA 2JCSA 5C2JB 4RFSA 1WBDA 4HB3A 1K5GA 2ZRGA 2FZ4A 3UWKA 3IUYA 4OI0A 3KUDA 4Q1CA 3R8FA 2GXAA 3KTAA 2F43A 1F3OA 4TZ0A 1SXJE 2PL3A 1KMHA 2FOLA 2V1XA 4XWOA 3QSYA 2J0SA 1EESA 3AM1A 3HR7A 3W5IA
chains in the Genus database with same CATH superfamily
1MAWA 4KAJA 1XDSA 1JDNA 1ZI6A 4Y9SA 2C54A 4C4AA 3QBDA 1U8FO 1Y8RA 3W4KA 4WKPA 4DABA 4DR6B 4E1BA 1CG6A 3SXUB 2VSXA 3U13A 3P0JA 2AMVA 2BFCA 4PZYA 3BMQB 1T3HA 3AJRA 1OUMA 2Z2JA 3DEJA 4IHJB 5AWFC 3SJZA 4D8WA 5FOQA 1Q7RA 3RFTA 3V5NA 2R1UA 2C3PA 3SDBA 3SMVA 3AETB 5U4XA 3UKOA 4ZMRA 2XBMA 2B83A 5KTYA 4AZSA 1P45A 2RI6A 3O2SB 1OROA 2OVFA 4CMIA 2ARKA 4UAVA 5K4HA 1NUPA 3H65A 3ZE8A 3SXJA 4DA7A 2NOAA 2MSDB 3S4YA 4HAIA 4LX8A 4YVFA 4GPZA 4KR6A 3LJKA 1ZGJA 4PPQA 3NYQA 1H3FA 3H5IA 2JW5A 1T9HA 3D6TB 2EIHA 1XU4A 2YWCA 2PS3A 2Y0EA 3DLTA 4JA0A 4LI0A 2PV7A 5I9IA 4RTOA 1JF8A 1YE3A 1PS0A 3A6KA 4QQNA 3WMRA 2CMDA 3P2MA 3ZCSA 4L16A 3D2LA 3J81A 3OTQA 3VDRA 1A4RA 1Z73A 4D42A 5ILOA 2OCBA 4A0HA 4GIBA 1VBFA 1E64A 1GQ2A 3K0FA 3FAKA 5T7BA 2JFVA 4CL8A 1LXCA 3EARA 3LYUA 3R2JA 2PLWA 3SJAA 5DN6A 1CDOA 2K87A 3BJEA 1G5TA 2H9AA 4G09A 4J0HA 3M81A 2O8FB 3ZKWA 3LH5A 2HMVA 3HCCA 2Z58A 2AOVA 4LZNA 1C4WA 1ANKA 2DPLA 4G84A 5AKHA 1JAYA 3NHZA 4WADA 1SBYA 3J7TA 2WYIA 4MTCA 5KNCA 1XZFA 3KJGA 4JR0A 5LP6C 4JLPA 4GPIB 1H6CA 2CGEA 1M8GA 2IPXA 2PO5A 3AHJA 3R0IA 2G5PA 4AECA 1QRSA 3DBHA 4MWBA 2WWRA 2JGEA 3MBKA 4BP3A 3ILYA 3KC2A 4J3JA 1YS7A 1W6RA 4WY8A 2P11A 2GPSA 2E4WA 3ZI4A 4B79A 5DBHX 3BT7A 2OV1A 2JI4A 1ODLA 2VNAA 3QV2A 5DK4A 2ZREA 4F4FA 1MT3A 5EJFA 3DQQA 3SX4A 2LR0A 3N6XA 5DGTA 5EIAA 2EERA 3FYCA 4G1FA 5JYBA 1NBHA 2H5LA 4RKYA 2ZB4A 2JCGA 1UMBB 1ISRA 2C2HA 5LJLA 2WIDA 1H05A 2O7RA 4JP2A 4WASA 2MCFA 1DQYA 3NEAA 4ZVPA 3QTLA 2HIMA 3T7SA 2WMNB 3JQ7A 2R85A 3TE6A 1A2KC 2B9EA 1OGJA 3I61A 1P17A 2G07A 4UAGA 4W6ZA 4NMLA 3Q9LA 4TKVA 3L18A 1SRRA 2HUNA 3PRJA 4CDRA 1QDLB 5A5FA 2XLCA 2F4NA 2P9ZA 3K6KA 4QVGA 3U5ZB 1LC0A 2QNIA 3O82A 1NURA 3K0SA 1JHVA 3KPVA 1HM5A 1QIEA 4W7IA 2CLKB 3HB4X 4OHXA 4BFUA 1ZONA 1LW7A 5GAJA 4EY6A 2GEVA 1EPUA 1T1SA 1B93A 2XMGA 2YFYA 3HKBA 4PWYA 3QK7A 5CDTA 1R00A 2OLEA 4MRVA 3LP8A 2AEJA 5A9TA 3VR1A 4NBKA 1J4AA 3HXOA 4FOPA 2Y0PA 4P54A 3IELA 5DYYA 5B1HA 1E0DA 1D04A 1JNYA 4JQCA 5H0IA 3ZUPA 5JAZA 4H3KB 4AAYA 4ITRC 