4ZEMA

Crystal structure of eif2b beta from chaetomium thermophilum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
382
structure length
328
Chain Sequence
PSLATWTKSLRDQSLEASIESLIFLLKRRQVTGDECAGAIAQLLRQVVAKSKWHDVDQLLYRVQTAGARLARAAPHEPVIGNIVRRVLGLIRDEASDIASDAASDIQSKSMFNLLSVQPFSVHALRSEVMDGIEEILDEINQADDQIASFAEIQIHPGDYVLAYQPSKTVERFLVKAASKRRFTVILASLNPQPYAALRKKLNAAGVSTINLASNGLMAYIPRVNKVIFGAKAVYQNGGLLVDSGACIAAQAAHEYLKPVIALCGVYKFCPEDPSDEVSRGELTTTDYIPPDLVDVYLTNLGPQTRHHLGGIYADHYKIEDIGFSLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor eIF2b-like protein,Translation
publication title Architecture of the eIF2B regulatory subcomplex and its implications for the regulation of guanine nucleotide exchange on eIF2.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 115
structure length 328
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 4zemA02
4ZEMA 3A11A 1T9KA 1VB5A 5DBOA 2A0UA 4LDQA 3VM6A 3A9CA 2YVKA 2YRFA 4ZEOA 4LDRA 3ECSA 1T5OA 1W2WB
chains in the Genus database with same CATH superfamily
4P4GA 1PNTA 4DSZA 1DC6A 2PUVA 3CC8A 3IDSA 3D4LA 1C4XA 3G2MA 3S1AB 4J1QA 2HK6A 1V5EA 4XTRA 2QU8A 5ALGA 2HPHA 2P9HA 3LGXA 1XVVA 1V4VA 2WUWE 4PNEA 2FSGA 5TSDA 1EJ2A 5H3HA 4B6RA 3AL2A 3E2PA 4CUJA 2YY6A 1DMRA 1PUJA 2YZKA 4MP8A 1XJ0A 2Q3FA 1YCFA 4ZEOA 2V6BA 2Q41A 1X7XB 2NO0A 2W8ZA 2NACA 2P4EA 3GDFA 1SC3A 3OFJA 2O0HA 1HE5A 2O1XA 4YXWA 4AMGA 3OZ7A 5I7SA 1QYXA 1XROA 1NFRA 4CLHA 4ARBA 4MQLA 4ZO6A 4B7ZA 1I9GA 2J7PD 3GQBA 2ZRIA 3OJ0A 4JEHA 5P8WA 2HWWA 3GRYA 2F1JA 5CVVA 5IK2D 3ZV5A 1LU9A 1MO5A 3FSGA 3LLUA 3PVSA 5HP4A 1V1MA 1V9CA 1YZGA 5I5EA 1CJKC 2AG5A 1GKLA 3KAQA 2XTZA 3ANNA 3I37X 1IUPA 4CQMA 2I6XA 2IDJA 2VA8A 4REQB 5DM1A 5FWYB 1NXSA 2B92A 4L73A 4FFDA 2DHEA 4F5DA 3DL2A 4FCVA 2V9CA 4RSMA 2QTCA 3BE5A 1FYFA 3D7KA 1FP2A 3L7KA 4PHFA 3VU3A 4MR8A 4FW8A 2UXBB 4I9NA 4ENWA 5AVKA 2BDUA 4U3JB 1SVOA 5FAKA 4MYDA 5DPMA 1G64A 3N59A 4UC0A 1NRJB 4NFHA 2FEKA 3DAGA 3L1JA 3KHUA 5ABPA 5AKYA 5CEJA 3H9EO 3E81A 4IX9A 1B3RA 4W5HA 3VR6A 2H63A 3H18A 4DDMA 1QP4A 4BLRA 4IQ4A 4ZCTA 1SXJB 4KNYA 4NE7A 3I1YA 3K05A 4FQ8A 3BWXA 3VPFA 2C7PA 4HDRA 1DUSA 1E1RD 4FFLA 4J3NA 5JBIA 4LHVA 1H8ED 5JYBA 1I33A 5E7MA 2Q6IA 3E1GA 3TRHA 4BO0A 4N0QA 2AA3A 4WL0A 5KEIA 5GY7A 2V9PA 3EFOB 5AOVA 1I36A 2H54A 1WV0A 2DAPA 2IGTA 2O4CA 3VU1A 1S2NA 5EJ4A 3LW8A 1JR3D 3FWNA 5IUNC 4Q1CA 5DO9A 3WLEA 4AJOA 1J99A 1VL0A 3PPVA 5HF6A 5ALPA 2I8CA 1YUNA 2PJRA 3STXA 4FR2A 3KTAA 4ND3A 3A8TA 4K6OA 1B0ZA 1JQLB 1TAHA 2HLHA 3N39C 2J9FB 2VNAA 3O84A 4MSUA 1YQXA 3RS2A 4EK9A 4FNGA 3JSXA 5CLIA 5AVOA 1KEZA 4K6HA 3HJRA 4FE7A 4LJ9A 4QA9A 3TW8B 4EMTA 4YPVA 5JXJA 3RV4A 5HTOA 1IHXA 3HNRA 4J43A 3GF4A 2O3TA 5CTAA 4OJMX 2X6RA 1GNRA 4QPDA 4C6RA 5CVCA 3DO5A 4UBMA 2DFDA 3TQHA 2O0JA 3DV2A 3D8NA 3P9CA 4HVCA 2PLRA 9LDBA 1ZD3A 1D4AA 3NKLA 3C45A 3ZE6A 4KQGA 4HNAA 3Q0TA 3M89A 2JJ2A 3PLRA 2BGRA 4NWIA 2OXEA 4URUR 3B6MA 3SQMA 4MQEA 3W2TA 1D4ZA 4J2OA 3KWMA 4PLTA 4BO2A 5JTUA 1YS4A 3Q9LA 1KEWA 3LF2A 2E6KA 1UDWA 3ZEAA 2B2XA 1NZFA 3K8OE 3MWDB 2HRZA 3D7SA 3AR5A 5JYEA 3G6WA 3EG9B 5AVQA 5IDQA 5TDHA 2CJFA 1ZZEA 5FR2A 3RSCA 4LN1A 3TRFA 5CA1F 5KWEA 1CP2A 3GJTA 2FWPA 3L0YA 1R9GA 1G8KA 1P1KA 2BMVA 1N7IA 2CD9A 2ZSHA 4IXMA 4N5DA 4RZ3A 2BKEA 3J7TA 4UE6A 1EX7A 3KHKA 1WV1A 1I2ZA 4LOLA 3P45A 5IS2A 4D9GA 5HHTA 5B6IA 4MUMA 3W3AD 5HM8A 2DXIA 1XRJA 1G98A 5AK0A 2K87A 5F21A 2DSTA 3GFVA 1XPUA 3LFUA 4ZDKA 4BV2A 1EM6A 4IEFB 3WWZA 1PBNA 1JDSA 4RQUA 3WRYC 1K5DA 5DHUA 3IP8A 4D4IA 3OPNA 1CJUC 1VIYA 3SJZA 1I0ZA 2V74B 3N2GA 1Z8FA 3O8CA 3NPAA 4GQAA 3VC2A 3Q2IA 4KQ9A 4DB4A 4CLRB 1HE3A 4V3BA 1YA4A 3VSEA 2FLKA 3I6BA 3WWCA 5JYDA 4ZRMA 2IY7A 3HY6A 3VDRA 2HXSA 4TYPA 3OT1A 4WK0B 4YXFA 2CUKA 4TTAA 1JU4A 1HA3A 5BV7A 1BWQA 4I8DA 4P5DA 4LJ8A 5EEGA 4DBVO 4RTMA 3HUTA 4FCWA 1T2AA 5ALQA 3WAKA 4A1FA 3G79A 2QJRA 1I3MA 2CLKB 5FNVB 1V1JA 2W6OA 1OOEA 1Q7RA 2JFFA 4EMUA 2EX4A 4W9MC 1BHQ1 1NQOA 3DONA 3EBPA 2Q5FA 2JJQA 3DE0X 1A0OA 2H57A 1MRSA 1KARA 2GPTA 4F91B 1QLWA 1RPAA 2LNDA 3LP8A 5JD3A 1U2TA 1QQAA 2BHLA 4PSAA 4ZT5A 1W2HA 4PC6A 1V5IA 4X24A 3P2OA 3SQXA 1G291 2OAGA 4HEA1 4P7KA 1AKTA 2B5VA 3A2LA 1I6LA 2MYUA 3DHEA 5AR1A 3WS7A 1PGQA 2PMBA 1XP8A 5ULLA 3ULKA 3O4RA 3TL3A 3CZMA 1YA6A 1AKQA 2ZSAA 3ETNA 3R1IA 5AVRA 4TKZA 1V7CA 2CB0A 2I2BA 2X5OA 3IUMA 3RRZA 1SCUB 1JSZA 2XKAA 3AEUB 2P77A 3C87A 3KFXA 2ZEJA 4G0QA 4ZMRA 4V0QA 4EG6A 3BH7A 1AXGA 1BX1A 2Q6OA 3HU3A 4GPAA 2VQ3A 3WA7A 5T6BA 3TK1A 1GV0A 3TNDA 4GE0A 2JIQA 4ND6A 1JEYA 2WWHA 4P7JA 3FHLA 4YK7A 2ZJ1A 1AHHA 4ZI7A 1XN4A 5L51A 5B6PA 4IILA 1YHNA 1N6LA 1CV2A 1GEEA 4F0JA 3V8PA 4EDHA 2C3PA 2XRMA 1P9OA 4GKBA 1TQ6A 2XWPA 3NBMA 4UEJA 3ZJ4A 4UHEA 3BGDA 3ZY6A 2OESA 4LMAA 5A7FA 3WLPA 4AY5A 3LLMA 1HWYA 1Q92A 3G0DA 5GTDA 2FWRA 2VNKA 4RLQA 5DNEA 3WLOA 4DCVA 3VU8A 1XALA 3C41J 5LU9A 1KAGA 4J0QA 3O8LA 1FFAA 2PX5A 2QW1A 1E4VA 1OPRA 2ABWA 2CZCA 2FG7C 2FG5A 2WFAA 2X1HA 1PNVA 2ZRAA 3PG5A 3MWJA 3Q8KA 5E6RB 4ML3A 2C1ZA 3IAFA 4Q16A 1ISFA 2XA2A 4GM0A 3G2QA 4DE5A 1ZOOA 2W2VA 1MG0A 4KO4S 10MHA 2XGGA 4KV9A 3BPSA 2LCFA 5ALZA 1USKA 4NOJA 5AI9A 1Y8QA 4GOKA 2ATCA 5IP5A 4GMXA 5FJIA 3HR4A 1KFCB 3IPYA 1M66A 3SFTA 5I7VA 5KYWB 1YB2A 3CXUA 2AEEA 