4ZEMA

Crystal structure of eif2b beta from chaetomium thermophilum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
382
structure length
328
Chain Sequence
PSLATWTKSLRDQSLEASIESLIFLLKRRQVTGDECAGAIAQLLRQVVAKSKWHDVDQLLYRVQTAGARLARAAPHEPVIGNIVRRVLGLIRDEASDIASDAASDIQSKSMFNLLSVQPFSVHALRSEVMDGIEEILDEINQADDQIASFAEIQIHPGDYVLAYQPSKTVERFLVKAASKRRFTVILASLNPQPYAALRKKLNAAGVSTINLASNGLMAYIPRVNKVIFGAKAVYQNGGLLVDSGACIAAQAAHEYLKPVIALCGVYKFCPEDPSDEVSRGELTTTDYIPPDLVDVYLTNLGPQTRHHLGGIYADHYKIEDIGFSLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF2b-like protein,Translation
publication title Architecture of the eIF2B regulatory subcomplex and its implications for the regulation of guanine nucleotide exchange on eIF2.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
total genus 115
structure length 328
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 4zemA02
4LDQA 1W2WB 1T5OA 3ECSA 3A11A 4ZEOA 5DBOA 4LDRA 3VM6A 4ZEMA 1T9KA 2YRFA 2YVKA 1VB5A 3A9CA 2A0UA
chains in the Genus database with same CATH superfamily
4R68A 1KP2A 4RZXA 2RB5A 3IULA 4H6WA 4HWOA 1J2RA 1NHWA 5I7WA 1LD3A 1GNLA 1VYHA 2IXTA 4Z9FA 5F1PA 1H3EA 5K4AA 4XD7A 3CLTC 4KV7A 1SUFA 1ZCAA 3FCCA 5JAPA 3CX3A 2PU7A 4A8PA 2HXYA 3KTDA 4U3JB 4B33A 2IUSA 3MWYW 1BRTA 1M1ZA 2CCJA 2WAMA 2AFRA 2YYAA 3HHEA 4TV8F 5DH9A 2PZEA 2RBEA 4CCYB 4DA4A 3F96A 3PC2A 5IVDA 4EECA 2ZS7A 2PL5A 4LGCA 1RAAA 5EHIA 2EQAA 3RUEA 4O4IF 3A1CA 3GGPA 4DKJA 4GM0A 4A5OA 2OCLA 4RVFA 1DG1G 1I36A 1NM5A 3KEOA 2XRMA 3T5TA 5B4VA 2BGNA 2NU6A 4LK3A 3VSCA 5JANA 4JXZA 2CB0A 4BVBA 2PKCA 3FCAA 3H5WA 3B1KA 4W7HA 4WSOA 1Y4UA 4BLRA 3WAJA 3UN1A 1BMQA 1D4ZA 3KKOA 5JFTA 4JKYA 3SU8A 2WIAA 1H2RS 1Z0IA 2QR3A 4AZSA 5CK5A 4WRRA 1Z4OA 1PI3A 4OHCA 3RASA 3ZJUA 5D7NA 3H86A 1SIWA 2PGDA 1NYQA 3JVDA 1YDEA 1YR7A 1XDGA 4KXWA 3Q4GA 2BMJA 16PKA 4TL6A 1XHEA 1ZD1A 2A78A 2R6GA 3C5EA 1Q0PA 1ZIXA 3KDAA 4M99A 3C43A 4KO1S 1DHRA 5TGZA 1JWLA 4MX8A 2C5BA 4RU1A 2X1LA 4H27A 5AXAA 2ZEJA 4XQGA 3TGPA 5ILQA 3WJ2A 4EUSA 2ZYGA 4YVFA 1NUHA 1EGAA 3GLQA 3AFHA 2HQRA 4J03A 3LXMA 4G4GA 3OX3A 4KU4A 2CNLA 3MINA 4NU8X 5LYJA 5TS2A 1ISRA 3ZV5A 5KTOA 2E4VA 3SR3A 2BGMA 5AW0A 1HURA 3KQSA 5AM4A 1Z5PA 1XDDA 4OY3A 4EELA 5JTUA 1NF2A 1U1IA 3N9IA 3NIWA 2NU6B 1G55A 4ES6A 5BXYA 5H82A 3FOEC 3H5AA 1E2MA 4OQPA 4S1WA 3VSAA 2MDTA 4XGRA 2CHFA 3JQ8B 1EWTA 1H2EA 2WAOA 1VA5A 4Q82A 1DBQA 3T5GA 2C07A 1P7WA 1UBUS 2B25A 3QF7A 2CE7A 1JT9A 1CR0A 1XRLA 3CSSA 3L7IA 3WE7A 1P80A 5KQLA 1JFFA 2ZAOA 4YRDA 4Y9TA 1LF5A 4CM3A 1WXXA 2VYVD 1MB4A 1R8YA 2X8LA 4FGZA 4DC0A 5JZSA 3N0RA 3I1FA 1TFRA 1N75A 3PITA 3E27A 4AC9A 1UC8A 3E70C 3IBSA 4FSDA 4TKLA 2C2HA 1L5NA 2P6PA 2QQEA 4J0IA 4UFOA 1PKEA 2H2WA 4NBUA 4AU1A 1RXSA 5LDHA 2VCHA 5BSWA 1E3TA 3IQHX 4KQXA 3A9VA 3CVWA 1GKYA 1JDPA 1KMIY 2VPWA 4L4YA 5FTKA 2GESA 5KYYA 2DGDA 4KR9A 1JJ7A 2G9ZA 2B30A 3MINB 1NRXA 2F3PA 3NEAA 1JLLA 1NXVA 3VZBA 3WLOA 2QMUA 2J07A 3PKIA 4YRIA 1FU8A 4ILEA 1BYUA 1RTTA 4EUEA 5BW8A 5EI5A 1XZBA 1O94D 4PIPA 4OXQA 3TDNA 4GKKB 5ALDA 2AFIE 3GVCA 1WSDA 2ODNA 3DEYX 3DLCA 4NFYA 4Z99A 4BRUA 1Z4JA 3SF8A 5B55A 4DWVA 1UXGA 2EKPA 2GA8A 2JIRA 2Q99A 4RPCA 1H0RA 1RADA 3GFRA 6AT1A 5KOJB 1HMYA 2UAGA 1D03A 1DRJA 3I0MA 1JR3E 1E2NA 5AKEA 2PNFA 4HB4A 3HO6A 3I5MA 2OBYA 4KXYA 2I4LA 3ELWA 4RVSA 3F90A 2Y92A 5ESRA 1X1SA 2QX8A 1A76A 2IU6A 2R1ZA 2R8XA 3JALA 1OILA 5IX8A 3GDGA 3EEFA 4XZ3A 5BQ3A 5IBPA 2HPHA 3KLPX 1NOIA 1KAGA 4BLWA 1L4GA 3NOXA 4TM8A 3ZH2A 5K2OA 1T26A 2FMFA 4IM7A 1BH6A 1R4MA 2E4XA 1JLLB 3BD7A 4WOJA 4DMMA 2C31A 2XGSA 1KNXA 1WULS 4AG5A 2CMDA 5TGTA 4L50A 4RHCA 1MABA 1KK2A 2Q28A 1P61B 1SKBA 1WXEA 3C85A 1D1TA 3HPQA 3JS5A 4HWPA 4OLJA 9ATCA 3ROKA 3KDPA 4P81A 1JDNA 5DFAA 4G63A 3IE0A 2N1BA 4QVKA 1BFUA 5ALZA 2ACEA 1I14A 3SF8B 4BQOA 4YECA 2HWXA 3VPGA 5ADWA 2J7PA 4QDOA 3V4LA 2X5XA 5E7MA 3ZJ5A 4RC9A 4ECAA 4EJMA 5KC9A 5TV2A 3LYAA 5CB4B 2GH1A 5EIOA 3V46A 4QPPA 1C14A 1G8AA 9ABPA 1ST2A 1B74A 5IMBA 1MV8A 5DXAA 3UK7A 2P79A 2PK3A 1W4ZA 3B5EA 4J1TA 4DMCA 3MJTA 2C3MA 4QU9A 3JALB 4UCWA 5I4KA 3EASA 5JYCA 2CBXA 1V6CA 3TMYA 5A7HA 2PD4A 3STVA 3ZC3A 4C0SA 4U2BA 1JMKC 3ZYCA 2FJUA 4WMLA 3RC1A 2BFNA 2Y77A 5HJEA 3AJEA 1G3MA 2AI2A 4ND4A 1T5OA 1Y6RA 2I29A 2YIVX 1R4MB 1KYYA 2G9VA 3EUAA 3PD1A 4KVAA 4OXRA 3RKUA 3TXXA 2H2FA 3WS7A 3EX7C 3EMBA 3O8DA 5LZ2A 1Z25A 1U0FA 1MABB 5CT6A 4PZCA 1ZONA 3GJTA 3O4RA 5EESA 3FMPB 3H65A 4NOKA 1CZKA 1W48A 2VUSA 1DPGA 1MC5A 3B51X 2WJ4A 1EP3B 1U0JA 4JUCA 2WMNB 4R8RA 2G40A 4LOKA 2DFTA 4EVIA 1Q1QA 4FBLA 5TPZA 1WKCA 2A3RA 3HEAA 4OSPA 3IAAA 4RIEA 5H3LA 1QORA 2ZP1A 1NAHA 3HJHA 3EIQA 1NVWQ 3Q3EA 4EPVA 1V4VA 2ZU0C 4DBZA 1KIAA 4YQYA 1DG3A 2WE7A 3HRIA 1FZQA 1UPTA 5GY7A 3UHOA 4F11A 2HK9A 7GPBA 3U26A 5CLJA 4TOIA 2VP2A 4KMRA 3ES9A 2ID8A 1NATA 4LSMA 3ZGOA 4B6JA 3FCXA 2RGNC 5BORA 4JWKA 3IT2A 4HZIA 4OLFA 3PXCX 3RSHA 5LWHA 4B1FA 4X1KB 4YJDA 3PC7A 4UOQA 5C8YB 1NXPA 1DQRA 2RGDA 2WP8J 1T1JA 2LE0A 5ULLA 4YCMA 4I8DA 3KT0A 5KNCD 1ND6A 1NUPA 1P2BA 2NZVG 3V2GA 2CF6A 2VSNA 1DQPA 3DP7A 5C5EA 4Y6LA 2R0QC 3NEJA 3TQOA 2WICA 4IDQA 5KJEA 2VK8A 3QXJA 4K05A 3HE3A 4PBRA 5FFFA 1J21A 4Q1VA 1KP3A 1W73A 1UK6A 3B82A 3GG2A 4M1SA 2HX1A 4RKEA 3CKYA 4ZAVA 1K7FB 2HZ7A 