4D4LA 2VZLA 3C3WA 1ZH2A 5AJZA 1H6BA 2JZCA 3CRVA 4FZ3A 1MENA 3HU5A 1I3KA 3GEHA 1TU4A 3GJ7A 4YQZA 4DCTA 4YAUA 1E2HA 2HF2A 3BAZA 4KEAA 2EBWA 1BFUA 1Q57A 1ZUD1 3I0MA 4LYEA 3STXA 1K86A 2GXQA 3LPDA 5HJ7A 4OBWA 4DV4B 9ATCA 3HKCA 2HJRA 4H7IA 3W5HA 2B3TA 4CYMA 3T38A 2YWXA 1VI6A 5EXTA 1NBME 3ACDA 1Y34E 3S1AA 2WJIA 5I8WA 4C43A 2IEIA 2OXCA 1JTVA 4HVCA 4JLNA 1Z08A 1GCUA 3LGSA 4KKVA 5DLPA 5TPWA 1E79A 3O7MA 4RTLA 2XUZA 5KYWB 4KRFA 2QG9A 1E4OA 5JMPA 3ETEA 1SY7A 3B8EA 5AJWA 1IEQA 4XW2A 4HHEA 2PEYA 3L0OA 1ETUA 3HXMA 5KYYB 4QYIA 3CZAA 3KTAB 3L8MA 2Q4OA 4R1OA 4RACA 3FFAA 3FD8A 3GCZA 2IOHA 5LB4A 4UHFA 5MFZA 5JNUA 4RE6A 4NCXA 3P20A 3ISTA 1CT9A 3EASA 1DINA 1T4CA 1IMJA 3KD3A 4QAQA 1HUQA 4Q3BA 2XB6A 2P69A 2HADA 4G5HA 1CJBA 1PI3A 1R5OA 1SELA 2OD7A 2WTMA 3QELA 4U7JA 5A7HA 3VSAA 4PFSA 4BMVA 3KQVA 3MBIA 5EZSA 3T6KA 4EFDA 1ZHOA 3RTCA 3SBOA 1U8XX 1YFZA 1J2JA 2FWRA 2GFQA 3OFSA 1X87A 3F73A 2I6GA 1A27A 4HF7A 1LUAA 4K03A 3K4QA 4XEUA 2O59A 2E4YA 3H84A 4BAUA 1ZSVA 3I0ZA 4PYLA 5K05A 5DHUA 1K9VF 5AOBA 4ZTUB 1ICIA 2Y99A 4YUAA 4EA9A 4LNHA 4I66A 3NMUF 4KO8A 5IX8A 1UBFA 2QIOA 4LOAA 5CDFA 1H2XA 4EJSB 2O5EA 2FUEA 2ECPA 5H3HA 4PPGA 3ZWDA 3HCBA 4P1ZA 4PSAA 4KACA 1K06A 1AQJA 2R6FA 2A92A 4UM9B 2NUBA 3CN9A 5F5NA 2H18A 2FW1A 2C97A 4L2IA 4LSMA 5C7OO 4B3RB 3PGA1 1BU5A 2IE8A 5JATA 5JRZA 1AN0A 5K9ZA 4N76A 3VZBA 1NNUA 2JLCA 4HNVA 2Z6QA 1K4MA 3VR6H 4KQ1A 1CIVA 5M2QA 1VJ0A 4YXWA 2FKNA 1Y8AA 1MD9A 4MQEB 3C74A 2NUPA 3CF0A 4IKOA 4P4GA 5IN4A 4ZVUA 2V0GA 1XEXB 2GOYA 4UPVA 3TRHA 4MR8B 3CCCA 4HQRA 4H59A 4MIEA 1ZDMA 4J2OA 1E2KA 1SIOA 3WYCA 4U2EA 2B9VA 2VAPA 1K66A 1KARA 5EL0A 4U6SA 4KFUA 4YO7A 3FUXA 5IXJA 1JWAB 2EL9A 2OK8A 5JAPA 1Q12A 2EF1A 4I9UA 4UPDA 3I62A 5DBOA 1PGJA 1TAHA 1XP8A 3NW9A 4FWTA 3VU8A 1UIRA 4DKXA 3U9LA 4PZUA 4A0SA 3U26A 4Q34A 1J99A 2WU0A 3FBGA 5EMKA 1YQDA 4YRLA 5EP3A 3U4GA 5TC4A 2JLUA 1Z4LA 2FMXA 4GRDA 4UEQA 4Q9JA 4F7WA 1ZIDA 5DULA 3CB2A 5FDFA 4DC1A 5B7NA 3NDIA 1Y8QB 1EA5A 1WMDA 4B6FA 5FH9A 4WH0A 3SNKA 3M4ZA 1P77A 1XJ0A 2DJIA 2RCYA 3BD9A 5H9VA 1JG1A 2QZJA 1IAQA 3GRAA 1R6UA 2D54A 5JVDA 1MZVA 4U1RA 3MXOA 5AM0A 1SHUX 2XBUA 1CR6A 4GKKB 1Z75A 4YO8A 3FYTA 2I1VB 3DCIA 2A5DA 1HFJA 4ZJPA 5AKEA 4HWOA 4DV1B 1MJHA 4Q6WA 4AVYA 1NJGA 4QPNA 3T5AA 2FZVA 5ALSA 3N1UA 