4ZEMA

Crystal structure of eif2b beta from chaetomium thermophilum
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
382
structure length
328
Chain Sequence
b'PSLATWTKSLRDQSLEASIESLIFLLKRRQVTGDECAGAIAQLLRQVVAKSKWHDVDQLLYRVQTAGARLARAAPHEPVIGNIVRRVLGLIRDEASDIASDAASDIQSKSMFNLLSVQPFSVHALRSEVMDGIEEILDEINQADDQIASFAEIQIHPGDYVLAYQPSKTVERFLVKAASKRRFTVILASLNPQPYAALRKKLNAAGVSTINLASNGLMAYIPRVNKVIFGAKAVYQNGGLLVDSGACIAAQAAHEYLKPVIALCGVYKFCPEDPSDEVSRGELTTTDYIPPDLVDVYLTNLGPQTRHHLGGIYADHYKIEDIGFSLQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF2b-like protein,Translation
publication title Architecture of the eIF2B regulatory subcomplex and its implications for the regulation of guanine nucleotide exchange on eIF2.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
total genus 115
structure length 328
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 4zemA02
2A0UA 1VB5A 1T9KA 1W2WB 2YRFA 4LDQA 3A9CA 5DBOA 3ECSA 3VM6A 1T5OA 2YVKA 4ZEMA 4ZEOA 3A11A 4LDRA
chains in the Genus database with same CATH superfamily
3AZQA 4EZEA 13PKA 1K08A 1JDPA 1TK3A 2F1IA 3DR3A 3FTNA 1XCBA 3I05A 3PLNA 1UM8A 2I3ZA 4Z86A 3V1LA 3RFXA 4DQLA 4EJ0A 2GJ8A 2PH5A 2V6IA 4OL0A 4RGQA 1NI3A 1U3DA 3LDUA 4D6YA 1D4FA 2Z1DA 4WW0A 2ADFA 2W70A 2YFHA 2YCBA 3SEAA 4I08A 5BQXA 4X9XA 1JG7A 5C0OE 3X3HA 1KU6A 4TV8F 1R5BA 3I9JA 1SBZA 5AOBA 4ER5A 1S01A 4UVGA 3U0BA 1CY4A 2QD1A 2V6GA 2ZVDA 2J08A 1OWMA 2R6CA 2OHFA 2FEKA 1W88B 1UEJA 1QMGA 1U2SA 3NWOA 4L8YA 1ESMA 2H9AA 2OEPA 2NU8B 1VLMA 5A03A 2QVZX 2ZCVA 1UOPA 2H2GA 2PVPA 1RHMA 1Z36A 1TM2A 3UUEA 1T0UA 1EVKA 4AG5A 1FFBA 3IA7A 5G3YA 4R0MA 4ICIA 1JTFA 1CJCA 5DYNA 4PBRA 3EAQA 4OJNA 3QFFA 2B6NA 1HE1C 3EIXA 4ALKA 1KY2A 3OA2A 4ZO7A 2ZSIA 2HNKA 4EPWA 1P81A 4PFSA 5JNWA 2QX9A 2X4DA 3U7FB 2O8BB 1LQ2A 2FF7A 3E18A 1HZJA 2PNFA 1J1ZA 1SUWA 5KQLA 3FKSD 1O8CA 5I7AA 1GNTA 2GESA 1E3EA 4W63A 2FPKA 3GP8A 6PFKA 3IOEA 1IEWA 3W2HA 1V16B 5H83A 4HFMA 4OHBA 4RJKA 1XZJA 2GHTA 4B6RA 3M1LA 4J0GA 3NC4A 2MTBA 3G5AA 5JVDF 2JAOA 1CJVC 3L4BC 3WICA 2G6BA 4QJ3A 4MRSA 5KQGA 1JFSA 2G04A 2ZYDA 2JHFA 3R7AA 5J47A 2VS1A 1OB2A 2IU3A 1L4EA 3MTIA 1N6IA 1PN3A 3E22A 2H7CA 1SH7A 4LZJA 3ANYB 3E1SA 1I1QB 4RKRA 5EXSA 2BFFA 1PAUA 1EDZA 1Q95A 3LZ6A 1ENOA 5ALKA 1ZO8A 4ZAXA 3GX1A 4EHIA 3A9SA 1ZRNA 1J4AA 4NEHB 5F7ZA 1XZAA 5BYAA 2I1LA 4MVJI 3IT1A 3PT5A 4D9IA 3UMBA 4MITA 4DLRA 1ESEA 1NFFA 3I1FA 2HRCA 1Q0PA 2IF0A 3QF7A 3SKXA 2A8YA 2YQZA 3RIYA 2IF2A 1W0KA 2ORYA 3T3PB 4ZTUB 1RZRA 1NDHA 3JATA 1OI4A 2P2SA 1BEZA 3RREA 2Y1DA 4ZCLA 3VYUB 4Z5XA 5C37A 3P20A 2AFIA 3Q7TA 4DUGD 4IXWA 2XWSA 3KELA 4C21A 2M6LA 4F6CA 5BMOA 1VFPA 3VI3B 3WVNA 1TCBA 4AQYB 5B12A 4Y0VA 5IAAA 1KHHA 3PGA1 3AU8A 1UBOS 4YCJA 2UUAB 2YBDA 1WB5A 1WSAA 2NXWA 4BCCA 2XCOA 1V37A 4CKBB 3V8RA 2HSDA 4GOOD 2E7ZA 4CR8A 1VSBA 3Q3VA 4WFIA 5FL3A 4DABA 3OKPA 3OFVA 4FCTA 4I50A 4QTZA 2Q1SA 3HCBA 5HCNA 5EJ9A 4DEVA 2DG2A 2NUTB 3F6SA 1YBFA 4IH1A 5EKTA 4H3KB 4BO7A 1PT9A 1DBVO 1OGJA 1K1EA 1LPSA 1E61A 2I9PA 1VHLA 3Q0IA 3S55A 1I2CA 4CTMA 1OHHA 1VJGA 1ZOPA 1J25A 4DKXA 4XGQA 1UH5A 1XXHB 2B94A 3P32A 4NZZA 4UDNA 3RS9A 3E70C 1UC5B 3RPEA 3C7KA 4RCVA 4X92A 1IPHA 2P4HX 3Q0EA 1SD1A 4LZWA 2GSDA 5C32A 4KCGA 1XNJA 2VP6A 1QOPB 4GD3Q 5DCUA 2YDXA 3K9HA 1QF6A 4BO9A 5CH8A 4YEDA 4E09A 4F8EA 4JDPA 5B2FA 3Q3CA 5B7GA 2H4FA 3UJPA 3OIGA 4Q3EA 4TLCA 4KP7A 5DN6D 5FXMA 2DFKB 4S0ZA 3I76A 3TEMA 4E3WA 2DR2A 4W5NA 3FBGA 2YFQA 5TPWA 4NECA 1C1XB 1F5NA 1NW3A 2DGDA 2NO6A 3N1UA 4ZV7A 1G3IA 4LXIA 4G1BA 4F12A 3C7TA 3KKZA 1U3CA 1NP6A 3TLEA 3UGKA 4TT3A 5AJZA 2BSXA 1ZEJA 4BNWA 2FSHA 1KYYA 3KQNA 4FOPA 4JBYA 1NXOA 4GBGA 1F8YA 5ICCA 2COEA 3A3NA 1ZICA 4IDEA 1AF4A 2XUHA 2R4TA 4U8GA 1QHSA 4HQ0A 3KT8A 2AMVA 1WWKA 2G4LA 2I5PO 2REBA 2D2FA 3BFJA 4UU7A 5CJPA 3B12A 5CW2A 3FTFA 4JEMA 5B58T 4GZ5A 1G9TA 4NHEA 1PSWA 3WMEA 3K6SB 4OPMA 2ZIWB 2KWIA 1OC4A 1T4CA 2FY8A 3DE2X 1LS6A 1PBNA 3HSYA 3NGLA 1TVMA 3O82A 2C3YA 1QH1B 3UAWA 1AQUA 2VJAA 1K63A 4B8ZA 1KMCA 1VYTA 2JIMA 4UARA 3EYWA 2UKDA 1WMDA 2NSDA 1FJGB 1IAVA 4DSTA 1VZ2A 2GILA 4D1YA 2MSWA 1HEYA 3TBFA 2IQIA 4RXTA 1CF2O 2DHEA 3FHOA 1XQ1A 5YASA 3IESA 1AQNA 2FTKE 1Z6XA 1UEIA 4W5JA 3VSDA 4X62B 4KGDA 4M0KA 4C7MA 3IP1A 4ALIA 2ZM6B 1ZGZA 3A05A 1T0JB 1UDBA 2QENA 3VAYA 1V11A 2WILA 4Q3BA 3I2JA 1GITA 1RMQA 3PE3A 5L95A 1SVSA 3AUYA 5L53A 5JH7A 4QWWA 1SBYA 3OMXA 4FEAA 4JP5A 3OPXA 4KFSA 1EE1A 3W5SA 4LQ4A 1XVAA 2BCGY 3DFIA 4U2GA 3WL3A 3KM0A 2CHEA 1A4IA 4TLLB 1L5HB 2PMWB 3ER6A 1X7XB 3VSCA 1SXJE 1YZTA 4PNZA 3AEXA 2X3FA 2GM4A 1KGSA 3SJUA 3QVWA 2QVYX 4CMCA 2XAUA 1U9JA 2VPTA 3OVMA 3OZXA 3EVEA 3L6UA 1X7WB 2GD2A 4GVXA 1A04A 4C43A 1LI7A 1ILWA 3B3JA 3LXXA 2PT6A 1GGNA 2B4AA 1O1YA 3GZJA 1CQIA 4B2IA 2OAP1 1F2UB 4R2HA 4EQ6B 3E8XA 5H81A 4D4IA 4GGOA 3ZVKA 5A05A 2EVWX 3B1FA 2XOEA 2EFHB 5HK9A 1Z6PA 3OOEA 1SVWA 1EHIA 4QPNA 4FGLA 4D0RA 2WQ6A 1L5YA 1QYXA 4QQRA 2PE5A 2OOSA 4ARVA 1XR3A 3ZHVA 1TCVA 4HAZA 1GRVA 2F67A 3T61A 1IULA 4EHBA 1Y3DE 4XARA 2XB2A 5FP0A 3MRSA 4CMKA 1U7TA 3TN7A 5DBOA 3AGQA 2WJVA 2FA9A 1DFIA 5JFGA 1RW4A 2OCXA 1PJAA 3O2QB 1E2JA 5IWAB 2IH2A 3KV3O 1XWIA 2BFAA 2QTCA 1W88A 5AJYA 2A9OA 3RBZA 3L1IA 3QBDA 5LBIA 4MV7A 2AJDA 1XJ5A 4PN7A 