4AS1A 3ESYA 1JEQA 2H7YA 2Q4DA 5FD8A 1YWGO 4RCZA 4TYMA 3L1UA 1NJ8A 3LUDA 4Q01A 3I30X 2XE7A 3C16C 2EIXA 4DVJA 3OLZA 1YAHA 2H2HA 5EJAA 3IUSA 1IBRA 5JYBA 4BY9E 2FFQA 5AFSA 1WABA 5ITZA 5J59A 1V45E 4BMXA 4DL9A 4DV2B 3ONWA 3G02A 2JJYA 1I30A 2FMTA 2NNWB 3ADOA 4Z7QB 2IV2X 5EKDA 3ZDZB 3TG2A 3GUYA 1SHUX 2VCEA 3LW7A 1TTTA 4IHAA 2QTAA 3J7AC 2PV0A 2R7LA 6YASA 2C7PA 4DZZA 1JPJA 4W5QA 2QUIA 1K7YA 3EDCA 4R7TA 4UHFA 4KG7A 3TEJA 4EKIA 5FAKA 1XLVA 3BC1A 2OB2A 1KP9A 2BGUA 3IAUA 3QF4A 1T36A 3ZWBA 3RYCA 3VAAA 3G68A 3RVNA 4OYLA 5AK3A 1KMHA 2JDIA 1OI7A 3AQIA 2P0YA 3FWKA 3IBGA 4PC6A 4EKGA 5BWBA 2J67A 4HWGA 5HGXA 4PGFA 5IM5A 5CA1B 1XJWA 4EP1A 3DKKA 2IODA 3H8WA 1HBJA 2HTEA 2ZAGA 2QSYA 2HDNB 3O0TA 2F7SA 1JEQB 3JSXA 4QFCA 4UBIA 3X1YA 1KFJB 2V7QA 2XNDD 2XY4A 3IBFA 2V98A 1C7ZA 2JJ1A 1FPQA 4G23A 4TMVA 5FWXA 3FPJA 3OFSA 3GK3A 5A3RA 1UQRA 4CZ2A 3HLKA 4BMOB 3QOFA 4FFPA 1CZUA 1Y5LA 1YZQA 1W5BA 3AHJA 4QREA 1WG8A 5ITZB 2YWGA 4B3FX 3VUFA 1LVUA 3U7FB 2DT8A 2ZIXA 3IEIA 1DQSA 1QCZA 2CXNA 2OESA 4N39A 5FA5A 2G9NA 3RIXA 4XEUA 2VA8A 3MVEA 1JG4A 2QAIA 3A70A 3AHCA 1V7PC 4P8RA 3DMGA 4GKJB 1KZ4A 1SXQA 5D3QA 1IIRA 4GPTA 3TLAA 3DYVA 3KQLA 5FWNA 5MFZA 4Z9YA 1GTL1 3TLCA 4C7VA 3C3MA 4KNVA 1N9GA 3L0IB 1T36B 3KKZA 3RYCB 4BB9A 5AM5A 2I1QA 3NCHA 1QCYA 3FOWA 3GLTA 3GA7A 4QU8A 1DXQA 1KMHB 2D2VA 4IFBA 3DCIA 1EQAA 4NBTA 2JCVA 1MHTA 3ZHSA 2D0DA 5J63A 4ASUD 4QXAA 2CLDX 1VIYA 1Z74A 4P4NA 4ZT4A 1AHPA 1KJJA 1GAEO 2VJKA 5FWXB 2IBSA 3MJCA 3CSUA 4DMRA 3I3SR 4LZPA 4LMBA 4FMDF 1H0SA 1WZEA 1XAIA 3L92A 3DR3A 2W6MA 3CWZA 3DVSX 2A84A 3PQDA 1G3RA 1YH3A 2BISA 3Q2KA 4OKIA 2PNJA 1BHJA 2J5KA 3MNFA 4C7KA 4CMKA 2E4ZA 5E4JA 2D5IA 2ZIXB 2PT6A 4K88A 4RTNA 4KHZA 5L4LA 1V0JA 3K0KA 4HGOA 1O5TA 4RJIA 4JLWA 4WFQA 2JASA 2XX3A 4HLCA 5KC8A 1ULBA 4BLPA 5F33A 2KW5A 4QVIA 4OJMX 2YN0A 2UZ1A 5LUAA 2O50A 5HCIA 1YOVB 2WHQA 3QE9Y 4H9GA 1U3GA 2J3QA 4EAQA 5JI3E 3DQZA 1N9GB 3H97A 5THXA 3KSRA 4UBMA 4PBTA 5FX2A 2RK6A 3G0BA 3FJYA 2R85A 1DKOA 1OXXK 1Y4DE 5CLLA 3OE5A 2J9ZB 5EIWA 2IKSA 2GCPA 1RU3A 1O58A 2A5JA 2PGXA 3GBSA 3PWSA 1II8B 3CNEA 4FHDA 4FM9A 2D54A 3O1LA 3ZWDA 4M1EA 1J2YA 1WBJB 3X2EA 3U7RA 4L5IA 2QYSA 1YS4A 1ISMA 1CZOA 1G66A 1M2EA 2C78A 2MSEB 2R8PA 1GPYA 3MGAA 3K70D 3KQUA 4AD8A 5AIBA 5TEVA 3AJAA 1Y8AA 4MV1A 3B12A 2I6SA 5CEFA 3K05A 3PHCA 4KNWA 1ISSA 4JGGA 5AUQA 1QNFA 3SSAA 2TYSB 1AF7A 4C7MA 3AY3A 1V1RB 1ZOIA 3QLEA 4BP9A 3UJNA 1IU9A 3WYNA 3FSJX 3IOYA 3FWHA 5J2UF 2LWIA 1VTKA 3D02A 4M0MA 4FYVA 1QTRA 2BZSA 1NG1A 3Q7QA 1HQCA 1UH5A 2B7CA 4G8JA 3I37X 1ID1A 1E9RA 2UZ1B 1JI3A 4RZHA 3ILXA 4MW5A 1I2ZA 1XKLA 4G1MB 3DNPA 1V5EA 3AKZA 1G8PA 4KO3S 4BBPA 3OETA 1YUMA 4YEDA 4RZQA 4XFJA 3U48A 4HSEA 4GMHA 1BMFD 1GNPA 3AUUA 3DGEC 2PFSA 5AK4A 3KP1A 4LJ7A 2CZCA 3PNQA 2WIJA 1JU3A 4NZOA 3SEAA 1JS1X 2QT0A 1E66A 3OZEA 3T7JA 1PNVA 1QTIA 1SC3A 3KEQA 2WF8A 4KBYA 3UWDA 2R5NA 1DFIA 1N2GA 4FEAA 4M37A 5BSRA 1RZUA 3FHJA 4LE0A 3IE1A 3IC5A 2VTBB 2PZLA 1BEZA 1RXCA 3H9EO 3OE1A 1IH8A 4FXOA 3TG8A 4JZKA 1O77A 3LJKA 1G3QA 4FJ0A 2JFQA 3IJPA 4X8MA 1ZGGA 1ORHA 1F17A 3NBUA 1BCSA 1SVOA 1XL1A 2IYOA 3FSEA 3JD2A 3JRXA 3Q3JB 3RVKA 1R4ZA 1MLDA 2DF8A 3H9JA 1WD5A 3LKDA 3PJFA 1LFDB 4LV5B 2EKLA 4DV4B 3S55A 5A9RA 3CO0S 1R0WA 3A3OA 3IQGX 4GOMD 3E6AA 2F1JA 4QO7A 3M6IA 3A58B 3A11A 3FA2A 3IVCA 4GVLA 2AN9A 4OCZA 4R8SA 4R2MA 1W34A 4W6ZA 2PUDA 2GCEA 5I8ZA 5J5VA 3IA7A 4CR6A 3OMLA 2XCTB 2HXGA 2VDNB 2D0OB 4LXGA 4M7RA 3U4AA 1P7VA 2YY7A 4IPTA 1DQYA 5KJ6A 1JKXA 4R1PA 1RLJA 1SCQA 2P8SA 1PYOA 4KXUA 4Y67A 5L6LB 2W2TA 1ZSNA 4UBJA 1RS0A 3PXEA 2R68A 3ND8A 2Y1WA 4P4SB 2VJYA 5HW0A 2MYPA 4PGHA 2DUWA 4IS2A 3RKRA 4C3ZA 3OX1A 5K99A 2NLOA 4ACBA 4BEVA 1EXVA 1I3OA 2C1ZA 5TS3A 1GLNA 3DT9A 4K6OA 2FRXA 1H1DA 1BCSB 1JFSA 1ZY2A 3WDLA 5DVZA 3BXGA 3X1XA 3EMKA 1UBFA 2IEDA 4NMHA 3R7LA 2A0UA 4DDMA 5EMLA 1TIBA 2QRQA 4OQDA 5DE3A 5FI1B 3T5DA 4X63A 2CDAA 5DN6A 3LHIA 3RJ5A 5FNVB 3WKAA 1RXIA 5BUSA 4G65A 1KAMA 5JMTA 2QTVA 3LYLA 5K0ZA 1VYTA 4DAEA 3HQ4O 2BC9A 3COYA 4JJZA 2YVAA 1JKFA 3OCJA 1VMEA 2PEZA 1S02A 1HWYA 3D2AA 3ROGA 1PFWA 4EA7A 4OI0A 1JEOA 2WWIA 3CKMA 4JEUA 2IZ1A 2R87A 4BQEA 2VWHA 4RPJA 3MTAA 3PKJA 4RVUA 4TQAA 1JBQA 2BDUA 4NEGA 5K0LA 2PD3A 1JAIA 1Y5NA 2O8CA 2WB4A 4J9UE 1C9KA 5GV7A 1W36D 3HJAA 4ZO6A 5KJFA 3BZWA 3DZIA 4RK7A 3FXAA 1NJ1A 2HTFA 2R3SA 5GWXA 1JIUA 1M76A 1PT6A 3KVVA 3AEKA 1U8YA 2WYHA 5CT4A 1W75A 3DDWA 3GX1A 1N9ZA 3F3SA 1A9TA 1U2ZA 3OPXA 3R5HA 5K3FB 4DLAA 5LU9A 1RJDA 1F1BA 4IDFA 3R5SA 4RADA 1QFSA 4TXLA 3E9ZA 2XA9A 3O26A 3E1SA 3U1VA 1AQ6A 2QI9C 5AHKA 4OLHA 3ZK7A 3L4SO 3V1NA 2P7IA 3VRHA 4KLAA 3PSHA 1C5KA 3T9BA 3AP2A 4NCBA 1PYGA 3PEUA 3RT7A 4R8KA 3WLJA 1PZGA 4C4ZA 3MTJA 1E4EA 4BBJA 1P72A 2V3VA 1XQWA 4TN5A 3DZDA 4IR7A 4G09A 4TMZA 4KRFA 2AEJA 4IMIB 4DZRA 3BK2A 1R50A 4IHJA 3A6KA 3EZ9A 4EJ0A 1J8QA 1U0LA 3G0OA 4M86A 2O8CB 1OV6A 4GECA 3GELA 5FOVA 5AR1A 3MCUA 4A23A 3P7MA 4LCBA 1OZHA 1E1YA 1A8HA 1URPA 2Q2NA 3AEKB 1WB9A 1IULA 1T6ZA 4RS4A 4GGMX 5DYWA 4EYEA 4MTCA 3M3DA 5TB5A 4CLDA 1I51A 4BPBA 2ADOA 2ID9A 3VZDA 3AF3A 1KZ1A 1WXHA 3KZKA 3JZIA 3TTYA 2JIDA 5E9AA 4MUIA 2O20A 3GYGA 4RL6A 2O4CA 5FI5A 1IHYA 2N9UA 1EDOA 2PGIA 3S8MA 4DM4A 3I6QA 5FADA 2HQOA 3A1VA 1KK0A 1LH0A 2V6GA 