3N2KA 4WUVA 4BY9E 3KBOA 3T5DA 1YQ9A 4WFQA 3VXKA 2AUNA 3T3OA 3THRA 3AM4A 3PQEA 3PUIA 3VPSA 3WKAA 1IXYA 1G64A 3AVPA 3KJHA 1J1ZA 1RPTA 1T5OA 3OFJA 3OFND 2HN9A 3PZRA 5COQA 1U9IC 4MRMB 5CITA 3L43A 3T4UA 4XM0A 5DCUA 3DT8A 1VRCA 1GPBA 1QHIA 2OCDA 2BV3A 1V11A 2VC2B 2ZAGA 1JRLA 3EDQA 3ICWA 3H19A 3L0DA 4P93A 5JU6A 1P0CA 2JGDA 2GEFA 1R8XA 1M2OB 4AJNA 1TQ4A 4AMYA 3UKDA 1U7DA 2P75A 1CQWA 2VQDA 4QUBA 2D00A 3D6VA 4JL6A 2XMZA 3E15A 3EPHA 2CNOA 4I55B 3DMHA 1SC3A 2CF5A 3RFFA 1WUHS 3O8RA 5I9LA 2PZKA 2FFRA 1GG2A 1SXJA 4QG7A 3KQLA 1SCKA 2HUPA 5CLHA 2R79A 4FUQA 4LJ7A 4L02A 4PAQA 1AXEA 1RYNA 3PXCX 2FETA 2VRCD 3GBVA 4CLEA 2XNDA 1Z5UA 3JQDA 1ZXXA 1NVAA 2NGRA 4TQUS 5AK0A 1O0CA 2BFBB 3BDIA 1BC5A 1QFZA 4URFA 4URZR 4A8PA 4F38A 2B8WA 3OT5A 1F48A 4QPJC 1KYZA 1MV8A 3NATA 3ERCA 3A3OA 4MGZR 2PSDA 2VUTA 4QVIA 3CS3A 4EUKA 5HJ2A 1Q7GA 3KB1A 3MTBA 4ZQGA 3SIXA 2HV9A 1HI9A 4JSYA 5CJ2A 2Z4RA 4P7KA 3X1YA 1K3FA 1J33A 1TQ6A 1UAGA 3GROA 4JAVC 1QZUA 4PQGA 4BMSA 1EHIA 3P32A 4RKEA 1OLOA 3WMXA 3DL0A 4HNRA 4Q7MB 3UV6A 2HSWA 5IBCA 4BNTA 1OHHA 2FVYA 2ZBUA 1Q20A 2EV9A 2PTHA 4GR9A 4O25A 4OQDA 1L5OA 1RRKA 3E27A 2X4GA 2GBFA 2O3TA 5FBLB 4YREA 3HSYA 5EE3A 4UBIA 3VR5A 2ZP1A 4GEKA 2PD3A 1PN3A 2JHFA 4MWSA 3CR7A 5KMGA 3N9IA 1N7JA 5C1PA 2VCYA 4IBOA 4ZT2A 4WVFA 4MLZA 4MVJA 4NESA 4R2MA 4ALKA 3NEYA 4LDZA 4QTTB 3MIIA 2C04A 4ZP1A 3B2EA 5F9FA 1YQTA 2PCLA 2H2AA 4JP3A 4OH1A 4RDCA 3ETDA 3KT3A 3EXAA 3JD0A 5TQVA 2RGWA 2E4XA 3SD7A 3KKPA 1WMSA 2GPAA 5KJ6A 1EUQA 4URWR 4U5QA 4Y2GA 4L9SA 3H8VA 5SZIA 3R7AA 3ZV6A 4DRZA 2N9UA 3I32A 3C41J 4DLTA 1XBTA 5IZCA 1Z8HA 3P8ZA 1IRIA 1ZBDA 1ZITA 2HB6A 3NFRA 1PJCA 1UBLS 1DIRA 3D5TA 1IPHA 2CMHA 3JVEA 3AUAA 4IJVA 4MUBA 3AJ8A 3FUVA 3LBFA 5A4FS 3BWEA 3IP6A 3JQBC 4BPBA 4ND8B 4MQFB 3SVZA 1QP7A 3HMQA 2R96A 5FBQB 1EEHA 2QY9A 1MFZA 1P9WA 1T0IA 2FOXA 2L42A 2ZLBA 3AJDA 4HDAA 2XITA 3R3HA 3KM0A 5IVPA 1YOVB 3P4UA 4NF2A 1SBTA 5BV8A 3A0UA 2I6TA 3AV0B 4F4CA 1W25A 3M6UA 1Y7IA 2QJWA 2IHTA 2XE6A 3UWSA 1IUNA 2ZYDA 5CVEA 2JVIA 2PMFA 3H5VA 1KGSA 4X1OA 5DGIA 3W1WA 3WYAA 2IIBA 4IIUA 5ES3A 2H1WA 2X6RA 2EX4A 1R5BA 5CLIA 5BW5A 1TM5E 1UFKA 2C3UA 3JALB 4LIPD 3AUTA 4FMCF 3SCZA 4ZYZA 2MDTA 2D6FA 1K98A 1IY1A 2C9MA 2ONCA 2VHTA 3VR3A 4E4YA 5KWEA 1YZGA 2WHRA 3ZE7A 4D4KA 1E3TA 2W5UA 