1OX4B 3T41A 3HWRA 4IKOA 1BWRA 3SZLA 2F3TA 5EP1A 2FMXA 5FL7D 4F92B 2R0QC 2AF4C 1IHOA 5DCYA 3E5MA 4QNRA 1FF9A 3GFFA 1CZNA 5EIBC 1U4NA 3GLVA 3ZIAA 4EJSA 4YY3B 4RS4A 3ER8A 1RACA 1GZSA 2DWOA 2JKYA 1P1HA 4RZ2A 4PINA 3ZK9A 1KQFA 4DEXA 4UBLA 4GAEA 3MJFA 2AJBA 2AGVA 2PVCA 3MXOA 3DQQA 5HCUA 2VWQA 2WJGA 1YS9A 3OFSA 4QOIA 4BC1A 2O8BA 5AJVB 5AT1A 1DKNA 1W0CA 4J0JA 3GLGE 4G1CA 1NQWA 4OYRA 4LI3X 2HJRA 3FRHA 1H0RA 3BL6A 3EGVA 3HADA 3QA9A 1NV8A 3HKEA 3AM1A 4L8LA 4FOOA 2IEZA 4QNMA 3OZAA 2WJAA 4RCYA 1KR5A 2H2WA 1Y3CE 2NVBA 4Z54A 4KHPB 4EG3A 1W1UA 3SZMA 4ODIA 3M3PA 3A04A 1GGFA 1W52X 2WOJA 3NAZA 4JD5A 2PEZA 4I55F 1CRQA 3HY6A 1DBSA 1UBEA 1WLYA 2P6PA 3NS7A 5K6AC 4DA8A 3UNXA 1AXGA 3KCQA 4DA0A 3C6ZA 7AT1A 4ZCPA 4EA8A 2GAOA 3CEAA 4JR0A 1PNQA 1RZ3A 1E9RA 1XZNA 4G86A 3FTQA 2D2EA 5C81A 2HV9A 4OP2A 1QHFA 4OGGA 1G66A 2F4NA 2Q3LA 2P0EA 3HHPA 1FZQA 4GM4A 4JJFA 2VOEA 3I42A 1CVRA 4FNOA 3LKBA 4UNSA 3HUFA 5BVHA 1SVIA 4WZAE 1NW6A 2B1RA 1T5OA 3BILA 2P5UA 4V1CA 3RFUA 3M5CA 1TK2A 4CM8B 2GCOB 1QHHB 2J6CA 3VDMA 2HSWA 2QRZA 3TMYA 3BMNA 1QANA 5GIOE 4JI7B 2HQOA 1UL1X 1DAOA 1IOVA 3KTOA 4K3UA 4EFDA 5KO2A 1Q0TA 3SHWA 1YAHA 3D31A 1GUDA 3VGJA 1HYGA 3O7WA 3HCFA 4FYIA 2HJHA 5AKIA 4OQ4A 1W9MA 4IS2A 4J2OA 5EP4A 1MVOA 5IJ0A 3W1VA 2FZLA 4C6HA 4J1TA 1UF9A 2R1VB 4IIXA 4NMLA 2BSQA 1PQ4A 3JCZA 4KBFA 4BMPB 4EYEA 2D2VA 4CG1A 3KQSA 4UMEA 1R18A 4B3HA 1AQJA 3CRMA 5HF9A 1UXGA 5BYBA 4CKBA 3RS7A 4PN3A 3FCXA 3B3FA 1TT7A 2W2OA 5HVNA 3IE2A 3UAYA 4MQLA 2DPGA 3ELBA 3MRVA 1S7GA 2JI7A 2CLLB 2WK1A 5AO9A 3JR3A 2B4TO 1WVGA 5KTRA 5IAJA 3ZBUA 3OIWA 2GR9A 4DHEA 1H2AS 2ZUVA 4O8CA 1P62B 4H7HA 4DADA 2BD0A 2XDWA 3OLXA 4BWFB 3BHIA 3IBYA 1S8FA 3MM4A 2QAGB 1QAMA 3BREA 3QEMA 4ND8A 2ILTA 2O2CA 2XZPA 3C3EA 3OO0A 3L0YA 5DHPA 5EMKA 5F12A 1TGVA 1J07A 1BWPA 1S2DA 3E8SA 4PZZA 3R8FA 1SVLA 2UXBB 1T6BY 5LZ8A 3W5DA 4Y2QA 3HCWA 4MH0R 3ED1A 4UHCA 3QVSA 1RDFA 5I9TA 1ZX1A 1OE0A 2VYFA 3HO8A 3JR7A 1U2PA 3ZDZB 4FVTA 3G2NA 4XEUA 1JEAA 1MD9A 2R25B 1T36B 4JT8A 2CLIB 1VXOA 2ZXFA 3M33A 4MS3B 1GEEA 3DPIA 4RENA 3UFXB 3WR5A 5JO0A 1P73A 4J1TC 2Z4SA 5JXJA 3EBPA 2WUFA 1U80A 4HAOA 4O4HB 3VI4B 2LTAA 2VNIA 1XA3A 2OLJA 4URZR 2BJHA 5BV1A 2V1UA 4P3XA 3A32A 4DLWA 1P7VA 2J67A 3QE0A 1QR6A 3GA5A 4Q3LA 1U7OA 1YL5A 5FJIA 5IC4A 1T35A 4P4UA 1ECFA 1F06A 1G16A 4IIVA 3VVBA 3WWOA 5FUQA 4E08A 2X3UA 4BNLA 3A7EA 4PRLA 1N25A 2CVHA 1LX7A 3H1BA 2R85A 3AEZA 4IBOA 2ZRPA 5FI0B 4ZK6A 3DAOA 3PV0A 3FI9A 3O8QB 5HMLA 4ATNA 1GRNA 2QSYA 3JYOA 4GSYA 1RAHA 4GX0A 1QPGA 3A3YA 4FTWA 1G21B 1IN5A 4I66A 4CMIB 5C5DA 3PEYA 1KI7A 1UWLA 2QDXA 4XQ0A 5DXJA 3A36A 4H1UA 3K6SA 3LC1O 2A2ZA 4C7XA 5CXQA 4DSUA 1BVUA 1IQUA 3FPCA 3JU3A 2J85A 3ILSA 4IJKA 5ALRA 1O0BA 4U7GA 2NSLA 4Q7QA 4JI0B 1QTQA 1Z47A 1QH1A 4UEQA 1E3QA 1J7JA 4YP6A 5FWDA 1DBRA 3W90A 4LF5B 4DCJA 1C3OB 2Y1KA 1WMSA 3JWHA 4BZQA 5AW2A 1MR3F 4ZDJA 2VWGA 1OIXA 4L8GA 3VVCA 4WPGA 4OKIA 4IX9A 4ZI7F 4YRAA 5A5GA 1KMMA 3WC4A 1TMKA 5MN4A 1H2RS 1KIAA 3AY6A 5ALJA 3KQLA 5C1BA 2YVKA 3VTFA 4J2TA 2F1KA 5AFSA 2WM3A 3ONFA 4FNAA 3AR3A 4HB2A 5EI5A 3HRIA 2VSNA 3KHKA 2IZ1A 3QG5A 3TXYA 1Z7YA 1FFYA 4GNRA 4TXNA 2WWRA 4DUPA 4RJLA 3WNQA 4DA6A 4AP5A 5KWVA 3ICOA 3OEHA 1N5RA 4HVLA 3EXEB 4AI6A 4CKXA 4V0RA 4FLMA 2YZ7A 4L15A 5DLEA 3K6RA 1IVYA 5E7MA 4UEOA 4KC0A 1L5HA 1OLUB 1DU4A 1X7XA 2C95A 2E89A 3PHHA 1SUDA 4NBTA 4EYGA 2F43B 3N7TA 2IUYA 1CS0B 3ZZ1A 3TFQA 1PQPA 3K96A 4MVCA 2CHUA 3LO5A 1IBRA 4BVAA 3U6KA 5FOXA 2PMFA 1NW5A 4DPMA 3AIKA 5JYDA 1MOSA 1J2EA 1X7WA 1Y7LA 3W7VA 4AJLA 4L08A 4YXFA 2HSJA 4WIAA 1Y3AA 1VSTA 3OTQA 1Y3FE 3AVTA 4CTKA 3VVLA 4BKOA 3WQSB 1KVRA 1X1RA 2AR7A 5FPTA 3DTVB 3K31A 4EKNB 4EQ6A 1AKRA 2NV2B 2VXBA 2JJ2D 3CUWA 4LZNA 1BU5A 1T2UA 3SF8B 4KTVE 3ENKA 4QPCA 3JQ8A 3DFMA 4YPVA 2AC2A 4QXAA 3X1KA 3JAKB 4AZSA 3E35A 3L8YA 1UQTA 3NZEA 3PE4A 4LYHA 1E3TA 4FIZA 1FP6A 3MRTA 4NULA 3DAFA 4HEA6 3EPHA 3EOAI 1IN7A 4C4RA 4IM7A 5ICSA 2ZOSA 3U9SA 5AVOA 1LK0A 3FNFA 2XNSA 2Q6KA 4DQVA 2N42A 3HUEA 3GG2A 4P3PA 4R54A 1OWLA 1E9SA 2BN4A 5KX5B 2PGXA 2OORC 4TQUS 1XCMA 1WPQA 2Z9BA 3GVXA 1AK2A 3DBIA 3KKPA 2WY2D 3WK6A 1TL7C 5JAOA 1HT2E 2ID4A 2Z9DA 3WS7A 3HVHA 4O0MA 2R7MA 1Z88A 4TMKA 4MO2A 1P5FA 2IUFA 3H42B 4C7JA 1B93A 3AT1A 1BW9B 4V24A 2V58A 1NIJA 3DYIA 2V97A 2VSXA 3FXAA 1O7JA 1XP8A 1F7VA 4P6VF 3W8DA 5JSFA 1SC6A 4LYFA 2ADMA 3R23A 3N8HA 1UMKA 5FA6A 5DM60 4BGIA 1DCTA 3JTEA 1AGPA 1QO7A 2PD3A 1M67A 2QNRA 2XYQA 1RBQA 2PZMA 1MO6A 5CH5A 3CZ4A 4G5YA 1HFEL 4O2LA 1H9BA 2BBWA 1JR4A 4ABTA 2IS2A 1IBCA 2AYXA 3Q5DA 4FLEA 2ZUBA 4KNWA 5CT9A 5ELLA 1F12A 2WWGA 4A8PA 1YZUA 3AVYA 1L5GB 1P6QA 1X92A 4WXYB 5FD8A 1KMQA 2X8AA 3PCTA 3PGLA 4JVNA 2WTEA 4TXJA 2UVPB 1B42A 3VPDA 4B45A 4XWWA 3B2NA 5B5SA 4F86A 1KAMA 4QU8A 3VKWA 5BR4A 4DQUA 2B35A 3PFGA 3HDVA 2DHDA 4C87A 1HF3A 3W6UA 4E33A 3FZYA 3V5NA 1EQAA 1K8RA 4CIBA 4IDHA 1TA4A 1T3TA 1E58A 2ON6A 2VN8A 4DMHA 3LC7O 5C5EA 2GCEA 2HQ1A 1HLGA 1U6IA 2V6FA 3M8KA 1GSIA 3B1ZA 3PNYA 4NZYA 4BO2A 2JIRA 1JQEA 3DZCA 3ZTYA 4A15A 2NZVG 1WXQA 4M9XA 4F3KA 3LQ2A 3QVGA 3RAEC 2RHGB 1PG2A 2AQKA 3CBGA 1MO5A 1KF0A 1UJ4A 1Y3BE 2JBAB 2OBNA 3H9CA 4I4TA 1I36A 4G0XA 4LPSA 4ZKDA 2HH9A 4S3MA 4F9EA 1XDWA 3V6MA 1OZFA 4ONEA 4QOGA 4TWAA 3WYDA 1YZNA 4HNQA 