2VUUA 1OKKA 3CO5A 3KEMA 4JT4A 3QG5A 3W4JA 1UMKA 3C3WA 1FVOA 4GX0A 3GLIA 1NHGA 3KUXA 4X45A 2NU8A 3GMIA 1ZMXA 4EG1A 2GCNA 4BMVA 4QT4A 3ADPA 2O2SA 1PJ2A 1NBWB 4TMYA 5DHTA 4UATA 4C7VA 3IQHX 4AK9A 5ITVA 5JSUA 1NKVA 3FN4A 4UTOA 1I94B 1P61B 1XNRB 3MMNA 3ABQB 1Y1QA 4H15A 4CG0A 3NBZC 4LECA 4XYEA 4OVKA 4BGDA 3A1WA 2I3AA 1PSZA 3TIIA 1AKVA 3EJ6A 4OU4A 3CNBA 1ODLA 1Y63A 1TTHA 4DNOA 4YAKA 4KOEC 1O6BA 2C29D 4JD5A 1K3TA 5IVPA 3FH0A 4U7GA 1XWFA 4RLSA 3IC5A 4PZYA 3ZE8A 3KWLA 1RU3A 3PDJA 3ZYZA 1L0BA 3ZY5A 1QK4A 2Y3IA 3D1JA 1OLUA 1RJ9B 2Q99A 2ZRHA 2A78A 4X7MA 1W4CA 2QVXX 4K26A 3P4YA 1RBQA 4LWZA 3CJRA 4V39A 3SSMA 4CCSA 5AIBA 3K9FC 1GWNA 3GIDA 5D5HA 4YRJA 5TQJA 1SIUA 3DGEC 4E32A 4OD0A 4GOLD 2WM2A 2JGKA 3QBVA 1WCWA 4ZVPA 2W6JA 3FHTA 2FMFA 2H48A 1HNNA 3GGSA 4QYXA 3B36A 3R75A 1PFYA 2I4RA 3KZOA 4KFUA 4EGAA 3D4BA 3FDZB 3BZUA 3HJTA 5JQGA 3A2KA 5JMPA 1N8KA 1WB4A 3W9YA 5B30A 1U7OA 2J9RA 5FWXB 4PZ9A 3DLPX 5C7YA 4R2KA 1TUBA 2O3SA 1AZTA 1U2EA 1CUJA 3IAS1 3Q7RA 4OOFA 1IUOA 4JEMA 5LIPA 1HORA 1Z16A 4ER3A 1NIPA 3RWMB 1WXIA 3AL3A 3R3HA 1YC5A 2ZJYA 3Q41A 2O2EA 2PZGA 4M0UA 2DM6A 4JB3A 2IHJA 4YYZA 4N7JA 4E5VA 3QWFA 1CZKA 3GLRA 4MWZA 4F4JA 4IFBA 4JOCA 4HF7A 3JW8A 4WAUA 3CLUC 1M6VA 1GILA 2P0EA 4MUYA 5HRAA 3M5PA 1YDHA 4AX4A 1MFPA 3WXBA 1P3Y1 2XV1A 3QBJA 2NT3A 3OHSX 4M53A 3VDNB 2P79A 2IITA 1DKPA 4FGWA 5EIWA 1ZEMA 2IP4A 3OO1A 4G0XA 5HF5A 4R71A 1NU8A 4BAZA 3SFVA 2D1SA 1B7GO 1I5EA 2XUAA 2X0NA 3OY2A 3P26A 4C89A 2IUTA 2P6OA 1SCAA 2QEQA 4H3VA 3K0AB 1RYFA 5EMMA 2EG9A 3TZKA 1CLEA 4YUAA 3BUSA 5ILOA 4D4HA 2JLQA 5CA1A 2Q6TA 1E5DA 3C6BA 1BS2A 4ZQEA 1GFWA 1Z12A 4NS1A 4B75A 2KBFA 1G16A 1HKHA 3KTDA 1DRUA 4Y67A 1UJ6A 5CCXA 2O0LA 2PKQP 2Q6VA 1YB7A 3LFHA 4IMPA 4RPKA 5CX4A 1A50B 3SYNA 3SSOA 4TX1A 5I7AA 5GVSA 1LW6E 1DRWA 2QTAA 1JA0A 3C3EA 4ALLA 1PSDA 5C80A 1CUSA 4J0FA 1J00A 3ORYA 1SUPA 1WB5A 1X0XA 2CDNA 4XEHA 3FWPA 1E6CA 3O2SB 5EE5B 3S68A 3EEQA 3GFGA 2EWVA 2PMWB 5KYGA 4KUHA 4CMIA 1F0NA 2PRIA 4OXNA 4R8MA 4XGRA 1ODIA 3N0XA 3ESZA 5UKDA 3AKCA 3EZ2A 1VPWA 4C07A 1C3JA 4AVYA 3QWIA 4QQKA 3WL3A 1FDIA 2L19A 2X9QA 2HRBA 3ZTYA 2ZJBA 1GVNB 3IUQA 3NP9A 4NCAA 5EJMA 2VP9A 1SD2A 4PAMA 3NLLA 5F3RA 3HUUA 1YR8A 1Z4LA 4LJ5A 1V45E 4Y2SA 3OQMA 4BQQA 1N6KA 1B8VA 3AKYA 3OQPA 1G9SA 1VLHA 2M9MA 3O4IA 1J70A 3T7SA 1Z08A 3K1AA 2FP4B 3QU2A 5D3MA 3WRWA 4F1KA 5BUQA 1UOPA 3SZRA 1C9KA 1GVHA 2WPDD 3H75A 3T9FA 3WL7A 2DPXA 2G07A 3DFFA 1L7EA 2Q9AA 3LLCA 4HPXB 2J3LA 3BMNB 3HZZA 2WNSA 2BFNA 1XU4A 1PS8A 1PTJA 1S8AA 1DBSA 1XXHE 3DD5A 3I2KA 2FZKA 1J5XA 2AX4A 4MO2A 5DSTA 2SBTA 3RTGA 4GAEA 5A6SB 4E7OA 4YN3A 2YCBA 2P0AA 5ICFA 2ZROA 1DCTA 5G4LA 2IXDA 4WNAB 2VFAA 3VOSA 2CLCX 2QVYX 3S4YA 1C1DA 2XMSA 3TPCA 2GO7A 3QVGB 4G1UC 4KKVA 4PTZA 4OHBA 4JUAA 4IOKA 5IFKA 1MDFA 4ARZA 1FIUA 1FVFA 1N8SA 2GCOA 2GXUA 4MRRA 5CYPA 5AK4A 7ABPA 2DC1A 4KXNA 1RVDA 1DIBA 1DSSG 3C4QA 3QPBA 3CBQA 4S0ZA 2P1RA 5LYJB 4BWGA 1FDUA 4I1UA 4MW6A 2V3VA 4K88A 2BFFA 2ZVDA 4OQLA 1TT5A 3CY6A 5CCBA 1Z5VA 1IRXA 3T3MB 1X7YB 1BDIA 3HRIA 3G5UA 1P91A 1L5HA 1PVDA 5AXCA 2GYVA 4K1LA 1XJWA 2J31A 4GGMX 3OCJA 3F74A 3LOUA 4FI3C 3AVTA 1MO6A 4ZT6A 3EZLA 3WYDA 3S70A 3CEHA 2QVGA 1NYQA 2V5AA 3GLUA 4F3CA 3SKXA 4FFNA 5TMDA 1YMQA 1W96A 3BWVA 3OCXA 4A0RA 4BEBA 2O1EA 4DN6A 2XF8A 3C5CA 1M8PA 4BB6A 1NVFA 2VOEA 1BE0A 3KNZA 1YJCA 1P3DA 4EA9A 1JEDA 2NPOA 4ZO9A 4CWAA 2X2OA 4TVBA 3NRJA 1F0YA 1OLXA 1P4JA 5BNIA 1RJGA 1U4SA 3AH8A 5LP1A 3ZLVA 4R6XA 2AIRA 1UINA 2PUJA 1C0LA 2JIDA 3U7JA 5LXTB 3GFFA 4LE1A 2QMQA 2R86A 4I66A 3IKLA 4L15A 4AUMA 3A3YA 5TF4A 3NJRA 3GVPA 4YHBA 3GVXA 4ZAVA 5LN1A 1YZTA 4L6IA 5JI2E 4G36A 2GK7A 4G5YA 4TWIA 2ATIA 3GBSA 3EIOA 5CNIA 4IJQA 3YASA 3QXJA 5F1PA 5IW8A 2ZM6B 1UEIA 1CWUA 1F5NA 1VZ2A 2MSDB 2O06A 2QGFA 3I9V6 4HX5A 4M9XA 2DBVO 2ZS9A 4RK7A 4EW6A 2CWDA 3EUAA 1FNNA 3IBTA 4N5HX 3SS7X 1Q0SA 3RVPA 2XUZA 1U6IA 3U1VA 4NNPA 1U28A 4WXEA 2X2PA 3M70A 4AP6A 3C6XA 5FL7A 1A4RA 3N70A 5AVXA 2FQWA 2HRRA 2PSSA 1SQSA 5ES3A 4MV3A 2NUAA 4M1ZA 4NYMQ 2PNJA 5J47A 3QVJA 3ZN2A 1GSAA 1QORA 2EF0A 2ZCUA 4YA6A 2DKOA 4BKUA 4IKPA 4W1SA 1S02A 4G63A 3RJMA 4JX8A 2PU7A 1DJMA 2G77B 1VRCA 2GWRA 4HSGA 2XZDA 3EEYA 1C3VA 2IT1A 3H2YA 2BW0A 4FGZA 5KHLB 5EJIA 1K66A 3ZV6A 3K9QO 4XVUA 2D06A 3PICA 1X94A 4BNHA 4LXIA 2OP0A 2R00C 3KUCA 3NYWA 1WXXA 4YCAA 4YMWA 2WSLA 1OC2A 1BDBA 1SURA 1G4UR 3HGTA 3KT0A 3PNBA 4IGIA 1R4NB 1EHCA 1J5PA 4II2A 3UKDA 5TR9A 4DV6B 4JV5B 5DMHA 5T5QA 3AVUA 1VSUA 4K8RB 2L69A 4QNNA 5G1NA 4BLPA 4X1KA 3RS9A 2M32A 5BWOA 1BRTA 2LGJA 3E3AA 1C7ZA 3WGJA 1XLWA 5AOBA 3M4XA 4ZCLA 1Z75A 2BUCA 2QN6A 3JQDA 4LSWA 5EXXA 5HGJA 4A2CA 4IIJF 1ZD5A 3IPLA 3EEBA 1JQ5A 3TZLA 2QTTA 3K71B 4C87A 2JHGA 4ND4A 4C4ZA 1TX4B 5ICGA 1YVUA 5IULC 4CEJA 3R3SA 1DAHA 3RLIA 2PR2A 5KB3A 1SXJE 2AE2A 3U7GA 2OO5A 5AK3A 3GLHB 1A5BB 1EWVA 2OV1A 1XEFA 1UBRS 2EGGA 2W43A 1RM4A 3QUQA 4PHGA 4RMGA 1ZGAA 4X7BA 5FLEX 1FX0B 2ZUEA 2BEWA 3HXKA 3BE4A 3ENNA 1LWNA 4M46A 1OXVA 1JJFA 2VAVA 3KZCA 1KSHA 2IHZA 1DMSA 2YOGA 4I7EA 3OC6A 2FW6A 1VI2A 2P4UA 4LY0A 1RQRA 2VPXA 3ZXXA 1TQHA 1YFZA 2E6UX 3VX4A 2FPIA 4WASA 4JSYA 1SHZA 2H2DA 5AKGA 4BNGA 3V1MA 1M2KA 1S1CA 5H3CA 1DBPA 1N2EA 1POWA 1XZCA 2JFGA 4HPJB 1OWLA 4MS4A 2YV2A 3CTPA 