4ZEMA

Crystal structure of eif2b beta from chaetomium thermophilum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
382
structure length
328
Chain Sequence
PSLATWTKSLRDQSLEASIESLIFLLKRRQVTGDECAGAIAQLLRQVVAKSKWHDVDQLLYRVQTAGARLARAAPHEPVIGNIVRRVLGLIRDEASDIASDAASDIQSKSMFNLLSVQPFSVHALRSEVMDGIEEILDEINQADDQIASFAEIQIHPGDYVLAYQPSKTVERFLVKAASKRRFTVILASLNPQPYAALRKKLNAAGVSTINLASNGLMAYIPRVNKVIFGAKAVYQNGGLLVDSGACIAAQAAHEYLKPVIALCGVYKFCPEDPSDEVSRGELTTTDYIPPDLVDVYLTNLGPQTRHHLGGIYADHYKIEDIGFSLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF2b-like protein,Translation
publication title Architecture of the eIF2B regulatory subcomplex and its implications for the regulation of guanine nucleotide exchange on eIF2.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
total genus 115
structure length 328
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 4zemA02
5DBOA 4LDRA 1T9KA 2YRFA 4ZEOA 1T5OA 2YVKA 3VM6A 3A9CA 4LDQA 4ZEMA 2A0UA 1W2WB 3A11A 1VB5A 3ECSA
chains in the Genus database with same CATH superfamily
3DC2A 2AZ4A 2P9CA 1VE1A 2A67A 1EP2B 2WWGA 3S29A 3X1MA 1G2OA 4CMKA 2WSSA 4QXQA 5EKTA 2CSXA 1XXHA 4G5FA 1PSZA 1FY2A 1QYVA 3PUYA 4JLBA 1GV1A 1RM3A 2O0JA 4PNPA 1P1BA 1VL1A 4RELA 5BSKA 1II8B 2Q4TA 5A9TA 3VVCA 2LZ0A 2FVYA 3O5AA 2Q6OA 4A8HA 4GM0A 3AL2A 1U2ZA 5H68A 1UKCA 1B8NA 3PPVA 2QXUA 3D4PA 2C9MA 1DQNA 2XRZA 4O4JF 3ZCSA 1D1SA 1JFFA 1NRJB 3UV3A 3VX3A 3EXAA 5F78A 1CZLA 1H6CA 2LNDA 2RHLA 3BHMA 2B98A 3DS8A 4BS9A 4WMLA 3PPIA 4P34A 2QTRA 1EA5A 2VR1A 1NUQA 2FV8A 1UOQA 3R9KA 2ZUEA 2QT0A 1JHYA 1KH3A 4PCAA 4WI1A 2XOXA 4KO3S 3HCCA 1XDWA 2DCMA 3OTHA 4EW3A 3NUZA 2ODWA 3F1LA 1QK4A 4TT3A 4B7AA 3G9UA 4HAVA 4C04A 4J76A 4CMCA 4TZ0A 2JJMA 4UUMA 5A5VA 1OA0A 3G85A 4QWMA 1XQ1A 1J5PA 1F9EA 1T1RA 1C5KA 5FL7A 1DMRA 2F59A 3RR2A 1LSJA 4RK0A 2VUSA 3E05A 3JZFA 3NIDB 3HO6A 4OFZA 5AT1A 521PA 1UM8A 3PT5A 4B74A 2C04A 4IXDA 4G26A 4LZLA 4OXQA 4ILKA 3GRVA 1YR2A 3TS1A 4TLEA 5FI0B 3B6ZA 4CKEB 2WIKA 2ICAA 4D8TA 3R77A 5KVVA 5K0JA 2UU9B 2DBQA 1QO7A 3GVXA 3AKYA 2DFKB 2CXPA 1VJ1A 3NAZA 2GRJA 1YR9A 4OQNA 4F46A 4YRNA 3AEQA 1ADYA 1AT1A 1OYWA 1Z8FA 2ZUVA 4JK3A 4QATA 5FO1A 3VPXA 3W5AA 1ZD8A 1GEEA 2Z09A 2ZI4A 2C0QA 2QTVA 3PQFA 5REQB 1LX6A 4G09A 5CNIA 2UV8A 1BFUA 1UDRA 3GMSA 3KB8A 1FQJA 2EKLA 2ODNA 4H35A 5BSUA 4LXGA 1UH5A 2PT9A 4F9GA 4NNPA 1C8BA 1QYXA 3LBAA 4TV9B 3A4VA 4MUIA 4V24A 3WTBA 5C8YB 3DOFA 3ESDA 1IB0A 2XAUA 3LZ6A 3QVXA 1CZOA 1LK5A 2ZJ6A 3NIFB 3SYLA 5EJ5A 2CFSA 3IYLW 1TZJA 4JC5A 4L08A 1OBFO 3EUFA 4LI0A 4ZQGA 2ZAIA 5DTEA 1KZ6A 4L78A 2OAQ1 1QHIA 1OGJA 2XF8A 4PZYA 4MW0A 1KYIA 3HMKA 3RUHA 4AJJA 4ER6A 1W36D 3IQGX 2GN8A 3TG8A 1LVHA 3V4SA 5C2JB 4LISA 4MIYA 3JAMA 5JD6A 2I2FA 2WOOA 2J6BA 2JH8A 1ZD5A 3QK7A 1HO3A 4J0KA 5I9SA 1SEPA 3A4NA 4A23A 4J0EA 1C0PA 4ALKA 1XOIA 1POXA 3A1FA 1SKUA 3WJ1A 2C9YA 3T7RA 2HBZA 3ETLA 4TMKA 3M70A 5CHYA 4CDNA 1MVLA 4QECA 1BE6A 3O4JA 1XBTA 4IHJA 4BXOB 3QYPA 1NI5A 1A72A 2PUJA 4K6CA 3AMVA 3CHYA 3ICQB 1Q44A 4EB3A 1ZIYA 1X2EA 1FW8A 2ZBPA 2YJ5A 4W1PA 3VX4A 4D96A 4EF4A 4NDNE 5M7EA 3V6LA 1TM5E 2X1VA 2R8OA 4DLZA 4I50A 3VHXB 5ED4A 1NF8A 1T4MA 2JFGA 4EITA 1YO6A 4B5KA 5K05A 2GWHA 3HXPA 2YVKA 4FK8A 1E9FA 5B58T 2XA9A 3I6IA 1NDHA 1UMBA 2R44A 2ECKA 2YFKA 3CVUA 1KAEA 2ONCA 3I4FA 2NO6A 4TV8B 2QX6A 2E5LB 3RKUA 5CIQA 3NJ8A 4Q3LA 3OT5A 3QW4B 1DIHA 3FDFA 2AMVA 3RS0A 5CB4F 2HUPA 4OHZA 4GFDA 3LMKA 5GZ6A 1QHHB 1GV0A 1YI0A 3ROEA 3BD9A 1A82A 3TIVA 3EBPA 3FYSA 4AB1A 1E98A 1SB8A 3D3WB 1F38A 4DFDA 2A5FA 2YZNA 4UTOA 5CDSA 2J3MA 3CEMA 2Y9PB 3RC9A 4EG5A 1SU8A 2Q3BA 1RYFA 2FR1A 5CDYA 3A1DA 4FJ1A 1HI9A 1UK8A 2O8FA 4M1TA 1R7RA 1X94A 2UZAA 1HDIA 2P62A 4MSUA 4A5SA 5B30A 3OKFA 5SZJA 3FNBA 2IYXA 1UFOA 4KAJA 3WFZA 2AUNA 3GFOA 4QJ3A 3FWNA 3DBVO 2V1UA 3LLMA 2IEBA 2OD7A 2VH2A 1PNTA 3NANA 4U63A 4C6TA 5FAXA 4KXQA 3HB7A 4D0NA 1S2DA 3OQMA 1R9MA 1E9BA 3LXMA 4G0ZA 4M4SA 1QVZA 4ASUD 4P93A 4FSHA 3JWIA 4HNGA 1RHRA 1ORDA 3AESA 4MCAA 1U6IA 3BMCB 4OBEA 4R1MA 3IVAA 2WOJA 4DB4A 1ISMA 1UBFA 4PZUA 5FWXB 1ZOOA 4RVOA 2VJDA 3PS9A 3COWA 2HF2A 3RM3A 2H63A 3LUDA 2WZCA 4ZXPA 1J2YA 1ZNYA 1OX6A 2FSFA 2OLKA 4DIEA 5EVCA 2ECQA 2AOTA 4JXKA 3ZEIA 1ZJ4A 3PXUA 3C0KA 4BNYA 1ODSA 1ODLA 4RFSB 2O1WA 4LNUB 1DHTA 4HQRA 1GGHA 2WTEA 1SC9A 2G04A 2VDOB 2VRWA 3L5KA 3U5ZB 1UBUS 5FFNA 1Z3CA 1M2OA 4MUKA 3L9XA 2WF7A 4KIJA 3Q40A 1IK4A 1H6DA 1QQAA 4PS0A 1LBIA 2I2WA 3I8OA 4IDDA 1N57A 4CKBA 2NLOA 4IXTA 4OHOA 3K09C 3TR0A 2BEJA 1R4MB 3RAPR 3ZY5A 3PHHA 2G9RA 3FBWA 4DUYB 2GX6A 1IVSA 4YI3A 4EPYA 1YUBA 1D8TA 5JYDA 2EGGA 5BXQC 3W5IA 4F6RA 1UZUA 2YYSA 2B8EA 1Z36A 3L2OB 4QGBA 4L8FA 2B30A 3SLKA 3CLSC 3OE7A 4K26A 1JWLA 1IWOA 3Q2OA 3W8DA 1WD7A 1KI6A 1W2GA 3H8VA 2OK7A 2WAXA 3RVDA 3SXUB 1FFXA 3WGMA 2QZ9A 3ELUA 2P0EA 5AKZA 4BBPA 4IDEA 4YQZA 1CDZA 4WCVA 5GM1A 1AB5A 1Q14A 1FSSA 3H11A 2QL6A 3AV0B 1VL8A 1TA9A 3HVIA 3U7EB 4QPPA 1ZWKA 1Q12A 2AR9A 1PNVA 2AOXA 4L5YA 4RS3A 5P21A 3IEVA 2VK4A 1RWKA 2QF7A 3ILSA 3SPXA 2ON6A 1FDWA 3DPUA 3PDIB 4J2OA 4NH0A 4QHTA 5DLQC 3QI2A 2OYRA 1PD0A 5DW3A 4CDRA 4B2LA 3IIIA 3OLQA 4UZFA 3K0FB 5CA0F 3GEEA 3RBAA 2JBAB 3BXHA 4D25A 2WHXA 2OKGA 2FUNB 1VJCA 3KL2A 3KOMA 3VDRA 1R9NA 3TX2A 1EZ1A 