1MQSA 4C1NA 3RJTA 1G9SA 5TVGA 1IZ7A 3QNMA 3DGFC 4LJSA 3USES 1UC4B 3WMRA 3S2YA 1QO0D 1QFSA 3EZNA 3QBJA 1Y80A 2B78A 4IXMA 3UWPA 4WZBE 4K26A 1ISGA 1RQGA 1UUFA 1J0DA 2HB6A 2R1VA 1EVLA 5CT8A 4HB0A 5EZYB 2WWWA 3DE7X 1YI8A 3SC4A 1YKFA 1N7JA 4ZDKA 4KACA 4OYHA 3D0OA 3D6NB 2B7CA 8OHMA 3JZMA 1MH1A 1TGYA 2WUDA 3SFTA 2FYTA 4PFJA 3VH2A 4DLXA 1NPYA 2EKZA 3B52X 3G9UA 3O3MB 3O3OB 1SBCA 4IH9A 2H18A 5T8KC 1I3KA 2C2YA 2MCFA 2ATCA 3GI1A 2PKQO 3L1JA 2B4YA 2HT6A 4BX3A 1KZHA 1LWNA 2J6BA 4LHSA 4PZEA 3GARA 4NMMA 4Y1RB 2E0IA 3D3WB 4XRGA 2HCFA 2HPZA 5JD5A 1YVPA 2J0UB 2OY0A 3DOHA 4AJ9A 2NNLD 5AHKA 2QB5A 1L4NA 2I2XB 3FPEA 2XITA 1DB3A 3U4HA 3HZOA 1XD2A 3CB2A 3N07A 3O84A 4U6QA 1U0NA 3G6WA 1RFGE 1CZHA 1K7CA 3QNWA 4PXSA 4EYKA 5I9SA 3ACCA 1I4OA 4GECA 3OU2A 4ZEOA 3VSBA 3L0OA 3L0BA 5HRCA 3ETDA 3CA8A 1P74A 3MILA 1E9EA 1SHKA 2Q9AA 2VHXA 5ALEA 4RMJA 4CTJA 1AGYA 2EZ8A 4MS3A 4PLWA 3H6GA 5FI1B 5IG2A 3SR4A 2C97A 1KEKA 4CLEA 2I9KA 1NP7A 5IP5A 1RJDA 2JZOA 3KKOA 2WHPB 4C6TB 1IBLB 3PC4A 4O4HA 3P9PA 4RK1A 4XDYA 3D7RA 4FFLA 4UBMA 5EHIA 3ZWQA 1H2EA 5JAPA 4RPJA 1GNSA 4GKJB 3H7AA 3IPAA 1VC2A 5FBRB 2GN0A 4L28A 1X7GA 2AOTB 2ZJ3A 1X1SA 5LA6F 1XKLA 3NM5A 3Q7QA 3PR1A 2JHPA 4R84A 1YH3A 2J0VA 3SJBA 4YJ3F 4MLPA 1VL6A 4F56A 2QYHA 1DO0A 2RKBA 4M36A 1SGWA 1WUTA 2B36A 1P0QA 3HBMA 1P0FA 1BTOA 2FRVA 2J87A 4B6FA 4F9TA 3O4IA 3E9YA 1U7PA 1ONBA 1R6UA 4OO3A 2GPTA 4MQBA 5AKZA 1WUKS 1G21A 2QAGC 3LPLA 1ISJA 4CMIA 3N9IA 4IQFA 4JHXA 5I6DA 4UCWA 4CR6A 3ZHZA 2BEVB 2PSJA 1DC5A 1XZEA 3R5JA 4R68A 1GUFA 2ZRCA 4KSCA 4OV6B 5IM4A 4LOIA 4JT2A 2NSHA 4P80A 3CLSC 5KJFA 3QFHA 2BMWA 1PHPA 1Q1EA 1C3OA 2QTGA 3G0OA 1PYDA 3KR0A 3LYHA 4X45A 5DH9A 4C7KA 2CZCA 1OILA 3AH8A 5ECYA 3C4QA 3GPCA 3HVIA 3PWKA 1KI6B 4GRAA 4QBGB 3T99A 3KOWA 4OMCA 2JGKA 2OYRA 4YRFA 3UV7A 2LGJA 1AO0A 1QQ7A 1D5CA 1P5JA 4E5PA 1QIHA 1USIA 2J9ZB 3TCKA 3D3QA 2V7GA 2BUBA 3Q7EA 4ARBA 1CB0A 5DOVA 3H9GA 1WCV1 3FRJA 3K8YA 3FCOA 4MWCA 4R83A 4NLLA 5AVKA 1DLJA 2QE7A 5A6VA 2O8CA 3AUFA 2W11A 2EP7A 1OBHA 4Z9XA 1A77A 2Z43A 3EXEA 4XGNA 1LF5A 5GY7A 1NNEA 2FK8A 5CPBA 1LRJA 1JEYB 1GAXA 3AP2A 4UUQA 4NABA 2ZJYA 5AJTA 1KYQA 4Y2GA 1OLUA 5HF6A 3W4KA 4N5MA 2PYIA 2YQ5A 2EIXA 3L6CA 4H77A 1P4HA 1CS0A 4J3NA 4RTJA 2WTAA 1C2YA 2FKNA 3TEFA 4BN0A 3T4EA 1PVVA 1IQRA 3OM9A 4ADSG 2PXXA 3EOZA 4IZIA 4IXTA 3PGMA 4PCUA 4BHTA 3H3JA 3AIMA 1CEXA 1P0PA 3DTVA 3H3XA 4PHTA 3R7FA 2C5BA 2R1TA 3IC5A 1QCZA 4FFPA 4TQGA 4P93A 4ZOLA 3VR5D 4N5NA 4A5OA 2WF7A 3CVJA 2WLSA 3NM4A 5F78A 2CD7A 3IRVA 3SF8A 1WBJB 3ZWVA 4GLFA 5IUJC 5E6UB 2EX0A 1ENYA 5DEIA 2WWXA 3FWHA 4R1TA 1WW2A 2H3EA 4INPA 3JAKA 4RQTA 4BTVA 1MNAA 2W00A 2PKWA 3NH9A 3AM3A 3LHKA 3GRKA 3DYBA 1T1RA 2HBYA 5LIPA 5A5VA 1R10A 5D7BA 3BDAA 4LK3A 4HQ6A 5JXHA 4WOJA 1XCJA 1TXGA 1MQAA 2EG5A 2O2EA 4J0CA 3PNLA 3TDNA 3VR6D 5AI0A 1SU6A 3OPVA 3HI4A 3BWYA 4Z49A 3FHLA 4KMOA 1X2BA 1T13A 2IPXA 1QKJA 3G17A 4JSRA 3UWMA 5BSEA 4YCLA 1N7HA 3TZHA 2JRCA 1HL3A 4U8HA 4D8XA 1PKXA 2O57A 1VZ3A 2XMZA 1A2OA 5AVUA 1NI4B 3R2JA 4AP6A 1BMDA 1USGA 3DHWC 1BW9A 5JC1A 2XX3A 4Q1DA 4X90A 1CR4A 1DO8A 1TMYA 3ABIA 1AA9A 1YVRA 4JASB 3CU5A 4EB0A 1I94B 3OPYI 1XN4A 2DEUA 2LUOA 4FK8A 5JPIA 4Q6BA 1TYAE 2E48A 1VKZA 3N8IA 2ZEJA 3RT1A 1Z56C 2OXCA 3AY7A 1GR0A 3PKIA 3PFIA 3CNEA 3OCJA 4PZ0A 4AJOA 2H11A 2GGSA 3ZHCA 2RGXA 2PBFA 4GVLA 2IS6A 1R0YA 1KI1A 1P9RA 2Y3IA 4FKMA 5FOVA 4MLDA 3RUHA 2PUEA 3ENZA 1DCKA 3DEYX 3H5IA 4RY0A 3SQXA 2CLKB 4CCYB 3GDOA 2O0LA 1PYOA 1RZRD 1RZUA 4C04A 3D4OA 4U9UA 4AS1A 4I1VA 4I6GA 3HJUA 1L5FA 3C16C 3DT8A 4CGZA 1O5OA 3C48A 2XNJA 1O0CA 1Q0QA 2CZGA 4AJNA 2HEGA 2NUPB 1U3TA 3GNLA 4IIYA 4XYEA 1Q17A 4PHGA 2Q1TA 4FONA 4EECA 5DNYB 3X1YA 4L5JA 5EP3A 4DA7A 2GK6A 5JEEA 1N0IA 4RSMA 2ZUEA 1VJRA 5JALA 1C3JA 4FE7A 3C4JA 1SIUA 3CX8A 4F2GA 1V9SA 1J2UA 1IHUA 4ID9A 3VPGA 3LNCA 1BMTA 2QY6A 3ZTWA 3BKWA 4MB2A 2FDRA 5KQRA 1XRJA 2JVIA 4TWIA 2QTRA 4RWZA 4O4IF 4D9EA 2FN9A 1OHHD 5CMLA 1E4EB 3TZEA 3OE4A 1NPTO 1V95A 4MGHA 4FFSA 4PSDA 3MJSA 4X91A 3SJZA 4C5BA 1ZD3A 3OJWA 2GERA 1ZN9A 4LC0A 4BVFA 2Q0QA 1DADA 3GEHA 3OWOA 3K9GA 4V0OA 2OQRA 4C76A 2ZZNA 4DKJA 1DTWA 3A1UA 5EZYA 4UOEA 5A9RA 4UBOA 4WGFA 4QZVA 2BKUA 1P4JA 5LQMA 2ZZMA 2M9MA 5BV2P 3LBFA 4M1OA 2GHQA 4AKIA 1KTVA 4R5HA 4LQDA 2QR2A 3GUUA 3I39X 1W0JD 3RADC 4JVOA 1Q0RA 2C2WA 2ASEA 2IXTA 4Y1GA 3JVEA 3E7WA 2VDOB 3DDNA 1AN0A 1U1DA 2LXNA 1TZJA 1VIDA 2Q0XA 3HDJA 3KJFA 3GUVA 2H63A 2IZ6A 3CR8A 3GFVA 1YDWA 5CGZA 4Y1RA 1YL6A 3DBHB 3R3SA 1V9LA 2J0UA 2I3DA 3TNJA 1GZ4A 2HK7A 4EY3A 3NIFB 4BXOB 4AJKA 2WTMA 1S8OA 4R2LA 3Q8LA 3FHJA 5BQ5A 1U94A 6REQB 4EUSA 4PAMA 3G6KA 5K0LA 1XROA 5D00A 1YHZA 1KAGA 2JLBA 1K5GA 1THZA 2IL1A 1KERA 2OP1A 2PZKA 3GPIA 3WP0A 3KJQA 1LJLA 1PIWA 1QIMA 1U0OC 3DO6A 2BR4A 1LRLA 2HZ7A 1ID8A 3MCVA 1RMTA 4HNAB 3MF4A 4YJGB 3O1IC 1TAUA 3H9UA 4FDAA 1USWA 1RU3A 3HNOA 4C6TA 3N53A 1S2MA 2FLKA 3DHNA 3R0XA 2YHUA 5HK8A 3GT0A 2OCPA 1ZD4A 3CVVA 5BWNA 3GQVA 5TQVA 2M1ZA 1BQEA 3BXOA 1NNI1 1FPMA 4RPLA 1LTHR 3H5LA 5I4CA 2GK4A 2X4GA 3M6VA 4F46A 4Q02A 421PA 1W29A 3A4TA 1GGJA 3CLUC 1GFZA 4ZP1A 3LLMA 4WKBA 1IVNA 2VDMB 3RLIA 1ZG3A 3U7JA 4Z4CA 2RJOA 1JI3A 3K73O 1R3DA 4CJXA 1VSUA 4AZ0A 4H0NA 1SEVA 3T7EA 4U9HS 3AEYA 3HCEA 1KRWA 1U0FA 