3R24A 2X9NA 3S44A 4OXYA 3NRCA 3RHZA 2ZB2A 3SOPA 1AC5A 4BGEA 2OHVA 3HL4A 2H1CA 5FF9A 4YJFA 1HDEA 3BM5A 3MTGA 3CPJB 3GNSA 4TKUA 5CVJA 3VDXA 4XWOA 1P0CA 1X8XA 3P0FA 3QXXA 1UQRA 2IOFA 4C0AC 4D9MA 4HH3C 2V97A 4OX9Y 3O9MA 3WLFA 4C76A 3R7FA 2VRCD 4GPIB 2HCRA 3AM1A 4WZAB 2PZ8A 2V7WA 3ANMA 3M1AA 4FSHA 4E14A 2GBPA 3ROQA 2F8TA 6LDHA 4II3A 2XNCA 2ZQZA 4A6PA 1GA1A 4HMQA 4PICA 1NAIA 2EP5A 3WJ2A 1ZUNA 1ZA2A 4MW2A 2W11A 2VS1A 2QR3A 3TEFA 2H08A 5GJBA 1EBUA 2QPLA 4MMYB 4DT1A 2BLLA 1NVWQ 1FMLA 4RELA 2B9VA 4XVHA 3ZWBA 2Q5LA 3OZRA 3FYSA 4AQYB 4JODA 4OMUA 4D3FA 3ABSB 4M1SA 3VJRA 2Z9CA 4JDUA 4RPIA 2HJHA 1TCCA 2FUG6 1FP1D 3E1KA 5HCUA 3QKRB 4NG5A 3ZWVA 2YXEA 3NTVA 4RPLA 2OC4A 3V2HA 3HV0A 3AUKA 1K5GA 1H6BA 3G2JA 1P9NA 4P86A 1ZM4A 4ZXPA 3WK5A 2ICAA 2ZVPX 3DEZA 2IV3A 3O4JA 4LGMA 1Z63A 3CNEA 3O4VA 4KG7A 1XL0A 3O8BA 1KSGA 1O9HA 5EHQA 3WZMA 2WIDA 2INGX 2R1VB 5F7OA 1IBMB 4EEKA 4DRXA 3EZ6A 4AECA 3HWRA 4O1MA 1NYTA 1UBJS 3AWDA 4DHWA 3COJA 3K0FA 4H7JA 3X1WA 1H1DA 4R1SA 2XAAA 1XWIA 2P9JA 1I4OA 3DR5A 3STVA 4NCXA 1NNI1 1Z5OA 2YIJA 2BI4A 2DWPA 1VG0B 2FWNA 3Q98A 3R9KA 4LOKA 5DSXA 3WFZA 5KWVA 5EMJA 1YR1A 4BKQA 4ZOCA 3UQZA 3QFFA 3TPZA 4GPTA 5EHNA 4OA5A 3SDBA 1A72A 4BPRA 4EG7A 4RETA 1WVMA 4JL6A 2YBDA 1YAJA 2HA7A 1J8VA 4IWNA 4MPPA 3ENVA 4MV8A 4WIAA 5EZYB 1L6RA 5KYVA 3ZGNA 3P9RA 2OCKA 3P1JA 3D43A 3IOEA 4ZFNA 2C4UA 5AFSA 1N2GA 3BGSA 1N78A 1UP7A 1D1TA 4OHCA 1Q2UA 3FI0A 1W5AA 2LKDA 3K5IA 3OTIA 2Q7DA 1BKYA 2FPRA 3TTYA 2C5HA 2CVPA 3DE1X 3PWTA 1ZCJA 4PF1A 5HA5A 1OVGA 1XIVA 3MT7A 3W1VA 1DRVA 2RARA 5JCJD 1KMIY 2J3IA 3L93A 1XTRA 1H2BA 3IAM1 4RFLA 5DXFA 4TYNA 4N41A 2NU6B 1N5MA 3MQ4A 5HZKA 2CXXA 5KHAA 5DP1A 4C4OA 2TSYB 2Q1WA 4A9AA 4NATA 2O2JA 3V8RA 2CT8A 2JZOA 3SR0A 4BV9A 4GOXA 1BHSA 2MTBA 3RKSA 2XE7A 4E6EA 2ZSBA 1J6UA 3ONVA 2IYLD 1WVGA 2R8OA 4MRPA 4DM7A 4EX7A 1NC3A 3ZUPA 1H6CA 2PKEA 4L95C 1NR5A 5JNUA 3H4TA 3R0JA 1Z56C 1W85B 4UBIA 2ZYVX 1OXXK 1X86B 2FWJA 4LSGA 3WK7A 4U9HS 1TDJA 3V8QA 4EY5A 4JJ4A 2HYIC 2WK1A 2HNAA 1KJWA 3K35A 4RZIA 3VR5H 3AW8A 3CLHA 4JITA 1OVMA 1TQ4A 4BFLA 5IANA 5HPYB 4Q48A 2DR0A 5ALLA 3AR4A 5C0OE 4LHYA 3T5GA 1KNQA 4KMMA 4CV0A 5CLFA 3OEED 2PKYX 5IDVA 4F4HA 3K1TA 1WO8A 3PGXA 1YAHA 4JKYA 1P1RA 3C6QA 1FW8A 3S2YA 4YASA 4L08A 2Y05A 1BFKA 2OECA 2R4QA 3O26A 3QF4B 5D3QA 1BMDA 5FOXA 4KQFA 2W4MA 4CG3A 3EGDB 1ZNXA 4A8HA 1MHPA 2OHXA 1KHTA 1A9YA 4FFSA 5ALJA 1BDJA 1P4RA 2CZQA 4X1OA 2AXEA 3CRVA 1R10A 3I2YX 3WBBA 1QHYA 1R5OA 1UK7A 1PZHA 2QM0A 1ULSA 3GJ7A 1N3IA 5JECA 4UFOA 3AOEC 1TQDA 4EA8A 4LZPA 3RTAA 1KDZA 1Y9AA 3SYKA 1ZGBA 2H5EA 2IYUA 2CMFA 2W6ID 5HOEA 5JAOA 1Z8NA 1W581 1YOVA 4HQLA 5IVHA 1EP2B 4LTDA 4DWVA 1VMDA 3OKFA 2Z6AA 1QP0A 3UJ8A 1UODA 3WWPA 1D2EA 4CCYA 3HWWA 3QI2A 1J23A 2CDCA 4BBPA 3X1DA 3PC8A 2PGNA 2FUKA 3REGA 4X62B 5TMEA 5FX2A 4A8TA 1O8BA 4BGVA 4IGAA 1V8FA 3LW7A 4CHTA 3S28A 2QRMA 2JA1A 3EUWA 3D6MA 3WL6A 2JJ1A 2YHBA 1HO3A 3INRA 4OV6B 2E1RA 4GZMA 4IIJA 4XWGA 3W7BA 1WJGA 1JEOA 1Y3CE 3E7WA 2CHUA 3MERA 3PFIA 4G41A 5EESA 5B36A 1ZG3A 1K7EB 1BH6A 2YQZA 1BQ3A 3MJSA 4GRAA 4JVOA 3U40A 4NZYA 4BQPA 2IK8A 3WRYA 3ZQ6A 1CQIA 3TZCA 2XXAA 3D5QA 2AVNA 1CCWA 8OHMA 1EK6A 1QVAA 5HJ5A 4Z4IA 1ONBA 4IEEA 3WE7A 5FJJA 4AWAA 2RHBA 2AEJA 1XZMA 3SD7A 2OCGA 1F0KA 2BD0A 1IUNA 1EFKA 4BZZA 1EAMA 2VLIA 1SVNA 2PMEA 4ZT4A 5FRDA 5T41A 3K6SA 5BMVF 4AS1A 1V1MB 4GBMA 3TJMA 1W5SA 2ONJA 2GAFA 2P9CA 5J3JA 2DWUA 2OCLA 3K5WA 5HIMA 4CQMB 4U9IS 2C8LA 1ZSNA 5CFPA 3FTNA 4QDOA 4F3YA 3TEMA 1RAEA 2I2WA 2VSNA 1H93A 3TCXB 3R3UA 3P19A 2VYFA 5FOSA 3RVLA 1DDOA 1I3OA 1KIFA 2CHQA 2P7HA 2D3TA 1Z2DA 3T1TA 1ZVQA 1ZY2A 3FZYA 4QAQA 3EA5A 2V7BA 1QV9A 3TWOA 2ADMA 3HDJA 1BKSB 1ENYA 4L22A 4WESA 2DPYA 5LZ8A 1T9AA 3JASA 4RS3A 4ZAFA 3LUGA 2WAYA 3E53A 4PPQA 4DXAA 2Q49A 2J0UB 1U7UA 1HT2E 1Y7LA 1AUPA 1QMPA 1KEPA 2PG3A 3ME5A 1KA9H 3RH0A 2R1TB 3SBDA 1OV6A 1TZBA 3MTQA 4BZPA 4MZDA 4N3NA 1TO6A 2CE2X 4RORA 3VH4A 3B6EA 4HH0A 4Q1BA 5GONF 2Y71A 5K8UA 3NH9A 1JALA 1P1FA 4KFRA 5J5VA 1Y82A 4M8KA 4OJQA 1FLNA 4KXFB 1U4NA 3QELA 2OK8A 3U61B 3NIWA 4G56A 2BBWA 4G5GA 1R74A 1UDXA 1RI2A 3TFOA 3IESA 4JC8A 2Q5IA 4KUGA 4Z49A 1JX6A 2YN0A 1HE2A 3CE9A 4IDNA 4ODIA 1B26A 5B2EA 1EVEA 1P2FA 2VJNA 2ORED 5NLLA 4XRGA 4MYCA 3WB0A 4FI3F 3KEFA 1W46A 4ER5A 2G17A 5A1JA 2IYFA 1T1GA 5CDHA 4PZLA 1A69A 2YHSA 5BVGA 2XVXA 3K0KA 4NVRA 4TYMA 1ISSA 3VTAA 3RC9A 1QRRA 3DDOA 4MPJA 4K6CA 1E32A 1L1QA 3EMVA 4ZA2A 2NYVA 2AF4C 2JLAA 1ZC3A 3F4LA 3ZTWA 5J4HA 3ERCA 2BFBA 2GKGA 4RC9A 4Z1MD 2JFZA 4LZOA 1XP5A 2W2KA 5CT4A 1HV8A 3BGWA 2FSSA 1XF1A 3AM5A 1JKXA 2QRPA 2DBZA 2GPYA 4GDMA 4XE5A 4EI7A 4PSVA 2FFHA 4HVTA 2AMJA 3VZRA 1LF5A 3TXAA 2XYRA 1B6TA 2FZEA 3ZWCA 1U3VA 3GJYA 3ZWWA 2HADA 2IXGA 1NZJA 4KH1A 5IXYA 1NL3A 3AIOA 4O2AB 5L6LB 3RSQA 2PJUA 1VA4A 5ALHA 1Y5IA 5K1ZA 5C4GB 1RZVA 2EKZA 4K8OA 3Q3EA 2J32A 1QGUA 2Q6KA 1U0JA 3Q8LA 3FMGA 5FOQA 2WMYA 1ZITA 5EUMA 4UDXX 4DXHA 1DIHA 1MC4A 1E2GA 3E18A 3INYA 1ZR2A 3VNVA 1FFWA 4BB5A 1L4NA 2A8YA 3F1KA 4B76A 2B36A 5AHOA 4Z0NA 3FPFA 3BRQA 1H66A 4MP6A 3ZH9B 1NG9A 3U81A 1AU9A 1KGSA 4GG1A 5DEOA 4XSHA 2NZWA 1QTIA 4OATA 3U3XA 1CUBA 1V96A 3PIDA 1ZVJA 3R6DA 4NAUA 4AKEA 4EB6A 5JR3A 3IUSA 4JLKA 2AH5A 1H2WA 2Q3HA 2C82A 5DI3A 3ZKAA 