1W93A 4KQHA 2VSOA 4IO1A 5FUYA 2G5CA 2QM7A 5K3DA 1QHIA 3GRZA 2J9FA 4ZDJA 4QUDA 5A1JA 4MK4A 3UGJA 4B3CA 1Q2XA 1UCFA 1GZHB 4N0DA 4IHJB 1JLKA 4YUAA 2VRCA 2J4DA 2Y1XA 4HDRA 1ZVVA 1KSGA 2EX0A 4ZXFA 5JXGA 2ZJ7A 3E9YA 4JVSB 1MTZA 3MAJA 1XPOA 3R3YA 4ZV7A 1GPUA 3CUSA 5E6SB 5EWMA 4PWZA 4CEHA 1XQXA 2FMHA 5L7WA 3RUIA 2B1IA 3K9HA 3QIVA 2AVNA 1T24A 2CVQA 3GH1A 3P4UA 1NOJA 3Q8XB 1PR5A 2QX9A 4HXEB 3L5KA 1CWUA 1QSGA 4HLNA 1GADO 2JAHA 4EHAA 3SQXA 5EMJA 1D2HA 5J1TB 1RXEA 4ZWNA 1GCIA 1YB4A 5JAZA 3DCJA 4XQ0A 4OQLA 4UXJA 4BX2A 3GLGE 4C0AC 5EKXA 5K0JA 4HGPA 7MDHA 4OHKA 2G07A 4EFDA 2Z6VA 2EAUA 4YAKA 2J9FB 1YI1A 1JHUA 4OI4A 4ENTA 1K6IA 1IEQA 3FPCA 1CZLA 1ZI8A 3WRYA 4ZVQA 3I4LA 4BHTA 1M8GA 4NJEA 4QU5A 1BD4A 4J75A 4D9IA 4DPMA 4EB0A 1BDBA 3LDGA 5JS2A 4UEQA 3EUFA 2O1SA 1MQSA 2G67A 2PA3A 4HGQA 4LXUA 1MO4A 2FEAA 4HDRB 4LSZA 1LY1A 2YN4A 1Y6QA 1PF7E 4NHOA 2IS2A 3BKWA 1M0EA 1KDRA 1T5BA 3NIFB 3SLGA 5EWMB 2R8YA 4CEHB 2AIRA 1CULC 1G8YA 1J09A 1G8FA 1NTRA 4I1OA 3ZWPA 2Q1WA 1PO7A 3QY9A 4K6CA 2OO5A 2QXTA 3KYIB 1NX9A 4C08A 2QVCA 4H77A 2QF7A 5HE8A 4QM6A 2V8OA 3U16A 1F2DA 3SR4A 4D3YA 3OQIA 3A31A 4JEHA 1N5LA 4W9NC 4MDFA 2W6ZA 3VU9A 1MB3A 2B69A 3R24A 4QPZA 4ZHSA 2BN4A 4IDOA 4LKOA 3WK7A 2HBYA 2ADFA 3ORFA 5JC8A 4X8HA 4A26A 2XWJI 4M7PA 1UBJS 2X1HA 1WR8A 2W4QA 3ZIDA 1JDBB 4G1CA 3WLPA 5EJFA 1EFAA 2C9MA 2YWHA 1UC9A 4UUOA 2WT8A 5D6OA 2AKAB 4WOPA 3R74A 1CJKC 1HYBA 3L01A 1KFBB 3JD1A 3IV7A 3PHIA 4NJEB 1KJNA 4YJ3F 5FPYA 4AJIA 1HYGA 1P7ZA 3BJMA 1K5GA 4G24A 2Q9UA 2WM2A 2P35A 4DWJA 2FP3A 1L3CA 3OM8A 3NALA 5KVVA 2IFTA 1D9ZA 2D0PB 1N2IA 4MWZA 3T0GA 4ZAWA 2A94A 2XDQA 1E9EA 3RBVA 4B3HA 4M8LA 1CYDA 3G5UA 2VDOB 3IPXA 3PE4A 4NPCA 3LUHA 2NXCA 4ETMA 3UEOA 4A92A 4YMGA 5HIJA 1H2AS 1L5QA 2EDAA 4GM4A 4UTOA 4I5FA 4NCKA 3W05A 3JSAA 1LLFA 4C6TB 3EPHA 4ZOBA 3VU9B 2WJJA 2JLCA 5JW6A 2IZOA 3AG6A 2ODBA 4LTDA 2XMDA 4YJ2F 4E2WA 4CLRA 1KEEA 5DISB 2Q9CA 4X20A 1ES9A 3N58A 3LWNA 2ACWA 3PZRA 5B1DA 4FXPA 4RPHA 4C4XA 4GXNA 4DG9A 3KOXA 3WIDA 5IAGA 3AVUA 5JCOC 2Y1DA 2P68A 3BIOA 4RF2A 2AC4A 2ZE8A 3NBQA 4K6GA 5LDDC 5LMCA 4C88A 4CKWA 1EVIA 4N5NA 5EZSA 5BMVF 1M67A 2B4RO 2H11A 2DMRA 2GJ8A 5BYJA 3H04A 2W42A 3AF0A 3DL0A 2Q46A 5MDHA 2BKEA 4NMXB 2IYTA 2WI8A 1T2FA 4ZQBA 3L7LA 3WOVA 4DDVA 5BNZA 4EVQA 4E94A 5AVJA 2CF5A 2XDQB 4H0FA 1QGED 5JZMA 4RY8A 3SC2A 1LWNA 1OBFO 2UDPA 4OTZA 1T9AA 2OMEA 2XGMA 3NHJA 2WJ3A 3EF1A 4OFXA 4QGGA 4UCFA 3ZQUA 2WEKA 2XTJA 2VSQA 1NAIA 4YCNA 1FUEA 2HSDA 1WAMA 2BEVA 5C4GB 3FPSA 1HGXA 1NVVQ 3F6YA 3QTLA 1ZNXA 1HE8B 2JFOA 4V0LA 4TRNA 4Z3KA 1M2NA 4Q9IA 6ABPA 4E33A 2Z4RA 4JJ8A 2Q2WA 1GU7A 1KEEB 3PR2B 4ZQIA 4JLVA 5FR2A 4CLRB 3ZHRA 3JWIA 2PE5A 2DR3A 1DC8A 1GUZA 1K98A 1AOXA 2BFWA 2I71A 1SQ5A 3I92A 4W99A 4ZOEA 2C2OA 2RGEA 2WF9A 4G25A 3SF0A 3PT5A 4GWKA 4MMZB 4NULA 4CKWB 2B78A 2F3SA 3QU5A 1YJXA 4DLPA 2P9GA 1Q7BA 4DBVO 3MLBA 1U28A 2IQ5A 3WOHA 3BXEA 1QZXA 1LS1A 2PZ8A 3C0KA 4KO2S 5CA0B 3ZXXA 1CUIA 4L5AA 4PZEA 4TTJA 1L4FA 4IV5A 2QEQA 5BN1A 1T0PA 4LBYA 3L0CA 2QL6A 4MR9B 1T0BA 1VB5A 2PS3A 5HF6A 3I2IA 3PDIA 3SC2B 3KXLA 4J16C 2W9XA 3CRZA 1FTNA 1VSBA 2BP7A 5JPDA 1MR3F 3C8DA 4A91A 4A6DA 3U4MA 1N6KA 1L7EA 4JLDA 3SIPA 4OL9A 1GU0A 4BKUA 3NRCA 4ISCA 4DZTA 4ARIA 3GUVA 4JJAA 3HVJA 3BFKA 2HOQA 1S2DA 1K66A 2D1TA 4XFKA 1IN5A 3LLMA 3ZV4A 3AF2A 3ENVA 2ZTHA 1XP5A 1VMIA 3GXOA 4KVZA 4JVOA 3A2NA 2W2VA 4LPSA 2HNKA 4GR5A 4L9WA 3FOZA 3ZZMA 4QATA 2JGMA 4ZYYA 3R9WA 2GK4A 4KGVA 3H3XA 3LQYA 2VDRB 2FKAA 3USES 1QIMA 1Q7TA 3QEKA 1T3ZA 2WK1A 2RG1A 4CL3A 1P0QA 4JBYA 2HHHB 4LF7B 1HE2A 1XSEA 3HA3A 1XT6A 2ERYA 3T52A 4GYJA 5LNK6 1GILA 1V43A 2YWEA 4ND5A 2ZRCA 3UCEA 4ZKDA 4RA6A 2HGSA 3KFVA 3FPKA 5YASA 2EBHX 1YZLA 5BYKA 4GP7A 5KWIA 4FX2A 1DBWA 1SGWA 3KEGA 4L74A 3PDIB 4LVUA 1EE2A 4HNGA 3BORA 3BCUA 4J6EA 1YU6A 3BXXA 2BP7B 3AR9A 1ZK0A 1MIHA 3H2JA 1VYVA 2IIQA 5KVCA 4KSYA 3H83A 1Y6GA 4ZDIA 4CMEA 1CY0A 1JFRA 2WYIA 4E6EA 1S8AA 2G80A 1RHQA 3E7DA 1NE2A 4K9KA 2BGGA 3DO5A 1AJEA 4HJXA 1Y8QB 2OQRA 2Q5IA 1F5NA 2PS1A 1R9GA 1UJ2A 2R6JA 1Z73A 1SELA 2Z9DA 3Q5EA 4JMPA 4YRKA 1ZKMA 1PUXA 2C03A 4G56A 4DC9A 3W79A 7YASA 1BNCA 1XQ6A 1IHDA 3O4VA 4ALKA 1HFJA 2BCGY 1FSPA 3ASVA 2ACVA 4RKRA 3V5NA 1YBMA 4Z9AA 3FLEA 2FKNA 2QSZA 1W46A 3DYBA 4RH1A 1NW4A 3DFUA 2WWGA 5K51A 1N2JA 2EQBA 1QG2A 2XVXA 5HEKA 5EKSA 1H9AA 3VKGA 2R97A 4KK3A 2ETXA 1GFIA 4RA6B 4X65B 1HLPA 3F5FA 4OO3A 2DLNA 1WHSA 5TY0A 3INNA 2XE8A 4FD2A 1ZUIA 4CG3A 4C30A 4KSBA 2FPLA 3OE7A 3SBOA 1KBOA 2AC2A 2YVQA 4QYSA 1O5IA 3DE4X 4BX0A 1A8PA 4UDOA 4Y1GA 2GCNA 2UKDA 1FOEB 1N3BA 2K2WA 2O7NA 5AKZA 5ER9A 5EPOA 1DRWA 2O8NA 3TWOA 1X42A 1EDEA 2GTIA 3CF6R 1ZXLA 1VSUA 3HXKA 5TPWB 4UQLA 3TLGA 4M9CA 3ESZA 2OV8A 2R751 4JJGA 2XUOA 2CLMB 2OT3B 2W37A 5KHAA 4L8VA 1ZESA 1C3XA 2W11A 1C0IA 1D2CA 3BCHA 3OT5A 2GYWA 3OTGA 4G6ZA 1Y5IA 4TS9A 3WWCA 4EGCB 1ICEA 1R0CA 4I1SA 2I8AA 4O2AF 5IUNC 2IZ5A 4E07A 1F0PA 1W9HA 3DTVA 3NT5A 3S2ZA 3OECA 2R86A 2W6PA 2XCUA 5AKHA 3K8YA 2VH1A 1YBHA 3C6YA 3MXOA 3RU9A 2Y1CA 4XSGA 4JR2A 1VBFA 3PJGA 3VX4A 1QXSA 1Z7YA 3EGOA 3KJNA 4EO7A 4C7BA 2FUG1 2BIFA 4FHZA 3MWJA 1GPKA 1LPOA 2IYQA 2NVUA 1E92A 3LP5A 1K4YA 1WE2A 4YREA 2A9FA 5D85A 2UU9B 1MJGA 5IH3A 2H5LA 1OJLA 2X9NA 3O47A 3DS8A 3EXG1 