3HCDA 3QVUA 4R1QA 1US8B 5AKGA 4R5MA 4WX2B 1B8PA 1WLSA 3R0ZA 3ZWCA 4ZJZA 1RADA 1D7OA 4NKRA 1NOIA 2Y1WA 1E2UA 1NKSA 4FN4A 1CRPA 4EKIA 4GX5A 4Z4QA 3KAJA 3B85A 5COAA 3TTVA 3HKCA 3EZGA 4MVXA 4MA4A 5BNZA 2WNHA 2PD4A 3HA2A 4ZQCB 2WQZA 3FOAA 1KE2A 1CJKC 2PH1A 4BFUA 1ODTC 4ZK2A 3TH5A 4UUNA 1N34B 4GMKA 2MJLA 4KJXA 1YC2A 3ETEA 1FOEB 4N12A 3RR2A 4S12A 3L7AA 3WFIA 1CRZA 1PG5A 4LY3A 2AK2A 3TLCA 2XQGA 2WG2A 3ZNQA 4DV6B 4ZHQB 5A5DA 3B8EA 3KDPA 3HP4A 4O33A 1SQFA 3Q7RA 3EHDA 3WGJA 3AHGA 4DM4A 3H9QA 3OTWA 4A2WA 1QRSA 5KYXB 1DEXA 1OF1A 2PFGA 4HMQA 1TIPA 4HC4A 1DBQA 3GXOA 3KT0A 4DRXB 2BBSA 3ZGZA 5GONF 5B3JC 4B6JA 1T3HA 3HS3A 4IRMA 3TZKA 5LCXA 3VHXA 5J59A 1V6CA 1SQ6A 4XYBA 2D0OB 5JCXA 1G7RA 3IAEA 3LK6A 4K6MA 3INNA 3KYCB 4LWQA 5DW0A 2PS9A 4DY4A 2HN9A 3C3JA 5AW6A 4QXOA 4P7GA 3FNRA 3OBIA 4KXUA 4UM5A 4HWSA 1MVNA 2Z3VA 4W82A 1DRVA 4W9RA 1CUUA 5DT2A 4E5UA 4NE9A 5KKCA 3JQ7B 1ZW1A 5JY6A 4PQYA 5JADA 2VZEA 3SPXA 3P9YA 3WIDA 3TB6A 3V48A 3MT9A 3B13B 1TVEA 2P2NA 4XJSA 4WY8A 5FV4A 1FFCA 3D3KA 3DBRA 2MSEB 1JA0A 2I2FA 2G40A 3C97A 3E0QA 3LHIA 4KKXB 2ZZKA 5COBA 5FYDA 5A4FS 3KKNA 3NBMA 1QYVA 4BO8A 1OMOA 1T15A 4LJ8A 2YUIA 3OOYA 1BROA 3MCWA 2I4TA 3R6LA 2WU3A 4L4UA 1WDTA 2PTGA 5AMXA 2GUWA 4LTDA 5FFMA 3U49A 1QR2A 4CLXA 5HW0A 5KWIA 4DMMA 4ZVPA 1F48A 3A26A 5BYKA 3GEBA 1IB6A 2XWJI 4G56A 4Q3AA 4LK2A 1FK8A 1Y7IA 3HDGA 1NVAA 3LXMA 5J43A 1DTEA 2I4LA 3C8MA 5FUMA 4HT3B 2A88A 2OVBA 2BCJQ 1RTTA 4GLJA 3ABQB 3EIWA 4II2A 3FVRA 3CXUA 3HMKA 4MUXA 1PEAA 1ZY2A 3V4SA 2PRKA 2X6TA 4MUFA 2PLAA 4WRRA 1QK4A 2CZQA 4DF3A 1NI4A 1VFNA 3D3JA 1UXOA 3D6UA 1M1YE 3SR0A 4KR7A 4DCOA 1UPXA 2JS7A 2C5LA 5KU7A 5KSPA 2DQYA 1KNXA 1V1MB 1WKBA 4OHMA 4UUBA 1SUEA 3DCYA 3L4EA 2HPHA 2YDYA 1ZMOA 2IPAB 1APBA 2D74A 3H99A 4RKYA 2R65A 2F8SA 2G3YA 1L8QA 2G70A 1P3Y1 4X6UA 3BULA 3UCEA 4KV9A 4NH4A 4C4YA 8ADHA 2EP5A 1AN9A 1I80A 1Z7EA 2JCXA 2UYQA 3FBTA 3FNHA 4RFSB 1BO6A 4G65A 4GZ3A 3TSCA 4ALJA 4HYQA 5AOAA 3RK0A 1CEYA 1EAMA 5CCEA 2D6FA 1EK0A 3T7TA 1JQBA 1M2HA 3BOSA 1N2CB 1QF7A 4B75A 1E1CB 2Q27A 1CP3A 1ZH6A 1I7DA 1KAHA 4IVPA 3REGA 3CTPA 1QIDA 3H9BA 2C9DA 4HWTA 1MORA 4CCYA 2FP4B 1PTKA 1YWGO 5AKXA 3Q98A 4FR2A 1G2PA 2IDJA 5F52A 3LVRE 2QRNA 1EXWA 3NDIA 4Q47A 2J30A 4EW6A 3RYCA 2XF2A 3BF7A 1LNZA 2JGFA 4NXMB 1FFSA 3RO7A 4EVQA 2FDXA 1FDOA 1A5BB 5J63A 4K9PA 4H4DA 1YFLA 2VC2B 2D1YA 5ED0A 3T06B 3H19A 1X1BA 3KJNA 3A6HA 4RFLA 1PG0A 1V4BA 3LGXA 2J0QA 3PXGA 2GF9A 3PFWO 2UZ3A 2G8LA 4GVPA 4A0QA 5JWOA 2FPXA 1R0LA 4WJZA 5G4KB 3U1TA 4Q1CA 3KLOA 1BMFA 1FYEA 1Z2NX 1YJ8A 2R7LA 1HT1E 3ABOB 4ISBA 2HADA 4NAHA 1L4MA 5CIWA 2J4FA 4ZJUA 3SIXA 1V39A 2H5EA 1B41A 2W6NA 5FRDA 1FX1A 1PSZA 2PQMA 1JAHA 4UE6A 3TVYA 1OTXA 3N2NA 2H85A 4MRNA 5E9JA 4KPUB 3FMIA 4OBWA 4MUJA 2BDTA 3T1VA 1K8XB 1GYPA 1R2QA 1MB3A 2B3TA 3D4NA 3RT9A 4CFZA 1B6GA 1UC9A 2C9ZA 2L2QA 2OZVA 2OFOA 1HOXA 2PGJA 1NF8A 3AERB 3AG6A 2FPIB 3IBSA 5B4TA 2FMKA 3OQ1A 1BNCA 5FKJA 1XDZA 5ES4B 1C8VB 4JUCA 3D81A 2NPIA 1QAQA 3AI1A 3QM1A 2J9YB 2YZNA 4YAOA 1RR6A 2GEVA 5BV0A 2YZMA 3EULA 1G19A 2HF2A 4B3MB 3V7YA 1DJLA 3ZHTA 2Y6VA 4OATA 3E5NA 2EKLA 4UMDA 4X60A 4NQZA 4CQMD 3MG9A 3QUAA 1FXUA 1W75A 1CQWA 4JLBA 1R5JA 3ZCVA 1D07A 3AF2A 4EY4A 3EEBA 6REQA 1EFRD 1RKBA 3WMGA 4RTPA 2KPOA 1T2FA 2DPMA 3CE9A 1SG9A 4P98A 4EF5A 3F3KA 2VXOA 1TM7E 4F4HA 5DCWA 5JQGF 1NSFA 5E1DA 3D4IA 4FBMA 2CUZA 3OY2A 2P3LA 1WZEA 1NE2A 2AUMA 4MKIA 4DCPA 5BYJA 3KRTA 5A9SB 3I61A 4BP3A 1SQSA 1TKBA 3D8BA 4KGVA 2BKXA 4C14A 1MBZA 4NZNA 1Y3HA 3EYAA 2YIDA 1TCUA 1W9HA 3G0BA 3QKSB 2N0SA 2Q62A 3HC7A 3G8AA 2OOKA 1W30A 3O21A 2JA1A 2QM3A 1FU8A 2ZGVA 3H2KA 3SHVA 3IPXA 4UOQA 3FWNA 4C08A 2H52A 5AIBA 2FR0A 3KXPA 4XDGA 1RE0A 4NZ9A 2QRPA 2YXNA 1XT6A 2D59A 4BMXA 1T9DA 2G36A 2ECQA 2GFIA 4NNOA 4LXYA 4EYSA 2WB2A 221PA 2G1JA 3C6QA 1C0LA 2OFWA 3C41J 4JU9A 2F48A 2IHYA 3GEGA 1N5JA 2D8AA 2R8PA 3AJAA 4LE1A 1VI2A 1F4LA 1NDUA 3IV9A 4KFUA 5F1KA 1QQBA 2I76A 1ZK3A 5BMVB 3DKRA 1Z15A 3BC1A 3OEHD 4G4SP 4MYUA 5H3HA 3ILXA 2I2DA 4PTLA 4XYLA 1HLFA 4XXHA 3H18A 1HTBA 4MW1A 4YRLA 1YCHA 1HE2A 2P2GA 2ZJ0A 3DDUA 4DLLA 5IFKA 4PGAA 1XZBA 4UM9D 2LV8A 3NBXX 5IT9A 3FB1A 1J2RA 1R16A 1VDZA 2QU8A 4AICA 5HRAA 1UMBA 4I7EA 2RHLA 1YRLA 3FFWA 5AVYA 5EA2A 4TLEA 1EA7A 2PLFA 2CLCX 3C5EA 4BAZA 1EJ2A 4H27A 2HCJB 1VYHA 2V03A 2VDWB 1H5NA 3A10A 1I2DA 2C2OA 3SBDA 3IEMA 2D1RA 2HSEA 4HN4B 2A0KA 3DT9A 4DIKA 3INRA 1W4BA 3VJRA 4U63A 4JMLA 3JQQA 2I22A 3PJFA 3OHSX 2GX6A 3AHHA 5KYXA 3I04A 4DRXA 2RGUA 2WZQA 2P9FA 2A9RA 2PT9A 4DVGA 1CUYA 1VGVA 2R00A 1P5RA 1RRFA 2JAUA 2XUFA 4N3NA 4V0MA 4D9FA 3WYNA 3GAZA 1CYEA 4NYJR 3ZTTA 2XI4A 1JL3A 4O2BF 1LC3A 2JANA 3EQ6A 3FNBA 4QT4A 1P2DA 2COKA 4TTJA 4MK4A 2FPGB 3AFIA 3M3HA 5EQDA 4NVRA 5A3SA 3KYCA 4W5HA 1W36D 4AYWA 2HI0A 3N74A 3IFSA 5CBPA 3ROMA 4PNEA 4KPGA 3ZCPA 2I4RA 2PRSA 4TOIA 5NLLA 5EPUA 4RNDB 2J48A 1N75A 2EJCA 2DQZA 2WJ6A 5DLDA 2P6OA 5EMHA 4WK2B 2YV2A 5FA8A 2E4AA 1KPIA 1I6MA 4K9MA 5AK3A 1DAKA 4D5EA 1C0PA 3DD1A 1G8PA 3DAPA 4JL8A 4DQXA 2ZR9A 1KY3A 1JU4A 5EKSA 1A2BA 4XVRA 4CDMA 4CV0A 2OB2A 1FSGA 3N2YA 1RI2A 1A2QA 1UJMA 1T10A 2IXGA 1A4RA 1B16A 1PE0A 1E4YA 2ZYGA 4UPDA 1RXWA 3ZDXB 3VAZA 3FSRA 1U8FO 4Q3DA 1VLLA 4MULA 3WQHA 3R3JA 4YXWA 3M0EA 2AKAB 