1T0BA 4B79A 5KWSA 4H6VA 4V0LA 3BF7A 3GXOA 4LMBA 1QKJA 4ZKDA 3Q11A 5C46F 2PUDA 1A5SB 4WKOA 2VHZA 4F4IA 3HJCA 3I52A 3NVKI 1YB6A 3ZXIA 5CDFA 1MABA 3NB0A 4H4EA 2CWWA 1GXSB 1M6YA 1SCBA 3FCYA 3KQOA 3Q2OA 4FDTA 1YWGO 2NO4A 2PKQO 4KSYA 1WTCA 1SG6A 2QLBA 4I81A 3L0OA 4L2IB 4KLAA 1P5JA 3OT1B 2QD5A 4OHYA 2C4VA 4C4XA 4F46A 3H5OA 3H65A 1C9YA 1UPXA 4NPCA 5AJWA 3TE7A 1FTYA 5D8DA 4EO4A 2BFDB 2HEGA 2FEPA 1U5AA 4LV5B 3LPNA 4DWWA 3QF7A 4D3YA 1Z0DA 2XR1A 2OV4A 1L8LA 4E11A 3CEAA 4UJ5A 1A1VA 4BU1A 1ECLA 2I66A 2JGLA 2J4CA 4E2XA 4CMGA 4XD7A 1O97D 1CRZA 3ZGOA 1TO1E 2D13A 3ILXA 3DZIA 5A3JA 4OP1A 1TLLA 2G70A 1IEVA 2AYYA 2A14A 1GZ3A 1QYVA 3O47A 1A8PA 4FFPA 1B93A 4AL4A 1GAEO 5CURA 4IJMA 2X7JA 4TUYB 5B1SA 4KPGA 4DSAA 4L0CA 4DIKA 1AZLA 2CJXA 3HN6A 4YAEA 1JSLA 2ZDGA 1WU7A 2WDPA 3B5JA 3E9EA 4KO1S 1TIBA 2MIIA 1QG4A 2AHOA 1JFLA 3VZQA 5HUHA 1RRKA 2DUNA 2V54A 2F9LA 4MOWA 3S29A 9ABPA 1CX9B 1NRXA 3VPAA 4BNTA 3LYHA 3DTVD 2M6SA 2ONCA 3E0XA 2RH4A 3GT4A 5D01A 4QKQA 5SV2A 1OJLA 1SUWA 1SK8A 2WG0A 2XWSA 3FYTA 1U3TA 5TQ2A 1EEXB 1LRKA 3CV3A 5CH5A 2XQVA 5I9NA 1N1EA 1OQAA 3QENA 1LQ2A 3L8DA 4EUKA 2WFMA 1CY0A 1GG5A 1HF3A 1DELA 2AG8A 3ONWA 3U4IA 4JJ7A 3RM3A 2YY5A 1W1IA 4OCZA 1NUUA 3HCAA 4BL5A 2G9NA 1W7AA 4ZI7B 4D9BA 2UYHA 1U9YA 3BMQA 3ONEA 4M1OA 4EUNA 4F3NA 4HAYA 3MXTA 3BT7A 2O8CA 3HBLA 1M2VA 4D8XA 1KZ1A 2AL7A 3TKAA 4EHAA 3M6XA 4A92A 4GKAA 4ND2A 3UCEA 4M60A 3BSSA 1U7WA 3EWSA 4UUMA 3RRFA 2UZ4A 5F98A 1SJ9A 2WJJA 5DN6A 1Z7WA 4L5AA 2DFNA 4CM8A 2PQMA 4OQ4A 3R3WA 5I9SA 3RFCA 1KP2A 1U3DA 2Q2OA 1YL5A 2G1PA 4PC7A 1E7RA 5DNCA 1DKNA 2Z9BA 1NJ1A 2DYKA 5AKZA 3Q40A 2I6FA 1H2ZA 1NMYA 2ODTX 1FXWF 1G5RA 4TM8A 3SYMA 3RVRA 4D9HA 4ZXFA 1S4MA 3W6NA 5JAZA 4W5NA 4INJA 4PX3A 1PE0A 2YMPA 3LY5A 3VTFA 1QHHB 2PWZA 2HMTA 1VGVA 3AEKA 4Q3KA 5AUQA 3ADDA 4YRMA 4ZVVA 3H5VA 1RXSA 5DOVA 4CVNA 4ZEWA 1EGQA 1PR6A 1JHUA 1GLVA 2IY9A 4YRRA 3E1SA 3L7IA 1LGYA 2GILA 2PZKA 2Z8YM 2IV7A 3HP1A 2IZ0A 2QMYA 1QAMA 3FYUB 3H2KA 5BMVA 1AMOA 3D3JA 4WDRA 3IMCA 1C7JA 2JH8A 4ZDIA 4ZP1A 2Z5VA 5CRIA 4PYLA 2A88A 1KIAA 4LNHA 4R9UC 9GPBA 1J07A 2ZWOA 5JBNA 1A1SA 3LFTA 1D1PA 3V1YA 1W4AA 3HDGA 3MQ2A 3W5VA 3RK4A 2UUAB 1DQYA 2JHPA 3IP9A 3NBKA 4HKTA 3WLJA 2P9FA 3F5DA 3KL4A 4ZVKA 2ROQA 2YYYA 4LXTA 1PV4A 4AQ7A 2AZXA 3W7AA 1DQNA 3PUIA 2NSYA 1C3LA 1P2DA 3TSYA 4ZJUA 1CFJA 5C2JB 5LQCA 3MOSA 4URFA 3OWOA 2RFLA 4CF6A 4CU2A 2JIZD 4PHCA 3GLHE 1RTKA 1TMOA 2ACVA 1R9JA 1K5HA 1WXQA 2QYHA 3IJRA 4JT2A 2IODA 1VE3A 5LMZA 2J3JA 5LD2B 2P9YA 4Q4JA 3B20A 1JLLA 5A4MS 1P1JA 1L5SA 1OBFO 5GONA 1NAHA 1RLTA 4BMYA 1KTVA 3RQSA 3I2JA 3DS8A 3KJZA 3QYJA 4K6KA 4GKVA 1JNYA 3HYCA 4FHCA 1NBEA 4NMXB 3FSRA 3H3XA 1NQ5A 4MUEA 5IXJA 1DT5A 3ZD7A 3N6XA 1HLPA 3AP3A 1FSFA 3BMXA 4WXHA 1W4RA 4X1YB 3ESDA 5ALWA 3LXUX 5TX7A 5C7LO 2O8DB 1YDFA 2H4YA 3W8RA 2VHVA 1TUBB 2ODAA 1VLQA 1TPYA 4RGYA 2P4QA 1LPBB 2C2BA 4JY7A 4A5SA 4AMUA 3GCZA 5C7OO 2WSMA 3OQIA 5CUQA 4DTCA 1E58A 1E4EA 3SQLA 3K8QA 3TLKA 5BN5A 1SCIA 2JB9A 2A0YA 4K9OA 3T38A 1XZPA 1CUHA 1UJBA 4RENA 4UTXA 1O08A 2VCEA 3DFIA 4Y2XA 1AVTA 1TZJA 3TW6A 1IBLB 1JU3A 1P4GA 1U8YA 2AJDA 2PDAA 1FFCA 3DVSX 3K09C 3KOYA 3L0CA 3MT0A 4KNVA 4QPCA 1I4LD 1X19A 5CTJA 3OZTA 3THWB 2GDZA 2P3QA 1CW2B 1PEYA 1H8HD 4IVRA 5E3IA 4C4AA 2QRVA 3BL5A 4ZYTA 4K87A 1OHHA 4OHVA 5CM9C 2ST1A 1JAYA 2OPBA 3GU3A 1NW3A 2C61A 4HYQA 4X60A 5TGZA 1ACLA 1XXLA 3AEYA 1YZUA 1N0UA 2HAEA 4R8RA 1KK2A 1ZJ4A 1HQYE 4DWJA 3OEHA 1BO6A 1TF5A 1Z2PX 2CVZA 1K6EA 1N6OA 1QCZA 2W4IA 5KREA 1PT5A 3L49A 1NUPA 3MJCA 1SR8A 2QQGA 3P0HA 4LRYA 1J8FA 2HF7A 2OYRA 4BLTA 4MUFA 4YDQA 2TYSB 3PT9A 1W5TA 1ODKA 2P11A 2PSFA 4CJXA 5LZ5A 1E6LA 3KDAA 1PZMA 3QI7A 4LYHA 4R84A 2ZKIA 1GGMA 1W0KA 1L7DA 4M0FA 4NU6A 4HEQA 1UFOA 3D7NA 2RK4A 4UEKA 1O0SA 3WBKA 2BEUA 1L7AA 1NOJA 2B0JA 2EFEB 2O52A 4RYDA 5SZJA 3ZGVA 1C9EA 3U4AA 3FDIA 3NM4A 1TVMA 5CP8A 3K9WA 4CFZA 3FRHA 2BJHA 2RGDA 3FGNA 1H2XA 2BDTA 5DJ5A 3QJYA 3ZU5A 4R0VA 4BX9A 4KGXA 3DZCA 3GFPA 4ZIRA 3A0UA 1ZC4A 2B4TO 5D51S 1IWPB 4BQIA 5HKKA 2ZU0C 2CLFB 2YWFA 3OU7A 2UV8A 3GRAA 1LLUA 4TYQA 1FFHA 5HTKA 4CMIB 2XQIA 1SU4A 3TI9A 3P2IA 3DKIA 4EF5A 4Q7EA 3AIIA 2VXCA 3O82A 3UJNA 1SXJD 3MYYA 4Z86A 1EFDN 4R9NA 3H84A 4CBVA 1GFZA 4I8XA 4PGMA 4Q3OA 1Z5PA 1DUIA 2X4DA 4YV7A 3BTVA 4NMLA 2AEMA 4GE3A 5CLQA 4MV6A 2R00A 2GHRA 3MTDA 5B12A 2VBIA 1YHYA 1QVRA 1CE8B 3ND7A 1X1SA 4YYEA 1I30A 3DBRA 1JHZA 3RWBA 1VZ3A 3VR4D 1YQQA 4R54A 3USCS 5KYNA 2JLRA 5LZ2A 2HFJA 2GNOA 3K1AB 4I99A 5D3MB 2WHPA 3B3JA 2BFWA 4F5WA 1VMIA 1DINA 2DTDA 3FOFC 4WLUA 1XDWA 2CXRA 2DQ4A 3BQNB 3T7EA 2QBYA 2J6IA 5BRNA 3I72A 4EGSA 5KC9A 1YS7A 4HGYA 1E1YA 2FPPA 4N39A 3Q15C 2PQ6A 4YUVA 3T0IA 4CIXA 3T7RA 1SXHA 5HQ3B 4QSMA 1CHNA 3WB2A 4IIDA 4DLUA 2I6UA 4E88A 1IU9A 5AHWA 3LX8A 4QWMA 4AC9A 4X94A 1QJCA 4DDWA 4MEJA 2EKPA 1Z4NA 1DRKA 4UCXA 3G9UA 2I2XB 2A1TR 2B5WA 1UPUA 1P9WA 1YRYE 3UJ6A 2HF2A 3I8OA 4MV7A 4GVXA 3WKCA 3B2NA 4G0OA 3EDMA 3G9QA 2NYRA 1ZRSA 4RNDB 2HW8A 2FETA 4MV4A 1WOYA 2QUAA 3AG6A 4BTLA 3MGCA 1RXWA 4MMZB 5CVUA 3T4UA 4DG8A 3RC8A 1TT5B 3RJ5A 5CX1A 4GIBA 3HY3A 2AR7A 1CR1A 1NMEA 3I9NA 3Q1LA 2W6PA 1Z34A 2JAHA 3I30X 4MAFA 4EB0A 1QOPB 1VCHA 5IBPA 3A31A 3SIWA 3IR5A 2PKCA 4KZKA 3A36A 1DAEA 3UWDA 2VQSA 