4G86A 5ESXA 4EEKA 3LBFA 2LVBA 4U9UA 4IXDA 1NQXA 4YYZA 1WBDA 1RLIA 1FLDA 2OORA 3BJZA 3PYLA 3I28A 2NXWA 3TLGB 2I2DA 3NGLA 4LCJA 3CMCO 3P2YA 2AR9A 1GZ7A 1KC1A 1XXHA 3UAGA 1M2OA 3JYNA 4U2FA 1K3TA 4O25A 3ZR4B 5JJIA 2HJGA 1W29A 4EFLA 3I6YA 4EMSA 2YZNA 3T1YB 1CUXA 1PG0A 1Z2PX 3DTVB 3CF4A 1ZVMA 3Q7SA 4OHFA 4PPYA 4Q3EA 3L8CA 5AKIA 3NGMA 3W0LB 1E6UA 1HDGO 1N5IA 4QODA 4DLTA 2Z04A 2CSXA 5TJHA 4D4GA 1LQUA 3K8QA 1OV4A 1EB8A 3A1SA 1MA3A 4KXMA 1LW7A 4PM4A 5TPZD 3DTTA 1O9HA 2B3DA 5C4IA 4PFKA 2NVUB 2H08A 2XPCA 3ZDXB 3ROZA 3TOSA 3GWZA 4POAA 3H87A 4PG4A 4PQGA 3TTSA 3L07A 5GTDA 1TF7A 2C8JA 2GPWA 3JQAA 2VBCA 3O94A 3PFNA 3PFWO 7ADHA 1OIXA 3FYCA 5DM2A 1MHPA 4FYJA 2CK3D 3QELA 5FO1A 1QOPB 3RAPR 4Z2YA 3KUXA 3G13A 2UZ3A 1BQ3A 4AP5A 1JBKA 3FN4A 3HUFA 1JKMA 4QBKA 3GIDA 3OSZA 1HR0B 1J22A 1U31A 1XXHB 2EJTA 3NWOA 1M2OB 2QG4A 2FWJA 3A28A 3KELA 1KQNA 3I76A 1YU9A 4NYMR 4UMVA 3T7IA 2ZT8A 1FDWA 3TLMA 4DADA 3NPMA 4IDAA 4QX6A 5KVAA 3CT4A 1IQRA 3ABOB 4Q1AA 1TJ3A 1T5IA 4UHEA 1TLTA 3YASA 4X94A 3ZZUA 2XGGA 3NHYA 1P19A 1M2HA 4ZCTA 3K0EA 2Q3EA 5LQRA 5DTJA 4Q9JA 1U2QA 1OLXA 3HM2A 2J5BA 4D8YA 2WTNA 4HGRA 1SXIA 2VPTA 3GMDA 1NXSA 3A26A 4G81A 3REQA 3T5AA 1XCGB 2AG5A 3CF4G 4FR2A 2BEWB 3HKEA 4J76A 5F7ZA 4BAZA 2ERCA 4RTMA 2GARA 2GNOA 1KDPA 3LTNC 4MW2A 1VL1A 1K8QA 2GERA 1E98A 3WWDA 3JQAB 3LT2A 1CY6A 2H00A 1FJHA 1MV5A 2VEDA 4QHSA 2IA5A 4QJ4A 4R6XA 4W7IA 3RVLA 1H6AA 3B1JA 3I6ZA 3W3AA 4J6FA 4P7BA 1THZA 3DL4A 2GM4A 1J8VA 1RP7A 3QELB 1O08A 4GI3A 1OAOC 1PVVA 1RYEA 1J9GA 1W4CA 3L8HA 4TTIA 1NYTA 5JARA 3T9FA 1CFZA 5CDFE 3HL4A 4P7FA 5HRCA 4AFNA 3JR3A 1Q83A 1CD5A 1SFRA 3LD9A 3UPUA 1C30A 2G3YA 2G1KA 2MMCA 2VH5R 4KDCA 4Q7MB 5B2EA 3GN2A 3VR4H 2JFUA 5EVJA 1U0RA 3SQLA 5HP4A 4G5QA 3A6LA 4L8LA 5INTA 2W6ID 1PQUA 1GCOA 1TVMA 1YZNA 3AB7A 3DE6X 3WBKA 1UIRA 1KGDA 3TX6A 1OLXB 1YKGA 4DA6A 5GJBA 1X1AA 1U2GC 2OHFA 1QP8A 1XZGA 4GI1A 3RFVA 3REQB 4R2IA 1KQPA 1KJWA 1TMOA 1WA5A 5IARA 1SZDA 1GR1A 2BKXA 3BULA 1ACJA 2HB6A 3D4OA 3HKEB 2A7XA 3AESA 3L7DA 5J9FA 3H6GA 4Z7OB 1T25A 2C4UA 4D5GA 1RPJA 4Q9KA 1M2WA 4B81A 1JIXA 1WY5A 5IKEA 4E1VA 1A8UA 2MCFA 3S2SA 4NDZA 4EG3A 1Q84A 3CVJA 3U0BA 2E82A 4AYWA 3QM1A 2WD7A 5C1DA 1HTBA 4RIIA 4D6XA 3CH4B 2OCGA 4TS4A 5CLQA 5CEEA 1UF9A 3EISA 4WIAA 2HV9A 1DJMA 2Q9BA 1VL5A 3PK0A 4I55F 1WV0A 2UZAA 2Z4TA 1ZBQA 3HJCA 4IKOA 1NQTA 4G5XA 4PQYA 1JLRA 4BP1A 121PA 5LP1A 1OI4A 4RMGA 1LTKA 2GCGA 3ZK8A 3GRKA 3IRUA 5L53A 2UZIR 4IDPA 4PXYA 1DJQA 1QHXA 1W52X 4HNHA 5CGZA 2Y67A 2P6NA 2IZ0A 2IF2A 2NTJA 2ZIVB 3QGMA 1OXMA 4ZJUA 1NSFA 3UT6A 3OU2A 3PLNA 3O4GA 4KDFA 2PUHA 3UM9A 4JP1A 1E58A 4XIJA 3AESB 5KVSA 1XNHA 2R9VA 3V8MA 1JEJA 4PE5B 5AOCA 1EA5A 1NYRA 3E9CA 1TK3A 3Q9NA 3QJ5A 1L5MA 5EGNA 2NQTA 4JYZA 2UUCB 1M10A 3GVHA 2O4UX 1SOMA 4L6IA 1OXSC 4WCFC 2XF2A 4X1IA 3D4BA 4GDFA 5AOVA 3IKTA 1MRSA 3OG9A 4BU1A 4FE7A 5SV2A 3D8RA 4S1TA 4PCUA 3ISJA 4FLFA 4O4JF 4PX9A 2WD7B 4L5BA 5DW0A 1UKEA 5KYNA 1DWQA 1JPVA 1N5OX 4CQMA 1ZSVA 2P40A 3I1JA 1J90A 4FYKA 1MNQA 1N1GA 3BFVA 3R76A 3ZU2A 4AJNA 3DJFA 4ZI7A 4RANA 5BY2A 2G0NA 2NSDA 2QGNA 3OQ6A 2ETVA 3T7AA 2P2LA 1H4VB 3R1IA 1Y5RA 2J85A 4F72A 4UM9D 1MAWA 5CEJA 3QBTA 4JOSA 1D2RA 1WTAA 3PHLA 2XZTA 2FZEA 2EYQA 5JCJD 1SCJA 2AWNA 3A4TA 4TGLA 3WKEA 3T5PA 3O8CA 1E3EA 1W1UA 4GRIA 3B1WA 3KYCB 1XYVA 4UE2A 4R7GA 2G4VA 3M4NA 1EPUA 3DAGA 4FMCB 2YRXA 2X0NA 2VUIB 3ETDA 4M8IA 2ZT5A 1NVKA 4NWIA 5EJ4A 4Z53A 2NMVA 6REQA 3L93A 3UTDA 4R1LA 4LGYA 1QV7A 1CTQA 1VSQA 2QVGA 4NU6A 4X1IB 2F4VB 4I4CA 4I4TA 4PQEA 4D82A 1MORA 1RWBA 2DTXA 1Q44A 2AI3A 2H85A 3N2NA 3OFNA 3ZOZA 2A0WA 5GV8A 2P2ZA 5KEIA 1CEXA 3ECSA 1I3KA 1I6KA 3DBOB 1NVFA 1IN4A 2GD6A 1PJTA 2XOKA 3N53A 3M6MD 4MP6A 4NQRA 3W3ZB 3ZCRA 1W44A 5FH9A 3D4LA 1SKYB 4K6MA 3CW9A 5DSZA 2ZUBA 2JCXA 3P26A 4C0KA 1V96A 2Z5LA 3FKSA 3JZMA 1ADCA 2IEAA 3LMKA 5HQJA 1Z0FA 2RGRA 4CV3A 2ZBVA 4X6XA 3DTYA 1QLJA 3JAKB 2WD8A 4G01B 4C6RA 4KR2A 2OCKA 3LSTA 4B4KA 1RM3A 4Z3OA 5JH7F 2VDVE 3MMNA 3PC6A 3X1DA 1DQNA 2ILVA 4K5QA 1YVEI 3OLWA 4BFCA 4ERXA 1I5OA 6REQB 1L7DA 3K8ZA 1RQ2A 3JCZA 5TT0A 1MRNA 1N3YA 1J07A 2FWIA 2IUTA 2ZTMA 4KQMA 4LZLA 4NDNE 4FYYA 5AI6A 5DYYA 5HMLA 5KNBH 1QIHA 2JARA 3GIWA 2EWWA 5K2MA 3SZUA 5KDOA 4HQLA 3OSUA 4KXVA 3UZUA 3PPYA 5BNTA 2QV0A 4LTMA 4EHBA 1XEFA 4KX5A 4MUGA 1GZ4A 4EY5A 4MW1A 3ZNQA 2CUZA 1QH8A 4P98A 2VL7A 3DPIA 2RGWA 2GN8A 1IM5A 4RF4A 3SXUA 2J1LA 2WOJA 1B6TA 1Z2CA 4HYQA 3TRIA 4EHNA 3P2OA 4X00A 5ARDA 1NKSA 1DC4A 4CMGA 4V0NA 1JT2A 1G21E 4R0VA 5DGDA 3UPDA 3SKVA 2OOKA 3DOOA 4JS0A 4AAYA 3C14C 4Q12A 2Z9CA 3VA7A 4RLFA 2D1FA 5LMNB 1MU0A 4AKEA 1P2GA 1QRAA 3PWKA 4RMIA 1TGVA 1OTHA 2MINA 5DB4A 4YPVA 4BKMA 3A32A 4AJOA 5C7YA 1XF9A 1NLUA 2O0MA 4TKUA 2OK8A 4QARA 3HJNA 4ZYUA 1BWPA 1L5FA 2ZROA 5AJUA 3ASYA 4B3XA 4NARA 1SC1A 3D9QX 5BWCA 2QP3A 3JQ9A 5F7XA 1M74A 2RCNA 4R5HA 1EIWA 2DVMA 1Z0KA 3FYTA 3PQ6A 5DLPA 4B4UA 4PAMA 4EKEA 2H9YA 3KCQA 4WECA 2OO3A 1QH8B 2XJ4A 4X0EA 2BEUB 4XCXA 3TS1A 3U5TA 1T9GS 2NUPA 2VDPB 3CS3A 2QMOA 2J08A 2PH5A 4HDCA 3SC3A 3SXUB 3TE7A 4ZVOA 1HSZA 3AG5A 2BGTA 1UAAA 4KX3A 2FPGA 4ARVA 3ZEAA 1ODKA 1QQ5A 1Q6ZA 1RNLA 3KT3A 4M36A 1SRRA 2WM8A 1ZM7A 3GC6A 3C6BA 4HNQA 4WXYB 4N8EA 3VGPA 3BHIA 2EP5A 2HIMA 3IT3A 3OHSX 