4Q02A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q02A00
2NQ2C 3W3AA 4B3BA 1XMSA 1DAFA 3QQ5A 2W0MA 3EPJA 4TZ6A 4EPWA 3QXCA 2NPIA 2H8KA 3SHFA 4URVR 1E94E 1BKDR 1G3RA 4OYHA 4DSUA 2WKPA 3CZQA 2IYZA 3FFBA 4KITB 2CL7X 1Z8FA 2ZSAA 4EJSB 4DB2A 4HUQA 4TSFD 1FOEB 3RRMA 4BFTA 2X2FA 4L5BA 4DBLC 2IWHA 1PZNA 2AD1A 2OFWA 4IHQA 5AUPB 1D2MA 5TVKA 1E4VA 1UKVY 1KI6A 3HU3A 4B2PA 1Z47A 3BC1A 1EK0A 4HLDA 4YLGA 5FTLA 1UF9A 3CM0A 4QBHA 2FPMA 3TK1A 2YKGA 2PLRA 2WTUA 3ZD6A 2ZE7A 2XSZD 1DO2A 3BXZA 4BEJA 1AZSC 1NLZA 1ZBDA 1XMIA 2FEOA 1E99A 4PHFA 4C0HA 4HB3A 1KGDA 2XX3A 3OEED 3HR8A 4NCNA 3RS3A 5EXTA 4D82A 2QM7A 1M1YE 1ZYUA 4NZYA 3PENA 2RCNA 5UKDA 4JLVA 1PVOA 5FR1A 1GRRA 1PV4A 2AD5A 2IA5A 3QF7A 3SBEA 5EXSA 2ASEA 4CGZA 2QGNA 5G3ZA 2OBLA 2CMKA 3P4YA 3U2QA 4RVCA 4PSKA 4RD4A 3EIEA 2REOA 2WJVA 1I2DA 3GFOA 4Q5IA 2I4IA 4JBYA 1Z6XA 2VEDA 1G4UR 3V4FA 2GK6A 2J7PA 2DHRA 3NDPA 2ZSEA 1NNEA 2O8DB 4ESHA 3ZIAA 3WNCA 3BFKA 1G291 3AF0A 4NHOA 3FOZA 5FI1B 2ZUCA 2ZROA 2B92A 2GCOA 3FDIA 3NDBB 1KK2A 3WY9A 3CUEF 2WOJA 1NMZA 2DY1A 3B2EA 5KYKA 3P4XA 2OLJA 3WYGA 1M6NA 1TAGA 4TLEA 4B3DA 5F2EA 3FE2A 2JLVA 2VYFA 2O8BA 2AWOA 1U0LA 2HXYA 1XD2B 4LHZA 5GVRA 4AYWA 3L0SA 2BKUA 2CCKA 4B44A 3LBHA 4M1WA 5DO9A 4PX9A 1GKYA 1V5WA 4LBVA 1ZNZA 3B6EA 4RD6A 4LYAA 3RWMB 4JVNA 1FTSA 1W4CA 3NWJA 3Q3JB 3KQNA 5LDDC 3SEAA 2GZDA 3I32A 2NIPA 4M1SA 3QG5A 1E2KA 5AWFC 4EPYA 2JATA 4BQSA 4ZDJA 1R0YA 2NZ8A 2X2EA 3U4QB 4C0BA 3EG5A 1ZC4A 4ZV4A 5JS8A 2IS2A 3GLFE 1KKLA 4BZQA 4QGFA 1CR4A 2VHUA 2WIAA 1SXJB 4JBXA 3CX7A 2IUTA 4D2IA 2AKYA 1CBUA 3U60B 4HDOB 4M9QA 5M04A 4HLUA 3SHWA 3WMEA 2AXPA 1XTSA 4GZMA 1XMVA 3QKUA 5EUMA 4R2HA 2JASA 1OYWA 4A0FA 5JJIA 5CLQA 4MUAA 3T1TA 3ZVRA 3PVSA 1W47A 1XXHA 3CO5A 4B34A 2VHCA 4PC1A 1KO7A 2ODWA 4B32A 4DLSA 2ZS7A 4BRUA 2P67A 2OFOA 2BMFA 1DEKA 4JLKA 3LO5A 4YMSA 1JJ7A 2KSQA 1P6XA 1Q1QA 5EP3A 3AGPA 2AX4A 2ZRKA 3ECCA 1MRSA 2ERYA 2QPTA 4UJ3A 3U7GA 1OFIA 4NYMR 1NSTA 1CR1A 2V9PA 1E1QD 2QZ4A 1ZRHA 2OAQ1 1IY2A 3RS2A 3GD7A 3Q8XB 3AF1A 2OBNA 1JQJC 2QG6A 1DG3A 2JLSA 3QBTA 2ZVQX 3K0CC 4Q9HA 4YONB 3W3ZB 2H18A 2XXAB 3R7WA 5BYKA 2OO7A 4PO1A 1U81A 1BH2A 2KWIA 3BFXA 3TSWA 4JLMA 421PA 4DLVA 4DDVA 1IJFA 4XOIA 3A4NA 3AUYA 4WA7A 2I1VB 2FFBA 5TXGA 4A8JC 3KXLA 3SYLA 2CVHA 1OIXA 4XD7A 1XCGB 1W48A 2FN4A 2F9MA 2QRNA 1KAOA 1E2LA 2J7PD 1JAHA 1I4TD 1VG1A 4JT2A 3EXAA 4EFMA 1W0KD 4KI0A 3ZVMA 2OZEA 1GRQA 1XJQA 1D9ZA 3ADKA 5JWOA 4P32A 2CLSA 1KI9A 2OESA 2VHTA 2ZETA 4H1VA 3SJBA 1Z0JA 1E2JA 1KK0A 821PA 2UZIR 3DOFA 4EPXA 1L4YA 3AF2A 4IDHA 1LS6A 1RRFA 1XTRA 3KJHA 2O8EA 3VR6A 2FX3A 3W6PA 1LF5A 1SXJC 4IVPA 3R7WB 2QBYA 5D3MA 5C46F 1Z6TA 5F9FA 2VPPA 1GL6A 3S1AA 4M1TA 3QVVA 3IGFA 2IHBA 2OUKA 4HDCA 5CJ2A 2IYVA 4EDHA 2IEYA 3D31A 1KMHB 4DC9A 4TMKA 2WWXA 2ZYVX 3IO5A 1VYTA 3WBJA 5HE9A 4ZI3A 5JZVA 5HCIA 3Q5DA 2IWRA 1N2CE 5KPDA 1HT2E 3OIVA 4MRSA 1OKKD 4Q18A 3FPAA 3WYAA 4BPBA 3AVTA 1T3HA 1E2MA 1KAGA 4GNKA 1NJGA 4LJAA 1E98A 5A0FA 4PAQA 2VP2A 2JDID 1C4OA 3SQWA 2BMDA 3A4LA 5J4HA 5FUVA 1NLFA 2O8DA 4BRWA 3GCGA 2LKCA 1GKUB 4UXHA 1KO4A 4C7OA 4YDSA 2LCFA 1P3JA 2RB4A 1KI3A 1UPTA 2PCLA 4MGIR 2IUUA 4A15A 4BE7B 1SHKA 1A5TA 1R5OA 1ZVQA 1W5TA 1T8TA 3T34A 3AP3A 4B75A 2F3RA 4YDHB 1GUAA 4DXAA 2QBYB 1TQ6A 1E3MA 4DLYA 1Z29A 1KSJA 4QG7A 2FNAA 4RKEA 4DIEA 2QTFA 2XNDA 2YNMA 2QP9X 3IQXA 1FZQA 2PT5A 3N70A 4ACAA 1JJVA 1KDTA 2B8WA 2D2FA 3UXMA 5KNCA 5DYGA 1EXMA 2VHQA 2CBZA 4LYFA 4HZUB 4P4UA 3PXGA 4P0TA 5IK2A 4AURA 5KU1A 1TQ4A 1KTVA 3BB1A 1KI7A 2NO7A 5E7IA 2RGCA 3LLMA 5FUXA 2GILA 4WZBE 4IDPA 4B6FA 3Q9LA 3CX8A 4J0QA 5F9HA 1ZD9A 3VR2A 3REGA 4OQXA 4NDZA 2R6FA 3ZZ0A 5E4FA 1J90A 2ODEA 1Y63A 3EPKA 3IILA 4M2LA 5FPTA 2XTMA 4HAYA 1S2MA 4AKHA 3GLGB 2BJWA 1IOZA 3U6BA 3IEVA 4RD3A 4A8JB 4LCBA 2AN9A 2FV8A 2JIZA 2ZUBA 3WNBA 2RGXA 5FUWA 1W5SA 2CNWD 1RC8A 1XTQA 3PCRB 4IEEA 4HI0E 4F93B 2ZR0A 2HV8A 2ZJOA 4RZ2A 2ZRAA 3EC1A 1ZCBA 3L2OB 1TF2A 2VHJA 4MRVA 4R98A 5J5CA 4IEIA 2G0TA 2F43B 2IS1A 3PITA 1ZM4A 3F5FA 3VX3A 1G19A 2BMJA 4GPTA 4ACBA 3U6KA 1E2FA 1R10A 1ESMA 2PJZA 4BEBA 4TL7A 1EFCA 1N5KA 3OZXA 5TY0A 4LJ8A 1P5ZB 1KY3A 2XAUA 2H5EA 3PV0A 4PXAA 1HTWA 4Z1MA 8OHMA 1XTIA 3FMOB 4MRPA 4MYCA 1XJCA 1OHHD 2FWRA 1G5PA 1IHUA 5JHHB 1G6HA 2WKQA 3CBQA 4N0EA 4V0NA 4JJKA 4RZXA 1LY1A 1R0ZA 4M4SA 3UG7A 4D4LA 2D3WA 1ZUIA 2HJVA 4TSFA 5A4JA 2ZSFA 3I3SR 2XGJA 3FHTA 4DEYA 3THXB 3D3QA 2C9CA 1DE0A 5L3QB 1N6NA 3KXKA 2JLYA 2IX3A 3PUZA 2FSFA 4OHXA 1W4RA 1VPLA 1ZW6A 4JS0A 3NH6A 5CDFA 1XZQA 1F60A 3NG1A 5AK0A 2CL0X 3VR1A 4HAWA 3MLEA 2EYQA 4TYNA 4A82A 4EKDA 2W2TA 4JLNA 3K0FA 4P4SA 5F3WB 1RRGA 2NO0A 3PUVA 3PUXA 4IOKA 1E2PA 3Q72A 2QY9A 1UADA 5DN6D 3BK7A 4QRHA 5KDDA 3U3KA 2XB4A 2WJGA 4C9BA 3RC8A 4KBGA 4LOAA 1FTNA 3EZ6A 2QPOA 4I1SA 3EIHA 3M0EA 2O8FB 1S4QA 4OQNA 5J4LA 5DHAA 3TW8B 1UDWA 2DPXA 1IXZA 1IBRA 1KZ7B 3VMFA 2VO1A 1H8HD 2J0UA 3CF6R 1B0UA 4KAXA 1J7KA 4LHXA 2ZR7A 1IY0A 1P2TA 2YVUA 3SE0A 3R9IA 3V00A 1VIYA 1COWA 4URWR 1AGRA 3GLFB 4IFBA 4UNNA 4BFXA 3RAPR 4Q1DA 4C0SA 2FSIA 4W7SA 3MWYW 4OQLA 2ZRIA 1SVOA 4P3YA 1CJMA 4D81A 4M1OA 5HZKA 4BLPA 3K53A 5BQ5A 3X1XA 3VNUA 