4DYHA 2FX2A 3W6UA 1N5JA 3LX5A 1HUQA 2OENG 2D00A 3B38A 1AH2A 2FPXA 4YP7A 5L7WA 1XL1A 3OIUA 2IU0A 3OZWA 1A76A 4OK5A 2RGNC 3G0CA 4HFMA 5FR1A 1X1RA 4MMXB 1WAMA 3RUDA 4QG7A 3HB4X 4FMDF 3DMPA 5FUBA 5SYAA 4O2RA 1FXWA 3DB1A 3DO6A 2RHTA 1MB9A 1NVVR 3L40A 1ZD2P 2ZRGA 1W5FA 4YT5A 2AMVA 4A27A 1Z8HA 2XHEA 1Z38A 3KE8A 3B3QA 4YX9A 3E8XA 4JYBA 3UQYS 4PIPA 4RIGA 1KEUA 4OKIA 4QPPA 3GAFA 3L6BA 2FP3A 4R2JA 5DNWA 1GPBA 5L4LA 4LF9B 5K3CA 4P34A 1R64A 1YB1A 1SZPA 1TYCA 2F59A 3LQ2A 5IBQA 3TQTA 1XQXA 3FCEA 2NXEA 3PQ2A 4RY0A 3EXFA 1UCFA 3NIDB 3ZEIA 1A5AB 2Z8ZA 1Z4OA 4MA5A 3MEQA 4DLBA 2QD1A 4AQDA 2BUAA 3R09A 3V4FA 4C6TA 1I4WA 2ISCA 2IPOA 3C7AA 1QCDA 1CNEA 1BE1A 2HIHA 1QZZA 1LBTA 3DZFA 2O8VA 3AR9A 4LC1A 1VPEA 3HLKA 3M7IA 5L7YA 1Z0AA 3HR8A 4I3GA 4S3MA 4E33A 1DQSA 1ORIA 2C0CA 2ZAMA 3CX6A 1CD5A 2PT7A 3B78A 4UAGA 1P1BA 5DU2A 4DV0B 5IEBA 1NWHA 3C15C 5JNVA 1UXJA 2Q1XA 2J5KA 1TFUA 3RIHA 4OI1A 1S8NA 2JD2A 2OORC 3I39X 3IEUA 3ITKA 4NDZA 1SXIA 1M1NA 2AMYA 2IHUA 3B3FA 3SKYA 4A8JB 1XB2A 1IY8A 1JG3A 4D9IA 4DRZA 3JWGA 2QY9A 3MUFA 1HDXA 4YP6A 5LCXA 3P9YA 4ASUD 2QMEA 1VLVA 1PFGA 2ECFA 3A10A 3JYQA 2B2CA 2HDNB 3K20A 3PZRA 3UUFA 4K0KB 3FMVA 1MG5A 3L5KA 5KDDA 4H3HB 4M3NA 3NBUA 4OQDA 3RFUA 1UQUA 4X1KB 1QE3A 2A9KA 2QX4A 3G1UA 1M2JA 2QXUA 2WNHA 4AJEA 4LVNA 3IV6A 4FEGA 1OA0A 4BO9A 3ZHXA 4E51A 1HOXA 2Y77A 4BFYA 2F7SA 4OHOA 1JIJA 4DNQA 3RIGA 1T1RA 3L9WA 5DWQA 4J7AA 4HK4A 2DQZA 4EJFA 1JIQA 3DNFA 3WJ7A 2AGVA 1F51E 2C83A 4KE7A 1CF2O 3KR2A 4BZQA 3EULA 1YI1A 3H2HA 5ALSA 1NOKA 1XPRA 3EGWA 3D64A 1BGWA 3F7OA 3FNRA 3KX2A 1FFGA 3TRIA 4KSCA 4JQZA 2VG8A 3AF1A 4G5HA 5AWFC 1PT6A 3ZE9A 2HJSA 1GUFA 1RHKA 2CY0A 3BWBA 1V7QA 3GEDA 2JANA 4L28A 1BCRA 4OL0A 5DX1A 3RYFA 3SDZA 3WL4A 1ECFA 4RPHA 3U13A 4DCOA 5IUJC 3DVAA 3SNHA 3FAKA 3RU9A 4JI7B 1D2MA 1K89A 1GLNA 1Z6ZA 1QVWA 2UUPA 3AFOA 3I4LA 3H17A 4MWGA 2UU9B 3LX4A 4J7UA 1HL7A 3MGBA 3S99A 4KR6A 3JQGA 4L3WA 4MS4B 4BNUA 2OYCA 2YASA 5A4DA 1JDBC 5K3SA 1QVVA 1ECGA 2P67A 2Y27A 3VNRA 2HL6A 1QIIA 1II8B 3BFJA 4YJFB 4L9RA 1ZOSA 4TKUB 1OLSA 2OE2A 2W7TA 3LI2A 2CDRA 1GPWB 2NW6A 3GH1A 3P9XA 2E49A 2QTRA 3E7XA 4Z9BA 4FYXA 3RPEA 1N6PA 4DUGA 1DARA 3KYJB 3LQRA 3U7RA 1J0BA 4FPXA 3GVCA 2Z4SA 5IKMA 3F96A 1TK3A 2W48A 4Y1RA 4JOBA 2Y1OA 2R2AA 4GC9A 3PHHA 3WWDA 3ZGYA 1ZM2A 3K72B 3AILA 2FWBA 4B4VA 1ZUNB 1A98A 4EZEA 5BN4A 1U2GC 3UUWA 1T2DA 1M34B 3TDMA 3L1IA 1OYOA 2HWXA 3FIUA 5DISB 1G9TA 4DT1B 4ETMA 5CCEA 5JPIA 1Z4IA 2PWAA 2R8PA 2VJMA 3D8SA 4L5IA 2HH9A 5DT2A 3RTCA 1P4HA 3AOEA 3IL2A 2W8BB 3ST7A 4GT1A 1GQYA 3EVAA 5NULA 2ZBPA 2I9KA 4HQ0A 3MBIA 2O50A 1LQUA 3SEAA 3V00A 1ZJYA 1CRQA 1J8YF 2GVNA 5HX7A 2HJ9A 1PYGA 3Q5DA 4YT2A 1GFSA 2DSNA 2N0SA 3SC2A 5C81A 1Y4UA 1XWWA 2A92A 2FPUA 1V16B 1H2YA 3I5MA 3NWOA 4IO1A 1STOA 5CA0F 2GYWA 1JHPA 3VPDA 2FMIA 1C4KA 3TQFA 4DRXB 2C7BA 3CBGA 3BXOA 5REQA 3OI7A 7MHTA 3BILA 1JECA 1MGOA 3K0FB 4IFTA 4TWZA 1U7ZA 2WU8A 3IHLA 4BCDA 5MN4A 3UPTA 3V8MA 1FYEA 3CB2A 4ARUA 3CF4A 3OF3A 3FB4A 4INOA 3UMRA 4EA7A 5A03A 2IU6A 4C0LA 3WMFA 4AKHA 1WW3A 1OC4A 1XVIA 2EKLA 1UWVA 1OIVA 2XI4A 4JOSA 3N6VA 2O8BA 3B6JA 3JU3A 1J7KA 4LG1A 3FLEA 1V6CA 5KTYA 2N75A 1WPRA 3B9RA 2NZYA 5FTJA 3ZGLA 2DFPA 1RXCA 1VCNA 1W76A 2I54A 4EO9A 2QT0A 2XNDA 5B1DA 1GP2A 3ORRA 1K4MA 2BCGY 4OL9A 1JKJA 1U8XX 5C5IA 3MUEA 4RIHA 3LPDA 1RAAA 2HK9A 4RVGA 3IEMA 4MKIA 1SEPA 4NXMB 2OHGA 2BMDA 3OESA 5KCMA 3VYWA 3D6TB 3EQZA 5EP1A 4CFYA 2QORA 3C8ZA 4RJ2A 1TM3E 3BICA 2IH4A 3DLBA 1JLKA 1RC1A 1K92A 2GFIA 3MJEA 1U0SY 3O7WA 1VHQA 2WKSA 4BUCA 5BWLA 3UVEA 1R12A 2XUPA 2JGNA 1FU7A 2FSVC 1G17A 2I1WA 1GZ7A 4G5RA 1GARA 4TKMA 2D2VA 5WRFA 4E31A 4QVGA 5KVSA 4H3KB 3L1KA 3EC2A 4D9KA 3EDOA 4S1TA 4BRWA 3P0RA 3GLFA 1X3LA 3FZNA 2J7PA 2PTHA 4IIBA 3BKWA 3BXHA 4R1PA 5LMNB 2WWXA 2F8MA 4N0EA 2H0AA 4LJYA 5IK2A 4YPOA 4G97A 1ZL0A 4LJLA 2YJ6A 4L4RA 4PQRA 5D1HA 5JALA 3N7UA 1VBNA 2DZDA 3QFCA 3QH4A 2GD0A 5DTEA 4GP9A 3TJRA 3OM8A 2QOEA 2XZLA 5C5DA 2FSIA 4TMTA 4TQUS 3E9YA 4OHMA 3WZ2A 4OUDA 1K7FB 4Z4FA 4AF6A 1D1QA 4JP5A 5ALKA 1ZJ6A 3DW3X 1WDKA 4TTPA 5GJWC 4QQNA 4Y6SA 1T5LA 1EWTA 3TG8A 2DETA 3NEJA 4O4IF 4HXFB 1Z4KA 1GKKA 3CPHA 4ALKA 5JE8A 2WZQA 3KIPA 1SO8A 4F9GA 3A6LA 1CZHA 4DLZA 4RVSA 1KEEB 2BKXA 3NUGA 1ZUD1 4Z9YA 3T5PA 1UKEA 5I7OA 2JLWA 5LM3A 2YYZA 5KTRA 2BF4A 2RJOA 1E1RA 3PDUA 4XKJA 5F1YA 2PD6A 2Y1XA 3H2BA 4J6EA 3TTVA 1H8EA 2I4LA 3G9TA 4NBTA 1GPH1 2MYNA 4OK3A 5BW5A 1Y3DE 4LF4B 5H8WA 2GKSA 2PX2A 2H17A 1GDHA 5IJ0A 1HK7A 1QX3A 3QHPA 4JIGA 3ZW8A 2A94A 5TY0A 4UZSA 4BQRA 3KPJA 1JR3A 2REQB 2AEFA 3N2KA 4ZVNA 3ZBPA 3PTAA 3HU2A 3V8NA 1PEDA 3KVYA 5A9SA 3PXDA 2IIQA 1JDPA 3D6AA 4UPDA 4DIDA 5K8CA 4FUQA 3BGOS 4LNUB 5K0TA 1JWLA 2DY1A 4O4HB 3GLIE 4PZCA 3UIEA 5KJ6A 3VTZA 1L7VC 4IHKA 3LYUA 4AS3A 4BEJA 3JV7A 4YT4A 5TXGA 4QOFA 5HWSA 3NPMA 6YASA 5TQVA 3GPBA 4P5EA 4XM0A 1GDDA 4YQEA 5AVJA 4BNFA 3OPMA 4CM9A 4C4PA 5ICMA 2GM9A 4GXTA 5IWCA 1TTQB 2I5PO 3DFMA 1EMDA 3KXPA 1NBIA 1MQAA 3OD5A 3PHJA 1ML3A 2OUKA 4EY4A 3P7MA 5CFNA 2FWAA 4ZYZA 2XMZA 3WFIA 1TMGE 3FKSD 4J03A 4Y9RA 1ZIDA 2VTDA 2NNLD 4IGFA 5EWLA 3MK31 1LPSA 3TSAA 4IIEA 4J8PA 4DB2A 2Y8EA 5BW6B 1ISHA 3LCVB 3DEHA 4RPGA 1JXAA 2ZR0A 4U02A 3ND5A 5J5AA 3D0QA 5IWAB 2BR3A 4PGAA 1O96A 2NSLA 