4Q02A

Second-site screening of k-ras in the presence of covalently attached first-site ligands
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
169
Chain Sequence
b'GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDCYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title A method for the second-site screening of K-Ras in the presence of a covalently attached first-site ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 169
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q02A00
4LYAA 4OK6A 4TT3D 3GCGA 4MUAA 3NH6A 2ZJZA 1AQUA 5AUPB 4Q5IA 3CBQA 4M1WA 4D80A 5BN5A 2OAQ1 1AJEA 1W0JD 2QN6A 1AK2A 4V0NA 3AVXA 2FPLA 2PEZA 1J8MF 3U7FB 2BC9A 2ZEJA 1DTSA 4KI0A 2D4HA 1EFTA 4B44A 3L0SA 3N5CA 4GZMA 3EZ7A 2ANBA 2CHGA 1E9CA 2OXRA 2Y8EA 4GOXA 2CE2X 2ZJBA 1G21E 5G3ZA 3I3SR 4AK9A 3B8HA 1QHXA 3CF6R 2WWGA 2N42A 1DE0A 4DLUA 4V0MA 1Z0KA 2EU8A 2QAJA 2H18A 2IYZA 5LD2B 4W5JA 5FPKA 1WE2A 2AXPA 4A8JA 2ZRHA 3KL4A 4OHXA 1JJVA 2ZITA 3RS2A 5FTLA 4Q48A 1YZQA 4UNSA 2D2EA 2ZRFA 1SHKA 4HLUA 4FWTA 4MKHA 4HB2A 3AF2A 4MYTA 1JQJC 4PHHA 1Q1EA 3AVOA 1TF7A 4Q7MB 4OHWA 2ERXA 2ZJOA 5TB5A 4ZI2A 3CNNA 2UVQA 1SVMA 2F43B 1KZ7B 3CWQA 1UAAA 4PTLA 1W4BA 5DN6A 1PVOA 4ABYA 3FDIA 1NVVQ 2KB0A 3T61A 2OAP1 4DSNA 1IN4A 3WNBA 3KTAA 1PLKA 2N1BA 3L0OA 4IXMA 1JAHA 1XMJA 1YU9A 1W44A 1G3IA 3MJHA 1COWD 1NMZA 1XD8A 1GNQA 3SBDA 2MMGA 3QKTA 2ZI4A 1D8TA 2WBLC 2QPOA 4ILEA 2XGJA 3FHTA 4CYMA 4BRUA 4IXNA 3QPWA 1RJ9A 3I4LA 1E2MA 4BLPA 4HUQA 1US8A 1G7SA 3ASYA 3DM5A 5JEEA 1EFRA 3DM9B 2Q3MA 4LHZA 1UDWA 5JZVA 4BLQA 1Z63A 1U8AA 3NEYA 3SFZA 4C0HA 3KKNA 4JJZA 4ZDWA 4OJQA 3A4NA 3ADDA 2J5XA 2ZSBA 1CEEA 4LHWA 1XJQA 4HB3A 4HZIA 5GJBA 3RLFA 2JLQA 5FL7D 1U0JA 2IEZA 2NG1A 4BEJA 3QEOA 3C8UA 5LD2C 3OIUA 4UJ5A 2G3YA 5GJCA 2G0TA 1BMFA 1CR2A 2QPTA 1LS6A 1SZPA 2GNOA 5H68A 5B64A 3BC1A 2IYLD 3BXZA 1LFDB 3L82B 3RRMA 1GUAA 4ASUD 1M6NA 4DLZA 3BAFA 2ZXUA 3U4QB 1HT1E 1MO5A 1F2UB 1OFIA 3RDPA 1MT0A 1ZC4A 1AN0A 2ZE8A 5CDFA 1CBUA 1SXJD 2HJGA 3U3RA 5FOWA 4HUTA 5JS8A 4CEHB 4GP6A 2CCJA 1Z8FA 3U44A 4CVNA 1GVNB 4V0KA 2JLZA 2WSSA 2R44A 3B13B 4TYPA 4E09A 2FU5C 5CIQA 1VIYA 2W6JA 1O87A 3ZIAD 2ZR9A 2BVNA 1F2TA 3NWJA 3TW8B 5JRZA 4D4MA 5FL3A 4OQNA 2V55B 3TUIC 5JJLA 4BFXA 1II8A 3SHWA 1K8RA 1FUKA 1VHLA 3A8TA 4MUBA 3GLHA 4RZUA 3I5XA 1ZUHA 3EW9A 4G5QA 3HWSA 4B3GA 2O5VA 1E1RD 3LD9A 2AKAB 2OESA 1G7TA 3MG9A 2I3BA 1AKYA 4M1SA 4QHSA 3TJZA 4AD8A 3NVAA 4DSTA 3PCRB 3D31A 3TVDA 2VPPA 4ZDIA 3K09C 2SHKA 2Q21A 1T6NA 2WJJA 3IO3A 3NH9A 4U02A 4KSCA 4PQFA 4Q66C 2NZ8A 3VHXA 4BPBA 2IYRA 4ZI3A 1I4LD 3RRNA 3QOFA 1KY2A 4DWJA 4DRZA 1Z0FA 5DE3A 2ZAOA 2QROA 2B7BA 3AVPA 5DYIA 4HDQB 4EFMA 1P9NA 2WJIA 4F4JA 3B2EA 4TT3A 5IRCD 2ZJ5A 1QVAA 4PC3A 1N5IA 3IHWA 2GF9A 4KJZA 3BWDD 1FW6A 4A36A 2LKCA 4RCZA 3ZLJA 5FBWB 4C2UA 4PAMA 2ZREA 2IUSA 5JWHA 2PMDA 1ZM2A 5IK2A 2ODEA 1N6HA 3QQ5A 3SE0A 2YOFA 4PQRA 3SNHA 3CH5A 1IOZA 1IJFA 4UNQA 5KYKA 4A4DA 1FZQA 3KQUA 2FZ4A 3B85A 1HURA 4CEIB 3RRZA 1W36C 1ZC3A 3CM0A 2L0XA 3VR1A 1KDRA 2C5LA 2HXYA 1IAQA 4E03A 3KKMA 4EUNA 3RYTC 1XTRA 2O0KA 1E0SA 4QL3A 1DAHA 2CVHA 4DT1A 5KTYA 1KKLA 1ONBA 5A0FA 4URVR 3SQWA 3T1QA 2Z43A 2JJ1D 4OQLA 3QF4B 3THWB 2PZGA 4TLEA 3A58B 4PC2A 3FOZA 2IXEA 3V9PA 4D81A 4UXHA 2JATA 4KBGA 4L9SA 1F48A 4EJSA 4FN5A 5FPHA 3SJBA 4TLAA 4B48A 1XD9A 2W2TA 1G3QA 4V02A 1T8UA 2CLCX 4Q1EA 1E4YA 4MRPA 4OI4A 3IIJA 1AM4D 2H57A 4PX9A 3Q5EA 2ZYWX 2XZLA 2CCKA 1T8TA 5LB4A 2IYSA 3TW4A 2PL3A 3CPEA 1ZD8A 2N46A 4B3CA 4JIMA 4CF7A 1ZIOA 4LJ5A 3W5IA 1OH8A 4TLCA 3LO5A 3KKQA 2IHYA 1P2VA 1UJ2A 4A6PA 3TH5A 1VG9B 3EWAA 5TV2A 1ZYUA 4XIGS 3VR3A 3TSWA 3LRPA 1CLUA 4PO9A 1HE8B 1TNDA 3TAUA 3KJHA 4PQYA 4LBWA 5J4KA 2OBLA 3BH0A 5FI0B 2JA1A 5FR2A 5FBVB 2FV8A 3E5HA 1F5NA 4MRNA 3WBJA 2XZPA 3GJ7A 3ND9A 1N5JA 721PA 2FEMA 2NPFA 2IS2A 2IWHA 1N6OA 3LLMA 4DC9A 1R0ZA 4DEYA 2WHXA 2KBEA 4DJTA 2Q9BA 4A15A 1SULA 4QGGA 1E2HA 2CLDX 3LH5A 4UKDA 1V5WA 3AGPA 4C0SA 3LDAA 2W0MA 5FL7A 1YZKA 2OBMA 2WWHA 1XEWX 4XH9B 3KUCA 4R71A 3MCAA 4F91B 3U2QA 4EPTA 5K8IA 4Q4AB 4DLTA 5C1BA 3BH6A 1FUUA 5CIWA 3QXJA 4NE2A 1ZCAA 5CDFE 4OI1A 2W00A 1RC8A 1GRQA 5BW8A 4OBEA 1Y3AA 1ZD9A 4PO1A 1N6LA 3NHAA 1G18A 2DWQA 3K8YA 5DI9A 3SYNA 3ZIAA 4MQBA 3GJ0A 1E2KA 3TNFA 3GLGE 3LVRE 3KQHA 1MO3A 4D26A 3IIKA 1E79D 5CM8B 4B33A 1KMHB 3X1DA 4DCVA 3RS0A 2F9MA 4DXAA 1SHZA 3H86A 3GLHE 3VU9B 2FFBA 1EFHA 5GVRA 1E69A 3VKGA 1CR0A 3LWNA 3U3MA 1D9ZA 2C2HA 2VP6A 2YWHA 3GEHA 1VYVA 3AVVA 4XSGA 2ZRBA 1DO0A 1PJRA 3NBFA 1NNEA 3EG5A 1JQLB 4WXPA 1GL7A 5E7IA 3EPJA 2PLFA 4WXRA 1RRFA 1E2JA 4MGKR 4ZKEA 1XXHB 5IHPA 1E2PA 4I1OA 1XMIA 2JGNA 4D6PA 1ODFA 1ETUA 3MWJA 3B7GA 4XTRA 2UKDA 2AL7A 2IUUA 5JWOA 1QHHB 1VMAA 4QFMA 1AS0A 4HEJA 4C0KA 4B3BA 3FFAA 2ZRIA 3KJIA 1HV8A 2PX3A 1OB2A 1X3SA 1JI0A 4F4IA 1GFIA 2NOAA 4QGHA 3EZ6A 2ASEA 4KYUA 2WZQA 2GCOA 2ZYTX 1LF5A 3GFOA 3LFUA 5TDHA 1CTQA 4AIIA 4D82A 2A2ZA 2OFOA 1YZUA 2ZS8A 3ZZ0A 2XZOA 1KNQA 4LRWA 4ESHA 4XWOA 1J90A 2F3RA 4LJ9A 3MLEA 1Z0AA 3VQTA 2JIZD 4B2LA 3JZAA 5FOTA 4D0GA 1G4AE 3SZRA 4EFLA 2GJ8A 3L0PA 2C98A 1G6HA 2ZE6A 3BFVA 1JB1A 4MYUA 4YMUA 3K0SA 2I4IA 3NBZC 4TMKA 2LCFA 3GJXC 4KFUA 4GRAA 3OIVA 