4Q02A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q02A00
2EYQA 4MKHA 3TJZA 1P62B 2V1XA 3CO5A 1KK0A 821PA 1US8B 2CL0X 1NMYA 1ZMXA 3FVQA 4HDCA 3LAWA 2AWOA 2I1QA 4GSYA 4A6XA 3AF0A 4BEBA 1HV8A 2PJZA 2QSZA 3BB1A 1W0KA 3AVWA 3CF0A 2WSSD 2HF8A 3KL4A 1SHZA 1Q3TA 3BK7A 1XB2A 2JCSA 2ZE5A 2OM2A 5CM8B 4DB2A 2FE4A 4PO1A 1JNYA 2RGNC 1NJFA 2ZI7A 1E2HA 2W2TA 4F91B 1MR3F 2GBLC 5FI1B 1P9RA 1DARA 4ZDJA 4PC6A 4KITB 3L0OA 3OE7D 1GDDA 3T1VA 4NCNA 3DKVA 4LBVA 3Q7PA 2G0NA 3RC3A 3BJIC 4B76A 3KQUA 4F38A 4JLKA 3EXAA 2J0UA 4ARZB 3FKSA 2FPLA 2C77A 1T3LA 1A1VA 4EJSC 4N0DA 4KLZA 4HSEA 1MRSA 1BH2A 2XXAA 4C0SA 4MKIA 4MRRA 3BS4A 3NKVA 1QG4A 3PG5A 4ACAA 1FUKA 2WBLC 4O2RA 4QNRA 3ZH9B 1SVLA 4HEJA 1NLYA 1M6NA 1VHTA 4MUAA 2OESA 4U5XA 5JSZA 4B73A 2YWFA 1BOFA 3PEUA 4MYHA 1IBRA 1OW3B 2XEXA 2DWPA 2GVZC 3KXKA 1TUEA 2FMXA 4BFTA 1CIPA 4MRPA 1E99A 1R7RA 1CEEA 1G3IA 2HCJB 1WDTA 5KOYA 1XWIA 2RAPA 1YRBA 3NVAA 2ZR9A 4IRUB 1ZM7A 2D74A 2CBZA 3IPXA 2R9VA 4FMCF 4E03A 4HATA 1DVRA 3LO5A 5DISB 1EXMA 2A5YB 4CEIB 3E2IA 4URUR 1W47A 4D2IA 4DDWA 8OHMA 2ZSFA 2WWFA 3PUZA 1E9FA 3KZ1E 4HYYA 1NF3A 4C7OA 1HYQA 1MO3A 4NCHA 4FWIB 3VR3A 5ANRB 5DSZA 1F60A 1AZTA 3EPHA 1BYIA 1MRNA 2PT5A 1G7SA 4B6FA 2NZJA 5KYKA 2HJGA 2O8CB 5JRZA 5ELXA 2F1JA 4DCUA 3K9HA 2ATVA 4G0NA 2PEZA 2WJYA 2XNDA 1H8ED 3I62A 3K70D 4UNRA 3V4FA 4IEEA 4LPKA 5D3MB 3BORA 4PANA 4IXMA 3A37A 1N6OA 4GI7A 4KO8A 2R6GA 5KNBA 4A2PA 1B23P 3ETLA 2C98A 1W44A 4A9AA 5FTLA 4TQUS 1F6BA 4JL6A 2ZRPA 4DRZA 2ZRKA 4WXPA 1BYUA 3REGA 2JLWA 1ODFA 2PBRA 3K9LA 3BD9A 1OXSC 2CL7X 3IIMA 4PHHA 1CR2A 3RANA 3TW4A 2BHRA 4LDJA 4MRVA 4Q7MB 3UKDA 2Z83A 2B6HA 3IILA 4A8JB 1VCNA 1ZC3A 2ZSEA 3CPHA 2OT3B 2ZI4A 2AKAB 3GPLA 5FL7A 3W6PA 3M0EA 4OHZA 1XZQA 1G8PA 5DN6A 1HEIA 1XTJA 1E2DA 4UJ5A 1G64A 2FFBA 2QMUA 3EG5A 2LCFA 1T3HA 4WAUA 2B21A 1G21E 4JMPA 4MKGA 3K70C 3QBTA 5HTKA 4OBEA 4AKEA 1UKYA 3T5GA 4AIIA 1D9XA 4V03A 3SHWA 3B1YA 1A2KC 2VEDA 2J9RA 2CK3A 2VTKA 3FMPB 4C4PA 3O8CA 1QHHA 2Q9AA 2KBEA 3HR8A 1E2IA 1RE0A 2RGCA 1Z3IX 1F2UB 1G6HA 2OFWA 4PHFA 2LKCA 3JVVA 5DHFA 3UXMA 4CT4B 1W2HA 4YQFA 1Z6TA 1U8AA 1R8QA 4TZ0A 1VG1A 4DLSA 2CLDX 1RRFA 3VX3A 4TYNA 1JI0A 4G1UC 1IN5A 1KNQA 2AD5A 2EQBA 2OHFA 5CIQA 4BRUA 2XOKA 2OXCA 1GOTA 4G5QA 1T8UA 1XX6A 2ZRNA 3SHFA 1N0VC 4EPRA 1G3UA 2XB2A 1F2TA 3TNFA 1XPRA 1S9HA 1OB5A 1U0LA 1NNEA 3TVDA 1XD8A 3QF4B 1GILA 1CRPA 2MSDB 2AX4A 4EAQA 4FCWA 4XOIA 1N25A 4CF7A 1GSIA 2HT6A 4LK2A 1COWD 5HCNA 2GF0A 2EWVA 1ZNXA 4DLVA 4YONB 4LBWA 4URWR 2CVFA 1D9ZA 3TBKA 1QRAA 1E79A 1Z08A 4RCZA 5BXQC 3DO6A 2YC2C 3CH4B 2EWWA 4MUBA 2HDNB 4R71A 1XMSA 3BFKA 2RGNA 4OI4A 2UVQA 1QHSA 3K0AB 4I1OA 2ZROA 1VCIA 1BO6A 3QSYA 4JSTA 5BQ5A 1KK2A 5EE1A 1L2TA 1P2UA 3RWOA 4JLDA 1GFIA 4UNQA 3VR4A 5JS8A 4B34A 2R6FA 2Z4RA 4ZV4A 3S1AA 2GCOA 3OAAD 3CBQA 1GG2A 1XD2B 3TW8B 2OFOA 3U3OA 3U60B 3WBKA 1DS6A 1E9RA 2RHDA 2WM9B 3QVUA 1K8RA 5FPSA 1DAEA 3F3YA 2DFKB 2JJ1D 3O8BA 5FTJA 5CJPA 1KGDA 2EFDB 3I8XA 3SE0A 4X8LA 3WHLA 4DLZA 3VX4A 2HYIC 1ZU4A 3EIEA 1K6MA 1HE8B 2CMKA 5IRCD 1FW6A 1RYHA 3FMFA 1KSJA 1N6NA 1JALA 2JIZA 3AKCA 3U44A 1T9HA 3KX2A 4GNKA 3OESA 2CNWA 1Z2CA 5CJ2A 3OEHD 4PSKA 3DEFA 3OE7A 2IW3A 2FV8A 2Z4SA 2FU5C 4IXNA 2C5LA 3OZXA 1T5LA 2QBYA 2V7QD 4HAXA 4LPSA 2E1RA 3HJNA 2WJIA 4PSVA 2C2HA 4GPTA 2ZRHA 4ESHA 4TT3D 2P5SA 4JBXA 3V00A 4YDSA 2GEUA 3EZ2A 2OCPA 1X1RA 5E95A 2GESA 1VDZA 2QP4A 1NVXQ 4IFBA 3WRYC 2YOFA 4TYPA 1SZPA 3FHCB 3CWQA 2RGBA 3AGQA 1NP6A 1QVRA 5J4YA 1R0XA 2ZJ2A 4BRWA 1OFIA 4KYUA 1S2MA 2GZHA 1DTSA 2FF7A 4JLOA 621PA 2GKSA 3EA0A 2QT0A 3MJRA 4D0LB 4DCSA 3TUIC 2OCAA 3CRMA 1G4UR 4TSFD 2KSQA 4TMZA 1I2MA 3LLUA 1EFRA 1FL9A 2XITA 4URYR 4ABYA 4W9MC 1EESA 521PA 1KZGB 1RYFA 3CNOA 2PT7A 2D3WA 1AQUA 4OK5A 3VNUA 3NHAA 4KFRA 3QKUA 4F93B 3GLIA 1ZP6A 2OO7A 1XEXB 4FCTA 3A4MA 4W7SA 3QXSA 4BECA 3GEHA 2F1HA 3CIOA 4OHVA 3X1WA 3AVVA 2R44A 1E0SA 3A4NA 5EZ6B 3HPQA 1R4AA 2GHIA 1FX0A 2QPTA 4LJ8A 4NBSA 4BZXA 5DI9A 2DFNA 3I92A 3ZS8A 3QKSA 3PUYA 2GXSA 3PENA 4M1KA 3TAHA 2IYWA 3U7HB 2YJTD 2XAUA 3BAFA 4JJZA 1NBMA 1G9XA 3LA6A 4Q4JB 1PLJA 1KY2A 1XD9A 5B30A 1TTTA 3AKDA 4OJKA 1D8TA 5JMTA 4KBFA 3MAAC 4Z8YA 1N5KA 1IOZA 1LVGA 2ERYA 3GLGB 3NC1C 1NIPA 3BGWA 1OXVA 1TQ4A 4KXFB 4WXRA 3U3KA 3ZYCA 4B3DA 1AA9A 4HZIA 4B47A 1W5TA 2ASEA 2GF9A 3LVQE 4LYHA 2F7SA 3WYFA 2QUZA 4TQ9A 3ZIAA 1P3JA 3CNNA 4EPWA 3KJIA 4IOKA 2ZREA 3VTKA 1ZM9A 1IN7A 1XEWX 3W5JA 3VR2A 3X2SA 5CB6A 1OIXA 3BIFA 4MA4A 3DDCA 1XTIA 2BMEA 2F9MA 4JLAA 1PLKA 1UEIA 5HR5A 4QGAA 2QMHA 2V55B 3RRMA 2DFTA 2XGJA 2UKDA 4FN5A 4DWJA 4CEJB 4HLDA 1GRRA 3EPKA 1KMQA 3HR7A 2JEOA 1ZBDA 2QM8A 4DDTA 1CR4A 4PC1A 3AP2A 2ORWA 3OIWA 3AKEA 5FBLB 1XZPA 1CJMA 2ORIA 5IDVA 2G88A 4B35A 1GL7A 1M2OB 2AFHE 2YINC 4D0NA 1Q21A 4M9SA 2ATXA 3HU1A 1W0KD 1D6JA 1Z6GA 1ZCBA 4DLWA 4LYFA 1YZLA 2BBOA 2QAGC 1J7KA 5JWRA 3AGPA 1U0JA 5BN5A 1UKZA 2GJ8A 2XSZA 2YC4C 2BMJA 1W48A 2OCBA 2IF2A 2YOGA 1P60A 2JLZA 3LW8A 3LBIA 1OH6A 2DHRA 1COWA 1Z0JA 5H1YA 3R9IA 1Q1ZA 5HE9A 2NMVA 2Q21A 4CW7A 2WKRA 3UPUA 2V8OA 3C41J 1SXJA 1DBSA 3VNVA 5FR2A 3GP8A 4OK3A 1YQTA 1MOZA 3IO5A 1E2EA 2FN4A 2A5GA 