1NIPA 1NBMA 4B2IA 1E0AA 3A8TA 1HH4A 4LYHA 5K8TA 4IRUB 2R6GA 4PC2A 1S96A 1FP7A 1E9DA 1OKKA 2WOOA 2RKOA 1LTQA 3OAAA 4NL4H 2J46A 5K8UA 1R0WA 3BD9A 4I1OA 2ZI4A 2C95A 4OHYA 4PQFA 2DBYA 4D80A 2HEIA 3JVVA 2LWIA 3OEHD 3D7MA 2JJ2A 5HZHA 3GEHA 1ELOA 3T61A 2XZPA 1WBDA 3U3MA 1FUUA 1M8PA 1QVRA 3OESA 1VHLA 3TUIC 3CF2A 2GJ8A 1RFLA 3THOA 4Z8YA 3BB4A 4RZUA 5DGXA 1ZJ6A 2Z43A 1JR3A 1E1RD 1Z0AA 2CLDX 1FP6A 1ZU4A 3FVQA 2C2HA 2NO9A 2DFTA 1LW7A 4TN1A 5H1YA 3SYNA 4M0LA 3TQFA 1NRJB 1AKYA 1RYFA 3UANA 2ZI3A 1R6BX 4JVLA 3U4QA 3QF4A 4Q00A 5KHOC 3LA6A 1X1RA 2GJSA 3ZVLA 4JLOA 1LVGA 5K8LA 2RGAA 2O0HA 2EQBA 1CLUA 1J8MF 2KBFA 3U5ZB 5IT5A 1GTVA 4BLTA 4GL2A 3S1AB 4A36A 2D74A 1NVVR 1ZM2A 3LQRA 2O52A 1E0SA 4OQMA 4LUCA 5JEEA 5CYPA 1G16A 4JL6A 4ZCLA 5JWHA 2A5GA 2FMXA 2V7QD 3QE0A 2X77A 3T1QA 3DVLA 5DI9A 4RCYA 5BXQC 1IXSB 1K5GA 3K0FB 4IFEA 3RABA 2HYDA 3EASA 3CZPA 2D7CA 3OEHA 1N6OA 2NG1A 4L16A 2ZJ2A 4ARZA 2A3RA 4K46A 1VTKA 3W5IA 2VF7A 3CPHA 1GNQA 1OSNA 3ADBA 3KQKA 4JKIA 1AS0A 2MSEB 3MWJA 1SQ5A 1ZNXA 2F3TA 3ADCA 2IS6A 1FX0B 4WOPA 1F5NA 1OT3A 2GCNA 1MT0A 2KE5A 5JI3E 1G21E 3LY5A 4TQ9A 2BOVA 5FFMA 2CLCX 2GEUA 4Q4AA 1Z0FA 3ZQ6A 5KSZA 2RGGA 3GPLA 4HAZA 4ZKEA 3WRXC 1CRQA 1XJ0A 2FH5B 4NMMA 3WXMA 3ASYA 3WHLA 3ZJYA 1COWD 4XJXA 1W36C 3ADDA 3GEEA 4KSCA 1TADA 2Z4RA 4ZCMA 4GBMA 1ZMXA 2ZSDA 3C8UA 3WNDA 2GHIA 2WZQA 1D2NA 1NSFA 4DKXA 6Q21A 2VSOA 3GLHA 4QHTA 4Y0AA 3B9QA 2ZYUX 2HF9A 2D4HA 4B48A 5HKKD 5FOVA 3WMGA 1TU4A 1YZNA 1XCPA 4UNRA 2W6IA 1HYQA 1YZTA 2NOAA 3VKHA 1HQCA 2J0SA 4Q47A 1Q1BA 2CHGA 1KJYA 5L8VA 3TUZC 3ZVNA 1A82A 1E79D 2CK3A 3SJCA 2WWHA 4OHZA 4BFSA 2WV9A 2QTVB 1SVKA 5C2JB 4PC3A 1E2QA 4E22A 3U3OA 2BCJQ 1AGPA 1XF9A 3VQTA 4NCJA 2IEZA 1QZXA 3VR3A 2P6UA 5LD2C 1QRAA 1XWIA 4A2QA 2ZJZA 3U44B 3AUXA 3I8SA 1VCOA 3M1IA 4KV9A 4PSVA 2G6BA 4ZIRA 1A1VA 3TH5A 5JBQA 4R7ZA 2EVWX 4KO8A 1DAKA 4QJ5A 2FFQA 1VCIA 3K9LA 2J0UB 2P5TB 4M22A 5P21A 1E0KA 2QP3A 3AVOA 5EE3A 1KZGB 1P9RA 3EZFA 4GOJA 4B74A 4LI0A 4D0LB 4BLRA 2I1QA 5SZKB 1JPNA 1ONBA 4U00A 2MMCA 4EFLA 3MMPA 1DVRA 3CX6A 1VG0B 2ZPTX 3ZIAD 3ZS9A 2JJ1A 3A58B 2ECKA 5AUQA 1P2VA 2WSSD 3QKSB 5KDLA 4XWKA 4NCKA 2IT1A 1JECA 3PEUA 2CNWA 3KZ1E 5H8WA 1UAAA 1SVSA 1N5LA 3UMSA 1R0XA 2QE7A 4H1UA 4CVNA 3RRZA 4CEHA 1OLOA 3SN6A 2GBLC 1N0UA 1CU1A 2JEOA 1W2GA 3DL0A 3TQCA 3T15A 2GAOA 2Q3FA 4ZCIA 3SJAA 5JLJA 4KYUA 5EZ5A 2V6IA 1UJ2A 2BBWA 1XD2A 2OHFA 1G7SA 1OH7A 4IOJA 3VFDA 3THXA 1P75A 3CR7A 2OLKA 1YR7A 3SC3A 4BFWA 1AIPA 2FG5A 2IW3A 3AP2A 1P4SA 2JGNA 5BWMA 3R8FA 4FMCB 4KU4A 3KDSE 2MSCB 4CF7A 1G6OA 1Q0UA 3MJRA 4JBWA 2ZI5A 4HYYA 2AR7A 2ZRGA 3NH9A 3O8CA 1LV7A 4MKHA 3I62A 4I4LA 1D9XA 2GKSA 3HYRA 3X2SA 5FTJA 1L2TA 1CJVC 2GJAA 3CLVA 5KNDA 3DMNA 1U8ZA 2FDCA 2V6JA 2WAXA 4FMDB 2V8OA 3GJXC 3GLIE 1W44A 4HAXA 5ELXA 4OQFA 1E9RA 2EWVA 1PLKA 4UQOA 4US0R 3F0TA 1YR8A 4G5SA 2AHOA 2BBSA 1KO1A 3RANA 2R6DA 2QSYA 5E3HA 3GLFA 2V3CC 5GJBA 2ZAOA 1W46A 4DT1A 4XTCS 3T1OA 2O0JA 4TL6A 1H8ED 2DB3A 4TZ0A 1DOAA 1NKSA 1I4LD 2ZRBA 5J4KA 4ZDKA 2WJIA 4L8GA 1WXQA 4PHTA 4QFMA 1OW3B 3KTAB 1ESNA 2GTPA 3QY0A 2FFHA 1ZD1A 4V02A 1T8UA 4Q21A 5KPJA 1NKTA 5TDHA 2ZREA 2D7DA 2WIBA 4EPRA 4CEIA 4POAA 1KSHA 4O2LA 5EP2A 2N46A 4JZKA 3RSLA 4JLAA 1HQYE 3EZ9A 1GFIA 2QNRA 1X8JA 5FBVB 1MRNA 4KFUA 2R6AA 3T35A 3U3RA 1VHTA 1CRPA 3CRQA 2ZUDA 3CB4A 3L0IB 2ZITA 2ZRFA 4Q4LA 3SNHA 2F1IA 3GJ7A 1E2EA 1FMLA 3ZH9B 4LWZA 4B76A 2R44A 3CPJB 1IN6A 2GAAA 1II8A 4CZ2A 2GDJA 5B30A 1ZM9A 2V55B 3KKNA 2QN6A 1XBTA 1E0JA 3SJZA 3VAAA 2QEQA 1FNMA 2ZRHA 3P20A 1E2NA 3Q7PA 3NBYC 4M9ZA 4D0NA 1EFRD 5E95A 5EE9A 4BLOA 3SZRA 3W8RA 4QC2A 5FOSA 1OXTA 4IVQA 2H92A 2X8AA 3AVUA 2ZI9A 1NL3A 4GMXA 3RRYA 3ND8A 4ARZB 1QHGA 3Q5EA 3GP8A 1G8YA 4G5RA 2ANBA 3NBZC 2FEMA 4QGAA 3RDPA 5AJXA 3I4LA 3D8BA 4LV6A 4LSGA 1M7HA 1RKBA 2JLRA 2QTHA 1A7JA 4MRNA 3HP1A 2P6RA 4JSYA 2AFHE 4FCWA 4QBIA 3ZZUA 1QVAA 1E69A 1NVUQ 2IYQA 5KOYA 1S9DA 1XPRA 1NY5A 3OIUA 1TNDA 5E7MA 4TT3D 3T06B 4KVAA 1X86B 4B3CA 4NH0A 4Q9LA 3LRPA 3MSXA 4B33A 2B7BA 3LWNA 3E2IA 4I1UA 4D4JA 4ERNA 3GMTA 2DWQA 1OXSC 4PPNA 3PUWA 2HT6A 1JEEA 1JEDA 4G0NA 1JNYA 3I5YA 3A1SA 4EJSA 1E79A 2ZE6A 1XU4A 3U3JA 4KFTA 3GLHB 5AJVB 3IQWA 1F3OA 1G8HA 1TUEA 3SYKA 2Q9CA 3EA0A 4R71A 1DARA 5G3YA 5HKKA 1EWRA 2A5FA 4MGKR 2C9OA 2WWWA 1E4YA 4X8HA 1WCV1 3V9PA 3AH8A 1N6RA 2IHYA 4TQUS 3U61B 3CNOA 3U7HB 1E9AA 2ORIA 2SHKA 1DAGA 1OFTA 3H4MA 4EIWA 3RC3A 4B35A 1Z2CA 4TYQA 3ZS8A 3N2IA 3SBDA 3TR0A 1RRCA 1M7GA 3IEUA 5C4MA 2F7SA 2ZYWX 1P62B 3NHBA 2GBLA 4ZO4A 5ANRB 3HR7A 5LB4A 1OXVA 3MJHA 2ZANA 4V0LA 2QL6A 4C0QC 4DLWA 2GRJA 2HYIC 5TB5A 2CXXA 4B47A 2GXSA 2DWOA 5FBWB 5DI3A 1XMJA 3T1VA 1KMQA 1HUQA 3A6PC 2QAGA 1N5JA 4GFDA 3CRRA 1QF9A 1TMKA 5CDFE 4KYIB 3QXSA 4QBGB 2YOGA 1JALA 2G9NA 1KDOA 1D6JA 4WW0A 1US8B 2F55A 2ZSBA 2JLQA 2QMEA 1V43A 2IYWA 1Z0DA 4QJ4A 1BMFA 2QORA 2RAPA 1O87A 2B21A 3VKWA 1VECA 4Q7KA 4D0GA 4LHVA 4D6PA 3W90A 5CM9C 4K81B 1II9A 2C8VA 1P60A 2X19A 1U2RA 2CE7A 2O8CB 4MQBA 1KIMA 1GSIA 4A2PA 4L4UA 4IKEA 1SXJE 2MSDB 1XX6A 4TMTA 4KFRA 2VTKA 4QBFA 5CK4A 1KSGA 3DMDA 4O2RA 2J45A 4IJMA 4TT3A 3RS0A 1QDEA 4TL9A 4UNSA 