5B7NA 1ENOA 1T3LA 5HZGA 5J4KA 2V4MA 4P86A 2MINB 4G26A 5A2QA 4GS5A 4D8XA 3RQIA 3DEZA 3TQQA 2WSSA 1Q15A 3NCTA 4P3NA 4TKUB 3WGIA 1UMBA 2E1PA 1SHTX 3AR5A 1LGYA 4G85A 4HZGA 4PZZA 1YZYA 4P7GA 3OQNA 2QY6A 3Q6MA 1M34E 4B43A 5B37A 1ZIDA 4WVLA 3D6UA 1P4GA 2YJGA 3UOGA 1HG1A 4YASA 2YOHA 2WJYA 1XCOA 3U7QB 4DR7B 4LVOA 1TLFA 2QTFA 5DEOA 4OQ4A 2MSWA 5FFNA 1EESA 1PDOA 3KCNA 4ID9A 1Z0ZA 2NUPB 4KOAA 5ECGC 2PTHA 5SYNA 4KOEC 5EJ8A 2R8ZA 1FX0A 1XFDA 5AUNB 1AQJA 5H8WA 2Y1EA 4AJLA 1KI3A 1ADJA 1WUYA 1Z13A 2FPGB 3GG9A 4JUBA 4LBZA 1JQ3A 3TLKA 421PA 4MO2A 3MD0A 3RYIA 1ST3A 4BUZA 2XECA 2OR3A 2AJTA 4LQCA 2D7CA 2CLLB 2OECA 4M88A 1E2DA 1ZNQO 1SY7A 4EG4A 3PHBE 2YYSA 2DBZA 3LKVA 4G9GA 1KI4A 4PS1A 4RHTA 5G3ZA 3VYVA 3FUUA 1U0NA 1ZOPA 4L8WB 5EZYA 2JHFA 3PE3A 4UD2A 3GRPA 4H4DA 3B85A 3C7DB 1X77A 2IHBA 2ZWAA 2PUCA 5T3UA 1BA3A 3TD6A 5TF0A 3ZU5A 3BMNA 3VC3A 3WC4A 4U5QA 1XCLA 4KPUA 1X86B 4NMMA 2V4UA 1V3VA 3WK8A 3HCDA 4JELA 1VFNA 1B26A 3EHDA 1B7GO 1YR1A 1RKBA 2G17A 1IAQA 1YA8A 1E1NA 3RR2A 5C5DA 2GASA 4UXHA 3KKQA 4MKRA 1FX0B 3CBGA 3HK2A 1GIAA 2IYUA 4YP7A 3FFWA 5EL0A 3H1EA 3ZJYA 3ZDBA 2BI4A 5KCMA 3O92A 4DF3A 4O4LF 2PPVA 1EFRD 4JXJA 4EYKA 1RDFA 3BMOB 3RYIB 4ZZ0A 3GFOA 3AKDA 3K9GA 1R5JA 3HB1A 3IB3A 3LDAA 5KTMA 5C8ZA 5K1ZA 2OWEA 2B8EA 4TWJA 4HEQA 3TQRA 4WZAB 3KXKA 5K0TA 5L4NA 3QYAA 3H5OA 1KWGA 1KC3A 1UJNA 3DPSA 3IUEA 2RGXA 4MGKR 4QDJA 4CU2A 4KWIA 2PMCA 5EZYB 2Z8XA 5AJZA 2WJAA 1TF2A 4MVXA 4X24A 1GQ2A 1Z5OA 1IJEA 3GCZA 1IOWA 4G9BA 4C5CA 1M6WA 3BFPA 1XWIA 3BMNB 1I3LA 1EP1B 1E8DA 1QHGA 2PT5A 3KK0A 4KPUB 1TT5A 5JFGA 1TMKA 2R6R1 3KQPA 4G3XA 3ZHCA 3NH6A 3IPCA 5EE3A 2H4HA 1V6AA 2GRUA 1CC1S 3FDZA 3KHUA 3PJDA 3TZLA 5KSWB 3IBTA 2COUA 3QP9A 4FDTA 3CR3C 2JBAB 1JVSA 1ULSA 1VHWA 4C7JA 1FY2A 3AR7A 3K09C 3RADC 3CN9A 4O0LA 1E62A 4CTJA 1HEUA 1WB6A 2RHTA 3L43A 4JBXA 1YASA 3L8FA 4HFNA 3ZTYA 3M9LA 1D1PA 5BV7A 3E4CA 2H52A 1EUCA 3L77A 1MVNA 3AU8A 2NP6A 3DP9A 3F67A 2G36A 5IHPA 3LX8A 1J0DA 4IZIA 3W9BA 3JQBA 4RZ2A 4DG8A 5CB0A 2QLLA 1QVZA 2CCGA 4EIWA 3M5WA 3SQWA 4MR8A 5T7BA 5E0KB 4Y9RA 1E3QA 2H1LA 2I03A 4Y7DA 3IR6A 2VWQA 3LIPA 5B6PA 1O97C 1RM0A 3PNVA 5KNDD 1DI0A 1TT5B 2VT3A 5AJTA 2IU4A 3VDXA 3HGTA 1SG6A 4DIMA 1LB1B 4HMQA 4EI2A 3LPMA 1QRUA 3CNQS 2WWFA 1CQPA 5IG2A 4IDGA 3FDZB 3R0XA 5FL7D 4E4TA 5HRUA 4B0PA 1BMDA 4F3YA 1DWPA 4QTZA 2ZXFA 3AUFA 3AC0A 3AVTA 2CUTA 1GTRA 3T06B 1RAHA 4AO8A 2CL0X 2YY5A 3UT5A 2ENUA 1B2RA 1R15A 1KH2A 5EIAA 4EJ2A 4XFDA 1DV2A 2ZLBA 2IYAA 1IBLB 2OG2A 1EUCB 2AFHA 1E63A 2R4TA 3PX3A 1G19A 4EY4A 1NQUA 2DR0A 1X2EA 4BNVA 1XKQA 4F4CA 3D3EA 2C77A 2C8VA 2IYEA 3L1VA 4D4JA 1OFVA 4KIWA 3TGWA 5G0VA 1UWKA 4IMJB 2DKFA 2Y76A 3R44A 2WJIA 4MUBA 4ZVMA 4MR8B 3F46A 4EJSC 4II2A 3ILVA 1ZCZA 4AMYA 2XKAA 1AMNA 3IAS6 4DCMA 3IP5A 4MCJA 3SC4A 2QS9A 1UMKA 3UHFA 4FJ1A 3UQYS 5I7FA 3UWOA 1N6LA 2PBFA 2Y0BA 1EQ2A 2O1WA 2ZIEA 1C50A 1SU6A 4TROA 5JNVA 1G18A 2XEXA 4XXHA 1WUTA 4KQ9A 2B5VA 1WF6A 2QRPA 1ESZA 1L7MA 3WRXA 3F98A 2KM1A 3KX2A 4IQFA 4Y2HA 1M6NA 4EK9A 1RVDA 1U0GA 4OFWA 3UT5B 1RPTA 1YNSA 2FJPA 2IEYA 1KE2A 1X7DA 4P4LA 1NR7A 2QTLA 1LPSA 3DLIA 4GR4A 2O59A 2JRCA 3ONNA 3NQ41 2I91A 2AFHB 1CP2A 3NTQA 2YKGA 1UQUA 3VQTA 4NRDA 1K68A 4P22A 1XA3A 5G40A 2I4MA 2NVBA 2RHOA 1K86A 3FOFC 1Z5WA 2X8AA 4MWEA 4K1XA 1ESMA 4CDNA 2CXPA 4LPKA 1GG2A 4FMBB 4KRYA 1NBOA 1UKAA 3CPHA 3GJZA 3L04A 1N92A 2AQHA 3FFBA 2BRUA 3K1YA 3N8GA 4IJWA 4LJ5A 4PYRA 3BH6A 4ROSA 4DJ5X 1FMFA 4JYMA 4LNUA 1BKSB 1X80A 4IJKA 4UAGA 3GGDA 3M8KA 1OVGA 4GLFA 4S1OA 5CRIA 4B3DA 2IUYA 5LYJF 1DT3A 4P54A 1TTPB 3TNLA 4BO0A 2O2YA 5E9JA 2Q29A 4MRVA 1W35A 2PQ6A 2GBPA 3GEHA 1YSCA 2RIPA 2H9IA 5F76A 1ZS9A 2VXYA 2WHEA 3FOBA 3LGSA 1KVTA 4LTNA 5T6BA 2FWNA 1ZD4A 1M7BA 4C04A 2DPYA 4CHGA 2XKBA 1JDJA 5BUCA 3OFKA 2X0KA 5P21A 1H65A 2ZYAA 3ESQA 3QPUA 1VE1A 4E5YA 1BHQ1 2DFPA 3VKWA 2PN1A 2VNHA 1KXJA 4MJ3A 3HFJA 4NZ9A 1B3RA 2EYUA 4MGZR 1K88A 3ENZA 5DHSA 2HA4A 2IP4A 2XMRA 4C6HA 1Y37A 4MRRA 2PLRA 4N3BA 3FVWA 5DYGA 5EQDA 4CKCA 1E2BA 3JY6A 2HWWA 3EFEA 2Z6UA 2VPIA 2C5GA 3HN7A 5B7PA 4UD6A 1ZMBA 2ZBPA 4LUCA 4TMYA 3OZTA 2NUTB 1AQUA 1L4YA 3W5DA 4AN4A 1DO8A 4LNUB 1X80B 2IYXA 2CHQA 2TMYA 5LZ5A 3DVLA 4MVJA 4B32A 1P9NA 1B41A 3K2IA 3P5SA 4JI7B 2HSZA 2Z58A 1IMJA 4E7PA 4HF7A 1T8YA 1GGFA 1H8HA 3GLHA 4MTLA 4DHWA 4FWIB 3R0QA 2HAEA 1IPFA 4F4FA 5GIOE 1KETA 3T4PA 2JRLA 1MRZA 4BNXA 5JSZA 5I7OA 4A9AA 2DH5A 2QX4A 2X3UA 2EKQA 3BS4A 3PLRA 2JAOA 1WSWA 3UHJA 3ZY2A 4EW1A 2IXAA 3TW6A 1JPUA 2JANA 1A71A 1OUMA 5KQSA 1YL7A 4G8DA 4DNOA 2WTBA 4ENRA 3UMSA 2ZWOA 4CBVA 3UATA 2PZMA 4OX9Y 1UIMA 5M3BA 4ZEWA 4B7CA 4FI3F 2GCOA 3PQ4A 3IP3A 4CKCB 1SPBS 5J2TF 3RRNA 3TZHA 3QWHA 1OYVA 3HV2A 5LL6P 3GY0A 3SS7X 1W5EA 4FC6A 2IU0A 3WLKX 3GJ0A 2XKKA 3EOAI 3M49A 5CX4A 3VBEA 3I32A 4L75A 4BATA 4QBHA 4ZT7A 3FYUA 3T7SA 1SWWA 2FHPA 4CN8A 1R8JA 4BMSA 1M0SA 2E55A 1E7QA 1JQAA 1XTQA 3NAGA 1NPTO 3O93A 1HFWA 4TT3D 3TIXB 2K6GA 4B4OA 1YJBA 2JI8A 3DFFA 4PR3A 3C1UA 1G20A 1RMTA 4V02A 4X93A 3MAAC 3SI7A 1NNLA 3GLHB 3BE8A 5EZ6B 1R6DA 4EBFA 3ICVA 1ZN2A 2DQKA 1R16A 2CY0A 2QZSA 3DEHA 2FOIA 2MTBA 5JSZB 1FBNA 4MVJG 4QRDA 2H1OA 1C9DB 1NMEA 1EVZA 1O4WA 1C7JA 1N3LA 4AT1A 2QLNA 3FHOA 2L17A 1FQOA 2JIQA 3MJRA 1A96A 1TADA 1OF1A 