2I4IA 2H17A 4BLPA 1GRQA 3FKSD 2ZU0C 1M34E 3EPLA 4JLVA 3QF7A 3KKNA 4AKHA 2ZPTX 3K9NA 3SJCA 2VP9A 3RSLA 5F9FA 1L4UA 1Q0UA 2QMOA 3REFA 2L0XA 3K09A 3JVUA 5FL3A 4GZMA 5L3RA 3PVSA 5AJWA 1RJ9B 1JEDA 5FTMA 3MWLA 2ZEJA 1PUJA 3R7WB 2J7KA 4EJSB 3SI7A 2WAXA 1KI1A 4A0RA 2GDJA 5H68A 1XBTA 4LHZA 3IPYA 5BN4A 5F9HA 1NLZA 1UFQA 4Q1AA 2JJ1A 4P4TA 2LWIA 2X8AA 1XU4A 4HAWA 2G1KA 3B2EA 5LB2A 5FBVB 1B0UA 4TMVA 4QGFA 2ZVQX 4QBHA 4GMDA 1OFHA 4RFVA 3SFVA 1HTWA 1NY5A 3HPRA 4IDPA 2V6JA 3H1TA 2IL1A 4DEYA 1TNDA 3LV8A 4OQMA 2ODNA 3SU8A 3W5IA 1U9IA 5JECA 1VHLA 1MO5A 5HZKA 1W46A 2WOJA 3OEHA 4H1VA 4Q03A 3V9PA 2IYVA 1J70A 2N46A 4UKDA 2O8BB 2QZ4A 4DZZA 3ZJYA 4L15A 4B43A 1MKYA 4Q00A 4P33A 3PV0A 3LFUA 2ZRMA 3NC0C 3QUSA 1Z0DA 4TL6A 3GLFB 2YHSA 2QMEA 3HYTA 5DE3A 1VYTA 2XNDD 3P20A 1O3YA 2V9PA 3SJAA 3T5DA 4JBYA 2NG1A 3LX5A 4EPVA 1SVIA 4B74A 4TL8A 4NCIA 3IIJA 4NP6A 5C4GB 4MQBA 2WIBA 1G3QA 1E2NA 1ZC4A 2JLRA 1P2VA 4G3XA 4B33A 2MSEB 4YMVA 1SVWA 3MSXA 3KXLA 3L2OB 4PC7A 5J4LA 5TVKA 2PLFA 4MYUA 4LC1A 4BWYA 2OG2A 3KQNA 2ANBA 2JGNA 4E07A 4LOAA 4Q1FA 1VTKA 1XDBA 4B3XA 4TSFA 1T4GA 4TTPA 4C2TA 4PZYA 1UF9A 2C03A 3GMTA 5E3HA 1P73A 4NMMA 4FWTA 2AXPA 2FZ4A 1RW4A 2IBMA 1XTQA 2QG6A 1DAFA 3B9PA 5FL7D 3GLIE 4TZ6A 3EC1A 1QZXA 2J41A 1SVKA 4LHXA 1W49A 4JVNA 4HB2A 3BE4A 4Z8XA 3A1VA 4LYAA 1E4VA 4OQNA 3WYAA 4DLXA 3IEVA 1E9AA 3ZDQA 2AKYA 1XCGB 4US2R 5JI2E 3PUXA 3QPWA 4MYCA 3TR5A 2IUUA 2CK3D 2P0EA 3GD7A 4AG5A 1JJ7A 1Z0AA 2WJGA 3CB4A 3IO3A 4LRWA 5IHPA 4DJTA 3FMIA 1NBME 2GXUA 2ZS7A 1Z63A 1H8HA 4NZYA 4PX9A 2ONKA 4RSGA 1OIWA 4IVRA 1V43A 3E5HA 1G16A 4JT4A 4LZZA 2FFQA 3LD9A 2R2AA 4P0TA 1PV4A 4HZUA 3KQKA 1TMKA 2YVUA 1U2RA 1FFHA 1XPOA 1VMAA 4A82A 1QVAA 3CF2A 4GZLA 2GZDA 4QBIA 1E0KA 2XOKD 3B85A 3CRQA 3KXIA 2W0SA 2B8TA 4AC9A 2RCNA 3BBPA 3NBZC 1NJGA 4UNPA 1MT0A 5FTKA 3PXGA 3GLHA 2ZIAA 3FHTA 4Q4HA 1G8HA 3MFYA 2BJWA 3KUCA 2BBTA 4IEIA 4DLRA 1G1MA 1G3MA 1Q57A 4NYMQ 2H57A 3P26A 3K8YA 5IF9A 1DO2A 1T0JB 3LX8A 4EQ6A 2QQEA 1OFTA 4QBFA 3GJ8A 3SBDA 2PJRA 1E79D 1KY3A 3KB2A 3I5YA 1VIAA 2WICA 2BCJQ 1HY3A 4D81A 3TVTA 2VHQA 4B48A 1Y3AA 1Z5ZA 4BLRA 1CP2A 1G18A 4DC9A 3CF6R 4E09A 5KU1A 3SQWA 2ZJOA 4LJ5A 5JLJA 2A5FA 5CDFA 3NIBA 3DHWC 1UKEA 4ZO4A 4DSUA 4JIMA 2WWGA 4JT2A 1JAIA 2FGKA 2ZS8A 5FOXA 1KO7A 3OIVA 5JCPA 1UADA 3I1FA 1JEEA 4L9WA 3ONWA 2AR7A 3FYHA 3MJHA 5BN3A 4JLPA 3RS7A 4NDZA 5KO2A 5L3SB 1GKYA 1TX4B 1I2DA 1R0ZA 1OH7A 4O25A 2RHMA 4ACBA 1NN0A 1CKEA 1CRQA 3L0PA 5E7MA 1TL7C 3ZS9A 2O8EB 3I3SR 3GJ6A 5GJCA 3AVQA 3FMOB 2RKOA 4EFMA 2XTMA 2WWWA 1KK1A 4BFSA 4CIDA 4P4SA 1VG9B 1OFUX 1S96A 4B3GA 1MO4A 5CITA 4DIDA 3UG6A 3I4LA 4M1OA 2JIZD 2O52A 2IWHA 1AS0A 5J5CA 2WV9A 2CNWD 4GP7A 1E2FA 1SXJE 4LY6A 1FMLA 1E9CA 4TLCA 2DWOA 1G7CA 5CLQA 4A0HA 4B2IA 3P4XA 2CL6X 4Q7KA 1EFHA 2QGZA 3U2QA 3D31A 2UZ3A 3A8TA 3A1WA 2BCGY 4XSHA 2QENA 4URZR 5FBRB 4LHWA 1GITA 1TADA 1CLUA 1ESMA 2P6NA 3KUDA 3K0CA 4XTCS 4DT1A 3NDBB 2N42A 3QKRA 4O3MA 3SNHA 2REBA 5G41A 3WYGA 4OI2A 3CLVA 1EX6A 4B2PA 2YKGA 1XJCA 4LV6A 1M8PA 1N6RA 2GXAA 3L0IB 1F5NA 5FOUA 1VECA 1KI9A 5CB8A 1KOFA 3VR1A 1N5LA 1SVSA 2F55A 3AB3A 3IBGA 1NRJB 3B13B 3LQQA 2ANCA 5KSYA 1KSFX 4IVPA 4AG6A 1P9NA 2Z43A 1EFRD 1XCPA 2Y8EA 1JR3A 3H0KA 4RVCA 1R0WA 4X8MA 1CF4A 5FTNA 4MRSA 1KSHA 1OH5A 1VIYA 5LB4A 2C9CA 5FOVA 3THWB 2ZRBA 4ZKDA 2G77B 1Z2AA 1ZIPA 2IT1A 2J45A 2P65A 4D0GA 4Q9KA 4NHOA 1G17A 2VF8A 3RVBA 5B64A 1SQ5A 4C0QC 1FNMA 3CRW1 3UK6A 4K46A 3KTAB 1IN6A 3KKQA 1N5JA 3ZD6A 1TQDA 2J59A 2CJWA 5B2ZA 3WXMA 1OYWA 1XP8A 2IS6A 1BMFA 4IFEA 4BEJA 2ODWA 4M1MA 4PQYA 3BFVA 3GJ4A 5CK4A 1NBMD 2O8FB 2O8DB 4ZKEA 1MABA 4Q4AB 2P5TB 5EJEA 1SHKA 5AJZA 4DLUA 2B7CA 4BFXA 3RS5A 4BLSA 3C4JA 4B6EA 2ZE7A 4PXAA 3U3JA 4PPGA 4BUJA 2BIFA 1Z0IA 2O0JA 2RH5A 4IVQA 3X1XA 4CVNA 2REXB 1NSTA 2CHQA 1II8B 2FWRA 2ZR7A 3AVPA 1XCMA 5JWHA 1XXHE 4OK6A 3N70A 2XTNA 2D2EA 5LD2C 4IKEA 3ZIAD 4XIGS 3THYA 2PX0A 2IEZA 4HUQA 3HYRA 1E2JA 4RD1A 5DI3A 2BWJA 1ONBA 3Q5EA 3W6OA 3ZZTA 2VHCA 5GJBA 3T35A 1E0JA 1FZQA 1R8SA 2OUKA 4M8NE 4WA7A 1G41A 1HUQA 2DCUA 4FMDB 4FXPA 3AM1A 5DO9A 5L3QA 1KI2A 1ZM4A 1GM5A 3K53A 1KJWA 4W5HA 4ZIRB 2V3CC 1ZW6A 5CLLA 4LCBA 4BQSA 4BLTA 1RIFA 4C0HA 1E0AA 4O0MA 5BYJA 4A6PA 2JDIA 1UPTA 4QKQA 2ZITA 3R8FA 1G7TA 1Z0KA 4EPXA 4A1FA 4OI0A 2B8WA 2DB3A 2EFCB 4BFUA 3QG5A 1DOAA 3PCRB 4MYTA 2V54A 3W34A 2BOVA 4D4KA 4QJ5A 3CR8A 3VQTA 1N6IA 4ERNA 5JHHB 3G82C 1JPJA 3MWJA 1AKYA 4KSCA 3TSZA 1A2BA 3AVXA 4UXIA 2OV2A 2CHVA 2V4ZA 4KYIB 4QGGA 1EFCA 3NBFA 4QC2A 2JAQA 3HWSA 2BDTA 1Q1QA 2IHYA 2AHOA 3CNLA 2BMFA 2EFEB 3GLHE 4PAQA 2FFAA 1EX7A 3MCAA 4R7ZA 2BMDA 4US1R 1KKLA 1G291 2XSZD 3UIEA 4RD4A 4JYBA 1NN3A 3QIAA 3DOFA 4Y0VA 1E1QD 3VU9B 4C0AC 1X8LA 1ZM2A 3DMDA 2HT1A 2VP5A 2ZJBA 3L0SA 3FHOA 2C9OA 3BH7A 2QAGB 5EZ5A 1SXJD 2GETA 4NYMR 4RKEA 3FTQA 3RWMB 1Q1EA 2FSFA 1KI6B 3O8RA 1G5TA 3C7KA 4JJKA 4WZAE 5P21A 2Q6TA 2XNSA 5CDFE 2A5DA 5AUPB 2CHGA 3PIRA 5CM9C 5J40A 5AWFC 2SHKA 4A2QA 4DKXA 4O2LA 4QM7A 4ASUA 1KDRA 1DO0A 5SZJA 1D2EA 1I4DD 1EGAA 2N1BA 3Q85A 1E94E 5DIFA 3UWOA 5HPYB 4CEHB 3DZDA 1QHYA 4G5SA 3R9WA 1AM4D 5C1BA 2IS2A 5SZIA 3MUFA 