3IDQA 3VR5A 3D6TB 2OILA 3DM9B 4DLTA 3DDCA 5A5GA 1PLJA 1WRBA 1G20E 1XCMA 4TWZA 1TUIA 3P27A 3E5HA 2C04A 3Q85A 3BIFA 3SR0A 4M1YA 5FTKA 1R4AA 4JYBA 1JR3D 4DDWA 3DHWC 3GLHE 4AYTA 3B9PA 3ICQB 2GA8A 1F6BA 4MKGA 4CT5A 3PEWA 3H86A 4Q9IA 2H1LA 2XTNA 1XEXA 3RSOA 4HLUC 2WSMA 3A36A 2ZYTX 4YMUA 2ZJ8A 1P9NA 1KDPA 2IF2A 4DCVA 5CLLA 1XPOA 3VKGA 3JVUA 3FFAA 4UJ5A 4EUNA 2IUSA 5BYJA 1HE8B 2VBCA 4ON9A 2WWFA 4PPGA 2ZE5A 4M9SA 2RGNC 2JIZD 2O8CA 5FBLB 1QHSA 4QL3A 2GXAA 2FF7A 4JLBA 3AKEA 3CKLA 1NVXQ 2BBTA 2QQ0A 1A2KC 1MO3A 2CEAA 1S9HA 2Q9AA 2O5VA 3QPUA 2N42A 3H1TA 2EFEB 4XSHA 2R9VA 3IHLA 3B1XA 2YHSA 3I92A 3RNLA 1RRPA 3A1TA 2BIFA 3B78A 5C18A 3B85A 5AJWA 2DYKA 1R5NA 5GJVC 3P26A 2QUZA 4R2IA 1Q1EA 3A1WA 4QOSA 2O8FA 5D3MB 5L3QA 2PMDA 1QG2A 5B57C 4MKIA 5EP1A 3SOPA 1A2BA 3WRYC 4DHEA 3TW4A 2NPFA 1H8HA 1W2HA 4W5JA 4A92A 1E6CA 1RIFA 3DO6A 4KLNA 5JHGB 1ZUNB 1KMHA 3EIQA 4AIIA 3BJIC 4LHYA 1I4DD 4WZ6A 2OM2A 1FQKA 4RD2A 4C0JA 1TU3A 1AKEA 4AKIA 2X1VA 2VA8A 5LBIA 2R2AA 5TARA 1XEWY 4QHSA 1U0JA 1Z6YA 4FCTA 2JA1A 1YZUA 4LX0A 1JB1A 1OIVA 2BEJA 4S2EA 1U90A 2ZRDA 4G5QA 1JI0A 1UFQA 3ONWA 3A4MA 2BVNA 4C7OB 1VDZA 2P2LA 4JKYA 4NBSA 4ITRC 3UATA 1EX6A 2IYTA 3L0OA 2JDIA 3BFVA 3IIJA 2VRWA 1R7RA 5AJZA 2HLDA 2YZ2A 2VQSA 1XB2A 1AN0A 2KB0A 1Q21A 1T3SA 4D4KA 4GDFA 1CEEA 3IPXA 3RHFA 3UK6A 2VF8A 3FMPB 1ZM7A 2C77A 4GI7A 4V0OA 1B23P 2D62A 4Z51A 1ZINA 3SFZA 3NC0C 4O3MA 5EQTA 1KNQA 3HPQA 1M2OB 1T0HB 3I1FA 1XXHE 4FWIB 4OI4A 5FR2A 1O3YA 1XP8A 4NKRA 4NCIA 1RJ9B 5SZIA 4EQ6B 3OE7D 3QXXA 2O8EB 1E2GA 1ZIPA 2ODNA 3QF4B 1G8FA 1SULA 3OFNA 5JEDA 3TKLA 4PTLA 3OF5A 4AY2A 5SZJA 1DADA 1WF3A 4UKDA 5GADl 2IYXA 1KNXA 4HSEA 4OI1A 3NXSA 1E9EA 1JPJA 4BFYA 3C41J 2OBMA 4MYUA 2V1XA 3QJYA 2QMHA 4C0AC 621PA 2OCBA 5KO2A 4JLDA 1YJ5A 1G9XA 1PUIA 3A37A 2D2EA 2HF8A 5FI0B 1BYIA 2G1JA 4HUQB 2CJWA 2OG2A 2YWEA 3KKPA 1NG1A 1RPZA 3C5HA 4DLUA 4E03A 1W0KA 3MG9A 4LHWA 4TMXA 2WSSA 2ZRJA 2VP0A 1S1MA 3QENA 1P73A 3G0HA 3TNFA 1NN0A 2ZU0C 2VP4A 3L0PA 2FJUA 4LZZA 2FZLA 2CCGA 3NTUA 3UG6A 3THYA 2GF0A 4XSGA 5FPSA 5JRZA 4AKGA 2G77B 1OXUA 2F6RA 1F2TB 5EUQB 4XD7D 3TUJC 1SGWA 4NPHA 4KCGA 4F7WA 2PZGA 4JSTA 4F4JA 1HE1C 4KJZA 1FL9A 4FD2A 3TE6A 2DFKB 2J7KA 3EA5A 4NP6A 2G83A 2ORWA 4BECA 2AFIE 1R8QA 4DCSA 1X6VA 2ORVA 4G3XA 1ZCAA 4NYJR 1G17A 2FE4A 1S0UA 1M74A 2QP4A 3JZMA 1AK2A 3U7FB 2OSBA 3IO3A 3AGQA 2ERXA 4AYXA 4FI3C 1CIPA 5IK2D 3B82A 4Q4JB 2ONKA 2ZAMA 1KI2A 3AV0B 1K8RA 1L8QA 3P1JA 3M6AA 1U8AA 4L9SA 4TMZA 2A9KA 3LQQA 2WWGA 4ASUD 4PAOA 4A2WA 5TMPA 3THWA 2GK7A 3AB3A 3W6NA 1SVMA 5IF9A 1YZQA 1NMXA 3KX2A 3QPVA 1QHYA 2ONJA 4IXMA 3K70B 5EJEA 3T12A 2A7QA 1GKIA 1KHTA 3AQ4A 2AWNA 3PIRA 2IF0A 1W4BA 3AKDA 2C5LA 2V1UA 1TTTA 1F2TA 3NBXX 2A30A 3K0CA 5JI2E 2PMKA 5KTYA 1F48A 1GVNB 1G7TA 2XEXA 4S35A 4WZAE 4CYMA 3MGCA 2EFGA 2O8BB 1ZUHA 3CWZA 3X1ZA 4G01B 3FB4A 3LH5A 3NBFA 3CRVA 5KSYA 1G8PA 2Q21A 3B7GA 3KJGA 1U8YA 3KFVA 4CRWB 4U5XA 4QNMA 3BH0A 1DBSA 1YQTA 4PQRA 2R8RA 1KK3A 2XJ4A 1CR2A 4QHYA 5DYIA 2W6JD 1HT1E 3K0AA 4G5GA 4Q03A 5FPKA 5H68A 3TMKA 3VTKA 3VU9B 3NVAA 1A4RA 1NN5A 3G82C 3ZD7A 1XD8A 3FWYA 3BGWA 3CH4B 3BAFA 1IXRC 4PAMA 4RZ3A 4BGDA 2YWFA 4NYJQ 5DHFA 3CR8A 3K09A 2CVFA 1AS3A 3R9XA 3C15C 3CH5A 4I1VA 5DH9A 1DAHA 1SKQA 3AEZA 3UMFA 4A4DA 2GZHA 5HPYB 2P0EA 5JMTA 5CIQA 4YMVA 5DSZA 3GLIB 2BCGY 3B13B 3TVDA 2PL3A 5E7JA 2P65A 4DVGA 3C16C 3EWAA 4JVMA 1E9FA 1NJFA 2Q3HA 4IXNA 3FMFA 2QT1A 4DRZA 1AQUA 3MRSA 4BZXA 3R9WA 2ZS8A 1L4UA 2FSGA 2V4ZA 4Z8XA 3LXRA 1Q44A 2P3SA 4JJZA 3CNLA 1CP2A 1GITA 3UWOA 1KOFA 4HEJA 4DIDA 2BV3A 3QBVA 1KO8A 2PX3A 3DZDA 3LX8A 4BFVA 3B8HA 2OXRA 4BWYA 3BORA 3B1YA 1Q22A 4TQAA 2IXFA 3QPWA 4RD1A 1VYVA 3LVRE 3SDZA 2O0KA 1N0WA 1UKZA 3K09C 1QHXA 3P32A 1WP9A 1AS2A 1TQDA 4FMCF 2Q0HA 5BN3A 4LBZA 1G1MA 5FOTA 1KI8A 4RJLA 4C3ZA 4DCTA 4ILEA 4CEIB 1OPXA 1ZAKA 3AF4A 1BYUA 2OCAA 3UKDA 3QIAA 1X8LA 1ZM3A 1T4GA 4H9GA 1Z63A 2XSZA 2QM8A 1EG7A 2HT1A 3GQBA 4V0MA 3CONA 4NONA 2FOLA 3BBPA 1MV5A 1FFHA 1YVDA 2QA5A 5FH9A 1UKEA 1G7RA 2PJRA 4M21A 3U44A 2CE2X 3QXJA 2ZR9A 521PA 3IBYA 2ZJ5A 2GEVA 4PHHA 4D26A 4DDUA 4WVFA 2PEYA 4LJYA 3T5GA 4OK3A 3TAUA 2XOKA 1LS1A 1OE0A 1NBMD 2XITA 2CHVA 2W83A 4PPQA 4V03A 5CK5A 3B1ZA 4NU0A 4C0KA 3MCAA 3KJEA 1XEXB 1Z0IA 4MDEA 2XB2A 3DKPA 4AK9A 2AKAB 2WJYA 2ZJAA 3KUCA 4Q9JA 4QNRA 3QKSA 2XTZA 1FQJA 3H2YA 4NCHA 3NEJA 3GEIA 5B64A 4OHVA 5JCPA 1XD9A 1T6NA 2ATXA 2ZEJA 5SZHB 4YMTA 5BN5A 3SFVA 4G5OA 3AVPA 4KODA 4ZPXA 2QROA 4D4MA 2ZTSA 1YHNA 4LDJA 3FGNA 3O47A 2REBA 3N2EA 5FPYA 2J41A 5DN6A 2QAGC 4AC9A 3LW8A 1ZD8A 2G3YA 2HXSA 4RFSB 5L3VA 3MAAC 4OBEA 4HLQB 1C9KA 2FA9A 4LJ5A 4Q1FA 4Z54A 4HDQB 1R2QA 5GVSA 1MO6A 1Z2AA 2C99A 2GVDC 4XWAA 1VCMA 2NGRA 1X1SA 2ZRMA 2LKDA 4LV8B 2P5SA 3QSYA 4DZZA 4TL8A 1GNRA 1G5RA 2REXB 3SI7A 5GJCA 1C1YA 2ZS9A 4QM7A 1EFTA 1EGAA 1P2SA 1Y3AA 5FL7D 5J40A 2DCUA 3GJ0A 1F2UB 4OJKA 3THYB 2A5JA 2VIIA 2QE7D 1W7AA 2YOFA 4MYHA 1EX7A 2FPKA 3BE4A 5HTKA 3UMRA 4BUJA 4PHGA 5J47A 2FGKA 1SZPA 2BEKA 2C98A 4FMDF 3VHXA 1BO6A 1JBKA 4P31A 4IOLA 4TLBA 3EPHA 1TPZA 2HCBA 3KB2A 4PC6A 1Z07A 3FKQA 4URXR 2H57A 1Q1ZA 2JCSA 4HZUA 4Z1MD 