1EB8A 4D9JA 4WFIA 4KNYA 4JMPA 3OPYA 3WA7A 2E6UX 4LDNA 3PC8C 4JU9A 4Z9FA 5ER6A 2F3TA 4KWTA 4YYEA 3Q10A 4I5GA 4MIOA 4P3PA 4C4TA 4E5UA 5EIEA 5HVNA 3UG7A 3UJAA 3A04A 3O38A 1IY8A 2OGUA 1Z6GA 1ML4A 2K7ZA 4UMEA 4X94A 5TMBA 3NBXX 4OI1A 1HOTA 1C0EA 4XSGA 4R9VA 2FPXA 1PG0A 5J1TB 1XA3A 1BHO1 5FI0B 2PZFA 4YFVA 1FS4A 3FGPA 4GI1A 2VHEA 2RGXA 1IQPA 4PLGA 3DO5A 3I3OA 3KT8A 4MMXB 4O3FA 4UU0A 1J0EA 4EGAA 2XVAA 4P53A 3UEOA 5CEEA 2Q6KA 4RCZA 2YV1A 2R48A 4ODIA 1CUEA 1H2EA 1YK1A 1ZKMA 3HA2A 1HO3A 1E63A 2PRSA 4CKEB 1B6SA 1ZD5A 1W1IA 2FZLA 3LXXA 3ZV5A 4KREA 4EFLA 4Q4DA 2Q6VA 4LF7B 1E66A 1GM5A 2ID8A 3RNLA 1WD5A 4I50F 4N5NA 2ZJYA 1JVBA 1UPAA 1QVRA 1SQ5A 4DMHA 1CPYA 4MV1A 3LPNA 1KEEA 2F62A 4MICA 4LSGA 3GPIA 1TZJA 5FPSA 1PZFA 1CP3A 1T29A 3FPGA 1TCVA 2NSDA 2WE7A 5TV2A 4KQXA 2HQ1A 3TN7A 2JK1A 4ZYVA 1AA6A 3AVTA 4ESHA 3A25A 3CTMA 2I33A 4Y1RB 1ZJ6A 3VDNB 4L0QA 4AYTA 4UEJA 3RVRA 4DLWA 4N47A 3RT7A 5IAJA 2WFLA 2XSZD 4P22A 1JHAA 2O2DA 2XT9A 3OE1A 1FP2A 1FBNA 4G85A 4UZSA 2VDPB 2ZR7A 4KQMA 5CVDA 5EXPA 1PJQA 4G0QA 4JBNA 1MB3A 2DWQA 4NMWA 4DIFA 3U19A 5I51A 4IH9A 3GW8A 2NVUA 4MQMA 4REMA 4U7DA 4R1SA 4BNNA 2W48A 4Q4JA 3IP9A 3RHTA 1XJ5A 5CA1A 1KQOA 3GJ3A 1IZ9A 1VSTA 1P9LA 3NX4A 1Y42X 4H0CA 3VUEA 1XMXA 4QELA 1QTNA 1N9KA 3EGDA 1VE7A 4R9RA 3MD9A 3CA8A 1J20A 4IVNA 2MR6A 3EXHC 1KF0A 1YB6A 4TTVA 4YAOA 1BYIA 2GCEA 3C1UA 5JTUA 1SNYA 3QFCA 4UHKA 4B6RA 1PJ3A 1RJDA 2I6UA 2V4ZA 4CT0A 1E6LA 3WNDA 3RW9A 1YL6A 3T4EA 4DAEA 4HWPA 3BMXA 2V4MA 3LBHA 2XRFA 5SV2A 4Z54A 4FR2A 4I3GA 3OQIB 1U7UA 1N1EA 2W2LA 3IALA 1ZP6A 3PC4A 4GLFA 4KNWA 5KX5B 2WJHA 1A2BA 3W5CA 1RXVA 2H1RA 5HIJA 3AF0A 3N6VA 3TBFA 3E35A 4OHRA 1E62A 4QEDA 1K2VN 4RWZA 5EIHA 3U4CA 1XLVA 2QBYB 3IJPA 3VNUA 1FDWA 3H16A 4OMCA 2Z8XA 2FDRA 2VP3A 4NYMR 4N3GA 3K9LA 5GM2A 4HJRA 4CU5A 3NBKA 3FDZA 1QZTA 4B31A 2P67A 4MPJA 3B3GA 4Q24A 5K8TA 1UDWA 3ZGOA 3AJEA 5L45A 3R9WA 4KN5A 1PKXA 3LMKA 1QJCA 3D2CA 4ZVLA 2ENWA 4D2IA 2EKZA 2QN6A 1VPVA 4F6LA 3I39X 1KIMA 4OB7A 1LPSA 5TXGA 2FZGA 4B7UA 2ZAOA 3I1YA 3CGWA 3L0PA 1FXWF 3UT5A 2WT9A 3G5AA 4PZ9A 4NV3A 4XDHA 2QW1A 5BV1A 2GBIA 1V2GA 1ODCA 3UHFA 5EJ6A 1HORA 4DDVA 5F98A 3I45A 4RF4A 4BJ3A 1CIJA 4ND3A 1Q19A 2Z4TA 1RZ3A 4B6GA 1ZVJA 2F1JA 2HR1A 1PL7A 1W0JD 4BMZA 5JNTA 1GZUA 3OFVA 1NXVA 