2BFFB 3D5EA 4FFLA 2WD7A 4JLUA 4HXEB 4NAVA 3RYHA 4DC1A 3H7IA 5DM1A 4ARZB 3QVVA 3AY3A 3DO5A 4U7TB 1JECA 4ZCMA 2HSDA 3CM0A 2EG9A 4Y6LA 2JGDB 2X9QA 3PNLA 2A4MA 1U8EA 1X7ZB 2FKAA 3U13A 4LJKA 2YXPX 1L1FA 3ESYA 4Q1EA 2VJBA 3IIKA 1LBEA 4UUBA 3C5VA 2OCKA 4KIGA 1QCCA 3P2KA 3ZIAA 5B36A 5GADl 2H16A 2HF9A 1WJGA 1VMIA 4DLYA 4EG8A 4Q93A 3C3KA 1HRDA 3QP9A 3ZNPA 2ONZA 3F5FA 3H1EA 2NXWA 4H6VA 5K3FB 3UGKA 1Y3AA 3MJSA 1D0IA 4IDCA 2PY6A 1VKJA 1R2QA 2VJYA 3INNA 1AGYA 2B4YA 3CUKA 4DWWA 3TW4A 4ZOQI 1M67A 4R2WA 4GHWA 2Q4OA 1YJAA 3VHQA 3HDGA 1BXRB 1FXUA 2RB4A 4IIJA 1DRWA 4HGYA 4LZWA 4X1IB 5A7HA 3ZY4A 1YDHA 3TLYA 4MUMA 2VYVD 3HB1A 1HRKA 2OOSA 2WLTA 3DXXA 3EDQA 1CUVA 1YWGO 3HY3A 1U3FA 3KB2A 2B83A 1WCIA 2QRJA 5EC8A 2BFWA 2JCBA 2W6NA 1Q2XA 2BUCA 3ICCA 5MHTA 3ELYA 4GZ5A 2EHJA 1ZR2A 1F4VA 1SUBA 2ZXEA 1EINA 3BJZA 1P39A 3AVUA 3QJYA 4RA6A 4ZAFA 2GBCA 4QTZA 3ZK9A 3H2YA 2E85A 1S8NA 4G6ZA 3EDOA 1TPZA 1KEUA 1ZK3A 4O4LF 1OROA 4EL0A 2O19A 4C0XA 3LC1O 4EHLA 3N53A 3Q2KA 4F21A 4CEJB 2ZYVX 1LQTA 3WNVA 1UEJA 1WLYA 2FPRA 2YY7A 3KQWA 2O2EA 3HP4A 4K9KA 4OXKA 2CMGA 2DM6A 3KOYA 1LDNA 3GP3A 1D04A 2Q1YA 1E1CA 3K3PA 3VGPA 2VAXA 2XHZA 4G3XA 4XB1A 4MDEA 4LFBB 3H19A 2E4AA 4NL4H 4NCIA 3U4IA 1SCIA 2H1RA 3GDOA 4XZ3A 2ATXA 2L69A 1HDXA 5AVQA 5CDFE 4GGOA 2Y67A 3TE6A 2K6GA 4URYR 3CG0A 3V4OA 4EVQA 4R41A 4KG7A 4MK4A 1G5IA 1NNEA 4PC1A 3QWHA 1GSHA 4UE6A 3WGLA 1R16A 3QUBA 1Z6AA 5F3RA 1P61B 1J8YF 4JC8A 2WJ6A 4BZXA 1ZHHA 2G83A 3N0TA 1XMOB 1I1QB 1TEXA 2C3MA 3T4EA 4Y3UA 2W6QA 3AVWA 3O8OA 3TD9A 2C2YA 1BWQA 4Y2XA 3AFHA 3FZNA 2BH9A 3CO5A 4WNIA 3C8HA 3WI7A 2WD8A 4ZI7A 5JFOA 3ANTA 1UBMS 1WAMA 1LD3A 5EHIA 1KJJA 1PKEA 2OBXA 3K4QA 3WV4A 5BYKA 2VDLB 3HB5X 1DDOA 2OHXA 4R9NA 5K4GA 1H3EA 1OTHA 3O9MA 2AN9A 2C00A 2M98A 4O2AB 2JLQA 4Q1DA 4BNTA 4UPEA 1IHDA 1SOMA 2OFFA 1BCRA 1A9YA 3U31A 1JLMA 5IEJA 2HDHA 4AS1A 5KAMA 3LYLA 2KHZA 4EGAA 5CDUA 3L01A 1XAHA 5KYVA 4OHCA 2HM7A 3NLLA 2C7OA 3V2GA 4JZKA 1ELOA 4BLTA 4YMGA 2EZUA 1DJLA 2BUBA 3BH7A 4GWKA 1AQ6A 4X71A 4BNWA 1EVLA 4R16A 5G0TA 1WB9A 1QOZA 2ZBGA 3R20A 4WOBA 4I9NA 1IYZA 5FBZA 1LDGA 1RXSA 2D4HA 4ZOAA 5TGZA 1CDOA 4C05A 2E49A 4E4TA 5LM3A 2VQ3A 3OQHA 2ANCA 2CN1A 1JLLB 3KKZA 1SBIA 4NXNB 3H3FA 1EGMB 1YB4A 2Q9BA 3F5QA 3Q7TA 3QMPA 3T7DA 2I71A 1CJBA 4JLNA 4XPIA 4BJ1A 1G38A 4GOKA 4AIIA 4UATA 4XQ9A 1UDWA 1DV1A 4Q9LA 1NPDA 1RBZA 4BMOB 2OM2A 2XW6A 1X3SA 2XQKA 5EP3A 2ZSAA 1D2MA 1PWHA 5BSWA 3TBFA 5BVHB 5KO2A 3ILYA 3SYNA 2P8JA 1CHNA 3A1EA 3UT0A 3PD1A 3U3OA 1SUAA 3W6UA 1EM8A 4RH3A 4U2FA 4HDSB 1KZ7B 1QB7A 3BORA 3MELA 2V65A 3NHAA 3PB3A 4NOKA 2WYHA 4W8OA 3SIRA 4IIXA 1QKKA 3PQ4A 4GMFA 3BTOA 1YQDA 3IT0A 1V71A 3O1IC 1KDVA 721PA 1R15A 1T4CA 2OL4A 1E58A 5IKEA 5CCBA 2GS9A 2IUEA 2XTAA 4M0CA 5BUQA 1L4KA 1F5NA 3R5KA 5ITWA 3BMQA 1FSPA 1TM7E 2YWXA 4G24A 1E3EA 4AVYA 3CWZA 1RCTE 5DJ5A 3SZLA 5HUQA 2Q5FA 2FDCA 1XA4A 1CUFA 1QE3A 1FJ2A 1H6AA 3JZIA 3KPVA 1CEXA 2A9VA 4IMRA 4EJ2A 5CH5A 1YBVA 1KAQA 1UT8A 1YZGA 1ZL0A 3C7DB 1FRFS 2PT7A 3VKFA 4AZ0B 2HREA 2YMPA 1U0SY 3EUEA 3CEAA 3U4CA 4DV0B 1AF4A 3RF6A 3AR9A 1NNLA 2X5XA 1GPH1 2Q2VA 4X1KA 5DRTA 4EKYA 5TQ2B 4DADA 1JHUA 1FQOA 5C31A 1F1JA 3EVAA 1U2RA 5DNAA 3L7MA 1ORTA 2X8WA 3L77A 5A3JA 3KTOA 5A4AA 3UMVA 2QR5A 1VPTA 5IULC 4JQZA 2ZTLA 4RY8A 4N4AA 1MB2A 3JQDA 2A9FA 4IVRA 2GPNA 4YRDA 1UFRA 4FFNA 4FXOA 1LC3A 1JTVA 1Q74A 2IDZA 2HJWA 3DL0A 3UPTA 1KVQA 2EOAA 3MAAC 5CLQA 1X15A 1XMVA 2WNSA 5JVDB 2ECOA 4YJHA 5TMEA 1Y82A 2X15A 4DV7B 1FIUA 4J7XA 3UK2A 3ZU4A 5LYJA 4HQ0A 5JZBA 1Y48E 4F4IA 1U0TA 4ZTBA 5JNTA 3RKRA 3HVUA 2ZYWX 1NN5A 5BQFA 4DLRA 1DC4A 2VBFA 3PG5A 3GELA 4R1NA 3IKMB 2ZEJA 2GCGA 4F1KA 2A9OA 1BW9A 3HU2A 4ZGBA 8OHMA 3ZHSA 4AQDA 5JZMA 4M0EA 2V03A 3ZDDA 1BMFA 4HUTA 4JJZA 1D4AA 3FSGA 3GGSA 4MW5A 1K4KA 5AKLA 5DTJA 2RBKA 4CCYA 4LOLA 4N0DA 1FK8A 4NVRA 3R7FA 4FB4A 5KJ1A 4XFJA 2XUZA 1XZKA 2WJZB 3H17A 1Z0DA 1V0JA 5AM2A 1LGYA 3EH2A 3BXEA 3RVOA 4ED9A 1AC5A 1AHHA 1ZM2A 5EKSA 4EYOA 3OZIA 4IO1A 4FEAA 2H08A 2J08A 4JVSB 4G8BA 1CVRA 4EUNA 2JDIA 3U4AA 3CCCA 1V6AA 3HDYA 1J1IA 2Z83A 5DGCA 5EIXA 2X8AA 1J56A 2W8BA 1A76A 1XZGA 2O3UA 5KVSA 1P1KA 4LZOA 4YJ3A 2P68A 3C1TA 3LO8A 2Y1OA 3NRCA 4X7RA 2OV4A 1KO7A 5TPZA 4MRMB 3K73O 3T06B 4Y2RA 4BKRA 4U9IS 1Z18A 3K0AB 4D8XA 5JUWA 1EA7A 4PZZA 5K0CA 1O9BA 3M9XA 4JDUA 4QPCA 4W99A 2VPQA 2ZETA 1LX7A 5AM4A 1JIUA 4H4CA 3F9RA 2PNFA 2C8KA 1K6EA 1K4MA 1T0PA 3BE5A 3MB5A 1GPAA 1W76A 2IU3A 5F9FA 5JJCA 1PYOA 4WWHA 3TLAA 1U0BB 2MYUA 4YCNA 4IDGA 3L7LA 3W5HA 4QFCA 2HKIA 2IZ0A 4MRAA 3CLTD 1VECA 1CR1A 1DOAA 3C98A 4YCCA 2A92A 4U7DA 3UHJA 4EY3A 4MR9B 2WW8A 3CFYA 1JQDA 3D8RA 2CE2X 2C03A 4C78A 2QX9A 1P1IA 3VOTA 3PGXA 5IDQA 2OZKA 3S1AA 1ZGAA 5ALWA 3UJ3X 3HXKA 2V6IA 3BSWA 1UMCB 3QKRB 3RUPA 4IQGA 4BLOA 5CFNA 3ZDBA 5U4XA 1P9OA 5L3SB 3FJOA 1KVTA 2J41A 5CVCA 5LBUA 3DB2A 4YREA 2DR0A 3KWMA 2BGGA 1NKSA 2X42A 3LH5A 4YV7A 3K05A 3JASA 3W5CA 4DC0A 2D2VA 4NIMA 4WHMA 4ZEMA 3T12A 2BV3A 1I4OA 3JQ9C 1ORWA 2ODTX 3I52A 3SKXA 3UBTA 2QJFA 2J3KA 3MTDA 1B43A 1SUCA 4F8EA 5IBQA 1L5FA 1FUEA 1YR7A 1ZVKA 2OK8A 4KOAA 4UHDA 1RLJA 3GA7A 2EWMA 4A26A 4D3DA 3L8HA 1YK0A 3EF3A 1GYPA 2KM1A 1TTTA 3OTWA 4DXAA 2OORA 3KFXA 3DYBA 3N2YA 2PMEA 4UQOA 2BHTA 2P9QA 