5L3SB 1ZIOA 3CF0A 3W5JA 1KY2A 4F4IA 2W2VA 1E9SA 3DPUA 2W58A 4GOXA 3KL4A 1K5DA 3GFTA 1T3LA 1VIAA 1TX4B 221PA 1GNPA 2YWGA 4OL0A 4JLJA 1E2HA 2QAJA 4KBFA 3OE7A 1WA5A 3AF3A 1XEFA 3M4YA 1K6MA 3OIYA 1IN7A 1EFUA 4KFSA 4URZR 1NIJA 1LNZA 1VG9B 3MD0A 1OV4A 1UEJA 3BRWD 4BLQA 1KSFX 1U94A 4PPFA 1ODFA 4AG6A 4FINA 3RWOA 3KTAA 1G5TA 4U7DA 4YXWD 1J2JA 1GM5A 5JCZA 3J81k 2XZLA 2UVQA 4CEHB 2DFNA 3WYFA 3BH6A 4XVUA 4Y0VA 4EJSC 4LRWA 3CW2A 4LJ4A 1KYIA 2C9YA 1Z6GA 2BC9A 4Q02A 5K8IA 1UBCA 3EW9A 4HATA 4Q4HA 3W6OA 4W5HA 4OKSA 1HV8A 3UIEA 4F91B 5JRJA 4MYTA 1FPMA 4OK5A 1BMFD 1P9WA 1S3GA 4X8LA 2HJGA 2W6ID 4OK6A 3LX5A 4DDTA 4GRAA 4ZIRB 2QMUA 1RZ3A 1GWNA 2FSHA 3BERA 4UXIA 4PZYA 3I8XA 4IDNA 4JL5A 2WWYA 5JSZA 2C78A 2AK3A 1I2MA 1JQLB 3MWKA 2H7VA 2QMOA 2GNOA 5DIFA 3PR1A 3LAWA 1P61B 1T5IA 1Z83A 3B60A 3QKRB 5C1BA 1N0VC 3K70D 1KK1A 3BOSA 3NEYA 2FZ4A 2R6CA 4W5WA 5EE0A 4B71A 3RVBA 2V54A 5B2ZA 2BJVA 4WIAA 2YC4C 1WQ1R 1CJTC 3GLGA 1NN1A 4RFVA 3VX4A 3FKSA 1G41A 4EPTA 2HUPA 5FTMA 3UWKA 3I61A 2A2ZA 3PJRA 2IK8A 3RLFA 2RMKA 5KDOA 4XH9B 3R8CA 2OT3B 5FPHA 4LBYA 3EC2A 2Z0MA 3DKVA 2VP5A 4Q4HB 3FTQA 4DCNA 3AVWA 2NTYC 2EFHB 1G3IA 4CEJB 3GJ3A 1CR0A 3L43A 1N6LA 2XXAA 2Z83A 1G3MA 1YZGA 2Q6TA 2AK2A 3BH7A 4UNPA 2WAYA 1Z5ZA 1NVVQ 4KHZA 3DEFA 2ZM5A 1NMYA 3THWB 4QJ3A 1GOTA 1IONA 2PZFA 3OHMA 5IHPA 1TEXA 2QI9C 3IHWA 1SXJD 3QXHA 4B6EA 1PUJA 1Z3IX 4NYMQ 2YWHA 4W9MC 3WBKA 1EWQA 1JXOA 1YRAA 1ZNYA 1G8GA 1IY1A 4GMDA 1GL7A 1LFDB 2VL7A 2E1RA 4XTRA 1XZPA 1EESA 2EWWA 5IDVA 4PSAA 2XNSA 1G4AE 4ZI2A 4BFUA 2WPDA 4LPKA 4AWXA 4A6XA 2GXQA 1AZTA 2OCYC 1E9CA 5EP4A 3DM5A 1RE0A 1E32A 1XDBA 3L8ZA 2YC2C 3KKOA 4U02A 3LFUA 3CNNA 4A0HA 4R9UC 4C0LA 1UM8A 4DB4A 1FX0A 1KI1A 2VP6A 2UKDA 1R8SA 3QUSA 1NF3A 1UDXA 3T5DA 4GOKA 4CDGA 2OFXA 4ESVA 2GJKA 5LD2B 3ZZTA 4K8OA 3LBIA 4WBSA 3TBKA 4IVRA 4KXFB 1R5BA 3NHAA 1XTJA 4MKFA 4FMBB 2WPDD 5FOXA 1SHZA 1DS6A 2ODBA 1LB1B 4N0DA 4MA4A 4DT1B 2N1BA 2ZI7A 3DZ8A 4YC7A 3MUFA 5FOWA 4B43A 4B3GA 3K8YA 4TYYA 4E5UA 2Z4SA 3QNUA 3A1VA 4ZKDA 2QGZA 1JR3E 4F4CA 1J8YF 3WHKA 3C7KA 4JLPA 4OI2A 3IPYA 5FOUA 1MO4A 3KJIA 3RS7A 1W36D 1F2UA 2F1RA 2PBRA 4IDOA 4O25A 5DLQC 1OIWA 4DLXA 4E07A 1NVWQ 4RKFA 1G3QA 3JZAA 2WMOB 1H65A 3PUYA 4PR0A 3KXIA 4JYCA 1D8TA 4AI6A 4UNQA 4TLAA 4DEXA 3FKSD 1U0HC 4UXJA 2OCPA 4FCVA 1NI3A 4EQ6A 1N25A 3BWDD 3ICEA 1G64A 4PZLA 5L3RA 4PO8A 4LYJA 2G0NA 1NBME 1Z08A 2P6NA 5FL3A 4AD8A 4LC1A 5AR1A 5AUOB 3ND9A 2OXCA 2TMKA 1TEVA 3GJ5A 3K0SA 4DSOA 2IYYA 5FTNA 1T91A 2PH1A 4D25A 3GLGE 4XWOA 4MGZR 1TL7C 4KLZA 1WE2A 1ZC3A 3TSZA 2GWHA 2BBOA 1QHIA 2ZRNA 2E87A 3MFYA 3REFA 3K70C 5F98A 1AJEA 3NC1C 4QKQA 1H8EA 4B73A 1DAEA 2FU5C 5HE8A 4PQYA 2HCJB 3X1YA 4ZDIA 1OF1A 4FWTA 3AVXA 3EZ7A 1IJEA 2B6HA 1MKYA 4DSTA 1G3UA 3B5JA 1NN3A 1QBKC 2B8TA 3LLUA 1UKYA 1OFUX 4URYR 1IN5A 2IYLD 2QRZA 4G1UC 4HB2A 4DCUA 4AG5A 1TQ2A 3TJZA 3IIMA 4GT1A 121PA 2F1HA 1MABB 4Q7LA 3V4RA 2UZ3A 5FBQB 2OE2A 1ANKA 4PFSA 4DLZA 1N6PA 1X3SA 1N5IA 4TTRA 3TLXA 1FW6A 4A0GA 1FUKA 3GJ8A 1GG2A 4C30A 3TIFA 4NE2A 4A9AA 4EAQA 5L3SA 4TYWA 5DI3B 4M8NE 3QI2A 3EX7C 2CL6X 4Q4JA 5JFGA 4B2LA 5KUTA 3H0KA 1OHHA 1OH6A 2D06A 3F8TA 3K1JA 4TYPA 4US1R 1HY3A 1JR6A 1IM2A 4DUGA 2WMNB 4Q66C 3LXXA 4B3FX 4WAUA 4Q19A 5TV2A 2KI5A 3AP1A 4M1MA 1RJ9A 1CKEA 2FPLA 2K5UA 1WMSA 4TMVA 2ZXUA 3ZLJA 3O8DA 4A1FA 1OFHA 2Y8EA 2JJ8A 3TAHA 1CULC 2KBEA 4I81A 4N3NA 1OH5A 4LK2A 2JLZA 3HU1A 4JL8A 5FL7A 2ZE8A 1SVLA 4JMPA 2IL1A 1JAIA 4PO9A 2J87A 2JJ1D 1Q20A 4HAVA 5KNBA 1GRNA 3C4JA 2CJWB 5IRCD 3KKQA 2BM1A 4LJ9A 1XNJA 2A78A 3PEVA 4Q48A 1U9IA 1MOZA 2RGBA 3OEEA 4HB4A 5CM8B 4RFSA 2BDTA 2GJ9A 1HEIA 1T5LA 4IW3B 2C03A 1OJLA 1U99A 4V0ME 2DR3A 2GCPA 2BWJA 5CB8A 4OI0A 1UEIA 2PX0A 1CF4A 2OEPA 4JVSB 2XNDD 3NKVA 1IQPA 1E2DA 3B1VA 3PG5A 1XTKA 1J99A 2HLDD 1SKYE 4HZIA 1US8A 2ZQ5A 4TMWA 3OIWA 4DWJA 3FHOA 2GESA 2NZJA 2J1LA 3FHCB 2VP9A 3UPUA 3TSOA 2QENA 5J4VA 2ANCA 5CITA 2CK3D 5EXPA 3O8RA 3TVTA 3SU8A 3CWQA 3F3YA 2WBLC 1N6HA 4RD0A 2BKEA 2EFDB 3K9NA 1AA9A 1CS4C 3PFIA 2VLIA 1WDTA 2OV2A 3I73A 2J0QA 1QHHB 4AKEA 2RHDA 4X8OA 1U9IC 2XOKD 4DSNA 2WHXA 4MRRA 1TF5A 1PLLA 4CT4B 4HAUA 4LY6A 1Z0KA 1FMJA 2FFAA 4DLRA 3KQLA 4PZZA 4DJTA 3QEJA 2YJTD 5CJPA 2YINC 3ZDQA 4BZPA 1T9HA 3W9YA 3KFXA 4V0KA 5EE1A 3ETLA 3LD9A 3EAQA 1XPUA 3TRFA 1II0A 1MR3F 1SVWA 4N1AA 4HLCA 1NY6A 3FYHA 4TLCA 2RGDA 5JS7A 1CJKC 3IKJA 2F1JA 1GDDA 2ZRPA 1XEWX 2CCJA 5JWRA 3VHLB 4US2R 3VU9A 4P4SB 4FIDA 1UBGA 4TTPA 5JSZB 2ZJYA 1WB9A 5HR5A 4LJ6A 2ZJBA 3IIKA 1W0JA 1Z6AA 3QKRA 1QHHA 2PT7A 1U98A 2IBMA 2VH5R 3PQCA 1VG8A 3IUYA 2JLWA 3O8BA 4CIDA 4A0RA 2XZOA 1N6IA 4BFZA 2QPAA 1BIFA 3TR5A 3E1SA 1J70A 4LJ7A 1SKYB 4WXRA 1OB5A 1VMAA 5J4YA 5EE5B 1XFAA 2EFCB 2PCJA 2IXGA 5G53C 5DE3A 3W34A 4YQFA 3QVUA 4Q1EA 3PEYA 1DTSA 2BM0A 3VR4A 2V7QA 4TTQA 3H84A 4MGYR 1Q3TA 1VKJA 4DUGD 3LDAA 3AVQA 4EFNA 4F38A 2IS4A 3QOFA 5CYOA 3DOEA 2XJ9A 2PLFA 1DAIA 4CEJA 1D2EA 1MABA 2YV5A 1PJRA 2IYSA 4F92B 3SQXA 4NYIQ 2Z6VA 2C96A 3A1UA 3L8YA 3K9GA 5D3QA 3LNCA 1NLYA 4C2UA 4XVQA 5C4GB 1T0JB 2ZRLA 5BN4A 1KO5A 1E1QA 2GCOB 2IXEA 2RGNA 4PC7A 3SS8A 3WP0A 4QM6A 2GVZC 2EW1A 