3EX7C 2VO1A 4BZQA 4W5WA 3WHKA 4F4CA 2W2VA 2CLCX 4DBLC 3DPUA 2O0HA 3K0FA 2FJUA 2WAYA 1NL3A 1AS3A 2BBSA 2H1LA 3CUEF 4LC0A 1CXZA 2RGAA 4M21A 1VKJA 1CTQA 2F43A 2E87A 4Q21A 1SXJC 4RFSA 1XMVA 2PX3A 3TUJC 2G0TA 4UJ3A 4TTRA 1VG8A 3ZVMA 4P3YA 3E70C 1X6VA 4I1SA 4I99A 2A3RA 2BVNA 3GEIA 1I4TD 2IUTA 4QL3A 1AKEA 4H9GA 5FBQB 3SFZA 4EPYA 3VAAA 2JJ8A 1ZM3A 1M7HA 5IT5A 2YZ2A 4PO8A 4DUGA 2CCJA 3EZFA 4WOPA 1JR6A 3WMEA 1KYIA 2IXFA 3H2YA 4JVMA 3VFDA 3K09C 1GVNB 3E1SA 2J0UB 3TRFA 1LV7A 3NG1A 4ZCMA 3DM5A 4JLBA 3IHLA 4B2LA 2G6BA 1UBGA 5HKKA 3FPAA 3D7MA 1AN0A 1FQJA 3ND8A 2PZGA 4IDNA 2QGNA 3KKMA 4MGYR 4RD2A 1ELOA 5GVSA 1W36D 4LV8B 2BEKA 3NHBA 2XXAB 2JATA 3CW2A 4S2EA 2J1LA 5FOTA 1FMJA 1W0JD 1Z6XA 5KSPA 4U00A 1N0WA 2R6CA 4NYIQ 3U7EB 4PZLA 2WKQA 5K8TA 3QI2A 5JSZB 2VA8A 1TU4A 3BH0A 2BKUA 5H70A 3SEAA 2OBNA 1VG0B 2J0QA 1KJYA 2KJQA 3SQXA 3T61A 1WF3A 3AP1A 1K5GA 3AEZA 4AYXA 1U9IC 4HAUA 2FEMA 2VP4A 1FOEB 4JKIA 2WJVA 1Q20A 3QQ5A 1JR3E 4UXHA 3P27A 2CXXA 4ILEA 1R2QA 4MDEA 2MMCA 3QNUA 3U5ZB 1II9A 4A0FA 1E9SA 4C3ZA 2ZAOA 4KLNA 3ASYA 4JYCA 1W36C 4C7OB 2C78A 1CULC 3VR5A 3QOFA 2ZS9A 3B60A 1DAMA 3PUVA 3R8CA 3SDZA 2ZSBA 4QOSA 2J87A 3OFNA 2HUPA 4J0QA 3KKOA 4NPHA 1KI8A 3HP1A 4KFUA 3SBEA 4Z51A 2F1RA 3MD0A 5D3QA 2HEIA 1FPMA 3K0EA 4QHSA 2VYFA 4M22A 2HCBA 2KWIA 2YV5A 2W00A 4S35A 1MABB 3NTUA 4A92A 3AQ4A 3BB4A 1YU9A 2VHUA 1H8HD 4L4UA 4EUNA 5B58C 3EIQA 5F2EA 2C04A 4Q9JA 1JPNA 4X8HA 3LBHA 2ZJ8A 1WP9A 2ZTSA 5GJVC 3CONA 3SR0A 4ZI2A 3W90A 3FFAA 3UMFA 3T1TA 3QY0A 5TMPA 3EZ7A 5JJKA 3ZZ0A 5J47A 1PZNA 1IM2A 1ZUHA 3OHMA 3T1OA 2Z0MA 4AKGA 4BGDA 1OIVA 3D6TB 1IN4A 4AYWA 1Q3HA 5G40A 4JZKA 5TDHA 5FPKA 5GADl 4RZ2A 5JS7A 3THXA 3MRSA 5A4JA 5FPHA 2PEYA 2VBCA 4PQRA 1RC8A 2QA5A 5KUTA 2EFHB 3ECCA 2ZI5A 4WIAA 2WWHA 5C2JB 4LSGA 3GJXC 4KFTA 2D7CA 4GT1A 4W5JA 5AUNB 1BIFA 1LTQA 2PZEA 2IWRA 3FFBA 1R10A 3CZPA 3M6AA 2PLRA 4HLQB 1QHHB 2FOLA 2QNRA 4DIEA 3EWSA 3U4QA 3C15C 5C4MA 1OYYA 3B1ZA 4PPFA 3L8ZA 4B32A 3ASZA 3ZQJA 4HI0E 1CJVC 4D4JA 6Q21A 1N0UA 2GJKA 1E1RA 2IF0A 1EG7A 3IHWA 1EFTA 2NIPA 2JASA 5JWOA 1AIPA 3BFXA 4TL7A 1MV5A 2QROA 1X3SA 1YR8A 2XJ4A 1M1YE 5G3YA 1KZ7B 2GK7A 4N1AA 1R6BX 1EWQA 4OQXA 4EFNA 3AVUA 3CPEA 3QBVA 2RGGA 1KMHA 5FBWB 1F2TB 1K5DA 1E98A 4HAYA 2GTPA 4AYTA 1HH4A 3R9XA 2DPXA 2ZJYA 5CYPA 2G9NA 2H5EA 3SOPA 1JXMA 1A4RA 4MGKR 4NE2A 1J8YF 1T8TA 1OXTA 3F0TA 1C9KA 1XF9A 4GP6A 1E1QA 2Q3FA 1JBKA 2PMDA 2BC9A 1T6NA 2MSCB 2OFXA 1G4AE 4V0KA 3I73A 5AK0A 1YR7A 3CX7A 3WY9A 1G19A 5EE3A 1SKQA 3PUWA 2IYTA 1US8A 4WVFA 1AJEA 2AK3A 3ADCA 3BB3A 1XJ0A 2GRJA 4HLUA 4NL4H 5SZHB 1P61B 2QE7D 1ZNWA 2D06A 2FEOA 2HXYA 3D8BA 1E9DA 3VHLB 4XTRA 1ZIOA 4TWZA 4F7WA 2W58A 3QVVA 2RGEA 3HDTA 5SZKB 2CCGA 3AF4A 1TAGA 3S1AB 2GCOB 2IS4A 3IQWA 5E7JA 1HE1C 2Q0HA 2C96A 2OE2A 5A0FA 3UG7A 3LY5A 3TK1A 2QORA 3Q3JB 1WQ1R 3B1VA 2QY9A 4IW3B 1LF0A 4LJ9A 4CT5A 2FGJA 2DWQA 4BLQA 5J4VA 5KNCA 1KJZA 4NYJQ 4RJLA 1LW7A 2HLDA 4KV9A 2ZYTX 2NGRA 4LX0A 4M4SA 1E2KA 4CDGA 2H8KA 1JR3D 4IJMA 4D26A 4TN1A 1HT2E 1KK3A 4TLDA 4P32A 3RRNA 3U44B 1Q12A 221PA 1KI3A 1S4QA 1YZGA 1UAAA 3CRVA 5JCZA 5L8VA 2XZLA 5HZHA 4K81B 2KB0A 4KVAA 3K0CC 3RDPA 1VCOA 1NKSA 4YMSA 4R2IA 4V0MA 4RD3A 4TMXA 4EFLA 5K8IA 3ADDA 1YVDA 2QBYB 5JEDA 4C0KA 1ZU5A 2FPMA 1WE2A 3IGFA 3UWKA 2WMOB 3C8UA 1YZNA 1BMFD 2GAAA 3KFVA 3CRRA 5JEEA 3W8RA 2WKPA 1W4BA 2GJAA 2FG5A 1E2LA 3B78A 4IHQA 3CKLA 1IAQA 4XWAA 2XB4A 4DCNA 5KSOA 1W0JA 2J3EA 2YWEA 2VL7A 2WPDA 1AS2A 2IHBA 1X86B 5EP2A 2VHJA 4B44A 2WJHA 4CEIA 2C9YA 1KAGA 3QEJA 3AV0B 2ECKA 4XH9B 1FTSA 1R5OA 4XVQA 4G5RA 4LV5B 1P5ZB 5J4HA 4NYIR 1DE0A 5J4KA 2O0KA 1NG9A 3SYLA 4XWOA 2FPKA 2YWGA 1XEFA 1G8GA 3TGPA 1KSGA 4I4LA 3I32A 4IOJA 3VKWA 3GLFE 1HQYE 1Z22A 2HJVA 4DDVA 1CBUA 4A2WA 1XXHA 5E7IA 4XD7A 1KO8A 4G5GA 5EQTA 1ZNYA 1N6HA 3GLIB 1GZSA 1UDXA 2NO9A 4A15A 1GRNA 1TUIA 3X1YA 4URXR 1QHGA 5EP4A 3WMGA 5UKDA 4DXAA 2LKDA 5D3MA 1XEWY 2QT1A 3UATA 3ZZUA 4HAVA 1FX0B 2DR3A 1G5RA 1P4SA 3ADKA 4QBGB 5DHAA 4YLGA 5CYOA 2ZJAA 3ZVLA 4ZCLA 3RC8A 3QKSB 3AVTA 1ZAKA 2ZETA 4PC2A 1AK2A 1YR6A 1DAHA 3B1XA 3MG9A 2EU8A 3TMKA 2FDCA 3CPJB 3N5CA 2JDID 1D2MA 1DG1G 3FDIA 5L3VA 3T1QA 3PQCA 3K70B 3RS0A 1N6KA 2NO1A 5CK5A 3KJGA 5FOWA 4A8JA 2I3BA 2ZI3A 2X77A 4JS0A 5KHOC 2XJ9A 5FPTA 3GFOA 2JLXA 4PFSA 3FKQA 4R2HA 5TB5A 2VSOA 4DLTA 1EWRA 2W6IA 4U7DA 2QN6A 1IXSB 1XJQA 4AY2A 1T0HB 2JLVA 3VHXA 1P9WA 2BV3A 3A4LA 4IOMA 2NO6A 3NEYA 2VH5R 1AGRA 3NWJA 5DLQC 1JQLB 1KI7A 2EFGA 3MWKA 3K0SA 2ZUCA 3RABA 3FB4A 1DADA 4D82A 4FW9A 2PCJA 4JVSB 4M9XA 4PPQA 1P6XA 3I61A 4UQOA 1DAKA 3QXHA 2H92A 4BFVA 3TIFA 4HUTA 1F2UA 3QPUA 4C9BA 4V02A 4OHWA 3U3MA 3AUYA 1IY0A 3O8DA 2EVWX 3THOA 5IK2A 2ZM5A 4QGHA 4US0R 3U4QB 4B3BA 1TQ6A 1W7AA 2W6JA 2ZJZA 3RS2A 4Q7LA 1G8YA 3IQXA 5DYIA 4ASUD 1ZCAA 4KAXA 1G7RA 1RKBA 2NZ8A 2IEYA 1JXOA 2ZI9A 1BS1A 4D4MA 2HXSA 1CJKC 3BRWD 4U02A 5C46F 1JB1A 1O87A 3QF4A 5FUVA 4FI3C 5KTYA 3PR1A 3IIKA 4QM6A 1Z83A 4MGZR 4A4DA 4N0EA 2GJSA 3IKJA 2P6UA 5DH9A 3GJ7A 1E2PA 2YYZA 1NVVR 3NBYC 4JLMA 4M1SA 5TXGA 2D2FA 4DCTA 2FH5B 5DGXA 1XMIA 3RLFA 2WZQA 2OLJA 2G83A 1GAJA 4FMBB 2ZYUX 1J99A 4ZI3A 