2H2AA 4Y0NA 3THXB 2FG7C 5H8WA 3G5AA 3DBRA 1I2DA 1TW3A 1WUTA 4IJMA 1IUKA 4BJHB 1R5BA 2EX1A 1NLUA 2PRJA 4HPXB 3MWYW 3OPNA 4U39A 4TYNA 3IJRA 2QRQA 3NEPX 4IMJB 3MGKA 4DBZA 3FNGA 1R0SA 3OZSA 3DFFA 3RREA 4G5HA 3LKVA 1GPKA 3ONEA 1SB9A 4QASA 5HILA 5L95A 4QJ4A 2XRMA 3BE8A 1H2HA 2QPLA 2ODBA 3I5XA 3JD3A 1DO0A 1NURA 1XT6A 2ZI7A 1JE0A 3FMPB 4N8SA 2FEWB 4F2DA 4Y6GB 1GL3A 1SC1A 4HY3A 4TPKA 1XCLA 1HE4A 4GPZA 4KWHA 2C2GA 4OQ4A 2BKUA 4WY5A 2A57A 1I01A 1WW2A 5D01A 1U02A 1UPFA 2ZCUA 3U4QA 3MQ4A 1TCAA 4PGGA 3SSNA 5FI3A 5EWJA 4JXXA 4ZWNA 1Z34A 4FFBA 1VBNA 5EZYB 1JDZA 2REOA 1UFQA 3N6RA 2RHOA 1P4HA 5EUCA 1KY3A 1RS0A 4NBKA 3TOZA 5HWSA 1U7OA 3H5OA 2F3RA 2FQ1A 4HAUA 1ABFA 1OT5A 1QVRA 4EG0A 3P0RA 1PDWA 4EQ6B 3DCIA 1JEYA 4D8UA 3IDQA 4TXLA 1I0ZA 1CP3A 3BE4A 4P92A 2NUPA 3DVAA 1PGNA 3WZ2A 3P20A 1I2AA 3JZAA 3GGOA 3NXSA 4D4JA 4EYGA 4WUVA 1PYDA 4DTCA 3TW8B 1M2GA 2C7GA 4DLSA 1H4VB 5FB3A 4Z3DA 4EARA 3UMYA 3E3LA 3L8ZA 3ZCPA 1OV6A 2FSPA 1F51E 1SRQA 4FJ0A 3NFRA 3KKQA 3R7AA 2CMHA 2GFIA 2NQ8A 5JE8A 1DDGA 4J91A 4RS4A 4E14A 6REQA 1RRCA 1M10A 4LHWA 4L57A 4KLNA 1T3SA 1L5MA 3QVMA 4WCDA 4LMAA 3TLJA 4OMCA 2AN3A 4HEA6 1W9MA 2V5UA 3HXLA 4MW2A 1H8EA 1QAOA 4JB8A 3SG0A 1OAKA 2PEYA 3NTVA 4HDCA 1WZEA 2A33A 2W6ZA 3FFWA 3QIAA 1KAMA 1PT8A 2GRAA 4M53A 1JMYA 3LT1A 2Q27A 3OMXA 1L3CA 3ZYCA 4IHJF 3VFDA 2OMEA 3K2EA 2VATA 4IG9A 4BNFA 3LL4A 5EUBA 3ZXYA 2VHUA 5A06A 5FBQB 4E3ZA 1H1DA 2WC1A 3N2GA 4HRYA 1E9DA 4H60A 2EFGA 1LDYA 1OV4A 4NLLA 3HCFA 4K0RA 1INLA 2NW6A 2YV2A 3KM0A 1RHQA 3AHIA 4DJAA 1TQ4A 4A2CA 3T3OA 3ND8A 4GXQA 1SBZA 2FJUA 1SBTA 2ZITA 1KFEB 3FHTA 2VLBA 1JKJB 5EJ7A 4UTNA 4PHHA 2G9ZA 3GY0A 4AWBA 3OD1A 4IG4A 3A4IA 1MTOA 3KE8A 2V55B 4JB3A 5F7JA 3W4KA 1W4ZA 4LDZA 2FLVA 4LBYA 5KYTA 3R0IA 4ML3A 4GI3A 2G5CA 4NU6A 4QQ8A 4RK7A 4AJPA 4RHYA 3AUUA 4ID3A 3KFLA 5HKKD 3KEOA 3QOXA 5BUSA 1KTIA 6YASA 2ZJ5A 1NI3A 1MO2A 2FUEA 3FW1A 2X8BA 5B1IA 1POWA 1HZZC 2WG2A 5BQPA 1F20A 2PZBA 4YP5A 3SU8A 4AS3A 3SFTA 5K0FA 2BEVA 2QG6A 1P4SA 1W1IA 3OX2A 3IE0A 1JIXA 5H81A 2RK6A 2HGZA 3EW7A 1DC6A 3NYQA 5FHRA 3T7CA 1GPLA 1JT2A 1NBEA 2VJOA 3GMTA 4I3FA 1D2CA 1XLTA 4TVSA 4KBYA 4UHBA 3VKHA 1BQEA 4BL5A 4F38A 1NASA 2CZCA 3GDWA 3M49A 2XSZD 3AEZA 4BIIA 2I8CA 3AHEA 4AP9A 1Z4OA 3DHEA 1IY1A 1XD2B 3RC1A 1Y6ZA 4LFAB 5GTDA 3OZTA 4F5ZA 3BIWA 1GL6A 3AUSA 4B79A 2J09A 4JD5A 1BE1A 3ITEA 4LJ7A 1RWXA 4A10A 1BEUB 3ICPA 4NE7A 3RS9A 3TQHA 4XTCS 1KKMA 1S0UA 3ZE2B 4MOWA 1DC3A 1QVVA 5LYYA 1HR0B 4AI6A 2IT1A 4J1QA 1AKNA 3H2BA 1XEFA 2OV6A 3SI7A 1P3JA 3WMGA 1USIA 4E32A 2JKYA 1GSAA 4L2IB 4Q82A 1USGA 2VHVA 3EBLA 1R4NA 1REQB 4MQ5A 1B14A 1U2DA 4V0OA 1YRHA 4CRWB 1S2NA 2PHZA 5LXTB 1HMYA 2GJ8A 1PJZA 2IDKA 4X00A 3SZOA 3TM5A 2AOUB 3EQZA 4CXMA 1T26A 3KG2A 4AAYA 1T3TA 3OPYI 5K0EA 1ZD4A 3EIWA 5GJBA 1CVLA 2WM3A 3HKDA 3DBLA 4WDQA 5ALGA 1G7TA 2F43A 3SCZA 3GFBA 2UUCB 3AIMA 3CSSA 1QIKA 3ENNA 2C88A 4EO7A 4XEHA 3SIXA 4DRXA 3UV7A 2PRZA 2VKQA 1V7CA 4F4DA 3L6OO 1T1JA 3DCJA 2O1XA 5DIFA 3D02A 3EOZA 1KZYC 5JJLA 1V45E 4G0XA 4FHEA 2GZAA 2GZHA 2IV3A 4CMAA 5C8XA 3NNNA 4IRMA 2W2LA 1SXJA 4IBOA 4XIIA 1KRXA 4YRQA 3VPBA 1KA9H 4CF4A 2ZYRA 5GQSA 5DCYA 1L8OA 2XLCA 4A1OA 4R54A 3VHLB 2CL5A 3R1IA 4CFSA 4EW2A 2Z3VA 2JJ1D 4FTWA 1MX3A 4I1UA 5FNVA 3BXXA 4MPDA 2JIRA 1FFGA 1Z82A 4DPLA 1PS8A 1NBMD 1TE2A 2H3EA 1D5CA 3WGOA 5CX1B 5TVKA 3EPKA 3L9WA 3AHHA 2Q46A 2J5RA 4UFPA 1IXSB 3PTLA 1QGDA 3L7YA 2HJ9A 2OENG 5JNVA 4WASA 7REQA 4B85A 3FPEA 4YMUA 1L5WA 1V43A 4JBWA 5BT8A 2VYFA 4F3TA 4YUVA 2ZTHA 1Q0QA 2NPOA 3N87A 2PBFA 3TMYA 5ERGB 4R7GA 3FB1A 4KGZA 3SZ3A 1G4AE 1V9SA 1RWVA 2Z57A 2JFPA 2WLSA 3KT8A 3MD9A 3OJXA 4HFRA 1XYYA 2WTMA 2VEDA 4Q4JA 3W77A 3V34A 4MKHA 4BMZA 1Z6QA 1YKSA 2OXCA 4FYHA 3SJAA 3WL8A 4EHNA 4DM7A 1UPXA 1P0FA 1B0UA 1G3IA 2Y3IA 2F17A 3KRTA 3ZKWA 4TN5A 2WUDA 4YJKA 3UV6A 2WRZA 5TIIA 3T3NA 1BJTA 4RF2A 4P36A 4PHGA 4ACAA 4Q3OA 1FRQA 2AC2A 2VDRB 3V00A 2IXTA 1NKTA 2WP8J 1X3LA 5AJTA 2I4LA 1H8HD 4TQ9A 5DHRA 3IAM6 2YIMA 3DZBA 2I29A 3LRPA 4EJ0A 2J9XB 4X7BA 5EMJA 1VSVA 2I62A 3DAOA 1IOWA 2IYPA 3KZMA 3NASA 2FWRA 3F6SA 2Y1DA 3WWPA 1LVGA 4JQYA 3M1LA 1QANA 2P65A 4A0QA 1KH1A 2DRIA 2B4AA 2F7SA 2PZFA 4LRSB 5FJJA 3K6SA 3PXXA 3PJEA 1JA1A 1PG5A 4B9EA 1UJ2A 1RZRA 1RD4A 2FKNA 3DFUA 1L6IA 2GBIA 2YJ4A 1TW2A 4LY6A 2VI5A 4YMHA 3ZBUA 3HRIA 3I23A 1R6VA 1ATZA 2Y1KA 4IIJF 4YBRA 3TKAA 1LRLA 1JEEA 3G2HA 2D1QA 4JVMA 1ZZGA 4RPIA 2ZIAA 6CHYA 3GJ7A 5I4IA 2A9RA 1RSZA 3DYVA 3KR9A 1WHSA 5DM0A 3SBOA 4WLEA 4IWNA 5EQDA 4KFSA 5LQMA 5IKXA 3FMVA 1GGEA 2X40A 3NPAA 3PUKA 5IT9A 4LIPD 4ZYLA 4BE9A 2NXJA 2ZE7A 4YAWA 1SXPA 1EEXB 2Q7XA 4FC6A 2CDNA 3RAJA 5BSTA 1IFXA 1EVZA 5KWJA 3NM4A 1FL9A 4U7PB 2LWIA 4ZQFA 4E94A 3BBLA 3W1WA 3K70B 4F2PA 4PLCA 5F35A 5DX1A 1C30B 3ZWCA 2WV7A 4GMHA 1D03A 3GJ4A 4PNEA 5BRNA 4ANFA 1TVEA 1GRRA 1AU9A 4WK0B 3LWDA 1ISGA 1S5PA 3IOBA 3A26A 2ZGVA 1T2VA 1L4EA 2AUMA 4OGFA 3N2EA 5T4BA 2H8GA 3VDQA 4QG3A 4YCAA 1SKMA 4Z4EA 5AUOB 3Q87B 1K4YA 1VSUA 1JFRA 5P8WA 4LE1A 1CUUA 2QXYA 3AVTA 2PQ0A 4WOCA 1N75A 2GPBA 4WLUA 5LB4A 2DFLA 4JUFA 4XX1A 3I6QA 3ZWMA 2QUIA 4DKJA 2FNAA 2X22A 2CBXA 2ZRLA 1OA1A 2QIOA 3A0RB 1E4EA 3DLPX 3WSTA 3EE6A 3UWDA 1CERA 1Y6QA 3TCNA 3GCXA 2F55A 1YIDA 4PYOA 4BMNA 3B6IA 1O87A 