5BT9A 2ZJ3A 4W5WA 3AF6A 3WLFA 2IUFA 1S3SA 2VP4A 3KZ1E 5AXDA 3SYLA 5IABA 1AS3A 1FUYB 2GCOB 4UM5A 3DPUA 4W1QA 4RD4A 3CH7A 3PTZA 3BE4A 3MA0A 1B0AA 2NAPA 2WSYB 4LECA 1J99A 2HUNA 1SCIA 1ILEA 1KO8A 3OHPA 4JUFA 3FYUB 1QRSA 1BIFA 1XK7A 2V7GA 4GC9A 5C8YF 1PHPA 2W48A 3GJYA 1M8FA 3CVVA 1K6EA 3SLRA 1CUBA 1F2UA 2YWFA 2I6FA 2AZ4A 3F1LA 3HN6A 1G20B 2QU7A 4H1TA 4J1TC 2KS6A 3DLBA 2PAFA 4X7RA 5GP1A 5AVQA 3DH0A 1HDRA 3O2NA 3I64A 4X92A 4R9VA 4X1YB 1A7KA 1SXHA 3MRTA 2BKUA 4PRLA 5BWOA 2H4ZA 5K6AC 2NPOA 2RONA 3AUSA 3IV9A 2IYRA 4H08A 4R1UA 3IOEA 4YGYA 5HBGA 2V1UA 3PA8A 4WKBA 4LXQA 1YR8A 2P6MA 3SQNA 3NZEA 4FEEA 3Q5DA 4NTZA 4PZLA 1QLHA 3RTEA 3PJRA 1Y1TA 4JI0B 1QX4A 1JB9A 3JQPA 2NYAA 1QAMA 1ZZGA 1BX0A 2BVNA 2C2GA 2C9DA 3HU2A 3N74A 3Q3HA 3W1EA 4E5KA 4O3MA 2Y1GA 1ZRHA 3MGBA 4YP5A 1JG2A 1JR3D 1MOPA 1ZL2A 1UPXA 1IQUA 2X2PA 2ZIUB 3MCTA 4HYEA 4UTZA 1U4NA 3V4VB 4E6PA 4BC0A 2QW0X 3TQFA 3U9LA 2QN9A 1JHVA 2X76A 4FCWA 4TKZA 3LQRA 1H8EA 1BA2A 1GL6A 1WP9A 3PXGA 3A06A 3NWEA 3MTQA 4L0CA 2HA6A 4MICA 4UQOA 3UGKA 1G0NA 2OV4A 3HEMA 4BJ1A 5CP8A 3HCEA 2AT1A 3ZPXA 2UVPA 1X19A 1SUSA 1M2FA 1O9BA 3IEXA 1D5WA 5A5FA 1I1OA 1LBEA 1GPAA 3WMRA 1GVHA 1XU7A 2YOFA 4KBFA 4WDQA 1X92A 3IURA 1QQTA 2QD2A 4X8OA 3WYCA 1XRQA 1RP1A 3A9RA 2PJRA 3IPRA 1TE2A 2FLVA 4DQ0A 4W8HA 2F9FA 4U7JA 2K5UA 3OMWA 5ALIA 3EOZA 1FRNA 2JFVA 4HRVA 4C5BA 1PV4A 3BIJA 1EM8A 4IG4A 1R10A 3S2EA 2O3RA 4WT7A 1W8IA 2BTOA 1QGOA 4M8SA 4NMWA 3UKJA 5C18A 5I5EA 1JQBA 3BB1A 3JD0A 3K9NA 4I6JA 4OFBA 5JBIA 1PFVA 4MPPA 2C7RA 3UUEA 1AKYA 4DLWA 1OE0A 3QMMA 4HRAA 4JH0A 4PYKA 5F5NA 4BGIA 4LY3A 2JIZA 4HRYA 4UU8A 4ZCRA 2C7BA 2HFKA 4I14A 2LD4A 5LIPA 3C5VA 3CZRA 1MEOA 2JVIA 3N2GB 3UA4A 4BX3A 4BP3A 1ODIA 4WBXC 2P2SA 4D9CA 2JLVA 3BWXA 4YALA 2GFQA 4L5CA 3MOIA 4F9GA 4FQ8A 3TTVA 3A4VA 3HCFA 4S1PA 1VMKA 2UVPB 4TLBA 4UM9B 5A6VA 5K0GA 1MW8X 2O5EA 2Z5FA 3UWMA 1BWSA 3C3BA 4JJKA 3SIXA 1P9OA 4AUMA 5I7VA 2PIDA 1XEWX 3CHYA 2MJLA 3E9MA 4RPIA 5K03A 1U63A 1JR2A 1TX4B 2PXCA 2QKYA 3QFTA 4K0RA 4EF4A 2YZ7A 3KHTA 4MV3A 2ZIAA 4OH1A 3Q10A 1WQ4A 3QEJA 3TSWA 4YMTA 2RCYA 4E2ZA 5AHXA 4OLAA 1NQ5A 3QNWA 3BYZA 3L8MA 5E2BA 3U09A 4MV9A 4PWYA 4YQEA 3EVBA 4BMCA 5I7SA 5DWQA 5KQPA 3MRXA 1N5MA 3PCTA 1EFPA 1NBIA 4JIGA 1MIOA 3IL2A 3NYIA 1P1HA 1FFAA 4TQ9A 3H19A 4D80A 1KDTA 3ZWMA 1Z6YA 4IICA 4CNQA 2XZPA 4C1NA 4F2HA 2XXAB 1LPMA 1ODFA 5FWYA 4XEHA 4FILA 3OLXA 4QDZA 3VFDA 1KEVA 5EHGA 1WJGA 3BDVA 3GQVA 5DHTA 1N9KA 3PC8A 5JR3A 2Z2YA 3IAHA 4PSKA 3MTEA 3SZRA 3ZU6A 3HR7A 4IEFB 4EA6A 2F55A 1I6MA 2XCQA 4QD3A 3K15A 5E3HA 3NO4A 3VOSA 1U3CA 1ZWKA 2GA9A 2JHAA 1WXIA 2D8AA 1DCFA 3CW8X 5ICGA 3G85A 3WI7A 2CD7A 4ZD6A 3GU3A 4YR7A 5BXQC 3KEFA 1AUQA 4BLOA 5B30A 2M6KA 4M0CA 2AZMA 5CNJA 3RUPA 2FZKA 1P7PA 4K6FA 5JU6A 2OL4A 4HN4B 1NXQA 3AL3A 4YV7A 3HXOA 2KE5A 4CM9D 3M1IA 4H4EA 3URMA 2VQ3A 2OM6A 4HS4A 2J6IA 4P5DA 4AWAA 4B6GA 3FPAA 3DFZA 1K5HA 3T3OA 1EFPB 2WUFA 4BVHA 1MIOB 3A6DA 1IBKB 4EFNA 4YP0A 2MU1A 3H5NA 1NXTA 4GVPA 1AURA 2DHRA 4HC4A 3DBVO 4J7XA 5FWYB 4ANFA 2R8EA 3MWGA 1V5FA 4OMFG 1NLMA 1PG2A 1U2PA 3OESA 3K2BA 3UK0A 5JEEA 1AK1A 3BK1A 2C7GA 1E3WA 2WAAA 4CIAA 5I45A 5MN6A 2WU1A 4INOA 1T10A 2JLYA 1Q5PA 5H68A 3UK1A 1VPVA 1UBLS 3KO8A 1KYTA 1KY2A 1V37A 2BCEA 2E21A 2KX7A 2F1KA 2X58A 4LMRA 4X3CA 4CLOA 3B3JA 3EXIA 5I5GA 3K1JA 3AW8A 3D5TA 3TYXA 3ZNOA 4EPTA 3FFXA 2NADA 2P27A 4RA9A 4ZT6A 4Y6PA 3VR5H 3WTCA 3I1IA 3ZN2A 1Q7GA 4DA7A 1Y7LA 3RSSA 2X8WA 1EFCA 3PGA1 1MQAA 3WZLA 4NZZA 1QGUA 1YIOA 1AO0A 4LF5B 2IEBA 1GUAA 1A97A 1KK3A 3DV2A 5F51A 1H5QA 1O6FA 1OXTA 2AYXA 2PANA 5H70A 4M6WA 2MYTA 2I76A 2FFRA 1TD1A 1ILWA 1MC4A 1NBMA 1PWXA 1VHJA 3A25A 1GNRA 4OV6B 1AU9A 3UJPA 3U3JA 5L9AA 3K1AA 1GA1A 3JQGA 3JQEA 3UJAA 2GDJA 4WBSA 1T5LA 3D64A 3V33A 1KAEA 5AW8A 4LSGA 1G42A 4Z8YA 3MOSA 5D8DA 5CM8B 5I7EA 4UM7A 1APBA 1YJAA 1YTUA 1I7NA 3T9AA 3MWDA 4I8IA 4WJZA 5ITSA 4N3CA 5GZ1A 5CYGA 1KYIA 4JUAA 3ZWVA 3EPPA 3I2KA 4RTQA 1F7UA 1HLFA 3FMIA 4ZC8A 1C9EA 4XSHA 5IK2A 4CLOB 3MAGA 3HJGA 2PGLA 1HSOA 1TJ4A 1Y9JA 4U7PB 4E7OA 3EXIB 2AEFA 2D1YA 1E9SA 5AUPB 3V9PA 2O7SA 4N12A 3TNJA 1AA6A 1PW5A 1U5CA 3HDYA 3ER9A 4RA9B 1PR0A 4E5UA 1QR6A 5L45A 3LHSA 1KI6A 2I5PO 2QJWA 4V0SA 2E5LB 3FTFA 1TQ6A 1W49A 4AMZA 3QE2A 5FPPA 2BMAA 2C61A 3AP3A 2QG6A 1JR4A 1DAOA 4BFLA 1N2CB 2A67A 4W5NA 1L5KA 5BW4A 2JEYA 2YWXA 1GAJA 4XM0A 1QE5A 3PHJA 5TQ0A 2YWCA 1JALA 2PKWA 1NVDA 3K1AB 4NCXA 1A95A 3DMPA 1Z2DA 2D3WA 1YS2X 1ESNA 3X3HA 3PFKA 4UZEA 2C92A 4B4VA 1UJ5A 1GNSA 1RJGA 3I9MA 3SGLA 4D44A 1U2DA 5FBLB 1W0KA 2XBMA 3MUEA 1E79A 2PLNA 5HF5A 2QD4A 1GQYA 2HYDA 4MGIR 5AJYA 2FPRA 5T4EA 1SVWA 3MWDB 3LKBA 4MLDA 3NYRA 4IJMA 3WGMA 2DERA 1P1IA 1YL5A 3QOYA 3MCWA 2AOXA 4EG1A 2HJHA 3IELA 3P0RA 1VP9A 2C5LA 3V4OA 2ICAA 4I5IA 4UBKA 4HVLA 1SWVA 2WWHA 3PRHA 1SU8A 2GQ0A 3T61A 1EZZA 1KI6B 4N0PA 3UMMA 1ZK4A 2GTPA 4YMUA 4YO7A 2IIVA 5IKMA 2J09A 2PA0A 1EMDA 3MYRA 2C42A 5CAEA 2AKEA 1OC2A 5FP0A 4GX5A 4LW8A 3RC9A 1TUEA 3TSZA 2W90A 3UJ9A 5TQ0B 2ZI3A 5GJVC 5SYMA 3CUEF 3W2GA 3E81A 3P8ZA 5T4BA 3ET5A 2RH8A 1V35A 2E37A 1JXOA 5GQSA 1QUFA 5ENZA 4KWTA 3P2KA 1CSEE 1E3MA 1FNNA 1LWOA 2DU8A 2HRCA 4EAAA 4FIDA 1JA1A 2J9GA 4RD6A 5MHTA 5EE9A 3QXSA 2I62A 1S9DA 5A5DA 5EJMA 3GGOA 4KPYA 