3AKCA 3K0AB 2WICA 1GIAA 3ZGXA 1GAJA 3G5UA 1E1RA 3RRNA 1AM4D 5GJWC 2L0XA 4MUBA 3R20A 1Q12A 2G88A 4CW7A 1QHNA 5JECA 2B7CA 3IBGA 3BS4A 4KVGA 4ZDWA 1S8FA 2WJJA 3ASZA 2W6JA 4Q9KA 4GP6A 2JJ2D 4XVRA 1BS1A 3LBNA 2NO6A 4Q1AA 5BW8A 5FBRB 1VYUA 4FW9A 4A6PA 1YE8A 2E9SA 1SVIA 1YZLA 1BOFA 1CXZA 3HJNA 2AL7A 4RCZA 2QQEA 1QG4A 4E09A 1W1WA 4BASA 2DWPA 1D5CA 1HA3A 4RY2A 4NYIR 2I3BA 2OAP1 2IYUA 2WJHA 2PZEA 3HDTA 3RYTC 1VCNA 2IC5A 3X1WA 3FMIA 4PANA 1IAQA 2J0VA 2WM9B 4JIMA 5EZ6B 1L7VC 2A5DA 2PEZA 4HB0A 1OH8A 4MDFA 1P7CA 3NIBA 4FN5A 4LGMA 1YU9A 3Q7QA 1ZP6A 1E96A 1G7CA 3BB3A 1Z22A 4RSGA 4ASUA 1DAMA 3GFPA 1ZU5A 1JXMA 1Z28A 3K0EA 5G41A 1N6KA 1DG1G 1Z06A 5CIWA 3KQHA 2QU8A 2YOHA 5KSPA 2G1KA 1GZSA 3EWSA 1Q57A 1IN4A 2QT0A 4OHWA 2ZI6A 4URUR 3CRW1 1NP6A 1S3SA 3HU2A 3HPRA 3LW7A 5JJKA 1P72A 4I99A 4P4TA 2KJQA 2BMEA 1YRBA 4O0MA 1MO5A 4II7A 1UBFA 3AVVA 1KKMA 2AXNA 3ZYCA 1RVDA 5LPNA 1XXHB 2ZRCA 2ZIAA 2ZU6A 3LV8A 5EXXA 1ETUA 2WKRA 2JLUA 1WBBA 4Q1BA 4QGGA 1Q3HA 5HCNA 1G18A 4Q7JB 1W49A 2DFLA 3WP1B 2J9RA 4YXWA 2IYRA 4QGHA 2R62A 2GETA 2NO1A 2W2XA 4WXPA 2RHMA 2Q3MA 2A5YB 1DO0A 4NTZA 1TF7A 1XRJA 4MH0R 1OB2A 1OXXK 2GXUA 3KKMA 3AVYA 3GLIA 1W36B 3GJ6A 3KQUA 4ABYA 4KSBA 2RGEA 3AKYA 4M53A 2J3EA 1FNNA 2H16A 2Q9BA 4BLSA 721PA 2W00A 4LC0A 3B1WA 1KJZA 1YZKA 4C2TA 1M34E 3CIOA 3KUDA 4LPSA 2WWIA 3OFND 2H17A 4QXAA 1S1CA 2VSFA 3W8NA 4EPVA 1X8KA 4X8MA 3E70C 1GILA 3U7EB 3ZQJA 4L15A 1CJUC 4IDQA 3RS5A 1AQYA 1ZNWA 3CRMA 4GZLA 3K9HA 4P33A 5CB6A 1GP2A 1SXJA 2GZAA 3N5CA 1EFRA 1N3BA 5DNYB 2BHRA 1YKSA 2J5XA 2EYUA 4LV5B 4B3XA 3KB1A 1E2IA 4Q7MB 4YMWA 1II8B 1RW4A 1KI4A 2ZVPX 3QG1A 1IN8A 1YR6A 3QKTA 2J59A 3GJ4A 1W0JD 4GP7A 3OAAD 1P2UA 5FUYA 4FXPA 2YYZA 3C14C 4GSYA 1RYHA 4Q01A 1UBEA 4C4PA 1DELA 1KDRA 4Q1CA 3MWLA 2HDNB 2CHQA 2GEDA 2MMGA 2JLXA 1W4AA 4LBWA 3C5CA 4JT4A 4OJQA 2GF9A 4L9WA 5G40A 2W0SA 2RH5A 2NMVA 2F9LA 1CTQA 3I5XA 1HURA 1NG9A 1EFHA 3X1DA 1KJWA 1MH1A 2CDNA 3HWSA 5AUNB 2QAGB 3CPEA 3EARA 3RS4A 2JAQA 3QEOA 1OYYA 3TGPA 4XIGS 1KI6B 4Q4AB 1LF0A 2VSXA 4IOMA 3EZ2A 3I72A 2WVJA 3EPLA 4MITA 1GL9B 3HYTA 3LVQE 4M1KA 4TLDA 5AJYA 4HUTA 2FGJA 4A8JA 3L82B 5H70A 1E9BA 3VNVA 2F43A 3WMFA 2R65A 2ATVA 4M9XA 5LB2A 1M7BA 2QSZA 5KSOA 2Z5FA 5B58C 3AM1A 1DPFA 5DISB 2EU8A 5JJLA 1YR9A
chains in the Genus database with same CATH superfamily
2Q8PA 2NQ2C 1OU4A 3DFKA 4J16C 1XMSA 4B3BA 1XTVA 4D9NA 2SKCA 4DABA 4E70A 4EKGA 4KPEC 3BWVA 4MKXA 4ZO8A 3QXCA 5JAMA 4WUVA 2WYOA 4YMLA 1QRSA 3AI3A 3GZNB 3SHFA 4FR2A 3MGKA 4UREA 3E9RA 3KHKA 4RY9A 4DSUA 4I6JA 3CZQA 4I2NA 3IAXA 5MHTA 1Y4SA 3AEKA 3F97A 3LCVB 2BELA 4IDAA 1Z8FA 3VAYA 1ZY2A 4EJSB 5LZ4A 4LAFA 4HUQA 3GIDA 4XSVA 3E4CA 4RXUA 1BXGB 4WDQA 4MW4A 3RRMA 4EHLA 3FNRA 1KZ1A 2V9ZA 1KE2A 2IWHA 2AD1A 3P5SA 4GL4A 5E4JA 1P0IA 1SQSA 4UHFA 1E4VA 1YRWA 3M5WA 4B4OA 4FHDA 3QVKA 4B2PA 1U2GA 2GN6A 2PQ0A 3GJSA 1EK0A 1PR4A 1QTRA 1UJ5A 4JT9A 2FPMA 3N6VA 3R0IA 2YKGA 3FCAA 5K3DA 3TSYA 2WTUA 3I2HA 3CLUC 3I4CA 4RDIA 5IASA 4BEJA 1AZSC 3JD0A 3UKJA 2HSDA 3RIHA 3UWPA 1JDPA 5K3FA 2C3MA 1DUIA 2XX3A 4CT0A 4YRBA 4NCNA 4N9QA 3ZBQA 1JFFA 2C58A 4M86A 1M1YE 1EDOA 1UR5A 2CYCA 1SUDA 1SVNA 1W93A 2ZTMA 3MK31 1MB0A 4JLVA 1CIJA 1QV7A 2J6CA 2WI8A 3G9UA 3PK0A 4H4CA 3IUBA 4HJXA 1GRRA 2QYOA 4PZDA 2AD5A 2IA5A 4RKWA 2G09A 4FEAA 1FRVA 5EXSA 4OP1A 2ZKLA 4JWTA 5LC1A 3OOEA 3SBEA 2XB6A 1XKQA 1V16B 1JI3A 3WTBA 1K6EA 3RLIA 3FTCA 4QASA 3QLEA 4PCLA 1TGVA 4MPJA 3TL6A 4CLOB 4X65B 4RD4A 1QH9A 4CUJA 2XKKA 3RG8A 3GFOA 3R5TA 3IX7A 4OQPA 5KJEA 2VEDA 1IZ7A 2D0IA 2ILVA 4JCOA 3IA2A 2GZSA 3VJKA 4CMBA 4Z6KA 1YS1X 1QJ4A 2ZSEA 3SHQA 3HXMA 4ESHA 1N1EA 1FBNA 2M98A 2ZIWB 4LXXA 2AT1A 4OSPA 1PD0A 4DIBA 3D8RA 3WGNA 5C9ZA 2ZUCA 3D6AA 1F6WA 3GYGA 3TR6A 2JAOA 2IZ6A 3NZEA 2GCOA 2ZSHA 3FDIA 4LW8A 3TBHA 5BMVB 5ICMA 4TLLB 1XNGA 1T8PA 1GXSA 2WOJA 3FNGA 3RUFA 3P4XA 3O4RA 1FDUA 4J2OA 4ND3A 1TAGA 3FTEA 4TLEA 1H4SA 3SF0A 3DDWA 4H7PA 5ALYA 5F2EA 4GI2A 4ZVOA 4DMCA 1UINA 1XN4A 2CF5A 4BP1A 2AWOA 4C76A 1U0LA 3QVJA 1XD2B 2TECE 3I5UA 4KIJA 4B3TB 3P2IA 1EMDA 1I6KA 3TNDA 3IALA 3MTAA 4RHEA 1UMKA 4PX9A 1P7ZA 1CZHA 1S2DA 1E3JA 1ZNZA 1ZHHA 2KX7A 2Q5IA 4EY7A 4MHTA 1MQ8B 1Y3DE 5LZ2A 3DP7A 1J39A 4JVNA 3D7NA 1FTSA 1W4CA 2VQDA 1V8DA 3NWJA 3H0EA 2DBQA 3VDRA 5LDDC 3OQMA 3SEAA 1JEQA 5E0OA 3BMXA 1NE2A 2BTEA 3BTOA 1V7CA 4UM8B 4WN3A 4N18A 2HADA 2LGJA 3SVZA 2CLMB 4QPPA 2AMVA 1R0YA 2JEZA 4I4TA 2NZ8A 4XRRA 5DYTA 4C0BA 1TMYA 1XALA 4IFIA 2N75A 4Z2AA 1X0XA 4ZV4A 5JS8A 3EHEA 3GLFE 1KKLA 1B14A 3R3XA 4KQIA 4MCJA 2ZWMA 5A05A 4NENB 2J07A 3RUEA 1I0LA 4LCEA 2WIAA 1A9QA 1WHTB 4QGFA 5I7OA 5BY2A 1EXWA 2HB6A 3PFGA 2AKYA 1E9VA 1ORTA 1IZ9A 1NQAO 4CM8B 3U60B 2OD9A 4X6LA 1EHCA 4S3MA 3JASA 4R40A 4YNBA 3I30X 1WTCA 3BVPA 2NU9B 4O33A 2GBFA 4IXTA 3ROPA 3UOWA 5EUMA 5FHRA 3WLOA 4KAJA 1F0KA 2ZBPA 4IKOA 4A0FA 4D9KA 4EHKA 2DHEA 2LE0A 2QYTA 3MJDA 1PJ4A 4QUHA 5JJIA 3PVSA 1W47A 1BQ3A 1SCUA 1XXHA 2I7XA 3CO5A 2PU7A 2ZPAA 2VHCA 4ZQIA 1JLRA 3T54A 3TOVA 5KJ1A 4KXXA 2O5CA 2XD9A 2ZS7A 4E30A 3ENKA 2HX1A 1RI2A 5I9TA 4QUBA 1XZNA 1DEKA 2FCRA 4RETA 1GNSA 3H2SA 4DLLA 5ES3A 3SJ7A 