1SCJA 5EWLB 5F1YA 4AY2A 4AKTA 5C4GB 1RVDA 1XNHA 5DV9A 2XE4A 1FS6A 1I7QB 2PL1A 3IVCA 4WW0A 1IL0A 2R85A 1B4DA 2IV7A 4CG3A 4Q4CA 4ZI7F 2HYIC 2JAOA 2GOYA 3JAKA 3UWPA 1O9GA 3IS3A 4R69A 1ZVVA 4GPEA 1YR1A 4MROA 4Q3KA 3WBFA 3VR0A 2BISA 2WHRA 5CAEB 4AUEA 3R3JA 1XQYA 1E99A 1Z6ZA 2GAFA 4LX0A 5JAUA 5EIWA 1E18A 1VE6A 1ONSA 4GM4A 1FYEA 1TT7A 2A8YA 2VDPB 1VSTA 1QRRA 3F67A 1JE1A 3L8EA 4N76A 3QJGA 4N7MA 4TS4A 3TJMA 4DMMA 1Y80A 3K0SA 3WLNA 2ZRIA 1MTZA 1GNRA 4KDCA 3E7FA 1QR6A 4QJIA 4X3PA 1SIWA 3WK7A 2I4OA 3IC5A 2QY9A 4PRZA 2X4GA 3L1JA 3ESRA 4OQEA 1TXGA 5JY1A 1JU4A 4R81A 4TKUA 4G81A 1ZK0A 1OJLA 2WWHA 3DF7A 4CIXA 1FDTA 2NX2A 5F2EA 1O54A 2PGXA 3W2HA 1XZLA 2BEUB 2NYVA 2ZLBA 4FD2A 4O63O 4C03A 4EKDA 2PUEA 5KYYA 1CLUA 4C76A 3IMGA 1A69A 1Z0ZA 4EF6A 1KYXA 1SKAA 1GPWB 1VSBA 2LW7A 2OZLA 4GOMD 4R51A 4WGGA 4WOJA 1OGYA 5DM2A 2MR5A 1Q92A 4R7ZA 4C22A 2R5NA 4YFYA 3SS9X 1PR4A 5FF9A 1DLJA 1F8YA 1QTRA 2DY0A 1T3GA 1L4NA 2D54A 4MVJI 2R6GA 4X3OA 4ENQA 4CEHA 1LI7A 2J3QA 1JNXX 3FYCA 3WGYA 3KCQA 4Z1OA 1HLDA 3JX9A 1JFLA 4WKPA 5J2TA 4YJGA 4OHPA 1X7WA 4F7WA 2VCHA 3BFKA 5FLEX 1TAQA 3QG1A 2BAGA 4BX2A 1N7IA 4D5GA 2E4WA 4P5DA 1GPMA 2HQSA 3CVOA 3IRVA 3KZVA 4OBXA 4ZO7A 2IYWA 4NMMA 1QGOA 2PXHA 3GNSA 4REOA 3EEOA 2XWQA 3A36A 4KW7A 3EIFA 1JIKA 4E2WA 3K4PA 5JRJA 3GLRA 2AMFA 2ZRNA 4UM7A 2BGUA 4NK5A 2ZAOA 4NEQA 4ZCQA 3FOEC 1ZN2A 3B9PA 4RHXA 5BYJA 3RDPA 5H82A 4DV1B 1EFVA 5G1PA 3UAZA 2P6UA 4BJ6A 2B1GA 2IYFA 1OLUB 4PRYA 5D5PA 3QKIA 1Y3IA 2ZJ1A 1IJBA 3OOWA 3HKBB 4DDVA 2WICA 1SUFA 3FWYA 1DFGA 1T5SA 1EZ4A 4MW9A 4GX2A 2NU7A 1T9DA 3VV3A 2GASA 1S01A 5F7ZA 3THRA 3WFJA 4OXYA 1P1HA 5C5DA 1W87A 4UTXA 5DPMA 1OI2A 1B6TA 2FFBA 1TMOA 5EZSA 3U3DA 3KTDA 1VI6A 4URUR 1WDTA 4LZNA 3LF1A 1TIBA 1LDBA 5U9CA 2ATCA 5FPSA 4KNYA 3LDUA 1MH1A 2BZ1A 7GPBA 4AYXA 4NAHA 2Y4NA 1DX4A 2XZPA 4UMDA 3QVGB 5EXDA 4RHUA 3RC7A 3RT9A 4OHUA 4A91A 4CL0A 1PGPA 1X1DA 2IVFA 1V8FA 2VDQB 1M6VA 3K5IA 4Q0MA 2PKRA 5LYJF 1FA9A 3IBFA 1HLGA 3K0KA 2RB5A 3GFSA 3TYXA 1ULSA 2YXLA 2WWYA 1EWKA 2GLXA 3MT0A 5CEFA 2O1SA 4BO6A 3TSZA 1KOFA 1OWNA 3ZNNA 2FFQA 3FDIA 1TI7A 2V7QD 5IAJA 1BKDR 1QXSA 3E5NA 4QARA 1RI4A 1S89A 2MHCA 4RK6A 4YRRA 4B17A 4BQQA 2WB2A 3L7JA 1Y9ZA 4JP2A 3VR2D 2J85A 1J0CA 3L0OA 5EXPA 2Q3HA 4NFHA 3LUHA 3HEMA 4ME6A 4ARVA 5CB8A 4ND8A 1QC5B 4KXNA 3ZZNA 4C14A 4RSMA 5JFTA 3HGTA 4EK9A 5A5DA 3ND7A 4HYEA 2I4IA 4AF8A 5EGSA 4UE2A 1WKVA 3QFHA 2NU6A 1I2CA 5AVUA 1HXHA 1UK7A 3EY9A 3LY5A 2P6MA 4G65A 2G28A 4NBLA 4O1IA 2XBLA 2YWDA 2ZPAA 3N3AC 4YJ3F 3FCSB 3A1WA 1W581 2AG8A 3EZFA 1AKRA 3FTPA 1E3DA 3IPAA 3PQCA 3HHPA 5B1HA 4M49A 1Z5VA 2ZDQA 4LZJA 5HPYB 3IDSA 4FMCB 3S3TA 1I0LA 3KXPA 2E4XA 4H3HB 4NZOA 4RD4A 4B09A 5DXAA 3I0ZA 1JBEA 1KMNA 3FYUB 4UUQA 2PH7A 4AX4A 1QG4A 1ILWA 2O07A 2QRHA 1VM6A 1J0AA 1QV7A 3O9VA 4KSBA 4JI6B 2C5BA 1PCXA 1C4KA 3I76A 1Z2NX 5EIBC 3ZYZA 4CEIA 1GR0A 5CW1A 4JDPA 5I5GA 4XD2A 4C43A 4E5PA 2TMDA 3A70A 1AE1A 2BDTA 1WOMA 2XJ9A 4YC7A 3T1OA 5L3QB 3CZQA 4J1NA 5G4KA 4GQIA 3LSTA 3P7MA 4TMVA 3AM1A 4W7IA 5DHFA 2WJ3A 2JBWA 1YQTA 2DKNA 1V8BA 1VOTA 4NHOA 3ZW7A 4TVOA 3C3CA 4DG9A 2ZYIA 3IELA 4HDKA 1M0TA 1H42A 2IC5A 2X86A 3ABZA 4D9BA 1GPUA 3ANLA 2CJWA 1MAVA 1ECCA 3C3AA 3M4XA 4R6WA 2WE7A 3LLVA 5F9MA 3FCYA 3KSMA 3LNCA 4GEKA 1E5DA 2O7SA 3M34A 2J0UB 3LY9A 4JYBA 5HS4A 3WL7A 1SIUA 1PZHA 5CM9C 2H7XA 4MINA 1CF9A 2YVLA 4FFRA 5AOVA 1RW4A 2B4KA 4MMXB 1E2GA 4MYRA 2D2EA 5PNTA 2P41A 4WJZA 2RIPA 3SQWA 1QAMA 2B61A 3G2QA 3GLUA 1YS7A 3FGOA 4UVEA 3EMVA 3I8SA 5HTKA 5JLJA 2EJTA 3QG5A 4IJQA 4OPMA 4MJ7A 4UZSA 2Y6UA 4MXDA 3CIOA 5AW8A 4OJYA 3Q9LA 4RVGA 4OLFA 3GNLA 1SURA 4KGDA 5KOJB 3ZDCA 3VJRA 2C4UA 4BGUA 5DDIP 4R8VA 4Z8XA 1L4BA 4GLJA 3I37X 3ZDXB 2EKDA 2XQJA 3BD6A 1SKBA 5DKFA 4DPKA 3PKJA 4GE0A 4NHEA 1K7YA 3IOEA 1JRLA 5JMOA 2YYAA 5JZSA 4HLNA 1O2DA 2WJPA 3E03A 5AXDA 3VVMA 4DIKA 4EHHA 5B7PA 1NBOA 2EQBA 3KB6A 2B0JA 1BGVA 2QVYX 2VP0A 3TXYA 3DOIA 1Z0UA 2HA2A 2MSDB 5F21A 2NACA 4X60A 3LECA 4OHWA 5SY9A 2B9VA 4B43A 4NNJA 4HDAA 1K8QA 3OTQA 4FR2A 5LQNA 5B2EA 4XQCA 2H7VA 3WIDA 3NHRA 5A9SA 4JJ8A 1R3DA 5KQPA 2PT5A 4LSWA 3ZI0A 1OXKB 3G9XA 3LP8A 2FSGA 3DL4A 2Y0PA 3FD8A 3IQXA 4LHYA 1Y6FA 3REGA 1Z3IX 2W6PA 3TRIA 4B8ZA 4EYSA 5FHQA 1OQAA 3MUEA 1BOFA 3TM4A 3TXAA 4BRSA 2Z8XA 1U8TA 3ERCA 3LQFA 3QTTA 5K0BA 2GMWA 1JMVA 4Q4AB 3ROGA 4JXJA 3WAGA 4YASA 4IXMA 4DF3A 4P7JA 3EQ6A 3IV7A 4J3NA 1ZYUA 4BQSA 3AFMA 3UT5B 2Z4TA 1G9SA 2LDXA 2ZB3A 2GDJA 3K6JA 4O4HA 2NSYA 4L4UA 4DJDC 5DO9A 3SOZA 3F5DA 1K2VN 3ZUPA 4A8TA 2VJPA 3BFJA 1JI0A 2O3QA 2IPOA 3DP7A 4DYDA 2CMFA 4NP6A 5GPBA 1QH1B 5C46F 1LBTA 3S99A 1V3VA 4DR5B 2GD2A 3MHPA 5FJIA 1QFMA 2WWRA 3C6KA 3KJZA 1VJ5A 3KKPA 4L4YA 3HVJA 5T3YA 1XCPA 3PGLA 1NM5A 2FPGA 3CRZA 3K5WA 1YJBA 2EF0A 1BO6A 1JPUA 4PY2A 1P0IA 3FAZA 1XCJA 4IHAA 4WA7A 4ASUA 4CKWB 3TB4A 1WXWA 1XEXB 3BCHA 1B1CA 1B7GO 4IV5A 3TIGA 1PEYA 3MOSA 1A0OA 4B6QA 4BOYA 3RRFA 4DNPA 4RZHA 2HRZA 4R5MA 4UREA 1ES9A 3V7UA 4D80A 4GZMA 4RPCA 3GLQA 4Y2JA 3VOAA 1QF7A 4BB0A 5DSXA 5GONA 5EPOA 1Y5NA 3RBVA 1ECPA 1ZCFA 3LZDA 1HDGO 2V7XA 1XB2A 4LN1A 5CMLA 4YDSA 1QRDA 2WIAA 3IBGA 3HKEA 4ZV7A 2BMVA 4KPUB 5HK8A 1Z47A 1C7IA 2NQTA 3S1SA 1CXZA 4HNSA 3ZH9B 3PEUA 2OFPA 4CZ2A 3WK6A 1XVLA 5HMLA 