1KSJA 1VTKA 3KZ1E 4TSFD 1KYIA 2YWGA 3B1VA 1NY6A 5DHAA 4GMDA 2JJ1A 4HZUA 1XZQA 1QHSA 3IPYA 1YZTA 1Z0JA 4ZCMA 2OCPA 4R9UC 3K9LA 2EQBA 4TMZA 4Q7JB 4L15A 4Q1AA 1JBKA 2X77A 521PA 5D3QA 4DUGD 5JLJA 1W7AA 2JLRA 1ZUIA 3NKVA 3MAAC 1GRRA 1HH4A 1ZM9A 3DL0A 1NVXQ 1SVKA 3CR7A 5AJWA 3B60A 4QRHA 1TMKA 1D2MA 4LV6A 2IXFA 1E0JA 2VSXA 1P2UA 3AB3A 1IONA 3CRVA 4MKGA 2QBYA 2REXB 2ONJA 5J4VA 1F3OA 2AN9A 4YXWD 5KNDA 2GESA 3KFXA 4JL5A 1GDDA 3T5DA 4BEBA 1XB2A 3B1WA 4RZXA 1L2TA 3P20A 4Q9LA 1XTSA 1WF3A 2X1VA 2FFHA 4B74A 4NHOA 3GEIA 1DAMA 1CJTC 1UKVY 2NZJA 2WOOA 1JEDA 3SN6A 5G40A 2RGAA 1NLYA 4PHGA 2NMVA 2NTYC 4EPWA 1MRSA 2WPDD 4IOMA 3SC3A 4QJ4A 1O3YA 2AFHE 1U8ZA 1E98A 3THOA 3WYAA 2FEOA 1F6BA 5EXSA 1LV7A 4Q03A 4DDVA 1XXHE 5E7MA 5E7JA 3CZPA 1EX6A 2PCLA 2EW1A 4DCTA 2EYUA 3LAWA 1OKKD 2B6HA 2IK8A 2P6NA 3BFXA 1KOFA 4CEJA 1P72A 4QNRA 3CRMA 3HU3A 2HJVA 3W5JA 4FWIB 5FUXA 1D9XA 2HUPA 4ZDJA 1TX4B 1VPLA 3FMIA 3A37A 4OQFA 4ZO4A 2C96A 1E9DA 1A4RA 1Q22A 4BFZA 4O2LA 1SVLA 4R98A 4XTCS 4Q4HB 1U9IC 3X1YA 2IS4A 2QM7A 1KSFX 3V4FA 3QSYA 1IQPA 4PC1A 1N0UA 3KDSE 1IN8A 4NCHA 1KTVA 1IN6A 3DKPA 1N6KA 2BBSA 5KDLA 3BRWD 4GSYA 2ODWA 1ZNWA 3GQBA 4I1UA 4W7SA 1VHTA 4IDQA 2MSEB 2BBTA 4JBYA 2D7CA 3TLXA 4TTPA 2J0VA 2WWWA 4G5RA 4MRVA 621PA 2TMKA 1GOTA 3SEAA 3UMRA 1OH5A 2NO0A 2ATXA 5EXTA 4DB2A 1N5KA 3UK6A 3JVUA 4F93B 3A1UA 4PPFA 1E79A 4Q1CA 5CK5A 2WIBA 3A36A 1OLOA 2XXAA 4KFSA 4QGFA 1NMYA 3CX8A 4O2RA 5LPNA 3EWSA 1DOAA 3FTQA 3X1XA 4LV5B 2O8CA 3BOSA 4DVGA 4FMDB 4LOAA 3VX3A 4MKIA 1LY1A 2C04A 2W2XA 1WA5A 2VYFA 5IDVA 1X1RA 2ZYVX 1XF9A 2GJ9A 4OYHA 2EFEB 1XTQA 4JVNA 3BERA 3L43A 3QNUA 3IUYA 4ACBA 1Z2CA 5P21A 1OF1A 4M1OA 2ORIA 1E0KA 4DLWA 4JBWA 1Z08A 3J81k 1J8YF 2ZU6A 2O0JA 1QG4A 4DKXA 1N2CE 3PXGA 1WXQA 2GAOA 3THXB 4V03A 5AJYA 2A5DA 2DB3A 2W0SA 4Q1BA 2Z4SA 4EPVA 3DEFA 1Z6XA 2ZVPX 1QBKC 3Q9LA 4I81A 1SKYB 5B2ZA 2JLSA 3ZQ6A 5C46F 3GLIB 1OV4A 1OH6A 3F8TA 1G5RA 3P26A 4IOLA 1CJMA 2YC4C 2QMOA 1XEXB 1VIAA 3U3OA 2QSYA 5EUMA 2HLDD 2QRZA 3EA5A 2JEOA 4MKFA 4AI6A 4N0DA 2JIZA 4BFSA 2IS6A 2AR7A 1GKUB 4TYYA 3NIBA 1GKYA 4DEXA 1LTQA 1F60A 2ZRNA 3N2IA 2ODBA 2J45A 2YZ2A 2IF0A 4MRRA 4DDUA 3IDQA 1Z47A 5EE9A 4D4JA 3MWKA 2BDTA 3HYRA 4E5UA 2E9SA 1GITA 1P9WA 3ZVMA 5GJVC 4CEJB 3WMGA 2F43A 3FMFA 1KIMA 2QZ4A 3CF0A 2BEJA 1R7RA 1AZTA 3QENA 3W8NA 3EC1A 3EA0A 2V6JA 2YOHA 4DUGA 1YRAA 1VCIA 4OJKA 1P5ZB 1UFQA 2F1IA 4P4SB 5FPSA 2FF7A 1P7CA 4C0AC 2C95A 3LW8A 1GTVA 1AIPA 1JALA 1GM5A 2ZVQX 2A9KA 1R0YA 1U90A 3FFBA 5HKKD 4V0OA 2R62A 1YRBA 2R2AA 3WNDA 1MO4A 4C9BA 5CB8A 2V3CC 4YXWA 2YC2C 2H1LA 2VSOA 1P73A 4OI0A 1EG7A 1VKJA 2QQEA 3W6NA 1KO1A 2X2EA 2ZRGA 1ZINA 2RMKA 2DCUA 4I4LA 3R7WB 1NN1A 4LJ7A 1J99A 5IK2D 4B71A 1JR3E 1NN0A 3PUZA 1Q1BA 4LGMA 1LVGA 2QGNA 3K09A 2IYVA 4M1KA 3DMNA 4WZ6A 2JJ2D 1N6IA 2C9CA 2WPDA 3DHWC 4Q00A 2VP4A 2Q0HA 5KSPA 3WYFA 4C4PA 4EPRA 3SI7A 2A5FA 2GILA 5EJEA 4PAQA 4E22A 2VEDA 4P32A 4AG5A 4BLSA 1ANKA 1FPMA 4A2QA 3C5HA 2PMKA 2OM2A 3Q72A 3BE4A 5HCNA 2F3TA 2GXUA 1M34E 1KDTA 5JBQA 2OFXA 3U7EB 1OKKA 1VCNA 2RHDA 2JJ8A 2AWOA 3O8RA 4Z1MD 2WWIA 3PR1A 2HV8A 3QKSB 1P62B 2H5EA 1OXSC 4YQFA 3U4QA 5ELXA 2VF7A 1F2UA 2D7DA 4DB4A 2A30A 1GILA 2HDNB 2WAYA 1G7RA 3UWKA 1PV4A 4CEHA 3CPHA 4LSGA 2DFLA 2R6CA 1S3GA 5BWMA 3NBYC 5LBIA 5D3MB 1Z28A 5L3RA 2FPMA 5LB2A 1M7HA 5AWFC 1LNZA 1Q3TA 1E0AA 2V1XA 3ICEA 5KSOA 2OFWA 3TQCA 3BBPA 5BN3A 4NONA 1YJ5A 2CE7A 2FSIA 5CYPA 4FMBB 5FTKA 4NCIA 5CLLA 3OZXA 3UANA 5JJIA 3IGFA 5C4GB 1TQ4A 3CB4A 3OAAD 2MMCA 3DPUA 4RD6A 1E9EA 3QI2A 3WP1B 3ZYCA 3IEUA 4TL9A 4YMVA 3SQXA 1E9SA 1PLLA 1Z83A 3TUJC 1XFAA 2AD1A 3HU1A 4LBYA 2AD5A 3GFTA 1U99A 1K5DA 2XTNA 2QRNA 2WSMA 2P6RA 3RC8A 3AP2A 2IYYA 1UKYA 3CIOA 4X8MA 4XWAA 5EXXA 2O8BB 4LI0A 1OPXA 2WWXA 4BZPA 4PZLA 3L2OB 2OEPA 1T0JB 4L5BA 4P33A 3AKYA 5J4LA 4JLJA 1EWRA 3A1VA 2PLRA 2DHRA 3DO6A 2FNAA 1MABB 2WJYA 1ZJ6A 2QNRA 1NLZA 4M21A 5KDDA 1H65A 3OIYA 4HATA 2XSZD 2VHJA 4S35A 1OSNA 1VCOA 4JL6A 2H16A 2J0UB 1X8LA 3D8BA 1VG8A 1XJCA 1P9RA 1CIPA 4IEEA 5SZIA 1E4VA 1QRAA 1W47A 3CLVA 1CU1A 1ZNZA 4LJ6A 5BYJA 4PZYA 4QBHA 1GP2A 4MA4A 1R5BA 4HAXA 4CEIA 4L16A 3AVWA 2ZE5A 3PEUA 4PFSA 2O8FB 2G1KA 3CONA 2VHUA 4GOKA 1DEKA 2IT1A 5FOUA 5JCZA 2O52A 5JSZB 1FP6A 2QE7D 4Q1FA 3ZVNA 3AUXA 1AGPA 5EP2A 1P60A 3LX8A 1W36B 3K9HA 1T5LA 2XTZA 1VDZA 3PQCA 2IL1A 2XX3A 2ZR0A 1HE1C 3LW7A 5J4YA 4D4LA 1IN7A 3QF4A 3GLFB 3THWA 3GLGA 2B7CA 2HLDA 3BB3A 4JLOA 4QXAA 2WM9B 4PSVA 2FGKA 3VR2A 4RD2A 1CULC 3CRQA 3JVVA 5KPJA 3CRRA 4GDFA 1UEJA 1E94E 3P4YA 2QSZA 1XCGB 2QA5A 1R0XA 4JBXA 3LXRA 3AVYA 4WA7A 2F7SA 2VO1A 2EFDB 4I1VA 4CT5A 3RVBA 4B2PA 1OFUX 4Q7LA 1ESMA 5SZJA 3AM1A 4W9MC 2E87A 3ADKA 3AP1A 4HLDA 4B75A 3LY5A 2NGRA 4PR0A 1QHIA 1IHUA 1W1WA 1R6BX 4AURA 1P2TA 2ZJ2A 2F1JA 3CNLA 3OEHA 4ZCIA 2ONKA 3GMTA 1ZP6A 4AYTA 3QXXA 1R0WA 3QPVA 3IKJA 2QMUA 4A0FA 1XMVA 3RS4A 3E1SA 1Q12A 1JAIA 2REBA 3RANA 5C2JB 4RFSB 5F9FA 1DAEA 2QM8A 4QM7A 5HKKA 5JRJA 2ZAMA 2RAPA 1J70A 4N3NA 2GA8A 4JL8A 3X1ZA 2XJ4A 4ITRC 2XOKD 2FA9A 4LPKA 3U61B 2YOGA 4U7DA 3NEJA 3G5UA 2OE2A 1KY3A 2OO7A 2J1LA 2IYQA 4DSUA 1PUIA 2EVWX 1EFUA 2BJVA 2ZU0C 5FTNA 3HR7A 3T1TA 5CM9C 3C5CA 1K5GA 1IXRC 