4ZDKA 4D6PA 5JFGA 1OXXK 1IY2A 1X1SA 4KCGA 4M1WA 4XSGA 3U6BA 1ZD1A 1CR0A 5EE0A 3LW7A 3NDPA 1Z29A 2A5JA 1NI3A 3MGCA 1IONA 4QJ4A 5JRJA 1SKYE 2XZOA 3GFPA 2ZYVX 1SXJB 4DUGD 5FOSA 3GEEA 1YKSA 1RFLA 4Z54A 4CYMA 1NLFA 5JBQA 2JLSA 3ADBA 1ZUIA 3KQHA 1NY6A 3UMRA 3I5XA 3ICEA 1XD2A 2MMGA 2Q9BA 4KU4A 3OF5A 5HKKD 2A2ZA 2QE7A 1OHHA 1UJ2A 3KDSE 2PMKA 1L4YA 2OBLA 4V0NA 4E5UA 3B8HA 3HU3A 4A36A 4BFZA 3GJ3A 4Q7JB 1W2GA 3G5UA 2IYSA 1GNPA 1ETUA 2ZI6A 4N3NA 4ZCIA 1FQKA 1GL6A 1G6OA 5G3ZA 4JKYA 2DY1A 4M1TA 2J0VA 2G1JA 5TARA 2GK6A 2IXEA 1OKKA 3EWAA 4JLNA 1UEJA 1P72A 5LDDC 3A58B 1RRPA 4PAMA 2QL6A 4Q5IA 1N6LA 3KJEA 5K8LA 3H84A 1NMZA 4FD2A 1VYUA 3EW9A 4OL0A 5H8WA 4UNSA 4TMKA 2NPFA 3A36A 4ZDIA 1TEXA 1U99A 1X8KA 2RMKA 2V6IA 2ZUBA 1W4AA 2NPIA 3EC2A 5EXSA 3SJZA 1DPFA 4YMWA 3A1TA 4GFDA 1OPXA 2IYLD 2B92A 4NYJR 1E9BA 1TPZA 4B75A 4KFSA 4LWZA 3T34A 1W4RA 1E9EA 3VR6A 4V0ME 4QHYA 4D4LA 3QKTA 3LBNA 1KAOA 4XWKA 5KSZA 1KO5A 1QF9A 1ZYUA 3IUYA 2P2LA 3DZ8A 2ZSDA 1NSFA 3OFND 2ZAMA 1Z6AA 4WBSA 1Z06A 3AF3A 5JJLA 4WZBE 3MWYW 5FPYA 4RZ3A 4IDQA 1W36B 3BC1A 3RS4A 3WP0A 2BEJA 3NEJA 2AN9A 3AUXA 4P31A 1MH1A 3C14C 4G01B 3AF2A 4RY2A 4UNNA 2WVJA 3FOZA 1ZVQA 3H4MA 2QRZA 1Q1BA 4UXJA 5FR1A 2JLUA 2GEDA 1SVOA 1Z28A 3WBJA 4KJZA 3TQFA 4C2UA 4QHTA 1CU1A 1XEXA 2ZRJA 4K8OA 4Q02A 5KPDA 2ODEA 4R9UC 4Q47A 2IX3A 4AKIA 2CDNA 1RPZA 5EXPA 1XXHB 1TF5A 2IYXA 1MO6A 1R0YA 1QDEA 1OLOA 2QI9C 3WRXC 4DEXA 3QPVA 1DELA 4YXWD 1XTKA 2IXGA 4PZZA 3DMNA 3LXXA 1Q22A 2AK2A 1KI4A 4NCJA 4L8GA 4Q9HA 4DVGA 4I1UA 5KDLA 3TAUA 1W5SA 4QFMA 2IS1A 1YE8A 3CWZA 1W4CA 3B1WA 1ZJ6A 421PA 4Q4JA 4KSBA 1KNXA 3W6NA 3WP1B 3DVLA 3EPJA 5FI0B 4M9QA 4TYWA 2FX3A 2OSBA 4Q19A 5AUQA 3V4RA 3GLGA 1GNRA 4Z1MA 2X2EA 1EK0A 2QPOA 5AR1A 3X1DA 2Z6VA 4LJAA 2ONJA 1OV4A 2C95A 1LFDB 3EARA 5EE9A 2F6RA 1RRCA 2IYQA 1E1RD 3QEOA 2ZANA 3PEYA 4EDHA 1S3GA 3IEUA 4HZUB 2QTFA 4TTQA 4C0LA 4C0JA 2NTYC 1S0UA 2OZEA 2QTVB 2QM7A 3PFIA 4ON9A 1GNQA 5G53C 3ZVNA 4MGIR 4X8OA 2YWHA 3G0HA 1E32A 2X19A 2XX3A 4OJQA 3ZGXA 2P67A 2WHXA 3GLHB 2GAOA 1I4LD 3DM9B 4Q4HB 5EP1A 4HDQB 2E9SA 2K5UA 3TSWA 2OILA 4CEJA 2VLIA 1C1YA 5JZVA 3X1ZA 4EQ6B 5K8UA 3LXRA 1AZSC 2QP3A 1ZRHA 2J7PA 3CX8A 1L7VC 4GOKA 4EPTA 4Q9IA 4PR0A 3QG1A 1QHXA 1GUAA 1R5BA 1P2SA 4Q48A 1G20E 2IK8A 3P1JA 4YDHB 2PCLA 3W8NA 2A9KA 2ZRIA 4KBGA 3MMPA 2PZFA 4QXAA 3CZQA 2YNMA 4Y0AA 1U94A 3A1UA 1OF1A 1HURA 4B71A 1YRAA 4PHGA 1A7JA 2OAQ1 2QP9X 3C5CA 5BW8A 1VYVA 1OJLA 2FSIA 3PEVA 3RNLA 3T06B 4PHTA 4HB0A 3OEEA 4TMWA 3SS8A 3SYKA 4BZPA 1KO4A 3L82B 1NN1A 1NVUQ 4TLAA 3Q5DA 1T5IA 4Q01A 1FP6A 2I1VB 3Q7QA 3ZQ6A 1WRBA 4L9SA 2IUSA 2JJ2A 4DHEA 4XVRA 4NONA 1Z47A 1CJUC 1ZINA 4AD8A 3QENA 3P4YA 2WOOA 2ZSAA 5EE5B 2JLQA 2AXNA 4KI0A 4OHXA 3KJHA 4GOJA 2HLDD 3LQRA 1KO1A 2P3SA 1AGPA 1U90A 2AD1A 1M74A 4P4SB 4Q18A 2QTHA 2GBLA 4PQFA 3VMFA 3I72A 3W3AA 5KDDA 1CS4C 1S1MA 4HLUC 4QJ3A 2XTZA 1GTVA 2REOA 5CIWA 4AURA 3TE6A 3P32A 2Q9CA 2VQSA 4L5BA 1XPUA 3U3RA 2VP2A 1KDOA 1S3SA 2GCNA 4DSTA 5FUYA 1E6CA 1E2MA 1RJ9A 1NG1A 2BM1A 2W2XA 1E2QA 4OYHA 3R7WA 2VRWA 4TLEA 3PITA 4EJSA 1Z0FA 2WWYA 5EUQB 2X1VA 1UM8A 3RRZA 4DT1B 2OCYC 2GVDC 2QRNA 3C16C 3QKRB 4PO9A 5AJXA 721PA 3RHFA 2WSSA 1AQYA 5GVRA 1DG3A 4HB4A 2Z5FA 4PSAA 4M1YA 3WMFA 2IYRA 1TEVA 1EFUA 1W1WA 2NQ2C 3WNDA 4M0LA 1IN8A 2WPDD 4AWXA 1GKUB 2ZJ5A 2JA1A 2ZRCA 2OLKA 3GJ5A 1IXZA 2B7BA 3AVYA 1Q44A 4PTLA 4II7A 4Q66C 5GJWC 4P4UA 1UBFA 1NKTA 1YJ5A 2O8BA 1PVOA 2GZAA 4TYYA 1Z6YA 3H86A 2G3YA 4NKRA 3IBYA 4JL8A 1WBBA 5EXTA 4GL2A 4XD7D 1DEKA 2ERXA 4LJYA 5EUMA 3ND9A 3GLFA 4OHYA 1ZD9A 1S1CA 3FWYA 3A6PC 1J8MF 5E4FA 1JQJC 1TF7A 1WB9A 3LH5A 1U98A 3EIHA 1A82A 4LJ7A 4RCYA 4CRWB 1VCMA 3AP3A 3AH8A 4FINA 3RRYA 2DFLA 4C0BA 1SULA 2WWXA 5JI3E 4KODA 1QHNA 5BWMA 1U0HC 4ESVA 2EYUA 2RGDA 2CJWB 3N2EA 1J2JA 4BE7B 1WA5A 1N6PA 1KTVA 3BOSA 2H18A 3AKYA 4IDOA 1L8QA 1X8JA 1Z8FA 3B5JA 4DB4A 3NH6A 1GL9B 4AK9A 1JJVA 4TLBA 1J90A 2R65A 2OBMA 5TY0A 4BFYA 2VF7A 4KVGA 1WBDA 2J5XA 2W6ID 4LJ6A 1OB2A 3LWNA 2BM0A 3AF1A 4PPNA 1UBEA 4QG7A 3T12A 4XJXA 1WCV1 2W0MA 3B6EA 4B3CA 2WSMA 4E22A 2IYUA 2TMKA 1E3MA 3Q9LA 4WZ6A 2A78A 2A7QA 2Q3MA 3TUZC 3THYB 4I81A 1G5PA 2OEPA 2QSYA 1G8FA 3QXXA 3TKLA 3J81k 2GNOA 4HUQB 3ICQB 4EIWA 2AWNA 4YXWA 3M4YA 1UBCA 4MH0R 1H8EA 5DI3B 3VKGA 4HLCA 1S8FA 2NO7A 1QG2A 1ZD8A 1LS1A 1OT3A 1R5NA 1XNJA 1N5IA 5IK2D 3TR0A 1TF2A 2FSHA 4A8JC 5B57C 2WIAA 5L3QB 1V5WA 4Q4LA 2VP6A 3GLGE 2WTUA 2V1UA 4DSNA 1HQCA 3FGNA 1LF5A 2W6JD 4ITRC 1NN5A 2VPPA 1KDPA 3GJ0A 3U6KA 2CCKA 3JZMA 1OH8A 2QU8A 3Q72A 3WNBA 3K1JA 1II0A 3K9GA 2AL7A 1XFAA 1QHIA 2D62A 2DYKA 1LNZA 2R6DA 1T3SA 1NVVQ 1M7GA 1OSNA 2C99A 1FTNA 1LY1A 2KBFA 3EZ9A 4QRHA 4YC7A 4H1UA 3T15A 4LHVA 2D7DA 1XTRA 3U7GA 1RZ3A 4TYQA 1XMJA 1NVWQ 1PLLA 1ESNA 3SYNA 4URVR 2GWHA 1E4YA 3LVRE 3HU2A 5BYKA 2F9LA 2ZRGA 2RB4A 2VP0A 2H7VA 4GMXA 2FSGA 3U7FB 2QAJA 2HF9A 4OQFA 3SZRA 3U61B 2ZR0A 2H16A 1N2CE 1YR9A 3BERA 3SN6A 1A5TA 1F3OA 2QPAA 3CM0A 5TV2A 4FMDF 3TQCA 3PEWA 2FZLA 3GQBA 4YMUA 1WMSA 3KFXA 2RGXA 5L3SA 3CH5A 1IY1A 1P75A 1YZQA 3RS3A 2WMNB 3O47A 4D80A 4NCKA 2O8EA 2ZRLA 4Q9LA 1IQPA 2GCPA 1OHHD 