1HKHA 3QBTA 2QZSA 4EF5A 1X1CA 4LRQA 1IDOA 1QJ4A 4LWOA 5IRCD 3HFRA 1DTWB 3AUTA 3PT9A 4AKHA 2E9SA 2FPWA 2O7VA 2P9FA 3VYRB 1S8FA 3JAWA 3F6RA 4AZVA 3K9GA 1ORRA 2RH4A 4ZOLB 2OBLA 2CDCA 2FSVC 3JTMA 3L18A 4GPIB 3M5CA 5IT5A 3C3WA 1RHKA 1QFYA 4ZFNA 4OREX 3SNHA 2H9IA 1TUIA 3H2KA 4XARA 5IBRA 4DDMA 5T3UA 1K7CA 1O7JA 4H7DA 5CA1F 3ZGZA 2QRMA 1ST3A 4MYUA 1G5QA 3CISA 1H2XA 3B5IA 4PIPA 2WWFA 4C4YA 1OCEA 1XMJA 3K30A 3KR1A 3KT6A 4QTUB 1PEKE 2VQFB 3QF4A 3AB7A 4KHZA 2R6DA 2XDQB 3AONB 4TXJA 2ZVDA 5C8DA 3JARA 2VQSA 4DCVA 3O75A 4Q48A 4DBVO 1TK2A 5HRCA 2C98A 4F56A 5TMDA 3MK31 2FHPA 1D4FA 2EG5A 2PVCA 3E9QA 2Q0SA 5F3DA 3T35A 3FHCB 4ZZ0A 3WYFA 5MN5A 1J9EA 1A5BB 1NYQA 3PD0A 4OHYA 4U7FA 1JEOA 5KIAA 2I6SA 3ROKA 1FDOA 2JAUA 4NFLA 1A5ZA 1XK6A 4JFAA 3U7QA 2IKSA 2W00A 3E82A 4L6IA 5BSMA 13PKA 3I39X 1XVVA 1SU4A 3N7TA 3CLKA 2ZI3A 4EIWA 3QHAA 1YH3A 3P0IA 2OHJA 2QYOA 4OFBA 4DJEC 2O1EA 2I6TA 3KLPX 1XTBA 4LZZA 2ZTMA 3DEFA 2QAGB 1AGXA 3RU7A 4NZMA 2HIMA 4EHDA 4YR7A 3OZFA 5IX8A 2I6XA 3CN9A 1TT5A 3LX5A 1B6GA 1NIJA 3AI3A 5BT9A 1LF0A 4K9PA 5C7OO 4TRJA 4IICA 5LQSA 4HUQA 1VP9A 3INRA 1UADA 4E4YA 4M0DA 1RACA 3TIXB 1WMDA 3LJKA 1AXEA 2OLEA 4CM8A 5C37A 4CM9D 3PUHA 2B8TA 4KXMA 2GT1A 2XUKA 1D4OA 3UYKA 2G4VA 2IL1A 1DQSA 1ZQ9A 5KB3A 1G9TA 3H13A 3UXEA 1AURA 4XJSA 3WP1B 5ADVA 6PFKA 3A7DA 1LVUA 1G20E 2ZAGA 1X0VA 1VRWA 2VHXA 3ZGYA 4EAAA 5FUVA 2M6LA 3R5HA 3WYCA 5CD9A 4EX6A 4WZAB 4C3ZA 1NT4A 1Z0SA 5D7NA 1RTKA 1KIAA 4KMMA 4DRYA 2OB1A 3TUJC 3IT2A 1XZQA 2RONA 2BR5A 1CQIA 3JYHA 2H07A 3K72B 4JR2A 4CIBA 4GIBA 3NMUF 2WU8A 4E5YA 1C1DA 3ODGA 4D97A 3NZEA 1MEJA 2F48A 4P32A 4LGVA 2CV1A 1SZPA 3NBYC 1H69A 2YDYA 4F8JA 4DA4A 1J90A 4EO9A 3BJIC 3WB2A 4DVJA 4W6QA 5KHLB 3STXA 1SUIA 4MVJD 3H1TA 4JVOA 2C96A 1YUNA 3CJTA 3GVPA 1M1UA 2VYVA 3MUFA 3ZGVA 4CMHA 3K1YA 1AV6A 3HCAA 3P26A 1VXOA 5EZ6B 3SHTA 2DTDA 4AZ3A 1AN0A 1XMQB 4KFCA 1NBIA 4H7JA 1ZJYA 3FPSA 3I9KA 1D0SA 3KU4A 2Y1LA 4U4AA 4RJKA 2BDEA 3IKVA 2PWYA 5FD8A 3TQRA 2QN3A 3VC7A 5K99A 1GUDA 4ENSA 1U9IA 4OAPA 1G7CA 1TA4A 3PJFA 3KKLA 4CQLB 1PG0A 3F74A 4MS1A 3QLUC 3WGKA 1L7QA 3EXHB 5LBTA 5ALPA 4JB0A 1ABEA 1SU6A 3QE0A 2GD1O 2B5VA 1NBME 1N6HA 3UOGA 1IN7A 2WG0A 3KZOA 4Y1RB 1Y8QB 4OTZA 5FI1B 3TG2A 1QNLA 5F9HA 1ZRSA 1X1AA 3PQ3A 3M82A 3EIXA 3VC2A 4NJOA 3TTXA 2YOFA 2V0GA 1ID8A 1PP4A 4M99A 3U3JA 3WQRA 1RLMA 3O94A 1OOEA 1JGTA 1E2PA 5GY7A 3SYMA 1WPGA 3UFBA 2VK1A 4NJMA 5IAAA 4ZD6A 1BX0A 3ZTYA 4G2TA 4ZCLA 1H5UA 4M0KA 2GVDC 4E13A 1K98A 3D4OA 3AU9A 4RKEA 1ZJZA 3WIUA 3HH8A 3AHJA 5JNWA 2O8CB 3OT1B 3NHMA 2OAP1 3PC2A 4Y2GA 4I4TA 1TTQB 4FEYA 4HTFA 5JXGA 2GN9A 3DULA 4IDFA 4M7OA 621PA 2H9AA 4G1CA 1J2EA 1KQOA 2H4YA 5DXFA 3I92A 4BNLA 4WACA 4F3RA 4DR6B 1KJWA 4MH0R 3AWIA 4ZT3A 1C29B 3N59A 4MIEA 4XB2A 3CEPB 2QPTA 1F6WA 4W7HA 5ALTA 3AUYA 2IYAA 3K0BA 4BNIA 2C2ZA 1Q1QA 1QTQA 1QMPA 1QWOA 3KLNA 4MTLA 5JR3A 3AY0A 1EIZA 4JKYA 2V6BA 5L3RA 3BSFA 2X23A 4DQLA 2O2GA 3B82A 3ZHQA 4Q5IA 1CJVC 4FC7A 3IAUA 4HWPA 4K6GA 1ULBA 3FUUA 3HDTA 3S27A 2O8FB 4V0LA 1CUBA 4Q1VA 3K9HA 4G1FA 4RTPA 2E5WA 3H75A 4QQNA 3EEBA 4ZMRA 3DAFA 2WKRA 5B57C 1FDUA 3OOHA 1JP7A 2C94A 3SWWA 5FPPA 3GLFB 1RJGA 1QIFA 4K8RB 4H6XA 2QRLA 4YRFA 1YR6A 3LWNA 3WYAA 1Y8AA 3V4FA 4ZEVA 2BRUC 4YEDA 9MHTA 4QBIA 3S2FA 1XVUA 3SD7A 2G7ZA 2XCLA 5BVGB 1OWOA 1T9CA 2Q45A 3K9CA 2HWYA 1J25A 5AJVB 1Q16A 2FUG6 2JLSA 2VSYA 2YVUA 3C5CA 4WEOA 3U17A 1UP7A 3OPYB 3MBKA 4MGKR 4ZJUA 2VTKA 4PU0A 1PKXA 1YAHA 5CVJA 1C14A 5LDDC 5E38A 2CV0A 2O8DA 2BZSA 4BMDA 3EZXA 1L4HA 1TIKA 3R9XB 2RH5A 2P1RA 1NDQA 4RADA 2O54A 4MW4A 2P9HA 3V7YA 5TE9A 3VPGA 5A0VA 3JQQA 4H7IA 1YRWA 3V1LA 3R0JA 3K9QO 4PPFA 5FWAA 1NDUA 3RS2A 3SFVA 2XXAA 2D5LA 1F0KA 3D1JA 1B8OA 4QUBA 1NNSA 2EBUA 5JAZA 4H1VA 3PQDA 4DABA 4Q4HB 2JIOA 4RW0A 3M1YA 2KB0A 4MWEA 3X1XA 3Q7EA 1VHQA 4YCSA 4L9SA 2AMYA 3SR4A 5ESDA 3WVNA 5BW6B 1DEXA 1ONPA 4PYRA 5LSAA 1XCBA 2UVQA 3B1FA 1FRVA 4F5DA 5J23A 3K7EA 4YLGA 3QLVC 3HCEA 4MQFB 1RI5A 2ZIVB 2ZBQA 3P45A 5IC6A 5EJAA 1C3EA 3ESCA 2D62A 3JW8A 3QPDA 1ESMA 1L4GA 4NARA 3CONA 2CJFA 2YFHA 3LUCA 4D9CA 1N2IA 4MLZA 1Y3BE 3KOOA 4EFMA 5C5IA 1NQOA 4K40A 2PPLA 3LTNC 5HG0A 1X86B 2Q1TA 5BORA 4AU1A 2ZE6A 3DDWA 4O8CA 3V4VB 4RA9A 3S2IA 4FCWA 1FUKA 3SX0A 2GBGA 4LW8A 4F2HA 4NF2A 3IAXA 1UBEA 2KWIA 3U3MA 3GQBA 3QU7A 2QTTA 2G63A 3LUJA 4F4JA 5CFLA 3WKAA 1P45A 1ZCBA 2XITA 1W4BA 4K6KA 3H99A 4R1SA 5D85A 1KQGA 2P91A 1F3OA 1WPQA 1QG6A 2QTGA 2C61A 3H1GA 3E7XA 3UFXA 5SY6A 2QP9X 3MERA 2PZAA 1ZOIA 2YFQA 4M9ZA 3QHPA 3DUFA 3Q7SA 3TF5A 2DPYA 1CE8B 2H11A 4KAFA 3REQA 4WA8A 4I1IA 4OI2A 1MJGA 1S1MA 5CIWA 1HUQA 1TKCA 4DNQA 2Z5LA 2R62A 1K0FA 4OI0A 4G0OA 2A7XA 4KCGA 4W9RA 1SHLA 1WNTA 4RVUA 1VIAA 3X44A 1SCDA 3ZLUA 3B12A 4F85A 1NVFA 1ZVJA 2M6KA 4ZO4A 1E1DA 1NLMA 4TWAA 1P74A 3IQFA 1UC5B 2BR3A 4UNPA 1AD2A 3K70C 2HA7A 3WK5A 5J2TF 1G5RA 2GN0A 2R8EA 4B4KA 3RIMA 2XCSB 2QLNA 1NVEA 1USWA 5H83A 5JQGF 5ECWA 5KX5A 1GU1A 3FHJA 3KQVA 3LGAA 1TVCA 1Q5PA 1Q91A 1UM9A 2JFXA 2VS1A 3EGEA 2WSYB 1UC8A 1W96A 1Q7RA 3T9EA 4HT3B 3PICA 4P5PA 3QX9A 2QORA 3TVTA 3GLIB 3HKCB 2YHUA 1SH7A 4NG4A 1ECLA 3HA7A 4PLZA 3D54D 3K2IA 4TLDA 2XUPA 1PL6A 3RSHA 3DMPA 2WZQA 4OB6A 1E2EA 4GBED 4NPHA 3X1JA 4RAQA 3JQFA 3TPZA 3QVOA 3VH3A 