1ISIA 1P1KA 1FNSA 1CXZA 2FR1A 3ZW9A 3T7TA 3OZTA 3MILA 1UDAA 1C7FA 1YBHA 1J00A 3ILHA 1YUBA 4QUEA 3B48A 5M34A 1YV9A 1GZHB 2PZJA 2R66A 3CH5A 1DRKA 2A5LA 3PSAA 2G67A 2OQ2A 2OXFA 2HTFA 4L5JA 4OFBA 4ZO4A 2P65A 4OHPA 2AOUB 4H7FA 4GUAA 3S29A 4PLVA 4M0PA 4GKAA 5JD3A 1KNQA 1S2GA 4J0GA 4RMHA 2F9FA 2IHZA 4D3DA 1EWRA 1QHHB 2XZDA 1E3IA 3EQ6A 3KALA 5FO1A 5LBTA 4KQ9A 3NM5A 2J59A 3RHSA 2GPJA 2CZCA 1CERA 1GKYA 2EG5A 2GN1A 1YB7A 2VDLB 2WNHA 3KYCB 4FNGA 3RYTC 3TUJC 1WF3A 1XZKA 3AKDA 5ECYA 4EB3A 2C7GA 3WL4A 3UNXA 4ALLA 1GPYA 4L73A 2RG1A 1MRSA 4Z1OA 5JDIC 1B6RA 1JEAA 2WSBA 4QBKA 2OCPA 4U5XA 2PA0A 3A70A 3LHFA 3GX1A 4II7A 5FYDA 3DOEA 5A04A 1AGYA 1QIHA 3UWDA 2EXXA 1HQYE 3ZWPA 3BTOA 5DLYA 2OA0A 2QPOA 1JP7A 2G9QA 4JB8A 3SY8A 4CLRA 4WXRA 4GKVA 1DC6A 2X5NA 3OMWA 1I1NA 1UIMA 3G85A 3LDHA 3FOZA 1FA9A 2UUAB 2AKYA 1ABEA 4Y6GB 4Z53A 3Q72A 3VOTA 2WVJA 1U5CA 2Q8NA 2FWMX 5EUMA 1XMIA 1E7YA 3PUWA 2QYTA 1JHUA 2PX2A 3AEYA 2R7LA 4QARA 4YRTA 1X77A 2AC2A 3G5TA 4PBRA 1J2UA 3QI7A 2OO3A 1BA3A 3G0GA 1QMGA 4JB0A 1N0WA 3C3CA 4M54A 2Q2QA 3T4PA 4EY4A 3DZCA 3UMMA 2CLIB 1DIHA 3PNVA 4HGQA 2PX8A 4NAVA 4OAOA 3L7CA 4O8ZA 4MOWA 1PX2A 3KHUA 3MT9A 3N8DA 3NHAA 2PU5A 4XIGS 1WUTA 1X8JA 3Q7PA 5KNDD 1XZLA 1WB4A 4IZHA 1CJVC 4PC1A 5FBRB 4YJHB 4CG2A 1QS0A 1FNBA 1ZU4A 2X40A 3E3NA 1ONPA 3QVOA 4YLEA 4M37A 1WB5A 2QUHA 5HF8A 4KAFA 1EBBA 1TM4E 2XW6A 3ZLTA 4M53A 2QTBA 3EG9A 4ZFNA 3TLBA 2VF8A 3C4VA 4M6WA 4R6XA 4MGIR 1BNCA 4R16A 4N0DA 4D79A 3HJHA 3RYHB 2FRVA 5B1SA 1T4DA 4EUSA 2CBZA 2F1IA 4BDTA 1TKBA 2OSVA 2O06A 1WU8A 2QTGA 5JH7F 3PEWA 1Y48E 1NE7A 1KZ9A 1QLJA 1K3TA 3MJRA 4NCJA 1KSHA 4FVTA 4JS0A 2RSLA 4IV0A 3S2YA 3X1DA 4G26A 3ZWOA 4BBPA 5SY4A 2CLCX 1X8XA 4ND2A 3JQGB 1PSDA 1BS1A 4U2DA 3ZCPA 1GAXA 3JTMA 3CLSD 1OGYA 3DMNA 4Q47A 3VOBA 1E5QA 1GNPA 2V8OA 4RY0A 3TJRA 3TR6A 1FMJA 1HBJA 1YR7A 4I4CA 3ZIAD 4RADA 4JXXA 5FI5A 4CV1A 2VQ6A 5H83A 1FJHA 3GI1A 5CXUA 1Z0AA 2O1XA 3EIHA 3QVGA 5EG5A 1FP4A 4E5NA 1NR5A 1QH9A 3DE0X 3JARB 3CF2A 3K6JA 4Q1VA 4BBAA 5IJ9A 1NE2A 1Y4AE 2DR3A 3I76A 1G5PA 4KX5A 1DT3A 3BXZA 2BFMA 3M89A 2ZE8A 4BEWA 2D7CA 3R09A 2VHXA 3TSZA 1OWNA 1I7PA 4IEFB 4FWIB 4XUGB 3LIIA 2AXPA 5KSYA 1A5AB 1V43A 3H6KA 4GUDA 4PHFA 2NZXA 4N1AA 1A7AA 4FGSA 3I04A 1RCUA 3ICCA 1WX1A 3AX6A 2PFKA 4LVUA 