2RK4A 1EUYA 3S2YA 1DQNA 2L18A 1MAWA 4HFMA 1QQ6A 2WTBA 3G8DA 3LT1A 1Q7TA 4OP3A 5CVDA 2ZRKA 5FWAA 3ECCA 3OWHA 2MU1A 2QPTA 2C54A 4FYPA 5K3CA 1PJCA 1H2WA 2P9ZA 2Q3EA 3LBYA 4NYMR 4A26A 1H3NA 1FJGB 3R3HA 3NANA 4UFPA 4LF8B 5EMJA 1UIMA 1CX9B 3NAGA 3RCBA 5K0GA 3IJRA 3GD7A 3KUKA 1YC5A 4XJSA 2JLSA 2ZVQX 2HSGA 1QMGA 2BFAA 2D0PB 4R54A 4FP9A 4EDFA 1XL1A 3I1YA 1H4VB 3ZLUA 5EWJB 1KH3A 1AV7A 3HN7A 3JYOA 4K2HA 3WNVA 5HKOA 2XXAB 1LJLA 5KNLA 1DT5A 1G5IA 2H00A 2QNBA 3CWCA 4JLMA 3MTDA 4RF3A 4PAWA 4XOIA 1TCAA 2HJSA 4KDFA 5TXGA 5AVWA 4IIGA 1Z4OA 3KXLA 1SKUA 2BGNA 3P94A 3DYVA 5BR4A 3FWHA 2VPXA 3VR4D 3NJRA 5H82A 2H2FA 4P1ZA 5AHOA 3NUQA 2D1QA 3R3ZA 4XD7A 5FAXA 4KPYA 2E37A 4KPUB 4UHEA 4DS3A 1ONOA 2XT6A 1QR2A 2BR5A 5EMKA 2F1OA 5FYQA 3QHAA 4EX6A 5P8WA 1H5UA 2PUJA 4OLJA 2QRNA 3TLGA 2I2XB 2GHTA 1WDKA 2CNOA 2R79A 1I4TD 4E12A 4JT2A 2H2WA 2Z58A 1UWLA 1AVTA 3EXAA 4LDRA 4RIEA 2X4DA 1YULA 3ADKA 5JWOA 1DT3A 4CCAA 1RRMA 1Y6FA 2OV4A 1UC4B 1HDGO 1ML3A 2AUMA 4MVYA 4JJAA 4U2KA 2AZTA 2RC5A 3QBEA 5I8WA 2BFFA 5H80A 4AWAA 2IV7A 5C37A 1NW7A 2VSQA 3LPAA 1LC0A 3ABSB 5FPPA 2O8EA 3ODPA 2FX3A 4FHGA 3GX1A 3K8ZA 1V11B 3W1EA 3GBSA 1QQ5A 1ULZA 3H2KA 5EWJA 5LLTA 5ISMA 3Q7IA 5C46F 1Z6TA 4L95C 2UVDA 1T4BA 2UZ4A 2PBFA 3U4AA 3OE4A 1CUWA 3ZKAA 4KXUA 2IEAA 4HDCA 4UMVA 5CJ2A 3P96A 3AL3A 3BIXA 4O1HA 4EDHA 2IEYA 2Z57A 3NBUA 1FXSA 2OPHA 3V1KA 1I7SB 3IO5A 2ZYVX 4A2CA 4IIJF 2UXDB 3V4SA 3AR9A 3PL5A 5E6UB 3FWZA 5HCIA 5KB3A 5KJCA 5CB4A 2BHNA 4N49A 3AJRA 4MW0A 3L7AA 3OIVA 1HG0A 1OKKD 1XROA 3Q6IA 4MRSA 4EYEA 4BPBA 1T3HA 4GQIA 1GLGA 1MJHA 2KLBA 3GROA 4JOSA 3PRKE 2RGWA 3ITEA 3AY7A 2ZIUB 2IZZA 4UUBA 1TC2A 2GZ2A 3K5HA 1L3BA 3QA3E 3T5MA 1Q7GA 1MOPA 5C7IO 5G4LA 1GPWB 5ALGA 2C1EA 2CT8A 5TNXA 1MT3A 1ZMBA 5CPFA 1MU0A 4BRWA 3GCGA 3Q0TA 2PSDA 3C6MA 3IB6A 3OTIA 2JLCA 2PLWA 3OX2A 3RREA 2LCFA 3TB6A 1P3JA 1LLFA 4HFJA 4LOIA 4UU8A 2PCLA 1NPYA 3AM5A 5I5GA 4UM7A 1NI4A 1P2BA 1A5TA 4IUYA 1R5OA 4AAYA 3KZXA 2BUCA 5EWLA 2NYAA 5FXMA 3CNBA 5BORA 1W5TA 2J5QA 4AZ0A 1GTG1 1ZL0A 1KQGA 3RYIB 4ZPJA 3A9VA 4PLWA 4B75A 4YDHB 1GUAA 5HX7A 1K8QA 1ISSA 1L5YA 4B4DA 1IEXA 2FNAA 1IBCA 1SIWA 2FWIA 4RKEA 4DIEA 1XZ8A 1FZQA 1T5SA 5LVAA 3VSAA 2B8WA 2YWDA 3TI7A 1ENZA 3C1TA 4HKTA 1LK7A 2I71A 1EXMA 3OBIA 4LYFA 4HZUB 3PXGA 5JMPA 3M6WA 4AURA 5KU1A 3V3TA 3BB1A 1KTVA 4ISBA 4IZHA 2NO7A 3MT9A 1Z4LA 2RGCA 4ZOAA 5E7IA 1JSLA 1N8SA 2GILA 5F52A 4GBED 4IDPA 3P52A 4B6FA 4MS1A 4FC7A 2Q49A 2W2KB 4MLCA 5IF3A 2HA0A 3TMAA 3KVRA 2VK4A 4XYEA 3LZCA 4M0PA 2DKOA 5E8JA 3W06A 5DHRA 5DM60 1FNDA 4K03A 1SZCA 2JK1A 4U1RA 3U49A 3ZZ0A 2FK7A 2WQ6A 4WNAB 1YS2X 3RQSA 1Q92A 4ZEVA 4X85A 1SXQA 4URHA 4D8UA 3EPKA 3W04A 2RHOA 1JDBB 4CMEC 3DAPA 1KYTA 3QU5A 3INRA 4KPGA 3GLGB 5T6BA 4HF7A 1Y9DA 2WE8A 3N76A 3IULA 1R6UA 3ELYA 4RD3A 4LCBA 2CSUA 1RLOA 2ZUBA 4YAEA 5FUWA 1N0HA 3AHDA 1RC8A 1XTQA 2KMLA 4BNUA 2IITA 2C2OA 3WMRA 2HV8A 3MJ4A 2FX2A 2ZULA 4XM2A 3BAZA 4DM7A 4MRVA 2VHJA 1YOVA 1AKNA 2XE8A 4RORA 4B6PA 4WOBA 4HNTA 3IEMA 2F43B 4N7BA 1G19A 2NTVA 3MS7A 2BMJA 1J0AA 4GPTA 3ZWCA 5G1PA 3GRAA 3DD1A 3U6KA 5J23A 1OLXB 1EFCA 1N5KA 4PM4A 1X2EA 3PE6A 5TY0A 2AMYA 4RC9A 1P5ZB 2DM6A 3TTTA 8OHMA 1TIBA 1JHZA 2QX9A 1XTIA 3M3PA 4MSUA 3PUHA 4MRPA 1XNRB 1GZDA 2J6IA 3VSEA 2W6PA 4XQ0A 3MXOA 5DLPA 5JHHB 4OQQA 4V0NA 1D2CA 1FFYA 3OZGA 4IJ6A 4JJKA 2VHZA 2VTVA 2PUBA 2DUUA 2I2WA 2P69A 4D4LA 5FV4A 3GBPA 5ENVA 2YXDA 2PYDA 2Z08A 2O2IA 5BVGB 2XGJA 5A9TA 3D3QA 2C9CA 1DE0A 4OHOA 1EIZA 3ZNPA 1N6NA 2JLYA 2CV1A 2G76A 4CM8A 3CW8X 2B0JA 1GR1A 1W4RA 3L05A 3L6DA 3OPQA 4K9QA 3PQFA 3ENNA 2RG7A 3T5BA 1XZQA 2XNKA 3BQMB 3QELB 3WRWA 1QP8A 1BXRA 1R6VA 1SBQA 3MLEA 4HAWA 5CNJA 3BRSA 4R2MA 4YJFA 2YUIA 4BLWA 4JLNA 4WXMA 2YRXA 5IBCA 4HDMA 2H4HA 3PUVA 3L1JA 4R2JA 3ZHQA 1GCIA 1RBMA 4IICA 3BK7A 5AW0A 2FMUA 5JH7B 2FEKA 1XZGA 3GVPA 4LSWA 3D6JA 4KBGA 1FTNA 3ZHOA 3U7QB 2QPOA 2JD0A 2O8FB 3MWEA 5J4LA 4OQNA 2I8LA 4X6YA 1ZCJA 4MWSA 1DRKA 2DPXA 4FHZA 2TMGA 3GFBA 4HWRA 3N2ZB 3WB2A 2CHEA 2VO1A 3DZFA 1H8HD 1H2HA 2DZDA 4CFZA 1J0XO 2X3FA 2B5OA 4PRLA 1TIKA 3H6HA 1K86A 3UMJA 1EK2A 3KJZA 2JJQA 3FDZA 3QGMA 4IIBA 2DXIA 1AGRA 2IVFA 1DJNA 1YNSA 4UNNA 1ILWA 1K9SA 4BFXA 4H31A 4C0SA 1XGKA 4M46A 5EIBC 4IIJB 2ZRIA 1SVOA 4GC9A 4HY3A 4P3YA 4C7VA 4D81A 1OBVA 1NFRA 4U7WA 5LMCA 4QQKA 4DE5A 2ODTX 5B1IA 5MN5A 5HZKA 1C3OA 2GEJA 3K5WA 1INLA 3ASVA 1JKXA 2NV2B 2ZVDA 3AEUB 4URFA 3Q0IA 2Y9MB 4DUZB 2F8TA 1E0AA 1JG6A 2OK8A 3LT5A 4I1YA 3PPYA 2V7XA 2OBXA 4LYHA 5HIMA 1H1LA 2R6GA 1ISGA 1S96A 1KR2A 2WOOA 4LXTA 4N8EA 4DIMA 3ZE9A 2HW8A 1LTQA 3NU1A 3OECA 5ITSA 4FU0A 5K8UA 1QIFA 1L5NA 1BXZA 3G5TA 4HGZA 5KTRA 3GXOA 2ZI4A 4KO3S 1ZH4A 1ZMOA 2C95A 3IJPA 4ZYYA 4MV1A 1YWGO 2D0DA 2DBYA 2ZTHA 2QRHA 4IO0A 3V33A 4E2XA 2W2LD 5JZBA 5HZHA 2A33A 3M5DA 1ND6A 3EVBA 2ACWA 2XZPA 5H3CA 3UT5A 1WBDA 1NURA 3OESA 1VHLA 3U9TA 1SC4A 1L7MA 2XA2A 5BSWA 2YXLA 2HO5A 3O5AA 1QH1B 3THOA 2AX3A 3ONNA 3WLMA 1PRYA 1U8EA 3HR4A 3M6LA 1ZJ6A 5IM5A 1Z0AA 2CLDX 5E2IA 4TN1A 1IFXA 1FP1D 1ZU4A 2ZAGA 3EE6A 2DFTA 4JU8A 3SYNA 5A6SA 1OGIA 3ICCA 4IIDA 3TQFA 1SJ9A 1NRJB 1KMIY 1AKYA 2R96A 4MR7B 4F8JA 