3LX5A 1CRQA 1E32A 2JJ2A 2Q6TA 3CWZA 3KJGA 3E70C 2C03A 4Q02A 3QXSA 4JVLA 5G41A 3K0FB 4MYHA 5FUYA 1QHGA 3IEVA 1CR4A 4JKYA 1KI4A 2GWHA 3KJEA 3QXCA 4TMTA 1W4RA 2OZEA 1RPZA 3ONWA 3ZD6A 5DI3B 2QAGB 3ZZUA 1GSIA 4RD1A 1H8HD 4RCYA 4Z1MA 1R5NA 5L3QB 4Q4AA 1Y63A 4BECA 5EE3A 4NYJR 4WBSA 2EYQA 1I4TD 2IYUA 4FI3C 4UXIA 1T3SA 4Q4JB 1M7GA 3EARA 2REOA 4HLUC 1G16A 4Q9HA 4N0EA 1G6OA 3GJ6A 4Q21A 1SGWA 3ZQJA 1LB1B 5DO9A 2O0HA 2IXGA 2WICA 3HPQA 4DZZA 1E1QD 2IHBA 2EWWA 1OW3B 2QTHA 1KI6B 4DIEA 1NIPA 4NZYA 2Q9CA 2XTMA 2FFAA 4M9ZA 1KMHA 4BFYA 1NG9A 5SZKB 3AQ4A 3BIFA 1G17A 2VL7A 3CO5A 4OL0A 1N6NA 3T12A 1FX0B 1S0UA 4JLMA 5IF9A 3VU9A 3UMFA 5JMTA 2F55A 3SR0A 1JR3D 3AKEA 4KV9A 2CHVA 3OAAA 3P32A 3X1WA 5DGXA 4AWXA 3A1TA 1B23P 4DHEA 5C4MA 2PJRA 4M9XA 1CJVC 4H9GA 2OCBA 3W6PA 3N70A 1CF4A 2ZS7A 1ZW6A 5KO2A 4AYWA 3MSXA 1TEVA 2GAAA 1XXHA 1OXVA 2OCYC 3CKLA 1YR7A 3WBKA 2CK3D 4HAZA 1UADA 4Q01A 5L3SA 2ZYUX 4V0LA 5JS7A 4CRWB 1D6JA 4TQUS 4Z51A 1QHHA 3LVQE 5AUNB 1E9RA 4F4CA 1U0LA 1N6RA 1OFHA 4IDOA 3EPLA 3R8FA 1DO2A 2RCNA 2WKRA 5JWRA 2QAGC 3CNOA 3RS3A 1SVSA 2XSZA 3AGQA 1UBGA 4TZ0A 2PBRA 4D0NA 4P3YA 1TADA 2QP4A 3RAPR 3C16C 5B30A 2KSQA 4FCWA 3EASA 4YMSA 2OILA 1KK2A 5TVKA 3SU8A 1TPZA 3AF3A 4K81B 1A1VA 1U81A 4ARZB 2YV5A 4TTRA 4BFTA 2R9VA 3B1ZA 4JVSB 4Q1DA 3UG6A 4QM6A 2B21A 3QBTA 1P6XA 1XWIA 5HE9A 4BQSA 4HB0A 3EZFA 1EGAA 2QE7A 1D5CA 2IYXA 4TLDA 2MSCB 1W46A 3RABA 2ZM5A 4P4UA 3HDTA 4TQ9A 1G20E 1DPFA 5TY0A 4AKHA 3L0IB 3ZDQA 1R8SA 2QL6A 1FNNA 4KYIB 3EPHA 1II9A 1U9IA 1XTJA 3K9NA 4IDNA 1WP9A 1E6CA 1TEXA 2WAXA 3P4XA 3ZD7A 1Z6GA 1YR9A 2IEYA 1KSHA 2WJGA 4RZ2A 5G3YA 3LBHA 1HY3A 1Z6AA 2OV2A 1Q21A 2VHTA 3MRSA 3QPUA 2OLKA 4TYWA 4A92A 2ZI7A 1J2JA 2HYDA 4PHFA 3K70B 2VTKA 4BZQA 1BH2A 3F5FA 4A9AA 2WJVA 1R4AA 4KCGA 3UIEA 4EDHA 1NI3A 4IVPA 5SZHB 4JLBA 1W5SA 4OQXA 1E9BA 1KO4A 3C14C 1DS6A 1LF0A 1OFTA 2CJWB 2NO6A 2ZJYA 2ZR7A 4TMXA 4LPSA 1W4AA 2KBFA 5HE8A 3B1YA 1BYUA 2V54A 4P31A 4GZLA 2BV3A 2ZRDA 2EFHB 4U5XA 2XOKA 4Z54A 2QP9X 3THYB 4M1YA 3SDZA 4DDTA 4Q19A 1G1MA 1ZNXA 1A5TA 4G1UC 2AK2A 4PHTA 3SYKA 4QKQA 4PC6A 2NPIA 2VF8A 4TL8A 2HT1A 4D2IA 3KKOA 1ZM4A 2LWIA 1G41A 3BFKA 4G0NA 4OHZA 2BM1A 3TK1A 1GIAA 2RKOA 1RW4A 1WQ1R 3VKWA 3ADCA 1T4GA 4FCVA 1NIJA 5JJKA 1S9DA 2IBMA 4EPXA 2IYTA 4M22A 1JPJA 3FGNA 4US2R 5L8VA 3NTUA 2F1RA 1ZD1A 3K0CA 1KKMA 2FJUA 2KWIA 4Q4HA 5CJPA 4CIDA 2E1RA 1AQYA 2V1UA 1IXZA 1ZM3A 2BJWA 3VNVA 3T5GA 4Q47A 1ESNA 4LJYA 3RSLA 1H8HA 3WHKA 2J0QA 3SJAA 4EIWA 4IW3B 3VKHA 1L7VC 2XB4A 1SXJB 3DKVA 2IWRA 3LLUA 4GFDA 2R65A 4UXJA 2QI9C 3D3QA 2RGNC 1KI1A 3K70C 3VFDA 3PENA 5HR5A 1Z0IA 1C4OA 4AKEA 1G8HA 2GJSA 5B57C 1P2SA 1RRGA 1C9KA 3AF1A 1TTTA 4NCNA 3ND8A 4XWKA 2PT5A 5H70A 5IT5A 1E1QA 1G3UA 1J7KA 3U7GA 3H1TA 3OEED 1HTWA 4CT4B 3PV0A 3O8DA 2ZI3A 1IY1A 4DCSA 3PIRA 1FMJA 2F6RA 5KNCA 3ADBA 1JR3A 1KHTA 2AK3A 2LKDA 6Q21A 3U60B 3KXLA 5FTJA 3CZQA 4Z8YA 4PSAA 1R10A 4EQ6B 3TQFA 1XD2B 3GJ3A 1CJUC 2ZROA 2D2FA 1Q44A 1Z0DA 2EWVA 5J47A 3MMPA 4C7OB 2HXSA 1KI8A 1DARA 2J41A 2QY9A 5KSZA 3B82A 2GK7A 1P4SA 2CK3A 5A4JA 2PEYA 1M7BA 4AKIA 1Z22A 2UZIR 1IY2A 1S8FA 3SJCA 1NVUQ 2ZI6A 2OSBA 2AWNA 1SVIA 1I4DD 2RGDA 3GJ8A 4NYJQ 5F3WB 3K0AB 2B8WA 3FMOB 3R20A 3THXA 2IYWA 1C1YA 2GZHA 2ZS9A 1X8KA 1X6VA 1QVRA 2J0SA 4HDOB 3G0HA 2RGXA 4KHZA 3PG5A 4BLRA 2W83A 4B6EA 3ZVRA 2O8EB 3GLIA 1W36D 2W58A 2DR3A 1A2KC 2FE4A 4MH0R 1XEXA 3B78A 2ZRMA 4XOIA 3W90A 1SXJC 4UNRA 121PA 1G64A 2X19A 3OFND 1N0VC 1XTKA 4P0TA 1BYIA 1ZU4A 4JKIA 2EFGA 2G88A 2QMHA 3D7MA 3QVVA 4L8GA 4NH0A 4KXFB 4GI7A 3KB1A 1JXOA 2OHFA 1NP6A 2GXQA 2ZETA 1RKBA 3EC2A 3KUDA 5FBLB 4CZ2A 4BLTA 4UNPA 1WBBA 3EZ9A 3FHOA 4PANA 4URXR 2JLYA 1P75A 3IQWA 2D62A 4TLBA 4HZUB 3QIAA 4TMWA 1KAOA 1LW7A 4ZCLA 5KUTA 4POAA 2Q9AA 4IDPA 2ZUDA 3I72A 4IEIA 5M04A 4FMCB 4P4SA 2ATVA 2ZRJA 3KXKA 2NQ2C 1D2EA 1Z2AA 2ZRAA 1OXXK 3DOEA 4O25A 1GG2A 3U7HB 3DDCA 1ZRHA 3LQRA 4KVAA 5UKDA 5BXQC 2VSFA 1NBMA 1ZIPA 3PEYA 3W3AA 4YLGA 2A78A 3SYLA 4B76A 3A6PC 3VTKA 4DCNA 3T1VA 4H1UA 1YZNA 1KK1A 3Q85A 4F38A 5CITA 2OG2A 1II0A 2OUKA 4YC7A 821PA 3R7WA 3VAAA 2V9PA 4HLQB 2DPXA 3FMPB 3LNCA 4IVQA 5TARA 4BUJA 3PITA 3TGPA 2JASA 4KODA 5EP4A 2KI5A 5FTMA 1JECA 2CLSA 2YKGA 2HF9A 1ZVQA 3DOFA 5FR1A 2CXXA 5EE0A 4RD0A 4RY2A 4URUR 1GL9B 3TR0A 5KSYA 2PT7A 3FPAA 1E2FA 2ZQ5A 1CR1A 1GNRA 3QJYA 3FKSD 3BJIC 2JCSA 5FOVA 2P67A 3WNCA 1DELA 4HYYA 4LHVA 2R6AA 3QKSA 1BO6A 2FOLA 4EAQA 4OK5A 4R2HA 4GP7A 2HT6A 4OHYA 1UM8A 4E07A 4LK2A 3AVTA 4EFNA 1EX7A 3MWYW 4TYNA 3TAHA 1E99A 2QEQA 3KQNA 5HCIA 5D3MA 3VNUA 2V6IA 1DAKA 4G3XA 2IUTA 1UBCA 1EXMA 3T35A 4KVGA 5FUWA 1IY0A 3K53A 1SKQA 3OEHD 1E2QA 1M2OB 1TQ2A 2ZSAA 3WRXC 1XU4A 1G9XA 1KJWA 1KK3A 5JHGB 4KFTA 4DLXA 3ECCA 5KDOA 1W49A 4JLNA 5EZ5A 4JT4A 3CUEF 3H0KA 4KO8A 2G77B 1G8FA 2IW3A 4M0LA 5F9HA 4ZV4A 2PX0A 2X2FA 1XPOA 4F92B 4K8OA 3VMFA 4J0QA 2XNDD 1X1SA 1E96A 3F0TA 3WMEA 3NC1C 1KK0A 1HUQA 2FH5B 2J7PD 4H1VA 2FDCA 4F7WA 5J4HA 2QT0A 1XCMA 5AJVB 3O8CA 1EESA 3OEEA 1HT2E 3M1IA 1WCV1 4G5OA 4WOPA 3O8BA 4ERNA 4GMXA 2ZRCA 4MYCA 2GBLC 4Y0AA 1XDBA 2HF8A 1MRNA 1OIWA 2CL6X 3FWYA 4PZZA 4M8NE 1AGRA 5AJZA 2O8BA 1ZMXA 5ANRB 4KITB 2B92A 2B8TA 3B1XA 3CX7A 