5KOHA 1E18A 4I1YA 1A9RA 1XE3A 3BJRA 4GBJA 1EUZA 1ONPA 2G08A 1IPEA 1AKTA 3GJRA 3WKCA 4DCNA 1AQYA 1NUUA 1SK8A 1X7YA 4PHGA 3A9UA 1Z5NA 1JHOA 5D2CA 5LMUB 2FN7A 2OMKA 4IDDA 1KAOA 3OZSA 1YZVA 4O2BB 3KWMA 3IYLW 3BK7A 3KPWA 4KI0A 1INLA 1CUZA 3H4MA 3U7GA 2O3QA 3N87A 3CLSD 4PTZA 3DC7A 5LQNA 4ZCQA 5E4YA 1IY2A 2PRSA 2ZBGA 2EP8A 3MJVA 1E3SA 3A3YA 1ATIA 2FPWA 2A9JA 4BLSA 5BPFA 2FR0A 2ZJZA 4R31A 5CNMA 5G2OA 5EKTA 1C4WA 2HIGA 1JIJA 3GYBA 3GRRA 4I36A 3BILA 4QRIA 1OXBB 2WTEA 4Y6GB 1YFZA 5CURA 2P1DA 3RSFA 4BVJA 3MJSA 5DIFA 2C2KA 3J81k 5I4IA 3TMKA 1DIGA 4UEJA 5IVKA 2NPFA 4B46A 4B8ZA 1Q0ZA 2EVWX 3DNMA 3SKXA 3SSOA 3NHKA 4BGEA 3KPUA 1IOLA 2H4JA 2QL7A 2Y2VA 5KOHB 2D13A 2RE8A 1RQLA 5E9QA 1DKUA 4C4YA 5IAAA 4JKIA 4N5HX 5JASA 4Y2RA 4C01A 2CFCA 2XB8A 3MS7A 1X7YB 3OCYA 4NICA 4PQFA 2XUKA 3ECCA 1SVIA 1WU7A 1GQFA 1A77A 2JHGA 1QHHA 2B36A 3G8BA 3N2KA 1E0JA 3PQ7A 4GX1A 4N6OA 3GAAA 3AM1A 1FSGA 3V4ZA 1ZLXA 3SBDA 4C1BA 5CGQB 3OJWA 2GRJA 4HDAA 1I0ZA 2YXDA 1Z18A 1W0JA 4RJKA 3WL6A 2IS1A 1NRJB 4UPEA 4BVGA 3P9ZA 1C1DA 4WN3A 2OK7A 4C7OA 2C3YA 2FU5C 5C46F 3RREA 4GOKA 3D8NA 4LJKA 2PZKA 1XRRA 3AEUA 2GCIA 3C74A 1FDTA 1AO3A 3QX9A 1D7AA 2TMGA 4ARSA 1CRPA 1E2KA 4UUQA 1LNZA 1O95A 2ZI5A 3QKSA 3HJTA 4HGYA 5IHXA 2AOVA 4ZJYA 3ASZA 4M0EA 4U2KA 5JROA 2VBFA 4NBWA 3SIRA 1J0EA 1R6AA 3IBCA 1DDOA 2EBFX 2Y66A 3AW9A 2OO7A 4AZ3B 3QNUA 4BAGA 1P81A 2C0CA 4O8ZA 4WI1A 2P77A 5F3RA 4ETIA 3DULA 3DT6A 4Q0MA 3NDJA 2L2QA 3LA6A 3N2KB 3S3TA 1QHHB 1R1DA 1IJBA 2OGWA 4F7DA 1V9SA 4HI0E 2W6QA 5ESDA 1BOOA 4FEYA 4A03A 1ANKA 2ORWA 3ZBQA 1IZZA 3NTRA 4HWKA 1DOAA 5DN9A 2VAXA 4BNNA 2YZGA 3DOUA 3B9PA 4EPRA 5L4SA 1KYVA 1Y9EA 2ISQA 3OKAA 5CB6A 1DELA 4DIKA 4QUIA 1FL9A 3DMTC 2HC9A 1ZXXA 1C1DB 1G2QA 1UZMA 3B6ZA 2IWHA 4C7OB 2GM9A 4WGGA 5BVHB 2Q3LA 2OKCA 4OGKA 3R7DA 4M9ZA 3AEUB 4NESA 1SG9A 3NEPX 1VZ3A 4H17A 1NASA 4GE3A 2OQIA 1ISPA 3QKSB 1YZ3A 1SA0A 5B3KA 1WXGA 5L3ZA 1TM3E 1ZIOA 2CUKA 3RVOA 1HNWB 4BYMA 2RH4A 1M34A 4KH0A 4QGSA 2O19A 4PAOA 2LKDA 1W5SA 2CNOA 1I4OA 1E99A 4EX6A 4YI3A 5BV0A 4MDYA 3CZAA 3DMDA 1N57A 2BFEB 1VBMA 1QIEA 2VK2A 4FGSA 4HRXA 3ZKWA 4IUDS 2WHRA 4RL4A 1E8NA 3QUQA 1G98A 1JLMA 4X85A 5G0SA 1IWBB 1L2TA 1MH9A 1Q0LA 3WQSB 3VU1A 4ZV4A 3LPCA 2X22A 3B89A 2PWBA 4ZO8A 6Q21A 1G6OA 1I1QB 1JL3A 4H59A 2XQKA 2W93A 4D43A 1HE5A 1DKPA 1R0KA 4U0KA 4D4KA 4F93B 1JDBC 4N8SA 5E4FA 5CG1A 3T4XA 3VYSB 1E3IA 2XYVA 4OHBA 2RB4A 4Q03A 5HFJA 1Z37A 2G6BA 2I34A 1FS4A 1N4DA 1VGQA 3P27A 3E9RA 1WPRA 1KYQA 1PE0A 1TKRA 2FRDC 3QI2A 4CWAA 1XTUA 4OK5A 1RQ7A 5G0TA 4E5DA 5IJ0A 4ZEOA 4ZTUB 1LPBB 2ZRJA 1HT3A 1E5DA 1SA0B 4O1MA 5F9HA 3HXMA 3DB1A 3ONEA 4BWVA 1LPNA 3GFSA 2C3UA 4Y2TA 3TAUA 1WQ1R 2I3ZA 2PYIA 4E2FA 4WUVA 1S2MA 3R75A 3ZQ6A 1XMVA 4G5YA 4JASB 2OO5C 1NWHA 3QEMA 4YDHB 3IEVA 3VNUA 1P62B 2ODEA 3RPEA 3ZKWB 4JL5A 2O5VA 1VGRA 4NE9A 3OQBA 4U00A 4KAFA 2JW5A 2FN9A 2DWOA 2NVOA 1TK2A 4RMHA 3E58A 4WKGA 1RMYA 2DHEA 3T3GA 1QYDA 1A27A 2ZPUA 2FSIA 3AERA 1IEWA 4WK6A 4OJTA 2AG6A 5A2GA 2ZXUA 1AVTA 1NBAA 2PZGA 4G0OA 1TZ2A 5FPTA 5JO9A 2WIKA 5CD1A 4E5MA 3KOOA 2G83A 2YXLA 1K6JA 3FSGA 3S1AA 5IVHA 4OREX 4CMBA 2IIBA 1E64A 4JVLA 4WERA 1HT0A 2QUJA 4Z0TA 2H92A 2HR1A 4JYAB 2FZWA 3TZ6A 1TNDA 5KSZA 4L4RA 4CT5A 2HXSA 4G1VA 2WWYA 1UDXA 2GXAA 4BLTA 1ZGHA 1CQIA 1QOQB 2OXEA 3W7BA 4DEXA 1IAVA 3O84A 4HP8A 2WD9A 4Q39A 4Y2UA 2FLKA 3HB0A 3QEMB 1OOEA 1GNQA 5ES3A 1DAMA 2JJQA 1H2FA 5A62A 5TQVA 1GZ5A 1O2DA 2WU3A 2ZDQA 1F3LA 2R8OA 1JHMA 1L4UA 1D1SA 3R3SA 4IOLA 1K2WA 1SXJA 3UC5A 3TFOA 1NFQA 1XGKA 4D8VA 3NC1C 5EMMA 5ALEA 3VX3A 2WV7A 1O7JA 4OXXA 1PZMA 3OY7A 4HTFA 4NBLA 2DQYA 5A3VA 1CHDA 4XTRA 4B2YA 1G6Q1 1GUYA 2W2LA 3AERB 4YC7A 4EEXA 4NMLA 3E5MA 4HLQB 3C5WP 4ZO7A 1X3SA 5K3OA 2VNSA 1T29A 2ORIA 3EN0A 5FJIA 4F5YA 1T1IA 4P5EA 5LQCA 1DEXA 4O33A 4TVOA 5CPBA 4EI8A 2WAYA 3CRMA 2EG5A 5AH0A 1DG9A 3RTDA 4GUAA 1P6QA 2FQWA 2PM8A 5I6DA 1G17A 2CDNA 4Y1EA 3B38A 4NLLA 2ZR9A 2HHAA 1UJ4A 4S3MA 4A8TA 2WG0A 1AX9A 3GJ5A 3JYQA 3U7IA 3DA8A 4FUQA 4HZUB 5FPKA 4K9QA 4ID3A 3QKIA 3FPFA 3CLUD 1CQIB 1OZFA 4F4HA 1TEHA 5C8YA 2ST1A 2AW3A 4AP6A 2CDBA 3TD2A 1FYDA 4LG1A 3WGHA 2E48A 2D3TA 5IKXA 2GT1A 1G0OA 2GBGA 1FSFA 1CVLA 1JA0A 2F2TA 5E7JA 1SXJB 1P2VA 4UNSA 1PL7A 3M9XA 4ZDKA 3NAZA 4DV7B 1JEYA 1A2OA 1DVRA 4CNBA 4UE3S 1HORA 1IMOA 4X64B 2VRWA 2M6RA 4PTYA 3T7TA 2ZJ6A 4RK0A 10MHA 1FMJA 4KACA 5T41A 2F3RA 5IBQA 1EFDN 1KJQA 1F2TA 3D4IA 3JVEA 1TVKB 1JTEA 3FTPA 1OHHD 1P1CA 4UJ5A 1T3GA 3ZWNA 2C9BA 4TVBA 1H2YA 3NKFA 3SCZA 3U3RA 3QOWA 3UB3A 4B7AA 4F2DA 2GEUA 3O74A 4MYRA 1QQ6A 3GR6A 3O4FA 1RLOA 4PO9A 5FXMA 1BE8A 4B6EA 3OOJA 2Q49A 3N28A 3TCNA 5HJ2A 1B1CA 3GPLA 5C7IO 3FHCB 1U0BB 4YJGB 1RYMA 5M5BA 3D3WA 4QFMA 3IAM6 1GFZA 1T6NA 3TB4A 1FRZA 4RENA 2I33A 3DR5A 3GUUA 3KJFA 4M21A 1YXMA 5B7QA 5TNXA 5AESA 2OB1A 3O73A 1YL6A 2JI6A 3ZX4A 2PWPA 3MMPA 1J06A 1HE3A 3ESRA 3KQWA 1WZUA 4IWXA 3RWBA 3TL2A 2XVAA 3WGGA 2QL5A 2B94A 3I3OA 1DIAA 1KE1A 2ZXEA 3FCSB 3ZWKA 2GEKA 1L5YA 1LKZA 1BW9A 2PLWA 1KERA 2XCIA 3HI6A 3O8QA 4J2TA 3QVUA 1SZCA 3CC8A 3FRIA 2ZBUA 4UAVA 4UM8B 5ETJA 1ZM4A 3LRTA 4GH5A 4Q3DA 3WADA 1L8QA 4JEMA 1KYWA 1PQ4A 3TPCA 5CR9A 3VV2A 3W6NA 1KVSA 1R0BA 2EZUA 1E0AA 1CLEA 5CXQA 3LQ1A 1AUOA 2BFMA 2OILA 