2A88A 2YHIB 3U49A 1C80A 2ACVA 1OTXA 3EJ6A 3ZDXB 4B8ZA 3TTWA 1DKQA 5EJMA 2Y66A 2G5TA 1F8GA 1K88A 1FYFA 1VHLA 4NV1A 5EJEA 2CY0A 5EESA 4G37A 4PFJA 4AO6A 2PM8A 2NVOA 3LZDA 3KDAA 2AFHE 1RMQA 5K3OA 1A71A 2PBFA 4MEAA 4TZTA 3OLVA 3B9RA 2V7QA 4FP9A 5AKIA 3PFFA 1JE1A 3SN6A 3EZ9A 1ZNYA 4S0XA 4WACA 3TW4A 1JHPA 2YWEA 4LJRA 3GGCA 3EGIA 5EXEA 4NCNA 1E1QA 4UEOA 2BT4A 5DBFA 3GJ5A 4BLQA 2BEVA 2W4QA 2WF9A 1MC5A 4FCVA 1BFDA 2VJQA 4B4WA 5IAAA 3WL7A 3OAAD 5JSFA 5IKPA 2X1LA 3O26A 3ZCUA 2F8MA 2B3DA 5BVGA 3LVRE 1AKWA 1MABA 1QK3A 2C1XA 5LOVF 2Q9BA 4HNGA 5EWMB 5TJHA 2X14A 2V0NA 5A7GA 1ZKDA 3LF2A 4HDKA 4BEVA 2ES4A 1F1JA 1YZUA 4JLDA 1TEXA 2GM5A 1B73A 3ETHA 5ILQA 5L6LB 3H2ZA 5FBKA 4E1VA 3RSFA 3WK5A 1G8FA 3QW4B 1AQNA 2JBAB 3JVUA 2FHPA 4NFSA 1QFSA 3EEIA 4EB6B 4URXR 2PIDA 3TQOA 3F3SA 4LCEA 5HEKA 3TBKA 4IP0A 1EEXB 1O94A 4HDCA 2MYNA 2L19A 4R2KA 5JAIA 4TL9A 3NYRA 3AU9A 2QR3A 3IAUA 2E48A 4YDHB 3ZNOA 4ESOA 1SXPA 1PJ4A 2AW3A 3T3DA 5BMVB 1NKVA 4PE5B 1A9OA 4WZAE 4ZQBA 3HY4A 1ZOPA 1Y89A 2WEKA 3RUAA 2EGGA 4PYIA 1SO8A 3MEQA 2VJKA 4MP3A 1TTTA 1YXMA 3BD8A 2GZAA 1TJ3A 4DM7A 4URVR 4L3VA 4GOND 3WQHA 4AXXA 1F9EA 1C0KA 1ESNA 2BFFA 3AOGA 3HBJA 5DHRA 5EWLA 1D6SA 2VL7A 5BV2P 5BN4B 2RG7A 3MCUA 4KGXA 2ODPA 4EA6A 3HBLA 1U0JA 4TSRA 1R0KA 1EXNA 2REQA 3KOMA 3O5AA 2G4LA 2IHYA 5AXDA 3WA6A 5H4HA 3CVVA 1YL5A 3M1YA 5A5VA 3ER8A 1B42A 4NL4H 5FKJA 1R4MA 3HI6A 3TEJA 2O3JA 3KL4A 4A8JC 1NRIA 4QXAA 1DX9A 3NTLA 2ZT8A 1U1GA 3NBYC 4LDPA 4J16A 1ONOA 4M9UA 2ZUTA 3I30X 4RIIA 1Z4JA 1UWLA 2W6QA 4MX8A 2BH2A 1F2DA 1YACA 3EMDA 5CAEB 1CWUA 1DKPA 1RHQA 1ZZEA 4JR1A 1GG5A 3KXLA 1BCSA 3F5MA 2XQKA 5B2FA 3OX1A 1BTOA 9LDBA 1VI5A 1E8DA 4I4LA 2X58A 3M82A 1ZM9A 4EECA 1J49A 5JS1A 1CJSA 1EFKA 1P3JA 2Q3FA 2YC4C 2Z08A 3FCXA 2KLBA 3H5OA 3LTEA 4E4TA 3AF6A 2IU0A 1NVUQ 5P8WA 4Y2YA 3RSLA 4AP9A 2VPPA 4J7CA 1R6AA 3AM3A 1Q1AA 2WKRA 2JLYA 3T9AA 2P35A 3BXFA 1BX3A 1ADBA 1JVSA 1LQTA 3B1ZA 2ATCA 4HMOA 5ENDA 4BB5A 2EHDA 1H3NA 1Y1QA 3UK6A 5AVQA 2C84A 1TMGE 3VC2A 3O31A 5ESXA 1P44A 3NASA 4GU5A 1QIFA 2QB5A 1KRWA 4RTKA 5L3RA 5TPZD 3WDMA 5AW5A 3A14A 4OUDA 3QVSA 4NCHA 3TW6A 1XEWY 2UXCB 4KFRA 1OBVA 3AY7A 1QB8A 1CUDA 2AX3A 3TLMA 2P3QA 2PU7A 3K9WA 2GUWA 2I6SA 1NW6A 1Q3HA 2PWAA 3DDCA 5GONB 5IAKA 5TS2A 4D02A 3QBEA 5ENVA 