3OIYA 4YMTA 2ODBA 4V0OA 1KKMA 2GXQA 2X2FA 1YHNA 2GEVA 3VKHA 4MRNA 1GKIA 2IA5A 3N2IA 1U8YA 2ZYWX 3AVOA 4KHZA 4DCVA 1DAGA 5KPJA 3B7GA 2W83A 2AFIE 1ZNZA 4JLJA 2VSXA 4MDFA 4EKDA 4RZXA 4FMCB 1OKKD 3K0FB 1Z07A 3KKPA 3LNCA 5LPNA 4D25A 1WXQA 4TMTA 1OXUA 3KB1A 2ZUDA 5JJIA 2KI5A 2F3RA 2F43B 2PH1A 4Q1EA 4RFSB 2BKEA 4CZ2A 1GWNA 1P7CA 4XVUA 5F3WB 3BXZA 4LYJA 4ARZA 2ZRAA 4CGZA 4BFWA 3UANA 1FUUA 5KNDA 2P6RA 4JBWA 4RD6A 2UZIR 3LLMA 3OAAA 1KIMA 4Q1BA 5F98A 1CJTC 2F1IA 2ZQ5A 1S9DA 5M04A 3A1SA 3M1IA 2GILA 2WWIA 2GJ9A 3R20A 4I1VA 4Q1DA 4OKSA 5C18A 3NH9A 5DYGA 1E69A 4C30A 4AI6A 2OXRA 3W3ZB 3NXSA 1E96A 1U8ZA 1PUIA 1SVMA 4V0LA 4M2LA 1NIJA 1SGWA 4GOXA 1TU3A 4Q1CA 4WW0A 4FCVA 3D3QA 3SC3A 2O5VA 4HDOB 3LDAA 3THWA 4F4JA 3BH6A 3NBXX 5EXXA 4B3FX 1N3BA 2HV8A 3DL0A 5FFMA 5FUXA 4BASA 5JHGB 4LI0A 1CR1A 2QQ0A 4LBZA 3RYTC 3PJRA 1KHTA 2GA8A 4NTZA 2J46A 5HE8A 3LRPA 2V7QA 3B9QA 3F5FA 3KTAA 3QXJA 4TT3A 2CEAA 3W9YA 2O8CA 1BKDR 1XTSA 3EZ6A 3CR7A 4TL9A 1T91A 2O8FA 2O8DA 4HB3A 2FFHA 4Q4AA 2NOAA 4HAZA 4OI1A 5FH9A 5LD2B 4F4IA 3QE0A 4GDFA 4IOLA 4M53A 4LHYA 4TQAA 3ZD7A 2ZE6A 1GIAA 2FA9A 1IXRC 3OIUA 2CE2X 4LGMA 4QNMA 3QJYA 5DNYB 4Z1MD 2VIIA 4MKFA 1LS6A 2F3TA 1ZUNB 3Q8XB 4JVLA 1PJRA 4RD0A 2BJVA 2IYZA 1II8A 3WNCA 5FUWA 3DKPA 5AJVB 3TSOA 2VHTA 4DLYA 2QEQA 4POAA 2FNAA 5DN6D 2CVHA 3L8YA 1NMXA 2EW1A 3EASA 1JAHA 3JZAA 4RKFA 1H65A 2YOHA 1KDTA 1M7BA 5AUOB 1IJFA 4A0GA 1XRJA 1JECA 1UDWA 3GFTA 4NH0A 1RVDA 1YZUA 1IJEA 3I8SA 4R98A 3SJBA 2J0SA 1Y63A 2ZU6A 3DOEA 4G5OA 3ZVRA 2R6AA 3THXB 4ZIRA 1YZTA 4F92B 1IHUA 3IDQA 4L16A 4GBMA 1FNNA 2D4HA 1HT1E 2XZPA 2PL3A 2Q3HA 3RAPR 2CLSA 2J7PD 2R8RA 1TQ2A 1VPLA 3QXCA 4MITA 1LB1B 2NO0A 3TH5A 2C8VA 2DBYA 4PC3A 3RSOA 5A5GA 5KDOA 2ZRFA 3FE2A 2CE7A 3KQLA 4FIDA 5LBIA 3C5HA 2VSFA 2IC5A 1F48A 1C4OA 4DDUA 4DSOA 4LJ4A 2JLYA 1E2GA 3EA5A 4IDHA 1UKVY 3MLEA 1YZKA 3F8TA 1G3RA 4JL5A 3OEED 1GP2A 4LUCA 2R62A 3TLXA 4GRAA 3UMSA 4BPBA 3EAQA 2OAP1 4JSYA 4ZDWA 3VU9A 2IYYA 2JJ2D 1RRGA 1ANKA 4ZPXA 4RZUA 1D5CA 4PAOA 3GCGA 1OE0A 121PA 1KMHB 5HCIA 2QAGA 4OQLA 3BWDD 3CX6A 1DAIA 1KI6A 2ZXUA 3ZLJA 1D2NA 2A30A 2BBWA 1P2TA 1QBKC 5EP3A 1U81A 2WJJA 2ZRDA 2HYDA 2ZVPX 5AJYA 3L43A 3K0AA 2ZE8A 4M9ZA 1FP7A 4CEHA 2KE5A 2ORVA 1SKYB 3B82A 4LBYA 1HA3A 4NU0A 4BLOA
chains in the Genus database with same CATH superfamily
2I9PA 1NFQA 1CUBA 1HQKA 1ZA1A 2V1XA 4BBAA 2AQKA 3TQHA 2PKCA 4KAFA 2I7DA 3C8DA 3KV1A 1GQSA 3PRJA 1V3VA 2C2WA 1GGKA 4EMTA 2AWOA 4UW9A 3E1GA 4LRYA 4Y9TA 4BEBA 1VM6A 2C2GA 2GZ3A 4KUGA 2NZ2A 4ALLA 5A1JA 1RQRA 1ADBA 1LFAA 1P19A 4FWBA 4B4WA 3J7AC 2WSSD 1JTVA 2HF8A 4WACA 2OM6A 3W2FA 4LFBB 1XB2A 1F51E 2JCSA 2OM2A 2P2DA 3H05A 4X64B 1Q7RA 5LXTA 3A9CA 4IGAA 1L4GA 1JNYA 1VPDA 4J0JA 2ZFUA 4X44A 1Y5LA 2L2QA 3V42A 1ND6A 4G4SP 1NW8A 3ADOA 5FI1B 5A3VA 3ZDYB 4ZDJA 5JH7A 3EQ9A 3C3JA 3OE7D 5I4BA 3KAKA 3PLNA 2Y0PA 3OPYB 4M9UA 5LOVF 1WBDA 3PDCA 3C3EA 1TK9A 2VKTA 4F6LA 5HKOA 4B76A 2WHRA 1B42A 1CJSA 3CVXA 3KQUA 4NZPA 5C32A 4JLKA 3OPNA 4ZK6A 2VJYA 4FZVA 1PG0A 4K6CA 1EE9A 3A70A 1IMOA 3AG5A 4TXMA 4U6SA 4DKJA 3G59A 3S70A 3ZWQA 2M6SA 1G98A 5K8JB 1I7LA 1YJAA 2XXAA 3Q6NA 2HJHA 4TVSA 4MRRA 1Z15A 3BS4A 2FRDA 3NKVA 1NQWA 4ACAA 4OOEA 1GZVA 2WBLC 1YU6A 3CLKA 4K9OA 4CIBA 4HEJA 4B45A 3TS1A 4DQUA 4I3HA 5JATA 1N77A 1M6NA 2JS7A 4V0QA 1BVYF 2HO4A 1EJ0A 2O4CA 2YWFA 4Z3OA 5P8WA 3K5IA 4Z4EA 1QV6A 4WZBB 4KQCA 3K4HA 4NAHA 4AJNA 2FMXA 2VDQB 1CEEA 3VOAA 3FLMA 2C4WA 1WDTA 4HKTA 4P34A 5KYXA 1XWIA 2HCFA 4D98A 2E4VA 3HV2A 4IRUB 1ZM7A 3MIZA 1CZKA 2CBZA 2D74A 4UAUA 1WPRA 5DU2A 1XZLA 5HK8A 1EXMA 1IOWA 1UUFA 4AS1A 2JGEA 4CEIB 1DQZA 3D7LA 4F2HA 2O7NA 3AUTA 3UWPA 4D2IA 2CDCA 2ZSFA 8OHMA 2WWFA 3DEHA 1R66A 1TCVA 1E9FA 2VNAA 3LT5A 1TT5A 1RI5A 3AHCA 3NV9A 4HYYA 3QKIA 4J3FA 4K8RB 4NCHA 4FWIB 3VR3A 1T2VA 1I7SB 1Z5PA 3PXAA 1F60A 2YFQA 3L1KA 4BMYA 5DP1A 5LQKA 2GHRA 1MRNA 1XDSA 2BY4A 1OLUA 2FWBA 2J6IA 1KP2A 5FCDA 3MGAA 1IRXA 1MF7A 1NAIA 1P77A 1TQ8A 3SC6A 3CQ9A 2O8CB 1DCKA 2IW1A 4DCUA 2W43A 4J2OA 4EY8A 3CURA 2RG1A 3PJGA 4WNIA 4LAFA 2FPUA 4UNRA 2HRRA 5F7OA 1NMSA 3O6VA 4ZXFA 1T2EA 3BIJA 3BORA 4PANA 3V7YA 1F9EA 4CCAA 4GI7A 4FUQA 4BO8A 4A2PA 5EIFA 2ID8A 2V97A 2C98A 5I9TA 2QF7A 1W44A 4H35A 3RTBA 4A9AA 4TQUS 4JL6A 1GPH1 2D5LA 3P96A 4DRZA 3KC2A 4DR5B 2ZRKA 2JLWA 1M2FA 3IOEA 4RLQA 4B7CA 3K9LA 4KQ2A 2CL7X 2J48A 3P94A 3KQNA 2GM5A 2PGOA 4U6QA 1EZ4A 1QE5A 2BHRA 3K96A 3D8SA 4IDDA 3JYQA 4LDJA 4MRVA 4DMFA 3O74A 2Z83A 2B6HA 2F4NA 3IILA 4H3HB 5B37A 2ZB8A 4JWTA 2ZSEA 1GSAA 4LHSA 2ZI4A 2AKAB 5KQSA 2PKQP 5FL7A 3W6PA 3M4JA 1D6NA 2DZDA 3G0CA 4OHMA 3GFVA 2ZIUB 1HEIA 1JIXA 1E2DA 2I8AA 2VH2A 2VYCA 3BPSA 1YZ3A 3L04A 2FFBA 4H0NA 1EGMB 2QMUA 2WDPA 1T3HA 3S2UA 1PL6A 3ICPA 2IEAA 3T9EA 2B21A 1XTUA 3CW9A 3LUDA 4GECA 4JMPA 1TTHA 1EUDB 3KZMA 3CJRA 4OHKA 1WPGA 3RIEA 3RM3A 3SLKA 4GH5A 2V6BA 4AIIA 3MGBA 1YVRA 4FYKA 3Q0TA 3B1YA 4WNYA 1A2KC 2CK3A 3BF8A 3Q40A 4UFOA 4C4PA 3O8CA 3HR8A 3S27A 4FE7A 1H1LA 2O1XA 1F2UB 4M3NA 1JA9A 1U3FA 3UTCA 2C5GA 1RHQA 3GA0A 2X3YA 5CH8A 1XOIA 2V5VA 4RK7A 3VPXA 1T25A 3N8KA 5IVDA 1EFDN 5BSMA 4TYNA 2B2XA 