3HA3A 3LFTA 2YRXA 2BFWA 2QMQA 1BS1A 3D8SA 4D26A 2R00C 1GOTA 5LLSA 4RIFA 4BE9A 1IUNA 3OZCA 2NLOA 3ZLBA 4AZWA 3CBQA 1QHIA 3H2GA 3WOHA 1Q50A 4C0JA 4DV7B 3USZA 1MEJA 2QN1A 4DJEC 4G4IA 5D85A 3I1YA 5CXXA 4RJJA 4WBNA 4FN5A 5A3QA 5DF1A 3GMDA 4QDKA 1NHGA 3VR3D 3ZS9A 5BN5B 1Z28A 3FPFA 4R41A 2G77B 1OX6A 4EPVA 3CLKA 1XMXA 1K0UA 4JN6B 4QDZA 1FYFA 3RWMB 4DMUB 1V1MA 3H8WA 3OBBA 2P30A 1G5FA 2AC4A 3CUKA 2IPMA 1UAGA 2ZS8A 5DWQA 3WDSA 4ALLA 3DTYA 5K8VA 1O97C 3CUUA 2LE0A 3O1LA 3I4CA 4RXMA 4PV7A 1RPZA 4O4JF 1UDRA 3ZBTA 3QYPA 1V48A 3QWIA 3PQDA 3RUAA 2RGRA 3P0HA 3NHBA 3QXXA 4H6WA 3KO8A 1FLVA 5DGDA 1OXVA 2BGJA 4G4GA 1HDIA 1VGRA 3ZOKA 3ODGA 1D2CA 1I0ZA 3CX4A 5FQNA 3LU1A 2OCAA 2FFHA 1YB6A 4C4OA 5BR1A 4QPPA 4HI0E 1Q5PA 1RYHA 2H7VA 4B3CA 1V3QE 1WDKA 3ZDQA 3IJPA 1TQDA 1VI6A 1VL5A 3C7DB 1LNSA 3SDBA 4UBIA 1JILA 1JPNA 4BJ5A 4P2GA 5CA1A 4BTLA 3LJKA 5AVQA 1FS6A 4LC9A 4D4HA 4N1AA 2NG1A 1BS2A 2JFYA 3PHJA 3LAWA 3K0SA 1O77A 4OIMA 3H4TA 4DMGA 2NPFA 2HMTA 4D4KA 3BE4A 3EG5A 5JO9A 1R1DA 3W2EA 4EY6A 1KEWA 5ANRB 4ENQA 4RDXA 1JHQA 3FFBA 5I4KA 1W94A 5K8IA 1GPH1 1YZGA 3AHDA 5DTRA 2CJYA 2P9JA 1ZJWA 3LWZA 3H83A 3HXKA 4QD3A 4AF7A 2IELA 3LE8A 3KZMA 3LXRA 1SHUX 5CYFA 1R6VA 1MIOB 2C1EA 2DHRA 3SEZA 1ZISA 4A92A 4E13A 3T5DA 1V0JA 5DK6A 1LLQA 3PR3A 5LU8A 4RVNA 5EPOA 1GTJ1 4LOAA 1DC4A 3QYAA 2YHIB 1YUBA 2V7VA 1LDEA 2K4MA 3ESRA 3RW9A 1S2GA 1TJPB 1K5DA 1W44A 4EENA 4N9WA 5TRTA 3DLPX 1SXHA 3RRYA 3GOQA 4KPUA 1L4KA 1WP4A 3EEQA 1MAVA 3JWEA 3KTDA 3E05A 1ESNA 3M9LA 4R3WA 2M6KA 1WHTB 4MCIA 1WVIA 1SXJB 4JJ6A 1B4DA 2FPIA 2X5OA 2P67A 4RIHA 3THOA 5LP1A 2C2HA 4KO3S 1WSDA 2R6HA 3OZFA 3GF4A 4BO6A 1V47A 5KPJA 3C8ZA 5D1HA 3KSRA 4LHWA 2OV4A 1O96B 1SCDA 1XRRA 5TMPA 1BWSA 3UMMA 3RTDA 2YOHA 2GO7A 1ZHFA 2R47A 1T1IA 2GNOA 4DT1B 1SWWA 1JJFA 1GG2A 1JT2A 1XHLA 4M6WB 5IARA 2W6JD 4Y2JA 3ZN2A 1JECA 1EFAA 1HNNA 4LVUA 4BKMA 1SUBA 1J2JA 4LZAA 3M6XA 3REFA 1PJ4A 2WIJA 1SC3A 1GCUA 4EPYA 1KC1A 1AQLA 1JSCA 2PS3A 5CJJA 2IH5A 4MQUA 1KIFA 4DG9A 2X1MA 3O94A 4DZRA 3AR8A 3Q5EA 4NBVA 2NVOA 2PSHA 3A7DA 2V4MA 2YVLA 1PUXA 4A2CA 1JGTA 2JRLA 3HFSA 5BSFA 5BPFA 1ILEA 1RWKA 1RWPA 2ZYVX 2IEIA 2VEDA 3M7IA 1N5IA 1W47A 1R9NA 3WLAA 1MHTA 3N2GB 4KRYA 4LY0A 2AG1A 4TRRA 3QKSA 4ZDIA 3S27A 7ABPA 4DJAA 4BLPA 4B0OA 1OJ7A 1FU4A 1U8ZA 1EDEA 3UAGA 4X61A 1H6AA 4MI1A 4IP0A 3KSDO 3PRKE 5BOVA 3WLEA 4DNQA 1ECLA 3KQMA 3SDZA 3BMQB 3KE9A 1HKUA 3E9RA 5JSKA 4BEJA 2PX2A 4ZCQA 4HY3A 1RWQA 1WVMA 2GBLA 2ZBDA 1V3UA 1R0WA 2VAVA 3BM5A 3P45A 1LW6E 5TPZA 2CL5A 5AW1A 4OFWA 2P1RA 3DE3X 3H04A 4HS4A 4AN0A 5ADHA 2X1VA 5LDHA 5JE8A 1QYWA 2JLWA 1H2WA 1O6ZA 3AEUB 3UZUA 3HJFA 2QLJA 2CK3A 4UM8B 3AUAA 4REOA 3I2FA 5AVRA 4BRWA 4QGFA 5HM8A 2WSIA 3UW1A 1JVNA 4M21A 2I6UA 3U7QA 1LDMA 3R6DA 4F4DA 3H05A 4X8LA 4G81A 4TLBA 1TO2E 2N9UA 1OPRA 4YS6A 3TW4A 3GLGB 2X2PA 4CTNA 2Q28A 1WW8A 1Y6RA 1U2EA 4TYPA 3KKKA 3GN2A 1V8OA 4XWGA 3FYSA 3BIXA 4JVLA 4KAAA 9GPBA 2P0AA 2X0JA 4IJ5A 1Y0BA 3CMMA 1FDTA 1DQNA 4HSGA 4BRSA 4ZQFA 3H9EO 4QIHA 4MEAA 2IIQA 2WU8A 1IJKA 1BMQA 4UVHA 2OFXA 2VLIA 1PUJA 2IX9A 4S1PA 4IWXA 3H75A 4FXOA 3UA4A 2VDWA 4UEJA 5AOCA 4D44A 2YZKA 4F6RB 4YCCA 1AV7A 3DBLB 3HA7A 2JLAA 1GR1A 2EZ4A 2HNBA 1MAWA 2PRJA 3FW1A 4HL6A 5CH3A 1G0OA 4BZWA 3COZA 3OC6A 2Q3FA 1II0A 4HH0A 5TEWA 4ASUA 4I19A 2V4UA 2ZBFA 3LGAA 3NWJA 3WSVA 4YO8A 2P79A 3B1YA 1ISPA 2HLNA 1RKVA 1A1SA 2QD3A 2Z6AA 1O9HA 2FGKA 3OT4A 4ETMA 2NVUA 1Z4KA 3OX2A 3KJHA 2IYLD 4PBTA 2DBZA 4EZIA 2EG9A 1BKSB 4I2NA 3BK7A 3C5VA 1O94C 4BLRA 2CSXA 1SFRA 4PC1A 8GPBA 1LPBB 4GM1A 1E5DA 2PEYA 1WMEA 2ZU6A 2V7PA 1C1YA 2VP4A 2G80A 3PJDA 2K87A 4KV7A 4JR1A 4P53A 1KSHA 4U5QA 1B14A 2WPNA 4DJJA 1Q1BA 4QXRA 1YHNA 2A0XA 4GOXA 1E3DA 3WHLA 4D42A 3B1XA 1PGQA 1D8TA 1Z17A 3U4DA 1DJQA 2AS0A 3KALA 4M53A 3KOYA 2B82A 1ODJA 2QQ5A 4ID3A 4Y6RA 1MU0A 2E85A 4Y2XA 5B37A 1BFUA 2QTMA 5BT8A 2P6UA 4AJ2A 1D6NA 1Y1TA 3IE1A 4QJ4A 4P2BA 3CURA 1E62A 4D8WA 2ZUFA 3O93A 2RHOA 2HSGA 3GEPA 3IJEB 3KD2A 1IE3A 2FWJA 4J0DA 5K8UA 5IMSA 4JELA 2WYOA 3P2KA 5E6SB 4JUIA 1ORRA 4G3XA 5JWHA 1E7YA 1QF9A 2BZ1A 3I4FA 1T2VA 4I50F 1PS0A 4Z2YA 5JI3E 4NJEA 3IQIX 1J8MF 2WUVA 2PA3A 4JJ4A 4L5CA 1T3ZA 2V3CC 4KR0A 1IMOA 1SUFA 3NIGB 3OIUA 4PTYA 4XJVA 4IMIB 4AQDA 2GJKA 2PJUA 4NS4A 1A82A 4UEKA 3REQB 1IY2A 3OKAA 1ICEA 1EHCA 4MWZA 3ZY6A 2ODEA 4ENVA 2NT3A 3HYNA 3OEYA 4FGWA 2ZI7A 1GAQA 5JNTA 3CJRA 2XE4A 4EI2A 1GTSA 4HEJA 1C81A 2I4IA 2Y4OA 2ZVQX 3CKLA 5DGXA 1SPXA 5H8WA 2CXQA 2G7MC 3F8WA 1JV2B 3ZY3A 1ESZA 5F77A 3WRWA 5K45A 3V4RA 4XH9B 4MVJA 3NV9A 4I8DA 3ST7A 4F5ZA 1AXRA 1E1QD 5JD3A 3RDPA 1GG5A 1ZCBA 4D45A 4AX8A 1RRCA 1W2GA 1YGYA 4KAJA 3KLBA 1NYRA 1UADA 4UUAA 5F2EA 1ADJA 1XWWA 1XTJA 3DB2A 1N2OA 4LGMA 2Y4NA 4NFHA 1EBUA 3JAWB 4HWKA 2DETA 4LE0A 2YX1A 4YHHB 3MFQA 1UC8A 3T3NA 3LQ4A 3CRVA 3G2HA 4TV8B 3I0ZA 4OH1A 1P1KA 5AOVA 1A4UA 2DULA 4G0MA 2HBQA 4QEZA 5SZHB 2F1HA 3ICWA 2NX2A 5DP2A 3UAZA 4DLPA 4M0MA 4Z4EA 1ZD5A 5FPPA 1Y6GA 1W4CA 1H0KA 3P26A 4G5RA 4ISCA 2H1OA 4QICA 1XK7A 2VKQA 4YMWA 1KMHB 2XZDA 3W5IA 3A6EA 3AHIA 1ML3A 1UMCB 1KZ1A 1DKQA 1FRQA 2C9BA 1PV2A 2POQX 4PLVA 2B20A 4NNJA 4CV1A 3DPUA 5BXYA 2WJIA 2PWBA 4D9JA 5FH9A 4FYVA 2QDKA 4OKNA 4NBWA 1DIHA 1EVEA 4UULA 4X97A 5G2OA 4YCDA 3VH3A 