5CCBA 2A3NA 2H1OA 4YV2A 5FWNA 2VNHA 4NNJA 1W88A 3OX4A 4KV9A 4EWLA 2D13A 1VKHA 3PQ2A 2H7YA 1A3CA 4ABYA 3ILSA 1ZIPA 5CM2Z 2FW7A 1U0GA 5EP1A 2C2KA 5A0FA 5LZ5A 2QP4A 1D2CA 3C1AA 4MI1A 2AOXA 4ZVQA 1Q0ZA 2CL6X 3KTDA 4MZDA 4OQXA 1WCIB 2H8KA 2AHOA 1E1KA 4GR4A 3TSCA 4KB5A 1FFWA 4TYMA 4EUHA 1YDFA 2YVKA 4XVHA 2J67A 3B5JA 3QKTA 4J9UE 3IAEA 4JYPA 5T6MA 5LP1A 4RV4A 4HFJA 4F3TA 1KO8A 5AKGA 1GPWB 3W06A 2X0DA 1CQXA 3IILA 3LOPA 2B35A 1H5QA 1E7MA 2W43A 4RQTA 2QZSA 4AJ4A 4M99A 5CD1A 5TNXA 1JXMA 1QLWA 3QE4A 5KKCA 2PNFA 5KNBA 1YRYE 2DY0A 1OC4A 2HPVA 3O4GA 2C4VA 3EVGA 3QFRA 1QRUA 2PUCA 1TUBA 4Q9IA 1ZL2A 2PUFA 2Z4SA 3KUXA 2V65A 3QOFA 4OHBA 5J2UF 3K0KA 2FPGB 2EJUA 2J9XB 5ALOA 3CNBA 4G2TA 5DBEX 3SJUA 4QA9A 4NBLA 4AD8A 4WBNB 4S24A 2J4DA 4GAEA 1IONA 1DMSA 1TC2A 2A0FA 5J5AA 2BFEA 1GR0A 1I80A 2COKA 4IO1A 3S7TA 3PCRB 2VWPA 3MUFA 1GQQA 3PENA 1OT3A 2XYGA 4YAEA 3RTDA 2O8CB 4W6QA 5L3SA 4UVHA 1O57A 3U4HA 5K3AA 1SB9A 2UUPA 3AR7A 1H9BA 4ZXFA 2DHQA 4D44A 2PGLA 3O47A 5LNK6 3LDFA 4CG0A 4IWXA 2H54A 3VZSA 4BV3A 4B4VA 1HY3A 1JH9A 3NCHA 4DKJA 1KERA 5LCXA 1CY6A 1Q91A 1HV8A 3OBIA 3LLVA 1T3GA 2JJ2A 4MV8A 1II8B 1JHQA 3ZXYA 2XUIA 3DV0B 5CEJA 1ZIOA 1ZGBA 2YINC 4XLLA 3WRYC 3E7XA 4EGFA 3DM5A 5KAMA 3QVXA 1R0XA 4AZ3A 3B52X 5LIRA 1ZI8A 2AYXA 1M1YB 1NF8A 1SZCA 2CYCA 2YY6A 4LRUA 2VNIA 2RIPA 2C8KA 2FG7C 1DKMA 5B1DA 2VP0A 1N6OA 5HDQA 1CNMA 1HLDA 2AG6A 3LY8A 4E3ZA 1D2RA 3HCWA 2QOEA 3CKKA 4MRNA 3DVQX 4K1LA 4Y2JA 1B15A 1NJ8A 2J3DA 2XYQA 4OO3A 5CVUA 3HBFA 3D59A 1PQYA 2PKRA 4DR5B 3ZWVA 2XH8A 1XTTA 4JUBA 2X0NA 3HA7A 4UHHA 3KT6A 3L4EA 4IM7A 3AWDA 4MUFA 4N0QA 2FSIA 1OXBB 1Y6QA 4L27A 3GEDA 1M2EA 4R54A 3QQPA 4ZMBA 3C7TA 3UWOA 2VT7A 3W6UA 1Z8DA 3O75A 4QYIB 3F3MA 4QQ8A 3HWX1 3K72B 4GI3A 1M5RA 2PUTA 3ONDA 2E5LB 1QVZA 2AVNA 2JS7A 1QV6A 4Q7QA 3FYUB 1N3YA 4X64B 3PDWA 4HI0E 4PN3A 4JI5B 3B3AA 3IXLA 4Y67A 4LXYA 1D9XA 3FHOA 3N2EA 5EZQA 4QXPA 2GH1A 4QUGA 1RHJA 4XIYA 1AHNA 1BKYA 1QUFA 1UMDB 3C8MA 5BR4A 5IH7A 4G1MB 3CF6R 3GHHA 4V38A 3OMLA 4B3GA 3HE3A 5DWQA 1APBA 1XAHA 2H6EA 4DJFC 4G0WA 2F8TA 1T10A 4WLFA 2AG0A 4TQ9A 3ZU6A 2WDZA 1U2ZA 1P31A 2WHPB 2ZWVA 2MSWA 1THMA 3KL2A 5EJGA 3TLAA 1ZPDA 4XGRA 1CB7A 2Z98A 3DPSA 2GJAA 1XTSA 4I4IA 5AM1A 3U3XA 5JSZB 4PGGA 1VKNA 1TZCA 5TEVA 3F8WA 3L4KA 