3PYLA 4ATNA 2ZBEA 1N2CA 2JFYA 1HZZC 1Q74A 1IN5A 2H2GA 4AM8A 5TQ0A 1YIOA 1EDEA 3GOQA 3WLKX 4D8YA 4FR0A 3AJ8A 4IQFA 2OXCA 1M6WA 1KP9A 2ZJ1A 1P5RA 3CIFA 2WF5A 3KYJB 4F9GA 4EHHA 1T8UA 2B7LA 4DRXA 1XX6A 3SHFA 5DNAA 4HGRA 1N0VC 2VBFA 4QXMA 4EPRA 5I9LA 1G3UA 2XB2A 5LZ7A 1NBOA 1F2TA 3VTZA 1XPRA 2C20A 1P2DA 1OB5A 5K3CA 3ZWNA 1XD8A 4H7DA 1R6VA 2MSDB 3CH7A 4XOIA 1N25A 4LK2A 4LFCB 3NWOA 2LBPA 2I65A 1RD4A 4CU2A 1HMPA 1YULA 4YONB 4O4LA 2VPYA 3EFOB 2QJRA 3HE3A 3KVRA 4CTJA 4ETMA 1QZUA 2OGSA 4IO0A 1Z08A 3CZAA 3I9JA 5G1NA 3L06A 5BXQC 4C5CA 5ITSA 5ICCA 2EWWA 3U4GA 4QNNA 1WBJB 4ID9A 5BMVA 2GWRA 7GPBA 1HLFA 3EZNA 2WILA 2JANA 3KU4A 4QOIA 1Z4MA 2UVQA 2EW8A 2MINA 3OOJA 3RROA 1CQJA 3ZW9A 3IBCA 3ROFA 3ODGA 3QELA 4HWTA 2JPDA 1KK2A 1QX3A 2IPXA 2DTEA 2OUIA 1RBMA 1WOYA 2CLEB 4IIHA 5JS8A 3T3PB 4JT8A 4HDMA 3N87A 3ETNA 2B0CA 4ZV4A 2VUSA 5BV1A 3B6JA 1J2EA 2WLSA 4LDAA 2BFWA 1NXQA 2R1VA 5D6NA 4QYSA 1E9RA 3NONA 2REQA 3M5PA 4JK3A 5FPSA 1C7ZA 2DFKB 2XEDA 4ML3A 1BCSA 1VLMA 2AN3A 1AGXA 3ZD8A 3TPZA 3V3TA 2N9UA 3G6KA 4O1IA 4EAAA 5CFNA 4WLNA 4B31A 3J7TA 4P3KA 3AILA 5IRCD 3O4IA 1U0EA 2GRUA 1TAQA 1GQQA 2LPMA 3GRPA 1T1EA 4QLAA 3ZVKA 1EHYA 2YIMA 5LP6A 4DJAA 4ID3A 1UPCA 3GGDA 3PC8C 4CKBA 3U44A 2G4VA 3H0CA 4GNKA 2Y68A 2I1WA 2XMPA 5K01A 4JU9A 5AO9A 4GYYA 4L4YA 4PNZA 4LZLA 1QYDA 2F1KA 3VHRA 4FBMA 4QQNA 2ZR8A 4B4DA 3M6MD 1MRZA 4EHJA 3WWCA 4WINA 2FV8A 1CVRA 4FFPA 1Q1AA 4U7TB 2C88A 3PFNA 3L1JA 4GSKA 2IV7A 1T5LA 4F06A 1BFKA 2E1RA 2FPPA 1AMOA 4B7XA 2C2XA 4MVJA 3ANTA 5LU8A 4OQZA 1B73A 1JIKA 5DTJA 4NEQA 5FO1A 4IHKA 4IFBA 1NVXQ 1GPBA 3PRKE 2VTVA 4WASA 3WLRA 1INLA 1MW9X 2XE7A 3H3FA 1QS0B 4M83A 1R50A 4TYPA 1V3QE 3N2NA 4ENRA 4BY9E 3FHCB 3M4NA 2HA0A 2VWQA 1Z68A 2I6QA 4MEJA 3RTAA 2R0QC 4JXZA 2C4NA 2DBQA 1R0XA 3HL4A 5JJCA 2Y93A 1K8YB 1P31A 1NMQA 1P1BA 1NBAA 3DOJA 3VU1A 1NXXA 1VRWA 2B4YA 3KZOA 2D1TA 4RAOA 2FTKE 1ZJWA 2ETVA 3R24A 3CRMA 4IH9A 3PGMA 1G4UR 4QLBA 1GAWA 4TSFD 2KSQA 2HQBA 1SEVA 3V80A 2OBBA 1J33A 3UAYA 3O90A 4JI3B 3OLXA 4W9MC 4HEHA 3PU6A 5CBPB 521PA 3OPVA 2N1MA 1H69A 4OLBA 1CHDA 4MWSA 5J23A 3DAGA 5JMOA 1AQUA 4GLJA 2QB5A 4MPJA 1ZP6A 4D3ZA 4F93B 1XEXB 4FCTA 2G0AA 4WKCA 4KAAA 4L0QA 2R7AA 2F1HA 3X1WA 2XA9A 2WF6A 2A35A 1NJ5A 5TR9A 1G2IA 1LSJA 4U2CA 3ZE6A 4AJ2A 3VMMA 3PR3A 1K86A 4MROA 4MPTA 2P78A 2H9IA 4BZXA 3T5CA 2BHNA 5DI9A 4CHTA 2IU6A 1K63A 3A1NA 3QKSA 2YRFA 3PUYA 1FDUA 4XIIA 5KAPA 2J3JA 3PENA 1JZTA 4M1KA 3TAHA 4KRYA 3HJFA 4DM4A 1M5TA 2O8NA 3HB5X 3RV3A 2FFRA 1E6WA 3SJUA 2AJBA 4RTNA 4I8DA 1M1ZA 5T3YA 1KFEB 4G85A 4Q4JB 1PLJA 1KY2A 4R0VA 4X7PA 3RARA 5B30A 3E22A 3HJBA 2FW6A 1P1KA 5JMTA 4FDVA 3G5LA 4EO9A 3GNTA 5ED4A 2B1JA 1N75A 5BMOA 2R66A 1XKLA 3MZ0A 5EIBD 2WTMA 2CXTA 4H6XA 4K9PA 1OXVA 1TQ4A 4AT1A 4WXRA 3U3KA 3ZYCA 2QN3A 5EMHA 2WSBA 4NQZA 1JA1A 4YJGA 2YXBA 5KCMA 3A6GA 5M29A 2DFPA 2V45A 4HEA1 1VIMA 4QEZA 2AMVA 3OWOA 3V8EA 4B47A 2F7SA 2X3UA 2J3IA 3E5MA 2HF7A 3V46A 3ZIAA 3CNNA 3NI2A 3KJIA 4JOBA 3OUTA 4U8GA 2NUAB 2Q2QA 4KBYA 3OI7A 1VHDA 1IN7A 1C9EA 3W5JA 5BOSA 5ITZB 3TLBA 3X2SA 1A5ZA 2QRHA 1DP4A 2WTBA 3BIFA 2R5NA 2PGIA 2D1YA 1E3TA 2BMEA 4LKRA 4MOWA 1H0KA 3D4IA 1DC5A 4ZQCB 4O2AF 3KQVA 5HQTA 5ES3A 1QJCA 2VI5A 2QMHA 3STWA 4YP5A 4K6KA 3ZPXA 1MW8X 5KU7A 1Y8RB 2XGJA 3AEUA 4R1MA 2UKDA 5EIBC 5JAOA 1SD2A 1I80A 4CEJB 4QXPA 2YXEA 4Q05A 4ZZ2A 4PLWA 3GLVA 1GRRA 5K0JA 3EPKA 3HR7A 5FOQA 1ZBDA 1RU3A 4MW5A 1CETA 1JIQA 3ZNNA 1M73E 1U0SY 2FSUA 4Q16A 4UHDA 1H42A 4WJKB 2IH5A 3I52A 1TD1A 2ZBGA 5FBLB 3ROKA 1XZPA 2J6BA 4JFRA 1LWNA 4OLHA 1AO0A 1YQUA 3KWMA 1J4AA 4NH4A 1BMDA 3PRHA 3VH2A 1QVVA 4B35A 1GZ7A 4OYRA 2YINC 3R0ZA 5LCXA 4D0NA 3FRHA 3TBFA 2A0FA 2DBRA 1KKUA 2OHIA 3R0XA 1CUDA 3SSAA 2ATXA 4U7JA 1TKAA 3HU1A 3PC3A 3ILSA 3UMCA 1D6JA 4HMPA 1KQGA 1IHXA 1ZCBA 2J6HA 3ROEA 1JKFA 1Y8CA 1EVZA 1ZLYA 2BBOA 3PCTA 4K5QA 1U0JA 1R8YA 1SKMA 5GZ3A 2GJ8A 2YC4C 1BEZA 2IHTA 2YOGA 2WJZB 2BJHA 1P60A 3QFSA 5FADA 2AI2A 3LW8A 1FRFS 2AFIB 2DHRA 4KGVA 3OZDA 5H1YA 2BUAA 3OA0A 1LZLA 2V8OA 1OUMA 3OJ0A 5FR2A 3H1FA 3ZQ4A 5ALJA 2WD9A 3MBKA 3KQOA 4BN4A 2LD4A 2FN4A 3AR8A 4ER5A 2I4IA 4ZARA 4RL4A 4LZAA 1GRQA 2H2FA 3PT9A 4D7AA 4JBLA 1M34E 2PV0A 4JLVA 4MAAA 2X41A 3F98A 3FOCA 2AN5A 1NP3A 2FUG6 3CB2A 4AY6A 5JPCA 4L3OA 1SZDA 3E7DA 4QGSA 2HLHA 3GEDA 3DL4A 2QMOA 3QMVA 2L0XA 4LXUA 3REFA 3SF8A 2GEBA 4K28A 5FL3A 3LFTA 5AJWA 3SXJA 2WPNA 2CHEA 4N0QA 1QAMA 3R7NA 5CRIA 4DR3B 3JQAA 3IAFA 3DFIA 1EVKA 4YPFA 2ES4A 1KI1A 2JGIA 3MUOA 1PWHA 4GUDA 4EJMA 2CXNA 4LHZA 5H68A 5J3JA 3O95A 1NLZA 1B15A 1LTKA 1MEOA 2H07A 4C20A 3UJNA 2JJ1A 4KXVA 3QEKA 4BNNA 2JGDB 1NUPA 4QVKA 2FZ5A 4HDKB 3RH0A 2Z09A 4F6RA 1M33A 4PLYA 1Z39A 1IBKB 3N0WA 1Z7YA 2H00A 3GDGA 1OFHA 5FUMA 2APJA 4D3DA 3RSHA 1HTWA 2C2YA 1ZMBA 3G7NA 4IDPA 1KU0A 2V6JA 4MUEA 5ALUA 4DEYA 1JLSA 1YHZA 1ODSA 4AO7A 2ODNA 3W5IA 4HX5A 5JECA 3OJWA 4NZOA 4MUKA 1QAQA 2MHCA 3FYDA 2Z08A 3GFBA 1BE0A 2WOJA 4PLTA 4LMPA 3OEHA 4H1VA 3VR3D 1HEYA 1ZGCA 1R4NB 3AO0B 1HORA 4S1OA 4Y6LA 1ZGHA 4FEEA 2FRDC 5DYNA 2QZ4A 3VZPA 2FUEA 4L15A 4JBHA 1FJHA 2SECE 1MKYA 4PRKA 3KTOA 2ZRMA 3JD1A 4CKCB 1SBCA 4TL6A 3GRKA 