4Y0VA 4JLVA 2BMFA 3KQKA 1CRPA 1YE8A 1FMLA 1MH1A 1ZAKA 2BBWA 4JSYA 2BCGY 4JSTA 1MABA 2A7QA 1Z07A 1M1YE 2ZUBA 3I92A 4KBFA 1QF9A 4BWYA 2V4ZA 3GD7A 2BEKA 3MJRA 1QDEA 2AHOA 4TZ6A 4N1AA 1PUJA 3VHLB 5GVSA 1S1CA 1OJLA 3OESA 4JS0A 3Q7PA 2J0UA 4MRSA 5FBRB 4JVMA 5AK0A 1M74A 2WMNB 3NC0C 5K8UA 1AKEA 4LHYA 2RGEA 2GDJA 4RZ3A 1IM2A 1NRJB 3CF2A 4ZIRB 4BGDA 2PZEA 3MD0A 3S1AB 4A6XA 4MGZR 2H8KA 3W3ZB 2J87A 4WAUA 4RD4A 2O8FA 3ASZA 2WKQA 3P1JA 2CHQA 5JSZA 1GWNA 1TAGA 5C18A 1SKYE 4NKRA 3QBVA 1DG3A 3GLIE 3A4MA 2GTPA 4WZAE 1XEWY 1BOFA 4Q9IA 2XB2A 2QORA 1GL6A 1DBSA 3GLFA 2KE5A 3OFNA 2YWFA 3QG5A 4RSGA 4TWZA 2C9OA 3GPLA 221PA 1DAFA 3VR5A 2JAQA 4QOSA 4RKFA 2GCPA 3TE6A 1XMSA 4M53A 2WVJA 4GNKA 2BOVA 3LQQA 2WMOB 4QJ3A 2GVZC 1OYWA 1YVDA 1UBEA 2R6GA 3BB4A 2GHIA 3EZ2A 5F98A 2CEAA 4OK3A 3I8SA 2FZLA 4NU0A 3K70D 3IBYA 1OIVA 1JR6A 2P3SA 3B6EA 3TVTA 1AS2A 2O8DB 1UDXA 4QBGB 2ZANA 4AG6A 1K6MA 1TQ6A 1VCMA 3SS8A 3Q5DA 2ZI5A 4L9WA 1ZNYA 5CJ2A 5H8WA 1EWQA 2RGCA 2RH5A 4LV8B 2J46A 2ZSEA 3QKRB 4GOJA 2XJ9A 4BFVA 4RFSA 1P3JA 1OB5A 1NBME 3O47A 3AKDA 3M4YA 3L8YA 3EX7C 2IF2A 1E2LA 3R8CA 1XPUA 4DLYA 2PZFA 4MGYR 5LDDC 4A2PA 1QHYA 1XEFA 3WMFA 1GRNA 2H17A 1I2MA 5CYOA 3MWLA 3Q8XB 4NP6A 1YKSA 1VECA 3VR4A 3SHFA 2GRJA 4YMTA 4YMWA 1UEIA 1KI7A 3IHLA 4NYIQ 4DLSA 2VP5A 4JT2A 3RRYA 5KU1A 3R9XA 1NKSA 3K0FA 5BN4A 1ZBDA 3C7KA 3T06B 5JCPA 4A0RA 1JJ7A 2EFCB 2WWYA 1FQKA 2QMEA 3EAQA 4PPQA 3I5YA 1FL9A 1YR8A 2YINC 2FWRA 1PZNA 4Q9JA 2CMKA 3FKSA 2QAGA 5DI3A 1G291 2BMDA 3T34A 4S2EA 1EFCA 4A8JB 1TF2A 5DHFA 5L3QA 1S2MA 4NBSA 3U3KA 1NN5A 2MSDB 5JI2E 3BH7A 3WP0A 1XZPA 2BBOA 3AKCA 3WY9A 3ZJYA 4Q4JA 2V7QD 1U2RA 2FX3A 5DYGA 2R6FA 1ZM7A 2FSFA 3TMKA 3OF5A 2YNMA 4LX0A 2FMXA 1B0UA 1KI2A 4QC2A 4D4KA 2J59A 1PLJA 2YHSA 4KSBA 5EP3A 3BD9A 1IN5A 4EPYA 1MV5A 1G5PA 1S3SA 1KI6A 1XRJA 2QTFA 4DSOA 3SOPA 1L4UA 3ZS8A 2QTVB 2QU8A 2YWEA 4XSHA 1YQTA 1FX0A 4G01B 3KTAB 3OHMA 4IOKA 2J3EA 3I73A 1YZLA 1Q57A 2NO7A 1TQDA 1W0KD 2FFQA 2XNDA 4HB4A 4R7ZA 3AF0A 1WMSA 2AXNA 2R6DA 4AYXA 4WIAA 2Q3HA 4B35A 2J7PA 1FFHA 5JI3E 3AV0B 1FTSA 4A0HA 3N2EA 3U3JA 1RRPA 2Z83A 1RJ9B 1TU4A 4QHTA 4HUQB 4ZPXA 8OHMA 1US8B 1JXMA 4MGIR 1EK0A 1H8ED 2GF0A 2AX4A 2ZSFA 1W4CA 1NKTA 1FNMA 4M1TA 1HA3A 3I61A 1U94A 3FVQA 2G83A 1YHNA 4LBZA 2JLWA 2FPKA 4RJLA 3UKDA 1WBDA 2XEXA 4W5WA 4B3XA 4BRWA 1E2GA 3EPKA 2GK6A 1RYFA 1AZSC 4A82A 2GCNA 4FIDA 4A8JC 2P2LA 4NL4H 4B2IA 5BYKA 2IA5A 3KQLA 1W0JA 5DH9A 4CW7A 3TSZA 4JMPA 5JEDA 5F2EA 5JHHB 1L4YA 2H7VA 2HEIA 4URWR 4ARZA 3IIMA 1KO8A 2FSHA 4HAWA 3AVQA 4LCBA 1X8JA 2Z5FA 3PUYA 2FSGA 3U44B 4A2WA 2QQ0A 3OIWA 3WRYC 1W48A 4V0ME 4C0BA 4HAVA 5BQ5A 4IJMA 1S9HA 3GLFE 1F2TB 3GLGB 2CCGA 2X8AA 3FB4A 2QUZA 3LV8A 1XBTA 5E4FA 3NHBA 3AEZA 3E2IA 3U6BA 1II8B 2VH5R 4LYHA 3GLHB 1D2NA 5AUOB 4US0R 3BGWA 4JYBA 2A3RA 4M2LA 4A0GA 1VG1A 4AY2A 4MITA 4OQMA 4LZZA 2RGNA 3MGCA 4PC7A 2BWJA 3EXAA 5TMPA 4B73A 1XP8A 2BM0A 3NBXX 1AS3A 4D25A 1XCPA 2V8OA 1NG1A 2DY1A 2ZSDA 3WYGA 3CR8A 2ZI9A 1NJFA 3HP1A 3RS7A 3PJRA 1NN3A 3HR8A 3TUZC 2OCAA 3B9PA 1XTIA 4JJKA 4M9SA 4FINA 4QHYA 2CJWA 5EE5B 4PPGA 2CL7X 4BASA 4BLOA 1QG2A 4LDJA 3K0EA 1KZGB 1COWA 2AKYA 4FD2A 4NYMR 4Q4LA 4GL2A 1FTNA 3VX4A 2GZDA 2CL0X 3QG1A 2ECKA 3KXIA 1OXUA 2HCBA 5KNBA 2RGGA 3U6KA 3DVLA 4DLVA 3ICQB 3FKQA 4G5GA 1CP2A 3THYA 4BE7B 1RFLA 1RZ3A 2A5GA 4YONB 2R8RA 2P5SA 1XPRA 4NCKA 3BK7A 3L8ZA 1G3RA 1N3BA 3V4RA 2BKEA 1NY5A 4R2IA 2GZAA 1TL7C 4JLKA 1ZU5A 2NIPA 1NF3A 2BMJA 1Z06A 4IKEA 4TTQA 3IBGA 2FN4A 2J9RA 4KLZA 5K8TA 2UZ3A 1OT3A 5GADl 4TL7A 1G7CA 2OXCA 3OE7D 2ZE7A 5FH9A 3UWOA 2NO1A 3B5JA 3K9GA 1KGDA 4C30A 4DT1B 1G4UR 5FPYA 2ERYA 5HZHA 3I1FA 2GXSA 3R9WA 3T15A 5K8LA 4TQAA 4KU4A 4XVQA 5A5GA 4ASUA 2ANCA 1NVWQ 2XAUA 3UXMA 1OHHD 4EJSB 1UBFA 2V7QA 1IJEA 1DG1G 1SXJA 1Q20A 2CVFA 1OXTA 1P61B 1S1MA 2K5UA 4FMCF 1CXZA 1KSGA 1WB9A 4IFBA 4B34A 3HJNA 1DAGA 1SVWA 1HYQA 1W2GA 3C15C 4FMDF 2I1VB 1N25A 1NBMD 5KHOC 2QENA 3CX6A 2P6UA 4JLAA 3A1SA 4LBVA 2VHCA 2ZRLA 2IS1A 3FYHA 2GEDA 3QEJA 5J40A 2ZTSA 2FG5A 2CBZA 2ZRKA 4WZBE 2XNSA 2P65A 2ZJ8A 3AF4A 3PUXA 4PSKA 3QF7A 1RRCA 4B3FX 1W0KA 5DNYB 4LC0A 3NXSA 4LJ8A 2DWPA 1E1RA 1DADA 1Q1QA 1X86B 4JYCA 4M4SA 2ZRPA 2GETA 2JLVA 4OKSA 2VP0A 2VBCA 3LBIA 1Q3HA 3SFVA 4EQ6A 4P4TA 3K1JA 4PPNA 2GXAA 5KOYA 1GZSA 1XD2A 2YYZA 3ETLA 4RFVA 4Q9KA 4US1R 4TMVA 1WRBA 4RD3A 4O3MA 4C7OA 2CDNA 3IQXA 4GPTA 3Q3JB 2C9YA 1Q0UA 4UNNA 1H8EA 1KO5A 3B9QA 421PA 4DIDA 5L3SB 5FBQB 1NSFA 1DAIA 5AJXA 4KLNA 3IILA 4Q7KA 2W2VA 1OE0A 4AKGA 4NCJA 3VR6A 1Z6YA 3K0AA 3RNLA 2RB4A 2PH1A 4AC9A 4XVRA 2IC5A 2WKPA 4LHXA 4G5SA 1RE0A 3M6AA 1E2DA 4NPHA 3KFVA 4BZXA 4TL6A 4HAUA 1M8PA 1BKDR 1KI9A 3TBKA 1Z3IX 1IBRA 3R9IA 2BKUA 1G3MA 2O8EA 1XJ0A 3CW2A 5CLQA 2Z4RA 1E2IA 3SJZA 2JLUA 4EJSC 4B3DA 5TXGA 1CS4C 1SQ5A 5HPYB 3UPUA 1W2HA 1IXSB 2VP9A 2D3WA 1A2BA 2DWOA 3QVUA 3RC3A 4O0MA 2C78A 1A82A 2CNWD 2XITA 1HEIA 2D74A 2GJAA 3RSOA 3NDBB 2ZIAA 4X8LA 4HAYA 4QBFA 1G8PA 2ZJAA 1OYYA 3IPXA 2C8VA 1CJKC 2ORWA 4URYR 2RHMA 5DSZA 3PUWA 1RYHA 2WWFA 4U00A 4BFUA 2ZUCA 3AH8A 1N0WA 3QY0A 4I1SA 1Q1ZA 4DBLC 2GEUA 3H2YA 3KKPA 4B32A 4BFWA 2JDID 4CDGA 5B58C 2W6ID 3JZMA 2DFKB 1FP7A 3MUFA 2ORVA 