4AD8A 5LA6B 3WB0A 1WDLA 2RHBA 2DOKA 4S35A 4HXYA 2HMUA 3TRFA 1ZD1A 2PWAA 1VE3A 4FB5A 2VF2A 3SQMA 4TTVA 4RDIA 2FAXA 4MGHA 3SE0A 5FPKA 5JI3E 4ZZ1A 3RTEA 2A0UA 3C7AA 1LSSA 3A4YA 1ZN9A 4LQCA 2BEWB 4X7PA 1W52X 2DECA 2QT1A 4BC0A 4BNVA 1TX4B 3HV2A 2Q7OE 4EVIA 2WKWA 4ZU1X 1ILEA 4U8HA 3K1TA 3O1JC 3QF7A 3B20A 4OYLA 5THQA 1J2TA 1BQ4A 1CF4A 4TZKA 2ECFA 1GNSA 2BLNA 4QDKA 3LW7A 2XE7A 4Y9SA 4NQRA 2VDWB 2OAEA 4H1HA 5KYUA 2JLUA 1P3Y1 3R7SA 1K08A 2AW3A 3EOAI 4D0RA 3NV9A 3PPYA 3ZWNA 2JHGA 3WXBA 3OLYA 5G0VA 1MC4A 1HOTA 1DO8A 1IHXA 5LBIA 2WU4A 3VYUB 3WKBA 5KINB 5KNDA 3D3QA 3PGMA 5AKYA 2ZZMA 4HC4A 1T8YA 3CPHA 5A1TA 4GSLA 5DU2A 3LY8A 3IESA 1PG2A 3KR2A 2GBPA 3JWEA 4IL5A 1LS1A 4PLFA 5NULA 1TC2A 4Z3OA 2WAYA 3ZDAA 1ULHA 5JSFA 3V4PB 3B85A 1K88A 3BD7A 5IBCA 5A0TA 3T15A 2HPZA 1GLVA 2XRFA 4N3NA 5KVQA 1I4EB 5KVAA 1KR5A 1LPAB 2AYXA 3F4LA 3R7LA 3OEHA 4HXGA 1NOJA 4LMPA 1UKZA 1VLMA 2JK0A 5NLLA 1B1AA 3WRYC 1ZBQA 3QWAA 3HSSA 3LY7A 3RU3A 3ENVA 1CB7A 1KVSA 3FKJA 3K71B 3FGZA 1I51A 4FE3A 1UBHS 4IZIA 2QTNA 3H05A 2ROQA 1GLNA 3G6WA 5ALHA 5J47A 2JCYA 2A78A 1X70A 4NKRA 1E9RA 1LU9A 3I73A 4MAMA 1DJMA 2O8EA 2CLOB 4EBFA 4R9VA 2B2CA 1MXFA 5BOVA 1K9SA 5GMOA 3VSAA 2FPPA 1P29A 2FZWA 2MDTA 1XN4A 4S1NA 2ZYAA 1W30A 2E2WA 4QLOA 3B3JA 3GEHA 1GKYA 4G9BA 4C5CA 1RPZA 3PHIA 4ZN6A 2Q3DA 1YA8A 3W3AA 4GRIA 4XI9A 5DULA 2YXDA 3ZWXA 4EGFA 2PR2A 2CVOA 1S6YA 1SUSA 3MYYA 3C48A 3NVKI 4MTCA 5B4TA 2ZIGA 1C0LA 3JQBC 3W5VA 5AO9A 3DHVA 4G1EB 3T5BA 1NXXA 5LUAA 4PCVA 5CB6A 1E3TA 2XADA 1NBHA 1WZUA 1CTQA 1WABA 2X58A 3ZLJA 4PYJA 3GCWA 1K6MA 4C4SA 5BWMA 1F2TA 4XGNA 5K4HA 3KJEA 4RQTA 5EXEA 4ZHQA 1VA5A 3WA6A 5E4YA 2R6AA 3DO6A 2D1TA 2O50A 3VR6H 1NUAA 4GDFA 4PYNA 3ZQ6A 1FVOA 4E6PA 2VSNA 2EZ4A 2J67A 3JVIA 3KQNA 1LTHR 2QQ5A 3LQKA 1MJHA 3IRUA 4IZOA 3PHGA 1VPDA 3U48A 3NTQA 4P0TA 1G1MA 1XELA 3C74A 2PDAA 3E4DA 4BV3A 1OT3A 3N2KB 4GMGA 1N92A 1HYBA 1MIOB 4JY7A 3V48A 3N8NA 1YQWA 4O4IF 4D3ZA 1T5LA 5E1OA 4IS2A 4J7UA 4XASA 5C1DA 5K0GA 3V4RA 4HR7A 1GKLA 2DR2A 2GSDA 4GMXA 1KNXA 8AT1A 1UWKA 4AK9A 2JIPA 4IPTA 2Q99A 4TYWA 2CLKB 3PWZA 3A9WA 3KAPA 4KWTA 4MHSA 3Q3GE 3ZXIA 3VKVA 1I13A 4PWYA 1MB4A 3V8PA 4GEGA 2CBGA 5KQSA 4Y1FA 3HYSA 1TECE 2W6JD 3NDRA 4L5IA 4LDPA 5JRDS 4GGMX 5EWMB 3IP1A 5LN1A 4OHBA 4UFOA 3W90A 4HEQA 2ADFA 1YJ5A 4J0GA 3EQ7A 1AH2A 3IB3A 3RROA 1U2EA 5DGIA 1ZLYA 1H2WA 4QUAA 5AW0A 3C6XA 3GI1A 5FA5A 1J9ZA 5EXTA 4LVCA 4KLZA 3PI7A 4WKNA 5JPIA 3GJYA 1H2BA 4D02A 1L5SA 3UCFA 2EQ5A 3X1WA 3JQEA 1XUOA 2AVNA 1PJSA 2W5UA 2XV1A 4GGPA 4O2RA 1U0JA 2UVPA 4X84A 5KOHB 3ROZA 1GDTA 2HK9A 2WVAA 3WMEA 3D64A 1XO1A 2YV4A 4DLLA 2J33A 4F3YA 4YHHB 3UMBA 2VHEA 1GQOA 1AZWA 1U6JA 5LP6B 1T34A 3BJEA 1OFGA 5JNLA 4BZZA 4F5EA 1G98A 1GM5A 1KEWA 1ML4A 2JFQA 4H15A 2GN6A 1Y5IA 3D5QA 3NOQA 3DBHB 1NU8A 4BQEA 5BOSB 1GEGA 3DE7X 2HEIA 5IAEA 4O4HF 3FYUC 2F62A 4QXOA 2Q4BA 2VHZA 3R24A 4DCUA 4E12A 2PBLA 3M4ZA 5D6OA 3QKSA 3VPSA 5HRAA 1L9KA 3JYPA 4BLVA 1EGQA 3ACCA 4ETIA 4OQYA 3K0CC 4QJ5A 3I5MA 2FSIA 2OD2A 2JB9A 4G5RA 3GBPA 5JQWA 3DZFA 1I0IA 3D8BA 3BAZA 1K68A 3AVXA 2X3YA 5AOCA 3ON5A 3L0BA 1A9XA 3PVSA 2IPNA 5FP0A 4EMBA 5CVTA 4QHSA 4J3FA 1NF9A 4H7FA 1N6KA 5EVJA 2OXRA 3JQ8A 3LKDA 1TU3A 4I55B 1SHKA 5DZSA 1QR2A 2QD5A 1QRUA 3ACBA 5FRDA 2OCXA 1X77A 1GGVA 3NHJA 3T3GA 3SMVA 2RCNA 3B3FA 4FWBA 2PAAA 2Q07A 4XCVA 1I4DD 3K8OE 4ZO6A 3LHFA 3M83A 1E1NA 3DTNA 5J1SB 2ZI9A 2W4IA 1UZAA 1ZWLA 3LC0A 3UGQA 5DMXA 4FE4A 3I3SR 4HNUA 4XOUA 5IYZB 3C1OA 1O3YA 2AK3A 5CB0A 3GLIE 5IABA 2WVJA 5DI3B 3FMIA 2PM8A 4XCQA 2B7BA 2EJCA 4HFNA 2HBRA 5KJCA 5KWIA 2IBMA 4PAOA 3TZCA 3V7FA 5KSPA 2DWPA 2GB4A 2K87A 2XT0A 3T5CA 5TX7A 3JZMA 3OO1A 5CURA 4AULA 3Q3IA 1Z7GA 1K8ZB 2FFAA 1PVDA 3TAXA 3GDHA 3GP8A 2BP7A 2D1FA 3RKSA 1XNQB 3MIZA 4PM4A 1BS2A 4EKIA 1FX0B 3G9TA 3SOPA 4R1PA 4INZA 2N0SA 3MRSA 4TM7A 5FL3A 5KJFA 2AN5A 1OU4A 4OBWA 5HE9A 3U4MA 1S7GA 2B82A 2A5LA 1UJCA 2QUBA 2CNWA 3P97A 3GB9A 4HLUC 4KQ9A 4P1ZA 4JKIA 1BKYA 1U3VA 3JQAD 2I6UA 3RPEA 3OZRA 3EASA 2AH5A 2V4ZA 3HBAA 1OZHA 2OO5A 2BONA 4TM8A 4ENUA 2VNAA 5EHNA 2C1XA 4ZTZB 2W6IA 5MN4A 2GQ0A 1T9ZA 3ZOKA 2X5NA 4KLCA 1KEEA 4S05A 4FIZA 4OLAA 1TF2A 3QU2A 1PJBA 1WXFA 2PS0A 3HJGA 3EGXA 1VG0B 3N0VA 3AZQA 4GZLA 1Z07A 3S55A 2PRSA 3BB3A 3DOOA 1JIVA 2FK7A 4YP1A 3LGSA 2F64A 3IP9A 1N33B 5FYQA 5AOAA 2AZDA 1H0KA 2B4QA 2C2OA 5CU7A 3RSGA 1ZOLA 1NBAA 2XB6A 3IA2A 4RD0A 2DWOA 5EOVA 4HNTA 2JJ8A 1YRYE 2YHIB 3CXRA 1ZJWA 4LKRA 2PNJA 3UWMA 5C34B 3NHLA 5SZIA 1GYQA 2GI4A 2VZ8A 1X2BA 1LBSA 1P2UA 2R2AA 2JW5A 4YJFB 4LHZA 4EJSA 4Z9AA 1E0DA 3AB3A 2QZJA 3BB4A 3ODPA 1Z16A 3P1JA 3K94A 2PA0A 5EFOA 4YV0A 3SQOA 4BKPA 5IU6A 5JDIA 3HRHA 1OJ7A 4YMWA 3URMA 4A2PA 4BVGA 4JITA 4EHKA 1NL3A 1VBKA 1UAGA 2JIZD 3U7GA 3DJFA 3AH8A 4CNBA 1BKSB 2ZVPX 4QT4A 1M8FA 1NRXA 2HHJA 1ZW6A 4FS8A 4IV0A 3HBFA 4J0HA 4HZUB 1ONNA 2GPWA 2HXSA 1EG7A 1CC1S 2H00A 5FT9A 2Y92A 4F4FA 4HDMB 3OQJA 4RO0A 4EENA 4TMWA 5FPTA 5DBEX 2Y1GA 3RF7A 2WT9A 3H18A 4BDSA 1JJFA 3GXOA 1K8RA 1N9GA 1H8HA 1ZP6A 4B31A 5FUXA 1EFPA 4RPJA 3GLIA 1ULTA 1H65A 3M5PA 2R7AA 5F76A 2R6ZA 2WIGA 1PUIA 2YW9A 2D8MA 4U1RA 2A88A 7ADHA 3SEAA 1NC1A 1NKVA 2BHNA 4FOOA 1FFBA 4DCGA 4V0ME 1M34B 4KZKA 1CUAA 5TF4A 3TLMA 1JWBB 4I5FA 1W0JD 4ILEA 