2H1RA 4PAQA 2VPQA 5F3RA 3ID6C 2I7XA 3ZWYA 2GZHA 5COQA 3OJFA 4QUIA 1CK4A 4IR7A 1KIMA 2KE5A 2VYCA 1R9JA 3JW8A 4QULA 4IFEA 2JC3A 4CM5A 1FQJA 5BO5A 4H1VA 1XEXB 2DWPA 4CL0A 1A95A 5AHOA 2GBPA 2XCUA 3MINB 4AZVA 4FBLA 2PYDA 2FF5A 3ZHOA 1NMYA 5I8WA 1EVIA 2V7BA 4D4GA 1RXUA 2BONA 1EFVA 2R44A 3PL1A 4MRPA 4RNCA 4LFCB 1VG1A 2VYVD 5CLIA 4BZXA 1GNPA 4HXFB 4UASA 3ZZUA 4UHHA 3F6YA 2JIDA 1P1IA 2FVXA 4JP3A 4KWTA 1MIOA 3V3TA 3BRWD 4AMZA 1G7CA 3BEDA 1JKXA 1XU9A 4H6XA 5A0VA 5KSZA 1SVKA 3DO5A 5HRUA 1ONPA 2EZ9A 2R5FA 3VYVA 3WNDA 1C9DB 3BHJA 1F8GA 3NVAA 2YHIA 5KNCA 3C6XA 2QXUA 1YQGA 1YOVA 2HJVA 3D8TA 3JALB 3PHIA 4HLUA 4Z1MA 2J5QA 5FCDA 3KCNA 4TVBA 4ABYA 4WUVA 1ZRHA 1AKTA 3MMPA 4DXDA 5JVDB 1SULA 2IW1A 2Y66A 2FMFA 3UTCA 3GIWA 3I0NA 5JH7F 2HD4A 3KJXA 4JL5A 1Q0UA 3WYGA 1S89A 1SVNA 1CUVA 1Y7TA 3FOZA 4Q6WA 3SE0A 4F5YA 1JN0A 2PY6A 3NQ41 1MOQA 1O54A 1OD6A 2JI8A 1WHTA 3EARA 4H7DA 4OM8A 5IAEA 2PZEA 3ANSA 1IHDA 3K16A 4QDXA 4M2LA 2IWRA 3UK1A 1T9AA 1YCFA 2XQVA 4ITVA 4K0RA 4EEXA 1AM4D 1KPGA 1PP4A 2VJCA 4HNVA 4OJMX 1TM3E 3NETA 4TWJA 3PGKA 1J8FA 3AEQB 4GF5A 4JJGA 1VCHA 4LS3A 5BSRA 4JVMA 4M6WA 5JJKA 3AJEA 1KE1A 5JRJA 4YQZA 4FFNA 3SKYA 3WSTA 1J7KA 1GNRA 3KJGA 5LMUB 1P5ZB 1JDJA 2BUCA 3ZD6A 4JYPA 1TIKA 4H1WA 1M2KA 3L1KA 1HKHA 4UJ5A 3W3AD 2LDBA 3FFTA 4TKZA 5IVIA 3T1OA 1QGED 1XEFA 2FX5A 1IM2A 2GCNA 4X63A 3EIEA 2EFJA 2LVBA 4OLHA 4CTOA 1MGOA 3BD6A 3GJRA 5E4JA 3RHTA 3JZDA 2ZJAA 1DZ3A 3R3WA 3L7JA 2I8CA 3L8ZA 3KS9A 2QZ4A 3Q9UA 4RQAA 4HLUC 4CDGA 3UWKA 1QSGA 1PGOA 2QRQA 1PTJC 3JV7A 3II6X 3N2GA 1OFTA 2P62A 2DKFA 2JI6A 1P2UA 4IDBA 4NARA 4L7VA 3QA3E 4MUNA 3U60B 2VA9A 1G63A 4I1OA 1KJ8A 1U9IC 4RX1A 4IFIA 5EJ7A 1OQAA 3CUTA 1SOVA 2VT6A 1XWFA 1G4HA 1Y8RB 2IYNA 4YRPA 1P75A 1SXJC 1QHNA 3LVQE 3LZDA 1TRKA 3BMQA 4KR3A 1YU6A 1FDIA 4OHWA 1Q83A 1UMDB 1ZUHA 2D62A 1YGPA 2O2YA 3O4VA 4M1WA 3E27A 3DAYA 3P2IA 3FWYA 3CONA 4MIYA 2NQ2C 3TDKA 2X2EA 2AMFA 3KWFA 3MS2A 4PLCA 3U80A 1Q19A 5M29A 2ZR8A 4WDRA 4EG1A 2HFKA 1OI2A 5HOEA 3TNDA 1LPNA 2R66A 4NV0A 4AG6A 1WV0A 3LF2A 3FAZA 2HU5A 2ZR0A 1N2GA 3OZ7A 1W5FA 4PQFA 2BEUA 4B87A 3ZDDA 2WW8A 1RABA 4K6OA 4JOCA 3I6MA 1AS0A 2R1UA 3H1TA 1N6LA 1JIXA 1WPRA 1S3IA 4BU1A 3NHWA 3ZIUA 1DIBA 4FD3A 1NVKA 3EXG1 3EIQA 1C80A 4NI5A 3O9MA 2IKQA 3T52A 1R12A 2YMLA 2R1ZA 1BC5A 1DAEA 1PHRA 2C8KA 4LSMA 2IY7A 4DVJA 1A8UA 4CNBA 1HYHA 3GK3A 4PPYA 1AGXA 5CCDA 1SNYA 2VP5A 3QF4B 1I2AA 4FDLA 4EF4A 5A4DA 4LA4A 4YWJA 4IGFA 2QI9C 4OHVA 2AA3A 1R6BX 3CE6A 4OA8A 1D2HA 1XAGA 3EUEA 2AOUA 1Z4IA 3RE1A 3L0PA 3U13A 4BLVA 3ZD9A 4ZRMA 1BOFA 1W96A 2AMYA 2HIHA 3NBYC 4BVGA 1KK1A 5EXXA 3F0TA 3L9XA 4NJMB 1ZK1A 2XWQA 4AUMA 4BO3A 5EXTA 1A88A 2JGRA 3WRVA 2B3DA 4D0GA 4YH1A 4DUZB 3M34A 4PRKA 2I33A 4LJKA 1JFTA 4TXLA 5CW1A 1T1EA 4BNTA 1IBKB 3IP6A 1X0XA 1JFFA 3NU1A 1ORIA 3QXJA 4MV9A 4MUGA 2ZYWX 1SIWA 3TQOA 4LE2A 2DHCA 4I8IA 1IUOA 2YJ6A 5GP1A 3VO9A 5TVKA 4B4OA 3QNUA 1NU6A 4FYWA 4JLSA 3OAAA 3UC5A 4L9WA 3AIOA 3JQBA 2GF2A 5LQRA 2H4JA 2RMKA 3NHMA 1Y5RA 1PL0A 1DPGA 5DIZA 1T2CA 3HCOA 3QTLA 3A4YA 2BE7A 1SPBS 1SKUA 2BR3A 4MLZA 1EQUA 5HA5A 4ZDWA 3RV4A 2YNMD 3TLBA 1COWA 5FWYB 1C1DB 2OCKA 2EXXA 2TSYB 4PC3A 1RWNA 4DQ0A 1XBTA 3AKYA 1NURA 4MPPA 2J5RA 2KYRA 1LCIA 3SYMA 3WGTA 1XNGA 4DCSA 4YMTA 4IVRA 3IOYA 5K0NA 4AURA 2NYAA 5E6SA 3GLFA 4QUBA 1GAEO 3LY9A 4MHOA 1PNOA 3ESCA 4XSHA 5DBHX 5TQ0B 4HGQA 3T5MA 2P91A 4EFLA 3X2FA 4R2KA 4IOMA 3ZW9A 4BKQA 3LDAA 3KQUA 1EIWA 4PCLA 3VPFA 4E0BA 3CRQA 3ENQA 1NRJB 5DM4A 4JI2B 4AJHA 5JRDS 4QELA 3O26A 4TVKA 2H1IA 3GDWA 3SD7A 1LPPA 1SKAA 1Z2CA 2XNKA 1NC3A 2E6KA 1Y1SA 4GXTA 4FDVA 1RHUA 2HT1A 4GC5A 2AE2A 1Z0IA 1E0JA 3A6LA 4QYMA 2ZWIA 5C34B 4B7XA 1XTSA 4ZYXA 5LSAA 3NANA 3LY5A 2JVJA 4LKRA 3ZWDA 4U7HA 3JQBC 1QHEA 3O95A 1B6TA 1USUA 3SHFA 4IPTA 1CJTC 1XZHA 2EFGA 3MGBA 4JLNA 3RYHB 3DVAA 3ZGLA 5AVWA 5FPKA 4X7MA 1VRVA 2BWJA 2CNWA 4RBNA 2Z4RA 4Q7LA 5F4ZA 2V7UA 4OHPA 4ZOBA 1GRRA 5E7IA 2JG3A 3UO8B 1QXSA 1KYTA 3CPJB 4BAUA 4CKWB 2Q2NA 1GUYA 2D7CA 4IS3A 1I5OA 3AF0A 2ZR7A 1IATA 5CG1A 1D0SA 5GOTA 4UTPA 2XDQA 5H4GA 2ONYA 4RQUA 3GC6A 1WETA 2X9NA 1NXVA 2VPIA 2PX3A 2GRJA 3C7AA 4NU0A 1CR6A 2OSVA 3KAPA 3MWLA 3O8LA 4JJZA 1HDCA 5ECWA 5AI5A 3V42A 2HKIA 3UJDA 5IN4A 3AESB 1H2XA 1KMHA 1IBMB 1CC1S 1UAAA 1RHRA 1UMCA 2FJUA 1XKQA 3N8NA 5ALPA 1FPQA 1N9GB 1MZPA 2CL0X 4RY9A 3RVSA 5EFZA 3B6JA 5JBQA 3KETA 3PLRA 3ROQA 3WWEA 1GU7A 1MPXA 1YACA 4KIJA 2CFSA 1BXGB 1F20A 2GYUA 2J5XA 3ON5A 2C00A 2AMLA 3BGDA 3PDIB 3W4JA 1ZYUA 5BVGB 2F9MA 2FZWA 1FSPA 2X4IA 4BNKA 4URVR 5LBTA 2YICA 3GLUA 5F1OA 5NULA 1XZFA 1XEXA 3KR9A 1KZYC 3L7YA 4GQBA 4P33A 4RVCA 2O8VA 2EF0A 3MINA 2R6FA 3JYHA 3FLEA 3PXCX 4AB1A 4C3OB 4KVFA 3TKLA 3ZQKA 4YMGA 4D0SA 5JISA 4AJEA 3WAJA 2X0KA 4JP2A 1ZH0A 1JA9A 1CR2A 2UXDB 2AJTA 1AG9A 3MUFA 3I2HA 3Q6MA 5IM5A 5HIKA 4RH3A 1PJRA 3LQRA 1D3AA 1EUZA 1GRQA 1P0CA 4AWBA 4CEIA 3NRBA 5J1SB 2ACWA 1OA0A 2OD2A 2A7XA 1WXDA 3K72B 3LIIA 3O74A 3PQ5A 1EAYA 1YO6A 3WY9A 2I0FA 1NONA 2WWHA 5DBFA 1QFZA 1EK6A 4JI1B 4F91B 5LZ2A 1FMFA 1JBEA 4UCXA 1LZKA 3A1CA 5EJAA 5FLKA 4E07A 2WC1A 3I5UA 3TD6A 4K88A 3AL3A 4F4CA 1U3GA 2O2JA 4I55B 4BVKA 2PL3A 3ITNA 2J4DA 3UMRA 4D81A 3JQDA 3OE7A 3UATA 1E63A 1EX7A 2AN3A 2KHZA 4DLUA 4EJFA 