4HDCA 1XX6A 5FFMA 2A5YB 2VIIA 4JZKA 4X8OA 1Z5ZA 3RWOA 3GEEA 1A7JA 1UKEA 3W8RA 2HYIC 3G82C 2P0EA 2F9LA 2J7KA 1TUEA 3RS5A 1T91A 1RIFA 4XD7D 2VLIA 3H4MA 1G5TA 4OHVA 4W5HA 3AUYA 4IFEA 4QGAA 1NVVR 3PVSA 1L8QA 3RHFA 5JECA 2BHRA 4IOJA 1KDOA 1U98A 3AVUA 5FOSA 2PCJA 5JFGA 4XVUA 2OBNA 3D6TB 1T3HA 2QG6A 3DMDA 2IX3A 1GKIA 3NDPA 4M1MA 4LUCA 3W6OA 2GBLA 4LJ4A 4B6FA 3H84A 4ON9A 4C0LA 1OH7A 3CRW1 2GKSA 3PEVA 4IHQA 2WJHA 1E9FA 1ZUNB 4B47A 3I62A 2VA8A 3LA6A 1UF9A 1FOEB 2DBYA 2RGBA 4JLPA 4MDEA 4LJAA 4L4UA 4GBMA 4NMMA 4KFRA 2Q3FA 5DLQC 1KAGA 4GT1A 3KB2A 1U8YA 2GCOB 4QBIA 5CK4A 5GJWC 1UKZA 3GJ4A 4LYFA 4PXAA 2Z6VA 5FPTA 2G0NA 1N5LA 4TN1A 5EQTA 2DYKA 1VYUA 3GP8A 1UPTA 2VQSA 1G19A 3W9YA 4NYIR 5L3VA 2I1QA 4B43A 4QNMA 5FUVA 1YZGA 4HSEA 3BS4A 2BCJQ 3P27A 4D0LB 3BB1A 3OE7A 5EUQB 5DIFA 1E9AA 4URZR 2WOJA 2G9NA 2AFIE 4IVRA 2OLJA 1KDPA 1Z6TA 2HCJB 5CB6A 1OIXA 3A4LA 4K46A 5G53C 4MDFA 3T1OA 3TR5A 1NLFA 5J5CA 4ZKDA 1G8GA 5DN6D 3FE2A 1OHHA 5EE1A 4IDHA 1GNPA 3ZH9B 1DVRA 1SXJE 2F1HA 2VP2A 1JNYA 4XJXA 3I32A 3W34A 1AA9A 3SBEA 1U0HC 3MFYA 1KJYA 2A5JA 4PAOA 4LC1A 5FI1B 3HPRA 4LWZA 3A1WA 4NYMQ 2QBYB 2VHQA 3I8XA 3M0EA 4FW9A 3TKLA 2GJKA 4RVCA 3C4JA 1S4QA 5HTKA 4UJ3A 3QXHA 3HU2A 4CGZA 2BMEA 1MOZA 1ELOA 1SVOA 3LBNA 1HQCA 3DZDA 4DDWA 1JEEA 1FQJA 1EFRD 1ZCBA 2QP3A 4YDHB 1T0HB 3ZS9A 4HI0E 1E2NA 1QZXA 1RVDA 3PUVA 3AP3A 2YVUA 1JPNA 1LS1A 3NG1A 4QG7A 3REGA 3TSOA 3UATA 1VYTA 4WVFA 1HQYE 5E3HA 2D06A 3GFPA 4Z8XA 2C77A 1I2DA 3UMSA 2WV9A 3IO5A 1KMQA 3U5ZB 2DFNA 2H92A 3QE0A 4ACAA 4C0QC 5EXPA 2BIFA 1BMFD 4WW0A 2P5TB 4OI2A 4RKEA 3X2SA 3ZGXA 3Q7QA 1BS1A 3EIQA 4JLDA 4KAXA 5FOXA 1NSTA 2PJZA 1NJGA 1W5TA 1V43A 4PO8A 2WIAA 3EIHA 5DISB 4A1FA 3PEWA 4ZIRA 1WDTA 2QT1A 4Q18A 1GAJA 1TU3A 3DZ8A 5AUQA 1E3MA 2G6BA 2Z0MA 3UG7A 3K0CC 5EZ6B 3S1AA 2KJQA 1KJZA 1YR6A 2NO9A 3LXXA 2C99A 2ODNA 3ZZTA 1XNJA 2GVDC 2WSSD 5EP1A 4ZDKA 3WHLA 1R5OA 5E95A 3F3YA 1NMXA 4YDSA 2W6JD 1G8YA 2GEVA 4II7A 4QJ5A 4X8HA 2WTUA 1KO7A 3BORA 1MR3F 1R2QA 3KX2A 2G1JA 5KPDA 1KNXA 3TIFA 2OT3B 4FCTA 4LY6A 3QUSA 4M9QA 1TF5A 4I99A 3RWMB 1E2EA 2CNWA 1QHNA 2DFTA 3GJ5A 1TUIA 2FGJA 5H1YA 4DLRA 4TSFA 1T3LA 1MKYA 3TRFA 1KI3A 2ZPTX 4C3ZA 2YJTD 1MO6A 3WXMA 5AR1A 4NTZA 3ZVLA 1NL3A 2QGZA 4EKDA 1S96A 4TYQA 3V00A 4C2TA 3QKUA 3CPJB 1R8QA 1BIFA 4HLCA 4DCUA 1VG0B 2QPAA 3FHCB 3C41J 2XXAB 1T5IA 2JDIA 2O8DA 3EIEA 2W6IA 4ESVA 2VRWA 3HYTA 2O8CB 4LYJA 1T9HA 1CKEA 3CH4B 4IRUB 3QKRA 3REFA 5HZKA 4NDZA 4FXPA 4XD7A 1N6PA 4C0JA 1Z29A 2JLXA 3PFIA 4UQOA
chains in the Genus database with same CATH superfamily
1O4VA 1E4EA 3HVKA 4TT3D 4ALKA 1SCUB 1T0UA 3K2QA 4GG1A 3PA6A 4M1WA 1NFRA 3D2BA 4Y2QA 3RSLA 5LC1A 4AJJA 4BMDA 4D80A 5BN5A 3UGJA 2H00A 2X8BA 4J29A 1AK2A 2WIKA 3HBFA 4U39A 4RADA 5H4GA 2PAFA 2I5PO 4QBTA 1XRMA 2Q1WA 4BNZA 1M76A 4DVJA 4FFVA 4KE8A 2IITA 2GBCA 2ZEJA 5D3ZA 2XXJA 5GOTA 4YMLA 3QVOA 1SUDA 5EKTA 4EBFA 5JNSA 3QM1A 1RKXA 3UICA 1PNRA 3B6JA 1NQVA 2W6OA 5M34A 1P5HA 1VE6A 2CHGA 5DCLA 2YQZA 5BNFA 5G4LA 3FUXA 2CE2X 1A7KA 1BWPA 1BXRA 1G21E 2ZJBA 3AFMA 3IUSA 3B8HA 1L5WA 1QHXA 4PY2A 3TLGB 4B5LA 3D6FA 2WWGA 2GEBA 1WVGA 4BZWA 4LW8A 4D79A 4DLUA 4EA7A 1P3Y1 1CX9B 1A04A 4Q9AA 2WU1A 4IIVA 3RS9A 2IRWA 3RQIA 1CLEA 2QVYX 2ZRHA 3ZE2B 1RMYA 3MUEA 5JZ9A 4JVOA 1NZDA 5KI6A 1FX1A 2P11A 1YZQA 3K9CA 1DKOA 4X1IB 5CU7A 4EYKA 6PFKA 1BX1A 4M1EA 1CS0A 1ECGA 2DGDA 5LYJA 3DE2X 5DT9A 1GGNA 3AF5A 1U2DC 4CKBB 4FWTA 2PMEA 4MKHA 1SCJA 1T3GA 3CURA 4HB2A 4EW2A 1SD2A 1RWKA 3FMGA 3CO0S 4INAA 5AVJA 5KTSA 3DDWA 2ERXA 3RJ5A 5DGDA 3NRBA 4G36A 2ZZNA 1SVMA 1IULA 1W4BA 4P54A 4DAOA 4NZPA 1ZKDA 2KB0A 1W94A 2OAP1 2QTVA 3FUWA 4RHUA 5T5QA 4BX9A 5ITVA 1VZ2A 1Y9EA 3WNZA 4E31A 3PGJA 1DNPA 5FKJA 1EHCA 5EMNA 1VHJA 2OV4A 4ENVA 2IYNA 2XDQB 1DBVO 3MJHA 3W6ZA 1COWD 2DOKA 4H16A 4IG4A 3ANXA 4IZ6A 4XR4A 1M6EX 1YVRA 2J3DA 3C8DA 4J90A 4NZOA 1DB3A 3HLKA 4RHTA 3M83A 1N5RA 1YB2A 1PR6A 2MMGA 5TPWB 5E0KB 2WBLC 2QPOA 3HKBA 4Q37A 3M4ZA 3H1FA 4LQCA 1H2YA 3R6WA 4MB6A 4TTIA 4B3SB 5BURA 3FGOA 1U0SY 3PTZA 3SR3A 3DM5A 5DV9A 1TZMA 5H81A 3DM9B 2AZ4A 3C3EA 5JZVA 4UTPA 1Z63A 1U8AA 3KKNA 4IJQA 1WEHA 4QQRA 4OJQA 2J5XA 1CEEA 4O1MA 3AHIA 3NV7A 4YGYA 1DOZA 4QATA 1XJQA 1EXDA 4C0XA 5K0NA 5CP8A 4R3UC 5J23A 2BTQB 5EG5A 4Q1VA 2JLQA 3ZK9A 4AN1A 1J2RA 1EDEA 3WYEA 3QEOA 3C8UA 3OIUA 5GJCA 2G3YA 4JAVC 4PLGA 4PW0A 4PNZA 4QO8A 1CR2A 5BQFA 4JI4B 5GV8A 4GI1A 3BTVA 4HS4A 3JPYA 1LFDB 2Z57A 1F06A 1UDRA 3CNQS 3HCCA 2C7VA 1GUAA 3OUZA 1M6NA 4DLZA 3LDHA 2XQFA 3ZX5A 2ZXUA 1MO5A 3HCBA 3JARB 1ZC4A 1RBMA 1AN0A 2ZE8A 3EWNA 3HBMA 3LUAA 1TO2E 4QXRA 4XLTA 1WSAA 4I50F 2XAAA 4A91A 4HUTA 5JS8A 1R16A 1V4BA 4AICA 2PY6A 1IBMB 4CM8B 4ZMRA 4DLAA 3T3DA 1GG5A 5LQNA 2JLZA 4GOXA 1T6YA 1L9KA 4ETNA 3B13B 1PNOA 2XVAA 3RF7A 4E09A 3EJWA 5CIQA 3UBMA 3H5VA 2VXCA 4WKOA 4EKNB 5BSVA 3ZIAD 1APBA 1HOTA 3QU4A 2BVNA 5GGXA 1IZ9A 5BN3B 2WHPB 4D4MA 3G3EA 4QJIA 2VJCA 4U5QA 2I6SA 2FPRA 3KQVA 2V55B 3U56A 1YMQA 3O3OB 1WU8A 1WX1A 4KAAA 2FRVA 3WWDA 4G4GA 3A8TA 3B6ZA 5C7OO 1N33B 3EW9A 4F6RB 3HB1A 3EXG2 1X7WA 4RGQA 5FEUA 1NNSA 2F4NA 1A8UA 3F9IA 4I4TF 2IUFA 4MS1B 4HWGA 3UMYA 1WKBA 3AESA 4BTVA 4JBNA 3OZVA 1V95A 2I3BA 