1ZH6A 1UL1X 1SKYB 2Y1EA 3HADA 4BRUA 3VR5H 3DTVB 1Y6RA 2V6FA 1N2BA 4IDQA 3S7TA 2X0RA 1EFCA 2G5GX 5L9AA 1UPBA 3DZDA 2WUFA 3P19A 2IP2A 3FYDA 5FDFA 4EPRA 5AHOA 1WXEA 2I2AA 5J1TB 3LA8A 5FFMA 2C3YA 1FXWF 1AKYA 3A32A 1CR2A 3WDMA 4ERXA 3WOVA 4KB5A 1IJFA 1XR3A 4X1OA 5A5GA 1A5AB 1JDTA 3B7WA 4MVJE 5HF9A 3LAWA 4RTMA 2HY7A 3HA2A 2BFCA 5JO0A 3O9ZA 1CULC 4ZEWA 4JI1B 4NQZA 3ZE1B 5FWYA 4UAJA 4DMRA 3MJFA 1RQ2A 4ZXFA 2YWEA 3H5NA 3WB9A 1TB4A 4PSVA 1Y63A 1MOZA 4AO7A 1M6EX 1U8FO 3VPFA 1IWPB 2V7WA 1OPRA 3DMTC 1ZJ5A 1K06A 3RC8A 3LT2A 2XUFA 3L92A 1RABA 4R8MA 2P2SA 2DG2A 2YJ3A 3A6EA 2PZKA 1RZUA 3HG7A 4LI3X 1DQRA 2NVUA 3NHYA 3VR4A 3WQSB 1H2YA 4RORA 4D9FA 5KPDA 2JIBA 2VP6A 4OUKX 3TJZA 5DEOA 1V16A 4JI4B 4BEWA 1MZPA 3ICOA 5AXCA 1Y34E 3RK4A 1R8QA 2QL7A 4LK3A 5HEKA 4DJ5X 2WNHA 2WSIA 4LXTA 4RFVA 5JS2A 4NXMB 1UOEA 2VDVE 2FVXA 3W06A 3VMMA 1EJ0A 1C9MA 2ZYHA 2QWXA 3LUGA 2HF7A 4IX1A 4P8RA 1J9GA 4RK1A 3WDKA 1RPTA 4ZGGA 3CN7A 4FX2A 4D3FA 5B7NA 3OA0A 3OZEA 4PSUA 3G82C 4GX1A 3OICA 3OPVA 4JJ6A 3QVTA 5B1SA 3WWCA 4I4TF 2CXHA 2J7PA 1P72A 3SP1A 2QAGC 3RFVA 4RJJA 2DUMA 5ALQA 5E4FA 1N5OX 1KR2A 2SCUB 2XB8A 2QNRA 5D5QA 1E6MA 5AVTA 1YHNA 1JDPA 3IKJA 4LSGA 4WN9B 3QPCA 4UOZA 5LJIA 3J81A 3VO9A 4XXHA 4I36A 4JI7B 1XK7A 3GGPA 2X0FA 3SC2A 3AYZB 3EZ6A 4MZDA 3CZ9A 3PA8A 1FSZA 1NQVA 1UFKA 2QDXA 3KUKA 5AJXA 1PI3A 4C0WA 2R97A 1C50A 2EIXA 3HI6A 4DMCA 5KUTA 1KKLA 1JEDA 2XMGA 3M9WA 2WHEA 5ELXA 4G36A 5TT1A 1DRJA 1Q0RA 1FDRA 3PRYA 3MJEA 2WIBA 3ZZUA 4KLAA 5EKDA 4G84A 1M1YA 4F9TA 4GQBA 1PFQA 1K75A 1K8XB 2I3AA 4MQMA 2VJMA 3WG9A 3GRAA 4RV5A 5LOVA 4KR3A 2BGTA 2IX3A 3DE1X 2HA6A 5M04A 1IRIA 2DHCA 4HFJA 3C8DA 1Z83A 4O4JB 4PGMA 2OZPA 4XUDA 4OI4A 4G1VA 4RYLA 4F97A 6Q21A 2OBBA 1F3LA 3OQBA 3R3YA 4ZAWA 2V9CA 2HHCA 3DAGA 1F14A 1QX3A 3KJNA 1FFHA 3NDPA 3ZE8A 1YCDA 1IPEA 5DX0A 2F1RA 5EI5A 3IQIX 1I7DA 4JBIA 4D0GA 4E5MA 2I0FA 3BEDA 1R0XA 4D9NA 4DSOA 4XGRA 5DLEA 1XTVA 3AR3A 4ZYWA 1GITA 1PR2A 1QF6A 4DEXA 2FRVA 1RWWA 3TRDA 2RMKA 3HYCA 2OZEA 1ZI9A 2E82A 4FYXA 3M6LA 2YRFA 4PX9A 3LX6A 3C45A 1YDMA 2R1VB 2X7XA 3RSLA 3U6BA 4RGBA 2DULA 3A05A 5KYWB 2ERYA 1NULA 4O33A 1NTRA 3NTOA 3DW3X 4FNAA 2QUHA 2HLNA 4GR4A 4L5AA 1KWGA 2QMEA 1SVWA 1RXUA 1JLSA 3JQ7A 3UK7A 5BR8B 5I01A 1C4OA 3K8ZA 1T5IA 2OBFA 1U2GC 1KFKB 3IMKA 4B73A 5GZ3A 1IXYA 3DR5A 3O8NA 3P2JA 3O38A 2ZU0C 3F7MA 2NYUA 1ISFA 2QR3A 3UJ8A 3VU1A 2C1ZA 4LCJA 4F93B 2Q7DA 5EPEA 3KSBC 3P9QA 1L7BA 3FOFC 1HT1E 2CDAA 1L5VA 3K31A 3UAVA 2AYYA 4I9FA 5KNCD 3DFIA 4EM6A 4V0KA 3Q8MA 4MV1A 1UCFA 2AXNA 1VG1A 3DNMA 3M89A 2O48X 4QREA 4KQ1A 5REQA 1OMOA 1U8AA 3HR4A 2ZG6A 5A6SB 3HXOA 1QGUA 1N5LA 5HS6A 2VDJA 2G80A 1ZVMA 3T7EA 2XDAA 1H2ZA 3A2KA 2COKA 1JR2A 4TV9A 1EFAA 1N8TA 4AICA 5IAKA 1KPGA 2YQZA 1Z25A 2CUZA 4WQMA 1XRQA 1WV1A 2I54A 5J4YA 5T41A 1OXMA 3AXSA 4NE2A 5L4LA 5JCOA 3X2FA 1DKRA 1ZM7A 1BRMA 1Y9AA 2EDAA 1KH2A 2OCYC 2DQSA 2ZRGA 3E7WA 2W7TA 1T25A 4HEA1 4N03A 5E0KB 2SBTA 3T5MA 3D3JA 3KYCB 2V6JA 1US8B 4IEIA 2DHQA 2DUJA 3KS9A 2YZKA 3ZVLA 5BQ3A 1GUFA 2AJTA 3BG5A 3HZOA 3CVJA 3D3KA 4CKZA 1YHZA 4IX9A 1OLXB 2NSHA 1ZNWA 1FP6A 5LQUA 4MYTA 3HPQA 1SULA 3JYLA 4RVDA 4OF4A 1ML3A 3DMNA 2R00A 4QGSA 5KU1A 2DPLA 4QX6A 2X4LA 4M86A 3UO8B 5LKRA 3PBKA 5BW4A 1LWNA 1IXKA 1Y9EA 3VR2A 2EKZA 5JG7A 4HB4A 2AIRA 2P9JA 3BIFA 3B9BA 4IZHA 4PVDA 1FS5A 3STHA 2LPMA 3KD3A 3BWVA 1ZGZA 2UAGA 2WMNB 4ZCSA 3T7TA 3VHXA 4Q3DA 4ZDIA 1TA0A 5KX5F 4TTRA 3NXKA 3GFPA 2QHXA 4QXAA 2GUGA 1P3DA 3RVSA 5K5EA 4FM9A 1H4TA 1QOPB 1KORA 4AJ2A 5HIKA 1N5JA 4OJTA 3TKLA 1I5EA 2G77B 1P77A 3UJ9A 4WCFB 4D6PA 1E89A 1FPMA 1O5IA 2PGOA 1ZJJA 3C85A 2XQGA 3TX6A 1QHHA 1M34E 3GRRA 4M3NA 4DIUA 4YIHA 3ZWQA 3KQUA 1NP3A 4MS3A 3KELA 2RE8A 1EVIA 1SKYE 1A1SA 1KVRA 1KZ4A 1JKIA 1JU3A 3GG9A 1E6WA 4GRDA 4C7XA 2XH8A 1SUDA 2A58A 2QE7A 4D81A 2HPHA 3KJHA 2B9EA 3H8JA 3MFQA 1FLDA 3WZMA 3KQHA 5B4VA 1G2IA 1JYSA 5T8KC 1R0KA 3O4HA 5I9NA 4LQ4A 2O8BA 3E9CA 1FFAA 4L8YA 2PH1A 1RM4A 4BMXA 4Q03A 5CLLA 3EGDA 3I2KA 3PLRA 5AVYA 4KPEC 3MGAA 2YVQA 1V5FA 5ICSA 3P2IA 1GD1O 4DB2A 1WB6A 4QFDA 5M29A 1P2VA 4O8ZA 1WF3A 1N2CA 4OH7A 5FWXA 1KP2A 1A98A 4HSGA 3U3XA 1KHTA 4JJGA 3V42A 5CGQB 4CL2A 4R6XA 1XRJA 4RESA 2N42A 3HWWA 3VR3D 3B5EA 3QYFA 5JWRA 1NJ6A 5K45A 3G2IA 4EMTA 5JTTA 2WMYA 1KKUA 1ZZEA 1OLSB 3WWOA 1MOPA 3L7NA 4ROSA 5I7HA 4IGEA 4FCCA 3NBZC 2XNJA 3LBYA 1BA2A 3OIVA 2Y05A 2WDZA 4FE7A 2EFYA 4B40A 1I9CA 3H9CA 2VCYA 4QD3A 4ZARA 2BYTA 1IN5A 1SRRA 1QYRA 3P9CA 3V1KA 3BZWA 2PSFA 1J33A 5IJ9A 3BMNB 1P80A 1ZN7A 1ONBA 3I45A 4HO1X 3VGJA 5L7WA 2IYZA 4TXHA 3KQMA 4IZ6A 4Y2TA 3ZCXA 3PFKA 4E31A 1YTLA 2NAFA 3BVPA 3V6MA 5B3JC 3NIBA 3N9IA 1Q1NA 5JAIA 1R4MA 3ZCRA 2OYSA 4D1YA 4R5HA 1PSDA 2GHRA 1NVKA 2OEPA 3DWGA 1HPLA 3E6AA 1MAHA 1W0KA 4C7OB 4ETWA 2CNLA 1RLUA 3PWSA 3NKFA 3UN1A 1N2XA 5DB4A 1NVGA 1E9AA 2Q3LA 2CLDX 4EA7A 2XCTB 1XKXA 4ER0A 1KL7A 2WSSD 1JSRA 5COQA 1IQRA 4B3IA 2AMJA 2QAJA 2IXDA 4ALNA 2SKEA 3NX4A 1NW5A 4Q3AA 4ZVSA 3T3MB 3VJKA 3E0QA 3AY6A 1FPQA 2CLEB 3MSCA 3VPAA 3BL6A 3U9TA 1MDFA 5KBYA 5IHXA 2FR0A 1LEHA 2ZBRA 3U37A 3I1JA 2Q50A 3PUVA 4L3WA 3U3KA 4GS5A 1B2RA 1VKNA 3H9GA 3HBMA 5GIOE 3CUWA 4IEFB 2KBFA 4U6NA 3O03A 2DT5A 5G53C 3PEWA 4KKXB 3V8MA 4CMIA 1XX6A 3TZEA 1FRNA 