3I52A 1T4CA 2RGGA 3PDCA 1PZXA 1R9MA 2JCGA 3WIOA 3R9KA 2VP3A 4MVJI 2XUPA 3D3WB 3GUZA 3T9EA 2H5JA 1EWYA 1SB8A 4JX8A 1AMUA 4N41A 1YS1X 3NVMB 4EGJA 2ZUWA 4UARA 4QLBA 3DHVA 3GMSA 3AHHA 3BGWA 4BNKA 3CF0A 4N3AA 5FO0A 3LM8A 4CMEC 2LCFA 4XI9A 4B6FA 4BFZA 3ABIA 1N1EA 2XBUA 4ZCPA 1BH2A 1M33A 1T9KA 2G1AA 3MXTA 4ZZ1A 1BW9B 1UZUA 3O8QB 2A30A 2P3SA 1Q7RA 3F3MA 4TWIA 1U6JA 3CVUA 4IX9A 1ESEA 2ZITA 3T3EA 1N1DA 1LX6A 6ADHA 2FPPB 4YWHA 4GZ5A 4CV2A 3UBTA 1NT2A 5COQA 2IQIA 4KV9A 2R5WA 1IHXA 3TAHA 3EPLA 3TLXA 4GRDA 5DHPA 1T4CB 4N0QA 2OTCA 3F4LA 4PC3A 5JCZA 3FG9A 3E53A 4H3HB 4DUGD 3OKFA 2DPLA 3GRUA 4WZBA 4EY8A 3GLFE 2UUAB 3DOEA 1E1RA 2VZLA 4R2WA 1CU1A 1I4WA 3RFFA 5LVAA 2IGTA 1GY8A 1I4LD 4NCHA 2DEUA 4M38A 3QSYA 4PXSA 3U4IA 5IZ4A 3Q87B 3PUWA 3LUCA 4OD0A 1BTOA 1X3LA 3V4RA 4OQXA 5GINE 3ND5A 4CF3A 3LFTA 2BKLA 3OAAD 3VOBA 3MBIA 1QYCA 2VPXA 5E1OA 3R8FA 3I62A 4R83A 4RQBA 5EJ7A 1NUQA 1UEJA 4MUYA 4YLGA 4Q1EA 2PJUA 4NV0A 3OCUA 3RRYA 3NWJA 4GPAA 2IS6A 1J42A 1GTSA 1JAHA 4QVGA 4RELA 3D0QA 1YI0A 2NXJA 3CA8A 3EQ7A 4K2AA 3G89A 4ZOAA 3SQMA 1CRQA 1A7UA 2Q6LA 5ALHA 3MQ2A 1V47A 1DUVG 1ZC4A 2E18A 1JIVA 5CYPA 5AKGA 3C24A 1NONA 1U0TA 2ZI6A 1HDXA 3LOUA 2OCYC 3S2YA 1U3TA 3AIOA 4ZOLA 4IV0A 2I2AA 4QGHA 4XVHA 4OHZA 4KLCA 1UP4A 4L5JA 3VH2A 1XCBA 4DLVA 1BVYF 4KR3A 4PLZA 4WZBB 3GLSA 5LZ9A 3QTTA 1YDGA 2DBQA 4MR7A 3NIGB 2QW8A 2P90A 1CF9A 1G5TA 1Q50A 2PG3A 3ELUA 4OP1A 1BDHA 3ZXYA 1G7TA 4YDQA 2FWRA 3OLQA 3KD2A 1G9SA 4XYLA 2NTYC 4QBFA 4CV1A 5T67A 5HZKA 2ONKA 2KSQA 2CFTA 4QNRA 1JQKA 1QVRA 2OORC 4PLVA 3TDMA 1L9XA 4HDNA 3QUTA 4LDJA 3P9IA 4DLSA 3WGYA 4EB3A 5IDXA 2VQFB 1TYEB 2CVPA 3I2HA 4GF5A 4YJKA 2X6QA 4ZEMA 1XZPA 2VJDA 3L7YA 2OV3A 3IP1A 4WV3A 4TXHA 4HQNA 2Q7XA 1X1QA 1CIJA 2Q0QA 8MHTA 4QPNA 1Y81A 3NBFA 1M6VA 2VRBA 4HG2A 4ON9A 5I3CA 5E95A 1L7QA 3HYRA 4PGAA 4RYDA 1PGQA 4V2IA 4D42A 1Y6ZA 4P08A 1NL3A 1AH2A 3GRVA 2B99A 2JLBA 1E0DA 2V7WA 1QK4A 2Z09A 3NOVA 2VSYA 3OIVA 4QPDA 2QQ0A 5MN5A 3LT4A 4IDCA 3WJAA 3MUFA 4UFPA 3H5IA 1MZPA 4ZMBA 1UJBA 1SURA 2NGRA 2B3TA 1DZ3A 2ZU6A 5AI4A 4BJ5A 1IUKA 2G63A 1I13A 4MR7B 4UCQA 4DMFA 3KE8A 4B0OA 1CUJA 1X8JA 5H4GA 1Z3IX 5AVOA 3WLRA 1F14A 5CH5A 3NRJA 3GL9A 2TS1A 1AG9A 2O3JA 2QN1A 3KR9A 5CNIA 4PVDA 3TH5A 4WACA 5K3SA 1E7YA 3PHHA 2L19A 4H18A 4PHFA 4TTAA 3DGFC 2QXUA 1DBRA 2XV1A 1W88A 1WEKA 1XPJA 3CZ5A 4AY5A 3ITEA 4L0DA 5HK9A 3ILSA 3KOZA 1XZAA 1J4AA 2A1UA 2IF0A 4Y9UA 3MN1A 4WADA 4KQWA 1E6KA 3L7BA 3WMEA 1FDVA 1M6VB 4FU0A 4YV0A 5A06A 3LHFA 5DM0A 2AZDA 3TIVA 2LZ0A 1C80A 1WMAA 3SJZA 3WXMA 2XCLA 5JJCA 1P1JA 5HIIA 3TCXB 2I4NA 3G7NA 2JH3A 2NX2A 2VQ6A 3AK4A 4N18A 5CBKA 1H94A 3BICA 5FOQA 1DEOA 1OFHA 5DGTA 3CNNA 1AZLA 3RYHA 1Q1EA 2PFKA 1PNTA 2W2QA 3OEED 3QPDA 4MXDA 1F8FA 1I3NA 3LC0A 4MULA 4OYRA 1SOUA 2Z8YM 1P5ZB 4PV7A 3S5JA 5DNCA 2G9UA 2JFXA 2XB2A 2XMBA 3MQFA 4NK4A 2F00A 2SKEA 4UNIA 5JQGA 1QG4A 5C1OA 2XLBA 1UP7A 4KWHA 1HFKA 2JIMA 2YV4A 4LXHA 2FX5A 5HF8A 4GXQA 3PGLA 1W88B 2IHTA 3VO2A 2I0FA 1MMFB 3AEZA 3WGOA 2YCLA 2XYQA 3PGMA 3NXSA 2BFPA 2C4MA 3BERA 5E8JA 2JLWA 3GLIA 1COWA 4WLOA 1DGQA 3T1VA 2VJNA 2X1MA 4LI0A 3UJBA 1K89A 3W3AH 4F45A 2FN3A 3KFXA 4N03A 3QVOA 2GZHA 1XG5A 2HK8A 2ORED 3FZGA 2QPLA 1XFAA 1ISIA 3GNLA 1Q0RA 1DDGA 4OQZA 1XLTA 5F52A 5HFNA 4BX8A 1MT0A 2CLOB 2QROA 2VHJA 1A82A 3B3AA 3BXOA 3QQ5A 1OH8A 3AIKA 4WXMA 3SN6A 4BFXA 4EW6A 4ZAFA 4CQNA 4L76A 5HDQA 3RYHB 4EW2A 2ZW9A 4EF6A 5KBYA 3G2HA 2D5BA 3DE7X 1X7HA 4ICIA 4GOND 2J0EA 2QL9A 4UZSA 3RHTA 4B2IA 1YS7A 3BL6A 4JROA 3OJ0A 4M1ZA 3X1MA 1PUJA 2R1VA 1MKYA 1P1RA 1RXVA 5U4XA 3DOJA 3UBMA 1T2AA 1ODJA 4XIIA 4KIFA 2P9HA 2ECQA 2ZRHA 3EAQA 4H6PA 5BSUA 1VCHA 5F7OA 4YV2A 5K20A 3MBOA 4K6HA 4YRPA 3Q7RA 1E9AA 1S8NA 5FUWA 3RUDA 5IBCA 3QW4B 4CUJA 4WXRA 3A3KA 4C89A 5F9MA 4NFSA 2FW1A 4O02B 5KYXA 1Y1SA 2ATVA 2HLDA 3D2LA 3GLIB 1RWQA 3C48A 1IHOA 1W2GA 4Y7CA 4UVHA 3ZW8A 1DTSA 2Q3MA 3ZBUA 5M2QA 1GGJA 3N2EA 1I6WA 2KYRA 3TMAA 2WG1A 4WBNA 2IX3A 4DUYB 4EKYA 2C0PA 1RWMA 4DSZA 4MWOA 3LKZA 4QU0A 4YCAA 4DIDA 5BMOA 1UDBA 4ZPJA 2FYTA 4F4JA 1IY9A 5AJXA 4BFUA 4G0NA 2JB9A 4QUBA 3SHTA 1QRTA 1OGIA 2HSWA 4MV7A 4AX4A 1OAAA 3REOA 4ZI7F 1UPAA 4V39A 3A9CA 2EJWA 1ACLA 2WU4A 3II6X 1I3CA 2AOTB 3ODGA 2R1VB 1SHZA 4IOKA 1RQNA 4CM8A 4R9UC 3HKBA 3PA6A 5KKAA 3BEOA 4GI5A 4MQFA 4BVEA 4DARA 2BF4A 2BFAA 1U0SY 2A4KA 1PGOA 5GGXA 2V3CC 3PCRB 3GZTB 1EVJA 3NBMA 5D5QA 1SH7A 5KYXB 1PL6A 3KKKA 4WZZA 2FSFA 4NABA 3IE2A 3B2NA 3I04M 1WHTA 3D31A 3ND9A 2BMFA 3GJQA 1XUOA 1Q1BA 2ECPA 1JQJC 2A92A 2R62A 3PB3A 4MLPA 1HYQA 1XV5A 1CR1A 1TEXA 3PQCA 4OBWA 3TBFA 3VTAA 4D3DA 2PUAA 4MQEA 3AJRA 2H7XA 4NBSA 4PAGA 4RMNA 4LJ4A 5KHOC 2OM2A 1P75A 1Y7PA 4WBNB 3ZE0B 3U61B 3DZKA 2IVZA 3AR4A 4I4TF 3GCWA 1X0VA 2AMVA 1YRHA 1QRRA 2B5WA 2WKWA 2Z3ZA 3OQ1A 4UBLA 4XB1A 2WYOA 1CEEA 3LZDA 1UFKA 2B8JA 2EL7A 2EF1A 2QYHA 4UXIA 3U4GA 1F5SA 1HRKA 4QOJA 3M1LA 2HPZA 4YH1A 5E4TA 2QR2A 4HYTA 1YK1A 3G2LA 3ZQKA 5L3VA 1RD4A 4UTXA 4E4RA 1TVCA 5D87A 4CM8B 4P83A 4TYWA 3A8TA 3V8NA 1VKRA 4D5EA 5IEJA 3ADDA 3OI7A 2Z83A 2W0SA 4MQFB 4B9AA 1GDDA 2WSMA 3AETB 5KYVA 1CUUA 1A9OA 1CE8A 1GPBA 1SVSA 2X7XA 4NCNA 2C1XA 3CLTD 4ONEA 4MIYA 3ITKA 1TXGA 1S5PA 1YS9A 3RJMA 1SVKA 3DFKA 5H9VA 2QJFA 5CXXA 4ALJA 3CLRC