8ATCA 1AKYA 1T5HX 4M1SA 4QHSA 4F96A 1N77A 2VUIB 1XZJA 3JQDA 4LNHA 4BAZA 4I8IA 5KB3A 1J5PA 1KDZA 3ABZA 1RQPA 5E6UB 1E1KA 1U3FA 3K09C 2FEWB 3L7NA 4U02A 1T6NA 1Z5UA 5LQAA 4MPPA 4DC1A 5AKLA 4KSCA 4PQFA 4DMFA 4EJFA 3PVZA 3VHXA 1B6RA 4ZI3A 2QGFA 2R25B 4NNPA 1AHHA 1I4LD 3EFHA 1BCRA 3O38A 2YYYA 1VYHA 5AKKA 3RUEA 1BU5A 5DE3A 1R66A 1GTRA 3E9EA 4Z4GA 4KRXA 4HDQB 3BGIA 4W1QA 3C6QA 5GV7A 1AQJA 3IP6A 3B2EA 1G66A 5IRCD 3X2EA 1RWNA 2O3RA 3DMRA 4NJEB 4P9NA 3GA5A 3UB2A 4GPIB 4EJ6A 3JTEA 3D4OA 4E46A 3MJ4A 3DKRA 4O6VA 4PAMA 1NUPA 2IUSA 2QLJA 1DWOA 2ZREA 3DNPA 4M8IA 5JWHA 1CY8A 3L6UA 3SE0A 2PUEA 4PQRA 4EG3A 2OG1A 4AROA 3T9EA 4D9IA 4ZYWA 2GH1A 1Z7BA 3NT4A 4G9EA 2DKNA 3QYJA 4KMOA 4WCVA 4QSMA 4UNQA 3OBBA 3O82A 4UW9A 4C4RA 5KYKA 1J42A 1MXHA 4KBYA 4A4DA 1FZQA 4RZHA 3TNYA 1JBQA 3UWMA 3RWBA 1HURA 3LHDA 3RRZA 3EJ6A 1W36C 5EC8A 2AI3A 2L0XA 2QUJA 1PR1A 4EUNA 3GO4A 4YRQA 1FP2A 2CBXA 2C42A 5DTRA 2NUTB 5K3BA 3RRXA 5JZBA 3OJWA 2FPGB 5KTYA 1ONBA 2JAXA 3RUFA 1C30A 9LDBA 4NENA 2RG1A 2Z43A 3SQWA 3VZPA 3TQIA 1TO6A 3P9SA 3QF4B 4D0SA 1T2UA 4PC2A 3FOZA 4D81A 1LA2A 2RHWA 4UXHA 1KP2A 2VT7A 1JHPA 3PD0A 3ZJ4A 2WUEA 4EJSA 1N34B 2B4KA 2BN4A 3TQSA 5IAJA 1J25A 2YICA 4AZWA 3MS4A 4I4NA 3IBTA 1G3QA 1BG6A 3KLBA 4JUFA 2X15A 4V02A 4BFLA 4MJ7A 3N07A 3PNYA 1AM4D 1WNFA 3EGDA 3Q5EA 5C1OA 4LF7B 2JGDB 2YHUA 5KNDD 1T8TA 1UPBA 3KR0A 4J49A 4O4HF 1OX5A 2GJ4A 2JHFA 3A6JA 1LDMA 3TW4A 1ZD8A 3NNNA 4UUNA 4GEGA 4JIMA 3RFVA 3RK4A 4B3CA 5CBKA 2AZDA 2NQ8A 4Z4HA 2HLPA 5FWAA 4QPPA 4LJ5A 3W5IA 3LPLA 4MUEA 2O0MA 3DXZA 3LCMA 4EB6A 3KKQA 2IHYA 4BL5A 2XTAA 5KKNB 4M55A 2OKGA 3U3XA 1D7AA 2PMBA 2V7BA 2O2ZA 3RFFA 2P9HA 4PCUA 1U4OA 4RETA 3VR3A 3LRPA 1P1RA 2VJNA 4F8JA 2H2IA 4L8YA 4B46A 3MJEA 4KWEA 4JYZA 1RHRA 4EKYA 3BIJA 4U9UA 2CYCA 2ILTA 2YDYA 5H59A 2OBLA 3BH0A 4BX2A 2DSTA 3AU9A 4M60A 4PZEA 3E84A 1ZCZA 3IQHX 1F5NA 3MRTA 3WBJA 2XZPA 4RX1A 2JG3A 2HDWA 1K97A 1YFJA 3GP5A 2VPTA 1XTTA 2B0JA 3TF5A 2X2OA 1VCHA 3HY3A 2IS2A 1J2TA 2XRYA 4DC9A 4JY7A 1I32A 4F6LA 1JDUA 1RPNA 1RYEA 2WHXA 3C8HA 3IEKA 4RF2A 1TKRA 4DJTA 5BYAA 5C7LO 4LVOA 2CLDX 1BVHA 4UKDA 1D6MA 3SJUA 3GLFB 5F51A 1VMIA 1UBLS 2WSLA 3I6IA 3PGVA 2W0MA 2D13A 3R7DA 5CCEA 1QB8A 3AJRA 4LX8A 3G02A 4K9MA 1UBKS 2HL6A 3PQ6A 1AX9A 3KUCA 4FZ5A 1AGNA 4R71A 1BTOA 2BGJA 4F5ZA 1JHYA 3LBFA 4V0SA 4KX5A 1D0VA 3U2QA 4RXTA 1JF8A 4IWXA 1ZONA 2DC1A 5HMMA 3J7AC 2VAXA 5CIWA 1YA8A 4QNNA 1MQAA 1U3VA 2YFYA 2J9XB 2NNWB 3CS3A 2VJKA 4RLQA 5T41A 2W00A 3RYHA 2IDKA 4C7BA 1T9GR 2XY4A 3E48A 3OE5A 3BRQA 3D3KA 2WU4A 3CG4A 3K05A 1QAOA 3IVGA 1IYZA 3L4BA 4PO1A 4TX1A 4RK4A 4KQ6A 3PYLA 3C24A 1N6LA 3NHAA 3O94A 3I2FA 5JSYA 2L69A 1P1HA 3R7SA 3RH0A 4HMOA 4ZQHA 1JN0A 2PT6A 2X9VA 3D8NA 3OWXA 2G6TA 2X0NA 1WB5A 3LVRE 5EWLB 1MO3A 3UJ7A 2QUKA 3D6UA 5FF9A 1XKQA 2F9MA 3SYRA 3G8BA 4Y2YA 5ITWA 2BGKA 3AEUA 3FZYA 3Q4GA 4S0ZA 4LYYA 2Y0EA 5CB4A 1L7QA 3M3HA 3VU9B 2WLTA 5GVRA 3ROFA 4YUWA 2PRYA 3VKGA 1CR0A 1EGQA 1NDUA 3TDMA 5BNWA 4B17A 4UPVA 1D9ZA 2BZSA 1DO0A 3D7NA 1PJRA 2BUAA 3NBFA 4YUXA 3EYAA 2IY7A 2AFHB 2XQIA 3IMGA 4FQ5A 4RPIA 4Q34A 3PE6A 4ENWA 2FN9A 3Q9UA 4IYJA 2W42A 4FJ0A 1DRVA 2PLFA 1UBOS 5I9NA 1E2JA 1A5ZA 1XXHB 1A9RA 1PYGA 3MT0A 3VYSB 3U7QA 1IFXA 1L8AA 3WKAA 1H9CA 1ODFA 2P4UA 2VXBA 3B5IA 1ETUA 1FNCA 3SZUA 2WJAA 5KNDH 5ITZA 2HBQA 2IUUA 3UJ8A 3OY7A 1B41A 4YJ2B 1QHHB 4RLFA 3JQAA 1T1JA 5A9RA 5EZSA 1P0QA 3U4IA 3FFAA 4DUPA 4IJKA 2DTDA 2DPMA 3KJIA 3BMOA 4L28A 1KE1A 4UPDA 1JWBB 1X3SA 5A2GA 4QU8A 4F4IA 5IKXA 1N36B 3SF8A 4AWAA 1SUAA 2D4AA 1Q84A 1GFSA 1MN6A 1V96A 1QRDA 2NOAA 3LA8A 2ASEA 4ZVLA 4ZPJA 2JLBA 2ZYTX 3ZI7A 4AIIA 3LFUA 4DY6A 4E7PA 4YFVA 4CMCA 3GGCA 4CT0A 2ZS8A 4RTNA 1YIAA 3ET4A 4INJA 4HXFB 4LRWA 4ZT5A 4DPKA 2ZOSA 4MV6A 1Z0AA 3F6BX 3A2MA 3K6RA 2JIZD 3F5MA 3L6RA 4B2LA 1YCHA 3JZAA 3PQ5A 4RYLA 3D4IA 1ESDA 2GJ8A 3BSSA 2C98A 1G6HA 2GUGA 3M33A 4N6NA 3BFVA 3VBEA 2Z8XA 2OFFA 4MYUA 3H9GA 5EIWA 2I4IA 3F46A 3NBZC 2BI8A 3G17A 1Q83A 3GJXC 3GJYA 1EG2A 1MPXA 2O8NA 3JY6A 4IL5A 4OQYA 1D7OA 4QYXA 1I94B 1VTKA 1ZVMA 1KYIA 2YWGA 2IEAA 3FW1A 3S3TA 4GMDA 5KVQA 5KWEA 1DT5A 1BXGA 2JJ1A 1UUFA 4KQ2A 3NPAA 3SZMA 2HA0A 3E9YA 1CUBA 1O6BA 3FYDA 1YZTA 3A11A 5KAPA 4TVSA 3ESYA 1NW7A 2B1RA 3K9LA 4DCJA 4Q7JB 2AMYA 3REQA 3OA0A 4D02A 4I4CA 2X77A 4Q1AA 4DUGD 2IU6A 1W7AA 3WI7A 4ENTA 1P2GA 5BR8B 1XNQB 4BVLA 1P0MA 1GRRA 3PQ2A 4TXMA 1ZM9A 2OO3A 1P91A 3ELDA 3G88A 3A3OA 3CR7A 3RHZA 1KDVA 4ETMA 3VRHA 2IXFA 2OUIA 1NF2A 1P2UA 1MMFB 3AB3A 4C6TA 1IONA 5B1EA 5TQ2A 2A0KA 3GZTB 2NUPB 3C74A 3ZX4A 1F3OA 2AN9A 3A10A 3SQDA 4KI7A 3KFXA 2IXAA 1XB2A 1H3EA 1UPFA 4MO9A 2BFCA 3VVLA 2DBQA 4EHKA 3PNOA 3G1WA 2X1VA 2LD4A 3G0IA 4WCFA 3UAYA 2B82A 2DHCA 5IAEA 3GEIA 5KCMA 4QVIA 3IHTA 1W2WB 3HCPA 3M7IA 1LX6A 2OA0A 3Q8LA 1C3EA 3H13A 1NLYA 2CNNA 1F8UA 4GS5A 4QOGA 5FO0A 4FHZA 4AJ2A 4EPWA 5HZMA 4TVBA 2EBHX 1SCAA 2EZ9A 3IV7A 2C2WA 1I01A 4H0CA 4U2BA 1E6LA 1U8ZA 1YKFA 1T34A 3K2BA 5BQ3A 3D8RA 4JQZA 3MFQA 4BPRA 3H86A 1Y3IA 4RXMA 4DDVA 3QWHA 5E7MA 1IJKA 2RHCA 3RREA 4AM8A 1EX6A 1T36B 2EW1A 3WK7A 4DCTA 4MP8A 1WCIA 4ZGBA 3LAWA 3IMKA 4CLRA 2P6NA 1X7GA 3OOSA 1KOFA 2VC2B 4CEJA 4G37A 4F71A 5JO9A 4NZNA 1N8NA 