3O0TA 1KVTA 2ZI3A 3M5CA 4PLYA 3S2UA 3FCEA 1G8KA 3KS9A 2R48A 4Q00A 3HZOA 2FPRA 5K0FA 4F2WA 3TDMA 3GLRA 5K8LA 2RGAA 1S7GA 2KBFA 2O0HA 5LQSA 4OUDB 5MFZA 5IT5A 3K31A 1GTVA 5CAEB 4JB0A 4P8RA 1ABFA 1E5DA 2YIJA 1E0SA 2O3SA 4UUAA 2ZUEA 1WXFA 4ROTA 3PF8A 4H2DA 4JL6A 5JWHA 5AI9A 3C6ZA 4FZJA 2BH9A 4BKQA 4EL5A 3T1QA 2IYAA 5LXTA 1W88B 5B36A 1P19A 1RABA 1Q3KA 3NM6B 3RSQA 5CW2A 3RABA 2GTHA 2FMHA 4AJNA 1CW2B 3U9SA 3IOYA 1ORDA 2OZLB 3HKDB 4KWHA 5H3LA 3U13A 1U2TA 4L73A 1QANA 3BJZA 2AEJA 2IOFK 3OEHA 2NG1A 4EENA 2ZYAA 4L16A 5L7TA 2H07A 2R7NA 3SSOA 3W5IA 2R87A 2VZ8A 4LX8A 2VF7A 2HEGA 3TTYA 2VPIA 4POOA 2WEKA 4I55B 3ADBA 4QTZA 1CR6A 4L76A 4PIMA 2ZBQA 3TOCA 3FSGA 9GPBA 3ADCA 1LLQA 3OP4A 5KNDH 2IS6A 4FK8A 2NVBA 4L9RA 4F1WA 3OCVA 5BWOA 1F5NA 1OT3A 4JGGA 3EFBA 2G70A 2GEKA 1UXGA 2KE5A 3ODGA 1G21E 1MJGA 3TCXB 2BOVA 1MX3A 3LP8A 1R50A 2PWPA 1F51E 5B12A 1FA9A 2B37A 2RGGA 3BGDA 3GFGA 1NWCA 3I28A 5F2KA 4ZKEA 3SCZA 2BW0A 2PGAA 5ESWA 4IG4A 2XRZA 2MSWA 3WHLA 5LA6A 4PHCA 2V9CA 3ADDA 3OQHA 1OLXA 4XUGB 3WGHA 4ZVMA 3GEEA 4MO9A 4QA9A 1M1ZA 1TADA 4NARA 1L8OA 4ZCMA 5BW8A 5EQJB 2P2ZA 1KEZA 4FZRA 5AVRA 1R6DA 2QXUA 4HX2A 1XXLA 4KXWA 3SS7X 2WIJA 3U19A 3EH2A 4DNQA 2ZYSA 4U7HA 5IT4A 2V0GA 4QHTA 1CUJA 3T1YB 3CLUD 4WJKB 4LSZA 4FT2A 4C08A 2R751 2E49A 4U9UA 5IJAA 1Q0HA 2PK3A 1I2BA 1ACLA 2RH9B 2D4HA 3OJFA 1Q84A 4EY4A 1D6SA 3KP1A 3WMGA 1TU4A 1YZNA 3CLRC 4AX4A 2C0PA 1I14A 2X8WA 2I1WA 1UMCB 3EVDA 5HVNA 2EDAA 4J9VA 4NZPA 1ORWA 3K0BA 5AKHA 3FCSB 5FUBA 1JIVA 3LG2A 3TUZC 1EAMA 3KPYA 1QORA 4OHZA 2WV9A 2QTVB 5DRTA 3OHSX 1DRVA 1U3VA 2YYSA 4XXHA 4RS4A 2CD7A 5ICEA 3UC5A 4PC3A 1E2QA 1TPYA 1BSVA 1YDGA 2J33A 3A6EA 3E8XA 1AGPA 4QXQA 2Z5VA 2A0UA 5FA8A 3L8CA 1ECLA 1BKSB 2P5YA 1CP3A 3ILVA 3ZHRA 4PPYA 1U7XA 3WLLA 4YB8A 2IEIA 3AUXA 3U44B 3I8SA 1VCOA 1N9ZA 5K3FB 3WGZA 5HZMA 1A1VA 4DR6B 1KYXA 4M36A 1F3LA 5K3SA 4R7ZA 3TZBA 3UM9A 1JZTA 2GMWA 3EEOA 1DAKA 4TMFA 5B3AA 2JGLA 1X7GA 2X8JB 3M6FA 1QB8A 3AIOA 3K9LA 4TUYA 2P5TB 4M22A 4BPRA 4B74A 3AVOA 3M6UA 4GOJA 4RACA 3QBDA 4BKMA 5KTKA 1J6UA 4LI0A 3OFVA 2IE0A 3LUFA 4M55A 1U2EA 3AUAA 4F72A 1APBA 5EI5A 3MMPA 2UYGA 4YUVA 3OI7A 1RWBA 2A9QA 3G02A 3QUBA 1OWPA 4KTTE 1T35A 5J2UA 1C81A 1V2HE 3A58B 2EARA 4GQAA 4INAA 2NP7A 4GGPA 1P2VA 2WSSD 4DRYA 5A4KA 4NCKA 1JECA 1GG5A 1QO7A 1C1XB 5BT8A 2ONZA 1K68A 5BVHA 1UAAA 2NUTB 4BKUA 2YQ5A 2WPNA 4WCFA 4H1UA 3BXXA 4CVNA 3Q3IA 1DKNA 2FOXA 3CR3C 3CLTD 1XRRA 4JK3A 5CPBA 2P7HA 3IHKA 3HSKA 1CZLA 2JEOA 1W2GA 1UJMA 4QDOA 4A23A 4BNDB 3ZDAA 1AH2A 1E1NA 4WZAB 3CUSA 3THRA 2Q3FA 4LNHA 1YB6A 4W1SA 5JLJA 1ZISA 5IKPA 5EZ5A 1N5RA 3CEPB 4P0PB 3UVEA 4QAQA 1K66A 4L74A 2O3UA 1VLMA 4OLHA 1KKUA 4B7XA 2JCVA 2R8OA 1E66A 3VBEA 4AMZA 3K9QO 3THXA 3CR7A 1IUKA 1OASA 2JH8A 2OLKA 3SC3A 3T3PB 3W8FA 7REQB 1R37A 1BJTA 2IW3A 5AHWA 1P4SA 5BWMA 4YCLA 1BWSA 4KU4A 3U4CA 1IXKA 1AE1A 1DIRA 5B3KA 4KSYA 1Q0UA 4AJJA 5K0SA 3DBLB 2AR7A 3OU7A 2C2YA 3CUVA 1XKTA 2VBIA 4HNHA 1GGMA 4TGLA 5DSTA 2PA3A 1LV7A 2Z56A 3C48A 4EKNB 1T8RA 4S04A 1P0QA 3RK1A 3DYBA 5EZQA 4AP5A 4EMSA 3MQFA 3GGSA 6GPBA 3I76A 3INYA 4JBGA 4FMDB 4Q93A 2JI7A 4MWZA 2V8OA 3ELUA 1MMFB 3GJXC 4ZRNA 4NE9A 3GLIE 1B1AA 4HAXA 4DF3A 2WLTA 5ELXA 2CLLB 1R3UA 2DMRA 3PFCA 2XKJE 4OH7A 3F0TA 1H9CA 2FW8A 3C7TA 4WZAA 3UY4A 1L7PA 1E1CB 1J20A 1U28C 3IUEA 5ICFA 3BX1A 2PY6A 5HCUA 2IVZA 2B20A 4DCOA 3IUNA 3WNZA 2V3CC 3IQEA 2ZAOA 3UHOA 3T1OA 4RVNA 4MMZB 2HHJA 1H8ED 3LWDA 2PS9A 2FEPA 2VNIA 4TL6A 4D9JA 3RBAA 3IQHX 1DOAA 4ND8A 1BJKA 4YPFA 4MEJA 5A4DA 5CW1A 1J0CA 1AKTA 1U8TA 1OW3B 1DX4A 4MW9A 4REMA 3IR7A 4WK6A 1NR1A 4INZA 5F51A 1ZD1A 3UJ9A 1FYEA 3KQSA 4CKYA 3BWXA 3PRHA 5JXJA 3UHJA 3X1KA 3KSMA 5ELMA 1NUUA 1JHMA 4XFKA 4RQBA 1RLJA 2ZREA 1K7EB 4QWWA 5BNIA 3FJOA 4W9RA 1JMKC 4CEIA 3V8EA 4AZWA 4TV9F 2N46A 4JZKA 2BKAA 3H5IA 4RCVA 4E1VA 3OZVA 1AGYA 3D6NB 1HQYE 2AOXA 4X91A 5AVQA 5HTOA 1J1UA 3C1AA 2EERA 1UXKA 1MRNA 2HPHA 1B0PA 1K92A 1T5HX 2R6AA 2YZNA 3ICVA 3LT0A 4LGCA 1JFVA 2WHPA 4AG3A 1VHTA 3IBFA 1JEYA 1CRPA 2B1IA 3L0IB 3M6VA 2ZUTA 5AI8A 5KOIA 3BRQA 1UOPA 2Q07A 1QQBA 2G25A 4YFVA 2GAAA 5E3JA 1TVCA 2Q4EA 4CZ2A 4HG2A 3W8DA 3VJRA 5IUKC 2REQB 3KKNA 1VFNA 3LC0A 3P2YA 2VN8A 1L5FA 3L4JA 1M5RA 4HNQA 3VAAA 4TS4A 1TM5E 4R69A 5G0WA 1FNMA 3P20A 1ZKMA 1E2NA 4M9ZA 4IV5A 3EIFA 2E1PA 3CCBA 4ND8B 5E95A 1ZAYA 1PIWA 1KEEA 3N8KA 1BOOA 3RIXA 1OXTA 4YRZA 2R84A 3N7TA 3DGEC 1RZRA 1YDMA 4QIHA 4Z2YA 1PR0A 3DEHA 1E77A 1KTIA 1G8YA 2NXJA 2QD2A 3PQ2A 4G5RA 4ZZ2A 4JUDX 4QGAA 3DUFA 2AYYA 4OVKA 4B7AA 4PYLA 3A0RB 5CXUA 1PN3A 4LSGA 1WPQA 3ZJVA 2Y1LA 1M7HA 4RANA 2BMAA 4E3ZA 2P6RA 4R2LA 3HP1A 3HCEA 3F7NA 1Z26A 3S2ZA 3DG9A 3ROMA 4R41A 4JUCA 4IWXA 5E6SA 1NFFA 1NVUQ 1EM6A 1LQUA 2R7KA 3B9BA 1YBHA 1S9DA 4JZYA 4KQFA 3TWOA 4PYOA 5AVTA 5KOYA 4MW1A 1PF7E 3LF1A 1KP3A 1XPRA 4ZYWA 4IO1A 3K9CA 2H29A 4AJ1A 1UMBA 1Z9BA 1K6XA 4L2IB 5L4NA 3M9XA 2D2IA 4PLCA 3W7AA 4YRSA 2FQ1A 3ZDYB 4B33A 2B7BA 4D4JA 5IVHA 4ERNA 1T6XA 2WE7A 1NBWB 3N9IA 3MLAA 4IZ6A 1B42A 2L82A 3PUWA 4YFYA 1JEDA 2GHRA 3X0DA 1JNYA 2W2QA 2YWRA 3Q98A 4MIKA 4V3BA 2HSWA 5E6UA 4Y9SA 4JAVC 5HF8A 5JCOC 