4E2YA 2ZGVA 3SE7A 3TR6A 2CDAA 4OAQA 2C1XA 1O3YA 3NEAA 1S5PA 4DCGA 4E88A 4JBYA 2BKAA 4ZQFA 3V8VA 1B3RA 4C3OB 4NCIA 5FFNA 3HZRA 2YIDA 4B9EA 4LIPD 2AX3A 3JYOA 4IYJA 3H2JA 3TLAA 5LA6F 1ZC4A 1KOJA 3BA1A 3ZXXA 5A3QA 1HFEL 2HK7A 3UJ7A 5JSFA 2PLFA 3O2JA 1IK4A 3QFCA 4TUYF 4QYXA 5AIAA 4P08A 2Q9UA 1SRQA 4I5EA 1T0IA 1W19A 4G23A 4IRXA 4LOAA 3QEMA 4YB8A 3DXYA 2H65A 1C0PA 1CQZA 2ZJ0A 3CKYA 2JARA 4GG1A 4WBNB 1H0HA 2VZEA 3KOYA 3FB1A 3FA2A 3VV2A 4RA6A 5E3HA 4UBJA 1PFGA 1CERA 5FL7D 1QE3A 4D74A 1B6TA 2I5PO 2XUOA 3IVAA 1PDVA 4BNKA 1QU3A 4I36A 4DTCA 4EX7A 5B53A 4MCAA 4JOQA 4WK0B 4Z8XA 1I13A 4LYAA 2V3VA 1E4VA 2Q1TA 3IEVA 1T13A 1SXPA 3P45A 4QX6A 3QVLA 2CK3D 4MHSA 5LLSA 3GD7A 4CLXA 2Q5OA 2O23A 3HGQA 4LRWA 2O7SA 2ZTMA 5IHPA 4ZAYA 3E0XA 1XZKA 3ROTA 4GXQA 3F6SA 3HRHA 2YWDA 3D8TA 4CXMA 1XKQA 4KE8A 3PRYA 2ONKA 4RSGA 1OIWA 1FLDA 2GT1A 2RONA 3DTNA 4JT4A 4LYGA 3WB0A 4IF4A 2FZEA 3L0DA 4ZJPA 2XUDA 2AFRA 1S2LA 5HNKA 4HZUA 1NVGA 1TMKA 1E58A 1U31A 3ANXA 1FFHA 2J33A 2H31A 3CF2A 4GZLA 3IMKA 4OJYA 1HE5A 1A5BB 1E0KA 4QBIA 5JUWA 4N3AA 3GRYA 3OA2A 1P9LA 2W0SA 1EX9A 3CZ9A 4UZFA 4AC9A 5KHLB 3RAFC 4KAJA 3A28A 1HFJA 3BL5A 4PRYA 2B98A 2TS1A 2X8JA 3HJRA 4BB9A 3ZCXA 5KVAA 4XEHA 1B00A 4JH0A 1SJ9A 4CUZA 2A0KA 3PXGA 5KJCA 3A1EA 2ZIAA 3CEJA 1CZUA 2J9XB 3F67A 2DGDA 1G8HA 2WRZA 1FFAA 2HZ7A 1G1MA 3D6MA 4LRXA 4BX3A 3P26A 3K8YA 1DJNA 3R3HA 5IF9A 5K6TA 4II2A 1DO2A 3Q98A 4J2HA 3FTCA 1CP3A 5DTMA 1OFTA 4QBFA 5EUBA 4K87A 3C24A 1FF9A 3H1EA 2CYAA 3P71T 4NVRA 4EO7A 2PJRA 1HXHA 2W2KA 3EXFA 2A9VA 3O38A 2J3LA 2BELA 2WICA 2HJ9A 1UK6A 3E2MA 4EJFA 2BCJQ 4DUZB 1ECCA 4D81A 3BXFA 1GSHA 1O6CA 3TX6A 4D44A 1RQNA 1Y3AA 1Z5ZA 5DTIA 5KU1A 3SQWA 1DIGA 2B78A 2ZJOA 1EZZA 1ZS9A 4E21A 1A7KA 1RC1A 3E7PA 1LGYA 4D0RA 4ZO4A 2AMLA 4RANA 2JFWA 2O2GA 2A1UB 4JIMA 3KYDB 2ZS8A 5JCPA 3LXUX 1G6Q1 2E6KA 4LE2A 1AHPA 3ON5A 1RBZA 4RLHA 3L4JA 3MJHA 4AZ3B 3W4IA 1I10A 3UUWA 1O58A 3LA8A 5L3SB 2UU9B 3G2QA 1R0ZA 3EGOA 1UOQA 4QG3A 4QYWA 2VXCA 3RVMA 1MG0A 5KI6A 1CRQA 2B30A 5BUCA 3H5LA 4EX6A 4J7AA 3ZS9A 3U5TA 4WE3A 2O8EB 4FCCA 3ET4A 2BPOA 1RYZA 2IX9A 1RMQA 2XTMA 1SH7A 1KK1A 4OHYA 1FYXA 1C9YA 2H52A 3GNSA 3LSTA 3RVNA 2Q07A 3W9SA 3VC2A 2IY8A 2E37A 2WG0A 3HRKA 1PZMA 3PC4A 2CUKA 2HRCA 2NSLA 3NU1A 4MWDA 4DIDA 3I4LA 4HH3C 4M1OA 2PRSA 2X23A 5FQNA 5LIRA 3IDFA 3OZTA 2G63A 2R1TA 3HKDB 3Q9UA 1WD5A 4LXYA 2WV9A 1D3AA 4GP7A 5J5CA 5DK6A 3DFUA 1SXJE 2RKBA 4LY6A 4TLCA 4UM9D 4U2DA 2DWOA 2WHQA 2C92A 1G7CA 2FWIA 2PGLA 2XXJA 4M76B 5CLQA 3RYFA 3P4XA 2QTZA 3FPKA 4RVUA 1JH8A 4IJ5A 1E3SA 1PZHA 4UEJA 3R5TA 2UZ3A 2YY7A 3DB2A 1CG6A 4JJ8A 1AH2A 3UFXA 2WSLA 4W5OA 4B87A 1R00A 4FYIA 2V7PA 5DCUA 1DHRA 4LHWA 1YVEI 2E5WA 4MVJD 5C52B 1NVFA 1CLUA 2O4UX 5JTUA 3NDBB 5ALSA 3H2SA 3QKRA 4HXYA 2REBA 3DLPX 4I8XA 3OX2A 3L01A 3AETA 2UAGA 2A3NA 1NXTA 1M8PA 3DE2X 1RKUA 4FYPA 1N6RA 3O0DA 4XARA 4M0PA 2B4RO 5EMKA 5BRAA 1H5QA 3ZWVA 2RGUA 1N5LA 1UMKA 3L7LA 4EEZA 5FD8A 3T7JA 4QOGA 1SC4A 5LP6C 4DPKA 4ARVA 2ZBRA 3ANLA 3BDVA 4V1CA 1Z8NA 1PJAA 4RVFA 1HC7A 3K8ZA 4AG6A 1E7WA 4L76A 5JVDB 1I4OA 3RIHA 3AFHA 4CMGA 4DJFC 3OLQA 1NX9A 2HMTA 3NATA 4FT4A 1Q0LA 1JR3A 4QA9A 3H0KA 1Y1PA 1SBYA 3L84A 4FILA 4X8MA 4M99A 4MRSA 3DVSX 1I1NA 1ZY2A 2VF4X 4HDRB 3A05A 5SYNA 3AI3A 5JXWA 2O2JA 2V7WA 2DFDA 3HJCA 1B4DA 2FUKA 5FOVA 1R9NA 1WDMA 2G77B 2VDJA 3OX4A 5I47A 1Z2AA 4OO3A 2CNNA 3I6YA 2H5IA 3IE0A 1WSBA 2HMWA 3Q15C 1VHQA 3ZUPA 4NHOA 1JNXX 1G17A 5JQGA 2EGUA 2G1PA 4L2IB 4ZOEA 2R6ZA 2QK4A 3DWEX 4XEUA 2GMWA 4G9EA 3RVRA 1PVDA 1FNMA 5B64A 2BGIA 2ZSJA 4K46A 4RTPA 4V24A 3KTAB 1IN6A 3KKQA 3F7MA 2BH2A 1V0JA 3GBSA 2O57A 1XWWA 2XQKA 2IS6A 2I99A 5ALMA 1BMFA 4BEJA 2ODWA 1XQYA 2PJUA 2WJWA 3CR3C 3V8RA 3VC3A 1F06A 3GRAA 2YHAA 4REQA 2V74B 1YA8A 4FS8A 3INGA 4OSEA 3UJ6A 3WWZA 3ENKA 1KY5A 1L4HA 3PXCX 5TNXA 2B7CA 3PFBA 5FBKA 3ZX4A 1CYEA 2OCIA 2GPYA 3C4JA 2ZE7A 5DMHA 1M2GA 2Q1SA 4IVQA 1D7AA 3X1XA 3B6IA 3K9WA 2YFYA 3M4ZA 3SK0A 5KTNA 2GEKA 1JKJA 3AVPA 1XCMA 1YS6A 5JWHA 1DRKA 3H87A 4YCAA 2X0FA 4JI0B 4QSHA 3N3AC 1LLDA 1PT6A 2XTNA 4XGIA 3UO8B 4IKEA 3ZIAD 4HHEA 4GQIA 3GRFA 4E2XA 2EBHX 4MWCA 3JAMA 3VTAA 1PUXA 1Z37A 4RQTA 4ZOLB 2WY2D 3LDFA 4KG7A 3T9DA 3ZI4A 3Q5EA 4FJ2A 4BO3A 3W7BA 1A8IA 2ZYAA 3CG0A 1E0JA 3ABRB 3F8WA 2B5OA 3NS7A 4WGGA 4IX1A 3SM9A 1P81A 2FW8A 3MLAA 4BVEA 3AM1A 3OD5A 3Q2IA 1GQ2A 2WHPA 5L3QA 4UUNA 1LX7A 1ZM4A 2PQ0A 1GM5A 2HN9A 1S89A 4EBFA 5F7XA 4EY6A 3UJ9A 1RIFA 4LVNA 2GB4A 1L7XA 1XRRA 5FXMA 4C0HA 5LIPA 2QZSA 4A6PA 2C4HA 1UPTA 2X6TA 4MQFB 1CUFA 3RVDA 2ZITA 3R8FA 1OXMA 1Z0KA 1IVYA 4OI0A 4HNQA 5A9RA 4BFUA 3QG5A 3KE9A 1F4VA 3GGGA 4D4KA 2AN4A 3W34A 3PGVA 1GAEO 4KFCA 4QRDA 4ERNA 5TEVA 3ZU5A 4ESOA 4Y18A 3TG8A 3JALB 3MWJA 4CMIA 1UJNA 3HGMA 2J67A 2OV2A 4HEQA 1GZUA 5J5VA 4BIIA 3MJCA 3BMNA 1G5IA 4CKXA 1BXGB 2PRZA 4TV9A 1IQUA 2AMYA 2ZYHA 4U7HA 4YUWA 4MW2A 3CLHA 3NBFA 4QC2A 2AFHA 4FGSA 5THXA 3UB3A 4FYYA 2IHYA 2O48X 1L1FA 4BLVA 2A9QA 2JIPA 4Z2YA 3TTTA 2H4ZA 3DLIA 3QY9A 3G0IA 4AO6A 1J0AA 5BUZA 1O2DA 4X6XA 2HB6A 3ETGA 5D84A 3UIEA 1DPGA 4P5PA 2NSYA 4WLFA 4WKNA 4D56A 2QVZX 4JYBA 1COZA 1SBQA 1U8CB 