2FQWA 3OCWA 3UJDA 1QOQB 4QU0A 3T94A 3DDHA 4AMBA 2J3MA 2O48X 2C96A 2G4CA 1E9DA 2X0KA 4FBGA 4JQCA 5PGMA 4ECEA 1ZO8A 4O2LA 1SVLA 2B2NA 3G13A 3M5CA 3D7RA 3GA0A 3K8OE 3PYXA 2CMHA 4Q4HB 1E6EA 4FD3A 2QM7A 4I2NA 1KSFX 2OENG 3WLFA 5KOHA 2O2SA 3QSYA 1VHDA 1CNMA 1CUYA 3ITKA 4LZOA 1FJHA 4I55B 1UBSB 4KL8S 1XDUA 1TQHA 2P9EA 3GVXA 3UAVA 3O03A 2LUOA 1JJAA 1QH8A 3EF1A 4E5PA 2FJ0A 3JQFA 4KO4S 1ZFNA 4AP9A 4KPEC 4I1UA 4FJ2A 1EFVB 1ICEA 3A05A 1W96A 4IZIA 4C3VA 2J0VA 3VU8A 4D8YA 2JFFA 3GDOA 4X95A 4EDFA 1JG4A 1JDSA 3CJQA 1OH5A 3SICE 4HWOA 5JC8A 5JNWA 5F1YA 4DB2A 1DX9A 1N5KA 2QTCA 1AUVA 4F93B 3FTNA 5BQPA 3TI9A 1O0BA 4XDZA 1K9VF 3H3JA 3WYCA 4YP0A 4M54A 2WIBA 4JCCA 1OLOA 4YH1A 2XXAA 1JAYA 1H2AS 4QGFA 1NMYA 5IM4A 3C1TA 4L3OA 2HRBA 2RJ3A 5HBRA 2FZ5A 3L3BA 4O2RA 4U7HA 5LQUA 2ZDHA 5LPNA 1BRTA 4LV5B 2O8CA 1FTYA 1HYHA 3E1KA 1TMOA 5C8YA 4JDUA 2A8YA 4MKIA 2XE6A 3D4NA 5A06A 5A7FA 2VUTA 2GRUA 4H4CA 4WASA 3ENZA 1X1RA 2OMEA 3WSWA 1E1CB 4HEHA 3EBOA 4N9WA 3LL7A 1ZX1A 1MFZA 1SCUA 4Z49A 1YIDA 5I5GA 4NXNB 4QUIA 3BCRA 2JKYA 5DTIA 4BBZA 2FW8A 1L4BA 1VJDA 3QNUA 4KIUA 4K6MA 3UB3A 4QDKA 3WHIA 4MLPA 1R9MA 2I8LA 3HP4A 4GUAA 4JBWA 4UDNA 4FGZA 2ZU6A 2CLHB 1B26A 5A7GA 1N2CE 4F5YA 3NHYA 1R9GA 1OD6A 4LOKA 1TKBA 4J4HA 3PX3A 3MTDA 4W7HA 4W5NA 1MNQA 2GAOA 2OD2A 4NAUA 4V03A 4GQBA 1X8XA 4V1CB 1GGFA 1I3NA 1XZKA 3O0TA 1YACA 4ZHQB 5CD9A 2HBZA 2O1EA 3DEFA 3FZEA 4Y6RA 5C46F 1VJRA 1SKYB 4JC4A 2JLSA 4JT9A 3SBXA 1XRLA 3U31A 5KTPA 3TLGA 4KN6A 4CG0A 1OH6A 4WQMA 1M8JA 4HYQA 2J9GA 3TW0A 1CJMA 3O8LA 2YC4C 3RTCA 1VIDA 1XQWA 2EXXA 1VIAA 1Q95A 3O9ZA 1LLQA 4FPXA 4BKUA 3OCJA 5EUMA 2QRZA 3EA5A 3ETCA 3GAMA 2I54A 4RJJA 4N0DA 2W5UA 2VG8A 2G8LA 1PFYA 3L7DA 4EENA 3U5TA 4TGLA 4X1IA 3P5SA 6ABPA 1QFMA 2ODPA 4NAVA 4BFUA 1YNOA 2A0FA 2BONA 3IDQA 1Z47A 4CKBA 4MO2A 4LF8B 3WL7A 3MWKA 4ND5A 2BDTA 2Y1KA 3CLHA 3M70A 4X63A 5EWMB 5HF6A 5CDTA 1IDOA 4M76B 2QYTA 1P9WA 3ZVMA 5GJVC 3VDXA 1Y4DE 5IUJC 4YWHA 3MTAA 3JQ9C 3WMGA 4C1NA 2C5FA 1BDIA 3W5CA 3QENA 1Z4NA 1M6HA 1STOA 3EA0A 1YRAA 3GUUA 1F2DA 3CHYA 3LUKA 1P5ZB 3PCTA 2FUCA 3ENVA 4P4SB 1JWLA 2FF7A 2QN1A 4F45A 5BSMA 3HVIA 2ZBQA 3M6VA 2ZUFA 2C95A 2PNFA 4RESA 5ECWA 1AIPA 3ZH2A 4DZTA 1W8DA 1Z4QA 2XDQA 4UU0A 1GM5A 1UMCB 3BCHA 1U90A 2JH9A 2MSKA 1WJGA 2ZTUA 2QU7A 2R62A 1WAMA 2R2AA 2XCLA 2XQGA 4J6FA 5LM3A 3KLOA 1WZIA 2YBDA 2IP2A 2VSOA 2YC2C 3GYGA 4P35A 5TPWA 3UB4A 3SGLA 3IH5A 1UFRA 1KO1A 5AVWA 5A0VA 1R12A 4BNYA 3VOAA 5B7NA 1KEKA 2Q6VA 2QL9A 4I4LA 4K1XA 3IKMB 4QTXA 4R2XA 1E5TA 3LY7A 5BSUA 3VI3B 2QHXA 3PQ8A 4F85A 1JR3E 2OBBA 4G4IA 1Q1BA 3IE0A 4IIJF 2BISA 1UH5A 3RBAA 4M1KA 1WULS 1BJRE 1N6IA 5KSPA 2Q0HA 4C4PA 2GDZA 1JZTA 2QN9A 5LOVF 3PDUA 3WAGA 3FPSA 4PAQA 1NNUA 1PJSA 1Q7RA 1RM0A 2BTQA 4HNHA 4AG5A 1ANKA 5C51B 3C3CA 2V7GA 1ZHFA 4ATNA 2PMKA 1UP6A 4ZV9A 2OM2A 3S2FA 1HRKA 3Q72A 1AB6A 1O94C 3G2MA 5FV7A 1IOVA 3JR7A 4INOA 1M34E 4MV3A 2JW5A 1IUKA 1VPVA 1UZAA 3T3MB 1U4SA 3AIKA 4I3FA 5JBQA 5KTKA 1GZUA 3MJTA 2ZK7A 4MVJI 4EOGA 4E1VA 1SEVA 1P62B 3DYBA 1OXSC 3ZVKA 3S40A 3ZXYA 5ELXA 2CV1A 3JARA 4U0JA 2D7DA 1FJXA 1R3UA 2HDNB 2WAYA 3FD8A 5A5FA 1PV4A 4TVKA 3CPHA 4MI3A 4LSGA 4UCXA 2PU5A 5COQA 3PPWA 4PYKA 4BC1A 2C3PA 5BWMA 1TJNA 3Q2OA 2EHDA 5D3MB 5JMPA 3WZ2A 3WGQA 2JHPA 5L3RA 2XMGA 1DKUA 1M7HA 1Q3TA 3AJ8A 3MXTA 1MC1A 4AF8A 3T7CA 3ICEA 2BDUA 3NDIA 3TLZA 3T5PA 4PBSA 4C4SA 2H8GA 2KQUA 1RJDA 4JP5A 5JANA 3FNIA 5BN3A 3GDHA 2WHPA 4M89A 4QDXA 5LZ7A 3BRWA 5F1PA 4E21A 4NCIA 4OAPA 2YYSA 3AIIA 1ZSYA 2YN2A 3LUHA 3UANA 4G0VA 2RBEA 2PR7A 2ACWA 3RYIB 4DANA 3ADPA 1CY4A 2I6TA 3OAAD 4F6RA 2MMCA 3DPUA 4RD6A 3QI2A 4MV1A 2Y27A 1QX3A 3IEUA 4EGFA 2CDBA 4MLZA 4XRGA 5LL6P 2Q0SA 3OWHA 2BFDB 1Z83A 3LT0A 1OBFO 1ULHA 2NZXA 5DX8A 5L7WA 3AY6A 3OZGA 1N3LA 3GFTA 3AHCA 3JD2A 4R16A 5C5EA 2XTNA 4CKYA 4DR4B 5E6UA 5JXWA 4IMRA 4ZCRA 1A5BB 2P6RA 1O6GA 4UBLA 4HGNA 5BXYA 1U9CA 3F7NA 3VNBA 3AMVA 3N6XA 3UWPA 3PGA1 4NICA 4PZLA 1WTCA 1SQGA 1I36A 2JCBA 5CHYA 3AKYA 1J2UA 3HJRA 4JLJA 4UEOA 1DU4A 1CZRA 5LBUA 3TDNA 1BQ3A 1EWRA 3B48A 4UHJA 2FEXA 2WSYB 4DQVA 4ED9A 2D6FA 1RHJA 1OWPA 2Y0CA 4WGGA 3NYQA 1Q7BA 3IPRA 4LRSB 3NRCA 4PXYA 3VTFA 4FOSA 1N9ZA 4JLUA 5ISMA 1JMYA 1GARA 3OJLA 1NJ1A 2Q5OA 4MW9A 4L27A 3OEWA 4NJEA 4D8TA 3J7TA 4S35A 4HQ6A 4WKPA 4JL6A 4CMEA 1SCBA 3DBIA 3STTA 3KUUA 1X8LA 1J0AA 2Y0BA 1OI3A 3DEZA 4PG4A 1I30A 5EZYF 3MTGA 4JN6B 2FFJA 3N53A 4XJTA 1P4JA 1CU1A 3O7MA 3F2IA 2XE7A 3LUCA 3MQ2A 5CB0A 4MWZA 1R5BA 2K7ZA 4I5FA 4OQ4A 2ZE5A 4KQWA 1SIWA 4FWBA 1H3FA 4S1TA 1R6AA 4GOKA 1DEKA 1EFKA 5FOUA 1J24A 5I4CA 3VPSA 4EITA 5I9MA 4MP3A 3AUXA 1AGPA 5EP2A 2NUTA 3K9HA 3USZA 1K2WA 2QMQA 1VDZA 2FPGA 2XX3A 1UJCA 1BHSA 3LW7A 4J9VA 3ER9A 3GLRA 2Y93A 1VJGA 3Q88A 1NVKA 1DUVG 1P0IA 1P7PA 1PS8A 1ZOSA 2YUIA 3QF4A 1NVDA 1P81A 2B7CA 2GPTA 4NJOA 4B85A 2ZT6A 5B6JA 1WUKS 2WM9B 1BFUA 5LQKA 3N6VA 3QW4B 3VR2A 5FYDA 3JVVA 4UM5A 3AI7A 3AUUA 5AW1A 4HQOA 3CEJA 4F86A 2TMGA 2DTXA 1GHTA 1ZK3A 2QSZA 5LMUB 4DR2B 1A88A 2XGSA 4EO9A 1DGQA 1NVBA 4NI5A 3FCUB 5FJIA 2F7SA 2EFDB 2C2MA 2ZWIA 5BNTA 1UK6A 2O1WA 1N32B 1W5FA 2JZOA 4W9MC 3G0BA 4X84A 5JYCA 1ZH4A 4Z53A 2NGRA 2ZIZA 1K9SA 4ZYXA 2ZJ2A 1RVV1 3DJYA 3O21A 