3D4LA 4G85A 3NWEA 3K1YA 3DP9A 3C3AA 1YCGA 2O2DA 4ZIRB 1S0UA 1KYZA 3LUHA 2NO1A 4UUPA 1OFGA 1WXXA 1JEQB 2RFLA 4FMDB 3T15A 3N2KA 4NNPA 2JIQA 2BZ0A 2HA7A 3IT0A 1YJXA 4MARA 4JB2A 3B82A 2ECOA 4N7BA 3VZCA 2PX6A 3LQYA 3KJEA 1VE3A 4A6DA 4BBZA 5JANA 4EPXA 3BKXA 1QQTA 3MLBA 4XVCA 4WACA 1CF4A 1EVYA 3IQFA 3FYDA 4J7AA 4FW8A 4HZIA 4ZV9A 1ADGA 1TEHA 1DT3A 1HTTA 1M0SA 4NYJQ 3H86A 5BQ3A 2QVGA 4LF4B 4QUJA 3OTOB 5J4LA 5DHQA 1P80A 3RQSA 4TN5A 1BDHA 3W9BA 3IMKA 2OK7A 2AFIE 3FLAA 4ZT5A 3OICA 2AOVA 2PZFA 5EUMA 5CLLA 2QSZA 1E89A 2RDMA 4Q7MB 5ECDA 2B4QA 4AF8A 1XPOA 3OJLA 3A3KA 4KVAA 3SIRA 4MP3A 1A8SA 1RJGA 5DRTA 5LLDA 3ZDAA 2RGNA 5I7EA 2A30A 2FZ4A 4Q19A 2JFQA 1JKFA 4ZEMA 4EMSA 4LF7B 4NFYA 1D4ZA 1ISFA 4D3SA 1OCEA 1Y8RA 2J0EA 2OXFA 1RLJA 2JDIA 3N75A 3OIVA 4TPKA 3SLKA 3G0DA 4F3CA 4I1PA 5BSHA 5ECGC 4W9MC 1DXYA 3H97A 3F78A 1MOPA 1IRXA 1UMDA 2YMQA 1ECJA 1G8GA 1PZEA 3DYVA 3FUVA 5P8WA 3RVRA 1JMKC 2YC2C 1LBQA 4OTZA 4YJHB 2L69A 1KDTA 1H0HA 1O8BA 1R0KA 2OCGA 4XUGB 1U63A 1ODKA 5I4IA 1KH3A 1WZIA 2J4CA 1RQ7A 3I5YA 4DV5B 1QNFA 1ZM3A 4Z1OA 1CUXA 1Q7TA 4RSHA 5JCJA 2W6QA 3HU5A 4HWRA 4L02A 1EEXB 4BKUA 4OIFA 3Q12A 2VCYA 2ZSJA 2HBZA 4J29A 3TTWA 1QGDA 4OREX 1PVDA 2F3SA 2MYPA 3HJCA 2PQ2A 3NHJA 5KTPA 1EP3B 3TRJA 3WRYA 2FCAA 4FPXA 4Q9NA 3H84A 4O1MA 3QSGA 3U3OA 1RM0A 4D4JA 1XK6A 5E3HA 3CZQA 4H3HB 1X39A 4YCAA 2RGNC 1RCFA 4V0LA 3SKVA 5CX1B 3HB1A 5HUJA 2VP0A 3TZQA 5KVAA 1IVSA 3BGOS 3GVCA 3MJHA 4Q24A 3DL2A 3Q85A 5EJIA 3Q8MA 2O3RA 2PHZA 3EMBA 4D9KA 4F2WA 2X1LA 1OH7A 1B6SA 4QLBA 3EXAA 3MUOA 2BRUA 1SVUA 3PPXA 1I3LA 2CLDX 4NJMA 3NTRA 4ZAYA 4YRSA 2ZTSA 4DC1A 1WULS 5LQJA 1XDUA 4NU5A 4L5YA 5JSUA 1A8HA 1KSFX 4Z9YA 4LMPA 3Q3JB 4OP3A 1U28C 2H1HA 5DW3A 1VL0A 1YR3A 2A78A 1G3UA 1B8OA 1RLOA 4JYCA 1BYUA 3TM4A 1UBFA 2C5AA 3PQFA 1W5BA 5FHRA 1PNRA 2A6PA 2GN4A 1ZH4A 4YP7A 4C4SA 2VBGA 4MNTA 4MQ5A 2AR9A 2DUMA 3T94A 1Z7GA 1HDZA 3GZ4A 3IVAA 4I4TF 3GQBB 4C2UA 1ZINA 2X5JO 4FQ7A 4E03A 1L7BA 2O8EB 3Q1LA 4Y2YA 4TYYA 2RARA 2Z09A 1FJ2A 2ODWA 3DKVA 4FM9A 4MINA 4BATA 1N2XA 2I66A 3QV1A 3VTAA 1J0BA 5FWYA 3NTLA 4JP8A 2EQBA 3E2MA 1GZUA 1GL9B 4JT9A 3R7SA 3BXFA 2ONZA 1B0ZA 2O54A 2FSVA 3F6RA 1KEUA 1RJEA 4PS1A 3K70B 5GZ6A 2JZNA 2BP7B 3PF8A 1L1EA 1B2LA 4MKHA 4PVCA 4QDOA 4HNTA 2WM9B 1G7TA 2NO5A 4PZLA 2AVDA 1X1EA 1YA4A 2JGMA 2MSLA 5DDIP 4B32A 2A92A 4CMBA 5EHXA 3KYJB 4FT2A 2Y77A 3F49S 2EWVA 4C88A 3RTEA 5HJ2A 2BRUC 3O4JA 3V1NA 2WMNB 4UHBA 3OOWA 2NUBA 3B53X 1ZAYA 1OVMA 3O91A 2K2WA 2DVMA 4B83A 3MWYW 1UWCA 4K6GA 5CDGA 5I3CA 1KO1A 2YV5A 1UPTA 4RKFA 4NOKA 2CJWA 3TTYA 2F55A 1UXHA 1I3CA 3SQMA 3BGVA 1CXZA 4Q16A 4R7ZA 3CW2A 1J0AA 2H65A 3H16A 5GOZA 1OYVA 3F8TA 3HACA 3NEAA 1DHRA 5FQOA 2QY9A 4Q4CA 5D5PA 5L6LB 2PNJA 1NG9A 2O8FB 4FB5A 2IPLA 3LMKA 3NAGA 4BECA 3GVIA 2Q1YA 4ZWNA 3KKQA 1J39A 5CYOA 1U5AA 1GKYA 3GCXA 1G1AA 1CUEA 1QTNA 3M6IA 2E3JA 2H9IA 3V46A 2X58A 4MR7B 4Z7OB 3CF2A 3D6TB 4QWMA 2W5UA 1NLZA 3A11A 4LRXA 5K05A 4FR0A 2R97A 5L40A 1Y1QA 2L0XA 4OOEA 2QN8A 4O4HF 1U1EA 1OZAA 2BHLA 1SKYE 4Y2SA 3UJ3X 3VC3A 3DOIA 2PX5A 2VP9A 2JGLA 5KREA 1YF3A 5ARCA 2C04A 3GLHB 1J90A 1WE2A 4AMVA 2FZEA 2IPNA 4RD4A 1WP9A 1XZCA 3AESA 3FRIA 4G67A 3GP5A 2ORWA 4X1KB 1JIIA 4JWTA 1T9CA 5EP2A 2BFEA 5EINA 3N05A 4BNIA 4ZC1A 3AY3A 2HDNB 3GEMA 4W8HA 1QFYA 3AFMA 1A4XA 1YBVA 5G0SA 5ADWA 1LBTA 1MCZA 1QB7A 3A6FA 1QMPA 3HJBA 4I4CA 1BXGA 1XDDA 1XEAA 3Q7PA 1UODA 3COVA 1Z16A 1YQUA 3I23A 3PDIA 4KJZA 4M0EA 2EWMA 4PO1A 3RYIA 5C3MA 3PLAE 4MKGA 5G1NA 3HQ4O 1RSZA 5AVXA 1PR2A 3VKVA 2P3OA 4X5OA 1R8YA 4K05A 5EKXA 3W05A 4E5MA 5GZ3A 5IM4F 2GAAA 4KDFA 1GDHA 1GZDA 1QWSA 1T8TA 4S24A 4EPTA 4ILEA 1OFUX 4JHLA 2ZBRA 3NOVA 4FC7A 1Q7CA 3V4FA 4WBSA 2BV3A 3R3HA 1T24A 3FWKA 1QH8A 3TLGA 3Q9NA 4BNJA 1U9YA 4NU8X 1E2IA 4DPKA 2JLZA 3B5EA 3BSYA 4ZT6A 1N57A 4MR8B 3EWAA 2C07A 2CFOA 3DEKA 4LG1A 5ENVA 3S2SA 3WKEA 1SG0A 2VNHA 5L3RA 4E4YA 3RSSA 2GQ0A 3NJ8A 3QKWA 3UMFA 2V5UA 1RIFA 3N2EA 2J7PA 1Z7WA 3OF2A 4KXFB 4UPEA 3MK31 2B99A 3KNZA 4KUHA 5H5JA 3M89A 3COPA 2OFFA 2VA8A 1T91A 2WIFA 2XMSA 2EIHA 2ZK7A 5JASA 3T1HB 4YROA 1EWTA 2QTTA 3G8DA 3OTGA 3M5PA 3PI6A 4KGXA 5DMXA 4ZIRA 4A0RA 3EUAA 5IKPA 3IB3A 4IJQA 4CQLA 3QPUA 3WFJA 2XUJA 3ASZA 1II8B 4Q01A 2DH5A 4TTRA 5EZQA 5F3WB 4J91A 4M54A 1EGHA 3JRWA 4G5SA 4A8JC 1DS6A 1LDGA 3LCRA 4DAEA 4EY5A 5C46F 4UVIA 4CLHA 4KN9S 4U5XA 3BERA 4UCQA 3LUAA 4Y2VA 4E21A 1ULBA 1NP3A 2OO3A 2CXHA 4CR7A 4URUR 3HXMA 4LAFA 2FI1A 3R3UA 1SKMA 3IEUA 3L8FA 2QLNA 1GN9A 4ACAA 2FR8A 4ZOLF 3ZS8A 2AWNA 3KJIA 4ZZ3A 2I7VA 1HGXA 3N8DA 5B36A 4ESVA 1UKCA 1MO2A 2AW3A 2OGZA 4UPVA 2C92A 3CSDA 4Q9JA 4QUHA 2ADOA 1QV7A 3SXUB 5AXAA 4FX5A 3AO0B 3LUKA 2YFKA 2XB4A 4GE3A 3O6VA 1JE0A 3EY4A 1M5TA 5KNDD 2N3ZA 1G7SA 1KK3A 3EG9B 3HB7A 2UDPA 1NUQA 3BFKA 4EYQA 2Q50A 2QJOA 4OXKA 3K4PA 5AIAA 2EW8A 2EWWA 3CTMA 3RRMA 1Q0LA 3DXZA 5F5XA 1FTNA 3WZLA 2IRWA 4QHSA 2IHJA 4JODA 4RXUA 1BDJA 1H8EA 5ALLA 3RTGA 1C4WA 1LNQA 4DHWA 4WKCA 4BVHA 2PQ0A 3IRUA 4L0DA 2RGEA 4P3NA 2HJWA 4ZPJA 4B40A 1M1YB 2FX2A 2EDAA 2C4UA 2HSZA 4FNMA 2TRSB 4N9QA 4PHHA 5IMBA 3URMA 1YR8A 3BE6A 2JEYA 2XMGA 3D5TA 4I1SA 3U1BA 1GKIA 2QLLA 5TDHA 4I4NA 1I2BA 3UIEA 2XE6A 1LTQA 4DSAA 2MMCA 5IVPA 1KZ7B 1Z22A 3BWXA 4NBKA 4KXXA 2ZAGA 