1MQ9A 1YB2A 3LO5A 3PPVA 3KPJA 5FWXA 4IXTA 3TKLA 2ZB8A 3NJ8A 4S12A 4O4HB 4A5OA 2XKJE 2ZJ2A 3GY0A 1BMFD 1XDDA 1PGPA 3NBQA 3E4DA 5HMLA 3RK4A 3NXKA 1KFBB 2IODA 1SQ6A 1XHLA 2YNMC 3WQSB 2Q99A 3N2GB 5CGZA 1OYOA 4ZCRA 2VHZA 2ZYHA 4GI7A 3WWYA 5MN6A 4L2IB 1GTVA 1C1YA 4TV8B 2G40A 3THWA 5AVZA 5JCJD 4JI8B 1ML3A 2R6AA 5FR1A 1KZ1A 3QVMA 4DCSA 1KVRA 4EI7A 2R1VB 5ALJA 3VPAA 3NV7A 4CTKA 2JFZA 1AT1A 1NN5A 1EFDN 1VLVA 1OB2A 4JELA 1PCXA 1VJGA 3L7DA 1R50A 3KZOA 2XOXA 1M75A 4LJAA 1QHXA 5B2EA 4DGSA 5J2TA 1U3TA 4KR2A 3W9SA 4QUAA 4B75A 5JCOC 4E5PA 4IDHA 2I8AA 2LD4A 3HYSA 4QRIA 4GLBA 1YJ8A 1H4SA 2AYYA 1Z7EA 2ZCUA 4HQKA 3RHZA 3QWFA 1SUIA 2QTVB 5LDDC 4EBFA 3A1CA 2DTDA 2UYGA 5LXTF 3IAXA 5DRTA 1U9ZA 1E2IA 3P9SA 3IEXA 4PYKA 5EVCA 1EVLA 2OYSA 5F7JA 3NH6A 4FJ2A 1F5NA 5I9TA 1E1CB 3T5CA 4DDTA 4ZJYA 4Z4EA 5CCDA 3FA2A 3REGA 2Q9UA 2NT3A 4KHPB 2ANCA 1P9NA 4X9XA 4BQNA 4J0KA 8MHTA 5F2KA 1DC7A 4CT4B 4P58A 4NBTA 3KR2A 4R51A 2GEJA 4CMEA 2CB9A 3VR2A 3LX4A 4N6OA 1L4YA 3FUCA 1IPFA 5IYZA 5KTOA 4E03A 3FSGA 3IIEA 3WWZA 1JQJC 4TQAA 3SEZA 1G8GA 1K6MA 3EG5A 1YJQA 2OOSA 3B5EA 4TKZA 1RS0A 1OE0A 3PFWO 1I30A 1DJLA 1IL0A 2QSJA 3AYZB 4KR7A 3DLPX 1D4AA 1TU3A 1U3VA 1XCGB 2PZ8A 3N76A 4MYSA 2HX1A 2PAAA 3EZ2A 1WLYA 5JW6A 1AUXA 3DL2A 3GMIA 4PZLA 3A6LA 1RE1A 1L8AA 1HKHA 2D2EA 3E5MA 3K35A 3PL1A 4N01A 4CM9A 3N5CA 3MGGA 4EKGA 1GZ5A 3QTTA 4DWVA 3WGIA 1LLCA 3G0HA 3LZ6A 4HS4A 2F3QA 3WOHA 3QTBA 4UBJA 4LY3A 5TJ9A 1Q11A 4RTQA 3L84A 3MJHA 4NZ9A 4EKEA 1RQNA 1IHOA 3PNBA 3GRVA 2XKBA 3DKRA 1KOFA 1NXTA 1P2TA 3Q3GE 2F3UA 1ZC3A 1AK2A 2OT3B 3O2JA 5B1YA 1DB3A 3BZBA 3IEUA 2HGZA 4HXYA 1GTRA 4UBLA 3S7ZA 1IZ7A 2HZBA 3TL6A 4C9BA 3K9CA 4C7OB 1TJYA 5H80A 2HBZA 1E5VA 1BN6A 1VHJA 2QHXA 2X8BA 2OFOA 3G8YA 2V6MA 3ZCTA 2DT8A 4LJ5A 5KOHB 4MR9B 3CSUA 4KDRA 3VHLB 5K03A 4I36A 3WK9A 2GNOA 2O52A 3MG9A 4TN1A 5BVHA 4LI3X 3CVUA 3HSSA 3A31A 3A1DA 3OF3A 4XOIA 4P6VF 1K92A 2Q3JA 2GHTA 4WRRA 1JFTA 2YFQA 1I24A 1WIWA 5A3RA 1IN1A 3WHLA 1V3TA 1V5GA 3C7CB 2VDUE 2CLDX 3GCWA 2CVOA 2XNSA 1OA0A 3BK1A 3OZEA 3TOXA 4JCOA 4M87A 3GJ6A 4MS1A 3JQFC 3MUNA 4KBGA 4QO7A 3UA3A 3V4SA 1N9GB 2R84A 3BILA 3FJYA 4ZOCA 1AZWA 1A1SA 3C8HA 2EZUA 3CNOA 1JAXA 4G86A 2CBGA 2I2BA 2GA9A 2CLFB 1TIBA 4MWTA 1JKJA 4O1IA 4V0MA 3DXYA 4KUHA 2X2OA 3HU1A