3UKOA 2B2XA 3VH2A 4BFSA 2Q28A 2O4CA 5K8JB 1DMSA 3V8QA 2FP3A 4TT3D 4ZHQF 4IKEA 4DA6A 3PC8A 1G6HA 5JARA 4DMLA 2QL9A 1Z5WA 4JEUA 2F8LA 5IFKA 2QT9A 1X7XA 1YDFA 2AZMA 4O59O 1ISIA 4L73A 2BKVA 3AUXA 2RHGB 4KQIA 5FBHA 2HSZA 3PPWA 2DB3A 1J0DA 2ZUWA 1NXWA 1Y81A 3K20A 3JATA 3B6MA 1HQDA 2XNHA 4LXYA 3GLHE 1GU0A 1OB2A 2OECA 5KMGB 4LJ8A 1V4VA 3IAM1 3L49A 3RO7A 1YCFA 3TZBA 1NX9A 3GEPA 3CPSA 3ZUGA 1RYEA 1PFKA 2Y2UA 4Q02A 4U8GA 4E33A 7MHTA 4PYKA 4KFRA 4ER3A 2HRDA 1PLLA 3NTLA 2BUAA 2LIVA 4JJIA 1PR9A 1TO2E 3D0QA 3NTUA 3AJ8A 3M3PA 4YRLA 2PMKA 1RJ9B 3CZRA 1EHIA 4G5XA 4BWGA 1WVMA 2XQFA 4PG4A 4H31A 4NU8X 2NTVA 3ZBPA 4Z99A 3WIOA 5BV8A 1UFVA 5A4MS 2J5BA 1UJMA 2YWGA 4NOJA 4KGVA 4ZT2A 3WS7A 1MXHA 2UUOA 5E7JA 3PUXA 4J6FA 4HYTA 3O47A 3UYLA 5FBVB 1O0BA 3RUIA 3QUAA 1SXQA 3LPCA 3EZYA 1O94D 4RF3A 3EDYA 4IINA 3EUAA 1EBUA 3GRPA 1BXRA 1XALA 3EC2A 3NHZA 4HATA 4X1IA 4II2A 3ANNA 1A5TA 1HMPA 2PWPA 5ALLA 5JNSA 1AVTA 2Y27A 4KI7A 4ZJYA 2AEMA 2Z8ZA 4MUJA 5HX7A 1E6UA 1XWIA 3I34X 3PKIA 4XLZA 5H3CA 4C30A 2CVQA 1YL5A 5IJ0A 1E6LA 3ED1A 2W2MA 3SHOA 3T61A 3K5PA 5IMSA 2W42A 3S8EA 2I4TA 1Y7HA 3DWFA 3H6HA 4H7HA 5EJGA 4MUHA 2JGEA 5EMMA 4E2ZA 1M6YA 5KYKA 1I1NA 2JCGA 1SVSA 4C5AA 1Y1TA 1JQLB 1BC5A 4NX2A 3ZU5A 2R1TA 3U1TA 1IY8A 2PRIA 2RGAA 3J7TA 4J0JA 1R74A 3LO5A 2Q9UA 1ZU5A 2EP7A 4CEJA 3LOUA 4ITVA 1PK9A 5LIPA 3U80A 4OA5A 4X3CA 4EG7A 4S1OA 1QTIA 2XMRA 1UZMA 3OBIA 1QZZA 2CEAA 3IUEA 2EW8A 4G37A 1LTQA 4IH4A 2QRGA 4JSYA 5BQOA 4BVKA 4QM7A 1E79A 1IHPA 1L7EA 3NO4A 3T4PA 1O6CA 1LZLA 1QZTA 3D4BA 4P3PA 2GXQA 4BYMA 4E2YA 2PSDA 3UM9A 1S9HA 1O1YA 2QM0A 2VTEA 3CX7A 2HJHA 5EIAA 2AI3A 3VR6A 5LQJA 1GRQA 2IS6A 3H1FA 1G55A 4LF9B 2D0DA 4MRRA 3TOCA 4QPDA 1JQ3A 1PAUA 3AILA 5I7FA 1QRSA 4C1BA 1U1GA 2OC4A 1XF9A 4Y30A 2QP4A 3EGCA 1UZNA 2GCPA 1B6RA 3OZDA 3EVEA 4RIFA 4PW0A 4X6LA 1RAGA 4B8WA 4INJA 1EX7A 3CVVA 3GPDG 1B8VA 5AIBA 3C1UA 5AW3A 4MA4A 4Z4GA 4ZQEA 1M54A 4P5EA 2P75A 2GLTA 2P3QA 4LYYA 5L6MB 4EWLA 3COPA 4CQJA 1Q1GA 1VQ1A 2L42A 3T4XA 4OLJA 4LF4B 1G60A 2FFJA 1KETA 2CUTA 2HSWA 3OE4A 3ONDA 4MI3A 4JR0A 1SG0A 1U28A 3NH6A 3MWJA 3GAFA 1DADA 3T9AA 5HIJA 4YAGA 4G0UA 4OXRA 1KDPA 1GNVA 2P77A 3TLEA 1E94E 1C80A 2RJOA 3BUSA 1DPGA 2VPIA 5DGTA 1OX5A 3R6WA 1BYIA 1VHWA 4TYQA 5AVOA 1TAHA 1RYNA 3ONFA 4NMLA 1AMUA 4ZZ3A 2C7QA 3HY6A 5DOZA 3K92A 4QOHA 1L5HB 3OURA 1Z37A 3DNFA 3MXTA 4R9SA 4HDRA 5DHUA 3V1UA 3DYIA 3FMGA 5EHXA 2B7CA 1PL8A 2VP4A 3ECSA 1B26A 4L95C 4DV4B 1VKZA 4S1VA 1UKAA 2PQMA 1C7JA 3T34A 1HNWB 1PWZA 2PMDA 4I1PA 4JBGA 2VSXA 1AKUA 1VBMA 1N6NA 2GETA 1Q1AA 1EUCB 4RXTA 5F3WB 1Q1BA 4KYTA 4YRPA 5A6VA 2RIRA 4Q15A 3P32A 1NJGA 4IKPA 3PHJA 1YZKA 3FWZA 2BJWA 4IVQA 3WYEA 5BR7A 1Q95A 3PHCA 2QD1A 3SFZA 3DQQA 1NVVR 1UBGA 2VH5R 3LGXA 1L7RA 2WKSA 4KPGA 4EGCB 5J59A 2H06A 3ZVNA 4PXAA 3K0HA 3MWLA 3QOFA 4YP6A 4E11A 3HMQA 2ZJYA 4HDSA 5LP6C 3NNSA 5KU7A 2FMKA 5IHPA 1K5HA 3TUZC 1TKRA 4UBKA 1V11A 2HHLA 2MMGA 1EFUA 5AK3A 3OQ1A 3LL7A 3I0MA 5CT4A 1TVKA 1U3WA 4V0QA 4IIHA 2Q4DA 4HGQA 1EK1A 1M72A 1W25A 1TZBA 2IIBA 3DZHA 5FUMA 3Q98A 3X3HA 3ZD8A 2HMVA 3GD5A 4ALMA 4DG5A 4ECEA 3BWDD 3HM2A 4L72A 3DHWC 4MMZB 4YRTA 2FX5A 2XWPA 3AYXB 3NR2A 3CF4G 1ZGJA 1VE5A 3GRUA 2JF0A 4IDBA 4KVGA 3ZV7A 3KB1A 3QE9Y 3OE5A 4R8KA 1L2TA 4U7JA 3PDWA 2VHJA 3BHNA 5EIFA 4Y2HA 2FY8A 1F8FA 3O4GA 3NKVA 4BKOA 2WQ7A 1RWBA 2YY5A 3PD7A 3RW9A 3S2UA 1JB9A 1OUMA 3CR8A 4AMVA 3GLGA 1DAKA 5TPWB 5TQ2A 4TS3A 5BYAA 2CFIA 3BXGA 3JRNA 4Y6PA 5CNKA 4QXPA 4PPYA 4RDHA 1IQPA 4WLOA 3RIYA 1K7FB 3M5WA 1N4DA 3QXJA 4PAMA 5JOQA 4TKZA 3NALA 4PQRA 1GTG1 1R3UA 1B15A 3EMKA 3F1KA 1P6UA 4UEWA 5LLSA 3VKWA 4CGYA 1OH7A 1OAOA 4LJLA 1THGA 1R6BX 1LRKA 4MR7A 4MWGA 4ZQHA 3HCNA 2CC2A 3JWHA 1IOVA 3OZVA 3MA0A 3JWGA 2FDXA 3HJUA 3QH4A 1QGYA 2BMJA 2BMFA 3QVJA 4JYMA 2C5LA 5C81A 3VPDA 4CL8A 1L4UA 1VPEA 1IY0A 2IYTA 3OECA 2IY7A 2PUTA 2Q9AA 4MKRA 2HLHA 1Q0ZA 3QZUA 1A9QA 4PAGA 3WQQA 3G5TA 1U4SA 4MP6A 4KSCA 4QVGA 3F8WA 3M3DA 4JEIA 3COJA 4BV2A 5IAOA 2BJHA 3IALA 1FX1A 2ZRJA 1BDJA 1VI2A 221PA 4MVCA 2HLPA 3QU4A 1UK9A 4DBLC 3N7UA 4QBGB 1Z4PX 3FDZA 5D3QA 1I4TD 3FPJA 2REQA 2FFRA 3AEUB 2AG5A 4X91A 4FGLA 3SEQA 1SN7A 1WTAA 3PE3A 1KERA 5DTRA 3H3XA 4D4GA 4NFYA 3N39C 3RS8A 2IW1A 3FNQA 4XD7A 1Q20A 2OVFA 5GZ1A 3L8FA 5K0LA 1U7ZA 2ZKLA 5F4ZA 4OFWA 3EWIA 4YACA 4XYGA 3NGMA 4JLPA 3MMSA 4RSRA 4XJVA 1QK3A 1WMAA 1GFIA 3IMCA 4IOLA 4QUKA 1JQAA 1TJPB 2NU9A 3AR4A 4FS3A 2DBZA 1Z7EA 3L4BA 4KZPA 1SXIA 4L74A 2IWHA 4IXWA 1OHHA 2VJQA 3AR5A 1GUAA 1TM1E 3T7AA 2NZJA 1RYZA 2YQ4A 1YIAA 5JEDA 5B2ZA 5JATA 1BVHA 1YXMA 4PPGA 1CWUA 1BN7A 4NYJR 2XZOA 3V8RA 3KOWA 4Y1GA 3K0AA 1Y8ZA 5TMBA 5BO5A 1HORA 3U61B 1WHTA 1UBRS 2AN4A 1XKQA 2OO7A 3IBTA 3NEYA 1XZCA 3OBBA 3MC1A 4HNAA 2H29A 4MX8A 3SX4A 3B38A 2XTNA 3RLFA 1JR3A 1KFCB 2WSBA 5EL0A 4AYWA 1T5DX 5HJ2A 4AURA 1Y1KE 1LC0A 2ILTA 4ID9A 3RFTA 4GI1A 2H1IA 1RQLA 3K1AB 4LZPA 4QYTA 1Q15A 3L5OA 4ZOBA 3GPLA 3BWCA 4AUNA 2CYBA 1A9SA 3PGA1 1E77A 4MR9A 1KS9A 1R37A 2P7IA 3F7TA 1LPPA 2RBEA 2Z2ZA 1O96B 5CX4A 1YAJA 3CLUD 4WBNB 4N0PA 3THWB 4G8DA 3V9PA 2PIAA 1C9KA 1UMCA 1KMHB 2AG0A 3LCVB 3QKRA 4OQPA 3C4VA 2PUAA 3RYFA 5JC8A 1KOGA 1XXHB 2I91A 2NUAA 3BN3A 3IP5A 1R8XA 4YX9A 4IRXA 2R25B 3FLAA 1VLZA 4FBLA 4OHMA