4PINA 3ZE8A 2JFWA 2XUFA 5HIAA 5JYCA 1G8HA 1DEAA 2YIDA 3V6MA 3WK7A 5DNWA 1H93A 2GPYA 4I4IA 3GDFA 1VJCA 3TRHA 4Q3DA 2AJTA 1E4YA 3F71A 4ISCA 5BNTA 1DLIA 1WCV1 1QE3A 3AH8A 2XUIA 3U7HB 3HRHA 1YQ9A 4DC0A 2J48A 3L7YA 3HCFA 1DAGA 1M73E 4OHUA 3R5SA 1BNCA 4EIWA 1UWVA 1V37A 1HLGA 3GR6A 3G2KA 4P2GA 4TYQA 2NLOA 3N2IA 3ZS8A 4BQRA 2G63A 4BNHA 5A9SB 2E5FA 3NDIA 3UV3A 1W1UA 3UENA 2FRDA 1E4EA 3O38A 4YJKA 1NJ1A 2NQ8A 2R1ZA 1M2WA 4UE2A 2ZYWX 5EMLA 5FLXA 4BE9A 3MWFA 1MOQA 2YASA 1Q15A 5KC8A 5IH7A 1ES9A 3JS5A 1H66A 1I3NA 4BQOA 3PQ7A 3NYRA 4MHOA 1T0IA 3L04A 5BNZA 3RADC 1G6KA 3T52A 3BEOA 3MJHA 3ELWA 1CCWA 3D7LA 1IQ0A 2QL6A 4GWKA 4V0LA 5BQOA 4C0QC 1VPEA 4HNUA 4YAOA 1ECJA 1Y0BA 2OCLA 4WCVA 2A9RA 4B47A 3TG8A 2HYIC 2CFIA 2GXSA 2DWOA 3D3JA 2MTBA 1JWAB 2XPCA 4FE4A 4R2XA 5FBWB 1XMJA 3UBMA 3WOVA 4CN8A 3T1VA 4DMKA 4RKYA 1GN9A 3H2JA 3MCWA 5K6TA 1E7RA 4ENWA 1DC8A 1N5JA 2FFJA 2H48A 5AM2A 4B5LA 1WMBA 2E4XA 3VKUA 1L6IA 3TGWA 4CR7A 5FIUA 5CDFE 4BJ1A 4W5OA 2M6LA 1SU6A 2QY6A 1KDOA 2PSEA 4WW0A 1FU7A 2W2PA 2W93A 1WWKA 4RULA 1XPJA 2QMEA 3ROEA 3U7EB 2YJ3A 1CC1S 1Z0DA 1BMFA 3ZQJA 2X15A 2RAPA 1O87A 1SBNE 3QVTA 5T8KA 4D0GA 1VECA 4Q7KA 4M8KA 3CTPA 4CGYA 1II9A 1Z5OA 1DBWA 1MJFA 3C8HA 3BWMA 1I3MA 1BFUA 4KN6A 2CE7A 2ZBRA 4TS3A 5CFZA 3DF7A 2QN3A 1KIMA 5FNVA 1GSIA 4BCDA 1HLDA 2H7CA 4Z7QB 1E3IA 4IHJB 1VI5A 2ZWVA 3DMDA 2J45A 4ONEA 4TT3A 4QREA 3RS0A 3AM3A 3ECAA 4O29A 4UNSA 4AMUA 2WF8A 4YI3A 4F85A 1CJCA 1IG0A 4LGVA 2PZBA 2YVQA 1WRBA 2NUAA 4N0QA 4X1YA 1XCMA 2Q27A 3M34A 5DMXA 4RU1A 1TUIA 3P27A 2C04A 5AW4A 1T43A 2G9ZA 1QLHA 4PYIA 1W4LA 5E7QA 3I09A 1T0UA 2YTZA 4ITUA 4JYBA 3RFCA 3DHWC 3JRNA 2DLNA 3BZUA 4G0OA 1LLCA 3P7MA 3CGWA 4YGYA 2GA8A 4JC4A 3ZE6A 4CT5A 1HOTA 2IKSA 5AKIA 1N9KA 1NRIA 1XKLA 1XCBA 1ZSVA 2H2GA 3HXTA 3IURA 4YMUA 3U5TA 2WW8A 2ZYTX 4DCVA 2K2QB 4PBTA 4DYDA 1BVRA 1V45E 3MHPA 3JVUA 3FFAA 1QG6A 1H0SA 5FI5A 2VBCA 2FDXA 1YBFA 2Y92A 3BZWA 4PPGA 4M38A 4WRRA 4ZMRA 1YQUA 2H52A 4L8FA 4C3OB 1AK9A 2QLJA 4L0CA 4NDAA 3L8HA 2XBUA 2FF7A 4XEHA 4JLBA 4D3XA 3AKEA 4MLDA 3S28A 1A2KC 3HB9A 1MO3A 4EM6A 1Y4DE 3I39X 2N42A 3H1TA 3ID6C 1J00A 2R9VA 3DLAA 4OHPA 4TUYB 5IBRA 5F73A 3UXYA 4AQ7A 2BGUA 3B1XA 5DHPA 2EHDA 4P81A 4HUJA 4PE5B 3RNLA 4L8VA 3A1TA 3M83A 1QFJA 1MHTA 1IULA 2P75A 3AV3A 4FHFA 2B35A 2A88A 4LE0A 1U0NA 3IVRA 3IL2A 2DYKA 3N2GB 4DSZA 1G8AA 2QUZA 4ALKA 4CNQA 1T13A 4QOSA 5JS1A 2O8FA 3QEAZ 4F11A 1O94D 3EA4A 4ENVA 2EZ8A 4L5AA 1MTOA 3QNMA 3SOPA 3WRYC 3F3KA 4GAEA 1LXCA 2PKYX 3TW4A 2YN4A 1V4NA 3JQ8A 4BAUA 4W5JA 1DB3A 2B99A 3RVLA 5I9SA 2XHEA 2PPVA 1E6CA 2I99A 4KLNA 1ZUNB 1K2VN 1G2OA 2YFKA 3OO0A 4D9EA 3IV9A 4C4SA 2XUAA 4YJHA 4LHYA 5F9HA 4L4RA 5HA5A 1QM5A 3TZHA 3EGXB 5JS2A 1O97C 4KQMA 5HNKA 2Y6VA 4W63A 4RK1A 1RXYA 2ZUVA 3ZHCA 3W1VA 1Z6YA 1FE8A 3SDSA 4R7GA 4U5QA 5GQSA 2XUGA 1G8SA 5FA6A 5JUWA 1UP6A 4HWTA 1C30A 2ZRDA 2IY7A 2XMRA 2EKLA 3ONWA 4G5QA 3A4MA 4XDGA 4Z0NA 5CTAA 1C2YA 2W4MA 3K6KA 4MICA 4C7OB 1VDZA 4ITRC 3W9BA 3NBKA 4Q3BA 1X7YA 3ZBUA 1ZITA 2CLKB 3PXCX 3TNYA 1E6LA 5EJ4A 2VRWA 1TAQA 3Q8KA 5FO0A 3HXQA 5G02A 3O2SB 3BMOB 1LRKA 1AN0A 4KL8S 2FWMX 1QX4A 1CEEA 1AO3A 1I33A 1RZVA 2QS9A 3IPXA 2VF8A 2AFVA 4GI7A 3EQZA 1U0FA 2D62A 3ESQA 5TGZA 5TQ2A 1LK5A 1S89A 1G0NA 1L5RA 3E22B 2OWDA 4QYSA 3KPUA 3WGMA 2X0IA 3UMBA 4OI4A 2XGSA 1XP8A 4AMGA 1WUIS 2V45A 4L5CA 1RJ9B 1XN1A 5SZIA 2AJCA 2V6BA 3QXXA 3ZQKA 1NP3A 4EITA 1E2GA 1ZIPA 4JT8A 1YQGA 4GM4A 4S1PA 1SQ6A 3BMCA 4HC4A 1HE5A 3W2FA 3LQKA 4XB6B 4CLDA 1SUAA 2HU2A 4CMEA 3RTAA 1VMEA 1NAHA 4MS1B 1SCAA 1XL0A 3KQOA 3VZRA 2A9OA 5TF0A 1SULA 5LU8A 4KNYA 2PL5A 4BMNA 2VZ9A 3WL5A 5CFQA 3KC2A 4UKDA 5GADl 4OI1A 1TFRA 4WTOA 1AO0A 1NNUA 2OBMA 1VOTA 2V1XA 3C3BA 1F8FA 4MYUA 5C34B 3WLKX 621PA 2HIGA 2JGJA 5L95A 1F7VA 2BKXA 2D2EA 1JJBA 2PRIA 4M89A 4AS1A 2CJWA 3KKPA 4IMJB 3EWNA 2DQKA 1RPZA 3C5HA 2QD3A 4G9BA 1O58A 1J2YA 1Z4NA 4TMXA 5JARA 3LL4A 3BSWA 1BC5A 2WJ3A 3T3DA 2C5EA 1NN0A 1SHLA 1S3IA 3L0PA 4RA6A 4YRDA 3HI4A 3NTUA 4WZBB 3VPSA 2GF0A 1NXSA 5JRZA 4ZI7A 1OXUA 2F6RA 2PRSA 4I55F 4XD7D 5EUQB 3WWOA 4FHEA 4CM4A 1N77A 4F7WA 1E7WA 4HVTA 3TYXA 1NXXA 1HE1C 2EKZA 1GFZA 4QUJA 2O59A 2HA2A 1E7YA 2J7KA 3DLIA 2WYUA 4JNKA 4NENA 4MKRA 1NR5A 4D3FA 1X6VA 2Z8YM 4I14A 2ZDGA 1Y7PA 4G3XA 1M83A 2VUIB 5M7EA 4DVJA 3GF4A 4Z5XA 3EFHA 2YWCA 4I5GA 2ESRA 1ITZA 1PT6A 2PH7A 3S8EA 4KRYA 5KNCD 3U7FB 3ITDA 2ERXA 3VZCA 2P0AA 1DBIA 4AYXA 3U56A 2YV3A 3G59A 5CLHA 1ISPA 1BRTA 2AF3C 1WV1A 1YQDA 4B17A 3P1JA 2A7XA 2F3UA 3NTVA 4ADSG 3M6AA 1RYDA 4TMZA 2A9KA 3LQQA 2NZ2A 1RJGA 4TVBA 3AFMA 5ALMA 4ASUD 2GM4A 4LNUA 3E58A 1SUEA 4UM5A 3BE6A 4EK9A 5AFSA 1USGA 2F64A 3AB3A 2W90A 5SV2A 1SVMA 3QFSA 1V9LA 3RJZA 5DGDA 4CL0A 5CFNA 2ONJA 1USVA 1CUXA 2UXCB 4IXMA 5BNWA 3G79A 1YL6A 4V1CA 3LP5A 1W0CA 5IEJA 3T12A 3GEPA 1MTZA 1VYHA 1NU8A 3M6MD 5L7YA 4D44A 3AKDA 1FF9A 1I30A 2C5LA 3COVA 1Q16A 3PNYA 1SHTX 1TTTA 4W5RA 3I9LA 2FUCA 3EG9B 5JI2E 3WV5A 1GJRA 1ORRA 2PMKA 4R8KA 5KTYA 3A70A 5AQEA 3SHVA 3ETHA 1HTBA 1G7TA 2X9LA 4KR3A 3HA2A 2R7LA 1JYSA 4H77A 4LKRA 1ULHA 2QK4A 1ZUHA 2M2IA 4ZRMA 3PNPA 3FB4A 3CRVA 5JOQA 3EGEA