1FFXA 2D1QA 2C3OA 1Z5WA 1P6XA 2Q5CA 1E6WA 5E2IA 3EVAA 4KL8S 3G5MA 1GEGA 4LOJA 2WPDD 1NQAO 2I6TA 4ND7A 4R8KA 3GJSA 4MGIR 4MPTA 4WVLA 2XDAA 4WXPA 4E2WA 4YUVA 2AHOA 1PDVA 2HLPA 2YWGA 3PGJA 1H3EA 2ZI5A 3HN2A 4D8TA 3KB2A 3ORQA 3WIVA 3ZVNA 3B8HA 3NT4A 3T9CA 1RE1A 5CLJA 1NMSA 3BZUA 4DCMA 5JJLA 3MT7A 4YAKA 1H22A 4RV5A 5LA6B 4JT4A 4QGSA 1ZOOA 5EIBD 2AX3A 4EA6A 4YJ3B 4LHEA 3ORSA 1UBCA 3DLAA 3ZV6A 3K0AA 2QJTA 1L7NA 4GSKA 1CE8B 4BAGA 3HV0A 3RG8A 1C7EA 2Q4OA 3K0FB 2ID8A 3V7WA 4RL4A 1ZP6A 2OHGA 5H4HA 1ZLYA 3UJ9A 2ZSFA 4FDTA 4PQRA 1N9KA 2GM9A 3ZWAA 1FQKA 3V9PA 2XGOA 4IY1A 1GYQA 1GILA 4KWEA 2G06A 3I72A 1MV5A 2FWNA 4JV5B 2MINA 3DULA 3BB3A 3OZTA 4UU8A 2W42A 3GQBA 4K3VA 3ZQ4A 1NL3A 2CNNA 2JFBA 3HH8A 1Y48E 3AXTA 4FMPA 4MICA 1CY2A 4YDSA 2I55A 2PUWA 3OPYA 5IDWA 2M2IA 3PBKA 4P86A 4HYTA 2X8JA 4BQRA 4EAQA 3WIBA 1X15A 3GGDA 5KJ1A 3R9WA 3LBHA 1HM5A 4CKCB 2HU7A 1O2DA 2BP7A 3RU2A 1SCJA 3JD2A 1GCIA 3HDQA 3O1HB 2HUPA 3LUGA 3MB5A 3HR4A 3IIKA 4MVJD 3NUZA 1ZGCA 2HEIA 4BLWA 2Q5QA 3TI9A 1H85A 1BDMA 4W5OA 3W9YA 3KZOA 3TMKA 2ZQ5A 1TEVA 2B2XA 4OQEA 4LHXA 3F9RA 1N1MA 2ZIFA 2Y6UA 4KFRA 5E6RB 2QJFA 2QRGA 6Q21A 2FW6A 2J3MA 4PIMA 4PX9A 1QDLB 3O8OB 5DNEA 2RONA 2PTHA 1YTLA 4RVSA 5DGCA 5HP4A 2QMOA 2DPYA 3CFYA 4WESB 2XXBA 4J0FA 2VAXA 4MRMB 1H3NA 4QATA 2LIVA 2Q3MA 3AP3A 2CFIA 4LCEA 1RXEA 4FFWA 4CFSA 1CWUA 4YMLA 1JQKA 4CUJA 4MUYA 3R74A 3NHRA 3V7UA 4HGZA 3SQLA 4U0KA 2GVZC 1E0KA 1M2VB 5EN4A 2Q0HA 2Z3WA 3ZZTA 1AS2A 2HQBA 4BFYA 1R4MB 1DTSA 3EASA 3QP9A 4NYIR 3KZNA 4ON9A 3PF9A 4Q0MA 5JG7A 3T7KA 1FP4B 3TLXA 3K70C 3M4NA 3DPSA 3EK2A 2OO5C 4M37A 3VHRA 4IDFA 2GFQA 1L4FA 4OXNA 1PW7A 3GLHA 4DDTA 2ZKIA 1W25A 2IUUA 2DCMA 4IF6A 3CT4A 5JFOA 2FJPA 4KIUA 2OCYC 2CKDA 4DMRA 4ZN6A 4M87A 3GDHA 1XRMA 3NTVA 4X1KA 5LQUA 3ZVLA 2A5GA 4IQGA 4P0TA 1CYDA 3V1UA 3BWCA 5HKLA 1ZEMA 4JGBA 3RTCA 1JSZA 4LNUB 1SIBE 5FBLB 4MR9B 2A4MA 1KAOA 4MUBA 2QTVB 4IIUA 4W1QA 1XPUA 1WXGA 3GDFA 2HK9A 3COYA 4MQ6A 3FLMA 3DV0B 4ILKA 2DT5A 2SKCA 1XZLA 3MPOA 3WB1A 4ZFNA 5GZ1A 1LSSA 3I9OA 4Q48A 2ZUSA 1X7ZB 3GNQA 4LOKA 1W2WB 2GXUA 1QG2A 2WM8A 3FR7A 3RTBA 1DQSA 10MHA 2W0MA 3EPPA 3O8BA 1K97A 4RK0A 1Z2AA 2AG8A 3NYQA 3VPXA 3OT5A 5BSTA 2WJ4A 4AL4A 3D2BA 3KB1A 2AE1A 4G5XA 1ZM7A 3KDSE 4HEA1 1QE5A 5JZMA 2NZ8A 4AK9A 4KW7A 2VRCA 4HAVA 4WEOA 3UKOA 5LXTB 4HH1A 4ND6A 3PGVA 4ZT7A 4AKSA 3M6AA 1U2TA 3OJXA 4WA7A 4D92A 4I5IA 5JJIA 2QAIA 3GVHA 4S1NA 4GWLA 2G7ZA 2H48A 3LT5A 4NTZA 1SXGA 4D46A 4RQBA 1JDSA 3EA4A 5BRAA 3RIXA 5LIRA 1A9ZA 1R64A 5JMTA 5SYMA 2FFJA 2RHHA 4OQDA 3D54D 1O4VA 1MAUA 1OXXK 1M7BA 1LI5A 3JZFA 4ZZ1A 5KNBA 5B2ZA 4PCAA 1ZXLA 3RRBA 4KHZA 3GA0A 3CS3A 4KXNA 4OB6A 3HPQA 3PKZA 4GT1A 4JIGA 2W7TA 3R9XB 1II8A 1NVUQ 3K7EA 1AUVA 2HO4A 1VL8A 1N2JA 2QMUA 4US2R 1A9TA 3BJEA 5KTTA 5TQ2B 2G9UA 1KDPA 4RA9B 1KFEB 1M1NA 5GVSA 1UBGA 1QC5B 3EFEA 5KOIA 1SU7A 2QZ9A 3LWBA 1Y4SA 1JAXA 1WA5A 2KMLA 3EISA 4IOJA 3BT7A 2PT5A 5CT6A 4O4IB 4MA0A 2A3RA 4L75A 2AOXA 4LMAA 4PSUA 2QQEA 4XB6B 5IHPA 2PX4A 1RBMA 3GJ8A 1U1IA 1S96A 5CB6A 4AXBA 4RVGA 1ZXBA 1T1JA 4RIEA 4X8MA 3RKSA 2NUAA 1OI3A 3ZV4A 4E94A 3EG9A 1V3VA 3BGWA 4RMHA 1E1LA 3ANXA 2ZE6A 4V2UA 1Q7BA 4QEKA 1BFDA 2C5HA 3L0CA 2VRBA 3FMOB 1OAAA 2CXNA 4AWXA 4ZVTA 3R75A 4LF9B 2AX4A 1RM5A 2ZAOA 1HX7A 4AG3A 4QGBA 4P8RA 2WG0A 4MCAA 4G36A 1IYZA 2VHWA 3GJTA 5C9ZA 1UBLS 3W9SA 1CSEE 1L0BA 5AM2A 3DD5A 4L4YA 2ISQA 2F90A 4LVCA 4ZU1X 1G8AA 1QJCA 4N8EA 5EIAA 1K6EA 2FR1A 2RGWA 3QKRA 3P96A 4JLPA 5HKKA 5L8VA 2GXQA 3LWNA 1ULUA 1XGKA 4GG1A 2OD7A 1H66A 2WVHA 4S35A 3A28A 3CUEF 1I8TA 1Y9ZA 2OLEA 4ZVKA 2VR1A 3QVXA 3QU5A 1R9MA 5EJ4A 1DFHA 2FEWB 2RBEA 4F9GA 3CGGA 1NQVA 3WSWA 4P22A 1DT5A 2HRDA 3BB4A 5HM6A 2PKRA 2Y27A 1B23P 2NZYA 1N9ZA 2CXTA 3R6TA 1YRAA 3PUIA 2P5YA 1IY8A 2JH8A 3SS9X 4ALMA 2B92A 4RFVA 4GRIA 2XMPA 4DLSA 4ND2A 4CMGA 4GOKA 2DBRA 2Y0BA 4E6PA 4RHXA 5JZOA 4MVJH 2YR0A 2REQB 1R8JA 3NHAA 5C35A 3BSFA 4RGYA 4K1LA 4RADA 5EG5A 5DBGA 4NCAA 2V0GA 1CIPA 3DWEX 2LW7A 4INJA 4U0JA 1V43A 2H00A 1IFXA 1LWOA 1Q0ZA 1RPNA 1X1AA 1QS0B 4GKBA 3ZJ4A 1XJ0A 5DP1A 1CE8A 1YZHA 3MQ4A 4PBSA 5AM3A 2FEOA 1VJTA 3R5FA 4KXVA 4MTLA 4XCVA 1G6HA 4CLOB 4MV8A 3A8TA 2NP6A 2GI4A 5DHTA 1GPMA 2C7GA 2ZVJA 1DWOA 4TRJA 4BQQA 1G21E 2ZJFA 4LBYA 3U48A 3BRCA 1JU3A 5BORA 2C8JA 521PA 3BX1A 1TI7A 3I8XA 2WWFA 3HLYA 4UEWA 5DBEX 4DQDA 1S2LA 4H9GA 4LBWA 5DWDA 2Q8NA 3PK0A 2EKDA 4GYYA 4IUBS 3PC2A 3FN4A 1JJBA 2R11A 2XMQA 3G89A 3KHUA 4I0WB 4XD2A 5J2UA 2SNIE 1UJBA 1KQ3A 3RH0A 2GPWA 5EJFA 2BC9A 4KR9A 4MROA 5BRNA 3U3RA 1XRLA 2I2CA 2DQ4A 3ZHYA 4JJKA 5DO9A 2ONCA 2JD2A 3KHTA 1QIKA 3B20A 3EMDA 1V5FA 2A5YB 1VIVA 1BEUB 3WLRA 1ZWLA 2XUAA 4CKCA 4M8NE 1J00A 2PKQP 2C1ZA 3LA6A 4AROA 5TARA 3MJVA 4ZPXA 4ITUA 3V7NA 1NUPA 3G1UA 2ID7A 1DWUA 1X13A 2ETVA 2XD9A 2JAHA 4N39A 3E7FA 4G0OA 5ALGA 3ZI4A 1J5EB 4R7TA 1PJZA 2FLVA 1AKNA 2XOXA 3K0CA 3PQEA 3UB3A 3FMVA 1XMOB 1E2NA 3R9IA 3EOBI 4DTCA 3THYA 2VHJA 4HTAA 1G6Q1 4IQ8A 3CR7A 4P4GA 5TR9A 5JWRA 4KEAA 5I9MA 2FN3A 4OXRA 3L46A 4Y9SA 5I9BA 5KNCH 3D4PA 1PR4A 3O8OA 1DDGA 1MKYA 4IDGA 3BD9A 5D3MA 5ULLA 2E4ZA 2O1SA 1OGIA 2QIPA 2WFLB 4WESA 2Z6QA 3TEJA 4MRMA 3RM3A 1OROA 5TNXA 3GMSA 4ZKEA 1NHWA 2SKDA 3IR6A 1BX3A 1ZIDA 4BB9A 5KEIA 1OV6A 1RAGA