1HDGO 3HNRA 5HJ5A 3EAGA 1ML4A 2HMAA 1KRXA 3V1UA 5LR6A 1HT0A 2VJOA 5JOQA 2OCXA 1RC1A 2WIDA 3IKJA 4KAJA 2AQ8A 3V55A 4IRMA 1OFVA 1EWTA 4JJAA 3I04M 3RS4A 4DS3A 3BDVA 1JAIA 1KVTA 4ENUA 2DPLA 2XD4A 2ZWOA 1E3WB 4GC9A 1KEUA 4JGBA 1DAEA 3ZHQA 1R18A 4QM7A 1K5HA 2A58A 2IPXA 5HKKA 5GIOE 1J70A 5ESRA 2EKDA 1V71A 4OV6B 4BHTA 1AA6A 4KYTA 1XQ9A 2Y92A 2FMKA 1ISJA 2NZVG 3IT2A 5CLFA 1QSGA 3GIDA 2DUNA 2K87A 2X1LA 3AHFA 1FYXA 1TQ8A 2J1LA 4MSUA 4JYMA 3IS3A 1RAAA 2V3WA 5KEIA 3DTVB 1QLJA 2EVWX 3TJRA 1H2WA 3HR7A 3L9XA 3L9WA 2J3IA 4NBTA 3T1TA 1K5GA 2I8CA 4Q3EA 4PYIA 4L51A 3DO5A 3KJGA 4ETIA 3E70C 2C03A 5DM2A 2O5RA 1ST3A 2OCDA 4FGJA 2G28A 2VI5A 4P3PA 2Q1UA 3D0KA 2NSHA 3OI7A 4BQNA 1QHGA 2J4DA 2NZWA 3B2NA 3TN7A 3IEVA 1TYAE 4UUAA 2ZCJA 3KJEA 2R66A 1WDWB 4JELA 4BNVA 5DM0A 1OAOC 4TMTA 4ZHSA 1XE3A 2FSPA 4JI7B 1NXTA 3ZD6A 5DI3B 1B43A 3ZZUA 1H8HD 1IQ0A 2FUEA 2AOWA 4Z1MA 4N0QA 4PQGA 4V39A 3ZG6A 1TIBA 1BKSB 1JKXA 4PG5A 2VRBA 3DDUA 4LOHA 3U4DA 3ZGYA 5MN4A 1G16A 5TE9A 3OT1B 4K7JA 4Y1RB 3I53A 4ZTZB 3K0CA 1CQZA 5AQEA 4RJTA 3G8AA 4BJ3A 4GMKA 4V2UA 3V2IA 4N0EA 1E58A 4RKWA 5DHUA 4J07A 5HSGA 3N2NA 1SGWA 4DIOA 1OZ0A 3KT3A 4PCVA 4E4YA 5AI4A 1PR9A 1C81A 3BWMA 5K7SA 1E1QD 3I76A 4AF6A 2IHBA 1A5SB 1JSZA 1G2QA 1ZH0A 3AB7A 1NIPA 2BZ1A 3KQOA 2N1MA 5EWLA 5L9AA 3KZKA 2F8SA 3BIFA 3FTFA 3T12A 4OL0A 5CPBA 4XYLA 2IPMA 1U3WA 3VU9A 2PWBA 5JMTA 3VPXA 3M1AA 3AKEA 3I04A 4F5DA 3CN7A 3I0ZA 1B23P 3WQHA 1T43A 4DHEA 5I8ZA 1FP1D 2YX1A 2PJRA 3OTOB 1MUUA 3GRRA 1CIVA 5C32A 1NVEA 4G0UA 2MYUA 3O84A 1KS9A 2Z6QA 2OCBA 2AFHA 3GGPA 2EERA 1UC9A 4WX2B 2XA9A 1SB8A 2ISCA 5KO2A 2CC2A 1GGVA 1YGYA 3MSXA 4WBNF 4ZCQA 2M9MA 1XXHA 2WHEA 3CKLA 3FVVA 1N8KA 2QN7A 1L4HA 1QTIA 1T9KA 1SC9A 1Y1QA 3G7SA 2CK3D 4J0KA 4B1FA 3RUDA 1JLRA 4Q01A 3OBIA 3RI3A 3TIGA 5L3SA 2P9BA 2XD9A 5IBPA 2I7XA 3UJ3X 1J8DA 3SLRA 4CRWB 1IHDA 1X9GA 1AKRA 4TQUS 4YJ2A 1QHHA 5AUNB 1SUEA 2R7NA 4F4CA 2V8BA 3LNTA 1HRDA 3ROEA 1OFHA 4IDOA 1ADYA 4Y2SA 5CYGA 1ZD2P 3EPLA 1J06A 1F20A 3UZUA 2WKRA 2KPOA 3JYOA 4TKVB 1TM3E 3ESAA 1FFXB 4CMJA 3CNOA 4WK6A 1M6YA 3DS8A 2OP0A 3AGQA 1XLTC 4J0IA 3H5WA 4KNVA 4LNUB 4X97A 3RS3A 4AECA 2TYSB 2QW0X 1YZVA 2QP4A 3PC7A 3SQLA 3MT7A 3G9UA 4FT2A 4R83A 2CFOA 1RADA 3EASA 2GM9A 3L1JA 4FCWA 3WWCA 1TTPB 1VLMA 3BHIA 4B7ZA 4R7GA 4EQZA 4Y18A 1USVA 1SXGA 4GVLA 5HEKA 3KVOA 5TVKA 5BV8A 1TPZA 4K81B 4EY3A 1U81A 3C6ZA 4ARZB 1SR8A 1RYYA 5SYMA 3QEMB 3KL2A 4QAJA 1YTUA 3MA0A 2B21A 3QBTA 3ZGLA 4JSRA 4BQSA 1GQRA 5TRTA 1VRCA 4ZXPA 1YCDA 3OQJA 4G5FA 1L3CA 2PRSA 3KR2A 4WERA 5K3DA 3NOOA 2XRMA 3QNWA 1GTMA 4JB3A 4HZGA 1CUHA 1ORHA 4MWDA 4U0KA 3COPA 4IJ6A 3EPHA 3U17A 1U9IA 1XTJA 2YQ5A 4DE5A 4HDRB 1SKBA 2WAXA 2FUG1 3O8NA 3MJDA 4BGVA 1KSHA 3SX0A 4PLYA 3WAJA 2QL5A 3OPNA 4ND8B 1Z6AA 2VHTA 3GK3A 3QPUA 5CTJA 5AXAA 5IAGA 5CFOA 4CT5A 4EVSA 2GSWA 2HYDA 1CT9A 4WFQA 5LVAA 2VRCD 1KYVA 1NXPA 2HB6A 4DA4A 3PHGA 4BMZA 2HWYA 1AKNA 2VTKA 4OYLA 3D5QA 2NUPA 2PZAA 4BZQA 1EP9A 1BEZA 1GLVA 2JBWA 1YJCA 2WJVA 4KGVA 4AT1A 4DA8A 1FLNA 1PL0A 4NMLA 4EDHA 1XMQB 1JDBB 1NI3A 1T2DA 3L7KA 5E8RA 3EUWA 5EHXA 5SZHB 4JLBA 2WE8A 1AKUA 2AOUB 3VO8A 3RVMA 3NOXA 4RPLA 3HXMA 1DS6A 4YAJA 2ZR7A 4LPSA 4RACA 3H1BA 4H7JA 3U48A 4ZYUA 2R5WA 3B1YA 4GRDA 4P31A 4ZAWA 4G0MA 4BNGA 2BH2A 2BV3A 4IHJB 4YALA 2ZRDA 2PSDA 3MBKA 3HVRA 3G8CA 1UJNA 2Z09A 3CE9A 4EATA 1GSHA 3QLEA 4D9NA 1J56A 2XQKA 4BO0A 1RACA 4O8ZA 3THYB 4QDUA 2EJWA 6REQB 2YWJA 4Q19A 2O3SA 4V3CA 4E5SA 4G1UC 3KE8A 2AK2A 1T36A 5AO9A 4ZT7A 5FD8A 4QKQA 4TL8A 1A8HA 2EJVA 3U62A 1R4NB 2CF6A 2LWIA 1G41A 5JAIA 1NRWA 3UTCA 2BM1A 5TLSA 2R6HA 1GIAA 3WK6A 3CXUA 1T2VA 1RW4A 3ADCA 5AW9A 1EEXB 4YPVA 4DJDC 3RLIA 1S9DA 4R69A 3UF0A 5JT1A 1WF6A 3AR4A 4LOIA 3WNQA 3ND5A 5EIBC 5L8VA 2YQ4A 2QM0A 3DZGA 5AVXA 3E7FA 4Z9YA 2KWIA 4Q4HA 1DPGA 5I4KA 5BWBA 2E1RA 6LDHA 5KYWB 1UJ4A 1IXZA 3AJAA 2BJWA 5CBPB 5DDIP 1ESNA 4QQKA 2BZGA 2IEBA 3KM0A 4XW2A 1MJFA 2ODTX 3BE6A 3LFTA 1WQ4A 1ZI9A 1ULAA 4R81A 3U13A 3TPZA 4IKPA 4MJXA 1QKIA 2H59A 4K9PA 1P2DA 2AVDA 2XUIA 1GZ3A 1L7VC 4YQZA 1ZGHA 2XT0A 4L22A 2IWRA 2YN4A 5IM4F 4UXJA 5FBKA 4KB5A 1EFVA 1MG5A 1XCJA 4MQ6A 2WQ6A 4WEOA 1IC6A 5HR5A 4IUDS 3GZJA 5C8YF 3B2QA 3MT8A 1RRGA 3BAZA 1U7XA 3D8SA 1TTTA 3N2LA 3S2SA 3T99A 3ZWDA 3DONA 3CTMA 1HFKA 3DFIA 3RIXA 1G3UA 1GKKA 2IZ7A 2WUWE 2ZB3A 3NJRA 3U7GA 2J67A 4FP9A 3GW8A 4CT4B 3NAZA 2HF7A 4NH4A 1H4VB 2MSLA 3G1UA 1FMJA 4DCSA 2C3YA 2FZCA 5DLDA 1GAWA 2C88A 3AEXA 1LWNA 3EGEA 5TGDA 9LDTA 1OX6A 5KNCA 2XR1A 3NTXA 5H7XA 3MOSA 4B2YA 2G08A 5F5XA 1ZCFA 6Q21A 3U60B 3JAKB 1RXIA 1YC5A 3IUJA 1SIOA 1VIMA 4JOSA 4CCAA 4NULA 1A50B 1KKUA 2C1XA 3VC2A 2JC3A 5E9WA 4D96A 3JASA 1E1CA 2SKDA 3GJ3A 1CJUC 3V42A 3ZGNA 1CEXA 3I6YA 3WICA 3BDIA 3H1AA 2QLTA 1OZAA 2PO7A 3O26A 2PE5A 2NXEA 2GK7A 3R3HA 4GR9A 2R47A 3JWEA 4JOCA 2PEYA 1M7BA 1ST2A 2JIMA 3C3KA 2P2ZA 4FYXA 3EXEB 3W7VA 4YYZA 3FOFC 1WVIA 4IIEA 3L4EA 1SVIA 2P68A 4CCSA 3MJFA 4HO1X 3GJ8A 3EEBA 4OP2A 2B8WA 4H1HA 2O4CA 4KZKA 5DTQA 2HH9A 4EUHA 1XZDA 2CNBA 2GZHA 2V7WA 5E4JA 4V1CA 1X8KA 4ZHQA 1E60A 2I3ZA 3QTLA 3OTQA 4HDOB 4TKZA 2I67A 1ISHA 3BICA 3ZVRA 1GG9A 4RE6A 2G09A 1Y4ZA 1JG3A 2DR3A 4UARA 3UYLA 2QK4A 3SKYA