1ZK2A 1TEHA 1VE7A 2X0JA 2ZVJA 3AK4A 1JX6A 5D87A 4C0AC 1X8LA 4ZYUA 5AVTA 1ZM2A 2PYDA 4HP8A 1IQRA 1HOXA 2ZJBA 4EUSA 3EVDA 5JNTA 1CUEA 1PK8A 1R18A 2C9OA 2GN6A 3LX6A 2WG2A 2IU0A 1ZXXA 4DADA 4FK8A 1ULHA 3RGGA 3AL2A 2O2CA 4MHOA 1DX4A 3C7KA 5P21A 5KYTA 1Z4LA 3H6GA 4QFBA 3WJ1A 2SHKA 3RYCB 3FGZA 4ASUA 3I1IA 1K8ZB 4DC0A 5CDYA 5T5QA 1EGAA 2BFFA 1AU9A 2N1BA 4MW0A 4XX1A 1QHYA 1Z9BA 3L6DA 2D5IA 2QW8A 3FBTA 1X13A 3BRWA 4MKRA 3V4SA 2CVQA 3KP1A 5C1BA 3ZBPA 4LZPA 4GVPA 2VO1A 3GUHA 3JQAD 1LDBA 2PTGA 4Q3EA 3WHKA 3MWDA 3QMPA 3DPUA 4WERA 2O0HA 5JMPA 1PR3A 3BZWA 3LUKA 4KE9A 4L51A 1JUDA 2GHQA 1ISGA 2M6RA 2MU1A 3DZHA 3IR6A 1X2EA 1H2ZA 2WAYA 5JALA 1NL3A 4HMOA 3WBBA 4A10A 5ARBA 1V8PA 1BS2A 3G0DA 2NU9A 4GI3A 1X1AA 4UVGA 1VKJA 3ZV6A 4BWFB 4DC1A 4ZTUB 4E70A 1Z2EA 2CZCA 1N0IA 1RE1A 1UC4B 1Z34A 1SUEA 2JCYA 2JHPA 2PX3A 2RHWA 2YMLA 3LUJA 2G0TA 2BMVA 1GNSA 1H4TA 2HCRA 4ERXA 4MQUA 3C5EA 4F1JA 3E70C 3W78A 4I99A 2DETA 3GEIA 3SFZA 2G17A 2IUTA 2JG3A 2F00A 2BONA 1ZM3A 1M7HA 2I4TA 2JJ8A 2K2QB 1UJ6A 2RH4A 3DDWA 2P77A 4IQ4A 4ZO7A 1O6BA 4JBGA 3HL0A 4RF2A 4RVHA 4BDSA 4JVMA 1WXIA 3QYPA 1W29A 3E1SA 4X1YB 3PQ6A 1ULBA 4ZCMA 5CLFA 3DM5A 1WZNA 3IQEA 3RUCA 3OE5A 3TMYA 4QDJA 2RHBA 2NV2B 4LMBA 2AOUA 3IPCA 4IDNA 1X1QA 1X80A 2PZGA 3VV3A 3ZW8A 1WHSB 2Z1NA 1Y42X 1DBWA 1RLMA 5DEIA 3WLAA 4ED9A 2EKDA 2VEOA 4FMPA 3I6ZA 3BTUA 3OT5A 5IH7A 1W0JD 2LGJA 1F6DA 1N0WA 4E1AA 4PZLA 5LYJF 1M6VA 1J6UA 1POWA 1UXKA 2FG7C 2FRVA 5CPFA 1B0ZA 3PF9A 1TU4A 1M0TA 1PEDA 2BKUA 2ERCA 3EE6A 1MFZA 4L4ZA 5CT8A 1ZN2A 3HCEA 3SQXA 3OJXA 2XUAA 2NT4A 1C1HA 3AP1A 1U04A 3D6NB 3AEZA 3V9AA 2NP7A 2RD2A 5J63A 1NQTA 4HAUA 3UK0A 4BU0A 3HDGA 4L72A 1YQXA 2H0QA 2I6TA 4BAUA 3SR4A 1RHJA 4NRDA 4Q82A 3R75A 3P27A 4Z7OB 3N8DA 4G0MA 3TMKA 3JASA 4HLNA 3CEPB 4AECA 5CB4A 3F5DA 2R751 1FSPA 3OFKA 1RCUA 1RAFA 3RIYA 1E9SA 5EGNA 4EY7A 3H11A 2P1DA 1I2ZA 2IXBA 4RPGA 2O1EA 5A4IS 3QOFA 1CUJA 1E7RA 5F78A 2QX8A 5K3FB 3HXLA 1DOZA 3R8CA 4Q39A 4GHWA 4IGIA 2DFVA 4EVQA 3U13A 4IJUA 3OFNA 4X00A 3KKOA 3T5BA 2ZWIA 4DLPA 1NNSA 2BR5A 2N75A 3BXPA 1LBIA 3UCFA 3TSCA 4DXHA 2Q7OE 1P4GA 2QM3A 5D3QA 5KMGA 1NQOA 3SQOA 3CT6A 3ANMA 5HF9A 3K0EA 4QHSA 2VYFA 2PRJA 3RV4A 4S35A 1EJBA 2YV5A 1KC1A 1PL0A 2Q4TA 3NRCA 2XB8A 2AVDA 3AYZB 4EUKA 5LDHA 3AQ4A 4RY8A 1FLAA 3EIQA 2GHTA 2NUTB 3FJ1A 3MJFA 4L0CA 4Q9JA 4DCMA 2V96A 4X8HA 3LE8A 2YY6A 2EOAA 1WP9A 3MGGA 4ZI2A 1H4SA 3NVKI 2W98A 3QV2A 5CFQA 4UBLA 1E61A 4R83A 5TMPA 2H4FA 1JEQB 3EZ7A 4MS1A 2O7VA 3ZZ0A 2L17A 4OUDA 1PZNA 1QIDA 2XD4A 2TMDA 5I9NA 3JPYA 3X1KA 1ODIA 2OO3A 4CM5A 2WD7A 1LBSA 1OIVA 4EW3A 3HY6A 3KEQA 4L78A 4LSWA 4P7BA 4UEOA 3VR0A 2Z9DA 5TDHA 3OT1B 2Q6OA 1JWAB 1X7ZA 2W9XA 5FPKA 2EIHA 2GPNA 3CO0S 3MRSA 5A4JA 2WVGA 4QD3A 2VBCA 5JAIA 1L3IA 3IYLW 3N5KA 5KNLA 4NESA 5BPHA 2EFHB 1XFDA 3SX0A 5FP0A 4XCQA 4XRRA 4YMHA 5ITVA 4FN4A 5JD4A 4KC0A 3HUTA 2YVLA 5CXQA 1H0RA 5DXFA 2BLLA 4WCDA 1R10A 4HLQB 5CPBA 5EJGA 4MW9A 3EWSA 4BHTA 4CKEA 1ORDA 3R0JA 1OYYA 5C4MA 4PPFA 1P8AA 1RLTA 4JUAA 1QOQB 1Z62A 4DGSA 5HOEA 1EGVB 3ZQJA 4OXRA 1CJVC 3SG0A 1X9IA 3U1VA 2CJPA 3QIVA 4I6JA 1NVKA 1KOLA 3R74A 3IHWA 8ADHA 3DDHA 2V6GA 3CNQS 3OPMA 3DDZX 4KUEA 1XAIA 3PEEA 1C2YA 2JFOA 2DPLA 3EEYA 3HDVA 3DDSA 1FVXA 3C8MA 3V8MA 2VDWA 2XJ4A 4K9KA 3NTXA 5A7FA 1HYHA 3ZE1B 3HCOA 4KXWA 2QVGA 1KA9H 2FVYA 4ZAGA 5TS3A 3N0RA 3TRJA 3I83A 2C2ZA 4EFNA 4CNBA 4ZTZB 3AVUA 5FBWB 4FGJA 2FQYA 1YFKA 2JI4A 3E23A 3KEFA 4KWHA 3BF7A 4HAYA 3V1KA 4AYTA 1HH4A 2AFVA 2PBZA 3KJZA 5HKLA 4XIJA 3L7AA 3W77A 4X62B 2H5EA 4FS3A 1A4RA 2MTBA 3U62A 1J8YF 1T8TA 2VDPB 4C4YA 3BFPA 1M72A 1XL1A 3F0TA 1IRIA 3FN4A 2DHQA 5EIOA 4BE4A 3FOEC 1XF9A 1R6XA 1E1QA 2CMGA 3DW1X 3L7JA 1DOHA 4CIXA 5AW7A 2OFXA 4V0KA 3I73A 3WY9A 3CX7A 3KXPA 2Q4EA 1J8QA 5JXGA 5DM2A 3RW9A 5EPOA 1SKQA 2VQ3A 4Q24A 3ADCA 1XJ0A 3AF6A 1N1GA 2PR7A 1P61B 2FKNA 1ZNWA 4Q9AA 4KR2A 4EP1A 1DT3A 4BC0A 2MJLA 3VHLB 2OYRA 1M34B 2GYVA 4V3BA 1ZIOA 4C1NA 4L95C 2Q8PA 2H85A 4FFWA 4K2HA 5GZ6A 3ERCA 3UJDA 1YJBA 4QEDA 3UGTA 1MJFA 4QTZA 5CG2A 5KX5F 5KZMB 1QR6A 4V3CA 3KKZA 1DINA 1QIEA 3S1AB 5ALGA 3AI7A 4N12A 7MHTA 1KARA 1HE1C 2OE2A 3RJ5A 1MTZA 1WAMA 3T38A 3FI9A 3KQWA 2XCSB 4CPDA 1YOVB 3LY5A 5EMMA 4RJKA 3Q3JB 2XVXA 2XWPA 1AUPA 2QY9A 4GM4A 1H4QA 3R0VA 5D3KA 1GGJA 3AT1A 5T3UA 4L6IA 2OHJA 3H5OA 1F4PA 3EJWA 3H9GA 2IRWA 4YMLA 3GDOA 4C29A 1JG7A 2BFEB 5GOTA 5TGDA 2HLDA 4KV9A 5EGSA 3TVYA 3TLMA 1JJAA 3IEXA 4X45A 3T41A 2H8KA 4YVFA 3VZBA 3WGGA 1JR3D 4PIPA 2P11A 2PU5A 4E14A 4D26A 1IN1A 1HT2E 1EGHA 1ZH8A 2VXYA 4OYLA 3AR9A 3QE2A 4TLDA 3RRNA 4EEXA 5BNIA 1QP4A 1Q12A 1KI3A 1S4QA 1XMXA 1YZGA 1NGSA 1UZMA 2C0CA 1DNPA 2KB0A 1ZEMA 2J5QA 2VFAA 4QGBA 4ZVUA 3RDPA 3ZR4B 5JBNA 4O8CA 4Y9DA 4UBMA 3JYPA 4MUXA 2UDPA 2JJYA 1AKVA 4KUHA 4LOIA 3J80A 1PNRA 4ZXPA 4YV1A 4EFLA 4L4RA 3BQMB 2EJCA 4BV2A 5EIWA 5KJFA 3AVVA 3DMYA 4BNGA 1ZU5A 2FPMA 5A2QA 3I9V1 2PZ8A 3OFJA 4FONA 3C8UA 1YZNA 1BMFD 2GAAA 2PS1A 2GN1A 2PWZA 1QTQA 1CR6A 4M88A 3T3OA 3KKEA 4FGKA 2QVLA 2FG5A 1E2LA 2WM3A 5ELMA 4ZHQB 2YZKA 3SBOA 4IHQA 4DCNA 1IAQA 3R3JA 4JBNA 4ZD6A 4UDNA 3T7TA 1IY9A 4FLMA 3TLGA 2C2OA