5AYVA 3ZHQA 3GHHA 1RC0A 2O2GA 2X2FA 2F90A 3FOCA 1CQIB 4HXEB 5EQDA 3ZTTA 5JFTA 4MVXA 4FFVA 4JT9A 2PL1A 5KKAA 5JXHA 4MQ5A 5I9IA 4A6DA 1TI7A 4M88A 2MT9A 3R4VA 4FMCB 1OWOA 3UA3A 1WU8A 5C31A 3SNKA 5H9WA 3L8YA 2MJLA 1JR6A 1Q3TA 1VHDA 1DX9A 1N9GA 4KITB 2JGDA 5LQMA 5TMPA 1KYXA 1TPZA 2FRVA 2R1ZA 2ZRBA 3W3AA 1ADGA 2L17A 3LKDA 5GOTA 1CK4A 1RS0A 3LY7A 4IUDS 2CFIA 3UTDA 2HSDA 3WQBA 5G53C 2DT5A 2DT8A 3GRPA 5EIFA 2CMDA 5JMTA 1B6GA 2VZEA 4F1JA 1E1QD 3H5IA 1OSNA 1J22A 4TMFA 2JATA 4WESB 4E2WA 2I34A 4NNOA 3MOIA 4RACA 3ORSA 4NESA 3LU1A 3CCFA 4Y2UA 721PA 3TM5A 1KC1A 1K27A 1P1HA 1YS1X 2WJZB 3AEXA 2FVXA 4LBVA 1SHKA 3ZHVA 4PRKA 4JYCA 4O4JB 2OXIA 5B64A 1NKSA 3V8EA 1ATZA 1BD3A 3IDFA 3ZVRA 1DBWA 3EPKA 1OB5A 5KQSA 4PLZA 4RBNA 3TR6A 2BH9A 2AX3A 3DP9A 4OYHA 5GWXA 5D84A 4B3XA 4E2FA 4PXAA 4EGFA 2GS9A 3BL8A 3FCXA 3QW2A 4W7SA 3KZNA 1EP1B 5EHGA 4D82A 4B47A 4DR3B 4ISBA 1RQLA 4MQMA 1B43A 1RWXA 4KW7A 4UHHA 3D81A 4Y9TA 5K4AA 3B82A 4P3XA 3UYKA 3VYVA 5KHOC 3JQRA 1CRWG 1I6WA 4RTJA 1RSZA 2IS6A 3BIJA 3FSEA 5J23A 1Z7BA 3CWCA 4V0ME 3V4LA 2WOJA 3UJ9A 3D3KA 4LGVA 1X7DA 2JGAA 4DQKA 1WSAA 5EXPA 4PLCA 4ECAA 1MEJA 1NUTA 1C0EA 3K8YA 1VYHA 4LQCA 1PL0A 1SVKA 2BFBB 1DGQA 2W2KB 4L1KA 1LB1B 1P18A 1KR2A 1U9IC 2A2ZA 2GJKA 2OV6A 4D8UA 2C04A 2J9ZB 4LUCA 4N7BA 1Q0LA 1ZK3A 3U1BA 1UBTS 1PV1A 3K2EA 2NXWA 3H2ZA 2OBFA 3QM1A 1S01A 3OTOB 5A5FA 4JLDA 1YULA 2BGLA 2HBYA 1ZRHA 3DJFA 4YH1A 3RD5A 5I7EA 2LDXA 1EA7A 2RCNA 3FHJA 3HCBA 4M36A 4I5IA 4EPTA 4EY6A 5BRAA 4Q3NA 5BN3B 4KI0A 3MWKA 3UWOA 3BFPA 1JG4A 2V5VA 3HSYA 1QGUB 2XZTA 3DHNA 1LEHA 1GEGA 3L8ZA 3RFVA 5CDUA 3EGXB 1V1RB 4RTNA 1MH9A 2XRFA 2XIJA 3FPHA 5C1IA 1H3FA 1RBYA 1HURA 2UZAA 2YQ5A 2JCBA 1W5BA 1UANA 2GVDC 3E9ZA 3D0RA 4RZHA 5I3CA 4HS9A 1ADYA 2JGMA 2FW9A 3LY9A 3ZZ0A 4ES6A 3W77A 5A3SA 3STTA 3VC1A 3BDVA 3MTAA 3SYTA 1KVUA 1KXJA 2OHOA 3B1FA 4PZDA 3ZJTA 3F6CA 1FUUA 3O5AA 2OZVA 4G1VA 1HEUA 1KO4A 4RKQA 2FPKA 2F1IA 3ZDBA 4J6FA 2G40A 4Y2PA 2O8EA 1QAOA 1JMVA 3HFSA 3U9SA 2O48X 3KB6A 3NVMB 1GPJA 1THGA 3AFGA 3BSYA 3F5FA 4F2GA 5FV4A 2XITA 1VJRA 4B45A 1T0HB 2XRZA 4GDFA 3IT2A 4LC0A 4I6GA 2B98A 4I9UA 3PNYA 1ESNA 1M7GA 4YAUA 1NV9A 2EW1A 2X40A 2MSLA 4QJ5A 1XRLA 1LI7A 3MXOA 3OC0A 3C1TA 4HTAA 5B37A 1MTZA 2ID9A 3ICOA 1R0XA 1KZHA 2GLXA 3A04A 3THOA 1EXDA 1NE7A 2OXTA 4YCLA 1ZUIA 1UIMA 3KOMA 3FHOA 2FEXA 3KZKA 3P9IA 4Q9LA 5AI6A 2JLVA 1XYYA 1VI5A 2Y6UA 2TECE 3KO8A 3HG7A 1S3FA 4M8IA 4NOLA 1RIIA 3I9FA 3OF5A 4FKBA 1SWWA 1EUDA 1NG1A 1I1OA 3EMKA 4O4IA 4BWFB 4OHPA 1YRLA 4QFBA 3A1NA 1V4BA 1UJ2A 4FK8A 1PS9A 3WHPA 5TT0A 3NR2A 4CV2A 1WOMA 1OIXA 1P77A 2W71A 3DOOA 5DTMA 3PNOA 2XCIA 1VTKA 3LDGA 1C9JA 1VJ0A 3WAGA 1AURA 4YR7A 3LT2A 3TLXA 5L95A 4BCBA 4PO3X 5KSPA 5IF9A 1TXGA 2D8MA 4QOEA 3VKHA 2I0FA 5CDTA 1M2EA 3BEOA 3VVLA 3WYNA 4LFCB 5AW4A 4DJFC 1QSGA 2R48A 3PGKA 5L3SA 3C6MA 1CYEA 1FYDA 1JHYA 3HHEA 3FZEA 2VCYA 3JD1A 3KKLA 1C5KA 2VHWA 1L4LA 1O97C 1SUAA 2G63A 4MGEA 5HOQA 1NOIA 2OVFA 2RCYA 3IS3A 1XZIA 3OOWA 4RF5A 2IKQA 3BMOA 1RLMA 3LDHA 3DC2A 4FZRA 4DLVA 2CFCA 1U2PA 1D6MA 3TLGA 2PT6A 1CC1S 4LYFA 1CETA 2DRIA 4I1SA 3SHFA 3I64A 2WA1A 1Q83A 1JEAA 5FBVB 1NUQA 2WJVA 4FQ5A 1QF6A 1AQYA 3NHRA 4PSDA 1I3KA 2DUUA 3EIEA 3NKFA 4W9RA 1HFJA 2YWGA 3L7YA 2EZ9A 2XODA 2SCUA 4MYHA 4CM4A 3TZQA 3UWPA 5IDXA 5JRJA 2R6DA 2FRXA 1HQDA 1T24A 3PRKE 4LXXA 2KBEA 1BAPA 1XBTA 2R5WA 3A3NA 1F5SA 2GM3A 3I05A 4G4IA 3E6AA 4UNIA 5CLGA 1WNTA 2JZCA 3SXUA 1ZOPA 1EYZA 3SQOA 4Z9FA 5J2UF 2VPIA 1L5FA 2VUSA 4UHJA 1ZCBA 4R3WA 4ZCMA 2V0GA 3AEKB 3IUPA 2CV1A 3WGTA 4NZMA 3H7AA 2QZZA 3CUSA 1F8FA 1TYAE 2A7QA 3R5JA 2WYVA 4IR7A 1UPTA 2Q1TA 2B1IA 2EKQA 4QQRA 2VPQA 3LRTA 4BVAA 2MMCA 4NCBA 1YR7A 2PS3A 4Y2JA 4WLEA 1KH1A 3DHWC 3CZRA 3NCHA 2C5GA 1DX4A 2X0KA 4PYNA 1VL8A 4QICA 5BMVB 2OY0A 2QXTA 1SUBA 2B3DA 2ZDHA 3L0IB 4PLGA 4D25A 3HZHA 3DWGA 3KJQA 1RQPA 4MVJH 2CUNA 3GG2A 3OLXA 5HR5A 2C4TA 3GEIA 5CVEA 4ER7A 2E4AA 3KEOA 4EG0A 2CKDA 3CH6A 4M0DA 3I2GA 3K9NA 4M9SA 4MX8A 4LF6B 4CEIA 1DZ3A 4PZUA 3FBWA 4CHGA 4BNWA 1IHPA 4IMIB 4OREX 1B76A 1BCSA 1O8CA 2H92A 5FTWA 1T2FA 3U49A 1SGWA 5BOSA 5MFPA 1FDTA 4C3UA 3MHTA 3MJFA 5L4SA 4RTQA 4WX2B 3IMEA 3NATA 4HMPA 4BFZA 3JQBC 1JQJC 4A5OA 1TCAA 1U02A 4XWKA 2XUIA 5JPCA 3TTUA 2CHFA 1II0A 1AKYA 2VDWB 4Y8VA 1BC5A 4NV0A 2VUHB 4D44A 4LV8B 4JA0A 3R5XA 4ID9A 3WP0A 4B6SA 1KWKA 3PL5A 2PEZA 2F4VB 2AK2A 1SOVA 1KQPA 1XF9A 2B4YA 4C01A 1AQNA 3AUYA 3CQ9A 1E0DA 2PMFA 3KXKA 4DC1A 4DLNA 2PUGA 3T06B 2ZRCA 2XMDA 2ZYHA 3R6TA 1GL7A 2GN9A 4FOSA 4FWTA 2FDCA 2QP9X 3ZDYB 2ZB8A 1PFWA 1Q1EA 3PNPA 1H2RS 3OQIB 3QOWA 2DB3A 1GU1A 1N6HA 4RMJA 1SCKA 3KSMA 1CVRA 2R8XA 1ZJJA 3DE5X 3BWDD 2Q4DA 3AZPA 1UBOS 3FF1A 4NI5A 1ILEA 2DOKA 3LGSA 2QTFA 2XZOA 4YCCA 3GGPA 3VU9B 4EX6A 2ZUWA 3NYQA 3JZMA 4H2DA 2RGNA 4OAPA 2VR1A 2P5SA 3I53A 2KPOA 4HL6A 4I1YA 4AJ2A 1U0GA 4EKIA 1FL9A 1MX3A 3FHCB 1Z36A 2JNWA 2I4IA 2ZIFA 4M38A 1UBKS 5HFJA 2VWQA 4QVIA 3B9QA 2FR0A 2E37A 2B1RA 1OB2A 2P5UA 3R9IA 2OQ2A 3GMSA 3E22A 1MRNA 4NZNA 4E5PA 2HPVA 3QV1A 4O08A 7MDHA 1XI2A 4RZ2A 3VJLA 4CL0A 2IIVA 1ZNZA 3PLNA 4F7DA 1NXOA 2PZAA 3JQ7A 2R3SA 3K5PA 1A7AA 3FUVA 2XD9A 3U3KA 2YMQA 4HB2A 3OIFA 1MC1A 1QO9A 2TS1A 4CQMD 4AFNA 4EUEA 4QAJA 2XMQA 2O3JA 2OO7A 1EQAA 2WQ6A 1XQWA 4CETA 4OB6A 4ZQBA 2XPCA 3VKFA 3LCMA 4HXYA 3TE6A 3REOA 1UPAA 2D1QA 4NLLA 1QXSA 3IDZA 4LQ4A 2ZBUA 5DWDA 4RHFA 2FE4A 2GAJA 2ECOA 4HQRA 4CKWA 3OQVA 2AN4A 2QHXA 1HYQA 4Z9XA 4KK3A 4OAQA 4XVRA 5HXAA 4C1NA 4WNIA 3KK0A 3RREA 1CEXA 4OMFG 5EJFA 4X5OA 1L7NA 2OORA 1H22A 1S3SA 4I50B 4B0PA 1DTEA 1Q0TA 4BIMA 1DQRA 2RHDA 2PL3A 2IYQA 5HUJA 3T3DA 4BZWA 1W75A 3FNHA 3HJGA 2D3WA 3L1VA 1J1UA 3BAZA 2ZJ0A 2CNKA 5K0ZA 1XMQB 2JFQA 3HXTA 2FYTA 2BKUA 3GRKA 1MGPA 2ZS7A 1WL8A 2QW0X 2WHPB 1HG1A 1JJIA 1Q95A 3F8TA 4FNOA 4G2TA 4G5QA 5DKFA 3WWEA 1Z2CA 3NAQA 4JDPA 1AM4D 1E3WA 1CY6A 1HC7A 5KAPA 3AIMA 4H7IA 5IVIA 3FUXA 2IIBA 4GD3Q 4RXUA 1DAFA 2BTQB 4MW9A 4YECA 1EUQA 5F12A 1CZNA 4FHGA 1T2VA 5CT5A 3WX0A 2XD4A 3AU9A 3GH3A 1J97A 1K3UB 1ORTA 5L53A 4M87A 5CU7A 1EA5A 4JNKA 4PONA 4FYYA 1ADJA 1XU7A 2W00A 3N86A 4HOYA 3QGMA 1SY7A 1VE6A 5AICA 1GGEA 3GOHA 4WNCA 3PFBA 2WJWA 1R37A 1L1RA 2LDBA 4KQ2A 3U48A 2K2QB 2H9IA 2NM0A 2PXCA 3HP4A 3ICPA 1EZ4A 1YQUA 4DIMA 1XZHA 1HTTA 1Z2EA 4MEAA 2B4RO 2JFPA 3PEFA 5EUQB 4WDQA 3UJ3X 5JU6A 3IPXA 1SD5A 1TYZA 1KI6B 1M83A 4L5BA 4OHWA 3OE7A 4F3KA 3LCUA 1Y6RA 3CZPA 4PIMA 4DLTA 2V58A 4EKEA 3JD0A 2LCQA 2GPBA 1JI0A 4E3ZA 3CG0A 4QYWA 2EIHA 1H3NA 1YXMA 2VK8A 3QTTA 4QU9A 3BORA 5JH7F 3KEQA 4GMDA 1Q16A 2JHCA 2CFOA 1UBUS 2P3LA 1Y3BE 3E9NA 4N0PA 1CSEE 2OXFA 1X1BA 1QNLA 2GQ0A 3WQSB 3B9PA 4PR3A 2RH5A 3UMVA 4HDKA 4AZ3A 4DCUA 4L8GA 1T3GA 4IIVA 3L3BA 5E3JA 1TKBA 1GTSA 3NXSA 1JQ3A 4BLOA 2HY7A 1L5ZA 2G9RA 2XRYA 1ZK0A 2D4HA 3EGOA 4N9WA 2IELA 2WF5A 3QP9A 3BBLA 4YJ2F 3TOZA 5DTIA 1W6UA 4FNMA 4FVTA 5AW0A 2NNWB 3Q9UA 3QEJA 3R23A 3EH2A 4QO8A 1SKMA 1ND5A 2C9YA 3BXGA 1C30B 2OCBA 2VDOB 3CN7A 3TRKA 3OT4A 2FQXA 2P62A 1TGYA 4JVMA 2PT9A 1VQ1A 1WBJB 1H42A 4NYIQ 4CUZA 2DBYA 4PCVA 5J2UA 1RIFA 2BBSA 3KCQA 2MCFA 2SHKA 4BLQA 4DC0A 2VYCA 2AZMA 3P0EA 5AKLA 2XDAA 5K8TA 3JZAA 3HYRA 1O4VA 5MDHA 2QQ5A 4TTRA 2ZRQA 1V43A 3KJIA 3L79A 4F5EA 3Q1KA 1O95C 3LA6A 3ORHA 2Q3CA 2PZJA 4WINA 4WBNB 1RHUA 1XD2B 4JJFA 1XCOA 2VRCA 2HLDD 3OU2A 4U2EA 1H65A 3WGGA 4PYQA 4ENRA 4BIIA 1EFTA 1XOIA 1Q15A 2ZATA 4M7WA 3USZA 4AULA 4D4KA 3MIZA 5DNAA 3E3OA 2ZJOA 3R40A 3ED5A 3HB0A 2OM2A 4XJVA 2ERXA 3ZWYA 1BEEA 1VJTA 4FN5A 1CUEA 1HI9A 2QPAA 5DHAA 4HX9A 4XDYA 3EZ9A 1UDBA 4NBSA 4AUEA 3OLYA 1HETA 3DLTA 3ZIAA 3DOUA 4YY3B 2YHAA 5JADA 4TXMA 3SHTA 1FA9A 1ZVMA 4EFMA 2CXTA 2FJUA 3O3MB 4KGZA 4QTZA 4B35A 1KBQA 2BZGA 4MUNA 4F97A 3FTDA 4NEHB 4O2BB 1T6NA 4NJOA 3TLCA 3D6NB 1CUDA 4QUAA 4FBLA 4CI0B 5F2NA 2VF7A 2ZXEA 2G5GX 3G8YA 1TZKA 2W37A 4P53A 4TL6A 4L6AA 4IICA 1O2DA 2R7MA 3BXXA 2N46A 3NU1A 3C5EA 1OX4B 3N0VA 1GPMA 2NSJA 2VF2A 1V6SA 2GPNA 1INLA 1ZGZA 3MF4A 4LHEA 4AWXA 4RY8A 2GNAA 4RFSA 2LWIA 1SC6A 3WO0A 4CMCA 5KQRA 5HZGA 3CH7A 3ZDCA 5LU8A 1Q77A 5J58A 4WLFA 2BWJA 3ZR4B 5CFRA 4MVJM 4X44A 5TEVA 2CXHA 1Z6AA 1PJTA 3BSFA 4LJ6A 3RIEA 5AKXA 3VR0A 5KCZA 4MCHA 1P17A 2O07A 4B8WA 4RYLA 1OXKB 1R0LA 1G5IA 3ANXA 3DUFB 3QE4A 2WHEA 4UQPA 4BX2A 3RSGA 4YJ3B 2XDQA 3AEZA 3C3YA 2PUWA 2QSJA 2ZBQA 2FG6C 2NP7A 1ZESA 1PLLA 2FSVA 4KAJA 3EC7A 4IIXA 2QZJA 3GELA 3P9PA 3FLBA 4PFSA 1W4LA 1MAVA 1IPHA 1Q19A 1XA4A 4JOQA 2NAFA 4R8SA 3DP7A 4LISA 3RIYA 4EMSA 1SBQA 2IHTA 3WFJA 4F11A 5A3RA 3IHWA 4YLEA 3GYBA 1ICIA 3IA7A 1NJFA 4PVDA 4L85A 4MRNA 2AN3A 3I5AA 3UUGA 4FLMA 2E18A 1F8XA 1SBTA 3IEXA 3HKCB 3KJNA 4FTWA 4PANA 4ZYLA 6REQA 5IJ9A 5DP2A 4CODB 2H51A 1IRIA 5JCJA 5EA2A 1TAGA 4YRPA 4KRGA 2Q2NA 2AG6A 3D2LA 2VEOA 4UNRA 5JAIA 2ZRMA 2IHNA 2JI7A 1I9CA 4P2BA 3HGMA 3IVAA 4EFDA 1WF6A 4E5SA 4P83A 4Q6WA 2HQ1A 3QXGA 4QFDA 3S6JA 3DTNA 2WVAA 1QQ6A 3GVHA 1TC1A 1PP4A 4AD8A 1MIHA 3AJEA 2C0QA 2WAOA 4PC3A 4QEDA 5JARA 4Y1RB 5D6NA 4GX5A 3RTDA 3ZWAA 1MAAA 4TV8F 2CJYA 1ORHA 4FR5A 2H9YA 3CPSA 4CMKA 1KXZA 2K2WA 1CQPA 3NONA 2IL1A 4LDJA 1YDGA 2HLNA 5DHSA 1G1MA 3FCAA 621PA 3THYA 5LDHA 4F71A 1C7FA 4G0ZA 1XZLA 4IWYA 4NDNE 1KJ8A 5CB8A 1K7CA 1PK8A 1YL7A 1IULA 2DFVA 3T4EA 1VDZA 5DTRA 4D43A 4ZMBA 3VR3D 2REXB 3OEEA 5EEHA 5PNTA 1HDIA 1CERA 3ZOKA 3ROKA 4ER6A 4P33A 2GDJA 2I55A 3K0HA 2PLNA 3FPBA 5IYZB 4XOUA 4PYIA 3VAYA 2ZSKA 5JEEA 5AO9A 4ZDJA 1H4VB 3KXIA 5CPFA 2W6JD 5F7ZA 4ND8B 3SC2B 4Z0PA 3U4HA 3I3SR 1XAJA 3C5WP 1VSBA 3PC7A 4MO9A 4Z7QB 3K70B 4HNGA 2VQ6A 3PJDA 4W8OA 5H9VA 1PQUA 1YE3A 1U98A 4WGFA 2YZ2A 4HHEA 5REQB 3OBBA 4WN3A 1YZ3A 4WQMA 2BGNA 2X86A 2B4QA 5BT8A 3N8IA 3I04M 3SVZA 4QM6A 2Q28A 4LQLA 5HS6A 3BJIC 4D6PA 1D4OA 2HHAA 2WI8A 1FNBA 4OKNA 3V4SA 4MGHA 3UCXA 4DR4B 1E77A 1WP4A 4B6EA 2FZ5A 2W6IA 2EXXA 1N0VC 1Y1PA 2BJWA 3PXBA 1G3MA 2HMVA 4U2KA 5FTMA 1NUHA 2Z58A 3EZXA 5CDFE 4IMRA 5HKAA 1MR3F 3QE2A 1OAKA 3VOBA 2I9PA 4EZIA 5AUOB 3ESBA 5T57A 1V8PA 1PNOA 4L8VA 3D1LA 3IBSA 3D6UA 4JVLA 5CBKA 2A9OA 4EGQA 4F9FA 2D8AA 1I4EB 1JKJB 3D8UA 3HBMA 4IHQA 4O25A 5DHQA 1KKLA 5HE9A 3RRXA 2XECA 4FQ7A 3U80A 4GKJB 3W5DA 3L0BA 3H2GA 5AH0A 5AJXA 4W5RA 1OZGA 3FVRA 3IVGA 4MYSA 4ZU1X 2YUTA 5JH7A 2HT6A 4H6XA 1V3UA 2QENA 3L06A 4UMDA 3RU3A 4B2LA 4R0MA 5JSZB 2XA1A 3U3DA 3PQ8A 1K0FA 4WZBA 4WRRA 5K3BA 5DRYA 4CL2A 3WK4A 4CIAA 3C48A 2PX3A 2QP4A 3IT1A 3ZLUA 2OHIA 5JAHA 2ZTVA 5EJ7A 4PFKA 4AX8A 4B84A 3NS7A 2PQ0A 1AIPA 1RACA 2A0WA 3ELYA 3BREA 1G5HA 3PSAA 4U39A 3ZIUA 5ECWA 4JP1A 1WEKA 1K9VF 1SULA 4YJ2A 2BCJQ 2WHRA 3WMXA 4I0WB 4KN6A 1ZIPA 3PXXA 1KO1A 1ID8A 1PYOA 2OXRA 4CLDA 1AS0A 1E4YA 3D2CA 3GUCA 1ARZA 4P84A 5ALMA 3IMFA 1YDMA 2F43A 2XKKA 4G9EA 2OEPA 1XZBA 2RGYA 4DMUB 1ORVA 1CT9A 3R0QA 4CTJA 1DBRA 1L5NA 2NUTA 3NGXA 5CYFA 3C16C 1YIAA 4QUKA 4LOHA 2DPLA 4OXKA 3A4NA 4X8HA 3T9AA 7ADHA 7GPBA 5KMGA 3HKBA 4DMLA 1UH5A 4HYYA 1JEEA 2DCUA 4PG8A 2FRDC 3OFKA 2OTCA 4CMEC 5LR6A 3AKDA 2GBGA 2ID7A 4II7A 5LVAA 3KJGA 3EJWA 2D5IA 2PFKA 2ZJ5A 2YXBA 3NHPA 5AOAA 2VI5A 4CRWB 1EJBA 1EWKA 2QYOA 5HIIA 5BQPA 3UFXB 3EPJA 3WR5A 4KCGA 4ZCSA 2AOWA 1CY2A 2Z83A 1ZH0A 4IW3B 2JFOA 5C3MA 1YR3A 2REOA 1RCUA 1JAIA 1RP1A 3AHEA 4Y1FA 3VO8A 5AI4A 4IJVA 4ZO4A 3I8XA 1F2DA 1P0QA 4MP3A 3RVJA 3PGMA 4IX1A 4J49A 1U9IA 4P4NA 4DIEA 5C53B 1YDWA 3BS4A 3N2KB 1T9GR 1W9HA 2DWCA 2PXXA 3CISA 3M3HA 2FTKE 4PRZA 4UEQA 4CCWA 5A9SB 3SXJA 4EJ2A 2R6JA 4KDCA 5I6DA 4XH9B 4TTIA 5C4IA 1JHDA 4X0EA 3QXHA 3JALA 1EFPA 4IDGA 3WLSA 2JLSA 2ZCVA 5H70A 3ADBA 4BVJA 4EMBA 3GT0A 1CR6A 3ZKWB 1XK6A 1XYGA 1ENOA 1S9DA 2XUKA 2GB4A 1OBVA 3I3OA 1MQ8B 3B3AA 1P33A 2XB4A 4KRXA 3SN6A 3O3OB 1ODJA 1LJ8A 3COWA 2X19A 1E3EA 2W93A 2Y1DA 3N28A 4IDDA 4WFJA 4Y30A 4YGYA 1VM6A 3T3HA 2B30A 2Z6UA 1DC4A 3MAGA 1ZH8A 2B21A 4RH0A 3CF4G 4OHFA 3PV0A 2EBUA 1R88A 2E4ZA 2YZMA 9LDTA 1DB3A 1DAMA 1IPFA 3DBOB 3DCJA 3P2KA 5HBGA 3PPIA 5EWLB 3U9TA 1FUEA 5A0VA 1FP6A 4W7IA 1JDZA 4KQMA 1FTNA 3HCDA 3KYCB 2EIXA 4B8YA 4YMSA 3DF7A 2F4NA 3EC1A 3VGPA 5E7QA 1UBSB 2Y9PB 2CLIB 5DBEX 1NF3A 3QU9A 4KAXA 2EG5A 2WZDA 4S35A 4UNQA 5TE9A 1JAXA 4U1RA 2RHLA 2XYQA 1I2DA 4ZCQA 4AJKA 4OGFA 4AY4A 1T6BY 3HEBA 3ITDA 2JI4A 4M37A 4N7MA 5SZIA 1DKOA 2Q27A 4XYLA 4DIOA 2CBZA 3IQEA 1IG3A 3CX3A 1U8UA 3GT7A 5FPQA 2HU2A 3RWOA 2IOFK 4KDRA 4KWEA 3IAXA 2MSKA 1GLGA 4EJSC 1KSFX 1N9GB 2I3GA 2R751 1C1HA 4JU8A 4P6VF 1NDUA 2C20A 2IYSA 1KQGA 1VB3A 3E4CA 4MR9A 2XADA 1R3UA 3WZLA 1Z17A 5JJBA 2Y4OA 2C8KA 5KJEA 1DKMA 3ZCXA 3AF3A 4ZALA 5AKJA 3GJZA 2YS7A 1Q14A 4ITUA 2BGIA 5BVHB 5BURA 4MI1A 3N75A 5HFAA 5IZCC 3MUNA 1Z18A 2W2OA 3D3WA 4JJ8A 1ZN7A 2GAOA 2NZ2A 4X3CA 2O9JA 3I2HA 3TEJA 1WDTA 1ENPA 1UXKA 1N9KA 1PW5A 1VCOA 3BRCA 4I19A 4KK4A 2ZBFA 3GUUA 5EMHA 1RJFA 4DCPA 3TNJA 8ATCA 3ANTA 3EDYA 5GV7A 1EU1A 1UKCA 4AN1A 4F72A 4R40A 4TV8A 4LZLA 4YB8A 4RL4A 3EIFA 1WD5A 4BUZA 1NP7A 3TGLA 5FL7D 2J1LA 4G0VA 2C7OA 5CDYA 1EFHA 1N9ZA 3A32A 1R8SA 2YV3A 2FCAA 3DQZA 3VO1A 4P3YA 5KQMA 3PQ7A 1A9RA 3KVNA 4RK6A 5DCWA 1LWOA 4RTRA 5EN4A 1MA3A 2ZBRA 2JLXA 2H1OA 3HYSA 3LF1A 4S2EA 4JBLA 1T8UA 1QTRA 2FUEA 3OHPA 3JQFC 5JC8A 3JTEA 4OTZA 1GPKA 4GLFA 1DXHA 4MV0A 3VVBA 4D2IA 2D0OB 1N3BA 1Y3AA 2HK7A 4DBLC 2HMYB 3LT1A 3G2NA 4J07A 4PYOA 5GZ3A 3I6QA 2RSLA 4QJIA 2H1SA 3LCJA 3ZE7A 3A9TA 1P7CA 4INAA 2OUIA 3QLUC 5F2OA 3U0BA 3ZCSA 3B6KA 3K4PA 4PCLA 2OFFA 3WGYA 1QS0B 4LHXA 4AZVA 1WKBA 3ELDA 1L1EA 2AZ4A 4I14A 3H13A 1HFKA 2CDAA 2I4OA 5CA0B 1AK9A 1QH9A 3GWZA 4JQCA 3L8HA 3T9EA 3SJAA 5HNKA 3DTVA 4Y1EA 2VT7A 4Q4CA 4J0CA 4WFKA 4NKRA 2WAMA 2Q1YA 3BD8A 1V5WA 2Z2ZA 1XRSB 2V03A 4I9GA 5EKSA 1DEAA 3UZUA 1ZIXA 1BJRE 4WZ6A 1IN7A 1D03A 1WKCA 1TIPA 3HM2A 1WMAA 3KQTA 4F04A 3BZWA 3BD9A 5A2GA 1GR0A 1JQBA 2JK0A 1PGNA 3MWFA 5EPOA 2IDZA 3RSOA 1JPVA 2VTBB 4BRSA 4NXNB 3AV3A 1VE7A 4L9AA 1TK9A 3QU5A 3Q12A 4BFVA 1TM2A 1RI5A 1TM1E 4EW3A 4KLRA 3EVFA 4ZAYA 4HDAA 2WJHA 4AIRA 4MK4A 3V97A 3V7NA 1GAXA 3Q8XB 1WB6A 3AR7A 2WYOA 2O2IA 1ZO8A 3GPLA 4QVKA 1OI2A 4R7TA 4DKXA 1SHJA 3SF8B 2B99A 5TGDA 1JG1A 1GKIA 2ZSDA 1ZGCA 3M34A 1BMFA 2B34A 3HI6A 4IEIA 4ZPJA 1NT4A 1DI0A 4ZGGA 4Z2YA 1E7SA 1YKSA 2WIKA 2C4MA 2J4FA 1KKUA 1UXHA 2YN4A 3G1WA 3GRZA 3M6MD 4IDAA 2Y0DA 5IU6A 5GADl 1YF3A 1W49A 5E0KB 2YBEA 3C70A 1SNYA 1RM5A 3OIWA 3P0JA 3PKZA 3RGGA 2FHSA 4NULA 2VDNB 4JP3A 5ILGA 3T1HB 3JXEA 5JJCA 3JQBA 4M1KA 5AM4A 1MZVA 5CDSA 4DKJA 1TEVA 3WO1A 1W36D 2NPIA 2ZE7A 2AV6A 1Z2NX 2FR1A 2P69A 1ZA1A 3IAUA 3KD3A 2WUDA 3QBTA 5EXDA 2JRLA 4AP9A 5AUPB 5AVSA 4BJ1A 3EF3A 3OX2A 3PUJA 5FNVF 3BK1A 2PQ2A 3MLBA 4OP2A 4QU0A 4WKNA 1NJSA 3MVEA 1ZEJA 5IT9A 3UENA 2OFWA 4MCAA 2QDXA 2V6FA 2IZ7A 4CTMA 2QG9A 1EUDB 4Z0HO 3KHTA 1CXZA 5BRJA 1M6EX 4HLUC 1NNEA 3RAEC 1HT3A 4GM1A 3SZGA 1XTUA 2JIZA 1XMIA 1NQTA 3B5EA 2HZBA 4M54A 5LSAA 3BCUA 1LK0A 4ND1A 3ABZA 2OLEA 4K40A 5GIPE 5E9AA 4DCSA 1XZJA 4NJEB 1F0PA 3EWIA 2XYPA 3CZQA 1EQUA 1GNTA 4JQOA 4X61A 3CZAA 1M67A 3HSSA 3NQ41 3VZCA 1J9GA 5JMOA 5L3SB 1F2TA 1JVNA 5I9TA 1JSXA 3UV7A 3V8BA 5D3ZA 1DPFA 2EEPA 2DUWA 3O03A 3A3KA 2FN4A 4DV2B 5IMBA 4N54A 2R7KA 3OKAA 3KWFA 4TXLA 3ROTA 2P8JA 3ZGZA 1A9QA 1Q0UA 3FDJA 2GK6A 3QG1A 3ZWDA 4U2FA 2ECKA 4MIYA 1I6KA 3ONFA 3V2GA 4FJ1A 4DZTA 3P9QA 1DHTA 3MPUA 4XCXA 1N8TA 1Z62A 2O3QA 4DS3A 2FJPA 3IV9A 1VLLA 3L6EA 3KSAC 5EJ5A 5JRZA 1XA0A 1GOTA 2J3QA 5ER6A 2C97A 3B1VA 3ZGXA 5L3RA 1SG9A 3GFRA 1H8HA 2ZGVA 3UXHA 4NS4A 1WQ3A 2V7QD 4ZQGA 3UPUA 3HO1A 1QG0A 3DPIA 1Y1TA 4J0GA 2JAUA 3GCDA 2HR1A 4BMPB 3SBOA 2EC5A 3Q7QA 1WZNA 2GWHA 1K97A 3HTXA 2CLSA 2GRAA 1X7XA 2W5UA 4H35A 4NG4A 1T4DA 2PLAA 4OKSA 5KYYB 5FA6A 2JGRA 3EDCA 1IATA 4N8EA 1X87A 1JDTA 2JW5A 1ESEA 4QREA 3NBQA 2HA0A 3S5UA 3I2IA 4URYR 4DQVA 1E69A 2R7LA 3CNQS 3ONDA 2LBPA 2R47A 2W2LD 4ZQFA 2ZYDA 5EHXA 1N4DA 1ZD1A 4D0NA 4GWLA 3LHKA 3QEAZ 1NSTA 2CKMA 1RXEA 2J08A </